4DWSA

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
543
structure length
526
Chain Sequence
GAVPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEKIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADETIDMGPLYNPGEIYLSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 186
structure length 526
sequence length 543
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsA02
1HKMA 3GXDA 5M5DA 2DSWA 3SURA 3DC0A 3NSNA 1DP0A 1VFMA 1V3JA 3LMYA 4PMVA 1CDGA 2EPKX 1QI3A 4ACZA 4GO9A 1OT1A 4HZ8A 4NRRA 4NSBA 3WN6A 4QLJA 4B9YA 3BAIA 4UZUA 1Q4NX 4JFWA 3VX0A 1NWUA 3CZJA 2EEXA 2EPNA 3B9AA 4JKKA 4LYQA 2J77A 5A2AA 5A3HA 4H2CA 4LPCA 4TUFA 3TTYA 2FGZA 2WM0A 1G94A 4UQDA 4WSKA 3SCPA 4V28A 4XUYA 1DWAM 1UKPA 2J47A 2V5CA 1J01A 4UNIA 5BYWA 2VNCA 4W7UA 3KL3A 1XCXA 3LPFA 2W67A 3MSGA 1QVBA 5HNNA 3LPOA 1B3YA 4Z2LA 1W2VA 2YLAA 4AD4A 4ZEPA 3NYDA 3SUSA 1H0IA 3IK2A 4KRTA 4UR9A 4MJ4A 3AHXA 2GJXA 1CGWA 1EDTA 2YBTA 1AQMA 1LL6A 4MNLA 3QHMA 1UUQA 2D23A 3K4DA 2ZUWA 4FF5A 5E9AA 3N04A 4DUVA 4PBGA 3VIHA 1DEDA 1BF2A 2YL5A 4JL2A 3PZQA 1Q6DA 2J7FA 1V02A 1WPCA 3RILA 1NWRA 2J8GA 1UR0A 3EMZA 4UOJA 3EDJA 5IDIA 4PTXA 4W86A 3VGBA 4IUGA 1E70M 5BROA 1X6NA 3WH6A 3AI0A 3CHDA 1QBAA 2WKGA 4H8HA 4TOQA 2VRJA 2V38A 2E9MA 2DQXA 4PN2A 2E8ZA 1OINA 4JFVA 4JFSA 2FHBA 1HKIA 3VTRA 3D3AA 4CCDA 2YLLA 1KWKA 3SCSA 1JG9A 3SUVA 2G41A 3IJ8A 5ABEA 2VQUA 4OBRA 2WZEA 3UERA 4DM2A 1DHKA 3EDFA 4HOWA 3AIRA 2BVYA 4M8UA 4R5EA 2QHAA 3GNPA 1H4PA 1W9VA 3M6DA 4PMNA 2WYSA 5AY7A 3MMDA 1LWHA 4W93A 4AD1A 4DWSB 1C8QA 1GQLA 2XFFA 1J0JA 2VL4A 1I1WA 2MANA 3VGFA 4EKJA 1C7TA 4OOUA 5JBFA 1BHGA 4IM4A 1ODZA 4QCFA 4AEEA 4HTYA 4WSJA 1QHOA 3NJ3A 3HU7A 3WEMA 2GK1B 3WUEA 1ZJBA 2Z1KA 1LG2A 4CCEA 3K8LA 2CBUA 2YDRA 2F8QA 3ZJ7A 4UCFA 4WJXA 2X1IA 4PMRA 1JZ6A 1JYVA 5CG0A 1HP5A 4GZJA 4UFMA 4QCEA 1J18A 4MPKA 3IJ7A 2FH8A 1GVIA 1QHPA 3AMDA 2JE8A 3CUFA 1ISWA 4GQQA 1FH8A 3AS2A 4ZXLA 2E4TA 5EBAA 3WDPP 1TA3B 2WHLA 1UD3A 4YN5A 2W91A 4RE2A 2A3CA 3W82A 1UWQA 5AYIA 4ATWA 1W1YA 4R27A 4LYPA 4UQ9A 1CGXA 3AIVA 3W4RA 5FOOA 3BAYA 2PWDA 3MUAA 4W5UA 1CEOA 2J79A 1ZJAA 5EB8A 1JZ4A 2WWDA 4HOXA 1MWOA 1BG4A 3N17A 2GFTA 2YOCA 3QOMA 2WC3A 2GVYA 2VMFA 4KH2A 5DT7A 5E0FA 1E6PA 3WD0A 1V6WA 1KR0A 3FY1A 3ZT6A 2XVPA 4U31A 1KBKA 2XSAA 3M07A 4D6EA 4JKMA 4QLKA 4QLLA 1CXLA 3CLWA 4FK9A 3WFLA 4D6FA 3FHAA 1MW2A 3E1F1 1NH6A 3PZGA 2ZX6A 3QOKA 3A47A 4PMXA 3NUKA 2VURA 4DM1A 3W6MA 4J27A 1KBBA 5HPOA 1E71M 1PX3A 1JXKA 3VUPA 1JD9A 4PMDA 4GXPA 1U30A 1GORA 1E6RA 4CD5A 3SCVA 1O6IA 1XYZA 4PTWA 3SCWA 3ZR5A 3FN9A 3SCRA 4U5IA 3VGDA 4W5ZA 1B3VA 1US2A 3OG2A 1A3HA 4L4OA 2G3MA 1CXIA 4AIUA 3GNRA 1GZJA 2BY1A 1WDPA 1X1NA 1ISVA 1VFUA 3GBEA 2A3BA 4PTVA 3K8MA 5LA0A 5M17A 2E0PA 5A6JA 3VDCA 2Y24A 1TCMA 2J7DA 1UQYA 4PUEA 1NWTA 3U7VA 3GH5A 4P7QA 1DTUA 3BAKA 3LPPA 3EMQA 2WSPA 1L0PA 4CKQA 4A3YA 4U2YA 3O6AA 3VGHA 1JGIA 2GK1A 3A6OA 3PZ9A 1GOMA 1C8YA 1FOBA 5CSYA 4CN4A 3ARRA 4C7FA 1BVZA 1E6SM 2Y4SA 3PHAA 3ARUA 1HN1A 3MUZ1 2YBUA 3CHFA 1WZAA 1XD0A 5LA1A 1UH4A 2FDMA 1CENA 2EO7A 3I3EA 4CU6A 1B90A 2BY2A 1Q6CA 1JNEA 1WP6A 1VBUA 2XVKA 4E4PA 1LF1A 3UESA 1C3FA 1VB9A 4XV0A 3QHNA 5LA2A 1NP2A 4GI8A 5HBFA 1NOFA 1XH1A 1HKJA 1XH2A 5BRPA 2BHZA 1HJQA 3AS1A 4U2ZA 3I3BA 2D1ZA 3WIJA 1GVYA 1OGSA 1J0KA 3AICA 2WHJA 4LYRA 1CXFA 1EOKA 2G8ZA 3N15A 2F2HA 4B16A 3U57A 1LL7A 3ZM8A 1HKKA 1W1VA 3GZAA 1W1TA 3WY1A 4P7NA 3BSGA 3CHEA 1MVYA 5M03A 3BLKA 2ZX9A 5IXEA 3CZ8A 4PSRA 1G5AA 4JIEA 1LL4A 2QPUA 1NP0A 4D6CA 3BCDA 4AY1A 3KEHA 4QDMA 4MTVA 1VENA 1UH2A 1CYGA 3PTQA 1BSIA 2J7GA 4NRSA 4TXEA 4Z2JA 1VJSA 1GHSA 1HJUA 1OIMA 1UD4A 3ZSSA 3W38A 1OD0A 4W8BA 3VIGA 1QNSA 1UKSA 4YHGA 2BY0A 2OWXA 1EA9C 4BZYA 1UR8A 1LG1A 3FXYA 3GDBA 1R86A 2A3EA 3AXIA 2WC7A 1MYRA 1ZBVA 1W9XA 2EPMX 2XHYA 5F7UA 4CD7A 1QBBA 3ARWA 4EAMA 1E5JA 3ZJ6A 2E8YA 1XGZA 1Q6FA 4CVUA 3CZKA 1MXDA 3WELA 1BFNA 3WH9A 1OIFA 3WDHA 3RDKA 4Z2GA 1ZBKA 4RE3A 2JF7A 1EIBA 1JDCA 4PCSA 2J74A 6A3HA 1BPLB 1GQKA 2ZX7A 4FLOA 1CZ1A 1WCGA 2WAGA 1BGGA 1TMQA 1EQCA 4UFHA 1B31A 1J9YA 2VUYA 4DUWA 3D5HA 1UWTA 1E40A 4GZEA 2WVVB 1QI4A 3PZOA 1UD8A 1DWFM 3QR3A 2J62A 2ZUNA 3RM4A 4P8WA 1E4LA 4BCEA 5HPCA 1VAHA 5I78A 4B3LA 3K4AA 2YA0A 5HDRA 3THCA 1H5VA 3I3DA 5FL1A 3T2OA 3T2PA 3ZR6A 3VD4A 2ZIDA 3FNDA 3CUIA 4HPGA 1ITXA 1KXQA 3VGGA 2VX4A 7A3HA 3T09A 1MW3A 1XC6A 4V2XA 1HL9A 1VFFA 3LPGA 5CPQA 2DT1A 2W61A 3AYSA 1V08A 2QV4A 1W91A 3DYOA 3L4VA 5A6BA 3UR7A 2J25A 1LQ0A 1IV8A 3EBVA 2X2YA 2X0HA 4FMVA 1FHLA 3L4WA 4MB4A 3NCOA 1H11A 1E4IA 5A8OA 2VX5A 2WNWA 2BXZA 1QNRA 4MNJA 2ZUMA 2BXYA 2GJRA 3VIMA 5CZKA 5E6YA 1V6YA 3W24A 3WNLA 2CHNA 3BCFA 4PMYA 1G1YA 1W3JA 2G3JA 3SUTA 3AROA 4XB3A 5BXRA 5A6SA 2CEQA 4P8UA 3F4VA 4Z2IA 1UR4A 3W6LA 5GNYA 3HN3A 5LYRA 2V3FA 2YL8A 3THDA 4NZCA 4UQCA 2WBGA 3VIFA 4AZ6A 1MFUA 5IHRA 2WZHA 1V3IA 5GNXA 3DYMA 5BRQA 3VM5A 2VR5A 1MW0A 2UY3A 3N9KA 2YDSA 2V3EA 5D9OA 1ZBCA 2Y2WA 1XD1A 2CXGA 2YA1A 1BVNP 3AS0A 1XSIA 3CZLA 5IFTA 1NOWA 3WBAA 4WK9A 3II1A 3ZSTA 1W9PA 1XH0A 1BYBA 5AC5A 2VX6A 3WDIA 3GNOA 2D20A 2J4GA 3CZGA 5A6BD 3MV01 4F9JA 2VT0A 4H41A 4KGLA 1FFRA 2PWFA 3VMPA 1W9UA 2DPEA 1XRVA 1JL8A 3ALGA 1E72M 2Y8VA 