4DWSB

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
540
structure length
527
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 190
structure length 527
sequence length 540
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsB01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsB02
2BY2A 1JF6A 1K9TA 1JFHA 3VDBA 4AIEA 2CEQA 3GH4A 3IK2A 1HKIA 1Q6EA 1XSIA 1PBGA 2NT0A 4UFJA 2WVVA 3ZT5A 3GBEA 4MJ2A 2VVSA 5A8PA 3ZOAA 3SEPA 1W1VA 1DWGM 3EDFA 1PZ3A 1W91A 2X8RA 3TTSA 5FD0A 3CLWA 1LF1A 3THDA 1HJSA 4LQ1A 2D20A 2J7FA 3WSUA 5DT7A 5I79A 2XHYA 3AIQA 4TXEA 1H0IA 2VVNA 4RE3A 5A6MA 3EDJA 2PWFA 5M17A 2WZIA 2ZXAA 2CKRA 3UETA 3ARVA 1J0HA 5D8ZA 4IUGA 1C7TA 4H8VA 4EE9A 2V3EA 4EK7A 3BAWA 3SUVA 4DWSB 5E6ZA 1ZBWA 2WHKA 3PZOA 2PF0A 2J7BA 2D24A 1G9HA 5TD4A 3CIVA 1E4LA 1CGTA 1MW2A 4W5UA 1IZJA 2EPOA 2VX5A 4JHZA 1X6LA 2CESA 3NYDA 2GK1B 2PWDA 1H11A 1NWUA 5A8NA 5HOSA 8CGTA 1H0GA 3ZJKA 1XV8A 2QV4A 4PSPA 1WDQA 1BYCA 4YHEA 3ARPA 2WK2A 1BVZA 3WDQA 4PRWA 4QAWA 3AS3A 1KQZA 3ALFA 1W2VA 2BHYA 1J12A 4F9DA 4V27A 2X0HA 2YDQA 3RM4A 2JALA 5A3HA 1GUVA 1GQKA 2A3AA 5AYIA 2XFFA 4D6EA 1BFNA 1RP8A 1IV8A 1J11A 3TP4A 2DGAA 1UA3A 4MNJA 4L4OA 3GXFA 3VD4A 1UD3A 2JF6A 3LPGA 1GORA 3VNYA 4GPNA 3VIHA 2VQUA 3WDIA 1C3FA 1HL8A 1W9DM 3CTTA 4AZ6A 3WNOA 1Q6GA 2DH3A 2WANA 4JKMA 4PN2A 1B0IA 3CUFA 3AZRA 1ZB5A 4B3LA 1L8NA 1W9XA 4DM1A 1TA3A 3VVGA 5JBFA 3NJ3A 3WUFA 3RMEA 2DPEA 4PMNA 1KGWA 3T2OA 3VDAA 1W3LA 2Z1SA 3QHOA 2OSWA 3VUPA 1JZ6A 1UD4A 4P8WA 2XSAA 5AY7A 1NOFA 2VCCA 3GDBA 1GQJA 4MNMA 1V6YA 2VZTA 5HXMA 1B3VA 3TTOA 2W62A 3WNNA 5M5DA 3WD1A 1Q6CA 2WZHA 1MQPA 3WUBA 2EXOA 2IUZA 4AZ7A 3APGA 3DC0A 2WHMA 3BMWA 1W1PA 3IAPA 2WLZA 1W2PA 3SUTA 2DDXA 5BXTA 1CPUA 3SCSA 2VX6A 1DWJM 3N17A 1EHAA 4UOZA 4WSJA 2WWCA 1HP4A 1OCQA 4HZ7A 1UUQA 2X09A 3KEHA 4U2YA 4NRRA 1EIBA 5A2AA 1UWIA 3DHUA 3RM8A 2BS9A 3CGTA 2ZXQA 4ACZB 3IJ9A 3WENA 3MKKA 2VCBA 1HJWA 1GW1A 