4AZ6A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
435
structure length
435
Chain Sequence
SHNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 175
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az6A01
3BMWA 4KGLA 3VGDA 3ALFA 2XJ7A 1WPCA 2WCSA 2QHAA 3VGEA 4AZ6A 4BZYA 1C8XA 2J7FA 5A94A 1W3KA 4WSKA 3MANA 3T0DA 1QHPA 5FOOA 2UWFA 2WYSA 3IAQA 4PMOA 3ARTA 4J3XA 1AVAA 1J0HA 3W53A 5C71A 4YHGA 1GZJA 4OOZA 3KL3A 2HVMA 1TUXA 1R8LA 3VUPA 1XSKA 1AQHA 1LL7A 4M29A 3VNYA 1MFVA 5LYRA 3W6MA 1ISWA 2FHCA 4MNKA 3VKKA 1VEMA 2PF0A 1H2JA 1A3HA 3WENA 1CGWA 1V6XA 3WQ5A 4UCFA 2XVPA 2CBVA 4GQQA 4AMCA 3MUY1 3AZTA 1EOKA 4H41A 2YDRA 4ZXOA 2E3ZA 3CZLA 4TVUA 3VD3A 5AC5A 3OGRA 1CGVA 3N1AA 2ZUNA 3VINA 4JFSA 2V3DA 3UG3A 5M03A 4MDPA 4NSBA 2XVGA 5I2UA 1DWFM 1HVXA 1MQPA 2QV4A 1JAEA 4CUCA 4JKKA 2VR5A 1JGIA 2E40A 4P7LA 1MWOA 1E55A 1VBUA 2YDSA 1PAMA 4P8XA 3VMPA 5ABFA 2WZEA 3ZM8A 4DWSC 1V08A 3OG2A 2C0HA 1L0PA 3HU7A 1V02E 3ARXA 3N18A 3FW6A 1C7SA 1VBRA 2G3MA 2W92A 1TCMA 4BQ4A 1UD2A 1JF5A 1UG6A 4RL3A 5EFDA 3GXIA 2YOCA 2PI6A 3SCPA 3GNPA 1UD5A 2VQUA 3ZJ6A 1TE1A 1KB3A 4UFIA 3TA9A 2BHZA 1OB0A 1JDCA 1BGAA 1CXLA 2WCAA 2Y8VA 1UD3A 2J77A 3WUGA 1VIWA 3KZSA 1O6IA 2ZXQA 4WF7A 3AHTA 2EBNA 5I78A 4M56A 3W6LA 3GNOA 3WDQA 2DPEA 2VVNA 3OLDA 5D9NA 3TTSA 4W85A 5AY7A 1E3XA 1KXVA 2VRKA 5ABFB 2BHYA 2XG9A 3IJ9A 2JFEX 3WH6A 1LWJA 1ZB5A 1Y7VA 4J27A 2WWDA 1HJWA 4JL2A 3S6TA 1HF6A 2VOTA 1B3WA 2ZUSA 4MDOA 1D2KA 1R86A 3G6LA 4D6FA 2YA2A 3AJ7A 1GJWA 4CN1A 3VD4A 3O6AA 1UH2A 4QCEA 1A47A 2W91A 2RGLA 3DC0A 5D4YA 1LJYA 1OGGA 4IISA 1HKJA 1UUQA 3B8SA 4GO8A 4OUEA 3SUTA 1KFWA 1NOUA 1W9BM 4W8BA 5JBDA 1HJQA 1UWSA 2W63A 5HNNA 2YA0A 4GPNA 2W66A 5GNYA 3CHDA 2F61A 2DH2A 1J0IA 1XHGA 4NF7A 3OGVA 5I3DA 2Z1SA 1E0WA 2DSKA 2ZE0A 3NSNA 2GJPA 2WSPA 3BLKA 5A6BD 1TVNA 3POCA 1KCKA 1X6LA 4CD8A 1FP8A 3CH9A 1K9FA 3AXIA 3PZNA 3W26A 2VX7A 2DT3A 3SCVA 2ZX5A 1CXKA 4MTVA 4N0RA 3VIJA 3SCQA 1ZBCA 4X9YA 1GOMA 4LXFA 1LL4A 1VRXA 4GIAA 2ZXAA 5CG0A 1B30A 4B3LA 2X1IA 2MANA 4UR9A 5HDRA 1HJUA 1MW1A 2ZUUA 3ALGA 4ZE4A 4GKLA 2UY5A 3AMDA 1QPKA 3CO4A 4F79A 3UESA 1WDQA 4H04A 1VJZA 4J3SA 4J3VA 4PMXA 4MAZA 4AD2A 1KR1A 2D3NA 4H8HA 3AS3A 3VIGA 2PWFA 3GBDA 3KL5A 1I1WA 1HT6A 3SCOA 1MFUA 5D8ZA 3AQUA 2Y5EA 2JIWA 3AYSA 3RM9A 4BQ2A 2J79A 4KGJA 4HZ6A 1RP9A 1CWYA 5ECUA 3M6DA 1BFNA 2BHUA 4D6DA 1VFFA 3U7VA 4Z2IA 4OJYA 5IFPA 2BY2A 4F9DA 4AIOA 4HA3A 3B9DA 4U2YA 3D3AA 3WD1A 2WC3A 4AIEA 3GBEA 4UQBA 3DHUA 4QP0A 2CESA 2O9OA 2D20A 4ZENA 1WZKA 9CGTA 1HJSA 5ABGA 1E0VA 1SMAA 2WVUA 4JFVA 1KXHA 2PBGA 1BYDA 1B9ZA 2VZOA 5BXSA 1HP5A 2J75A 1DWIM 3K1DA 1BAGA 1JZ4A 4ACZB 2JEPA 3BAYA 4PCTA 1EO5A 3F5LA 4ZE5A 4KRUA 4HA1A 1CGUA 3MMDA 1HL9A 4CU8A 2PWGA 3L4YA 3CMJA 1ITCA 3ARRA 1M03A 3EDKA 1V3IA 1CENA 4H7VA 2YL8A 4AZCB 3VIFA 3CBWA 4W86A 3VOCA 4LGXA 4OBRA 5I0DA 4Z2HA 2DSZA 2EPNA 1PX4A 4JHZA 3MUAA 2IUZA 1E6SM 1QBBA 4CKQA 1FFQA 5BXRA 1J10A 5A6AA 3PZVA 1PPIA 1XCXA 3GM8A 2VNCA 3W0KA 3UG4A 1Q6DA 4FLSA 5A8QA 5A69A 3WUFA 4P7OA 1GOIA 2W4XA 3N13A 2D23A 3D5HA 4PEEA 1JZ2A 3AXXA 2FH8A 1FOBA 3FNDA 3MUIA 2A3HA 4Z2LA 1JNEA 1XD0A 5EMYA 1AMYA 3CUJA 2WMFA 1C7TA 4GI9A 3WDJA 5A6KA 5A95A 1FH7A 1TFVA 3WFLA 3ARQA 4P8WA 2EPKX 2JE8A 3RM4A 2YBTA 3L4UA 4H8VA 4DUXA 3U7BA 2ZX7A 4NRRA 5CXPA 2W62A 4W88A 1W3LA 1KBBA 2G3JA 1WZMA 1WDRA 2XPKA 2J47A 2XFRA 4U5KA 1UQYA 1BSIA 3OZPA 1BQCA 2OWWA 1X1NA 1O7AA 1OM0A 4QLLA 4HOXA 3OGSA 3WNPA 4AIUA 2F2HA 1E56A 1HJVA 3SUUA 1UWTA 3PZGA 1J0ZA 1N82A 5CJ5A 4BQ3A 2YLLA 3NCOA 4GINA 3PTQA 1ZL1A 4FK9A 1VFUA 3N9KA 1LF1A 1H49A 3A6OA 3W4RA 1QNPA 4KWUA 5JIWA 1E4IA 4P7NA 4ACYA 4UTFA 4M82A 5M17A 2A3EA 3UERA 3TTQA 2VRQA 2ZUWA 3EMCA 4BCEA 1FHLA 3UR8A 2VZSA 4MNLA 1IZJA 3VIHA 4JZ5A 5DEZA 2OO2A 2DIEA 1M01A 1W9DM 2W5FA 1EDQA 5I23A 3O9NA 3MS8A 4D71A 4DWSD 4XV0A 2BXZA 2CBUA 4D6JA 1H09A 2FHFA 2X0HA 4HMDA 1V3JA 3FXYA 1JYXA 4R27A 4GI8A 3BAWA 4U31A 1CXFA 3VGFA 2VVSA 5I77A 3PTMA 2WHLA 1UKOA 3BLPX 2EPLX 1SFSA 1US2A 5I5RA 3MU7A 4W7VA 4UFMA 1WAWA 2V5DA 4EK7A 1I75A 3WF2A 1WCGA 4RE2A 3GZAA 1XRVA 3BH4A 4E2OA 1JD7A 1HKMA 5A8PA 1G01A 1DWHM 4B16A 5JBFA 1JDAA 3QGVA 1D7FA 2WLYA 7CGTA 2W67A 2G41A 2WMIA 2VZUA 1M7XA 1B3VA 4RE4A 3VIOA 2ZXDA 3VMOA 2GFTA 2OSWA 5GPRA 2OYLA 5A6BA 2Q8XA 3J7HA 1W9UA 3L4TA 1CLVA 4PSPA 3GXDA 4AZ5A 2D1ZA 1KXTA 2PB1A 3VIPA 2WHKA 2D0HA 1V0LA 1KCLA 1R7AA 3F5JA 4RE3A 3W29A 1E6NA 1E5NA 1BLIA 1ZJBA 4B9ZA 3CUIA 3N15A 4XB3A 4DM2A 1GW1A 2X05A 2PWHA 1SR0A 4JAWA 1JZ3A 1K9EA 1L8NA 4ZEPA 2CETA 2XTKA 4BA0A 5EB8A 1ITXA 5A3HA 2YL5A 1E1FA 4HMCA 3A3HA 1W9VA 1CPUA 1W91A 1CXIA 2QPSA 1UD8A 1WO2A 4J7RA 3IK2A 4GZJA 2PWDA 3WMBA 1Q6EA 1FH9A 1E3ZA 1KBKA 1FFRA 3WH9A 1JL8A 3AISA 1J0JA 4LYQA 1VEPA 2XWEA 1DWJM 4N42A 3TTYA 3VVGA 4V2XA 3IJ8A 1J9YA 1U33A 1E15A 1VAHA 5CPTA 4Q7NA 2V3EA 3CUFA 4HU8A 3VM5A 2XFYA 1UH3A 4WLCA 1WP6A 3VDBA 3BSGA 2O9TA 1V03A 5F7UA 2XVNA 2C8NA 4UZUA 2VTFA 3N04A 4U2ZA 3WF3A 3SCNA 1QNRA 3A4XA 3CUGA 3OLEA 4OBSA 1OIFA 4XX6A 2E4TA 1MQRA 4J28A 2YIHA 4TTUA 3GNRA 3ZT5A 4IM4A 5DMYA 4JHOA 5CLTA 4D6EA 1W3JA 1JZ5A 1NWTA 3AMGA 4Q22A 5CGMA 3K4DA 2OLHA 5I24A 4BF7A 1JG9A 