3WF1A 2C0HA 3AXHA 3CZEA 1K9DA 2WVVA 3GH4A 1ECEA 3VD5A 1DWJM 4U5KA 1C92A 1C93A 1OB0A 1W2PA 3AMCA 5D9NA 4MNMA 2EPLX 3RM9A 4M81A 1JDDA 7CGTA 3SEPA 2XWDA 1VJZA 1GJUA 3MUIA 3DHUA 4JFTA 2PBGA 1E0WA 2ZXBA 1GHRA 4GIAA 3RM8A 5JH8A 1B2YA 4AZ7A 3OLGA 2E3ZA 2QMJA 4PUDA 4P8VA 1UKTA 2O92A 1HP4A 1B3ZA 4CU8A 1H41A 4OZOA 1TVNA 1CXKA 3WDJA 3ARZA 1K6AA 2VQTA 5A8MA 2J8FA 5KEZA 3VOCA 5JIPA 3WH8A 2UWFA 1V3HA 2CKRA 1CXHA 2WLZA 4YHEA 2FHFA 3WNKA 2HISA 1CLXA 3AZRA 2EPOA 1V03A 1YHTA 4MB5A 1H49A 3O9NA 3BSHA 4A3HA 4B9ZA 1F4AA 3SCQA 1ODUA 4IPLA 3MMUA 2Y5EA 4HU8A 4E8CA 5EMYA 5DMYA 3F5JA 2CESA 3UEQA 1E5NA 3MSDA 3AZTA 2WMFA 3M7SA 1CWYA 2VI0A 2XG9A 1E6QM 1MQRA 4UQAA 5CQ1A 2ZUTA 4P7OA 3KWXA 1EOMA 3UR8A 1VEMA 1E9LA 1WDRA 2DH3A 3WF0A 3ARQA 3ZJKA 4AWEA 1VIWA 3VD7A 1KXHA 3A3HA 2ZXDA 2XVGA 4JHZA 2OYKA 3BMVA 2IXUA 4BF7A 2EBNA 1R8LA 3RPMA 1UZ4A 4OBSA 3WQ6A 4L4PA 3WNMA 3AYRA 3CO4A 1GOQA 1KGUA 3MANA 3VDHA 3WQ4A 4QAWA 1UH3A 1JYXA 5CLTA 4MJ2A 1E56A 1NARA 4TVDA 3DYPA 4AZHA 2JIEA 1EH9A 2VO5A 2DT0A 4WKAA 1V0MA 1KGWA 1HJVA 3AXXA 2WBKA 5DT5A 4AYSA 3CGTA 4HP5A 1XSKA 2PBOA 2ZXQA 3SCTA 2YL6A 1SYTA 3K1DA 4ZENA 1L8NA 2W4XA 5A1AA 4ATDA 5TD4A 1WZLA 2O9RA 1LWJA 1NQ6A 3WDRA 3WMCA 1OGBA 2WB5A 1E6XM 1J0HA 3MMWA 4AD5A 2VZSA 4LGXA 2VZTA 2FGLA 2VZUA 1M01A 4GI9A 3NSMA 1E6NA 2WHMA 4WKHA 1TZ7A 1FFQA 3VU2A 3WQ8A 2WC4A 4CU7A 3MO4A 3JUGA 2IUZA 1UG6A 3UG4A 2ZXAA 1EO7A 1R85A 3K46A 4B15A 1VEPA 1WNOA 1NOUA 3WKZA 4XX6A 3RJXA 3WF4A 1KXTA 2WCGA 4PSPA 1NWSA 2VTFA 4PRWA 4J3VA 1Q6GA 1V3KA 2C7FA 4MADA 4HZ7A 3CUJA 3U5UA 3EMCA 3WD3A 2O9TA 2VRKA 5KZ6A 4CN6A 5BXTA 1J0IA 3AMGA 2YL9A 1YQ2A 3WNNA 4TVCA 3A4XA 1XSJA 5D4YA 4OOZA 3S6TA 2F61A 2BFGA 2RGMA 2CBIA 1KCKA 4TVUA 4D6GA 3WSUA 1V0KA 2ZWYA 1E4MM 1BQCA 2YIHA 3WENA 5A8QA 3WNPA 1RPKA 1KR1A 1V6VA 3VIKA 3AIWA 1MQQA 5DO8A 5I3DA 1GPFA 1ISYA 1QI0A 2XUCA 1RP9A 4J3XA 4CCCA 1OT2A 1G01A 1E0VA 1QNOA 1JZ8A 1JI2A 4AZCA 2ESCA 1OGGA 2WPGA 2VCCA 4CD8A 3W53A 1QW8A 3W27A 2GDVA 1TVPA 1WE5A 3AQUA 2W63A 1BTCA 2OSWA 1OBAA 5HXMA 1ISXA 2W66A 4JZ5A 3ZT5A 3WH7A 4W84A 1B30A 5IFPA 3OA5A 1MQPA 2GDUA 1N82A 2RGLA 3MV11 2VOTA 1TG7A 3CBWA 4PMZA 1JZ2A 4W8LA 4PCTA 5FL0A 3VIJA 3NDZA 5D9PA 5ECUA 1WZKA 2FH6A 2OYMA 3CIVA 3KZSA 4DUXA 5C71A 1PX8A 2AOSA 3SUUA 2WMJA 3BGAA 3UG3A 1UA3A 3AJ7A 1HVQA 4J3TA 2X0YA 4BS0A 1BLIA 4TX6A 1UQZA 1V6XA 2PF0A 1UD2A 2C8NA 5FCZA 4C7GA 3VX1A 2WW5A 3PZUA 5EFDA 4FLQA 1ZBWA 3ALFA 2D3NA 3EDDA 4W85A 4AIEA 1B0IA 1BGAA 1UOKA 5JIWA 4HZ6A 2VCAA 1KQZA 1WDSA 1AVAA 1U2YA 4U3CA 5A8PA 1A47A 1KXVA 4UTFA 5CGTA 4GPNA 5I23A 4HA1A 2XIIA 2EXOA 4LX4A 1IZJA 1OWQA 5DFAA 3N1AA 1I75A 1UWSA 3MUY1 1VBRA 1H0GA 1EGZA 3BH4A 3ZO9A 1WZMA 4PMQA 1LLOA 4D71A 4AMCA 2ZWZA 3L4UA 4PMUA 1PEZA 4D6IA 4DWSC 2X8RA 5BXPA 3VIPA 2XM2A 5A6KA 3AHTA 4PMOA 1V02E 3ZOAA 2XGIA 4LXFA 1CIUA 2XVNA 5C70A 2A3HA 5GPRA 2BVTA 1GQJA 5D8ZA 3O2LA 3VGEA 4GO8A 1CLVA 3WH5A 4E8DA 1E0XA 2JEPA 1BG9A 2DH2A 2WMKA 4Q22A 3POHA 4CN1A 1JD7A 4GKLA 1BAGA 2XFRA 1OM0A 1VEOA 2CYGA 1B3WA 1FA2A 1HT6A 5A8NA 5E0CA 2DGAA 1E43A 3PZIA 4BQ3A 2CBVA 3PZMA 3TA9A 3GYCA 4M80A 5A2BA 1M04A 2D0HA 3WUGA 2CHOA 4H8UA 2QMKA 1J11A 3WUFA 3TOPA 1GOIA 1VRXA 1HIZA 1WDQA 4M24A 3T08A 3ARYA 2XYLA 4MB1A 3AIQA 4F66A 1D2KA 4UFIA 1TR1A 3POCA 1JYWA 3PZNA 4JAWA 2WK2A 3VIIA 4X0NA 3BAWA 2BNJA 4W7WA 4CD4A 3WBEA 1HF6A 1W9DM 4OJYA 4KRUA 1EQPA 3T0BA 2A3AA 4ZFMA 1AQHA 1V6UA 1FP8A 3K8KA 1DWIM 1UKQA 2J75A 9CGTA 2ZOXA 5I2UA 5FKYA 5M3WA 4P7RA 3U7BA 1UA7A 5FIPA 3F5LA 3CUHA 1UR1A 2WVUA 5I77A 3WL0A 1CGYA 2YKKA 3W25A 3CH9A 1CXEA 2XGBA 1UWUA 2XIBA 2BS9A 2J7BA 1H2JA 2QLYA 4X0VA 3CMGA 2TAAA 1K9TA 2B31A 5E70A 1E73M 4KGJA 1E3XA 2DIEA 4HOZA 5CSUA 4ZE4A 3AMKA 3T0DA 4D1JA 2CIPA 1QI2A 4ML4A 2FHCA 2VVSA 1PX4A 2DT2A 3N11A 1EHNA 2DSZA 2CPUA 1MW1A 3RMEA 3AIEA 4MNKA 3PZTA 2UY5A 4E2OA 5A2CA 4UFLA 1XHGA 3WD2A 5AYBA 1K9EA 3WD1A 1AMYA 1D3CA 1UD6A 2VRQA 4XZBA 3CPUA 1M03A 1KWGA 2YJQA 2CERA 1LJYA 1ESWA 1RH9A 4OIFA 4CGTA 3KL5A 1QW9A 3VD9A 5IHSA 3DECA 3F5KA 4HPHA 4S3KA 4EK7A 4V27A 3EDKA 1RD6A 3NSXA 1FH7A 1JZ5A 2BHYA 1JFXA 2NT0A 3TTQA 1XV8A 4TTUA 3MU7A 4PEEA 1UWIA 4AC1X 3CUGA 2ZUUA 1MXGA 1D7FA 1ZS2A 5A69A 3QHOA 1JFHA 4FLSA 4AZ5A 2EQDA 2ZUVA 2GJPA 3AHZA 4BQ2A 1UWRA 1PZ3A 4HA3A 3VVGA 3GXFA 4UQEA 1IZKA 2OSXA 3KL0A 4ACYA 3EDEA 1H3GA 4W7VA 4KWUA 3J7HA 1SR0A 4W88A 5D8WA 2D0FA 2D0GA 3EYPA 4AZIA 4NI3A 3ARVA 1W3HA 2VR4A 2JALA 5FD0A 2DSVA 1GOWA 1E3ZA 3KE0A 3T2QA 3S2CA 2OYLA 1W3LA 2CBJA 3B9EA 1Z32X 2XSBA 1WAWA 1V3MA 4N0RA 1JXJA 2XPKA 1BYDA 3HJEA 3FHQA 4JKLA 1S46A 5A95A 4AZBA 1WB0A 6CGTA 3OGVA 1PPIA 3ZJ8A 1J10A 2AMGA 3GXIA 3SCUA 3WMBA 5CPSA 2UY4A 3ECQA 2XTKA 1M53A 4P8XA 3A4WA 2W92A 1JNDA 2W5FA 3BLPX 1PAMA 4LQ1A 1KB3A 5ABFB 3AMLA 2BHUA 4AD2A 4CVWA 3AHYA 1R87A 4NF7A 3TP4A 5BCAA 1GNXA 1ITCA 2DDXA 4GZIA 3VDBA 4WLCA 4PTMA 3ZQ9A 1B1YA 1VF8A 2WLYA 3L4XA 2XM1A 2ZX8A 1JF5A 4AD3A 1ZB5A 4JCLA 3ARTA 3PTKA 3OLIA 3W81A 1E4NA 4AD0A 4ATLA 4GI6A 4ZXOA 3VNYA 4Q7NA 2G4FA 3WUBA 1RP8A 4HMCA 4AZCB 1UHVA 3UG5A 1KFWA 1KGXA 2GUYA 3OZOA 7TAAA 3AS3A 2JEQA 1PBGA 1GUVA 3G6MA 3WQVA 3CTTA 4N42A 1OCQA 4GINA 1K9FA 4HU0A 3WEZA 4H04A 3UETA 3W26A 5HOSA 3AISA 1JDAA 