4F4RA

Crystal structure of d-mannonate dehydratase homolog from chromohalobacter salexigens (target efi-502114), with bound na, ordered loop
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
YFQSMMKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAKTPGERYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of D-mannonate dehydratase homolog from Chromohalobacter salexigens (Target EFI-502114), with bound NA, ordered loop
rcsb
source organism Chromohalobacter salexigens
total genus 154
structure length 408
sequence length 408
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4f4rA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4f4rA01
2OZ8A 3N6JA 1ELSA 4ZCWA 4G7FA 3T8QA 2QQ6A 3JW7A 3MKCA 2OPJA 3CAWA 3KUMA 3PWGA 3S47A 1FHUA 4MGGA 3T4WA 3PFRA 4DX3A 2FYMA 3CB3A 3RGTA 1KKOA 3TJIA 3SQSA 3CT2A 2GDQA 2PP3A 4M6UA 4J3ZA 3VDGA 2XSXA 3UCDA 2ONEA 2PODA 2AL2A 4E5TA 1R0MA 3GO2A 3R11A 4KEMA 3CYJA 1KD0A 4DWDA 7ENLA 3V3WA 3D47A 2HNEA 2DW7A 3UJFA 3UCCA 3TWAA 3OZYA 4GISA 3IJQA 4E4FA 4IL2A 2P8CA 4E4UA 3DDMA 3ZLFA 2HZGA 4IP4A 3DESA 5EU9A 3SBFA 3UGVA 3U4FA 3T6CA 2XH4A 3ZVHB 3TJ4A 1P43A 4H19A 2OFJA 4EWJA 1IYXA 3DG3A 2OZTA 3ENLA 3P0WA 3DG6A 3JZUA 3R10A 3FVDA 2OZ3A 4ZA0A 4GIRA 3UXKA 1WUFA 3HPFA 3GY1A 3V4BA 4KT2A 3R0UA 3DEQA 3VA8A 4GGHA 3UJSA 4IL0A 3TW9A 4A3RA 3TWBA 3RO6A 3NFUA 2GL5A 2PA6A 4IT1A 4JN8A 3MWCA 3K1GA 3NO1A 2PTYA 1MUCA 2OLAA 3IJIA 3ES8A 1PDZA 3VCCA 4JHMA 3OPSA 1R6WA 4Z17A 4G8TA 4HCLA 3RITA 3VFCA 1DTNA 4H1ZA 2OQHA 2QDDA 2OVLA 3THUA 2RDXA 4HYRA 5FJPA 3R25A 2ZADA 2OO6A 4F4RA 4GYPC 3MZNA 3BSMA 4H2HA 1BKHA 1PDYA 2GGJA 3MY9A 4KWSA 3QN3A 4MMWA 2MNRA 3DFYA 2PPGA 1NU5A 3DERA 3MUCA 4GFIA 3I6EA 4FI4A 3PWIA 1SJAA 2NQLA 1XS2A 3Q45A 4IZGA 5IDZA 3IK4A 3EEZA 3P93A 2PTWA 3R1ZA 4GMEA 4HCDA 1YEYA 2PP0A 2PMQA 3B97A 2OQYA 5FJRA 3EKGA 3RRAA 3N4FA 1OEPA 3H7VA 2P3ZA 4GGBA 3MQTA 1JPDX 1TKKA 3GC2A 4ROPA 4HNCA 2OG9A 3NXLA 2P8BA 3ES7A 3DIPA 3UXLA 2QJNA 3OTRA 1KCZA 1JPMA 5ENLA 2I5QA 1EC9A 2P88A 4E8GA 1ECQA 3JVAA 4DXKA 2OKTA 1TE6A 2CHRA 3ZVIA 3H70A 4J1OA 3I4KA 3R0KA 4DYEA 3ZVHA 3GD6A 1JDFA 3NZGA 4K2SA 3I6TA 2P0IA 2XH0A 3OP2A 2GGEA 2AKZA 4K1WA 4FP1A 4H83A 2HXTA 3QLDA 2AL2B 4K8GA 5FJOA 4M0XA 1FHVA 1MDRA 3DGBA 3ZLGA 6ENLA 3TCSA 5BOFA 1F9CA 4DN1A 3D46A 2QDEA 1TZZA 4JN7A 4HPNA 3STPA 3SJNA 3TTEA 3FXGA 3H8AA 2GGHA 2PS2A 2FKPA 4X2PA 3V5CA 3QPEA 1L8PA 3RCYA 4A35A 4HN8A 4IP5A 1MNSA 1SJCA 3SN4A 2DW6A 3VC6A 1P48A 2PCEA 3CK5A 3ZLHA 3OZMA 5J04A 3IJLA 3TQPA 2PGEA 3N4EA 2GGGA 2POZA 1MRAA 3V5FA 1BQGA 3T9PA 3U9IA 3SN1A 1RVKA 3FV9A 2QJMA 4IHCA 1SJDA 3OW1A 1MDLA 3FYYA 3TOYA 2PSNA 1XPYA 2QGYA 3N6HA 2PTZA 1WUEA 3RR1A 3BOXA 3MSYA 4Z1YA 4KPLA 4ENLA 3P3BA 3Q4DA 3DG7A 2O56A 3VC5A 1SJBA 2GSHA 2XGZA 4E6MA 1EBGA 4YWSA 1W6TA 3UJ2A 3PK7A 5BOEA 3QKEA 3FCPA 1E9IA 1ONEA 1EC8A 3CXOA 4MKSA 4GYPA 3VCNA 4A6GA 2PGWA 5FJUA 2QJJA 2OX4A 4HCHA 2QVHA 3SN0A 4HNLA 2PU1A 2HXUA 2XH7A 2GGIA 3S5SA 2AKMA 3BJSA 3SSZA 5FJTA 2PTXA 3H12A 1EBHA 3UJRA 2MUCA 3UJEA 1KKRA 4DHGA 1EC7A 1NELA 3FJ4A 2XH2A 2ZC8A 2PU0A 3QTPA 1JCTA 2PP1A 2AL1A 3DFHA
chains in the Genus database with same CATH superfamily
2DH3A 3EBVA 1GKRA 4HSHA 4JNYA 3WK0A 4YNGA 4RW3A 4YCOA 2F5ZA 2EQDA 1OZMA 1XDJA 3DFOA 4BF5A 1STZA 3GXDA 3HIJA 4GI6A 1V0NA 3S47A 3R13A 4KBXA 4MB1A 4PN2A 3PZUA 3NL5A 3OGSA 3EWDA 3BJFA 1ZJBA 3MSDA 3QR0A 1VJSA 4LPCA 2IPGA 4C91A 3SQSA 4M6QA 2WK2A 3W02A 2QCMA 1GVIA 1TJ2A 1BAGA 2E67A 2ONEA 3S1VA 5CEWA 5I78A 3PZGA 1HJVA 2PC8A 1TV3A 4DLFA 1G7UA 5B80A 4F2TA 4IH3A 3DECA 4ATWA 1TA3B 4MKNA 3TP4A 3UR5A 1RH9A 1VFSA 4RE0A 2ZRZA 1NFPA 4WCJA 1B4KA 4TVDA 1RVGA 3QC0A 4H6QA 1MVYA 2Z4GA 4D8LA 1JCLA 3SCRA 1P0DA 2PBGA 2QPSA 1U5VA 4IQJA 1UJPA 2ZUVA 1N61C 3ITTA 2GLKA 3KOYA 3N19B 3U4FA 3L66A 1YPIA 3KBNA 3QGKC 1PTDA 3NTYA 3JS3A 1FKXA 4M80A 2OZTA 3AIVA 4H7ZA 4QGCA 4ES4A 2OZ3A 2VUYA 4IF2A 4FR1A 4OV9A 4HYVA 3C2RA 3PS7A 2CYGA 2YYTA 1O5RA 1DV7A 3GNOA 5CPOA 1CNVA 4GI9A 3CZJA 1VBUA 2EJ1A 4YWIA 1VQTA 3G24A 4HZMA 4DO7A 4RXGA 3MW7A 2J6VA 3NQ7A 2E1WA 1AODA 3QPZA 5BXPA 5I06A 3MCOA 4M8UA 3TWBA 1UUMA 1FA2A 2RABA 1LQ2A 3UPBA 1V7AA 3SQLA 1XYBA 4LAMA 2EQ6A 1DNCA 3H23A 3LTPA 5EA9A 1ZZMA 1R87A 1QNPA 3HB9A 3W00A 4H41A 3VCCA 2XVKA 4AUBA 1IEIA 3U4AA 4LUYA 4PUNA 1HL9A 1XLKA 3TTSA 3TC3A 1CZ1A 1JQVA 4EPBC 4XUYA 5GJMA 1DJQA 5EMUA 3CIVA 1E4NA 4R53A 3NQ8A 3ZR5A 2FLIA 3CUXA 5A6BD 1V3MA 1FWDC 1M41A 1BD0A 4DJDD 1WAUA 5I6SA 2JKEA 2PWEA 3AQUA 4M24A 2C14A 3SIMA 1EHNA 3LNMA 1ZGDA 2HV5A 4PULA 4MMWA 1FWSA 3GH7A 4H4WA 5D04C 1Y65A 1UA3A 3GC5A 3CQHA 5EKYA 1ZY8A 2WNNA 4FI4A 1HVXA 2Q8ZA 3PWIA 3I7RA 4GABA 3RPMA 5IOBA 5IDZA 4CD4A 2ZIDA 2WMKA 1A0CA 5XIAA 1XXXA 3UWUA 3RU8X 3R1ZA 3BOFA 5AY7A 5FEXA 1W3TA 3GQYA 3UZJA 1XLJA 5IHSA 5XIMA 3C0SA 3CBWA 4AEOA 1BWCA 3DGZA 4O54A 2CZ5A 1UD3A 1ONXA 3T4CA 4LYKA 1X96A 2O7SA 3S2LA 4I5XA 1C7TA 4J3SA 4E8GA 1CB7B 3VIIA 4BQ4A 3Q6JA 2OKTA 5EBUA 4B2DD 4ZTXA 2AAAA 3W2KA 4GO8A 4MB4A 1HT6A 3DH9A 3A6OA 2AKZA 4GZEA 1Q6EA 4DO4A 2C15A 4Q4SA 2Y6ZA 3GH5A 1J2BA 2VD9A 5I0DA 1FWRA 3TC7A 1JOAA 1OFAA 4KFOA 4X9YA 3H4XA 2YCKX 4DB7A 4HTYA 1XCFA 1NQKA 4GUGA 1SPQA 2CFFA 3SJNA 3SY5A 3AIEA 3WQGA 4AWTA 