3WFZA 3AS1A 2GDVA 2WKLA 4MADA 4FLQA 1X6NA 2FHBA 4XZBA 4AZHA 1GHSA 3AROA 1GQIA 1UQZA 2DSWA 3VDCA 2CNCA 1Q4NX 4L4PA 1E5JA 4DM1A 4URIA 2NT1A 2D24A 2JEQA 3QOMA 4W8LA 5A2BA 3E1F1 8CGTA 1BF2A 1J18A 3S2CA 1G9HA 1HIZA 1W9XA 3AZSA 3U5UA 4U33A 1UKTA 5E0CA 1UWUA 4C7FA 4ATLA 3MO4A 2A3CA 4M1RA 3VIKA 3VDAA 4D6CA 3OA5A 1TVPA 3WD2A 1MVYA 1I1XA 2FGZA 2YL9A 3ZT6A 4HP5A 3RILA 2GJXA 5CSUA 1P6WA 3N12A 2J25A 3BAJA 4FLOA 4A3HA 3OLIA 3WN6A 3WSUA 3WH5A 4CD6A 4UOQA 1TA3A 4AYSA 3ZQ9A 3SUWA 2GVYA 4JFWA 3MUZ1 5KEZA 1UR8A 5E0FA 3A4AA 2JALA 1R85A 3FY1A 1QI5A 1QNOA 3K4AA 2WHMA 2WWCA 4LYRA 2C7FA 5IHSA 4AY1A 2V3GA 1PZ2A 5JBEA 3NIYA 1VF8A 2YDQA 4PSRA 3SCUA 4YPJA 2CEQA 3MSDA 4HMEA 4TOQA 3WUBA 3K8LA 1RD6A 4XZWA 2QLYA 4GXPA 3OBAA 4PMVA 1E1EA 1WB0A 2DDXA 4HOWA 2D0GA 2ZWZA 2FH6A 3CHCA 4AD3A 4P8UA 3PZOA 2VX4A 2OWXA 4KMQA 4MJ2A 3EDEA 2GDUA 5GNXA 1XSJA 4ATDA 2CITA 2Y24A 1GOOA 1XSIA 3LPFA 4PN2A 3GDBA 4CCDA 4Y7EA 2WHJA 2PMRA 5CGTA 2JNKA 2XHYA 1ISYA 2XM1A 1H4PA 2WMGA 1C93A 5EBAA 4CVUA 1CBGA 2BS9A 2IXVA 2WVVB 3NUKA 3OZOA 2XFFA 4PMZA 1KR0A 1W2VA 4Z2KA 4UFLA 3VMNA 3RMEA 3GH5A 3VIIA 3ZSSA 4AZCA 1U2YA 1UR9A 3FAWA 1AQMA 1RH9A 1M53A 1F4AA 3AIVA 2DT0A 1BPLB 2EXOA 1JYWA 3WBAA 4EKJA 2X09A 4GI6A 3TTOA 2VJXA 5HPCA 3LPGA 5A6JA 3AXHA 3M7SA 3NYDA 1DHKA 3RM8A 3T2QA 4AD5A 4BS0A 4AD1A 1NWUA 3T2PA 3W28A 2J8GA 1E71M 1JYNA 3MV11 1C8QA 3AIUA 1K6AA 3AHZA 3HN3A 2WXDM 1YQ2A 3DYMA 3MV01 1IT0A 1GVYA 1HKKA 2AOSA 1Z32X 4WKAA 4DUWA 3HJEA 5I79A 2BVDA 3UEQA 1E6RA 4HPHA 4H2CA 1C92A 3EBVA 1JIBA 3WY1A 4PUDA 2PWEA 7TAAA 1EH9A 2VL4A 1NM9A 1JXJA 3F5KA 1W32A 4JFUA 4UFJA 3W38A 1GUVA 4TVDA 3RJYA 1E70M 1EA9C 3DHPA 4PMUA 2DQXA 2OZNB 4MB5A 5FD0A 2ZIDA 3N11A 5FL0A 3VO0A 3VU2A 1JF6A 3UG5A 2XM2A 3ARZA 2YLAA 1ECEA 3VILA 1GORA 4AEFA 2W61A 1WDSA 1E9LA 1DP0A 2D22A 1CNVA 2OYMA 3NJ3A 2B31A 1US3A 3AI0A 4CD4A 1UR1A 2Y4SA 2A3BA 4AZGA 3UR7A 1OCQA 4P8VA 2E0PA 4UQCA 3CHFA 4M81A 3FN9A 2VCAA 5BXTA 3PZ9A 2WVSA 5A1AA 3WF1A 3WELA 3U5YA 3KE0A 2WMKA 4DUVA 2EEXA 3F4VA 2WB5A 3AIWA 4M80A 1CXEA 4W93A 1H5VA 1HL8A 1DEDA 3PHAA 3SURA 3TONA 5HOSA 3AHVA 4XUYA 4K68A 1GOQA 4ZXLA 1QNSA 2EPMX 5E6ZA 2ZXBA 2DSVA 3A4WA 2OWCA 3AIEA 1WNOA 3QR3A 4W7UA 3WKZA 4PMYA 2DEPA 1JI1A 4NI3A 2J7EA 1QHOA 4MNMA 3AMCA 1VFMA 2VC9A 1C3FA 2V38A 1MQQA 2J7GA 1TMQA 1XGZA 2G8ZA 2J4GA 2VX5A 1C8YA 1Q6CA 4TTGA 1OD0A 2WBGA 4D72A 2ZX9A 5D9PA 1GPFA 2DIJA 3L2LA 2DT2A 3PZQA 4FMVA 3BAXA 3WNMA 2WPGA 1B0IA 2CERA 1XH1A 3AFBA 4PBGA 5FIPA 3AHXA 2YL6A 1OT1A 1JZ6A 3WNNA 5FL1A 2EO7A 2UY3A 5HXMA 1CDGA 3II1A 1KWGA 2QF8A 3I3EA 3JUGA 1QVBA 4GQRA 2BY3A 4AZIA 1FHDA 3L4WA 1E4LA 4P7RA 3PZUA 1QI2A 3OIHA 2WSKA 3VIMA 1B2YA 3AICA 4BQ5A 1WE5A 3WIJA 1AQ0A 5TD4A 4DWSA 8A3HA 1M04A 2BFGA 3MSGA 2CCRA 5CQ1A 1B3YA 4PRWA 5HBFA 4IPNB 1UD4A 1IZKA 4FLRA 2XUCA 3CZJA 3GXFA 2NSXA 1MW2A 1GJUA 1CEOA 3WEMA 1LWHA 2CBJA 3CUHA 5ABEA 5CLWA 1EQPA 3WD3A 2QPUA 3ZJKA 2J7DA 1ISZA 4NZCA 1JNDA 3WH8A 4UOZA 3IAPA 2J62A 2EJ1A 3VX1A 4UOJA 5E70A 4UQ9A 1ZBKA 3WMSA 2ESCA 2E9LA 5CPSA 1PIFA 2O92A 2J7CA 3PN8A 4PMNA 3WNKA 7A3HA 3WQ4A 1RPKA 5AC4A 4AEEA 1XV8A 2VCCA 3GXMA 2G3IA 1CXHA 2GSJA 3NDYA 4UZSA 3ZOAA 4ATWA 1VJSA 1NP2A 1VENA 1VEOA 2BVYA 4HU0A 1GONA 1OT2A 3RDKA 4WJXA 2E9BA 3AMLA 1KWKA 1BTCA 1LLOA 1GQLA 3KL0A 4JIEA 1H1NA 3CLWA 4UFKA 1LG2A 4C7GA 4TX6A 3T0BA 1XC6A 3BAIA 1EHNA 1MXGA 3T08A 2WZIA 3WF4A 4V27A 2D2OA 2DGAA 4B15A 2G3NA 3CZEA 1NWRA 1UZ4A 3WEZA 1V3HA 1J11A 2GJXB 4KRTA 3WF0A 1OSEA 3ARVA 5EFFA 5CZKA 3VPLA 2XYLA 3POHA 2HISA 4F9JA 4JCLA 2IXUA 4YN5A 5LA2A 2E8YA 1RP8A 1XYZA 4MB3A 4B3KA 3ZR6A 5A2CA 3ARSA 2D3LA 3CZKA 3MMWA 2VCBA 4CGTA 2WMIB 5FKYA 5BRQA 3QHOA 4HTYA 3ZO9A 4PTWA 5JUVA 2GK1B 4M8UA 3EMQA 2J74A 3ZR5A 4HZ7A 2WVTA 2EQDA 2GJRA 3TP4A 3MKKA 4TX8A 5A8NA 4HA4A 3IANA 2VO5A 4S3JA 1NQ6A 1HX0A 3K8MA 4AC1X 3WQ8A 1VFOA 4MB4A 5C70A 1HNYA 3QHNA 1UKPA 3N17A 4QFUA 1EGZA 3B9AA 1NH6A 2XSAA 3WUEA 3W81A 1W2PA 3BGAA 1ODUA 3ARPA 1BG9A 4KH2A 4U5IA 5BYWA 2JF6A 4S3KA 3CHEA 2VURA 2X8RA 1EO7A 3ARWA 3ARYA 4E4PA 3WEOA 4DWSB 1JFXA 4CCEA 2NW0A 1E72M 3L4XA 6TAAA 1DTUA 3NSXA 5IDIA 2VZTA 1FP9A 1CECA 1MYRA 1W3HA 2WW5A 1KXQA 1Q6FA 3W25A 3O2LA 2WC4A 4TUFA 3IJ7A 3WH7A 4D6GA 3QHMA 1KGUA 1PIGA 3CMGA 3VGBA 2QMJA 3PZIA 1XH0A 1K9TA 1QW9A 4LX4A 3GYCA 2XVKA 1TR1A 2XWDA 4IPLA 4JL1A 4AD0A 4GZIA 2V3FA 4JFTA 2DH3A 1OD8A 4E8DA 4HPGA 3CIVA 2ZUVA 2GK1A 1CGXA 4FF5A 1HKIA 1BVNP 2JF7A 3W37A 4JKMA 5DT7A 3WNOA 3WDRA 1MXDA 3B9EA 3WDHA 5C8BB 5DT5A 3I3BA 1J01A 2BXYA 4YHEA 3WQVA 3CGTA 4WIWA 3WBEA 4UFHA 2ZUMA 1EDTA 3T0AA 1E6ZA 5IFTA 1NP0A 4FZPA 1GQKA 4EAMA 2VMFA 3G6MA 3SUVA 1W1VA 2O9RA 1VB9A 2AAAA 3ARUA 1XCWA 1UWQA 2PC8A 5IHRA 4H8UA 5AYIA 1OWQA 5A8MA 6A3HA 4CCCA 3AIRA 5A6LA 2ZX6A 4HOZA 3RJXA 1UWIA 1LQ0A 2WM0A 3AIBA 1UD6A 1CZ1A 1C91A 2WKGA 1JAKA 5BROA 3FHAA 3U57A 1E0XA 3RPMA 1KGWA 1V0MA 1DWGM 1UKQA 5DFAA 6CGTA 1S46A 2CBIA 3NDZA 3GH4A 1UWRA 4MNJA 1UR2A 2CXGA 2X0YA 3PZTA 4AZBA 1B1YA 1ZJAA 1QI0A 5LA1A 1K9DA 3BC9A 1OGBA 2VQTA 4F66A 4OKDA 3W24A 1YHTA 1B90A 3ECQA 4LPCA 3M07A 1PZ3A 1GVIA 2CHNA 5HPOA 1UZ1A 2YBUA 4WKHA 3HMCA 3AOFA 3CZ8A 3VGGA 1U30A 2ZX8A 1NWSA 2YJQA 