2XJ7A 4AXNA 3WL1A 5A6LA 5C8BB 2HVMA 1FH9A 4U3AA 2DT3A 2GSJA 1QI5A 3VKKA 1ZU8A 1B9ZA 4W8AA 3OLDA 1W32A 4PYSA 5I5RA 1C91A 4X9YA 1HVXA 2CETA 4F79A 1G0CA 4MAVA 2ZX5A 2QF8A 1PZ2A 3QGVA 3PBGA 1E1EA 4XZWA 3G6LA 3L2LA 4AIOA 1H09A 2E9BA 4IISA 3CMJA 3GM8A 3U5YA 5CPTA 1EO5A 1G9HA 1GONA 3WQWA 1GW1A 2YA2A 2G3NA 1KCLA 1V0NA 1E55A 3AIBA 1CGVA 2DEPA 4EANA 3DHPA 3IJ9A 4AISA 4F9DA 3CHCA 1GCYA 3OBAA 2WSKA 1EHAA 2VCBA 1GOOA 3N18A 4UQBA 1F4HA 4W87A 1W1PA 4IPNB 3AIUA 3AOFA 1EXPA 1R7OA 1QOXA 2Q8XA 1TUXA 2DSKA 1PIGA 1HJWA 4UFKA 4D6JA 2X09A 4MAZA 5EFFA 5ABGA 2EJ1A 3VNZA 5I6SA 3SCOA 3M46A 4JL1A 1NM9A 2NSXA 2WXDM 3AZSA 4D1IA 1JAEA 3FAXA 4QFUA 1TE1A 4OUEA 2O9OA 1C7SA 3MS8A 5ABFA 2CKSA 1JIBA 2NT1A 3VM7A 4AEFA 3WEOA 3L4ZA 5GQBA 4RL3A 2JIWA 2VZVA 3OGRA 3WD4A 4MB3A 2WHKA 2WVTA 4B3KA 2PC8A 1DWGM 2BV9A 4ZE5A 3GTNA 2ZUSA 2ZE0A 3OLEA 1H1NA 4HA4A 2PWHA 2E40A 3RCNA 2WKLA 3N12A 2VX7A 4WF7A 3APGA 1WKYA 3RIKA 3PTMA 2PI6A 5E6ZA 2DSUA 1FHDA 2OLHA 1GQIA 3RJYA 3VMNA 4DWSA 5CGMA 2XVLA 3TTOA 1O7AA 3NDYA 5AC4A 4AW7A 2J7EA 4JFUA 2V3GA 5JBEA 4K68A 3VO0A 4S3JA 3GH7A 2JF6A 1HJSA 3VD3A 1EDQA 1OSEA 1CGTA 5JUVA 5I79A 1CGUA 2WMIB 2D24A 1E6ZA 3L4TA 4URIA 2CNCA 5I0DA 1E1FA 2CITA 1SFSA 4J3UA 2W62A 1J12A 2O9PA 1BYCA 4Z2KA 4J28A 1WO2A 2VJXA 3PN8A 3OGSA 3BAXA 3VILA 1CECA 4TX8A 4D6DA 3AFBA 4CUCA 1JAKA 3ARSA 4UZSA 1CTNA 3L2MA 4UOQA 1TFVA 5ABHA 4J7RA 2JFEX 1UR2A 5A94A 1TA3A 1HJXA 1HX0A 4OKDA 2DIJA 2WMGA 3ARXA 1IT0A 3UCQA 3N13A 3VPLA 6TAAA 4F8XA 1B3XA 2NW0A 3PZVA 1OD8A 2ZICA 2CCRA 2E9LA 1X6LA 1J0YA 4WKFA 3WNOA 4TTGA 4HMEA 4UFJA 1JI1A 4A4AA 3IAQA 1ZL1A 5BWFA 1US3A 8A3HA 2OWWA 1I1XA 4JCMA 1BYAA 3ARPA 4C7DA 1VFOA 1E15A 4MDPA 2WCAA 3FW6A 4DWSD 1SMAA 1P6WA 4RE4A 4Y7EA 1UZ1A 2J7HA 4U33A 1QPKA 1QHZA 1UKOA 3GBDA 3B8SA 4H8VA 2J7CA 3BAJA 3TTSA 3SCNA 1U33A 2OSYA 3T0AA 4Z2HA 1QNPA 4D6HA 4QP0A 2Y8KA 3MKKA 4W89A 4ACZB 1KQYA 1Y7VA 4H7VA 2OWCA 4EE9A 2V3DA 3SIMA 4MDOA 3AHVA 2WVSA 4FLRA 1Q6EA 2WZIA 4CD6A 1JZ7A 3B9DA 4JHOA 4M29A 1C8XA 4M56A 4YPJA 3BC9A 4J3SA 1UR9A 5DF0A 3W29A 3BMWA 5BXSA 3W0KA 2G3IA 1SMDA 2VZOA 2WCSA 2Z1SA 2V5DA 1C90A 5A6AA 1DWHM 3BXWA 3VINA 2VC9A 3WMSA 5CLWA 1HNYA 3VMOA 3IANA 3ZT7A 2WMIA 3GXMA 3WF2A 1MFVA 3OZPA 1JF6A 5DEZA 2XFYA 4AZGA 2PWGA 5D9MA 1CBGA 1CNVA 2YDQA 1JZ3A 1W3KA 1PJ9A 1HL8A 1XYFA 3ZIZA 1ISZA 2AAAA 8CGTA 2GJXB 3WQ5A 3NIYA 1M7XA 1QNQA 3L4YA 1PIFA 3WFZA 1HXJA 2D2OA 4BQ5A 1XCWA 2VVNA 5A6MA 5GNZA 5I24A 3FAWA 2WWCA 4HMDA 1W9BM 2J78A 4M82A 3SUWA 2UY2A 5CXPA 4GQRA 4WIWA 2QPSA 3A4AA 2BY3A 1CPUA 2XWEA 3OIHA 5E09A 4BA0A 1J0ZA 3RO8A 3TONA 1GOKA 5JBDA 2WMHA 4UOZA 4KMQA 2PWEA 4D72A 1JYNA 1R7AA 4M1RA 2BVDA 4P7LA 3W37A 1UYQA 1UD5A 1AQ0A 3W28A 2D3LA 3VIOA 1V0LA 2X05A 3IAPA 4BQ4A 2WANA 3WDQA 1EDGA 3WF3A 3ZMRA 2D22A 1GJWA 1FP9A 3HMCA 4J3WA 3VDAA 2IXVA 5CJ5A 3OB8A 2PB1A 1V3LA
chains in the Genus database with same CATH superfamily
1U1JA 4K2SA 3OIXA 3SURA 4US6A 3CNYA 1K7EA 1VFMA 3EOSA 1Y5WA 3UFYA 3AAMA 2YGYA 1CDGA 1QI3A 4ACZA 4GX9A 5G4WA 3FJ4A 1Q6QA 3AUOA 3VK5A 4NRRA 3S5SA 4QLJA 3UU0A 2J13A 3BAIA 5T8GA 4I6VA 4JFWA 3B8UA 2HK0A 1J5SA 2EPNA 2VD8A 4JKKA 5A2AA 2PLKA 3V0UA 4LPCA 4TUFA 2A85A 4EF8A 2PEVA 5F2GA 3W7KA 2FGZA 3C56A 3F7JA 4DZIA 1W5OA 3CTLA 1WYIA 1RCXB 2Q5AA 2AQOA 3DFSA 4UNIA 1XIIA 5BYWA 3T78A 3KL3A 3LPFA 2ACQA 3NM3A 2PRLA 3MJMA 5AC7A 3MSGA 1VQTA 1XPYA 2XFWA 4QQ3A 3LPOA 4XD4A 3CIWA 4CNSA 3NYDA 4YL2A 1H0IA 2ICSA 3ONBA 2GJXA 2YBTA 1F40A 5G4HC 3ZFHA 4WOZA 4IWWA 3K4DA 4N9BA 4FF5A 5E9AA 2WPBA 3G1SA 5HQEA 2KO7A 1DEDA 4CEXC 2ABAA 1V02A 1NWRA 4ZOBA 2J8GA 4UOJA 5IDIA 4W86A 3C4UA 3FJNA 2ZZ4A 5C9XA 2PDCA 3BQ6A 3EWDA 2B81A 3WH6A 3AI0A 3VAWA 1XIMA 3CHDA 1DJGA 3QMTA 3BZJA 4IMFA 4J4OA 3P80A 4H8HA 2F38A 3RFAA 2VRJA 2LPVA 4PN2A 2E8ZA 3RR4A 3S1UA 4K39A 3AO0A 1RBLA 5EPDA 2HPMA 5DXYA 4KWWA 5I02A 2VM8A 1XQLA 1I4NA 2ZVRA 3SCSA 1SO5A 4GUIA 4JIIX 2G41A 1MUWA 3N9SA 5L9FA 3UERA 4DM2A 3B0XA 3SN0A 3EDFA 1Q2SA 3AIRA 3LSBA 2EPHA 1Y5VA 1H4PA 2WYSA 4J5NA 1LWHA 5FJRA 1NDWA 4H9YA 3VZZA 1F07A 2VL4A 2P0OA 3TQ0A 1I1WA 1K8XA 1TV3A 1ZAJA 2MANA 3ABSA 1C7TA 4PL1A 1Q66A 1BHGA 1LROA 5HNTA 4IM4A 4AEEA 3CPRA 3N6JA 1DIEA 5BOOA 3G24A 3GY1A 5TBOA 4ZFCA 3WUEA 3O5DA 3SDOA 4C91A 1I0BA 3HBLA 4CCEA 1JQVA 1NDZA 3VXGA 3ZJ7A 3PULA 4WJXA 4GXWA 5CG0A 4GZJA 1DIOA 2KFWA 3DG6A 1J18A 2XISA 5C5YA 2XN1A 3EX4A 3OU8A 2XIJA 2YX0A 2JE8A 3K13A 1FH8A 2E4TA 4UUIA 3UWWA 3KDOA 2IPWA 1TA3B 1LOLA 4YN5A 3MP3A 3C3UA 1UWQA 2NWRA 4RZ4A 4ATWA 1QTWA 3E12A 2QS8A 1CGXA 3W2MA 4BEUA 1V4YA 3BAYA 2PWDA 4DI8A 4JTKA 3ITXA 1T40A 4JR5A 3LA4A 5TQLA 4HOXA 3W71A 1KFCA 3LCLA 1MWOA 1BG4A 1Y0OA 3N17A 5HR7A 1XRTA 3FX4A 4RNHA 3QOMA 2GVYA 4YCPA 1JCHB 1SZRA 4YS1A 2WSQA 1VS1A 4CLMA 4I90A 1GKRA 1QXLA 4Q4RA 5EBUA 3E0LA 3N6HA 3M5YA 4DAIA 4GQGA 4GFSA 4FK9A 1MW2A 3KW3A 3GTIA 3PZGA 3QOKA 2IKHA 2RDTA 4PMXA 3NUKA 2VURA 4J27A 3QVQA 1E71M 1J6PA 5MHBA 4GVHA 3IKDA 4HNNA 1U30A 3KS5A 5C54A 3ZR5A 3FN9A 1O94A 4U5IA 1DE6A 4W5ZA 1A3HA 2G3MA 1KM0A 4ERIA 1D7JA 2DVUA 3F2DA 1WDPA 2ISFA 3CB8A 1X1NA 5C9ZA 3QPZA 4HNTA 2VKZG 1Q8AA 3OPSA 3GBEA 3KBMA 1ITQA 1TWZA 4PTVA 2OGJA 3MKCA 5BOEA 3A5VA 5M17A 3VDCA 4N9CA 