1EQPA 4OKDA 2OWWA 4AIUA 5IDIA 3WFZA 5DO8A 2EPKX 3CHEA 4ZEPA 3AIVA 4H41A 3SCTA 3WN6A 1DHKA 3WH9A 5A2BA 2XG9A 1CTNA 1FA2A 1XRVA 3AIEA 4MADA 4P7OA 1ZS2A 5A8OA 4X9YA 3HN3A 2VZVA 2J79A 2XUCA 1WZMA 1OINA 1VBRA 1D7FA 2XWEA 3LMYA 1XCXA 1NWRA 2DEPA 4RL3A 1GJUA 4F66A 1XGZA 2CITA 4H04A 4X0NA 1YQ2A 4UR9A 1AQMA 4P7RA 4PMUA 2WB5A 1E4IA 1MFUA 2ZUMA 1CECA 3WELA 3VGFA 1I1WA 2FGLA 4XZWA 2WHJA 1HJQA 3S2CA 4AWEA 4PCSA 1BTCA 2GJXA 2BV9A 1VFUA 1FP9A 3OGSA 1E72M 1QI5A 2CHOA 4QDMA 3WNKA 4CD8A 4MDOA 5A2CA 1V3HA 1B90A 4AEEA 4GQRA 4HOWA 3BAIA 3PZMA 4WK9A 4KGJA 3AIWA 2WMJA 5E0FA 1HP5A 1OWQA 1J0KA 1QW8A 2BXYA 9CGTA 1ZJBA 3AS0A 3W4RA 2YBTA 1UQYA 1UWUA 4OBRA 2V38A 3T0AA 1UR8A 3B9DA 3MV01 2DSVA 1WP6A 1GOMA 5HPCA 4GIAA 4UFKA 2OSXA 3VD7A 4PMVA 1JNDA 2NT1A 3BCDA 2GJRA 1EHNA 3GM8A 4JCMA 1M03A 1TCMA 1UQZA 1WO2A 1VFMA 1MW0A 1F4AA 3WQVA 4W8BA 1W9VA 1MXDA 5BXRA 4KH2A 4M81A 3N1AA 2W63A 1OT1A 2X0YA 3F5JA 3I3BA 2X05A 3SCUA 3PTMA 5BRQA 1FH8A 4HU8A 3VIGA 5EBAA 1WCGA 1JFXA 1ESWA 4CVWA 1V0NA 1GVYA 3OLGA 4W84A 2BNJA 4U5KA 1JZ7A 3LPFA 5DT5A 3ZJ7A 2WVSA 5DMYA 1UZ4A 2EPLX 3NSXA 4BZYA 4BQ4A 4GO8A 4E8CA 5IXEA 2ZUSA 3UG4A 2G3JA 1MW3A 1RD6A 2J7DA 3SCOA 4GXPA 2W92A 1B3XA 3AZTA 3VIKA 4W7VA 1JNEA 1QNRA 4LYRA 2VJXA 1GOWA 1KXQA 2XVNA 2J47A 4D6JA 1J18A 2CERA 1CXIA 1HVXA 4QP0A 4AYSA 1G1YA 5CXPA 4HA3A 4P8XA 3K8MA 1JF5A 3NUKA 3SUSA 1JD7A 1QNSA 3SUUA 1H41A 4JZ5A 1B1YA 4MAVA 4D6CA 1ISWA 3WFLA 1BGGA 2Y8KA 1YHTA 4YHGA 1AQHA 1G94A 1UR2A 1FFRA 2UWFA 3AMKA 2F61A 4CD7A 4XX6A 3QOKA 4UFLA 3VO0A 4WKHA 3EMCA 2J7EA 2WPGA 2V5DA 1J0YA 2HVMA 4HTYA 2RGMA 3WH8A 2XM2A 1K9FA 2QF8A 2CBUA 4D1IA 3VPLA 4EANA 2O9RA 1E0WA 1UOKA 2VC9A 3AYRA 3WMBA 3ARYA 1C8QA 3ARTA 3KL3A 3WMCA 4PBGA 1W9BM 4JFTA 2RGLA 4XUYA 4ATLA 3CHDA 3HJEA 4MAZA 1KWKA 3ZR6A 1BVNP 2WKGA 3F5LA 5BCAA 2VRKA 3BLKA 3WDPP 4C7FA 4W86A 3UESA 3WDRA 8A3HA 3VM7A 4JIEA 3NIYA 1J9YA 2CBVA 3BSHA 5A1AA 1QHZA 2D23A 1R7OA 4QFUA 