3WQWA 1W9PA 1C90A 3L4ZA 3CZGA 4WKFA 3WL1A 1ISVA 5DF0A 2O9PA 2VUYA 4PMQA 3WNLA 2XIBA 3GTNA 1CYGA 5CSYA 4D1JA 1V6VA 5A2AA 2WLZA 3BSHA 4TXEA 3ZIZA 5A8OA 1HP4A 2VR4A 1OGSA 3GH7A 4M24A 1GCYA 1R7OA 2CYGA 2WK2A 3AZRA 3L4VA 1WZAA 3THDA 1GOKA 1SMDA 3AS0A 1UR4A 2WMJA 1JFHA 3SCSA 3WMCA 5BXPA 1MW3A 5E9AA 1ZBVA 2J7BA 4Z2JA 2ZOXA 4QLJA 1G94A 3RO8A 1QHZA 4PYSA 2WZHA 4AXNA 1BHGA 1HJXA 5ABHA 4EANA 1CTNA 1QI3A 2J78A 1J0KA 2XGIA 3WL0A 3SUSA 1TG7A 5LA0A 3VGHA 1V6YA 4J3TA 5CPQA 4B9YA 3ZMRA 2VX6A 2CKSA 4J3UA 2XVLA 3WD0A 4CN4A 3UCQA 2Z1KA 2BVTA 1V02A 5D8WA 2BNJA 3EYPA 2Y2WA 1CGYA 4W84A 2XGBA 2J7HA 4GZEA 3AIQA 3MMUA 5E09A 3AYRA 4OIFA 1EQCA 2OSXA 4JKLA 3THCA 4ZFMA 1E40A 4U3CA 1EHAA 3VM7A 4W5ZA 2NT0A 4NRSA 1UYQA 4D6HA 1H0GA 1JI2A 4D1IA 3AS2A 3LPPA 4MAVA 5BWFA 3AMKA 2ZUTA 4IUGA 3DECA 3APGA 2FGLA 4PTMA 4EE9A 3FAXA 1NOWA 5GNZA 3L2MA 1TA3B 4CD5A 4PMRA 4W87A 1EXPA 1D3CA 3PTKA 1GNXA 1EOMA 1XD1A 2AMGA 1HVQA 4PUEA 4R5EA 3SCWA 4OOUA 1PEZA 3RCNA 1UA7A 4W7WA 1ISXA 1HN1A 2VT0A 4CU7A 1XH2A 4PTXA 3VDHA 4AW7A 2WMHA 3NSMA 3VD9A 2WNWA 1OBAA 2GUYA 4E8CA 3DYOA 2ZICA 1JYVA 5JIPA 1V3MA 1J12A 1ODZA 3LMYA 3BAKA 2XSBA 3FHQA 1BYBA 5D9MA 1Q6GA 4F8XA 4QAWA 3RIKA 4UNIA 5BCAA 3WQ6A 1WZLA 1V0KA 2CPUA 2E9MA 4QLKA 2WCGA 1V3KA 4PTVA 2DT1A 5BRPA 1NARA 5D9OA 3SCTA 2XIIA 2A3AA 1UA3A 1ZS2A 1QBAA 2J8FA 1E73M 1BG4A 4AZ7A 3TOPA 2CHOA 3LPOA 1OINA 1SYTA 1F4HA 4PMDA 1UH4A 2WC7A 2WVVA 2CIPA 2TAAA 1QW8A 5M5DA 1TZ7A 1FH8A 2OSYA 1H3GA 3ZT7A 1QI4A 3A47A 3PBGA 3K46A 3VTRA 1E43A 1E6QM 4P7QA 1EIBA 1GQJA 2BV9A 1R87A 4V28A 2UY2A 3BCDA 2WAGA 3QOKA 4L4OA 4MJ4A 4WSJA 4CVWA 1KQYA 1H41A 1E6PA 4UQEA 1CLXA 1JXKA 3KEHA 1UR0A 1H11A 4CN6A 1EDGA 2F8QA 1BYAA 1BGGA 1V3LA 2FDMA 1XYFA 3UETA 4CD7A 1V0NA 3KWXA 4UQDA 5GQBA 3ZSTA 2OYKA 3VD5A 5A6SA 1HXJA 1W1YA 4JCMA 4X0VA 1E4MM 4WK9A 4U3AA 1DWAM 1PBGA 4A4AA 4J3WA 4W89A 1GOWA 1QNQA 3BCFA 3DYPA 3EDJA 3SEPA 5A6MA 5KZ6A 3BXWA 3OB8A 2QMKA 1CGTA 1E6XM 3WD4A 5DO8A 1G0CA 1V6WA 3EDDA 4X0NA 2VI0A 1B3ZA 4AD4A 1OIMA 1UHVA 3EDFA 4CU6A 3OLGA 2PBOA 5FCZA 1JZ8A 4W5UA 4MB1A 2DSUA 1UOKA 1W1TA 1B3XA 3VX0A 1IV8A 4OZOA 4HZ8A 1ZU8A 2X2YA 2JIEA 1MW0A 1B31A 1G5AA 1W1PA 2V5CA 1LG1A 1CIUA 2RGMA 1E4NA 1ESWA 1LL6A 1GHRA 1JZ7A 2WANA 2UY4A 1UKSA 1JD9A 1QOXA 3CTTA 4AWEA 1V6UA 3WDIA 3W27A 5E6YA 2CKRA 4LQ1A 1BVZA 4GO9A 4LYPA 3SCRA 5IXEA 3W82A 2G4FA 1WDPA 4QDMA 3PZMA 2BY1A 2WBKA 4QCFA 3VNZA 1WKYA 3T2OA 4TVCA 3I3DA 1G1YA 1PJ9A 2VZVA 5AYBA 3ZJ7A 1PX3A 3EMZA 1H0IA 3CPUA 4C7DA 5I6SA 4A3YA 1KQZA 2ZWYA 3VD7A 5M3WA 4UQAA 3ZJ8A 4Z2GA 2YA1A 4W8AA 4MPKA 1PX8A 4ML4A 4ACZA 4AISA 1FA2A 3WDPP 2VRJA 1BYCA 4D6IA 3M46A 2Y8KA 3T09A 4FZOA 1ZBWA 4PCSA 3AHYA 1KGXA 2YKKA 2D0FA 3BMVA 1J0YA 3K8KA 2BY0A 3SIMA 2EPOA 1JDDA 1NOFA 2E8ZA
chains in the Genus database with same CATH superfamily
1GTHA 3ALFA 2V5KA 5TF0A 4NPHA 4C6IA 3VGEA 2J7FA 2EG6A 4WSKA 3MANA 3T0DA 5FOOA 3NZPA 3AC0A 4WOZA 1R5YA 1LT8A 4NILA 4R33A 4B5VA 4KEZA 3CAVA 4YHGA 3QLLA 3KL3A 2ZA1A 1SO5A 3VNYA 2QAPA 3HV9A 1XLFA 1ISWA 1UC4A 2OR2A 4LVBA 4MNKA 2BB0A 1F76A 2PF0A 2I1OA 3QXBA 3WENA 3QPEA 1QNVA 2ODOA 1EWEA 1W56A 2PGWA 2PGFA 2QJNA 3BWWA 4A3RA 4AMCA 4C6BA 5HA7A 2YDRA 4ZXOA 2E3ZA 3VXGA 4TVUA 3VD3A 3DFHA 4U28A 3FA5A 1U83A 1BXBA 2I16A 2E5CA 2O4QA 1OEPA 1QMLA 3R13A 3SDOA 4F4RA 2F38A 5I2UA 4ICMA 1MQPA 1CLKA 1A4MA 1SU5A 3CYVA 2O56A 1F3WA 1E55A 1TTPA 2YDSA 4XZNX 1PAMA 4PE8A 4P8XA 1ZJIA 3VMPA 3G18A 2OKOA 3LNPA 1P0DA 4HY9A 4K37A 2C0HA 3TK7A 4D2JA 1R3QA 1S1PA 3KRSA 3R11A 3HU7A 1SZNA 3QSRA 3ARXA 4A2SA 1VBRA 3UFYA 1NFGA 1LCOA 5IRPA 2W92A 1I6NA 1TCMA 3DFSA 1UG6A 3UA4A 3L2IA 4I9TA 4BQ4A 4CNOA 6XIAA 5K7JA 3V16A 3SCPA 1SU6A 1EKOA 1AZ2A 2VQUA 4C5YA 3L3PA 1TE1A 1KB3A 2H8XA 4ML9A 3EJTA 1TREA 2F2KA 3FYYA 4LAZA 4A05A 1BGAA 2V67A 1CXLA 2WCAA 4E3VA 2J77A 1VIWA 3DERA 3KZSA 2EBNA 5I78A 1Z42A 3W6LA 1V7AA 1IT8A 2DPEA 4GBUA 4MSSA 1GZGA 5AY7A 2QAFA 2VRKA 2IQTA 1Q5MA 4F0LA 1DBTA 4J27A 4TV6A 3DBNA 1VCFA 3G0XA 1B3WA 1FXPA 2ZUSA 3HGOA 1MNZA 4MDOA 2WM1A 1D2KA 1GJWA 4QCEA 4GIEA 5H8UA 2RGLA 3DC0A 2PE4A 3W2NA 1LJYA 1OGGA 3ES8A 1NFPA 1DIOA 4DBSA 4HMNA 3W1UA 3JRKA 3VZXA 4A35A 5K3VA 3SUTA 1DE6A 2I17A 5EMJA 2X41A 1HJQA 3DU0A 5HNNA 1XXXA 2YA0A 4K39A 4GPNA 3C2EA 1JCTA 3CHDA 1R34A 1TB3A 1XHGA 5KITA 3OGVA 3BANA 2ZE0A 3NSNA 4AUBA 2DZBA 3HO8A 1X6LA 3L5LA 3PPFA 4LUTA 4GHRA 5G1MA 3A4JA 1EJUC 3SRDA 3E9AA 3DN5A 2DT3A 4XD5A 3V5FA 3Q37A 4GIAA 3OHXM 2RAKA 4LUSB 2X1IA 2MANA 3AWOA 1MW1A 3AMDA 1QPKA 3CO4A 3GIPA 5KINA 4F79A 3ZZ1A 5LNVA 3L68A 4HNLA 4R3UA 3UESA 3VEAA 7REQA 3LDVA 4J3VA 4JIPA 1KR1A 3VIGA 1RQHA 3FGCB 2GQAA 3R0UA 3R94A 1I1WA 4DHGA 1MMFA 3AYSA 5LGZA 4BQ2A 1ZWWA 4FA3A 3MDWA 4JY9A 4Z2IA 4JD4A 2BY2A 4F9DA 4AIOA 4AIEA 1TWIA 2Y88A 4JIQA 3K2GA 3MP3A 2O9OA 1WZKA 1O12A 2A4AA 2Y7FA 4RJEA 4R7OA 4MUZA 2VZOA 4F0RA 1DVJA 2J75A 3MMTA 3QZEA 4NASA 1AZ1A 2I9EA 5G2IA 5MKGA 4KRUA 5FEPA 4S3EA 3MMDA 4O1FA 4O19A 1VFHA 4GISA 4H01A 2YXXA 3ARRA 3EDKA 3M0YA 1FCBA 3T48A 2VWSA 1BD0A 3T4WA 5C9UA 3M4HA 3VIFA 4NG3A 4ZOCA 3WLMA 3A5VA 5I0DA 1I4LA 2DSZA 3WX7A 2EPNA 1PX4A 1TQJA 4FXRA 3KM8A 4QBXA 1PPIA 1XCXA 1FTXA 