2MF9A 3U7VA 1JRBA 3QLLA 4Y2WA 4Q8PA 3LMZA 4LCQA 3PWIA 1JGIA 4JNZA 1XBXA 1FOBA 5CSYA 4B5XA 3ARRA 1FKJA 1HN1A 1EXBA 4ZODA 1FKSA 3CHFA 1ICQA 3UZYA 4WEVX 3RG6A 1CENA 4CU6A 1VBHA 3M0VA 1WP6A 1A5OC 1LF1A 3UESA 1C3FA 4XV0A 1IIGA 1TIWA 1E0TA 3T4CA 1TZZA 3FV9A 1XH2A 4NU7A 4HNLA 2Q02A 2P10A 3MY9A 4BF5A 3AICA 2WHJA 2F2HA 1AJ2A 4B16A 4Q8QA 1ICSA 1AD4A 1TKKA 5AZ0A 2ZRZA 3VC5A 2VDGA 3WY1A 1MVYA 5M03A 1G5AA 3W3OA 1LL4A 4AAJA 1XP3A 1EUNA 1NP0A 2E09A 3LOTA 1HGWA 1FRBA 2A1YA 3KEHA 4O8RA 4MTVA 1CYGA 2DIKA 1BSIA 2ABBA 4NRSA 3T7VA 4AG0A 4Z2JA 3U48A 5J5RA 1XYMA 1Q2RA 1OIMA 4I6KA 2XZ7A 4QIUA 3W38A 1XPGA 1JNSA 4W8BA 3VIGA 1V6TA 1UKSA 4FNUA 4YHGA 4K1GA 1ZJHA 3FXYA 3DEQA 3AXIA 2QW5A 1IE7C 3FEQA 4QJ1A 4CD7A 1XX1A 4QT3A 2YZRA 3R0UA 3NXLA 2F21A 5LNVA 1XGZA 3O1NA 3WDHA 1BF6A 4ZGYA 4KETA 2QJNA 2FZDA 3ABRA 2PDIA 3M9YA 3O07A 5FEXA 4BR1A 3GU0A 1XKYA 3FXGA 1IT7A 2Z4GA 4O14A 3KADA 2ZZ6A 3NURA 1J9YA 2BOFX 5BRBA 5HUPA 4G7EA 1F3WA 4OTKA 5H8PA 1UD8A 4JEQA 4BCEA 2QJGA 2C13A 3THCA 1H5VA 3EWXA 3TDFA 4LAWA 1FJDA 1KTCA 1LWIA 1YDOA 1D7KA 1KM4A 3CUIA 1ITXA 2X1SA 3VGGA 3W1NA 2VX4A 7A3HA 3T09A 1EBHA 2YW4A 3DBNA 5JXQA 5HW6A 1JVNA 2POTA 4O11A 3DYOA 3LHZA 4DXXA 1R9ZA 2YFNA 2ZZ5A 3BGJA 2F6KA 1YPXA 3GHSA 3G22A 3O7UA 4JHMA 1H7WA 4O8AA 3HJZA 3SO7A 3L23A 3W9ZA 2E68A 2QIWA 4HCLA 1POKA 2WNWA 4TYOA 4AUBA 3ES7A 1Z6KA 3U4FA 2I17A 4GLEA 4MNJA 3A4JA 5CZKA 3W24A 3RO6A 2CHNA 3WH0A 3JRKA 4UTJA 3GU2A 2GL5A 4TIMA 3TOYA 3HMJG 2CEQA 4FO4A 1DIDA 4UWMA 2ZR6A 2O7SA 2XSXA 4MKSA 4NZCA 2WBGA 3N6QA 3UXAA 4YWSA 3ABOA 3N19B 2Z27A 3WLLA 3UQNA 3N9KA 5FJIA 2YDSA 5D9OA 1ZBCA 4ICNA 4IPJA 2Y2WA 3A9IA 1XD1A 2YA1A 3UZXA 1BVNP 2QCGA 5CG7A 2PGWA 4HU4A 3W75A 3QRHA 4DRKA 3NQ6A 3TJIA 3O0FA 2FZNA 2FFCA 2BBFA 3W1XA 2J4GA 1ML1A 3LLDA 3UY7A 1J79A 4PR4A 2Y63A 3LUTA 4AF0B 3B8IA 3FIGA 4KGLA 2PWFA 3DI1A 4DNMA 1TMLA 4AVOA 3WF1A 4AWUA 4IPXA 3AXHA 4GOAA 1AZ1A 1GG0A 3CZEA 4R7OA 1LT8A 1PHQA 3ANVA 1Z41A 4W9OA 1GT8A 1OB0A 2FB3A 3IIPA 4BKNA 5D9NA 4IZGA 3UGRA 1WQ5A 1JCLA 2ZZ2A 3CWHA 3RM9A 1JDDA 1TPB1 3KLKA 1L6WA 1VJZA 4I7UA 2VN1A 4MZYA 2PBGA 5DMLA 4GIAA 1FX6A 1D6OA 4EACA 3RLUA 1KFLA 4ERGA 1EYWA 4RXGA 4RDZA 4AZ7A 1F6KA 4L72B 4MY9A 1KKRA 3M0ZA 7XIMA 5GPGA 1HP4A 1PKYA 2X7WA 3I65A 4I7VA 3HPAA 3ARZA 3NZQA 2D9FA 3H12A 3VOCA 3HGSA 3IGUA 3LNMA 2GOKA 2ZYFA 4H6KA 2FHFA 1O5KA 1LUCA 1BD0A 1CLXA 1J93A 2OJPA 5K9CA 5G2WA 4B9ZA 4DRNA 4DBSA 1FHUA 4MFEA 1A3XA 4NZ5A 5EMYA 5DMYA 3G5EA 3QY6A 4XIMA 4LAMA 3BSMA 1E5NA 5EU9A 4YTQA 4MYXA 1SQ7A 2XG9A 4WGXA 4DO5A 1E6QM 1EJVC 2D2GA 1FKBA 1LQ2A 4UQAA 5LIUX 4Z08A 1S3HA 4DRJA 4P7OA 1XLGA 2Q6ZA 2P88A 3Q2DA 3FSUA 2XN2A 3LBMA 3ZJKA 2QNEA 4JFKA 4QJ4B 1YTEA 4ZR8A 1A5UA 1KXHA 2P1FA 4QG6A 4YTUA 2XVGA 4ASTA 1W5MA 2PP1A 4GGHA 3BMVA 3QY8A 1R8LA 4LUSA 4OBSA 2EG6A 1D3GA 1QATA 3WQ6A 4L4PA 3AYRA 3CO4A 3KABA 3PPHA 5HNRA 1ECQA 4V1YA 1O60A 3VDHA 3GG0A 3WQ4A 4QAWA 3IRSA 3F2BA 1NARA 2DZWA 2P5NA 2XINA 4GY1A 4ZSTA 1QR7A 1HJVA 3PAOA 2NUYA 3MC5A 4LB4A 4FOKA 4AYSA 3O5PA 2HTMA 1XSKA 2PBOA 5FEZA 1CI1A 4H7CA 1DKWA 1AODA 3S5OA 4ZENA 1L8NA 2W4XA 5K7JA 2CLOA 2O9RA 1LWJA 4UTWA 3EWZA 3WDRA 2WB5A 2LLEA 2VZSA 5BW6A 4WDWA 2VZTA 4GI9A 2PDGA 3WJXA 4NG3A 3ID7A 1XLAA 2WHMA 3H4XA 5DBUA 1XLBA 3E0IA 1TZ7A 4MPQA 5C2GA 3T8LA 1WDWA 3VU2A 5ECVA 2YW3A 2PMQA 4CU7A 3V3WA 1F9CA 2CW6A 1YE4A 2JKAA 1KRAC 1VEPA 3ABQA 1NOUA 4JN6A 1YBQA 4QEHA 4XTDA 4PSPA 3CQHA 2CLPA 4J3VA 3W7OA 1R3YA 4IIGA 1ZFJA 5F2LA 4LBUA 4IP4A 3RRAA 5BXTA 4O0QA 3IPWA 4BEQA 2GQ8A 3GIPA 4HYRA 2R82A 4XIAA 4Q8NA 3M5ZA 2ZADA 3K30A 5D4YA 1XC4A 1E4MM 2YIHA 3DFQA 1DORA 1V6VA 1A0EA 1A5BA 3VIKA 2VEMA 1RQBA 1GPFA 2VELA 1RP9A 2Y1HA 1G01A 3MZ2A 4J2MA 3NNTA 4R3UA 3H70A 3FOKA 3TNBA 4XZLX 4CD8A 2VOMA 4KCWA 2QVHA 3N14A 5FESA 4QM1A 5HXMA 4JZ5A 4PUNA 1DHPA 4W84A 3FKRA 1SSDA 4IT1A 1N82A 2RGLA 1OABA 3MV11 4ROPA 5HINA 2PPGA 5ECUA 2OYMA 4B5WA 3BGAA 3UG3A 1UA3A 3AJ7A 4GNVA 4BS0A 4NZ3A 3CL6A 1EQ3A 2CLMA 4PCFA 3B7XA 3NVTA 1HFBA 2IQTA 4RZ6A 3TH6A 4C7GA 4N4PA 1VC4A 1J8VA 3S5ZA 3LTPA 5ENLA 5EFDA 3DZ1A 4FLQA 3SJ3A 1XI3A 1B0IA 1BGAA 4ZL1A 5JIWA 3UCDA 1KQZA 5GJNA 3N2BA 4U3CA 5G1YA 1A47A 4K8EA 1MXSA 1X1OA 4O12A 3B97A 4UTFA 3SM0A 4JIPA 1DYSA 1F8MA 1S2CA 4HA1A 4PRRA 2EXOA 5HUAA 4IGHA 1IZJA 5I3HA 1SSGA 3A12A 1CX9A 1H0GA 2QCDA 4PMQA 4D71A 2ZWZA 3L4UA 4IQEA 4TR9A 1L9WA 5FAJA 5K4XA 2W0UA 4LTSA 2NUXA 1M5YA 2I1OA 4FEZA 1PDZA 3AHTA 4LUIA 4LC8A 1V02E 3ZOAA 2XGIA 4F0RA 2A3HA 3CEUA 4DBEA 3BMBA 4GO8A 1E0XA 3CLMA 2DH2A 2WMKA 4Q8TA 2D69A 3SQSA 1G4PA 1XGEA 5H2ZA 1BAGA 2XFRA 4QNWA 3TWBA 3LV6A 2GGEA 4L80A 4LRTA 5A8NA 5E0CA 3M0IA 3CEPA 2CBVA 3GYCA 5A2BA 1UIOA 1PZ1A 1AJ0A 1FXQA 1J11A 3WUFA 3TOPA 1RQEA 4KESA 1G6CA 4GFIA 5DELA 4HNVA 1HIZA 1WDQA 3FYPA 4CNOA 3ARYA 4D8LA 3MVTA 3CV7A 1TR1A 4QTGA 2BB0A 3QKZA 2DZAA 2VP8A 3WJWA 3HGJA 3EWBX 2FAPA 4QDPA 2ACRA 3VZXA 2VR2A 1EQPA 4KRUA 5EKYA 4GGQA 4S38A 2J75A 1K02A 1XLLA 2PV2A 1R2SA 1UA7A 1OG6A 5HW7A 3CUHA 1UR1A 3E3HA 5I77A 1NIUA 4ZA0A 2Y85A 1CGYA 2OZTA 2YKKA 2Z25A 3JXVA 2Z29A 4E0CA 4QJ3B 4G1NA 3HFTA 1SZGA 1Y0EA 2DVTA 1UWUA 2XIBA 1H2JA 1I2RA 3M0MA 1BKSA 1DTNA 1AW5A 1K8CA 1SU5A 2PFHA 3RRXA 3ZVIA 1XRSA 2DIEA 