1LG2A 3RILA 1V3IA 1KBBA 3VDHA 1UH3A 1ITXA 3AHZA 4ATWA 4UZUA 3FXYA 4M56A 3DYPA 2YDSA 2XVPA 2YJQA 1U2YA 4OZOA 4V28A 1EH9A 2VZUA 2WCGA 4UQDA 1K6AA 1VFFA 1BYDA 5I0DA 3ZSTA 1WDPA 1O7AA 3PZGA 1VEMA 4PMZA 3PZQA 3I3DA 4TX6A 2WCAA 1H09A 3SCWA 2ZX6A 1EDGA 2FHBA 3FAXA 7A3HA 2F2HA 5FCZA 4LGXA 3FW6A 1XH0A 1H49A 4DUWA 4CCEA 1WZKA 3UR8A 4AC1X 1XD1A 1OGBA 4UQBA 2YLLA 3WF4A 1HL9A 4TVCA 3WDJA 1TE1A 1UR0A 3W37A 2UY3A 3MANA 2ZX7A 4M29A 5D4YA 3CUIA 4HMDA 3MS8A 1X6NA 1OIMA 2J7GA 2YL8A 4GO9A 3ZR5A 3OB8A 2WMIA 4AZHA 3S6TA 2YA2A 1UKOA 1SYTA 3AIBA 4HU0A 1J0JA 3FAWA 1OM0A 1TVNA 3FHAA 3AZSA 4ZE5A 5I78A 3NDYA 3OLDA 1NOUA 1J01A 4MB3A 3MMUA 1US3A 3KWXA 4BS0A 1WE5A 4E8DA 4J3SA 3IANA 5KZ6A 3MO4A 2J7CA 4W7UA 1AMYA 5I5RA 2JIEA 2X2YA 5JH8A 5A6BD 2O92A 2ZWZA 4R5EA 1VJSA 4ML4A 3CZJA 3AS1A 1JDCA 3D3AA 2ZXBA 5M3WA 3K4DA 4UFIA 3RJYA 3AXXA 5I2UA 1Z32X 3M6DA 3VOCA 5I23A 1H3GA 4PSRA 4EAMA 1JZ8A 4OOZA 5HPOA 1QPKA 1VBUA 1JXJA 4MJ4A 3ZSSA 3OGRA 2BY1A 4URIA 3ECQA 4GZJA 3GH5A 3A4AA 1E6PA 3UEQA 3WD4A 3QHNA 2Y4SA 3UERA 1EXPA 1LWHA 1KWGA 1PZ2A 1OGSA 2C8NA 1OB0A 3VU2A 1LLOA 1MQQA 3WIJA 1HKMA 4W85A 3M7SA 2ZXDA 1V6UA 2JFEX 3OZOA 2Y2WA 3N18A 4F9JA 4D71A 2WSPA 3VILA 4LYQA 1WNOA 5IFPA 2XIBA 4CD4A 1WDSA 1CBGA 2BY0A 1E6QM 1NM9A 1GZJA 3B9EA 1FHDA 3E1F1 3GNOA 3AOFA 3T0BA 5M03A 4OOUA 4NZCA 1ZJAA 4L4PA 1B3YA 1UWSA 2V3FA 1M01A 2VX7A 2WVUA 1XD0A 2J25A 3RM9A 1QHOA 4E4PA 3W0KA 1E4MM 5A6JA 1RP9A 2DT3A 1L0PA 1MWOA 1LL7A 4PMXA 3VMOA 1XSKA 1C8XA 4HMEA 4FF5A 2O9OA 1QHPA 3K8LA 1KFWA 1DWHM 1W32A 2PB1A 3W6LA 3N11A 2XFRA 1OD0A 2QLYA 4UTFA 1JAKA 1RH9A 2AAAA 3U7VA 3L4YA 1OD8A 3UG3A 3PZ9A 3PHAA 2GDVA 3OA5A 4S3KA 1IZKA 1JD9A 3VIJA 4PTXA 1V0KA 2XWDA 4PUDA 2YA0A 4IISA 1VF8A 5ABHA 1BF2A 3L4XA 3AYSA 2UY4A 1PAMA 1GPFA 2G41A 1JXKA 4PMYA 5BYWA 1BHGA 1PIGA 2XFYA 2DSZA 2X1IA 2ZX5A 4J3WA 2NSXA 3U57A 4U31A 1NP0A 4UCFA 4LXFA 1V0LA 5FL0A 1J10A 1E5JA 1KR0A 1TR1A 1W1TA 3AJ7A 