3ACOA 4LAOA 3TJ4A 4P7OA 5I09A 1ZLPA 2W4XA 3EA2A 3DPQA 3D5HA 4ZO9A 4PEEA 1DOSA 1ZTVA 3AXXA 3U48A 3H70A 2Z0VA 2FH8A 4I9MA 2GA9D 3CT2A 4OHQA 1XD0A 3LRMA 3NURA 3CUJA 3M0LA 4GI9A 3WDJA 2ACSA 4XZLX 5A95A 3F2CA 4HNCA 1IXNA 1FH7A 2WO5A 5F2LA 3WFLA 4OT7A 4LF1A 4Z0SA 3CB3A 4YCPA 3GC2A 1DJZA 3QW4B 2B7QA 3ONBA 4HIBA 2AKZA 3PPHA 1SZEA 3U7BA 4NXSA 2ZX7A 3P81A 1VCGA 1WXYA 3O7UA 1B5TA 4O1EA 2G3JA 2XFRA 1EYEA 1J4EA 4IQDA 3RCYA 1VBGA 1BQCA 4ZOBA 5HJXA 1X1NA 3U2EA 1O7AA 1OX4B 3KFTA 3PP7A 4IPIA 1SZFA 3OGSA 1H7PA 4A21A 3OZMA 2F2HA 1E56A 1YW1A 3SUUA 4PUMA 3PZGA 4UNKA 4BQ3A 2Z8YA 2YLLA 3NCOA 3UPMA 1HL2A 1EB3A 3B06A 3TH6A 4XSMA 2Y7DA 3MB9A 4JL9A 3A6OA 3D52A 3BLOA 3B4YA 4KWUA 1GNTA 5F4WA 1E1DA 3RG6A 4P7NA 5C2GA 5FJTA 1MUWA 4QX4A 3NPXA 3TTQA 2ZUWA 3EMCA 5LSMA 1WV2A 4MNLA 3R8HA 3VIHA 2QV5A 3KVMA 1LZOA 3IRSA 1UJPA 3W75A 1MRAA 1M01A 2W5FA 2V82A 2VFFA 1W54A 5HNUA 3MS8A 1LP6A 5KSWA 1QTWA 4D71A 4PB5A 4XV0A 4FZSA 3PAOA 2PURA 4EAYA 3DPOA 1A0DA 4I8YA 1L6GA 2GPTA 4E0CA 1V3JA 2IQ0A 3FXYA 5CBBA 2ZA2A 3CMFA 1DHPA 4R27A 4XAZA 3BVXA 4U31A 1CXFA 3VGFA 3PTMA 4JTFA 3ITYA 3BPWA 3NA8A 2G5WA 1US2A 3UZYA 2J66A 1QR7A 1CT5A 3SB0A 1KCXA 4UFMA 2RJGA 3WF2A 4GQ0A 1WCGA 4FEZA 3KBMA 3GZAA 3I39X 5A8PA 1DWHM 1B57A 2Y7EA 2EX3B 4EWND 4O14A 3QGVA 1D7FA 1YPFA 1PZ0A 1B3VA 1QK2A 1F3EA 4QS6A 2OYLA 2QPXA 2Q8XA 3CWOX 3EXTA 3ZLHA 4AZ5A 2VR2A 4QQUA 2WHKA 1V0LA 1KCLA 1S38A 1E5NA 4O28A 2PLCA 4XB3A 3UQNA 1AJZA 2PWHA 3EPNA 4KW2A 1I4DA 1K9EA 4DEFA 4NJKA 3UR5A 4V15A 1JCNA 1TIMA 4ZEPA 1X03A 1W31A 3ABQA 4L9ZA 5EB8A 4EZRA 3S1GA 2YL5A 4E2BA 4Q8WA 5HINA 2QIIA 3QKEA 4JEJA 1GVRA 3F4WA 4FHAA 4OWGA 1G69A 1W91A 4R5LA 3ABRA 2BMBA 4GWEA 3EB4A 3R8RA 1WO2A 3KS6A 2LXYA 3ZR4A 3WMBA 1E0TA 1KBKA 1FFRA 1PE1A 5L9FA 3EB3A 3D46A 4N42A 4DWDA 2NCZA 3F4NA 2TYSA 3IJ8A 4Y2WA 4M6UA 1J9YA 3I7QA 1U33A 3TW7A 1VAHA 2V3EA 3LM7A 1P1MA 2XFYA 4WLCA 1P0EA 1PL9A 3BOLA 1BSLA 1H61A 3GHTA 4S3GA 3EB2A 2ZKMX 1V03A 2Z28A 5F7UA 1REQA 4IQLA 3B51X 4GRSA 5D2YA 2C8NA 4B92A 3WG6A 4U2ZA 1U1HA 3RLHA 1PDZA 1EP2A 1EJXC 4OBSA 4XX6A 3L5AA 1GKQA 4J28A 3L3OM 3K4WA 5DMYA 3KDRA 2B7PA 1SO4A 3VNDA 2QULA 3MC5A 5CLTA 1B4KA 1Q13A 4D6EA 3AMGA 3H12A 3TXVA 1ZAJA 4Q22A 4H8SA 3K4DA 3L7RA 4OFCA 2Z1WA 3U9IA 3VKCA 4GGBA 3OBKA 4MADA 4FLQA 3W74A 2E6FA 1ZSXA 4IX0A 4UTUA 3UPWA 3WLHA 3AROA 2QUTA 2VC7A 2DSWA 4H00A 2CNCA 1ZP4A 1X1OA 4JTSA 2VM8A 3QY7A 3BZGA 4URIA 1ML1A 4PBEA 2D24A 2I5GA 1TE6A 5F4XA 8CGTA 1BF2A 1J18A 1G9HA 2KAUC 4IUOA 3AZSA 2CLPA 4C60A 3U5UA 3TSBA 3HA1A 1T7LA 2FVKA 2PDNA 4ATLA 3STEA 1KFJA 3LCFA 1UBPC 4M1RA 3OVGA 1GOXA 4PB4A 3OA5A 2GDQA 2VC5A 1ZFJA 3WD2A 1MVYA 2FGZA 1HG3A 4Q8VA 3NXLA 4NUWA 1P6WA 3UXAA 4H7CA 4NYUA 1LOQA 3HQPA 4NJJA 2GVJA 4GI4A 4G7FA 3PY2A 1YTKA 4AYSA 4X61A 3SUWA 4CQDA 3URQA 4JFWA 2J6XA 1D7KA 3UYCA 1QCWA 5E0FA 3T05A 3KCOA 3AU2A 4LFYA 2ND0A 2WHMA 4LYRA 5IHSA 5LZLA 4OE7A 2YDQA 1TZZA 4TOQA 3SAZA 4KT2A 1A5CA 5HNTA 3PK7A 2Y5SA 4PMVA 1E1EA 1WB0A 4EACA 2D0GA 3NZRA 2FH6A 3PZOA 2VX4A 5C9ZA 3K5XA 4N02A 2NQ5A 4WY0B 3EDEA 1L8PA 4OV4A 5GNXA 1F5ZA 2CITA 4PL1A 4PN2A 4IL0A 5AC6A 4Y7EA 3W7OA 5GVJA 4X60A 1AD1A 2PMRA 2XHYA 4GQBA 2FIQA 1OZQA 5D2WA 2WMGA 5HK4A 4KKXA 2IXVA 4AWTA 1RLDA 2XFFA 1TQWA 3ATYA 3N3TA 4LOCA 4UFLA 1QWKA 2PDIA 3RMEA 3ZSSA 4AZCA 1UR9A 1EBHA 3BJFA 3NPUA 3AIVA 4IMGA 1TJPA 3NM3A 3L0GA 3PS7A 4EPKA 1O7DB 4UTWA 4UCGA 2NUXA 5BNKA 1EBGA 4YTUA 5A6JA 2LM0A 3IWPA 5CC5A 3OU8A 3GQYA 3RR4A 1LWIA 1LRQA 4HHPA 4AD5A 1OABA 4BS0A 2ATMA 3W28A 1C8QA 1OY0A 2NX9A 3AIUA 4E2VA 3DYMA 3LQGA 1WXZA 3MV01 3C56A 3O06A 3CNYA 1P43A 1XPYA 1E9YB 3S5SA 4S3BA 4HPHA 1C92A 2RUSA 3EBVA 3WY1A 7TAAA 3GVGA 2N3KA 1RBOB 2VL4A 3UF9A 1JXJA 3TZFA 4JFUA 4Q8TA 4TVDA 1E70M 3QRHA 3N14A 2A21A 4JTIA 1ICQA 3VO0A 3VU2A 1A5KC 1AFSA 4UDYX 1F61A 2WJEA 1G4EA 4NJIA 4C6MA 2OYMA 3NJ3A 2B31A 4LV9A 1UR1A 1GKPA 2A3BA 4AZGA 3UR7A 3CHFA 4M81A 5HMDA 2P53A 4DYJA 3PZ9A 2XFWA 1AH0A 3WF1A 2EF9A 4RXGA 3KE0A 4IGSA 1XIMA 1SFLA 3PUDA 1IWPA 3VC5A 2ZZ7A 4H6RA 4ERGA 1DEDA 3MWAA 4IM0A 2CLHA 3PHAA 1G7VA 3RF9A 1AMKA 4PC8A 3YPIA 4G9PA 4F48A 3R0DA 1XQLA 3B8WA 3QR3A 3WKZA 3P82A 4E8GA 1P48A 2LLEA 3LBCA 3NQMA 1S39A 1V93A 1W5PA 2G0WA 3MCNA 2DY3A 3R79A 4MUPA 3I65A 2ZX9A 3F2DA 3NDOA 1B54A 3LGDA 4FMVA 1X96A 3WNMA 3VNJA 4FNRA 3U4AA 4QS5A 3WNNA 2EO7A 4Q4QA 1UW9A 3G77A 4LWWA 5HXMA 1Y65A 2XIQA 3TLQA 3I3EA 3JUGA 3URNA 4QJ5B 1FHDA 1YE4A 4GNVA 5HMSA 1M7OA 3AICA 2AMXA 4GYKA 4BQ5A 1UPMB 3GW3A 1Q63A 3NYZA 1WE5A 1IYXA 4XBSA 8A3HA 4FOUA 2R9RA 3GWQA 5CQ1A 2Q6ZA 4KCUA 1RY0A 3RO6A 5HWMA 3W1QA 4LALA 4IPNB 4K36A 1F2JA 1IZKA 1PUDA 5TKYA 2QDDA 3GXFA 1W8GA 2D69A 3LRKA 1D9EA 2PEVA 1CEOA 3UWQA 3LTPA 2FMNA 4J9JA 2QCGA 1W1ZA 3CUHA 1M65A 5ABEA 3TOYA 3WD3A 2QPUA 1CX9A 2DZSA 3GR4A 3SRKA 1JNDA 1I49A 5DCEA 3WH8A 3G8RA 2EJ1A 1QXLA 5I3HA 3D51A 4GIRA 3ATZA 3CU2A 3QMSA 1XLKA 4NXKA 4NZ1A 3WMSA 3KCJA 3CIWA 2PLKA 4LAKA 4C5ZA 4MY8A 4H9ZA 1AH4A 5AC4A 2I9UA 1KFKA 4Y9MA 2Y63A 2GSJA 4UZSA 3ZOAA 1VJSA 4ZO7A 3UWZA 5CC3A 3QN3A 3LCWA 1N8FA 1OT2A 3RDKA 2E9BA 4GNKB 3CH0A 2PUZA 1U5VA 4HSOA 4GVFA 3ITXA 1GQLA 1GG0A 2FLIA 4TX6A 1IEVA 1M68A 3T08A 2PDFA 