4HOZA 1G4EA 2AKMA 2PV1A 3PPFA 4DYEA 5EA9A 1KM2A 3T0DA 4D1JA 4NYUA 2CIPA 1OHLA 1TPC1 4AHQA 1KO0A 4OVXA 3NPUA 3XIMA 4QE5A 3T07A 1JQXA 1TTIA 4O4VA 1B9BA 4MNKA 3L9CA 3P7YA 5I3GA 5AKQA 2IQDA 3KFTA 2UY5A 4E2OA 1XHGA 3HPZA 4IQDA 5AYBA 3RLVA 3TEVA 3WD1A 1OZQA 3CYJA 4XQ6A 4O10A 4JYEA 8RUCA 2X16A 3S5NA 3LXBA 1PIIA 4E3TA 1YEYA 4CGTA 1QW9A 3VD9A 4W9TA 5LXXA 4OWGA 5BU6A 4XAYA 3NSXA 1JZ5A 1OQFA 4A2RA 1JFXA 2NT0A 4AC7C 3TTQA 2RFGA 2EULA 2FZ9A 3QPEA 3GAKA 1UWIA 4AC1X 3CUGA 2VEPA 1YX1A 1AL7A 3S5YA 2WJEA 1MRAA 2DZPA 2YCIX 3O63A 3UR5A 3GD6A 4D9PA 4BHYA 2ZUVA 3NPWA 3FGCB 5FJUA 3VFCA 4BQ2A 3LCHA 4AY8A 1R3TA 3IV3A 4ACYA 1QT1A 3TN5A 2E6DA 3TCSA 1YNQA 3KLLA 4L9ZA 5DMNA 4Z1YA 2P50A 2JZVA 3IV8A 1GYNA 5D8WA 5HT1A 4IG2A 2CWNA 2D0FA 4DJFD 3EYPA 5DIUA 3ARVA 1MDLA 2VR4A 1QRQA 2JALA 1E3ZA 3SB0A 1W3LA 2CBJA 3SRFA 3EXTA 1RR2A 4HJWA 2NUWA 2I16A 3GVWA 1J2WA 4O52A 1BYDA 1ROTA 3BVJA 2H3BA 3OVPA 4JKLA 1SUXA 1S46A 4LAXA 3E5BA 3E96A 3OGVA 1PPIA 4Y9PA 4I8DA 4JQ4A 2IQ0A 3W72A 4MKVA 3PS7A 3ECQA 3TCEA 3OO2A 4GXMA 4KBXA 4IIHA 1JNDA 4GHRA 1POJA 1TRIA 5F2MA 2Y7DA 2IF4A 3GVGA 4F40A 1Q13A 3NFUA 1GJPA 1V77A 3AMLA 2QUNA 5HK4A 4PMJA 4NAFB 4R7JA 5BCAA 1K70A 3VDBA 1B3OA 4WLCA 2I7GA 3ZQ9A 4OGZA 1B1YA 3D6NA 5HA7A 1LDCA 1L1PA 2DUXA 1VF8A 1RLDA 1HG3A 2ZX8A 4GVFA 3CGMA 1XLFA 3PBWA 3NQEA 3ARTA 5EY5A 3CL7A 3BZGA 1A50A 2C3ZA 4ATLA 1VCGA 2H8XA 3VNYA 2BVWA 1TE6A 3OYZA 4A35A 3WUBA 3SAZA 2I5GA 4AZCB 3UG5A 4LAKA 4DRQA 3OZOA 3PUOA 2PD5A 3KZPA 1BRLB 2BXVA 1GUVA 3G6MA 1YKWA 3Q4DA 3W7LA 3R89A 1OCQA 4CQ8A 4GINA 3HOJA 4GE8A 3UETA 4HKPA 3W26A 3UVAA 2X1RA 5HOSA 4CCZA 4Q4SA 3AISA 4NAEB 4PE8A 5CC5A 3OHMB 4CNPA 5A6LA 3TC5A 2HWGA 1FH9A 2GSEA 4AWSA 1NF7A 4FX6M 3W1AA 4JX4A 1B9ZA 1K8ZA 3W1RA 2ONEA 2WZTA 4W8AA 4NNCA 2YYUA 1R9YA 3NL3A 3CWNA 3H2OA 4GIEA 2VGFA 1C91A 4X9YA 4LY4A 1HVXA 5HTGA 4P2VA 1NSJA 2ZX5A 1M3UA 4A8IA 5FF0A 1H09A 3DIPA 2PDFA 4IISA 2QVNA 3LHWA 5CPTA 3CV6A 4B90A 4MOZA 4QZVB 1GZ1A 3MSRA 3WQPA 3HPSA 4AWTA 3AIBA 4HT3A 4F9DA 2V5LA 3KTCA 2WSKA 1GOOA 4UQBA 4JIQA 2EKGA 1EXPA 3G8RA 3N25A 1R7OA 2Q8XA 1OC5A 1DXEA 1HJWA 3UZZA 3WLJA 4R7WA 3SGZA 3HURA 5CBIA 1FWIC 4DO4A 2C1GA 2EJ1A 3VNZA 3WCZA 3SCOA 1X7FA 3QV7A 2WXDM 1TE1A 4G9PA 4BFAA 4UNLA 3HGRA 4HN4A 1X8FA 1BQGA 3WEOA 4RL3A 2PN0A 3WD4A 2Z1BA 2QUUA 4B3KA 3VZYA 1T96A 4WOQA 1XYAA 3OLEA 1H1NA 4HPJA 4S1FA 3W7NA 1IEQA 3DFYA 3N12A 5DQPA 1V7YA 2VX7A 4WF7A 1TREA 2VFEA 5MKGA 5FJJA 1TPVA 3TDBA 5D05A 2OLHA 3HV8A 3ANUA 3KXQA 3VMNA 3S6OA 2DG3A 3TTOA 1O7AA 3NZGA 4AW7A 2B7NA 1LCOA 2I9UA 4K68A 3TYUA 4PGLA 5C2CA 3MBFA 1XFBA 2OO6A 4U4MA 1HJSA 1GKQA 2CNCA 5EMMA 2A3LA 2W62A 1VCVA 3MDYB 4Z2KA 3LUOA 2RDUA 4GABA 3BAXA 3OZMA 4EAYA 5JMUA 4CUCA 3ARSA 5KINA 2AQVA 3VNIA 1TFVA 3WBWA 1H50A 4JX5A 2JFEX 1TV4A 1TA3A 6REQB 3ICJA 2OLSA 2DIJA 4KCTA 1YIXA 4L56A 3UCQA 1QDSA 3N13A 4HU3A 3C0JA 5EYWA 5F4WA 2NX1A 3E0WA 2TPSA 4UMCA 1JCJA 2NW0A 2FB2A 2ZICA 4HCHA 2QEZA 3EWUA 2WQPA 4HK6A 1J0YA 4WKFA 1ZLPA 1JI1A 4GC3A 5LNUA 3KVMA 1JUKA 5D03A 2OWWA 1F3EA 4IMAA 4E3VA 2R9RA 3GR4A 4LYKA 1E15A 2WCAA 1MRQA 1O5RA 1UZ1A 4Y7EA 2F7FA 3STEA 3LCXA 1QASA 1GVSA 1QHZA 1UKOA 3GC5A 3GBDA 4J4NA 1YNYA 3B8SA 4H8VA 3TTSA 3SCNA 3NEVA 4GK8A 3APTA 3MYPA 2IKJA 4DROA 1DJZA 3JVAA 2OEMA 4ACZB 1L2UA 1VBGA 4JTCA 4GJIA 5DX7A 3AXMA 2FZBA 2V3DA 1YLVA 3WLPA 3WLMA 1VFLA 2WZIA 4CD6A 3EX3A 5CAKA 2RKXA 2H6RA 3B9DA 4R88A 1C8XA 1G4TA 2GGIA 1FKHA 4J3SA 3U2ZA 1J4IA 3QTGA 5I3IA 4EP8C 1BWLA 1T99A 2VZOA 2WCSA 3EEZA 1NMWA 5H8MA 3WMSA 3ZT7A 1MFVA 2JBMA 5DEZA 2PWGA 5D9MA 2FTYA 1QFEA 5AFDA 2QDEA 1OY0A 2OKOA 4O1EA 1XYFA 3ZIZA 4UTLA 1I6NA 2AAAA 3GDMA 3G1VA 8CGTA 2GJXB 2QCNA 5M2FX 4F0KA 3WFZA 2D2OA 5TNVA 3E38A 5I24A 2J78A 2P76A 5BWAA 1G7UA 3SUWA 3C2EA 4LJ3A 3HG4A 4WIWA 3A22A 3B8TA 3OVRA 3REQA 1WBHA 1OF8A 5JBDA 3PC0A 2WMHA 2PWEA 1IR1A 4J1OA 3W37A 4H6RA 4IMCA 3NI6A 2ZC8A 3O06A 2QDDA 3W28A 4KEUA 1QJWA 3VOGA 2D3LA 1AH3A 1XR2A 4GNJA 5F4XA 3WDQA 3ZMRA 2Z6IA 1GJWA 3G1DA 2G0WA 4ADSA 5DANA 2O56A 3FYYA 3OB8A 4LEQA 2OELA 1V3LA 3XISA 5AVHA 4F0LA 3VOHA 3THAA 1M7PA 2FIQA 1V3JA 3LMYA 4PMVA 4RDYA 1UMLA 3TJXA 2R1PA 1I2OA 2XGZA 3P67A 1XBVA 4C6IA 4HZ8A 3C86A 4JFJA 4RNFA 4LRSA 2QZRA 1Q4NX 4MWAB 1PINA 1NWUA 4ZOAA 4EXQA 3M64A 3ERPA 2HBXA 4LYQA 3ZWSA 2A6NA 3T9PA 4MVAA 1XLDA 4LAVA 3PJTA 4NXKA 3SADA 5D2XA 3GWQA 1AH4A 2WM0A 4H83A 3ABZA 4WSKA 5A8GA 2PSNA 4XUYA 4TW7A 3WQOA 1RAKA 3GXTA 3PK7A 3QC3A 1PKMA 4IT4A 4HHLA 3PR9A 1QVBA 3UXDA 3GZ3A 1P6CA 2Y0FA 5HNNA 1BTMA 1XUZA 3STCA 1TWDA 4QRNA 2BTMA 3W7CA 1F3XA 4X63A 3SUSA 3IK2A 4MFDA 4UR9A 4FNRA 2RSEA 2C15A 1ALDA 1CGWA 1GGOA 1EDTA 4UBPC 1FCUA 4MNLA 5HMEA 3IJDA 3OBEA 4M51A 3UXKA 2XDFA 3EKZA 4PBGA 3VIHA 1DOSA 3PZQA 2J7FA 2Y78A 1A80A 1OYAA 1WOAA 4MJZA 3P0XA 3LENA 2EAWA 1YRRA 5BROA 1X6NA 3COTA 1TO3A 4L5ZA 1B54A 4O0ZA 5DIVA 3STFA 2V38A 2E9MA 2DQXA 4JFVA 4JFSA 1RK6A 4FALA 2Y61A 4A2SA 2XPAA 4TW6A 3E2VA 1A0CA 1HKIA 3BW4A 5HKGA 3VTRA 1TJRA 5GVJA 2G3FA 3SUVA 4N7QA 5ABEA 3R12A 2VQUA 3P3BA 4JYSA 1DHKA 3DFHA 2BVYA 3NQVA 4M8UA 4UC5A 3QW3A 4JQ3A 1KBLA 3M6DA 4PMNA 3L2IA 4DB7A 2F84A 4AD1A 2PV3A 1S1RA 1X38A 4IMDA 3VGFA 5HAOA 4EKJA 2QDGA 2GJLA 1ODZA 