1C7SA 1HX0A 1XYZA 2FH6A 3EMQA 3CBWA 2BXZA 3IAQA 2ZX9A 4QLLA 3OLEA 3AHTA 3PZNA 3EBVA 4U3AA 3W27A 1QI3A 2XSBA 3D5HA 2W67A 3MSDA 3GXMA 4W5ZA 3CO4A 5ABFA 3VGEA 3WEOA 1C90A 4U2ZA 1GCYA 1B3ZA 5EB8A 1E6NA 3THCA 1OGGA 1Q6DA 3N9KA 1D3CA 1EQCA 2VRJA 4J3VA 4J7RA 2EJ1A 4HOXA 3RJXA 2GJPA 1EO7A 2CYGA 3W38A 2GSJA 5D9MA 2G8ZA 5ABEA 3ALGA 4AZCA 2A3HA 3VIOA 4TVUA 1KCLA 3QOMA 3DYMA 1CNVA 3M07A 5GNZA 4A4AA 2E4TA 1W3JA 3AMCA 3FNDA 4Z2GA 2DIEA 3ARSA 3SCNA 4PCTA 1GQLA 1XYFA 2VNCA 4CU7A 1VFOA 1DTUA 3AHVA 1PEZA 3T2QA 3CMGA 3VINA 2WM0A 3AMDA 2QMJA 4GI6A 4JAWA 3GXDA 1E9LA 4M80A 3F4VA 4UOJA 1ECEA 4UQCA 2IXUA 2BFGA 2B31A 1QBBA 4P7LA 3BGAA 2GDUA 4PTVA 2PWHA 2PWEA 1X1NA 4GZIA 3SURA 3A4XA 3TONA 5BWFA 4B9ZA 2ZUVA 2YKKA 3POHA 4MB4A 1NH6A 1JIBA 1WB0A 5E70A 2PI6A 3B9AA 3WF2A 5D9OA 3WNPA 2JEQA 1V6XA 3W29A 1JDAA 2CNCA 1TG7A 4W89A 1Q4NX 5JBEA 1HF6A 1S46A 4PTMA 5JIWA 3GH7A 1HNYA 3A3HA 2TAAA 5JUVA 3M46A 4J28A 2C0HA 4NF7A 3UR7A 1OT2A 1KB3A 3WQ5A 4AD4A 4D72A 2W4XA 3PN8A 4MPKA 1MVYA 3N12A 3EDDA 3SCVA 1V3MA 4PTWA 2WVVB 3N13A 3RCNA 1KQYA 2WMGA 2XJ7A 3MUIA 4W88A 1GOIA 3ZIZA 1KGXA 4DWSA 4EKJA 3NSNA 2YDRA 4IM4A 3L4ZA 1V3JA 5GQBA 1E6SM 1RPKA 3O6AA 5D9NA 4AXNA 1WZLA 2WW5A 1GOOA 2EO7A 5DEZA 2A3CA 4PMRA 2C7FA 4AZIA 1HJXA 1ODUA 2GK1A 1Y7VA 3WUGA 4PUEA 2GFTA 3VKKA 1EDQA 4X0VA 2J74A 2UY2A 4PMDA 4QLKA 2CETA 3KL0A 1NWTA 2ZICA 2EEXA 1DWAM 3TA9A 1WZAA 3ARZA 2XTKA 4JFUA 1WAWA 4PEEA 4AD5A 2Z1KA 1SMAA 2FDMA 4M1RA 1EO5A 3L4VA 3ARQA 3A6OA 5CGTA 1EOKA 5CPTA 2CXGA 3VD5A 4M24A 3B8SA 4BQ2A 1VJZA 2J7HA 1QNOA 3VIPA 3CPUA 5GNYA 1V6WA 4H2CA 2CBIA 4FK9A 1ISZA 1CLVA 4DWSD 2QPUA 3CZGA 1HKJA 1W9PA 6A3HA 4CUCA 5JIPA 2BVTA 2W5FA 1UR4A 1E0VA 3AQUA 4KMQA 3RO8A 4JFSA 4KWUA 4N0RA 4U5IA 3WL1A 1U33A 2EPMX 4BQ3A 5GNXA 3WQ8A 2VL4A 5A6LA 7TAAA 4DUVA 4HOZA 2AMGA 4ZE4A 1E6ZA 4GZEA 1UKQA 3AHYA 4MNKA 4M82A 4J3UA 2UY5A 2ZIDA 2WKLA 5CJ5A 3ZJ6A 4YPJA 1CXKA 1M7XA 3BH4A 3BAKA 