2WZIA 3WF4A 3WLRA 4V27A 1DJHA 1LRNA 4QISA 3WEZA 5KBPA 4KFPA 3QQ0A 2EFKA 4HR1B 1XPGA 3W02A 3WQDA 5HR6A 3SOGA 3CV5A 2ZRZA 1WBHA 4UTTA 3POHA 2HISA 2P88A 4KF1A 5FAGA 4JCLA 4YN5A 1TQXA 1EEXA 5CPOA 4QJ1A 4LEFA 3KBJA 4DXVA 2G37A 2WJFA 1YDNA 2Y70A 2DZAA 1B9BA 3QHOA 4KCVA 2Z2UA 3CZSA 1W6TA 3FKKA 3E0FA 2GUUA 2J74A 4DF2A 2F7OA 2TMDA 1XYBA 1QWUA 2NQHA 3QYQA 5A8NA 3PANA 1WA3A 1S2UA 3ME3A 4LS0A 3MI2A 1IIGA 3R58A 1N8WA 4EZPA 3ER8C 3EX6A 2GOUA 1HNYA 1UKPA 5EY5A 3DFQA 4MYAA 1EGZA 1WOBA 3W2KA 1JUBA 1R3SA 1QWNA 1YXDA 4BNEA 4AHQA 3W7GA 2WOQA 2V30A 2WZTA 3IIXA 1EO7A 3ARYA 3GXTA 3VKAA 4Q4RA 1JFXA 2C91A 1YXYA 2OLAA 3L4XA 3NSXA 1TTIA 2XU2A 4GJ1A 4XTIA 1J8VA 2WW5A 4F0MA 1YTDA 2J6VA 4D6GA 1PIGA 3CMGA 3FGCA 3VGBA 4DX3A 2Y7GA 2YI9A 2QMJA 3R8GA 4D9PA 2QEZA 4LX4A 4NX0A 2DVXA 2XWDA 3Q58A 3EJSA 2V3FA 1XLBA 4E8DA 4HPGA 2GK1A 1KTBA 1OCBA 3GVQA 2GGIA 2ZC1A 1HKIA 5U7SA 3TNBA 2JF7A 1XLCA 5H6HA 1XLDA 3WDRA 3P8IA 1XRFA 3B0YA 4WQ6A 3OVPA 4C6NA 4YHEA 1O5KA 3R5EA 3CGTA 4XIAA 2ZC8A 3LCLA 2ZUMA 2RDUA 1X8CA 1VBHA 4Q4SA 3T0AA 4NNBA 4C6DA 3FYOA 1JPMA 4M6QA 4FZPA 5ABTA 1GQKA 1TQUA 1EJRC 2VMFA 3G6MA 2BZNA 2O9RA 3TVAA 1X97A 1PB0A 1PCWA 4H8UA 1I2OA 1OG6A 6A3HA 3VE7A 3TC6A 2WM0A 4Y6GA 3DPPA 3CT7A 4GD0A 2BOGX 4HGXA 1ZJHA 4A3QA 3FHAA 3W7NA 1W3NA 3O6CA 2I57A 3GH4A 4QE1A 4MNJA 5DMLA 2B7NA 4EZVA 1KRBC 3CWHA 3NXFA 1ZAHA 4AZBA 1ZJAA 4FX6M 4J35A 1QI0A 1JUEA 5LA1A 4XZMX 1OGBA 1EJ7L 4AX7A 1TWZA 2BOFX 1B90A 4WPCA 3M07A 2H3DA 1JVNA 1KM3A 2CHNA 2VEPA 3KBNA 4NT0A 4REQB 1MRQA 1W17A 2FTYA 1P1XA 3VGGA 1OC6A 3P8JA 1W9PA 1BXCA 3CZGA 3GIQA 3N6JA 4FAMA 2VUYA 3LCGA 3PBYA 1CYGA 1XUUA 4JN8A 3HQNA 1EP3A 5A2AA 3NQFA 3BSHA 1RR2A 4TXEA 2F1AA 3TJXA 3E0VA 3SY1A 1VPYA 4ADTA 3VDGA 3QQ1A 1TJ2A 3GH7A 4ADUA 1X38A 1IGWA 3NEHA 3A3XA 1YPIA 4IQJA 1GOKA 1P7TB 1FWEC 4C65A 3W7PA 3MPGA 5AC7A 3NEVA 5AHEA 4HJFA 4EXQA 2VC6A 4Q6XA 1LBLA 1ZBVA 1YNYA 1UUMA 4H19A 1G94A 4FR1A 1QHZA 4PYSA 4Z1YA 3C2VA 1CTNA 2F1BA 1J0KA 3FSUA 3SUSA 2OJPA 4L6DA 4AY8A 4JYFA 1TX0A 2WKJA 1V6YA 4K7VA 4J3TA 2CLOA 4B3ZA 4CN4A 4HN8A 2Z1KA 4X2RA 5D8WA 1H7WA 4KIKA 1CGYA 4EX4A 2QFFA 1XBVA 3AIQA 3MMUA 2JGQA 4FS9A 5HJLA 5EMKA 2OBMA 3W1XA 1XJBA 3DAQA 1E40A 3GTFA 3N25A 5LXXA 3GK0A 2UZ9A 4U3CA 2NT0A 1UYQA 1H0GA 6ENLA 5HUOA 3DFNA 3M0HA 3LPPA 3DHFA 2TSYA 3PWIA 3T40A 4K8HA 4S39A 4PRTA 4KQNA 2FGLA 2OX4A 3FAXA 3L2MA 3TCEA 3U3HA 1TA3B 4H9YA 1JEZA 2VD8A 4PMRA 1EXPA 2VD9A 1XD1A 4R5EA 3RCNA 1BVWA 1MI3A 1UA7A 4M5PA 5SWUA 3THUA 1HN1A 5FEWA 2GYIA 3QV6A 3L67A 5LNUA 3Q4DA 2W3ZA 2RAGA 1UJQA 4GY0A 1ODZA 3LTYA 4LH8A 3LMYA 4KWWA 3RX2A 3FHQA 1O94A 3O15A 4Y8EA 2OQLA 3L12A 2JNSA 3LLDA 3WQ6A 5BCAA 3LBOA 3DI1A 1WZLA 4O1DA 5BMXA 1TV4A 2E9MA 3BG9A 4QLKA 4PTVA 5HUPA 4L1XA 2NV1A 5D9OA 3V7PA 1DTNA 1OFDA 4F0KA 2IKGA 1AK5A 3JZUA 1ZS2A 4AQLA 1QBAA 2WSQA 1Q8JA 3RX4A 2G4JA 1LBFA 1UH4A 2NXGA 1JCMP 3PNUA 1YEYA 1IEWA 4LVAA 2D73A 1A3WA 1FH8A 2YXOA 4LV4A 5AZ1A 1QI4A 3K46A 3RV0A 3VTRA 1E43A 4IMFA 3UD6A 1EIBA 2BV9A 2UY2A 3OO2A 3C0LA 2WAGA 3BGJA 1JCYA 4GJIA 3S1UA 3CAKA 2ZRYA 4QHRA 1H41A 1Z89A 1E6PA 3BVJA 3W84A 4CN6A 5HJYA 3HPSA 1KFCA 2HPMA 1ZCCA 2XN1A 2PDKA 1V0NA 3EWWA 4UTMA 2OYKA 3UZZA 3VD5A 5A6SA 1HXJA 2BTMA 4J40A 3P60A 3WBWA 1PBGA 4A4AA 2YFOA 4ZOAA 3SEPA 5KZ6A 5KZEA 1CGTA 1ONWA 3THAA 5I06A 2ISSA 5DO8A 1G0CA 1R0MA 3EDDA 3GFXA 4NYYA 5T26A 1XIHA 1NTHA 1OVDA 1TELA 3TV8A 3LUTA 3EDFA 1XLHA 3OLGA 4FNTA 2PBOA 5FCZA 1F05A 3O0FA 1XLMA 1R6WA 3FA3A 4W5UA 1GVOA 5DCDA 5AFDA 2IPFA 2J27A 5CPLA 1TPFA 2R1MA 2EHHA 3DDGA 8RUCA 3JW7A 3KAVA 4DJDD 3V75A 3B52X 1W1PA 1RUSA 3NO3A 1CIUA 4GYFA 1LL6A 2GGEA 4J2MA 3C8FA 4L1GA 1I0DA 4JWDA 2UY4A 3WO8A 1UKSA 4GXMA 5FI8A 3E2RA 3GR7A 4HK7A 3TAOA 1M1BA 3BLLA 1I8JA 2BDQA 4US5A 3U2CA 3W82A 3EGJA 1NF7A 3F4CA 5FEZA 2WBKA 1K1DA 1WKYA 3I3DA 4HKPA 3GDRA 3ZJ7A 2HMCA 3LB0A 1EPVA 4C7DA 3W01A 4A3YA 3VOFA 3VD7A 5M3WA 1FWCC 5RUBA 3N29A 2DVUA 3R1ZA 2YA1A 3WLIA 4W8AA 4MPKA 4JTQA 4MWAE 3CASA 2CWXA 4IP5A 3WDPP 2VRJA 2NXHA 1W0MA 2CLKA 2X30A 4HYVA 1ZBWA 4PCSA 3AHYA 1V4YA 1ADSA 1WKDA 2D0FA 3H4XA 1VH7A 4S23A 5HQLA 4RDVA 1UZDA 4HTBA 3TN5A 1NOFA 5KMYA 3OEXA 1E2UA 1XIJA 4HNNA 1NJJA 3EX1A 4A8LA 4BY3A 3VGDA 1O4UA 4GLEA 2IS7A 3EWZA 2CLIA 3EPOA 4IIEA 4F0HA 4AZ6A 4BZYA 1EC9A 2XH7A 1W3KA 2BGQA 4WGHA 3GKFA 1J0HA 3FX4A 2A85A 3HAJA 1DJYA 3D3FA 4LUTB 3BW3A 4QRNA 2HVMA 1ITQA 3VUPA 1MXSA 1XSKA 3QMRA 4HQVA 1SVDA 2BVWA 5FSDC 1MFVA 4O17A 1EZWA 1TWDA 3GZ3A 4O15A 3N2CA 1H2JA 4I9JA 3MHGA 3GUGA 3WQ5A 3PG8A 2XVPA 1LQ2A 1YWMA 4GQQA 5DMMA 3ENLA 3MUY1 3AZTA 4RV3A 2PP3A 3M44A 3CZLA 3P5ZA 2ALWA 1ONXA 3OGRA 3VNLA 4L6OA 3I4EA 1R9XA 3H2CA 1JQKA 1MEWA 3VINA 5CC6A 4JFSA 3W86A 3UG3A 4YLWA 3GU2A 5M03A 1E9ZB 3G5EA 4MDPA 2XVGA 4NSBA 3HF3A 4B5NA 1Q6RA 1K8YA 4RDZA 4Q3MA 1HW6A 3K30A 4ZL1A 1O1ZA 2E40A 4GG9A 4IFOA 4JICA 2OT1A 1S1RA 4FO4A 5ABFA 4O50A 2WZEA 1R33A 2PSNA 1H50A 4NZFA 5CPMA 4AVMA 2EGZA 1C7SA 4NX5A 2BSLA 1UD2A 1JF5A 1KKRA 3VYLA 4RL3A 2YOCA 3QJAA 5I7GA 2ISFA 3ZJ6A 1OX6A 3K13A 4JTRA 2Y8VA 4KIEA 5DY2A 1UD3A 2A6NA 2EAWA 1O6IA 4LRTA 4DBEA 3RX3A 5FF0A 4MWAB 4H9VA 3W85A 4PZVA 4JTAA 3WDQA 2VVNA 4EZSA 3CV1A 