1YDVA 3R2GA 1M6IA 2WPFA 1EKOA 2FZBA 2ZE0A 3B8VA 2WBKA 2JQXA 3AWNA 1BG4A 2VR5A 3LGEA 3WQ6A 3CZLA 1KFLA 3AMDA 4GKLA 2XJ7A 2IMRA 4CD6A 1B3WA 2Z2UA 3E2VA 3ZJ7A 1LBFA 2XIOA 4UR7A 3EPNA 5HDRA 1JF5A 1DIEA 4MY8A 3ANYA 5CC3A 3G1HA 1XIJA 3WQEA 3L8KA 3U9IA 1T8XA 1EJWC 1GQJA 3QEZA 4PUKA 1G7VA 3G0XA 1LQAA 1E5NA 5LIWX 1I2NA 4PL2A 2Y8KA 1QFEA 4HK7A 4PMOA 2E7FA 3HQNA 1MEHA 3HGSA 3T0CA 4O8AA 3SZ8A 1A3WA 3II1A 3V1PA 1AJ0A 4R34A 1RA0A 4XD3A 1RD5A 4MLRA 4BHYA 4ZO8A 4U31A 2ZXBA 3HM7A 1KBJA 1JUEA 2ON3A 3BLFA 3BTNA 3KS6A 3P6LA 1T41A 3AI0A 1YDOA 5JBFA 1S5WA 5C9XA 2QIWA 1GVRA 1TPUA 2INEA 4DHGA 1OCQA 3S9YA 4JTGA 1UWUA 3A4WA 3H21A 4QS5A 4N9BA 1TV7A 4LV4A 3BAKA 1Q6CA 3UWYA 3VNIA 1EX1A 3E0WA 1TVNA 1L6YA 2A7PA 2E4TA 3QPYA 4H4SA 1OFQA 1EZWA 1Q6QA 3MB9A 5HMEA 2X42A 1KBKA 2ISDA 4DX3A 2HQMA 4QJ5B 3B40A 2JGYA 4Q8MA 2V8ZA 2DIJA 2WMHA 1OHLA 4Q8PA 4UFMA 3KOFA 1C91A 3VDGA 3W1RA 4LF2A 1QATA 3V18A 1RPKA 2BWGA 5AFDA 3DKJA 1V3KA 2A3EA 5I00A 1VKFA 3WX7A 1KWKA 4HHMA 3D47A 1V08A 2CEQA 4GINA 3L5AA 4TTGA 3KBJA 1TR1A 4IMFA 4NF7A 3WD3A 1M68A 3FGCA 4NJJA 3WMBA 3ZLFA 3SCWA 3O16A 3BMVA 3DAQA 1RZMA 1XGZA 2OZ0A 2YXOA 3A12A 3ZVHB 3L65A 1BKSA 2QPXA 1VFFA 2V68A 3LK6A 4BFAA 1IEVA 1Q8AA 3R10A 3ARXA 4UNLA 2FQIA 4LUTB 1ME8A 2VX4A 1T6MA 1HKKA 5A8MA 3V4BA 1E1EA 5HWNA 3ITOA 1EJXC 3CM4A 2H6RA 1JRBA 2W4XA 3DEQA 4TV6A 4CCCA 3MBFA 1SGJA 3PSWA 4Q4RA 4IL0A 1M7XA 3WQOA 1HFBA 2DVUA 3IV8A 1FQ0A 3ZQ9A 3MT1A 1W5OA 4W7UA 3OVGA 4KERA 3EDDA 3WIJA 5E0CA 3LHVA 1K7FA 1ZB5A 1R9ZA 3LZ3A 4AZIA 3DX5A 2WAGA 1PDZA 2NSXA 4KS0A 1TRIA 2VGBA 4GJIA 1S2VA 2GQ8A 1QU4A 4LTSA 1T40A 4J56A 3E2SA 3CTLA 2WNZA 1J6PA 3KWXA 3GE7A 1WYIA 5LNRA 4DWSA 4O1CA 1GW1A 2VOMA 4PUEA 4E38A 4HJWA 3N2TA 3CUJA 2G5WA 4GYKA 4CNOA 4GFSA 2QDHA 2UBPC 2X41A 4LOCA 4U28A 4ZZ9A 1VH7A 2O4QA 2YFNA 4NNCA 2H9AB 3BPWA 1NWRA 1PDYA 4JFTA 5KZDA 2MANA 3VIFA 5K9DA 2GGJA 2WB5A 3CV7A 1OYAA 2FMNA 3W73A 3SIZA 1UKTA 3UG3A 4GK8A 1A4LA 2NX9A 3PNZA 3SI9A 4UTTA 1PEZA 1EH9A 3NUKA 3BDKA 2RKXA 2DZAA 2VEGA 2PD5A 3J7HA 4NILA 3VOCA 2NVKX 4QE1A 3RNMA 1ISYA 2ZUMA 4Y8FA 1QI3A 3P93A 3SUTA 3NSMA 3ZM8A 2OEKA 3RLHA 1KTNA 1EBDA 3NQGA 2YQUA 1I2QA 3N4FA 1PX3A 2W92A 3WZ0E 4GZJA 4L6DA 4F66A 5AYXA 3ZJKA 2W79A 1J4EA 2Z6IA 1L8NA 2W55A 3WSUA 3BWWA 1G67A 1HKJA 2F8QA 3MHUA 3WF0A 2XVPA 3GR4A 4RE3A 1XP3A 3GU9A 5EL1A 3WEZA 1GVOA 4RKAA 1WKDA 4QP0A 1JEHA 3SY8A 3F2DA 2CHRA 4YJ5A 1HXJA 1MO0A 3C52A 3FAXA 2QCDA 1ZSXA 3LLXA 3VE7A 4C1KA 1GEQA 3OP2A 1W9UA 5F1UA 3B9NA 3R0DA 3LV6A 3AYRA 3L5MA 3S6OA 4NAEB 3UT0A 4NXSA 3UYIA 1F6YA 1KM0A 5LZLA 5FL0A 4L1GA 4XTDA 2J9XA 1C7SA 5RUBA 2D1ZA 6PTDA 3POCA 5F2MA 4JKMA 1RJQA 1NEYA 1KA9F 4REQA 3UQNA 1BYBA 2FGLA 3C5QA 3EB3A 1OABA 3HURA 3N11A 2P10A 3BV4A 3AMZA 4FIRA 3B8DA 4Y9NA 3VC6A 2ZKMX 3IRSA 4RE4A 2CLPA 2OWCA 4JXCA 3WDHA 3MP4A 1VEMA 2VZOA 3NDYA 1DWIM 1IF2A 3UNDA 1ESWA 4A4AA 1YKWA 3OU8A 4TU1A 1BRLB 1GVYA 4NP7A 3BICA 4L9XA 1IT7A 3HG4A 4AVNA 2FZNA 3OW1A 2ZRXA 3FYYA 4HP5A 3CIWA 4OVXA 3WH9A 1JD7A 1B3XA 1U1JA 3PG8A 1C3FA 3NSXA 4V27A 5IBXC 4KETA 4N9DA 2OR2A 2D73A 2W0UA 3NCOA 1AG1O 4IGHA 1QT1A 2UY4A 2FFCA 3WDQA 4H2CA 2OLHA 2VELA 1X39A 3NWRA 2A1YA 4DI9A 3A4AA 4V2XA 3MHGA 4LCSA 4N4QA 3TXZA 3E02A 1BFNA 3DZ1A 3T8LA 4JIHA 5H8PA 4GA8A 1EZ2A 3AO0A 2GK1A 2E5AA 5CBIA 1M04A 4PRWA 1FWBC 1QCWA 3GZAA 1VHNA 5CSRA 1GQIA 3P8JA 1XSIA 3VNYA 3GH4A 2BTMA 1GTHA 4QAWA 2JGQA 1E6RA 3IJ9A 2Z1WA 2AL1A 5HOSA 2JFEX 2OZ8A 5TAOA 5AKQA 3WD2A 1VC4A 3T8QA 3VD3A 1QJWA 1YE6A 3JW7A 3DXIA 4M6VA 4PUMA 1VCFA 4E2OA 2EKCA 2QNEA 1QASA 4FK9A 4MFEA 2ZX7A 4HT3A 4AVOA 1DIOA 5DF0A 3PFRA 5E6ZA 5F2LA 1DVJA 4XKMA 2FMOA 4OHQA 1F8MA 4P8VA 3G1SA 3LBCA 1D2KA 2BY2A 4IIFA 3WENA 1TWIA 1OFBA 4P7OA 1P0BA 3TCEA 2QXWA 3E0VA 4M6UA 5ABHA 2J62A 4X63A 5G4EA 3BK0A 4HOZA 4GNKB 4I5RA 1JI1A 4NI3A 2DUXA 3KL5A 4A8LA 1DJHA 5TNVA 2YA0A 4BI5A 4CN6A 1CCWB 1UQYA 3R8HA 3ZSTA 2PZ0A 1S1PA 1TIWA 3UR7A 4O18A 1ZP3A 2FPVA 1TJ1A 2OWWA 3ZZ1A 4P8WA 4WK9A 3UG8A 4GISA 3T2PA 4Q33A 3W38A 1FEAA 4JTKA 1QBAA 5EU9A 4XZWA 2YCLB 1E0UA 1WZMA 4ZQOA 2QJGA 4S23A 2Y7FA 2R9RA 1US0A 1W3NA 3W7LA 2RH9A 4IMGA 3FKRA 5E1QA 3NSNA 4C6JA 4JTDA 3B8UA 1CXFA 3THAA 1IXQA 3AMLA 2ZX9A 3GYCA 2V2DA 1NF7A 1K8XA 2F2HA 4TVYA 1OK6A 2TAAA 4PMNA 3N3TA 4S2BA 1WDPA 3NZRA 3HPSA 4JQ3A 4K6AA 1JULA 2ISVA 3TFCA 4NZFA 3C4UA 5E6YA 1WX0A 1XIMA 1AJ2A 4HN4A 3A21A 4GLEA 4N7QA 3S46A 2EG8A 1U22A 3MSRA 3NFUA 2AMGA 2GL5A 7PTDA 2XSAA 4DUVA 1VHCA 1E6QM 2HDJA 4XTIA 3K1GA 1QPRA 1JDAA 4TMBA 1JZ4A 3KCJA 1HKWA 3SFWA 3MA8A 1UBPC 2VD8A 4YYCA 1R7OA 1O6IA 5A6TC 1FTXA 2PEVA 1Q7QA 2DUAA 4PCFA 3VFCA 3IEBA 2QDDA 1TV8A 1HKMA 4Q8NA 3GVWA 5CZSA 1NHQA 4W7VA 4F0LA 1V6UA 2BNJA 3R79A 2BC0A 3GS6A 4XK2A 1TWDA 1BWVA 3TX9A 3W86A 5C8BB 2V3FA 2IQTA 2ALDA 1AW5A 3QZ6A 3S3GA 2WMIB 3EAUA 4C6CA 3IGUA 1CB2A 2VENA 2ZX5A 1KXTA 3BW3A 3A3WA 3G8RA 4PSRA 2I1OA 2V3EA 4EM4A 2JF6A 1IZCA 2YL8A 3SDOA 2FVMA 4IQDA 2VVNA 1SJAA 3GKAA 1SB3B 5DRIA 1PAMA 1BEUA 3GDRA 1J0HA 3PF3A 1UZHA 2E6FA 1ITCA 1YBQA 4JIQA 4WJEA 7XIMA 1GRTA 1E3ZA 3QQ1A 3MKVA 3CJPA 1LOQA 4BCEA 1FH9A 4UZUA 2V5DA 1I0BA 1EL3A 3RRAA 5JIPA 4YHEA 4XD5A 1R38A 4IMCA 4GQGA 3AROA 3H54A 3TTOA 2GZXA 4NZJA 3JR2A 3CQIA 1V3JA 1OSEA 