4QCFA 5CC7A 1ROUA 4B4HA 5E0KA 2ZQ0A 5M1TA 1XCFA 3CQ0A 1SPQA 2CBUA 2XIQA 2QAPA 4LVBA 4H4IA 1MNSA 3HPFA 1JZ6A 1JYVA 4UTMA 3GU1A 4V33A 4K38A 3PWGA 4J3ZA 4MPKA 2FPVA 1KW1A 3TLLA 2FH8A 1GVIA 1QHPA 3CUFA 2NWSA 3TUUA 5EBAA 3WDPP 6ENLA 2WHLA 4Y9MA 2PTXA 2VFFA 4RE2A 4XZNX 3LQLA 4DHGA 3T44A 2WSYA 2E5CA 2QV5A 4F2BA 4GUHA 1W1YA 1W8GA 1FKDA 4R27A 4C1NB 1H63A 5G2HA 3W4RA 3IJIA 3UJEA 4W5UA 2ACUA 3QV8A 2Z00A 1JZ4A 2WWDA 2NXHA 1QUMA 3KOXA 2VWTA 1P5BA 4PBEA 4GI4A 2VENA 2AGTA 2YOCA 2VMFA 4E2DA 5DT7A 1E6PA 1SJCA 3UWQA 1KR0A 3FS2A 3FY1A 3ZT6A 2XVPA 1KBKA 2XSAA 3M07A 4RUBA 4D6EA 4JKMA 4QLKA 3WX7A 4L6DA 4BJHA 4W9QA 3DFPA 1NH6A 2OGYA 3KS6A 1CT5A 2BASA 1KBBA 1PX3A 2PS2A 4PMDA 1ZCNA 4ODMA 1RCOB 1GORA 4IGMA 6XIAA 4REQB 3SCVA 1XYZA 4I9AA 2V8ZA 2YDAA 2BOGX 3O16A 3SCRA 3VGDA 1GOXA 1O68A 1CXIA 4AIUA 3GNRA 3DKJA 4N6FA 3A21A 3H4GA 4FSAA 1VFUA 4I8YA 5HW8A 2IKGA 4JIHA 4UTWC 4LF1A 1MNZA 5A6JA 4HNOA 2J7DA 1UQYA 4Z1DA 4LU0A 1NWTA 4US5A 1Q6UA 1IEXA 5E5CA 3EMQA 3W7PA 1PXGA 3GNDA 4G7EB 4A3YA 2ZRYA 3SECA 4U2YA 1P4CA 1A5LC 2OO0A 1YYAA 1X98A 3A6OA 1LBMA 1ZZMA 4DF1A 2Y4SA 2CZDA 4NHVA 5DY2A 3MUZ1 1QWGA 1WZAA 4H9MA 4X9SA 3QSTA 5LA1A 3H53A 1UH4A 2RAGA 2FDMA 3QLDA 1Q65A 1F73A 2XVKA 4HJFA 1EC8A 1GQNA 2GGJA 4GI8A 1NOFA 1HKJA 2PF8A 4I5RA 5BRPA 1OYCA 3MP5A 4U2ZA 2D1ZA 4A8RA 3NQFA 1GVYA 4QROA 1J0KA 4HARA 3N3TA 4C5ZA 4B5VA 1KFKA 2DQWA 2N87A 3THUA 1HKKA 3GZAA 3O5KA 2PDXA 5FJTA 1W1TA 3EA2A 2ZX9A 3W2NA 5IXEA 3CZ8A 3HZ3A 4PSRA 3U3HA 2FVLA 2R1MA 3BCDA 4AY1A 1YPFA 2QQ6A 4OUIA 3W7GA 1GHSA 1HJUA 4HK7A 1VZWA 3GTXA 3WK2A 3NL2A 1QNSA 2OWXA 2PLJA 2V63A 1PDYA 1EA9C 3S1GA 3UQIA 4BZYA 4K8GA 3LCIA 1UR8A 1LG1A 3GDBA 1H1YA 4LS0A 1OCJA 4DJED 3WQFA 3I6EA 1IEWA 3BE7A 3TE9A 3AUJA 2HE8A 1QPFA 3ARWA 3ZJ6A 4LUYA 1WKFA 3CZKA 1MXDA 3WH9A 1OIFA 1ZP3A 4ZBCA 3B0UX 1J6YA 1FCQA 1EIBA 3H2MA 1M5WA 1YXCA 3LS9A 1EJXC 2Q3OA 1GZGA 2X0SA 3VOFA 4S39A 4FLOA 1CZ1A 1BGGA 2QUMA 1B31A 2Y70A 2VUYA 4DUWA 2ZR4A 3ELFA 1U83A 5AN7A 3T40A 3BG5A 4P8WA 4LCSA 3ENLA 3I3DA 1CCWB 2NLIA 2ZZ7A 4MZ1A 2G5WA 3VD4A 1P48A 1EWEA 2ZIDA 3AWNA 2OTDA 3ZZ1A 3TN4A 1EJUC 5HJLA 4LUTB 1MW3A 4UB9A 3NTYA 4RXFA 4V2XA 3WLQA 3LGGA 4NX5A 2ADAA 3GUWA 3RHGA 3CPGA 3W1LA 2DT1A 2W9MA 3O8AA 2QV4A 1W91A 2E1WA 3UR7A 2GWNA 1HZYA 5A6TC 4J9JA 1KM1A 3S1XA 2J25A 1LQ0A 1IV8A 2IPJA 3OW1A 3NVDA 4JEJA 1SZFA 1N7KA 4GYPA 4FMVA 3NCOA 4ZB5A 1FDZA 1LUCB 1E4IA 5A8OA 4Q8VA 5IOBA 2BXZA 4B2DA 3E0FA 1IX5A 2VCDA 3WNLA 5CPOA 2PDUA 1W3JA 1E51A 3R8GA 4C6KA 5BXRA 2POZA 4ILSA 4QBXA 1YE6A 3OQEA 4Z2IA 1UR4A 1TPWA 2BDQA 1WAUA 3W6LA 5GNYA 1L2QA 5C0QA 3MMTA 4Y6GA 3IACA 3BJSA 3VIFA 4AZ6A 5IHRA 1TV2A 1XQKA 1TPUA 3G1RA 3VM5A 2VR5A 2XP7A 3UYIA 3QQ1A 2C19A 5EGRA 3QMRA 4B5TA 9RUBA 2EG8A 7ENLA 4Y9NA 3GUGA 1XSIA 4O1CA 1NOWA 4LUSB 2PBCA 3ZSTA 2QULA 1BYBA 5AC5A 2D20A 3M0XA 2X1UA 3CZGA 1VFTA 3MV01 4Y96A 4F9JA 3KVKA 1RPXA 2V2CA 2C0HA 3V16A 3GVVA 3NG3A 3C2RA 2WVVA 3QY7A 1UB3A 3UVIA 4U5KA 5I06A 3B8WA 3AMCA 3WFAA 1XRFA 3CAQA 2PLMA 2WJZA 4GVGA 1UJPA 2TSYA 2PDQA 2V2DA 4DBDA 4TMCA 3STGA 2XWDA 1W54A 1E0WA 3BCJA 3W2LA 1EUAA 3BL3A 2WKJA 3GDKA 3LCFA 3M5VA 2AMXA 2TODA 2QMJA 3IARA 3G1FA 5RUBA 1PWMA 5HR6A 4PUDA 4P8VA 3Q67A 1B3ZA 4CU8A 4LW7A 4OZOA 2CHRA 4ZQOA 5CC3A 2VQTA 3S6DA 3GTYX 1RA5A 1RLCL 1ZALA 4JNYA 4OHQA 3N4FA 2CKRA 1Q7ZA 7PTDA 1IEVA 4AMAA 3WNKA 3AYTA 1YBQB 2EPOA 1YHTA 4MB5A 3C2YA 2YXGA 1H49A 4R85A 3TZFA 3BSHA 4KR0B 1X6UA 1S2WA 3WLRA 2PDWA 1P0KA 2PDBA 4KFNA 1ODUA 3W7RA 3E49A 3MMUA 4HU8A 3DC8A 1W26A 2HXTA 3UEQA 3AZTA 2WMFA 1B5TA 3F4CA 1DQWA 3OP2A 3ZLHA 4ZMGA 2WQDA 3W1MA 3RPDA 1VEMA 1E9LA 1PZ0A 2H90A 3AC0A 3WF0A 4ONVA 4QGCA 2ZTKA 1J6OA 1VIWA 3HGOA 4JTIA 1IEIA 4JHZA 1IIHA 2OYKA 3QYQA 4BF7A 2EBNA 2O4QA 1IXQA 2INZA 4DQWA 1LYXA 2YXXA 3ITCA 2Y7GA 3BLLA 3IVUA 1GOQA 4XBKA 1Q63A 4GVIA 1NU5A 2RURA 1UH3A 4DPPA 1GVEA 5CLTA 1JYXA 1E56A 3DYPA 4GIVA 5GJMA 3R4IA 4UMBA 2DT0A 1V0MA 3S2MA 3GTHA 3R8RA 1L6SA 3RX3A 3KZ7A 4GQBA 4MMWA 4LNCA 4AFYA 1NF0A 3K1DA 4IQCA 3O5RA 5A1AA 4ATDA 4ICCX 2R91A 1OC6A 4GWEA 4ZCWA 1OGBA 1E6XM 3MMWA 4AD5A 4LGXA 1M01A 5J04A 2FVMA 1UC4A 2A5HA 3KRSA 4FNSA 1GVFA 1FFQA 3WQ8A 4AH7A 1ME7A 4HGXA 3KX6A 3U8GA 2IUZA 1EZWA 1TR9A 3BURA 1EO7A 1XYBA 4Q6XA 2C0AA 2QCDB 2ZRVA 3WF4A 2NLYA 1KXTA 2WCGA 4LS2A 3IJ6A 4PRWA 3RU8X 3SGUA 3W2KA 5KSWA 1SW0A 3S46A 3WD3A 2VRKA 4DXVA 1EIXA 1J0IA 3AMGA 3NQAA 4WD0A 2YL9A 1YQ2A 3WNNA 2TRSA 4OOZA 4CNTA 2RGMA 2BFGA 3RCYA 4NAFA 3O5IA 1V0KA 2AL1A 5A8QA 3WNPA 3TJLA 3UP8A 3JZEA 4DEFA 5C55A 3SRKA 1JZ8A 4RV8A 4Z1BA 4LVGA 4AZCA 2VCCA 3I7RA 3W53A 1QW8A 2PU0A 1BRLA 2QJMA 3W83A 3OEXA 2W63A 1BTCA 1H5YA 5CZ0A 2OSWA 1OBAA 2WV8A 2W66A 3LB0A 3EGJA 3ZT5A 4NAEA 3OA5A 2GDUA 2PURA 2R94A 4ENLA 2VOTA 3CBWA 4PMZA 4W8LA 5AHIA 5AHMA 2CZEA 3IK4A 5D9PA 4HCDA 4YTTA 3N3MA 3KZSA 4JQAA 4GKTA 5C71A 2AOSA 1RY0A 1HVQA 3DENA 1UD2A 3LN3A 4HSNA 2LJ4A 3PRBA 2K8IA 3PZUA 4HPNA 1ZBWA 3ALFA 5XIMA 2FTWA 1P0EA 1FKXA 4MUPA 1VPQA 3DDMA 1WDSA 1U2YA 3DGRA 4M7SA 1PB0A 4GPNA 2HNHA 4NZFA 4NKCA 1R3RA 5JH1A 4JN7A 2DFAA 4LX4A 4Q4PA 3STPA 1DJWA 1OWQA 5DFAA 3M43A 5I3FA 3BH4A 1IF2A 2FQIA 5FF3A 3ZO9A 6TIMA 3TYBA 1BWVA 1LLOA 3VE7A 4AMCA 2BX7A 