4JN6A 3SZ8A 4DRSA 2VELA 3TTSA 4W85A 1PWMA 4YTTA 5XIAA 1E3XA 1I2RA 1KXVA 4ZFCA 1FDZA 2BHYA 1NVMA 1QPNA 1US0A 2JFEX 3WH6A 5BU9A 1DE5A 2OEMA 1Y7VA 4YNGA 1TTQA 2IKJA 3THQA 3S6TA 5K9XA 3W87A 1Z3NA 2BBFA 3B40A 4KEUA 4RW3A 4JY8A 4D6FA 3O6AA 2GUBA 3IGHX 4TR9A 3SADA 4QEEA 3U0HA 5CBJA 2PDBA 3BUPA 3VNIA 1H51A 4IMAA 3ITTA 4MKSA 1AL8A 2F61A 2DH2A 4GIYA 4NF7A 3LLLA 5I3DA 2Z1SA 2DSKA 3APTA 4ZB5A 2GJPA 1GWJA 2WSPA 2VUNA 3POCA 1J5TA 1PYMA 1FP8A 4XKYB 2OMAA 3GHRA 3PZNA 4C91A 4MTVA 4N0RA 3H7UA 4X9YA 1W8SA 1LL4A 3D50A 4JNEA 2QCCA 1BTMA 1F6KA 5CG0A 4LT9A 4PRRA 2PLJA 4RLIA 3OYZA 3MSRA 5HDRA 3GTIA 3ALGA 1KNWA 4ZE4A 2UY5A 3M7WA 3EKLA 3OIXA 1WDQA 1U1UA 1VJZA 3V5CA 3P5YA 1Z7AA 4J3SA 3FA4A 3A5FA 4E6MA 4MAZA 1LUCB 3NQAA 3UBPC 3AS3A 5LIUX 2Z2AA 3PWGA 4H6IA 2PWFA 1D8WA 4E2DA 3KL5A 1Z44A 3SCOA 3LY0A 1E9VA 3NO1A 3LN3A 2VP8A 3RM9A 4KGJA 4XD3A 1RP9A 3N6QA 1Q2SA 1QK0A 3H24A 1BFNA 3C2OA 4D6DA 3N6HA 1VFFA 4O1CA 4OJYA 1PHQA 3HG3A 3IIZA 4IMDA 3S42A 3GBEA 3TQVA 4UQBA 2FTPA 3H2NA 1TPWA 4FPSA 2D20A 4ZENA 9CGTA 1HJSA 3MW7A 5ABGA 1E0VA 1S2AA 1XGDA 4IL2A 4G5DA 2QUUA 3EJQA 1B9ZA 4FP1A 5G4WA 1E1CA 1BAGA 1JZ4A 2JEPA 3F5LA 4ZE5A 3D47A 1YXCA 4JIHA 1CGUA 4HA1A 2G50A 5BOFA 4ZR8A 2PWGA 2V0OA 1I2PA 4BEUA 1M03A 3GG7A 1LT7A 3H6OA 1V3IA 1WDZA 1A3XA 5LHEA 3QPZA 2FGBA 5G5IA 1XI3A 3CLMA 2YL8A 1OK4A 5CH9A 4KERA 3VOCA 3E6EA 4WZHA 2IUZA 1QBBA 2QDEA 1FFQA 1VJIA 5CGQA 3BLIA 2VEKA 5A6AA 4RZ6A 4MVAA 3GM8A 2VNCA 2YFNA 1FHVA 3UG4A 1Q6DA 3QC3A 3VCCA 1GOIA 4ZSTA 1JCLA 3H7RA 4BI5A 1T0OA 2PPGA 1GQNA 3FNDA 3B0PA 2WMFA 1C7TA 1T5AA 2RAJA 4LAMA 3C3UA 3ARQA 1TQVA 1G4TA 2XINA 2I7GA 2YBTA 3L4UA 1G4PA 4H8VA 1I2QA 3QGKC 3W1MA 2W62A 4W88A 1W3LA 3H4WA 1F7BA 1WZMA 2P10A 2XPKA 4EZNA 1OF8A 3SN4A 3OZPA 3VFCA 4KIKB 2FZBA 3KRUA 1OFOA 1OM0A 4HOXA 3APYA 2F18A 5GJPA 3DZ1A 1Q7ZA 1A0CA 3IV3A 4PUWA 2C79A 4YIWA 2KX9A 3SRHA 1N82A 2QJJA 5FF3A 2YW4A 4XAGA 4EF8A 4FK9A 1P0BA 3DX1A 3OK8A 5EMLA 3UJRA 1XYAA 1QNPA 4JS3A 4WX2A 4AU0A 2IKHA 4OQVA 4UTFA 4RZ4A 3GDLA 4M82A 3OVRA 2PTDA 3VZYA 2VRQA 5CG7A 2P3ZA 4GYJA 3IIPA 2H8ZA 4NVTA 4PO2A 4JZ5A 3E38A 3BJSA 2OO2A 2NUYA 2OB3A 1EDQA 1MJGA 3BZJA 3O9NA 4MY9A 1O5XA 5JVLA 3O3NB 5C2CA 2UV8G 2GQ8A 3PM6A 2BXZA 5EGRA 2QS8A 1H09A 3S8HA 3B03A 3FV9A 3WQFA 2ZADA 2Q71A 1U1JA 1WUEA 2QVNA 1YIXA 3BAWA 1FDJA 3W71A 1MNSA 2CXEA 1UKOA 2MI7A 3BLPX 3CEUA 3EEZA 2EPLX 3GFYA 1CW2A 1W9MA 5FJOA 3MU7A 4W7VA 4E81A 3W76A 3LLXA 3IEBA 1I75A 3PULA 4B2DA 2WV8A 3QR0A 4GBDA 1XRVA 1JD7A 5JBFA 1EL3A 1GT8A 2WLYA 2VZUA 4K2SA 1M7XA 3ITLA 2W6RA 4G6QA 4XKMA 1JPIA 2GGGA 3NQ6A 3NVDA 1IWAA 5A6BA 2FYMA 2YDAA 1OA1A 3MI3A 3LNMA 4PSPA 2FB2A 2D1ZA 2PODA 7ODCA 3B0XA 3CQHA 2QKWA 4FXSA 1R7AA 3F5JA 5I3JA 3UZJA 1E6NA 3PJUA 3H2OA 1S2TA 2OQYA 4BF9A 4DM2A 4JNFA 3S0CA 4JAWA 5AHMA 1JZ3A 4XK2A 1H5YA 1R38A 3E2SA 3SFKA 2AQVA 1EC8A 4N6FA 4W9TA 4HMCA 3VKHA 1CPUA 3H54A 2E77A 1CXIA 3TSMA 1K4GA 4PR4A 1BEUA 1UD8A 3TC3A 3KOFA 2QDGA 4GZJA 4UXDA 1FH9A 4R9XA 1E3ZA 1IWBA 3WH9A 2VYOA 3KLKA 4LYQA 1VEPA 2XWEA 4UMCA 3FVDA 1NELA 4IOTA 4XO6A 1DWJM 3DG6A 3VVGA 3GLCA 4KEMA 4P5UA 3TYCA 3W6YA 5CPTA 4Q7NA 2G96A 1GZ1A 1F3XA 1DJWA 1WP6A 1VIZA 2X1SA 3HFTA 2O9TA 3GHUA 3G1AA 3WLKX 1CCWB 4B5XA 5XINA 2ABAA 2XVNA 3I2WA 4UZUA 2ZDRA 1AQFA 3A4XA 3CUGA 3F7JA 1OIFA 1ME9A 2WYHA 4RPQA 2YIHA 4TTUA 4B5SA 3GNRA 3ZT5A 2R6OA 4IM4A 5EMMA 5D03A 2VGIA 2YSWA 4DQWA 1QFEA 2A7PA 2ZYFA 4R5KA 4BF7A 2QJIA 3KVJA 3AS1A 5TNVA 2WKLA 3S5ZA 1O68A 3CJPA 3GKAA 5MF5A 2NLYA 1Q65A 1KBIA 1A5AA 1GHSA 2DU2A 1GQIA 2C18A 1Q4NX 2WNQA 3ZWTA 3RK8A 1E5JA 1D3GA 4DM1A 3LHZA 1RHCA 2JEQA 2PF8A 4W8LA 1UCWA 3E1F1 3S2CA 2OODA 5JH1A 1HIZA 4GK8A 6PTDA 1YDVA 1UKTA 4GMEA 4C7FA 3EJPA 3WJYA 5D02A 4QE4A 3VIKA 4DB7A 1ZUAX 4D6CA 6TIMA 1TVPA 2XISA 4JTCA 1T99A 4C1NA 5A8GA 2YL9A 2WZMA 1FUYA 4WJEA 4IMCA 4US5D 4UDXX 4IWQA 2GJXA 5CSUA 4O4WA 2DZVA 2OEJA 2J25A 3ABOA 4WY0A 1KW1A 3GNDA 1QPRA 3PLTA 4CD6A 4UOQA 1OYCA 3W88A 2GVYA 2PTXA 2DZUA 5D2VA 1QI5A 2ZA3A 3PJTA 2WWCA 2EJAA 2C7FA 3TROA 4AY1A 1OFRA 1OFQA 4ORMA 5JBEA 2AGKA 2CEQA 3WUBA 2FKPA 1RD6A 4MWAC 2WNZA 1MUMA 4GXPA 4HOWA 3OBAA 3EKZA 3UA3A 4XQ6A 3WQEA 4P8UA 4JNMA 2OWXA 4KMQA 4ZO6A 1A80A 4WD0A 1XSJA 2ZDSA 2Y24A 1VBJA 4NZ4A 1GOOA 1KM0A 3MUXA 3MBFA 3GDBA 3WYZA 1EJWC 1XYCA 3NQDA 5HANA 5K2ZA 5CGTA 3GDKA 4G7EA 3BOXA 4XAYA 1BRLB 4ES4A 5EBAA 1C93A 4CVUA 2CLLA 2WVVB 3PSWA 4AAJA 2ISWA 3CHVA 4PMZA 4Z2KA 3WK3A 3VIIA 1JPDX 2Q8ZA 2GOKA 3SI9A 1F4AA 3FS2A 4DJDC 3MCOA 4JQAA 1CB2A 4XISA 4GYPC 4NNCA 4XAPA 1PV8A 4E5TA 3TTOA 3BLBA 5HPCA 2W9MA 2GLKA 3LXCA 3G3MA 1ZCOA 3AXHA 1DHKA 3RM8A 1TMHA 2A7RA 4S3CA 8XIMA 2YYUA 2GF4A 3GX9A 1E71M 2OX1A 3EOEA 1BRLA 1J5SA 1K6AA 3AHZA 1FRBA 1NF0A 2WXDM 1YQ2A 4B2DD 1GVYA 2AOSA 1QPQA 3S6DA 4IFKA 4DUWA 4DO5A 3ABHA 3AYVA 4CNNA 2ACUA 3UEQA 2NVAA 1Q8AA 4PUDA 2O4MA 3UJSA 2Z2BA 3TWBA 3F5KA 5G2HA 3A9BA 1W32A 3RJYA 3R6IA 2HK0A 2VGGA 3HPAA 3FKRA 4MB5A 2ZIDA 1XIEA 4DJEA 2CLFA 1XIDA 1JF6A 1ZAIA 3ARZA 1S5WA 2YLAA 1ECEA 5CSRA 3IUIA 4AEFA 1WDSA 3LZ3A 3P61A 3CEPA 3AI0A 4CD4A 2Y4SA 4IWOA 4LCQA 2NLIA 3NQ8A 1GGOA 4UQCA 3FN9A 4NJHA 1RQBA 2NX3A 1XRTA 5BXTA 4NP7A 