4LUJA 1KCZA 1GYNA 3URAA 4DWSC 2Z00A 2G3FA 2XIMA 2Z7KA 1H51A 1B3ZA 3SADA 4Z1CA 3LNPA 4PE8A 1MRQA 1PV8A 1DHKA 3MMUA 3NPUA 5C70A 2WJDA 3LGDA 2NX1A 1RY0A 4OE7A 5M3WA 2YJQA 2G0WA 3MS8A 4AWEA 2INFA 4HJFA 1EOKA 1XH0A 4ZFMA 4JHZA 4GZ7A 3W70A 4UTTC 3TQ0A 4WD0A 3H2EA 4IJCA 3WUGA 1CXEA 4BEUA 1R3VA 1V02E 1EB3A 3V5CA 2D24A 4NZCA 1TREA 3LQGA 2GDUA 4I90A 4D6FA 5J5DA 3ELFA 3THCA 5CSSA 2GFTA 2C79A 4NX5A 3R07C 1Q63A 4Q7BA 3MKKA 4D6EA 1HJWA 3C8FA 2C7FA 1YPXA 3ITCA 1P48A 2E09A 4K3ZA 3TSBA 4PMRA 3C2YA 1UR0A 3N2OA 2WVUA 2YVFA 3AHVA 3LM7A 4LBSA 4IFKA 1TYTA 3NIYA 4LUSB 2GGGA 3V5FA 2WXDM 1QDSA 3KOZA 2WQPA 3E96A 3FV9A 1PZ0A 3U8GA 1ZBWA 2CLMA 1JNEA 2G97A 4F0RA 2A6NA 1Q7ZA 4EP8C 2GUYA 3AS3A 4W5ZA 1VB9A 3KHDA 1X1OA 3TVAA 2CESA 5KZEA 3Q4DA 1A50A 1H61A 1NP0A 3APGA 3KZSA 1YNQA 3T07A 1CW2A 4DM1A 4KWVA 4MNKA 2BOGX 5LHEA 1B90A 2WZEA 2F7FA 1KQYA 3XIMA 1J93A 3M64A 4KRTA 2IQDA 3M5YA 3NQCA 3FEMA 3HTWA 1OGSA 1V02A 1QI0A 1J2WA 4GOAA 4MB5A 1TB3A 4HCHA 4ROQA 4ZMGA 1GRGA 3DHUA 1YLVA 2CKSA 1CYGA 5JQ9A 2Q8XA 1FY6A 4FXRA 1ME9A 1M7PA 3LADA 3QR3A 4HU3A 1GOOA 4KCVA 5CPMA 1QNVA 3BAYA 3SR7A 4JQ1A 4NNAA 3FJ4A 2RAGA 3Q58A 5B7YA 2PP1A 3O6CA 2I7GA 3EWBX 4BF7A 1EF3A 4JS3A 3L12A 3M44A 2QQ6A 1Q6RA 2HVMA 2CBUA 2ZX6A 2HS6A 2EGZA 3S6TA 3OOQA 3VUPA 3E49A 2JE8A 1XLDA 4XG1A 3G1FA 1J18A 3UERA 4MAZA 4CEUC 4RDVA 3L4WA 4RDYA 1UA7A 4B5VA 4QSHA 5BRBA 3L0GA 2VFHA 4K8DA 2E40A 2ZTKA 4J27A 3I7SA 1A0DA 5E70A 1MQQA 3AIWA 3ARYA 1Q6LA 3T55A 2VDIA 1EO5A 4DUWA 1DOSA 3GG0A 4E5TA 1TV4A 3R11A 3UESA 2OQLA 3MVIA 3T08A 1H7RA 2E6DA 4QITA 3PBMA 3E6EA 1NY1A 2C1GA 4WZHA 2CHNA 2WMJA 3PJUA 1WOBA 4O16A 4U3AA 5DBTA 4MKVA 3DESA 4EE9A 1PYMA 3NVTA 1A5MC 1J0IA 3S9ZA 3QY6A 3AN1A 3IANA 5BU9A 1UZ4A 3O63A 3ENLA 3WLIA 3OYXA 3TXVA 4Q22A 2Y85A 3MI2A 2ZTJA 4QJ1A 4H00A 4N6FA 5FA5A 3N14A 5BWAA 3HPAA 3H24A 5FD0A 1IT8A 3I10A 4QCFA 4AZCB 3L2LA 3EMZA 1ALDA 1KM5A 4HVXA 3GAYA 3DH7A 1J96A 3QH2A 5I79A 4OUIA 5I03A 1R2RA 2J7DA 4LS2A 2WOWA 3V0TA 3TU9A 3L2IA 2JIEA 3PPCA 2DT0A 4JFSA 3CH9A 3GFYA 3WCZA 4IG2B 1SR9A 1ZNNA 1F4AA 3S5OA 1GUVA 3WLQA 1K02A 2C1HA 2XUCA 4GY1A 4UTIA 3GG8A 3A9BA 3CC1A 3EA3A 1O1ZA 3VGEA 2DQWA 5I3IA 1XLIA 3DBPA 3WNLA 3VX1A 3WQWA 5T91A 2WCSA 3NDZA 2REQA 5D2TA 3W1TA 3KWSA 5TBOA 3RXZA 3NVVB 3BSMA 3W1MA 3ISIX 4XO6A 4MZ1A 5L6UA 2VOTA 2W62A 1FCQA 1NDYA 5EBAA 3LRLA 5FKYA 2YPIA 4JYEA 1DJZA 1E73M 2EEXA 2P5NA 4W4QA 1NU5A 4A22A 3VGHA 4G2DA 4C1NA 3ZXWA 4S3KA 4ACZA 1R86A 3QW3A 4D72A 2XWDA 4HGXA 3QY7A 1XLMA 3PWAA 4I5UA 1MXSA 4ZFCA 4P7QA 3MUXA 4DWSD 3NYZA 4AYSA 3SEPA 2C91A 3O0HA 1D9EA 3E0IA 2WP5A 1G4TA 4IIGA 3GC2A 1W5PA 3ERPA 4HNCA 2VR2A 4XISA 4PEEA 4IUGA 3G3DA 2GWGA 3LGGA 3VO0A 3BLPX 1GORA 1VRDA 4R33A 2NQ5A 1EC9A 2WMFA 3W26A 1OD0A 3LBOA 4DXKA 1XG4A 5HQEA 3R58A 4OBSA 4RUBA 3T78A 4DYEA 1YTDA 4JL1A 2QKFA 3WQ8A 3WK1A 3L7RA 1DWFM 3NR0A 1ISVA 4A8RA 1XR2A 2QGHA 3BG9A 2YSWA 4JHOA 2HMCA 1S39A 4K1WA 1LOLA 2Q02A 4FP1A 4UTLA 3N2MA 3SRHA 3UY7A 3WFAA 2BP1A 4R88A 2HVNA 3TCSA 3M0XA 5REQB 1EYEA 1OG6A 5CC7A 1QPNA 3B3DA 4PBEA 4RJEA 5MKGB 1X98A 5C7HA 4WOZA 2PS2A 1GKQA 5IM51 1VIZA 4UFLA 2ODOA 4B3KA 2VZSA 2WHJA 4BS0A 1L6FA 1WO2A 2VRKA 5DELA 1DIDA 2RDTA 2VURA 3WBEA 4IOTA 1GG1A 4GPNA 3VE9A 2FVKA 3SCPA 2XIBA 5JCMA 2W3SA 3ONBA 4XKYA 3ZSSA 1L2UA 1J01A 2I17A 2IPJA 1P1MA 3T09A 3E0FA 1GSNA 4UQAA 3R5EA 1MW3A 5D2XA 3D9XA 4IIBA 1FCVA 1QNOA 1XD1A 1XBYA 5CXPA 1HGWA 1DL3A 2GJXA 2Q01A 4C65A 5DT7A 3IARA 2RDWA 3VDCA 4YWOA 5H8UA 1XPYA 2X8HA 4G9PA 1OC5A 3EOOA 2QLYA 2XTKA 3FSTA 1KWGA 2BXYA 3RPDA 3QFWA 2CBIA 3AXXA 1E70M 5KSWA 3GYEA 1VPQA 4M56A 1JG9A 2WZMA 1OINA 4EM3A 4DJFA 3VCNA 1EA0A 4GRTA 2PURA 1P6CA 1TSIA 3T42A 3BAWA 3OLIA 1E0VA 3LENA 2A4AA 3QW4B 1ZHAA 2YAUA 2F9RA 1IGWA 2V82A 3F03K 4TOQA 1XLEA 1AZ1A 3H12A 4IFRA 3KEHA 2ABAA 5M1TA 1I2OA 3WF1A 4C6EA 2BOEX 3AOFA 4LC8A 5BW6A 3DJGX 3AHZA 1OX5A 5KTLA 3EPOA 1W3KA 3CHCA 3C2OA 1WBHA 4O1FA 4UTFA 3M0JA 3C2FA 3AS0A 3IRDA 3TNBA 3ZYZA 1EJTC 3M9YA 4Q4MA 1QWKA 4BV6A 3M4HA 2W6RA 3MKCA 4JYDA 2PDNA 1JCXA 3GNPA 3ZO9A 1S2AA 3TYZA 5HJLA 5H6HA 3GIYA 1TPWA 3FHAA 4JAWA 3MMDA 3TJIA 1FP9A 2O0TA 4J3ZA 1HTIA 1S5MA 2XSXA 3F2CA 4DNHA 2DVTA 4JPGA 4BWLA 3W29A 3W6LA 2WPEA 2CLHA 3ZT7A 1Z3NA 3ZT5A 1ZAHA 2A21A 3GVGA 3M1ZA 3BUVA 4JDYA 1FWIC 4O53A 1A3HA 1JVNA 1H1YA 3OLDA 1AJZA 3P80A 2RUSA 3LN3A 2D2HA 4H7CA 2YFOA 3AXMA 1VFMA 5K7JA 2AGKA 2AQWA 5A5WA 3URBA 3AU2A 5EMYA 5DMMA 3T6CA 5JRBA 3W2JA 5DCEA 4D6GA 4UQDA 3DFQA 1FHLA 2A7NA 1XJBA 2HE5A 4ERAA 1JYVA 2ZZ0A 1HQTA 4P8UA 1P0NA 5BXTA 4QBXA 1NDWA 2XINA 3BZJA 3LUTA 2WBGA 5D9NA 4GIRA 4UNIA 4RCXA 4H4IA 4A2SA 1ZCOA 1DXEA 1V51A 3IIZA 4WUIA 4PRTA 1CX9A 3MP3A 3OJGA 3OIXA 2W27A 3KAOA 2NV2A 4URIA 2X09A 4H8UA 1HZYA 1SO4A 4I9AA 2V5LA 3M0LA 4LY8A 2BHZA 4NRRA 3OVPA 3CEPA 3KCLA 4IGMA 3IUDA 2E5BA 4HQVA 2PF8A 4MJ4A 2O55A 4HHHA 3MZ2A 3MWCA 4L65A 1CGWA 3MP5A 1OADA 1JFHA 3NO1A 4B5WA 2PTYA 4UQ9A 3PUGA 1PBGA 4B5TA 4YTUA 3AALA 4LU0A 1H7PA 4MYXA 4GD0A 4HA0A 1UP3A 1V59A 1GONA 2XGIA 4A05A 2OVLA 1GOIA 3UXDA 2Z26A 4QJ3B 1ZBVA 3IGSA 3A24A 3B9EA 2DJXA 5XINA 3WBWA 4PCSA 3SECA 1KQZA 1W3JA 2O9TA 4GYPC 2WANA 1KW1A 4UCFA 1WZLA 3WD1A 3W2UA 1HX0A 3FYPA 3BQ6A 3E0LA 2QUUA 