1PHWA 4PMUA 7ODCA 5HWBA 1FWDC 1RVKA 2X8RA 3GXNA 1VPXA 4JTSA 1SJBA 3VIPA 1R38A 5A6KA 3IRDA 4PMOA 2PCEA 4MZ8A 5AC8A 1CIUA 4E4FA 3UJFA 1TWSA 1W0MA 3VGEA 2F2KA 3TC7A 3CU2A 2JEPA 1YADA 1AW2A 4Q22A 4GKLA 2OZ0A 3B8DA 1OM0A 1VEOA 1X96A 4Y9OA 1B3WA 3URAA 4EXAA 1HT6A 2RJHA 3V75A 1E43A 1PYFA 3PZIA 2PDNA 3C2VA 3TA9A 4QS5A 1M04A 2D0HA 3WUGA 4JFMA 4ODQA 4H8UA 3KVJA 4YVXA 4LALA 1GOIA 3HF3A 3O5JA 3L0GA 2ZQTA 3V36A 2X30A 3HG2A 3NZ1A 4HTBA 3AIQA 3MHFA 1NQKA 1JPKA 4LVAA 3L21A 4UFIA 7TIMA 5JH2A 1JYWA 3PZNA 4JAWA 1H7RA 2DVXA 3NQ2A 1GRJA 1WA3A 2GGHA 3WBEA 1HF6A 4JQ1A 3LK6A 5XIAA 3BANA 3T0BA 2EG7A 3SRDA 1H7OA 3VOIA 3VNDA 4C6EA 1AQHA 1FP8A 1T8XA 9CGTA 2ZOXA 1ZUAX 5M3WA 3L5MA 3F5LA 3TW6A 1F7BA 3HQPA 3WL0A 3P82A 4E6MA 1A0DA 1CXEA 1EGVA 2EKCA 2BS9A 4LWWA 2GSHA 2R1LA 2QLYA 3QYSA 4X22A 2TAAA 2B31A 3EA1A 5E70A 1EX5A 1E3XA 1XLJA 4JQ2A 3W85A 1KBIA 1S5VA 2OKTA 5CSUA 3C61A 4ZQRA 1EA0A 3AMKA 2C91A 2PZ0A 1QI2A 4DRMA 2ZQUA 1XLCA 3EX1A 1K7FA 1T11A 4GY0A 3MSYA 3N11A 2CPUA 3AIEA 1H7XA 3GPKA 6PTDA 2DW7A 5A2CA 4UFLA 4IHCA 1TQXA 1K9EA 4C6NA 2OOGA 5HWMA 1AMYA 3VKDA 1KWGA 3UWUA 5HJXA 1Q4WA 1RH9A 3PBMA 4DLFA 4S3KA 4V27A 3EDKA 3L67A 4DO6A 4EIVA 5HJYA 5LXEA 1FWFC 4DN1A 4JTDA 2ZUUA 4WJEA 1UUMA 1ZS2A 4C6OA 2A0NA 1NFPA 3QHOA 3V7PA 1QPLA 1JFHA 4PUWA 4DZ2A 2CLEA 2YR1A 4LCRA 1AJZA 4DJDD 4AZ5A 2EQDA 3U2CA 4AX6A 3UA4A 3BG3A 3NEHA 2VWSA 2DZBA 2PDLA 3DX5A 1PZ3A 5E93A 4HHHA 4ZPVR 1IZKA 2O4MA 2B7QA 4KEMA 5AECA 5HQMA 4W7VA 5MF5A 4KWUA 4UCGA 1AD1A 3TZNA 2CLLA 3J7HA 2J88A 1SR0A 4W88A 1QO5A 5I03A 5K9DA 3LHTA 1A5AA 4NI3A 4FI4A 1W3HA 3KBWA 5FD0A 3TR2A 3W1QA 3RF9A 1RXOB 3UJ2A 1UBSA 3S2CA 5KMYA 2HEJA 4HB7A 1Z32X 1WAWA 3W84A 1H62A 1SFTA 4DZ5A 3HO8A 1RCQA 4YYCA 2IKIA 1G67A 4UR8A 3DU0A 1H51A 1DJHA 2QCLA 1D3HA 3THQA 1KM6A 4DNHA 1OFAA 3LRKA 2ZQVA 3L0NA 3WMBA 2I56A 1BVWA 3GS6A 3I68A 3UG8A 4ZOCA 3A4WA 1S2UA 2HRWA 4J35A 2ODOA 2W5FA 4X61A 1ZJIA 3BLPX 3MCNA 2BMBA 3R79A 1PAMA 1KB3A 5HWJA 3I10A 2MUCA 3AHYA 3IUHA 1R87A 2DDXA 4NY2A 3S9ZA 4B91A 3CB3A 3FEMA 4XO6A 3A23A 4QIBA 5AHEA 3TAOA 3L4XA 5XINA 3E2SA 3ZS4A 2QGHA 1T0OA 3L12A 5E1QA 2YBVA 4JCLA 3IEBA 1PUDA 2PU1A 1XF0A 4XBJA 5PTDA 4ZXOA 2P0IA 2ZDRA 4I9MA 1E9IA 5MKGB 1QNVA 2GYIA 1KFWA 1KGXA 3AS3A 4YWIA 4KIRA 4E2BA 1GTEA 3CTTA 4G1KA 4B92A 1V51A 4H04A 4MWAA 2E6YA 4LOCA 3S8HA 5J6EA 1F5ZA 2XJ7A 4AXNA 3WL1A 4PTDA 3BK0A 1TJPA 4ODNA 5F1VA 4PCPA 4IFRA 2X1TA 2QYGA 1ZU8A 5SWUA 1XIDA 1W32A 2HDJA 4GUJA 1HW6A 2QR6A 2VGIA 2J6XA 1OFEA 2OMAA 1NEYA 3KHDA 1W1A1 2RH9A 2CETA 3PNZA 4F79A 3EAUA 3UXIA 2ZR5A 5CZTA 3TK7A 4MUZA 4XVEA 4XD6A 4X60A 4XZWA 3O5FA 1JCNA 5DRCA 1FKKA 1GPWA 3GM8A 3U5YA 2C6QA 1GONA 1OG0A 4NP7A 3A13A 4WGHA 5CBJA 3OYXA 2G3NA 4FZIA 4C5YA 3VKJA 4W4QA 4HA0A 2NV1A 1CGVA 4DRPA 4EANA 1NSGA 3CJPA 3OBAA 4X3ZA 1EHAA 1ZK6A 3VOJA 3HV9A 4LANA 1W1PA 4TW8A 1C9HA 3AIUA 2DG9A 4DVOA 2TYSA 1QOXA 3IHZA 4OT7A 2DSKA 4FAPA 2RUCA 2P8BA 3KRZA 5I6SA 1B6CA 3M46A 3H7RA 3E0VA 1XINA 4O50A 4XISA 1NM9A 4D1IA 4GMEA 1JAEA 3FAXA 4QFUA 1DJNA 5ABFA 2QGYA 1JIBA 1BEUA 3VM7A 2GWGA 2WO5A 3DBPA 3NA8A 2JIWA 2VZVA 3IUDA 3KM8A 4PODA 4JTGA 2G37A 4KS0A 2CZVA 3CQKA 1A4LA 3S42A 2YCEA 5D33A 1DWGM 5FAGA 2BV9A 2ETNA 1X8CA 2ZE0A 4O28A 1JCTA 4HA4A 1XM3A 3INPA 4DH0A 1WKYA 2Z24A 1LLWA 1K77A 5E6ZA 2NVAA 4L1XA 2DSUA 3KACA 1VJIA 4FS9A 3O5MA 2XVLA 3WYZA 4FOUA 4Z42C 1JRCA 2ZE3A 2ISDA 3NDYA 5AC4A 3VO0A 1R46A 4S3JA 4B5NA 2P3ZA 1KT1A 2JF6A 1JUBA 1CGTA 4N4QA 3WK1A 2X7VA 5B80A 3H6OA 3NQBA 2D24A 1E6ZA 4AIBA 2CITA 4S23A 4J3UA 1J12A 2VFDA 2CZ5A 2Y5JA 3TVAA 5T26A 1CECA 3OZYA 4PH6A 1KCXA 4IX2A 1EP1A 1OFPA 4BY3A 3NR0A 3L2MA 5K4ZA 3JYJA 5KTLA 3M7WA 1FWHC 4J7RA 2KE0A 1UR2A 1HJXA 1HX0A 1JPIA 1D7IA 2PPOA 2WM1A 2KGJA 3P84A 3G2GA 4AXKA 1HUVA 1UROA 4IQLA 2E28A 3MBDA 1A4MA 2Q3RA 3L5AA 4C1NA 3REQB 3PZVA 1Q3NA 1JPDX 4JPGA 1OD8A 4MM1A 3B4YA 2E9LA 4CQ9A 4EVZA 4IXXA 2RUQA 4TTGA 4UFJA 3GFYA 3W1UA 2HPIA 1ZL1A 1UZHA 4U28A 3C0QA 3BG9A 3C52A 4NL1A 2F23A 1BYAA 1HL2A 1VFOA 4MDPA 3FW6A 1UUOA 3KBVA 2J7HA 4UTTA 4U33A 2Y8UA 2ALRA 1IWAA 3SFWA 3W76A 4ZS6A 1WOBA 3BAJA 3DXIA 4HYWA 2OSYA 1Q5MA 1FD9A 4DPQA 2ITKA 1JPMA 4Z2HA 2BSLA 2B5UB 1QNPA 3MTWA 4D6HA 1Z42A 3DG7A 4QP0A 2WJFA 1VH7A 1ONEA 5HQLA 4QISA 3VNKA 4QJ5B 3S2NA 4FXRA 4DUOA 2G95A 4QG8A 5G1TA 4DXKA 3P93A 1VFSA 4REQA 2OWCA 3TJ4A 1F76A 3EWYA 1FCVA 3VNJA 2ZA3A 3OTRA 4C6QA 2WVSA 2G97A 5D2WA 1XIBA 1IGWA 4C1LA 3MWAA 3H8AA 1Q6EA 4LVDA 4BI7A 1W3NA 4M29A 1XS2A 3ITLA 4M56A 3BC9A 2QT3A 2G4JA 5BXSA 4UMAA 4DX3A 1SMDA 2XH0A 4DZAA 2V5DA 4HD5A 5K9XA 5I98A 1KM3A 3BXWA 1F74A 2ZRXA 3VINA 3NAVA 1AUSL 4KW2A 2WMIA 1YXDA 2WSRA 3WF2A 3MUCA 1Y8BA 5LNRA 4AZGA 3QXBA 1CBGA 4I7WA 1XIEA 1K1DA 3BLEA 2G50A 4NQ1A 4LV9A 3W2UA 3R11A 2A21A 1ISZA 3GLCA 3EOOA 5CEWA 3P5ZA 1AFSA 1M7XA 3WJYA 2WOQA 4CQDA 3LZ3A 1XCWA 1ZAHA 4MHBA 5FI8A 2VVNA 5GNZA 4MJMA 4HMDA 1GW9A 4M82A 2FMNA 2OOFA 2UY2A 4AEOA 3EKLA 5DO2A 2VHLA 4JTAA 2QPSA 1TV8A 1CPUA 2A79A 1TWWA 3TONA 4WSHA 4KMQA 1JYNA 1R7AA 4M1RA 4EF9A 1V79A 1KTBA 1UYQA 2B7OA 4NJKA 4RR4A 4OECA 4DJFA 1XYLA 1SFLA 1VIZA 3VIOA 3W7JA 1V0LA 2X05A 2ZC1A 4S3FA 4HSHA 4LVFA 4IFKA 3WF3A 3CMFA 3TW7A 2D22A 1IR2A 1OVDA 