4Z2HA 1V3KA 3PTKA 1GVIA 3WH7A 1PX4A 2DSWA 3GXIA 1CGWA 4Q22A 3QR3A 3CH9A 3CHFA 3WL0A 1TA3B 3AFBA 1E3ZA 5AC4A 3VDCA 3F5KA 5D9PA 4A3YA 4W8AA 5IHRA 4W8LA 2YIHA 2EPNA 4HA4A 4AW7A 2DH2A 4GINA 1UD8A 1QNPA 1MW1A 2CHNA 3L2MA 3VMNA 3WF0A 2E3ZA 4UFMA 5CQ1A 3NDZA 1UR1A 3ZO9A 5C70A 5CSYA 4UZSA 2QPSA 3VGBA 4BA0A 1CLXA 2E0PA 4CCDA 4R27A 4D1JA 3T0DA 4P7QA 3L4WA 1V6VA 5LA0A 3WNLA 4HPGA 4NSBA 4ACZA 4AD2A 3CZKA 3ZM8A 1EA9C 2O9PA 1FOBA 1EDTA 5CPQA 2ZUUA 3WD2A 4MTVA 1A47A 3VIIA 3KE0A 4RE4A 4B15A 3AIUA 2AOSA 2D0HA 3PTQA 1ZBCA 2VR4A 3POCA 5I3DA 1GOQA 3T09A 4NI3A 4XV0A 1CGXA 1KXTA 3W25A 3OIHA 1XC6A 3GNPA 1UD6A 4AZ5A 1JYVA 3GNRA 4HPHA 5A6BA 3AISA 3OLIA 3AROA 1W3KA 4V2XA 2WHLA 4PYSA 2XPKA 3ARUA 2G3NA 4UQAA 2CBJA 3W26A 1GOKA 4PMOA 1GNXA 3IJ7A 1E3XA 4CVUA 5CZKA 3W82A 1US2A 2VTFA 4FLSA 1E5NA 1PJ9A 5A69A 3AIRA 2E9LA 4BCEA 5A95A 3EYPA 3PZIA 2YA1A 1V02E 2OYKA 4FLRA 2ZUNA 3SIMA 4GI9A 4Z2JA 1ZBVA 2CPUA 1PX3A 4Z2IA 2YLAA 1QW9A 1JI1A 1VRXA 1J0ZA 1QI2A 1UKPA 1UKTA 2G3MA 4TOQA 3MSGA 3AICA 4ZXOA 4WSKA 5CPSA 3TOPA 3BXWA 2GJXB 1VB9A 3BCFA 3T08A 1TFVA 3WF3A 1FH7A 3O2LA 1CGYA 2E40A 2WYSA 1MQRA 2WXDM 4MB1A 3WH6A 3I3EA 2OSYA 5C71A 2ESCA 1QI4A 4D6HA 2WCSA 4XZBA 2J75A 4XB3A 3KZSA 2DT2A 4NRSA 3GZAA 1R86A 2WC4A 5CG0A 1V02A 3WH5A 1M04A 4JKKA 3W81A 1BG4A 4TTGA 1XSJA 2V3DA 3QHMA 1BG9A 1ISYA 2FHFA 3SCQA 2J78A 1PIFA 2VO5A 1W3HA 4CN4A 1U30A 2V5CA 5DFAA 4AD0A 2WMFA 4HMCA 4IPLA 5A6SA 1E0XA 1FFQA 1P6WA 1M53A 1UYQA 1IT0A 3WY1A 3L4UA 3VTRA 3VX1A 5KEZA 4FLOA 3WF1A 4CN6A 1H4PA 3N04A 2QMKA 5A6KA 2A3EA 1BYAA 1KXHA 2BHZA 1B9ZA 2WBKA 5EFDA 2EBNA 2VRQA 1GHSA 4OBSA 1HJVA 2DIJA 1G0CA 4Y7EA 5BXSA 4AMCA 3ZT6A 3VMPA 4PMQA 3L4TA 4JHOA 4CD6A 2G3IA 2XVLA 2GVYA 2FHCA 2OWCA 2WAGA 1F4HA 1LL6A 4AISA 3BAXA 1BAGA 2XGBA 3CZEA 1O6IA 1E4NA 3BC9A 1E40A 3WDHA 4J27A 1C91A 1PPIA 3WQ6A 1UHVA 4B3KA 4JFVA 3WD3A 1WKYA 3ZMRA 4MNLA 3N15A 3W24A 3MMDA 1DEDA 1DWFM 3T2PA 4QLJA 