3TROA 4AEFA 3G1VA 1XKJA 4M3PA 2PPGA 3KOXA 1A47A 4CVUA 1ZALA 3B0XA 5D9PA 4D8ZA 1KCLA 8XIMA 1TYPA 2ZZCA 3S1GA 4WX2A 1M3UA 3AUJA 1LJYA 2E25A 2RJGA 2CHOA 5FESA 3BURA 1W9DM 4AD3A 4XIMA 3USBA 2NQZA 3VNKA 3QFAA 2ZXAA 1VF8A 2YL6A 1NAL1 3EDJA 2EAWA 3LDVA 2PDQA 1TA3A 3GHRA 1QHPA 4MFDA 4CD8A 2V67A 1VJZA 3UNTA 5I2UA 2VFIA 3KBMA 4F40A 1ZK7A 2ZRWA 4AB4A 1IHIA 3UWVA 4KKXA 2VCBA 4JKLA 1VQZA 1I1XA 4L7ZA 2WM1A 4KCTA 4HYWA 1PKNA 3EKZA 4XWUA 2WO5A 5T8GA 1F8WA 1LUCB 1TELA 3LRMA 4AWUA 2FZ9A 1E71M 3I4KA 2DZWA 1K70A 3O6AA 5HATA 1XI3A 1B9ZA 1KR1A 4QNEA 2F84A 3S2CA 4X60A 4KWWA 1HKVA 4DM2A 1RK6A 1Q7MA 4YVPA 4UTUA 2HXTA 4AFYA 4TX8A 4HU0A 4ONVA 2DORA 5BOFA 1CTNA 3ALGA 1WDQA 5IHRA 2GR1A 1EYWA 1U2YA 3IIVA 1F2JA 1OX4B 4XVEA 3TTEA 3G6LA 5G5IA 3M46A 1LLOA 1WQ5A 2ZVRA 5I77A 1TPVA 2OTDA 1J0ZA 1KFBA 4G1NA 3P67A 2BZNA 4XV0A 2IPWA 2AQVA 2AQOA 1PKYA 3MDUA 5HJYA 3AUOA 4IP5A 1V4YA 4H8NA 3V16A 3CT7A 3G1XA 4X61A 1FCUA 3LHUA 3N4AA 1JPKA 4KW2A 2ATMA 2I16A 1O5XA 1XLFA 4Z08A 3IJLA 4QQUA 3N4EA 3L5OA 1XYFA 1G4EA 5CJ5A 4IXXA 3TW7A 3AS2A 2OOGA 4HBKA 1GVSA 1F7BA 2QGYA 4WJXA 1MI3A 1Z32X 2QT3A 3UWQA 1S5TA 4Z1YA 1DWAM 3P3BA 3NQMA 3UA3A 4UOJA 1BWLA 2Y1HA 1GRBA 1Q8JA 1E55A 4BEQA 2EPOA 5HK4A 1JD9A 4WDUA 3UJ2A 4KGJA 5BOEA 3QKEA 3VKJA 4GXPA 1DXLA 4A29A 2XN0A 3GD3A 2QJJA 1B4EA 1QRQA 4FA3A 3O05A 2PAJA 1N5WC 1EJVC 1LTDA 1N2VA 2DZUA 4JL2A 1WOAA 5AHLA 4L4PA 3N73A 5CLTA 3EOSA 2BLEA 3VCRA 3CHEA 5CQ1A 3SR6B 3RN6A 1ICQA 5HUPA 5B7ZA 1AH4A 2W63A 4NG3A 4DJDA 3UR8A 4J2MA 4EK7A 2X16A 5G1MA 2CCRA 3DFTA 3N15A 1XRTA 1CT5A 3WMSA 2DIKA 3LPFA 3DHFA 4ZCWA 3CMGA 3PC0A 3TA9A 1Z6KA 1XISA 4GKTA 3CAWA 3VNJA 1UZDA 1LYXA 2VR4A 3IJ8A 1KN0A 3GDMA 4I6VA 1SO6A 3AXHA 4FNUA 4AX7A 2G50A 1XPGA 1F3XA 1TE1A 4MIMA 4L4OA 4X3ZA 4HPGA 2ZYFA 3MJMA 1NHSA 2NXHA 4C6NA 3FJNA 2PRHA 5E09A 3CT2A 4CN4A 3DYPA 5C9UA 4PGLA 4XBSA 2EF9A 2CNCA 1P5BA 3D5HA 4FS9A 1S7MA 2H3DA 1BXNA 3UCDA 3Q65A 4ILSA 3UD6A 1Q6FA 4NJIA 3OBAA 1HL8A 4DWDA 3LM3A 2VWTA 4O4WA 4JEQA 1G0CA 3UFYA 4H8VA 4LCRA 3TZFA 1FOBA 5DANA 4GVGA 3AZTA 3E9AA 3EOLA 4Q32A 1GT8A 1U1UA 4B2DA 4E4UA 4K1GA 3QR1A 5ABTA 2A3HA 4NYUA 2HBVA 1UWQA 1V6TA 2WZHA 3VIKA 5EMMA 2VFEA 3LCGA 4XZHA 2OFJA 2WKGA 3P61A 3DG6A 4KESA 3WLTA 4PCTA 2VX7A 2BVDA 3WJZA 4JTHA 1LQ0A 2D23A 3IACA 1XYLA 4W8AA 1V03A 1W8SA 2WSPA 2Z7GA 4GGHA 3HGRA 4RV8A 1TUFA 3PG9A 4QE4A 4M51A 3W23A 2G37A 4JTSA 1UD2A 5D8WA 4A3YA 3RO6A 5EMLA 3DUGA 4CVWA 1N8FA 5K3VA 1HP5A 4EQXA 4DRSA 1VP5A 5FMHA 3USZA 1GWJA 2YW3A 3P82A 1EQPA 3PZTA 1WV2A 2DH2A 3W1UA 4V28A 3TNOA 2DZBA 4LVGA 4E2DA 1JFXA 1O1HA 1HP4A 1Q6GA 1TCMA 3QV8A 4WY0F 5A94A 2OQHA 3B05A 5HWJA 1POJA 2CBVA 4HYRA 1GJPA 4QRNA 3ITYA 4HMDA 2PDCA 5IFTA 3GG1A 4UMCA 2FDSA 5U1OA 3WELA 1JZ3A 5HMDA 4ECLA 3MY9A 4UXDA 1UB3A 1NDVA 4RPQA 1FDJA 3P0XA 1H7WA 3W83A 3OYZA 1W9BM 3OVRA 4H6KA 1I9CB 1XG3A 4YVVA 3H2FA 2BODX 1EF2A 4CQAA 4Z0JA 1XS2A 3KLKA 5A95A 2WPCA 5AC4A 4FLOA 3VPLA 3H4KA 1YNYA 3ZIZA 3CPGA 1YDNA 3NJ3A 3STEA 1SU5A 5I3JA 4Y8EA 4F0HA 4HSNA 3VNDA 4DBEA 1R9XA 2OSWA 1UWRA 3HG5A 1PSCA 1GZJA 1TKKA 2XVNA 5JBDA 1ITQA 4US5D 3WEOA 3GDKA 2EQ7A 4CD5A 1UD6A 3BCFA 4JQAA 2PDJA 3DHDA 3ZT6A 3UXLA 1QHZA 3FX4A 4R7JA 3OTRA 1JPMA 3ARPA 3IGXA 3IIXA 2X05A 5HR7A 3JVAA 4ICMA 1I2PA 3N04A 4LNYA 3ZVHA 3RFAA 4J57A 2V9DA 4QXIA 3NZPA 2BOFX 1XLHA 4O1EA 3FDGA 1Q45A 3IVTA 3SQPA 1FVPA 2V30A 3GKFA 3K4WA 2QEZA 1PZ3A 4LUTA 2J8GA 1CXHA 3TR2A 1KO0A 1A49A 4LB4A 5A8QA 1EWDA 2GQWA 3VFLA 2I57A 1HGYA 1TZZA 3E2RA 3GIPA 3UETA 4PFHA 3U57A 4AIBA 1VAHA 1T7LA 2VC9A 4U2YA 1QOPA 4H9TA 3WQVA 1MNSA 1Q6OA 3CASA 3PPFA 3WEMA 1IV8A 1X8FA 4DZHA 3LBMA 3OZMA 4R5EA 1BZLA 4U4MA 4UQCA 3C2VA 4RZ4A 3TYAA 2GUUA 1XHGA 3E2QA 4P2VA 2ZZBA 5KETA 1EPVA 1R46A 2NV1A 3N6HA 4KFPA 2J7BA 4WVXA 1RQBA 1FFQA 1Z41A 6ALDA 3NL2A 4Z2HA 2NUXA 3ETRB 2QIIA 3CAKA 1UWSA 2H9AA 4A3UA 5H91A 1FWAC 4E6MA 4ERGA 3PBUA 1HJUA 1J0YA 3W7MA 4XZLX 5G5GB 3PK7A 2DT3A 4HNUA 4BI7A 1VYRA 5TD4A 3NRZB 4RNIA 4DI8A 4B5UA 5A2BA 1W91A 3QC3A 4NI8A 1W1VA 4S39A 3TONA 3WLNA 4S3AA 2OX4A 3HPZA 4G1KA 4LALA 4NZ3A 2JEQA 2VQTA 4IISA 5U7SA 2P3EA 4NKCA 2WBAA 4HSOA 4N02A 1PYFA 4MDPA 2EPMX 5C2CA 1F3WA 3BVJA 2WC3A 8XIAA 1FDZA 3RJXA 3HJEA 2V81A 1K9EA 1EC7A 1EA9C 2ZC8A 4C6IA 1JCTA 5LKYA 4Y90A 4U5IA 3ABZA 1VPXA 4ZB0A 3N2BA 3UYCA 1SFSA 2RFGA 4LAOA 4DNMA 1RM6B 1RLDA 4JBRA 3KUMA 2WKJA 3VD4A 3ZS4A 1XYAA 4QEEA 2Z1BA 1C8VA 4JNZA 2C0HA 2IXUA 2XWEA 2WSRA 2JK2A 3RGTA 1YNPA 2CETA 3RR4A 4AD1A 4D2JA 4F9DA 1RBOB 4FNRA 2P0OA 2Y5EA 4KH2A 3CO8A 1DBTA 3MV01 3GRSA 1U1HA 4O10A 4NAEA 2VC7A 1JJKA 1H1NA 1EIXA 4MWAB 3A47A 1JYXA 1OCJA 4JEJA 3NOEA 3MBDA 8CGTA 1W54A 1MFVA 2Y8UA 4RXFA 1LG2A 4GI8A 4RX0A 5HULA 5A8GA 3ARUA 1JL8A 3U7BA 1BF2A 4WDTA 3MCMA 1GPFA 1GTEA 1IEQA 3GC4A 4XSMA 1RCQA 3WG6A 1XIBA 3CMFA 4XAPA 4AC7C 4AIOA 4PTVA 1Y7VA 2V5CA 1OB0A 2XH4A 4MNJA 2QUTA 1UR2A 1N82A 1NWTA 7A3HA 4H6RA 3QSTA 4J28A 3EXRA 1K8YA 2BY1A 3GHTA 3FVDA 1XANA 3EWYA 3JUGA 3HG3A 4IPPA 5M03A 1LF1A 1OC7A 1WUFA 3GHUA 3PB2A 2CERA 3RHGA 2OJPA 5HNRA 5BYWA 1SW7A 1ZJHA 4O28A 2PCQA 4JTRA 2Y70A 1SZNA 3DJJA 1DE6A 3UJSA 3UZ5A 1O95A 3H2NA 3ATZA 3TA6A 3TTQA 1PKMA 3BGJA 5HPCA 1I1WA 4NJHA 4GQ0A 2G95A 1M1BA 3VOGA 1GRHA 