5T8GA 4WR3A 4OU1A 3BQ5A 1FWTA 1W3IA 3WELA 3G2GA 5LIKX 2WMKA 4CCZA 5B7ZA 3F4VA 4FXJA 1H5VA 5I3IA 2HS6A 5DLCA 5F1VA 3DHDA 4EZWA 4ATMA 3SURA 2X1TA 4XUYA 3H55A 4K68A 1GOQA 3LSBA 1DKWA 4E3CA 2EPMX 2ZXBA 2DSVA 5C9XA 2OWCA 3AIEA 3O05A 3H2MA 3TQ0A 4DJED 4PMYA 1JI1A 1Q85A 3CO8A 2VC9A 1C3FA 2V38A 2J4GA 2HV5A 2VX5A 1Q6CA 4QDPA 1YX1A 3GVWA 3CQJA 4D72A 2ZTJA 1GPFA 3I7RA 4YYFA 1U00A 3L2LA 2FZMA 2J9YA 1YMYA 1XS2A 2DVTA 3M64A 4BK9A 5JU6A 3PZQA 3N9SA 2XN2A 1H62A 2PDHA 2WYIA 3AFBA 5FIPA 3AHXA 4K8EA 4DELA 2PDUA 2Z27A 4Q32A 3W7IA 1JZ6A 5FL1A 1QX1A 1KWGA 3W1NA 2QCEA 1QVBA 3L4WA 3C2FA 1E4LA 1GK8A 4P7RA 2B81A 2WSKA 3UJEA 4GJJA 1ZGDA 1JQVA 9RUBA 3WIJA 4AIBA 3HURA 3T8LA 3VKBA 3V5OA 5MHBA 3W83A 2CHRA 1B3YA 1LM1A 1QRQA 4QR6A 2XIJA 2PGEA 3GI7A 3AU6A 4ZQCA 3E74A 3P14A 2NSXA 4AWSA 3KBWA 4XBKA 3LHUA 2WSRA 3MUCA 3RUBL 1EQPA 4HPNA 4AVOA 3CWNA 4NZCA 1VGAA 4IP4A 2F84A 1KC7A 3B4UA 1VYSX 2GWNA 2X40A 4HPJA 3GNNA 3WBYA 4I5XA 4UOJA 1DQUA 4UQ9A 4MJZA 1WKEA 4LVFA 5CPSA 3S4TA 3DG3A 3DH7A 2O92A 3B8VA 4DF1A 3QZAA 4B90A 3WNKA 3WQ4A 3FDKA 2H9AA 3OHMB 5AYZA 3NDYA 2V9DA 2X3VA 4IIBA 4DZAA 1YDOA 1OAOA 1A5NC 2BVYA 4HU0A 1GONA 4WJXA 2ONEA 4IGNA 5REQB 2EG8A 2PDQA 1QWGA 3HGRA 1K8CA 1LLOA 2DORA 1UPPA 4HK5A 1LOSA 3EXSA 1XC6A 4HNOA 2QJHA 3O6YX 3QQWA 4B5UA 4GX8A 2G3NA 2H6RA 3QR1A 2VEFA 1V3HA 1J11A 2FMOA 3W7HA 2ZZ5A 2CZEA 2OPJA 4PA8A 4F40A 3W2JA 4HYRA 1JDEA 3T0TA 4ZVJA 3QGAC 3M5XA 2PWVA 4JTHA 4YVPA 3G1VA 2G3FA 5REQA 3GXNA 2IXUA 2E8YA 2VWTA 3IGSA 3IJIA 3O63A 3R7MA 2E5BA 3ZR6A 5A2CA 3ARSA 3CZKA 2DFAA 4YU1A 4CGTA 4DXKA 3ZO9A 3NL5A 1TPB1 3STPA 1SW3A 3V0UA 3KVKA 2EQDA 2FVLA 2GJRA 2REQA 3QLDA 2E1DA 4HA4A 4I5RA 3S5OA 3LX9A 1EUNA 1NQ6A 3HAHA 1HX0A 3K8MA 4AC1X 3WQ8A 1VFOA 3Q84A 3TN3A 3H26A 3QHNA 4EZOA 3NM1A 3N17A 1L6FA 2PRLA 4AC7C 1WOAA 5FF2A 3WUEA 3W81A 5TQLA 3ANYA 4ICCX 1BG9A 1QO2A 2JF6A 3CHEA 2VURA 5AHFA 3ARWA 4QXIA 4E4PA 5LHFA 3FK4A 2NW0A 4FIRA 3PAJA 6TAAA 1AH3A 1ADOA 1DTUA 5IDIA 2VZTA 2NQJA 3LENA 3GDTA 1PS9A 3IJ7A 4TUFA 4QTGA 3VUSA 5EPDA 2IQDA 2ZRVA 2QJGA 1XH0A 3LV6A 1K9TA 4WXYA 1Q4WA 2OTDA 1ZENA 1TR1A 4AD0A 3K1GA 2F9RA 2D1LA 4S2BA 5EMUA 1OD8A 2HCVA 5EU9A 2I56A 2GVEA 4KPLA 3W2MA 1DJXA 1THFD 1N8IA 1FWJC 4FF5A 2ADAA 1J6OA 4JKMA 4BR1A 2FDSA 3WNOA 2PZ0A 3S46A 3WDHA 2Y8UA 3HOJA 3KDOA 4LCSA 4N9BA 1J01A 2BXYA 3RYSA 3NAVA 3CPRA 3WBEA 1UP0A 2O7QA 4K3ZA 4UFHA 4G56A 3O16A 4JNZA 4KCTA 5IBXC 4AG0A 1L9WA 1QAPA 1H7RA 1SR9A 3RLVA 3USZA 4ZQMA 4EAMA 3V1PA 1W1VA 1VB9A 4JTDA 1WYIA 1XCWA 2PC8A 5AVHA 4L56A 3SY5A 4V1YA 4R85A 5AYIA 3M5ZA 3LG3A 2P0IA 1V51A 1G4SA 4O54A 3HFYA 3BTNA 3RJXA 1UWIA 2HNEA 2EWFA 2HQAA 3AIBA 1TMLA 2F7FA 1CZ1A 1SJDA 1C91A 2WKGA 1JAKA 2PZNA 1E0XA 3NQCA 3T1GA 1V0MA 5TAOA 6CGTA 2P8CA 4G6CA 1KBJA 2H3BA 2WSYA 3KXQA 1ZPTA 1C9WA 2A2IA 2HVNA 2FJUB 4A2RA 3KP1A 5FJIA 2OG9A 3BC9A 2VQTA 3S2MA 4J1OA 2XZ7A 4LPCA 1YHTA 4PUUA 4LY4A 1M3UA 3LQLA 4Z1BA 4HNTA 2ZFAA 1GVIA 4C6FA 2PCEA 3UVAA 1RK6A 4UTKA 3G1YA 3AOFA 3CZ8A 4G8TA 2YJQA 5C54A 2Z6JA 1TV5A 4AB4A 2O9PA 1KRAC 3S2LA 4PMQA 3WNLA 2XIBA 3QTGA 4AX6A 4D1JA 3UWYA 2YZ5A 2XDFA 1C9DA 4WUIA 1MO0A 3COTA 5HWJA 4XSLA 1R7OA 2WK2A 3AZRA 4JLCA 4F3HA 1WZAA 1SMDA 2YPIA 3RAOA 4MZ1A 3W70A 4WDTA 2WMJA 3SCSA 3WMCA 1X7IA 5BXPA 3IVSA 2R8WA 5E9AA 2BGNE 2P76A 1N55A 2ZOXA 4QLJA 3ZXWA 1XYLA 2WZHA 3CIXA 3WK0A 4N9CA 3HPZA 3NQVA 2XGIA 5FLEX 3P0WA 2FFIA 3QY6A 1TG7A 1O5QA 4M51A 3VGHA 3V18A 4B9YA 3AYTA 3P80A 4IMEA 4LEQA 3ELFA 2VX6A 5KTLA 2CKSA 4J3UA 2XVLA 3WD0A 1OX4A 1LROA 1TQTA 2BVTA 3MCMA 2YIAA 4IJRA 1KCZA 2QUNA 4PUKA 2CZFA 2PTWA 1A53A 3ITOA 4LAUA 3NO5A 2XGBA 2J7HA 4GZEA 4ZQNA 2RDWA 5E09A 1XX1A 3AYRA 3O6DA 4OIFA 3GDMA 3W9ZA 3THCA 3HM7A 4IG2A 1HZYA 4N9DA 1NDWA 2X16A 3F1QA 2F6KA 4A8RA 3W7EA 3BURA 2C13A 2H90A 2R1KA 1SO3A 5DN1A 3PFMA 1S2WA 1HQTA 3APGA 2Q12A 4PTMA 4EE9A 2VFGA 3V1HA 3LHTA 3MJMA 3LHYA 4PODA 1R3VA 4CD5A 4AFYA 3OWGA 1NIUA 4Z0JA 1V77A 3KVLA 3PTKA 1EOMA 1HTYA 1HVQA 2VHLA 4W7WA 1XQKA 1ISXA 1KLYA 2HTMA 3GVRA 4CU7A 1EPXA 4AW7A 3UCDA 3SQMA 3VD9A 2WNWA 2GUYA 2Q3OA 3UXIA 2ZICA 3CPGA 1V3MA 4QSFA 3MO7A 3WLJA 3BAKA 3E5PA 1TTJA 1BYBA 5D9MA 1Q6GA 1IXQA 1RLCL 4XTDA 1UIPA 3E3HA 5JMUA 3W7CA 2DT1A 3MVIA 1NARA 2XGZA 1F8MA 5FIGA 1TV3A 3P3BA 2A3AA 4KS0A 1L6YA 1UA3A 5FSEC 3DI0A 5I00A 4DLMA 1E73M 2FJKA 5AECA 3TOPA 1OINA 2V2CA 4POCA 1T40A 2CIPA 5BWAA 3KBSA 4C6PA 3DC8A 1TZ7A 2Z7GA 1H3GA 3I4KA 5DBTA 4ENLA 3PBGA 4CEXC 3N2OA 1E6QM 4P7QA 3LMZA 3PG9A 5KETA 3BCDA 4TIMA 2V81A 4LU0A 3P0XA 5G1YA 4NL1A 1FCUA 4MJ4A 4CVWA 3BUVA 5D32A 4HPXA 1KM1A 3AWNA 4UQEA 1CLXA 3KEHA 3A12A 1BGGA 2FDMA 1XYFA 3UETA 1I60A 3E5BA 5M2FX 3W7JA 1WAUA 1R9YA 4IICA 3DX5A 3AALA 3DDMA 4AWUA 1DWAM 1JCJA 4A8NA 1GOWA 1QT1A 1ICPA 1TX2A 2NZLA 2AQWA 1Z41A 1Y8BA 1E6XM 3WD4A 4N2YA 1R46A 1V6WA 3LERA 4TV5A 4QG8A 5C5BB 4H2HA 2GVGA 4GUGA 1DL3A 3OJGA 1BQGA 2P8BA 3KRBA 1TR9A 3UU0A 1KRCC 4X63A 2QXLA 1UBSA 1B3XA 3VX0A 1IV8A 4OZOA 4X2PA 1F07A 3T46A 1J2WA 1ZU8A 4DJFA 2X2YA 2JIEA 1MW0A 3GO2A 2V5CA 1CB7B 3C5QA 1OFAA 3DFTA 4CQAA 3V4BA 1E4NA 1ESWA 1K3UA 1GHRA 3D4YA 1JZ7A 1RAKA 2XH2A 1T6MA 1AG1O 3N19B 4AWEA 3FCPA 4LCRA 2AAMA 