3HMCA 4YMZA 3LTSA 5CJ5A 2PB1A 4HMNA 5M5DA 3W70A 4XZHA 2DSWA 5CPLA 2J66A 1A3WA 4IIDA 3P14A 4KT2A 4UDMA 4GO9A 1ADOA 1XL9A 1OT1A 1XLKA 3TU9A 1R3QA 4B9YA 3VFLA 4NIRA 3EIPA 3EPNA 3VX0A 4GY7A 3CZJA 3VNMA 3B9AA 5CC6A 3DHDA 1U5HA 3R0KA 3TTYA 1A5CA 4RX0A 4ODRA 2QIIA 1PWLA 3LDVA 3M0JA 4UQDA 5FEPA 4AHOA 4PRTA 4XZIA 3ME3A 4GYPC 2NXGA 2DJLA 2J47A 4UR7A 2VNCA 1XCXA 3OBKA 3UD6A 4NNBA 1FQ0A 1BXNA 1GYMA 4KWOA 1KBJA 2A7PA 3L5LA 1W2VA 1XIJA 3P6LA 2YLAA 4AD4A 3QPYA 4GACA 3U2OA 2RUSA 3BTNA 3M6YA 4MJ4A 3KUMA 1XG4A 2Z2AA 4O17A 2ATMA 5CJMA 4LUTA 1UUQA 2D23A 3N29A 1KFJA 2ZUWA 2ZZ1A 2OQLA 3KOFA 4PB4A 4DUVA 2HQAA 1CW2A 3M0YA 1BF2A 2YL5A 3MI3A 1WPCA 4JBRA 1UR0A 3EMZA 3NTPA 2EHHA 3EDJA 3Q45A 3GC4A 1F8AB 3GW3A 3VGBA 1EYEA 3M47A 1CB7B 4IUGA 4ERAA 1PBKA 4MG4A 4ZTYA 4DRHA 8TIMA 5LKYA 3VC6A 1YNPA 3W02A 2WKGA 1TPDA 2Y62A 4TOQA 3GU9A 2XH7A 1OINA 1SFJA 2QF7A 1AQFA 3VA8A 5LGZA 1KA9F 5CJNA 2FHBA 1ZP4A 2X41A 2FJKA 5CSRA 4S3BA 4CCDA 2YLLA 4MGVA 2WNQA 4JICA 3A3XA 1ZNNA 3DERA 3WQCA 1F2JA 3QTPA 1EGMA 2NZLA 4ZZ9A 2E5DA 3PJXA 2QHAA 1OEPA 1X97A 1JPHA 3R1ZA 2VYOA 3TXZA 4W93A 4TO8A 4DWSB 3F4NA 3CM4A 1JDFA 3WK0A 1R2TA 2UZ9A 2XFFA 3N2CA 3VCRA 1SJDA 4YYFA 1J0JA 5T91A 4JOMA 4ADTA 3U9IA 4ZO7A 5I3JA 3UQAA 1I2PA 4OOUA 5JBFA 4WSJA 1QHOA 3NJ3A 3WEMA 2XPBA 2Z1KA 1LG2A 3K8LA 2YDRA 3BLOA 4L9XA 4N2YA 4UTKA 2QXWA 2VEIA 2X1IA 4PMRA 2MLZA 4B5UA 1HP5A 4K3ZA 4UFMA 1T8QA 3C3NA 1DXIA 1NMVA 5AVNA 7REQA 3LBCA 3IJ7A 3AMDA 3LLXA 1P1XA 2VDIA 3ZR4A 4QR6A 3LHYA 3G77A 5EMLA 4QX4A 2BWGA 3FDKA 1TMHA 4RV3A 3V1PA 2W91A 2A3CA 2NVDA 3W82A 3ZVHB 5AYIA 2PODA 3LEPA 3GRIA 3WLIA 4A05A 3KP0A 3ES8A 3IIOA 4GZ7A 3B0YA 3OVGA 4C65A 2Y88A 3MUAA 1EBGA 1PTAA 2J79A 5EB8A 1MMFA 3PRAA 4MSPA 4IL0A 1WBJA 4JX6A 3UY8A 3LRLA 4S3CA 3WD0A 3RAOA 2PGFA 1ZCCA 4ZB0A 2BGNE 3CUZA 3PUEA 1THFD 3WFLA 4LY8A 4D6FA 3FHAA 2OX4A 3VUSA 2ZTJA 1V7AA 1QPQA 4DM1A 5HPOA 2UV8G 1JXKA 3VUPA 1AK5A 2GDQA 4H19A 1P1MA 4ECLA 4GXPA 3UI6A 1NY1A 1O6IA 2GUBA 3SCWA 3V1HA 1ONRA 1B3VA 4L4OA 1H1ZA 2OB3A 2OEJA 2BY1A 3KRBA 1ZCOA 1H61A 4GCXA 3KAFA 2A3BA 3MT1A 1WXYA 3CV2A 2C79A 4XD3A 1A5MC 5HNUA 2Y24A 1TCMA 2M1IA 1DBTA 4P7QA 1DTUA 3BAKA 3LPPA 3NZPA 3UPBA 2PTYA 4CKQA 1PV8A 3LY0A 3O6AA 1WDDA 3NYZA 3VGHA 2GK1A 1OX4B 2A2IA 3TAKA 3WBXA 3FDGA 1RBAA 1UBPC 3FVDA 1AL8A 4Z1AA 3HM7A 1CB2A 4IJRA 1BVZA 4WY0A 5BU9A 1E6SM 3LBOA 4HK5A 4Y90A 3PHAA 4GIYA 2YBUA 4BF8A 4V1XA 1OZMA 1V8EA 4MLRA 2BY2A 3PBVA 3SJNA 1Q6CA 1JNEA 1C9WA 1W1ZA 4WCJA 1VBUA 1VB9A 1S5MA 2OVLA 1TZ9A 3LXCA 3QHNA 5LA2A 1NP2A 1DQUA 4L65A 4PBFA 3W7IA 1HJQA 2H9AA 3HB9A 3I3BA 3WIJA 1Q85A 4FHAA 1LBFA 3LNPA 1EPVA 1U79A 1OGSA 4GX8A 4L6OA 1CXFA 2G8ZA 2NVCA 3G18A 3U57A 1LL7A 3ZM8A 3ZYZA 3H24A 3PUGA 3S9IA 4U84A 3BSGA 3V4BA 4JIEA 2OPJA 3NPXA 3JZUA 3FVMA 2Y7EA 2QPUA 2JGQA 3R94A 1V5XA 3RYSA 1SW3A 4MGGA 4XZ9A 1NAL1 1UH2A 1EP2A 2J7GA 5EMUA 2DZSA 3UCCA 2D2JA 3NO3A 3T4WA 4KERA 1XFCA 4TV6A 3ZSSA 1OD0A 3LXAA 3MHUA 2Z1XA 1T41A 1BL4A 5F4SA 1P5QA 4ZQMA 2BP1A 1R86A 2A3EA 1RJQA 4IUOA 5DY3A 4Y9AA 1W9XA 2FLIA 4ZPWR 2EPMX 5J8LA 4A8NA 2YFOA 5F7UA 1QBBA 1E5JA 1LM1A 3WK3A 2E8YA 4CVUA 1TTJA 3EX2A 5I00A 3EB4A 1S5WA 1W17A 4FXSA 4B5SA 2OXNA 4RE3A 3OODA 1Y5XA 3CT2A 3PJWA 5EL1A 2J74A 2XIOA 4Z0JA 1WCGA 2WAGA 1TMQA 1EQCA 3O6YX 4O54A 1ZY9A 3K1GA 3PRDA 4KFPA 3U0HA 2WVVB 3PZOA 1DWFM 3QR3A 5C7HA 2ZUNA 3RM4A 1E4LA 3IWPA 3I6TA 5FL1A 3O3RA 3T2PA 3ZR6A 4WR3A 4O1BA 3RK8A 3FNDA 3CC1A 4HPGA 3BPWA 4FX8A 1FWCC 1KXQA 4FIQA 4F48A 2ZDSA 1XC6A 4MWAE 1VFFA 2W61A 3DHFA 3AYSA 4KQZA 5AB3A 3KCEA 3L4VA 1XWYA 4OBTA 5A6BA 3MI6A 1FDJA 3A3WA 3VE9A 2C18A 3UNDA 4ZOEA 1LRTA 1J4RA 2PWUA 1NELA 2JKEA 2L5HA 4L9YA 3TFXA 2DJXA 4DZ3A 2X0HA 1FHLA 2OT0A 3K4WA 3S4TA 5D2YA 1DQXA 2PZNA 5H8UA 4A8LA 4MF4A 2ZUMA 4FNPA 5E6YA 1H60A 3BCFA 4PMYA 2G3JA 3SUTA 4J2PA 3AALA 4XB3A 2OFNA 5A6SA 3FA4A 4RCXA 3L0KA 2V3FA 3KDNA 4GG9A 4FAMA 3THDA 2WZMA 5IM51 1AW1A 2YB4A 1MFUA 3DYMA 5BRQA 3RCMA 1MW0A 2PDJA 3PUDA 1DJXA 4W9PA 2V3EA 4RNIA 2OQYA 3C2FA 1OK4A 3KHJA 3AS0A 1K03A 3CZLA 4IPPA 3WBAA 1UWAA 4WK9A 3SR7A 1W9PA 1XH0A 4CQAA 2VX6A 3MI2A 3HA1A 3UWVA 3VMPA 1W9UA 2DPEA 1XRVA 1E72M 3H7UA 5CZSA 2YXOA 3TR9A 1KT0A 3RR1A 2XP6A 2YYTA 3GHRA 3GH4A 1ECEA 1QCWA 2INEA 1U1UA 1DWJM 1C92A 3R13A 1I60A 2RDXA 4B2DD 4MNMA 4TX9A 4WUIA 4M81A 1IQ8A 7CGTA 4K36A 3W73A 4KQNA 1QK0A 1GJUA 3R8HA 3MUIA 4JFTA 2ZXBA 1GHRA 3ITGA 3RM8A 3P8IA 5JH8A 3LM7A 3W22A 3GE7A 1B2YA 3OLGA 1P6BA 4UTIA 2DG4A 2O92A 3WDJA 1R3VA 3PBYA 4RDWA 1LT7A 5JIPA 3WH8A 2UWFA 4UXDA 3SZ8A 4JDBA 2WLZA 4YHEA 1Q6IA 1P0NA 4NT0A 4O53A 3AZRA 3MQTA 2JQXA 1V03A 3PB0A 4L7ZA 3R6IA 5BMWA 4C90A 1F4AA 3WBYA 2BZNA 4IPLA 1G7VA 2I57A 4E8CA 3F5JA 1VD6A 1RD5A 3QKEA 2CESA 3MSDA 2V2HA 3H21A 3M7SA 1CWYA 2VI0A 4OFCA 1DJQA 3IKGA 1MQRA 3KTSA 5CQ1A 2JK2A 2NQZA 4AX7A 2ZZ3A 3KWXA 1EOMA 1W1IE 2FJUB 3UR8A 2HROA 1WDRA 2DH3A 2P8CA 3ARQA 1VYRA 3TYZA 3L68A 3VD7A 3QV6A 1EEXA 2V5BA 4M6VA 3WMLA 3IIXA 4Y8FA 4NJJA 3TQVA 1XGDA 3WLNA 3F4WA 1O5QA 1M68A 4Z1CA 5G2IA 1I8JA 3MANA 1VPYA 2D2HA 4YLWA 4N02A 3A9BA 4YTRA 3FA5A 1IXPA 4H1ZA 4AZHA 2VO5A 1EH9A 4R53A 2E1DA 4WKAA 1IXNA 1KGWA 3AXXA 3G8EA 2WBKA 4JTFA 3I4EA 4S2BA 3TQPA