3BH4A 5G2IA 3GBEA 4PTNA 3KP1A 2WVVB 4ZB2A 2J47A 4V33A 1X7IA 4PB3A 3W6MA 4LXFA 4LGXA 1V3IA 4JR5A 1VFUA 3KVLA 3VK5A 1LWHA 4QE5A 5SWUA 3EXTA 1GW9A 3SGUA 3TN5A 1W1ZA 4IICA 5CC5A 4UQBA 4ATDA 1DTNA 4RNFA 3BANA 5FACA 2VHLA 3AISA 2BGNE 3A7UA 4ZTYA 1J79A 1QPQA 3UWZA 4Z0SA 3GB6A 3HF3A 4PTWA 4H2HA 5EMJA 3W1QA 1XIIA 2ZUWA 3WKZA 4TO8A 2PRLA 1QO5A 1SZFA 3S1XA 3FXYA 3LHWA 3TFXA 3FJ6A 1SYTA 2ZXDA 5D9MA 1VZWA 3DFSA 3F5KA 4EMWA 1E1FA 3QMTA 2X8CA 4C6MA 3PVFA 4HIBA 3GBDA 1HL2A 1WE5A 1AL8A 1A80A 4AD4A 2YDAA 4Q6XA 1BTCA 1VYSX 3PZOA 2OSXA 1E3XA 3EEZA 2ZQ0A 1O4UA 5ABEA 3V5OA 1Z42A 3EOUA 3RMEA 1E5JA 3B9DA 4S3CA 4DXXA 3HU7A 4CU8A 3M5VA 2OKOA 4MJMA 1A3XA 2BSLA 1JPDX 5G2WA 4NAFB 4ROPA 3L4UA 2V6OA 4XIAA 1ZL1A 3OZOA 1M7JA 3WBAA 3CZEA 3MUY1 2GYIA 1H5YA 2QJHA 4PUWA 2QS8A 3OGVA 4Y96A 5A2CA 1EDTA 2A3LA 3IJ7A 2IKIA 2XVGA 2YCLA 3ZVIA 4XUGA 3PULA 2ZVIA 2VEKA 2O9OA 1OIMA 1TTQA 2FPTA 2HVOA 3O2LA 1QK0A 2QMJA 4GNJA 3WQFA 5FEWA 3HGOA 1WA3A 4H83A 4QDWA 3KX6A 1PZ2A 3CZGA 1Y5XA 1NDAA 4Q8VA 1US2A 4DN1A 4DUXA 4OJYA 3OHIA 3G18A 3KBWA 4JN7A 3VZZA 3EWWA 2NZLA 4ZEPA 2J3NA 3WF4A 2PDUA 2E9BA 5D37A 4WOQA 1H2JA 3QPEA 4YPJA 1FRBA 1L8PA 3MHFA 2NVDA 3S4TA 3RCYA 3I3DA 2ISSA 1TTIA 1RP8A 2G3IA 4FO4A 1KFWA 3VIGA 4JCMA 1W5QA 4F2BA 4E2BA 3VIMA 1Q5MA 1Z8AA 1TPFA 3FA5A 4FF5A 3CPUA 4LV9A 2VRJA 2Z2AA 3LCWA 5J04A 7ODCA 5T26A 1VLIA 1ZAIA 3AMCA 2XIQA 3WD0A 1V7YA 3QFBA 5GNYA 2GOKA 1S3TC 3R6IA 1ZY9A 3SN1A 4IPNB 2IKGA 4FXFA 2G4JA 3EX1A 3JU2A 4XB3A 3ME3A 3CV6A 3EYPA 2AOSA 4LX4A 4ZXOA 3BOXA 1UASA 1PZ1A 2NT0A 2Y2WA 3OBKA 3BGGA 2WMIA 4L56A 3UW6A 1E9IA 4D6JA 4XAYA 2F6XA 4PMJA 1Q85A 1F4HA 1ICSA 1EGMA 3CHDA 1R85A 4KEUA 3IWPA 2QUVA 5JUVA 3GU1A 1SW0A 5ABGA 5I23A 2HXUA 4H4VA 1J0KA 3EWCA 1S3HA 3KVJA 3BSGA 4E8CA 3W9ZA 1IWPA 1UD8A 3CGTA 4XAGA 5HXMA 5FF4A 2YCIX 4GY7A 2WSKA 1XYZA 2CFYA 2Y0FA 1OJTA 3K46A 2OT0A 1P0KA 1XLCA 2QCLA 2WSQA 1LM1A 3GIQA 3NL6A 4BQ3A 4HB7A 2J7FA 3BQ5A 3VIJA 1B9BA 1Q1WA 2ACRA 2IS7A 4QEHA 1KC7A 2XM2A 3N2CA 3MTWA 3SCQA 3PWGA 4NX0A 2GH5A 2PWUA 3DENA 2DSUA 4GYJA 1FFUC 1W5NA 4OBTA 5CAHA 4DVOA 4JTJA 3Q37A 2INZA 3T4WA 5CZJA 5E9XA 4H7VA 1PCKA 3QQWA 2VDGA 4S3GA 1IZKA 1BVZA 4GBUA 2X1SA 2DZSA 1W32A 2B7QA 3COTA 4XO7A 3WJYA 5A6JA 3OB8A 3WD4A 4EMIA 3VNMA 4TQTA 2YDRA 4IIEA 2W0HA 3NURA 3TYCA 3W7RA 4GYFA 2ZUUA 3EWXA 1KD0A 4JDBA 3LXBA 3LPGA 3UJFA 3CPRA 4DF0A 4PUDA 1ZMDA 3TWAA 2YZ5A 3L68A 1LROA 1YRRA 2CXEA 2W91A 4DPQA 1TJRA 3DFNA 4O0QA 3W1PA 4AF0B 1JUBA 3K2GA 4DY1A 1GOXA 3N34A 4ZO7A 2BY3A 2VRQA 3E5BA 1XDMA 3XINA 2TODA 1LP6A 4H19A 3QQ0A 4LYPA 2FVLA 3MSGA 1XLLA 1E6NA 3FA4A 5JMUA 4GWEA 3OGRA 3UZXA 3BW2A 4WXYA 1E1CB 3NVDA 3QOMA 4DZ5A 2NQHA 5KVIA 3SB0A 1K4QA 1OX6A 1ZPTA 1K77A 2IUZA 2ZRUA 1R3WA 3STCA 3QMSA 1ICPA 3RM9A 4ATLA 1V97A 1GEHA 3T7VA 4AVFA 3P62A 5IBXA 5LIXX 1MW0A 4IGNA 2QUNA 4P61A 1JNDA 3A5VA 2NLYA 2NVCA 1ENUA 4IP7A 2NUWA 3O1NA 1WDRA 1W0MA 2QVNA 3W85A 1LL4A 4HCLA 1IXNA 4NZ1A 3GFXA 5C7VA 3NQ2A 4O0ZA 1L2QA 3WJXA 4MOZA 1ZQ5A 1FWWA 3TAKA 1IWBA 4WKAA 1CWYA 3G0SA 3LU2A 4WSKA 1YBQB 1V6YA 4QQ3A 3H4GA 5C71A 3NYDA 4J4KA 4IFOA 3MZNA 3BAIA 1WXYA 2YGYA 4GIAA 4EOUA 1UC4A 2VTFA 1E9ZB 2GJPA 2EPHA 4KWSA 2Y5JA 5LA1A 3LMYA 3QN3A 1OT1A 2A3BA 1CPUA 3VOFA 3VDHA 3WDJA 3HJZA 4EPKA 4WGXA 2GVJA 3CV1A 4HZ6A 4NASA 2DY3A 3PM6A 5FJJA 3RCMA 1FWGC 1C29A 3WQ5A 2V5KA 4EAYA 4LRSA 3BW4A 3H2MA 3QGAC 4GVHA 3ONCA 4H3DA 1OD8A 1ISXA 1VBGA 4JTTA 2X2GA 3UU0A 1GGOA 4F3HA 5BCAA 1O7AA 4XD4A 2I56A 4PR4A 1GEUA 1H11A 4LH8A 1KR0A 3AYTA 1R8LA 4JTUA 3GG7A 2W3RA 4XVDA 4RLIA 2PDKA 1OGBA 2D0FA 4GGBA 3MMWA 3VIHA 4HPHA 4Z2IA 4GCXA 2P53A 1KRMA 3ATYA 2DU2A 2OEMA 3KRSA 3FSUA 2OG9A 3K4AA 3M0YA 1OGGA 4O1AA 4B9ZA 3THDA 2QAFA 4AWSA 5HWMA 4UTWA 3GDBA 2B7NA 2VZTA 3S9IA 4YN5A 4GQRA 4LF1A 3NXFA 1M53A 4WEVX 5DCDA 3VMOA 4ZQCA 1UJQA 3NZGA 2V5BA 4ZOAA 1POKA 2A79A 3S42A 5BWFA 2P0IA 1VDVA 3VIOA 4JY9A 1U83A 2E9MA 2YW4A 4LNCA 2G8ZA 3FK4A 4M0XA 1PHQA 2NQ9A 1XH1A 1C9DA 4LS0A 4YU1A 3INPA 4AZCA 1KRBC 1UH4A 1WDSA 4DEFA 4HPNA 3KDOA 3U2ZA 5CPSA 3H8AA 4Q4OA 3W7CA 2VX5A 2HBXA 4GI4A 3GW0A 4NZ4A 1X6LA 3C56A 1DWHM 5BROA 1SR0A 4G7EB 4A2RA 2WOIA 4M1BA 1V3HA 4IG2A 5DRCA 3VVGA 1TR9A 2TPRA 1AQMA 5DMNA 1Q3NA 4NSBA 3AIUA 3ZLHA 4H8HA 2BFGA 1J5TA 1QNRA 2V3GA 2WCAA 4PMXA 4ZQPA 2HPMA 5IDIA 3C2EA 1AZ2A 4MNMA 1N60C 1L0PA 4MHBA 4K8HA 1C9WA 1SJDA 1D8WA 2WLYA 2PTZA 5FOOA 3EOEA 1A5LC 4ALDA 1CECA 5BZAA 3MSYA 1EPXA 1TTPA 6CGTA 5AN7A 4L6OA 3W87A 1YHTA 4KFNA 1P7TB 2J27A 4TVUA 3R4IA 4XBJA 1QHOA 3MWAA 1LOSA 1A5SA 4RR4A 3CYVA 5HJXA 3OLEA 5HBFA 4A6GA 1S5NA 4IGSA 1EFZA 1ZLPA 3B04A 5FJUA 2BY0A 1PIGA 3RF9A 3M7SA 3AWOA 4Y9PA 4Z2JA 3SN0A 4KEZA 4Y9OA 4CKQA 3BLIA 5GJPA 2AKMA 3H53A 4M82A 3TYEA 3GDTA 1PB0A 5E0KA 4QDMA 3N9RA 4W8LA 5MF5A 3KLLA 4HNNA 2HCVA 1V0KA 1PL9A 3GTHA 1TWWA 1ZU8A 4FNSA 3GLCA 3PN8A 2YBTA 2CPUA 3QTPA 5FS9A 2PDFA 3DFHA 2UZ9A 4Y9MA 3U5YA 3BZGA 3FHQA 1BYAA 3RYSA 4W93A 2XIIA 2E8YA 5FEPA 2YX0A 3O06A 3N6QA 1I0DA 2FTWA 1AQHA 4H4PA 1DE5A 1F05A 1TV2A 1W17A 4WGHA 2XFWA 4YVXA 4LIIA 3TKFA 3RAOA 3CTTA 4RDWA 4PH6A 4U33A 2GVGA 2WHKA 4LYQA 1D7YA 1JPHA 1NPXA 3NOYA 1BLIA 4U5KA 3U6WA 3H2OA 4OBRA 4O50A 1FO4A 4V1YA 4UFHA 1XIEA 2DZPA 2J8TA 4RZBA 