3T4AG 2CKRA 4YVXA 4LYPA 4Q33A 3SGZA 3M6YA 4TVCA 1IF2A 4EVZA 3M16A 1S5MA 3NL2A 3RLGA 2J24A 1PX3A 5HMFA 3EMZA 3SSJA 1H0IA 3L21A 1UOZA 3DIPA 2PDYA 5I6SA 2OGJA 3EXRA 3PR2A 4Z2GA 1ME7A 2Z4GA 3TWAA 5MKGB 3TIMA 1XDJA 4ACZA 3UCCA 5HWNA 3TQKA 1FA2A 4F01A 3M46A 3N4FA 4D6IA 4YYCA 1RCQA 1NQKA 1KGXA 3S2NA 4E4FA 2YKKA 4NHVA 3CQIA 2BY0A 3OVQA 3B97A 2QDHA 2FZNA 3GHSA 1TRIA 2GSHA 1IR2A 2G95A 2POTA 3HAIA 3BMWA 2O55A 3QTPA 1KD0A 3M0VA 1WPCA 2WCSA 4W4QA 2QHAA 3DEQA 2HBXA 2Z1VA 3MJYA 1ITUA 5A94A 4JX4A 1U5JA 3URAA 3INPA 2UWFA 2WYSA 3IAQA 3BICA 3ARTA 3G1SA 3NVTA 5C71A 2PAJA 3B05A 3NQ7A 4FALA 4OOZA 2CLEA 4Z08A 2YKTA 1AQHA 1NSJA 4M29A 4S3AA 3TXZA 4A8IA 2PTZA 1VEMA 2CZDA 1HUVA 1A3HA 1K70A 3STFA 4MG4A 4UCFA 2CBVA 4IM3A 5T91A 4QE5A 3GG8A 1EOKA 4ZB2A 2QCDB 1TJ0A 4JWIA 2EPHA 1WXJA 3LSCA 3NQGA 5H8PA 4K38A 3E2QA 3N1AA 1AA1B 4H9MA 2AL1A 2V3DA 1XBYA 1DWFM 5AVNA 1HVXA 4CQBA 1XLLA 3KHJA 1JAEA 3H2EA 4JKKA 2VR5A 1JGIA 4G2DA 8XIAA 2MUCA 3PVFA 3HQ1A 4IZGA 4JN7A 1GEQA 2GZXA 3PTDA 1IGSA 4BHYA 3ZM8A 3GG1A 1L0PA 3IPWA 4UIOA 3N18A 3QBUA 5T9BG 2G3MA 4C1KA 5D09A 1NAL1 5DCBA 4JTGA 1OCJA 3P62A 4JIRA 5KZMA 3SRFA 3GNPA 1UD5A 3PBVA 4PFMA 4GUFA 1RV8A 4UFIA 3TA9A 2BHZA 1OB0A 1EF3A 1JDCA 1ENUA 1ZP3A 3WUGA 4DJEC 2ZXQA 5D30A 5HQMA 3USBA 1YBQB 4M56A 3GB6A 1GYLA 7TIMA 3TC7A 2VEIA 1F6PA 3DGBA 5ABFB 2XG9A 3RITA 4JX6A 4DAIA 3VKJA 1OJXA 3TDFA 1DQXA 3IARA 2ZRUA 5FACA 1SSGA 3SIZA 3H2FA 3WLPA 3LEPA 1VD6A 4YMZA 2OGYA 4F0SA 1DPMA 3R4IA 3UZWA 1SJAA 4UUIA 4IWPA 1R86A 2YB4A 4CN1A 3P84A 1A47A 4H9TA 4UC5A 4IISA 1HKJA 4WDXA 1UUQA 3B8SA 4MHBA 4OUEA 1NOUA 4W8BA 4HT3A 3R25A 1P0NA 1UWSA 2W63A 2JKAA 5GNYA 5BRBA 1J0IA 4EPBC 1KA9F 1E0WA 3ORWA 4AF0B 2NVDA 1Z69A 4EZUA 5A6BD 2GJNA 3BOFA 1TVNA 4XG1A 4L4LA 4CD8A 1XYMA 3MY9A 4D8JA 1K9FA 4R5IA 4N4PA 3W26A 2VX7A 3SCVA 2ZX5A 3VIJA 3SCQA 1ZBCA 2PP1A 4LXFA 1VRXA 2ZXAA 4IIGA 1B30A 1MDRA 3JZEA 1EYWA 2ZUUA 2A0NA 1C29A 2WJDA 1J79A 4NY2A 4AHPA 1PVNA 3F4DA 1GG1A 3ERPA 4H8HA 5D33A 4JTJA 3GBDA 1A5SA 1BF6A 3L0KA 2HPIA 3AQUA 1TZ9A 3QFWA 2Y5EA 2XSXA 2J79A 4Q4PA 3TJLA 4DCNC 1NDYA 4AF0A 3WJXA 3I68A 3SM0A 5XIMA 4ERAA 3U7VA 1WBJA 4MY1A 1TJRA 4JQ2A 3R0KA 3D3AA 3WD1A 1UB3A 3DHUA 4JTUA 1S5NA 2HK1A 1SMAA 3WLQA 1QJWA 2PBGA 1X8FA 3M47A 1BYDA 3KP0A 1RK5A 2R82A 3TYAA 1DJGA 5BXSA 1HP5A 3U6WA 1Z6KA 1DWIM 3K1DA 1IIHA 4LY8A 4ACZB 3BAYA 4PCTA 3NGJA 2X1UA 1OFEA 4DYKA 1ZHAA 4CU8A 4XZIA 4HJWA 3G3DA 3L4YA 3CMJA 2HXTA 4EZYA 4MMWA 3S9ZA 1CENA 2YXGA 4C6QA 3UY7A 4AZCB 5K4XA 5LNWA 1VFTA 1Y5XA 3TW6A 3ICJA 4JTLA 4OBRA 4MWAA 4JHZA 3MUAA 1E6SM 4CKQA 5BXRA 4JTTA 1DQWA 1EGMA 4IW0A 2CWNA 2WQPA 3W0KA 4FLSA 5A69A 3D6NA 5EYWA 3WUFA 1PTDA 5DY3A 1VS1A 1ECQA 3F2BA 1J6PA 2D23A 1UPXA 1XKYA 3NPWA 3W7KA 2TODA 3C0QA 3MUIA 4GX9A 2A3HA 3KRZA 4Z2LA 3VI2A 3VK5A 5EMYA 4IWWA 1XDMA 3FJNA 4UTWC 2INEA 3I6RA 3L5MA 4TMBA 3TMQA 1TFVA 4UR7A 3CQKA 4P8WA 1QPOA 4MFDA 2EPKX 2AL2A 2JE8A 4NIRA 5DMNA 3ERCC 1AUSL 3QYSA 4QJ3B 1G7UA 4NRRA 1F3TA 1WDRA 2J47A 4Y9OA 4XD4A 1UQYA 4MZYA 2CZVA 4QLLA 1ADDA 3GTHA 3WNPA 4WHBA 1I4NA 2HJPA 3TFCA 1QASA 1UWTA 1J0ZA 5CJ5A 3JS3A 1GVEA 2E6DA 4GINA 3PTQA 1ZL1A 3QFEA 3N9KA 1LF1A 2RKXA 4LBRA 3EX4A 1S2CA 3CL8A 1H49A 3W4RA 4QG9A 1K7EA 4HSNA 1GVSA 4JBRA 2QXWA 1E4IA 4CNPA 4OGZA 5M17A 5E1QA 3GAYA 3UERA 3UZ5A 2QT3A 4BCEA 1SUFA 4RDWA 3LOTA 3UR8A 2OBLA 1IZJA 4KRZA 5C0QA 4EZXA 5DEZA 2YCEA 2DIEA 1W9DM 3HPFA 1R3TA 2QF7A 2R1PA 1X6UA 2EKCA 3QA8A 2C19A 2XIMA 2F6UA 2CBUA 3W1RA 4ZBCA 2FHFA 4L61A 2X0HA 1JYXA 4GI8A 3LI0A 1YADA 3QWEA 2VVSA 5I77A 1DORA 4IF2A 4NNAA 5IM51 3JVAA 1SFSA 4MFEA 3GE7A 2QCHA 5I5RA 3AUJA 1OK6A 4LNCA 4Y8FA 1WAWA 2V5DA 3M9YA 4EK7A 4EOUA 4H6QA 4LUYA 1OC7A 4RE2A 3ISIX 3WK1A 1HKMA 1P6BA 1G01A 2V2DA 4V33A 4B16A 3T49A 5LNRA 1JDAA 3TLLA 5C55A 4LW7A 1H7NA 2IPWA 1FCQA 3FXGA 4RE4A 1K6WA 3KBVA 3UXLA 2OSWA 5GPRA 1Y5VA 3J7HA 4RX0A 5D37A 1W9UA 2AQOA 3A9IA 1N7KA 3ZYZA 4HNVA 3L4TA 1CLVA 3GXDA 1KXTA 2PB1A 1XR2A 1VYPX 3M0XA 3QZ6A 3UNTA 2Z26A 3HG4A 3GC5A 4IHCA 4FOJA 4OUIA 3T42A 9XIMA 3GVVA 3E0LA 1SO6A 4JTKA 1ZJBA 1XGEA 3OA3A 2ZCGA 3N15A 2X05A 2O0I1 3I6EA 2DZTA 3TN4A 3B53X 1L8NA 4I9AA 4Q6JA 2GGJA 1ITXA 5A3HA 4FNPA 1VR6A 1E1FA 3A3HA 3W2UA 3IVUA 5HR7A 3CM4A 1J93A 1QUMA 1I9CB 4CQCA 4Y9AA 3B04A 3IGUA 4J7RA 2RHGA 3PWAA 1JL8A 1KM6A 1J0JA 2EG7A 1GYMA 3QF0A 1RALA 3TTYA 3NWRA 3T8QA 5CZTA 1MEHA 2G97A 3GD6A 3P6LA 1JUKA 3VM5A 3HQOA 1UH3A 2DUZA 3W1PA 1TPVA 1IHIA 3NQEA 2E67A 2QJMA 3TFXA 3ZVIA 3CAWA 4JQ4A 4KETA 3NR0A 3G8EA 4LANA 2VTFA 3N04A 3SCNA 1QNRA 3OLEA 4ZB0A 1MQRA 2PDMA 3A98A 4K1GA 1OHLA 1PTAA 4JHOA 2PTYA 1W3JA 1KFEA 1NWTA 1JZ5A 1XP3A 1F6YA 3CYJA 5CGMA 3TNOA 3W1TA 4FM3A 2OLHA 3WFZA 2J9ZA 1X39A 3WFAA 2FHBA 4IH3A 3UWUA 4AZHA 1YDYA 4JWCA 2PA6A 1UQZA 1QO5A 3VDCA 2ISDA 4A6GA 4DPPA 2QCNA 3MSYA 4LBUA 1KM5A 2PDCA 5C7HA 1XUZA 1BWVA 2VDGA 3QOMA 1W9XA 3T44A 2DW6A 1RVGA 2C0AA 4JWEA 3KOYA 5E0CA 1UWUA 1YNQA 2A3CA 3FOKA 3UXDA 4GH1A 1UMLA 4O1BA 4G7EB 4GKTA 2QGHA 2DZWA 4HP5A 4BI7A 3RILA 1A5MC 6REQA 1V5XA 2OCZA 3C7NA 3N12A 3BUDA 3KAOA 4LC6A 3BAJA 4A3HA 4TO8A 3BLEA 4PB3A 3OLIA 3WN6A 3WSUA 1EJSC 3UY8A 4M3PA 4LUSA 1TA3A<