3A4JA 5CG7A 4C6PA 1UR3M 1T3QC 3A9IA 5REQA 1F3PA 5FF2A 1HKIA 2TSYA 3EA2A 3OODA 4AYGA 4PCNA 4S3FA 3GUGA 3RLGA 5FF0A 5MKGA 4S3JA 3K5XA 1N8WA 2PE4A 2VQUA 4L9YA 3U3HA 4D9PA 4FIQA 5JVLA 4B5XA 5HR6A 1JDDA 3PTMA 1AQFA 5FSEC 1H41A 1M03A 1R47A 1R3QA 3DDMA 2I9UA 4YLWA 3AFBA 4FF7A 4RV3A 3VABA 4FLQA 5DLCA 3SBFA 3APYA 5ABFA 2B7OA 4UBPC 1NSJA 3GR7A 1KLYA 2V0TA 1GHSA 3B0YA 4JN6A 3TJ4A 1IYXA 3WYZA 5EFFA 1XFCA 4LCQA 1FH7A 1FECA 4MADA 2PDXA 4NUWA 3SCOA 1S1RA 1FWEC 3O6YX 3W7PA 2Y7EA 2A85A 3TZNA 4GACA 5DY3A 3GY1A 1W9PA 1U5JA 4L4LA 3B9OA 2TRSA 5D8ZA 1FP8A 2WPGA 3VGFA 4IX0A 2QZRA 3NG3A 2ANUA 2C0AA 2X1UA 4DO6A 4H9VA 2VGIA 2XG9A 2D2JA 1UC5A 3TMQA 4AY8A 3M6DA 4JN8A 1UZ1A 3H7UA 1JGMA 3UA4A 4TX9A 2XN1A 3GXPA 1OBAA 4ZSTA 1GZ1A 3RCNA 5I3FA 4IXHA 1VR6A 1X2GA 1OY0A 2WOQA 4OKDA 5LA2A 3PFMA 1Q1RA 1BSLA 1TQJA 3B06A 1JAEA 5A6KA 3GX9A 4Q7NA 3CU2A 5DXXA 4Z1DA 4XD6A 3IS4A 5BMWA 3DBNA 2QULA 2PDYA 2E0PA 1NFGA 3BMWA 1PIIA 1DQUA 3OEXA 5GJNA 3IVSA 3HG2A 4GRSA 1S46A 2MNRA 3DFYA 1QW7A 3PBWA 2BCPA 3UG5A 3VKKA 2WM0A 1SFLA 3F7JA 5K9CA 1V6WA 2BX7A 4TTUA 3W74A 1MOKA 3C0JA 4AG0A 1CGXA 1NHPA 2GR0A 3B8SA 3QOKA 3P5ZA 3RK8A 4ACYA 1EEPA 1M6JA 2ATSA 3P81A 3U0HA 3QSRA 1FUYA 4XZBA 1KGWA 4QISA 2PBOA 4D6HA 4N42A 3O07A 4WSJA 1I45A 3ARWA 4NEWA 4EF9A 4BQ5A 2HEJA 1SZRA 4D6CA 3LRKA 4I8DA 3KM8A 3OQEA 2FGZA 2Q71A 4JD4A 4LBRA 1I60A 4NL1A 3GXNA 1QI5A 3FLUA 2GQ9A 3WFZA 3C6CA 2ASHA 1TUXA 3QLLA 3VILA 4D1JA 2CZVA 4GH1A 1PPIA 4C7FA 5CZKA 4LT9A 4O14A 3G3MA 2E3TA 1OFOA 3P74A 5IXEA 2XDFA 5FS6A 1R30A 4OTKA 1XX1A 1XIHA 1TPDA 3ITVA 3R8RA 4WKFA 3QV9A 1KLZA 2DJLA 3IIPA 3QF0A 3TLQA 5JIWA 4QLJA 4CGTA 3LB0A 3OZPA 3WQCA 3BCJA 3SGZA 1TTJA 3T40A 1L9WA 3WN6A 3SUVA 3SCNA 2E5DA 1A4MA 1RCOB 3AAMA 2EQ8A 2NUYA 3ALFA 3NA8A 1F9CA 2LLEA 5AYIA 5D03A 5HINA 3P14A 2ABBA 2NWRA 4U2ZA 2E3ZA 3STPA 1QOXA 3TDFA 1KCKA 1XIFA 2EO7A 2OX1A 1XLGA 4DLMA 2ZZ3A 7TIMA 3DOPA 4DJEA 4KIEA 6REQB 4PODA 4AD5A 4TVCA 3S6DA 3PNUA 4PTXA 4W86A 1Z7AA 1OFPA 2G3MA 3CGDA 3A4XA 4N6EA 3DK9A 3AIRA 3T0AA 1R3YA 5CGTA 4JIRA 4LANA 3WQPA 2POZA 2QAEA 2J6XA 2V3BA 1DIKA 3AHTA 1J11A 2Y89A 5FAGA 3MUAA 4JZ5A 3WUFA 2I14A 2P76A 4UTWC 3OLGA 3VZYA 5CLWA 3GNXA 2E77A 3CHVA 4AZ7A 3HMJG 3VZXA 2O7QA 1H2IA 4J5NA 1L6GA 2XGZA 4J3WA 1QW9A 1EBGA 5D09A 4UTKA 4GIEA 4PTMA 1ONEA 2YL9A 3W53A 4ML9A 1AW2A 4L64A 3QRHA 3P2VA 4C6QA 4FOUA 1CLXA 2QVHA 3L2MA 3UXAA 1JIBA 1B2YA 2R1NA 3KOWA 4H4UA 2WSYA 1EBHA 1X7FA 3CL8A 2X7VA 3EDEA 4MZ8A 3UJEA 1UBSA 4GVIA 1PTGA 3I3EA 5F2GA 3VI2A 2ZBTA 4O57A 3U2CA 4XAZA 2YDQA 3PZQA 4RDZA 2XN2A 4BQ2A 3N6JA 5TQLA 4KRZA 1X38A 8A3HA 4FLSA 4ZBCA 5FCZA 3C0QA 1CGTA 2X0YA 3KTSA 4F0SA 4H01A 2Z24A 1BGAA 4H4QA 4K7ZA 1XBZA 4ZO9A 5D05A 1FHUA 1V0MA 4CQ9A 1LUCA 2UV8G 4W5UA 4UFJA 3K8MA 4OU1A 1GCYA 1O12A 2PF0A 2Q3RA 3IAPA 2ZE3A 1E43A 5LNVA 5C2XA 4Z42C 2OSYA 3VOHA 4GHRA 1CI1A 1JYNA 2PLJA 1C8QA 1UD5A 2VEMA 3GR8A 2AGTA 4JTIA 4MG4A 2QAPA 3KW3A 1JZ6A 1EP3A 3WLSA 3SUUA 1VS1A 2DSVA 3KHJA 2D0HA 1MXDA 4CNUA 9XIMA 4GXMA 4PSPA 3VMPA 1ISWA 1GHRA 3RILA 1UD4A 3CGCA 1FDYA 3ANVA 3T0TA 1OX4A 2VCAA 4R7WA 5KINA 3EPMA 3REQA 4LBUA 1YTEA 2W54A 3UBPC 2CLKA 1YXCA 2Y7GA 5CH9A 4BA0A 5DMYA 3FG2P 3IJQA 2E8ZA 3W4RA 2ZZ7A 3E5PA 4NU7A 4HOXA 3QFEA 1FKWA 5LGXA 1JRPA 1A53A 5CBBA 3KBVA 3SM0A 1E56A 4HA4A 2ZWZA 3W6YA 1PWLA 3FEQA 2JEPA 1BTMA 1J10A 1E6XM 4Y6GA 1K9DA 4FALA 1TQXA 2X1RA 4EKJA 2NXGA 3EZ4A 1C93A 2XISA 4LAUA 2CC0A 4H4RA 4FAMA 2EJAA 3RRXA 3WH5A 2YXGA 1AQ0A 5E93A 4ZGYA 1XRVA 1WP6A 1O68A 5DT5A 3W2NA 3R0UA 1LBMA 3UZZA 1FWJC 1YDYA 3VNLA 4J3XA 2BBFA 1GG0A 4A3QA 1FBAA 2V2HA 2J4GA 4JICA 3UP8A 3U2OA 2DEPA 4MYAA 4XZMX 2Y4SA 4AEEA 3VDAA 1V0LA 1K4HA 3GW3A 3B0PA 2YXXA 2UY5A 2C1IA 4S3BA 3UZWA 3DU0A 1QNQA 2OWXA 1U33A 3LY0A 2RDXA 1TVPA 3GTNA 3DI1A 1ITXA 5IRPA 4JNMA 3AXKA 3OHMB 5CSUA 1GNXA 2BHYA 1GOWA 5F4SA 1PIFA 3TK7A 3R7MA 4LUIA 3DKLA 3VGBA 1N62C 2W3ZA 3FIGA 2WZTA 4YCPA 4FB7A 3L4XA 1PUDA 5GVJA 4PMYA 3NM3A 4IWWA 3HZ3A 4Q8WA 3ZMRA 4X22A 3TV8A 2OGJA 3HFYA 4EXAA 3M0IA 2C8NA 2QJIA 4NY2A 1ZCCA 3NQAA 3UCQA 3DC8A 4DIAA 3CB8A 2WCGA 3OA3A 5FIPA 2PMQA 2OQYA 3N25A 3R43A 1ODZA 3ABOA 5HQLA 5DXYA 3V7PA 2HJPA 1T96A 1DXIA 1I4NA 3N29A 3WMCA 3R94A 1WZAA 2KX9A 3LG3A 3NXLA 2P8BA 3LTYA 3WJSA 3WF3A 5U25A 1WNOA 4FX6M 2VM8A 4AX6A 5IFPA 2VKZG 1RK5A 3GD6A 1JDFA 4ZQNA 4WR3A 2QHAA 3H26A 3AU6A 2HQAA 4WSHA 1LLZA 5LNSA 4MUZA 3QLDA 2AL2B 1BVWA 5F4WA 2VEFA 6ENLA 1P6WA 2VX6A 1B0IA 2V69A 3HFTA 3BGAA 4BI6A 3RUBL 2Y61A 1LT8A 5CGMA 2OOFA 4FXJA 2ZRVA 2IPFA 1H62A 4B92A 3IVUA 4X2PA 3MDWA 2W67A 1ZFJA 1GPWA 1I2RA 2Z1VA 3AMGA 4FLRA 3K8LA 3AXIA 3S8HA 3NQDA 5BXRA 2PLKA 4Z2KA 2GDVA 1XLAA 3E1F1 3UPWA 1RJRA 3I3BA 4L4MA 3WUEA 2JF7A 2DW6A 1PVNA 3AJXA 3L4YA 2Y7DA 3TR9A 2QCEA 4JIIX 4OWGA 5FS7A 4G5DA 4ZVJA 1W3HA 2WC4A 3HMCA 4UZSA 1QOQA 4O1BA 5BNKA 1MDLA 3IUIA 1ZDLA 1SM9A 1XCXA 1XQKA 1NWUA 3KP0A 1WUEA 2DFAA 1RLCL 3VM7A 4KPLA 4GCAA 3BG3A 4ZB5A 5I24A 4LY4A 3FCPA 2F38A 1EC8A 3N1AA 4UB9A 4GYPA 2ZC1A 3E38A 4PMUA 3UF9A 3F4VA 1EP2A 4WY0B 1U30A 4DBSA 2WHMA 2R91A 2W61A 4GUFA 1XV8A 1UKPA 3F4WA 3FDKA 4US6A 3W84A 4JTQA 4PEKA 4CQ8A 2C19A 3UPMA 3QXBA 2X0HA 4ORMA 3B4YA 3UJRA 4DJEC 1RV8A 1JZ2A 3GRIA 2QCHA 1ZX9A 2PZNA 5FEZA 4PB4A 2PUZA 3LXDA 3EAOA 1FIQB 4JX4A 3BAJA 3PTQA 3HQ1A 3BXWA 3ITXA 4GG9A 3A3HA 2FFIA 2YOCA 3RJYA 3GTXA 4HPJA 2NQJA 4PMZA 2WYSA 4C1LA 3N12A 1G4SA 3S2JA 4AIEA 4HOWA 4NXKA 5D2YA 4DBUA 1D3GA 5GNXA 3B8TA 3CB3A 1TO3A 3CWOX 1H49A 3CLMA 2B81A 4H6EA 1EWEA 1RP9A 3BMXA 3W1XA 4HZ7A 1XF0A 4AHPA 1GVFA 1VLWA 3M16A 2OU4A 5HNNA 5H1WA 3M0HA 1DJWA 3AZSA 1R0MA 2FB3A 1RR2A 1EUAA 1P0EA 4KEMA 3B4UA 4US5A 4I6KA 7ENLA 4ICCX 1B3OA 3FA3A 3LSBA 3O0KA 1UOZA 4BZYA 4NNBA 5AC8A 2PDBA 1R2TA 3K30A 4XZIA 4LWWA 2WKLA 3II4A 2CLFA 1Z9AA 3WNOA 3CO4A 4AU0A 4DF1A 2P8CA 2UY2A 3PR2A 1IEWA 1G01A 1FWTA 4GX9A 3ZWSA 4ZSUA 1VGAA 4M6PA 3TYBA 1LPFA 3KBSA 3VKAA 3IC9A 4W85A 7TAAA 2J78A 4IQLA 1P43A 4MZYA 3SRKA 1SFJA 2A3AA 5BU6A 4EQRA 1WKFA 1TYGA 3NVWB 4KCWA 3R8GA 1ADSA 5C6MA 3ARQA 3KTCA 4EX4A 4JX6A 1G6CA 3GXTA 1H09A 1BSIA 5KZMA 4LC6A 3TQKA 1W1YA 4UCGA 2CDUA 1FWNA 4ZR8A 1JR1A 1ADDA 1OFEA 4EWND 5E9AA 1JXJA 3IPWA 1XL9A 3URHA 3LLDA 4LB3A 4LW7A 4J7RA 3WNMA 3PZIA 3G1AA 3BLLA 1CGUA 1DP0A 3NEVA 3HV8A 4CN1A 4FPSA 1AUSL 2KAUC 2GWNA 4Y2WA 3OA5A 1EEXA 3ARRA 5AHMA 1SFTA 3W1LA 1MUCA 1PWMA 1MFUA 3IJIA 2C71A 1BGGA 4C7GA 4MWAE 3CAQA 2Z27A 3C61A 4R9XA 2PWHA 3TEVA 1P6BA 1H7XA 3WL0A 3QV7A 2IW0A 4N2YA 3Q94A 1NJJA 3FJLA 3LS9A 4CD7A 4ZOCA 2JKAA 2ZOXA 3W1NA 2HROA 1RA5A 3O9NA 1P1XA 2ISWA 1X1ZA 4HK6A 4EXBA 2VC6A 1ZMCA 1EGZA 3P8IA 4F4RA 3P60A 2C3ZA 3W82A 1CDGA 4C90A 4KF1A 4C6LA 2VI0A 4WLCA 1DPMA 1HN1A 4M81A 4WIWA 3ZFHA 3DGRA 3CXBA 3MUIA 5DO8A 2XZ9A 1E9LA 1I75A 4W84A 3VX0A 2VMFA 2QDGA 3RX4A 2PI6A 4QG9A 3QGVA 5DQPA 1TFVA 4GUIA 3Q45A 3W0KA 3G2GA 3UZYA 2QCNA 1W1TA 3IK4A 5KITA 1VRXA 4HMCA 1D7FA 2Q8LA 3VMNA 5A69A 3SRFA 2VFDA 3FN9A 2C6QA 4F48A 3SUWA 5I09A 2GUBA 1AA1B 1YEYA 1YADA 4Q4KA 1I8JA 4MWAA 3L21A 3RX2A 1H60A 4RE2A 1JZ8A 3ANUA 4W88A 3DFPA 4AY7A 1UMLA 1B30A 1K6AA 1E0XA 3DIPA 1UPMB 4UIOA 3T81A 5D9OA 2BMBA 4O4VA 1ADOA 1EJUC 4JTAA 1GVQA 1TE6A 2PDWA 2YR1A 3BO9A 2WW5A 3R0KA 1E6PA 3TE9A 3HW2A 2CZDA 1ODUA 3C8NA 3TOPA 6XIMA 3G5EA 8TIMA 2B31A 3RNDA 1GOKA 1LRQA 4JQ2A 2XVLA 3EX3A 4WHBA 1H0IA 3KLJA 3WJWA 5KZ6A 4CU6A 3K4DA 1K4GA 4L80A 1AH3A 1RSCA 4YL2A 3D46A 2C3CA 3LHYA 1ONFA 3KXQA 1AL7A 1AMKA 3PBYA 4XAFA 1E51A 3U2EA 1UUOA 3A3XA 2V63A 4J40A 5CBJA 3PJWA 4EANA 2O4MA 3I68A 4AC1X 1JF6A 4JX5A 1NQ6A 3ID7A 3S83A 4C7DA 2WVVA 1JUKA 1OIFA 1VFLA 2IKJA 2I5IA 2H3BA 4O11A 2FTYA 2WP6A 1ZUAX 3JRKA 2YBVA 1TZ7A 3FKKA 3B0UX 1HIZA 3AJ7A 1NOWA 1Q2SA 1BQGA 3GVQA 2J9ZA 1KBIA 2BB0A 3URNA 2Z1SA 1P4CA 6TIMA 2R94A 3NGFA 4GH3A 3PANA 1AFSA 2QR6A 1R7AA 1M9HA 4UTMA 1OG0A 4D6IA 3VGGA 4B16A 3W37A 5CJNA 3QBUA 3K13A 1E9YB 2R1PA 2V38A 5HANA 4QDPA 2QCCA 4DJED 1W6TA 1NP2A 1MUMA 4C5ZA 1GOMA 5EGRA 5LXXA 1EGVA 2OT1A 2CU0A 1NF0A 2DP3A 5L9FA 1GRAA 3POHA 4HMEA 3WQ4A 4M1RA 3PJXA 2OXNA 4CQDA 4I7VA 3O6DA 3BJSA 2E68A 5A2AA 1OVDA 5H8MA 1QWGA 2G96A 3ORWA 5AYZA 2QF8A 1KCXA 4YIWA 2PWGA 4QJ4B 4GC3A 3LX9A 2D20A 3A23A 1ISZA 2FGBA 3WLKX 4B9YA 5BRQA 1Z89A 3O7UA 4GY0A 1IT0A 4W89A 1W1PA 5F2IA 6XIAA 3SCUA 1KM4A 3W1AA 4G7FA 3ZR6A 4NAFA 4EAMA 2HPIA 2OPJA 1GQNA 3GNRA 1SW3A 4HMNA 1REQB 2YB1A 4DZAA 1ME7A 1TIMA 3DC0A 5C2GA 1XKYA 5BXSA 4ZODA 3LI1A 4WDXA 1KKOA 2ZWYA 1CXKA 1DORA 2CWNA 3OQ8A 2VEIA 3BV7A 2FZMA 1OFRA 4BF9A 3V0SA 1ZBKA 2R8WA 3RMJA 2GJLA 4IPIA 3RIKA 3MMTA 1MNZA 1YIXA 4Q8OA 1JDEA 4GQBA 4ADWA 1MYRA 1HNYA 1MSSA 4GVFA 2PWVA 3SQMA 5M2FX 1J9YA 3SY1A 3DHPA 3CUFA 3CV2A 1KXHA 4K8EA 1R3SA 1WKYA 2CIPA 4RPPA 2V3AA 1TZ9A 4A8NA 4IP4A 1ZKQA 4R85A 2VNCA 4Y7EA 3DN5A 5CPTA 3G1YA 1SQ7A 4GQQA 2JIWA 3C0LA 1W2VA 3PZNA 1KV8A 3EWUA 3T2OA 1E4MM 1TWSA 4X0VA 3WNNA 3P0WA 2DPEA 1EIBA 2CWXA 2J7CA 1HJSA 3EWZA 3BL3A 1VBRA 3UXKA 2GJRA 1A5CA 3PPHA 4FDCB 1B5TA 3MYOA 4J3VA 5AZ1A 2ZA3A 1X2HA 4FX7A 3STGA 4KT2A 1XINA 3FW6A 5LNWA 3MANA 1MUWA 4MAVA 3WK2A 1NFBA 3VM5A 4WQ6A 3QM3A 3VA8A 3QZAA 4G6CA 1JGIA 2CLEA 3QMRA 3OC4A 3W7EA 4EF8A 3D3AA 3TW9A 1NOUA 4KQNA 3TN6A 3HN3A 4H9MA 1B3YA 4XX6A 1LORA 4DNAA 3V36A 3CUGA 1YXDA 4RL3A 4FSAA 5JCLA 4NRSA 3WMLA 1R3TA 1QPKA 4QLLA 4IT1A 5AHIA 1IEXA 1EDGA 3HGJA 3BARA 2BV9A 5JXQA 2EQ9A 1GRFA 1S2TA 1JZ5A 3DYOA 3PTDA 1NM9A 1ZRQA 1EHAA 3RITA 4IMAA 2PD9A 4LVFA 1YYAA 3GHSA 1Q13A 1CXIA 3VD5A 2J66A 3KFTA 4KWOA 3SGGA 2ZADA 5G1TA 1X97A 1Z44A 1H50A 1WKEA 1VYPX 3FY1A 5TF0A 1JCJA 1K9FA 2TMDA 2PDMA 1W3IA 1JI2A 1X6NA 3LEPA 4HA1A 1OWQA 1ZAJA 1QK2A 3N9KA 1H7OA 1EX5A 4POCA 3HQOA 3H2AA 4XQ6A 3M07A 3F2BA 1MXGA 4FEZA 1YTKA 2GQ3A 3ZOAA 1Z69A 1SVDA 2HK0A 5F7UA 4H9YA 3IGHX 1QMLA 5FSDC 2O9PA 1MZHA 2PP0A 3O8AA 4MSSA 3W7DA 1PCWA 3S5ZA 5FJIA 5LYRA 3EKGA 4QROA 7REQB 3GD4A 4NHVA 1DWJM 4KPRA 2Z28A 5DEZA 2Y63A 3LXAA 4DUOA 3SCVA 2EKGA 3LB8A 4CNPA 1O60A 2V5JA 1GYLA 1B3VA 2P50A 4AF0A 4EVZA 4KWUA 1LG1A 1PJ9A 1WDDA 1ZS2A 4JFVA 1K7EA 2BGQA 4EQSA 1NTHA 2FPYA 1WCGA 4AXNA 1LDCA 1UOKA 4Q4QA 3KCOA 1YMYA 5G2HA 3FFSA 4S1FA 1BQCA 4K38A 3A7AA 2GGEA 1C8YA 4UMAA 5D4YA 5CKSA 3QHMA 5LIUX 3FAWA 2J7EA 3APTA 1MDRA 3MYPA 1JEZA 1E1CA 1W9XA 2BS9A 3NPXA 3NGJA 4PUUA 3HPXA 2QPUA 4ZE4A 4O0KA 2OODA 5I3DA 4PC8A 4EMJA 1V8EA 3UG4A 4HU8A 1A5UA 2FHFA 4FR6A 4BR1A 3M0ZA 1H5VA 1DKWA 3NEHA 4AAJA 3WL1A 2DT1A 5HUOA 3P84A 4HN8A 2XPKA 4MWAC 1MQRA 2ZZ2A 3PJTA 2RGMA 2G3NA 2A7RA 3L9CA 4LSBA 4J9JA 1VPYA 3LYEA 1W5MA 1A5OC 2PGFA 4KEVA 3GAKA 4DAIA 4QS6A 2A6LA 3GVVA 3CQ0A 4IHCA 2E6AA 2QV4A 3RLVA 3S0CA 2FB2A 1QR7A 2SFPA 1B57A 3PBVA 4OECA 4HNOA 3BJTA 1GESA 1W56A 2X7WA 1Q65A 4ZENA 4P7RA 2GSHA 1OF6A 2YA1A 4N0RA 2Q09A 2P1FA 3WNPA 4YWSA 1K8CA 3HA1A 2DV0A 1E6ZA 4DPPA 3HO8A 2Z1KA 2D2OA 4MKSA 3VKDA 4APNA 2VEPA 5BRPA 3QHOA 4HHPA 2PGWA 3ZWTA 3MV11 1E72M 1UWAA 2GR2A 2VL4A 4CU7A 4YTSA 3G6MA 2PU1A 3CUHA 1UKSA 4A8IA 1IZJA 2YVGA 3B0VC 2CKRA 3LTSA 3M5ZA 4ASTA 4W8BA 3R12A 2QUMA 1NOFA 1FFRA 2WC7A 4TMCA 1X6UA 5FS8A 5PTDA 3BCDA 3GM8A 4HZ8A 2GVYA 5CAKA 4PMVA 2CLOA 3WO8A 1YE4A 2PGRA 1GKPA 4TXEA 3PAJA 3H4WA 3UXIA 4LRTA 3NPVA 3GNNA 2X99A 1RXOB 3BG5A 4I9TA 3G1RA 2YZRA 1KV5A 3PBGA 4J3TA 3VKCA 4P7NA 1RALA 3WNKA 3OVQA 4RK8A 5AVNA 1LRTA 1Q4NX 2CLLA 1NARA 5J8LA 4OQVA 4Q4PA 1WPCA 5I7GA 4W9TA 1ONWA 5CPQA 2IQ0A 4R27A 1CEOA 3T05A 2E9LA 1BXCA 3ECQA 3GO2A 3CYJA 4DYKA 4B15A 3V3WA 3O15A 1PS9A 1YPFA 4DELA 5LIYX 2RDUA 1UQZA 5C54A 3NM1A 2WMGA 4FMVA 3CH0A 4C6FA 5FF7A 2BVWA 3KS5A 2HWGA 3NL3A 4E4FA 5D2VA 4RNJA 4ZO6A 4B90A 2YIHA 3QTGA 4G7EA 3STFA 4M7SA 1RY8A 2YYUA 2R82A 1KM6A 4JOMA 1IIGA 1UROA 1GOQA 3TJLA 4QX4A 3VUSA 1ZENA 1UCWA 3GXIA 5EYWA 1CLKA 5DX7A 5CPNA 3B8WA 1FHDA 1O5QA 3MU7A 8RUCA 3JZUA 3A64A 1WAWA 4ZA0A 2PDIA 4UQEA 4CCZA 2EPLX 4D8AA 5K4XA 4DZIA 1DHPA 4GR1A 4MTVA 1S38A 4I7UA 3HPFA 4H9ZA 1PHWA 1N55A 3NO3A 2FHCA 2J77A 1PE1A 3SSJA 1V77A 4Z1BA 3P7YA 2PDGA 4ADUA 5FAJA 4E3VA 1XUZA 4Z2LA 3GZ3A 4NJGA 1P7TA 5LA0A 1CENA 4Q8UA 1F8IA 2ZRYA 4JIPA 1VEPA 2AMXA 2PA6A 1D3CA 4MY9A 1XWYA 2BXZA 4OOZA 1SZEA 1PO9A 1RCXB 2XFFA 1ZTVA 1DJIA 1BVNP 4LEQA 3ITLA 3N2XA 3ABSA 1W8GA 4ZL1A 3N9SA 3L0KA 4Z17A 1TPC1 4INFA 1E0TA 3S1WA 5CZTA 3W72A 4H1ZA 5CSYA 4UFIA 5HMSA 5TIMA 1UR1A 4AD0A 3GRTA 5FJPA 3CL6A 3R25A 5JCIA 2J75A 4YYFA 3Q2DA 1SUXA 2X0SA 4A21A 1EXPA 3UGRA 3D6NA 5FI8A 1XW8A 1KFEA 4OT7A 3PHAA 2O92A 1TMHA 1XGDA 3FNDA 4RNHA 5CPLA 3NQ6A 5DCBA 1XHCA 3WY1A 3ZR4A 1E40A 1WZKA 3DERA 5F1VA 4N9EA 1XQLA 3WDPP 1XSKA 3PUDA 2L5HA 4UTHA 3BC9A 2Y62A 3FOKA 5EPDA 1ZJAA 2EPNA 1O5KA 4IZGA 4IMDA 1MQPA 4D1IA 3EX2A 3SJ3A 4AMCA 3LPPA 3L4VA 1BXBA 1UG6A 5HMFA 4B5NA 2BVTA 2PTWA 4AH7A 2X8RA 3VGDA 1TPH1 4XZ9A 3CAVA 3THQA 3LLFA 4C6OA 3WLOA 1NWSA 3PSVA 4PBGA 4JGDA 3N18A 4CUCA 3UY8A 1KGXA 3W88A 2Q3OA 2PB1A 2X50A 1EP1A 2Z2BA 1US3A 4CNNA 3FVMA 1WDWA 3CUIA 2OYMA 3PUOA 2P88A 4DF2A 4D6DA 3M47A 1K03A 3MVTA 2GSJA 1VEOA 3I7QA 1XSJA 2A0NA 4Y9AA 2E5CA 4Z2GA 3W7HA 1K8ZA 3YPIA 2GSEA 2CLIA 2JK6A 2ISFA 4CCDA 1UP2A 1J12A 4OZOA 4JFUA 4N9CA 4MPQA 2F6UA 4MWAD 1AMYA 3FYOA 3I4EA 3TAOA 4O15A 1OJXA 2DSZA 3WLLA 5HPOA 1T5AA 4JTLA 3MC5A 3FXGA 1TPEA 1QW8A 3PZ9A 4FNPA 1BG9A 1YQZA 3JZEA 4PUJA 5I3GA 4B3ZA 1RBAA 1VBJA 4H4TA 3FGCB 3T44A 1UPPA 1DEDA 3W7NA 5GPRA 4I9MA 1SJCA 3SN4A 1S2WA 2OYKA 1ZXIC 2ACSA 4LS1A 4UFKA 2DZTA 2Y24A 3AYVA 1GJUA 2VUNA 2C16A 2NT1A 1KNWA 3TQPA 4GNVA 1KFCA 3ITGA 1RD6A 4GJJA 4X2RA 4NT0A 3CGEA 1N8IA 6TAAA 3RG6A 4FNQA 1RVKA 1Z48A 3PAOA 3MO4A 1H3GA 5CGQA 2W5FA 1GQLA 4X0NA 2C3DA 1DJXA 1PX8A 4K7VA 4XSLA 3DG7A 4ZXLA 3V0UA 1UH3A 1AK5A 2HRWA 5LIKX 1A0EA 4WJ8A 4GUHA 4J35A 4YHGA 2XHYA 2J13A 3IJ6A 1OK4A 3BLOA 4ML4A 3CXOA 1G1YA 2A3CA 3AYSA 2GRTA 1CIUA 1C8XA 3LMZA 3RM8A 3T1GA 1YQ2A 2XSBA 2EXOA 3VDBA 1UP0A 3LPOA 5ECVA 7CGTA 2YDSA 1BRLA 4HNLA 3TTYA 4C6BA 2GGIA 3S5SA 5FJTA 5I02A 4QNWA 2J25A 2B7PA 3O0FA 1MZRA 4ERIA 4LAKA 2MUCA 1QBBA 4DWSB 4OUEA 3GTIA 1E6SM 2EG7A 2BXVA 3W7OA 1HJXA 3W2MA 1S2UA 3F4CA 3WF2A 3RLUA 3AMKA 3RM4A 1ONRA 3TN3A 1NELA 4NEVA 1JROA 3VIPA 2ZA1A 4QLKA 1TX2A 2FJKA 5A1AA 4GXWA 2DVXA 2ZDSA 5G4HC 1JDCA 5AOUA 1ELSA 2CZEA 3VINA 2FJUB 1EOMA 1MO9A 1UW9A 1UR4A 3KE0A 3CHFA 5I3HA 1V6XA 2FH8A 1CGYA 1JCMP 2Z29A 3AIQA 3O3RA 1SMAA 1WBJA 4M52A 2DQXA 3OG3A 3W3OA 2ZICA 3EEGA 3TMLA 1F61A 1Q4WA 4WF7A 3W2LA 4FNTA 1KFKA 4RZ6A 4HK5A 5ABFB 4L6HA 2GDQA 3T2QA 3RX3A 2Z0IA 3A13A 2B0MA 2R9ZA 4HD5A 4YMZA 1J8VA 1V79A 4QR6A 4FZIA 2PODA 4O19A 3R89A 4RZ5A 2RHGA 2VP8A 2J7GA 3CLWA 1BWKA 2ACUA 2XU2A 3WH6A 2WWDA 4JTFA 5LGZA 4CNSA 1FXQA 1KBBA 3H55A 5DFAA 2HNEA 4NVTA 1X1NA 2DW7A 3URQA 3W7JA 1BYCA 4F79A 3H7RA 2EG6A 4WKHA 3F5LA 5I3KA 4JFWA 2VFFA 3IV3A 4S38A 1IE7C 3K8KA 3L5LA 2OEJA 2VC5A 5CC6A 3M0MA 2FH6A 4H04A 1DWGM 4L5ZA 6REQA 3WLMA 4UOZA 2ESCA 3NQBA 2XYLA 5AZ0A 4AY1A 1TMLA 1F76A 1C92A 4QFUA 5KEZA 1CLVA 2VZUA 4K39A 2QCDB 2B4GA 5A6AA 3MUZ1 4IMEA 1PX4A 1FWHC 4EACA 1MW1A 3GTFA 2NV9A 5K4ZA 1TPB1 1A5BA 3QYQA 4HA3A 1R5YA 4YTRA 3SCSA 4QM1A 3MPGA 3W24A 1BHGA 4DBWA 1FH8A 2DZVA 2G4FA 5DN1A 5C9ZA 4REQB 4J2PA 3GWQA 3W7GA 3ABRA 3TC6A 2YA2A 2VT0A 3T0DA 3LV5A 4H9UA 1F73A 1JRCA 4MF4A 1B31A 4OOUA 4GO9A 3V35A 2VCCA 4E2VA 3QVQA 5A8PA 5E5CA 2FHBA 3ABXA 3U48A 4R9OA 1ZP4A 3A5FA 2OLAA 3ES8A 2PLCA 3GDLA 3WLHA 2YLLA 4MJZA 1N7KA 4IPLA 3L23A 1XC4A 5J5RA 1GK8A 2PDHA 4G8TA 3LCLA 3LHTA 3G77A 3U7VA 3NQVA 5GQBA 1W1A1 1IWAA 4JIEA 4PCPA 3W75A 5EY5A 3KRZA 4KRUA 1OYCA 4JDRA 4Q8QA 2OO6A 2W66A 4LAZA 1YX1A 3V75A 1KRAC 1BKHA 1W31A 2ZZ5A 4R7OA 4PRRA 3EDKA 4HPXA 2YLAA 1IR1A 2G41A 4H4ZA 3SW6A 1XRSA 1G5AA 5T9CE 2J7HA 3WBYA 2PTDA 4F8XA 4JKKA 1CBGA 4O13A 2GK1B 4N4PA 1N63C 4M19A 4ZOEA 3VNZA 2NQLA 4H50A