2ZWYA 3VM5A 4JL2A 3U7BA 2V3GA 1HXJA 4YN5A 3MU7A 1LL4A 3ZJ8A 4ATDA 4ZXLA 3W53A 5LA2A 1VEOA 4GQQA 2XM1A 3RDKA 1CWYA 2Y5EA 4D6DA 4AEFA 3HMCA 1HT6A 5D8WA 1JZ4A 2D0GA 2D3NA 4UNIA 4DWSC 4CN1A 4MB5A 3RIKA 1MFVA 2Y24A 4KRTA 5CSUA 3BSGA 2JF7A 1KGUA 1FP8A 1K9DA 3NCOA 4W93A 2CKSA 3CZLA 2A3BA 3J7HA 1CGVA 3MUZ1 5FOOA 2BY3A 5HBFA 5CGMA 1UWQA 1AVAA 1JGIA 4K68A 1NP2A 1JL8A 4GI8A 3WBAA 1EGZA 1UWRA 2BVDA 1D2KA 2VOTA 1V08A 4FMVA 4HP5A 4JCLA 1ISXA 2W91A 4OJYA 2YBUA 1ODZA 2XVKA 5LYRA 1H1NA 4WF7A 3BAJA 1GJWA 4ACYA 3AXIA 3GTNA 2WC3A 5HDRA 3W28A 1DWIM 1JZ2A 1I75A 2XGIA 4P8VA 2YL5A 3W6MA 1R87A 4OIFA 4J3XA 2VUYA 2DSUA 3CZ8A 1DP0A 4H8UA 2WLYA 3EMZA 2WNWA 6CGTA 1KR1A 1XH2A 1B30A 1XH1A 2Y8VA 2WMHA 4AZBA 1E71M 1JDDA 3WQWA 1HN1A 2CCRA 4UQEA 5C8BB 4P7NA 4B9YA 1CZ1A 1TMQA 5HNNA 4HZ6A 5CLWA 1E1EA 1C92A 5E6YA 1BPLB 5FIPA 3WNMA 5EFFA 3NSMA 4AD1A 4A3HA 4AZGA 2FH8A 3A4WA 5I77A 1GONA 2YL9A 5BROA 2ZX8A 1B3WA 3ZT7A 3DECA 3LPPA 1W9UA 4ZFMA 2WVTA 1JG9A 3DHPA 4WKFA 2NW0A 3U5YA 1BGAA 2PC8A 2IXVA 3BMVA 5A94A 2J4GA 3PZUA 5IHSA 1PX8A 1V03A 3MUY1 2D22A 2JE8A 4GKLA 2DQXA 3DYOA 1CXFA 1E56A 1CXHA 4WJXA 3G6MA 1EOMA 2VX4A 1ITCA 1CXLA 3MV11 2CIPA 2WC7A 3VIMA 3ARXA 1GHRA 4BF7A 1CYGA 2J8GA 3GYCA 7CGTA 4Z2KA 3PBGA 1B2YA 2WMIB 5BRPA 1QNQA 1NOWA 1G01A 3WEZA 1SMDA 1K9EA 2WZEA 1NQ6A 2Q8XA 2OWXA 1QBAA 3IJ8A 2XIIA 2VURA 1GQIA 1JAEA 4C7GA 3MMWA 3G6LA 3VGGA 3ARRA 1TUXA 3VGDA 5I6SA 2DT0A 1FH9A 2VT0A 3WKZA 4U3CA 4B16A 6TAAA 5FL1A 2D3LA 4JFWA 1UD5A 2VZSA 1ZBKA 1CDGA 2PWGA 4JKLA 3OBAA 4HA1A 3OGVA 4N42A 2ZE0A 1UKSA 3UCQA 1SR0A 3GBDA 5FKYA 3EDEA 1OSEA 1UG6A 3L2LA 1Q6FA 4UOQA 5E0CA 1ZU8A 1OIFA 3SCPA 3U5UA 1C93A 3FHQA 1ZL1A 3WEMA 2D1ZA 2E8ZA 3FY1A 2JIWA 3BAYA 4BQ5A 5GPRA 1I1XA 1QI0A 4H7VA 3O9NA 4LYPA 2WWDA 2JEPA 4LX4A 2VZOA 4W87A 1UH4A 2WSKA 3AMGA 4DUXA 2E9BA 1WDRA 1ISVA 3QGVA 5DF0A 3VX0A 3WBEA 2XYLA 4TVDA 1E73M 1OBAA 1UZ1A 1UD2A 1BSIA 2VI0A 3TTYA 1AQ0A 1HIZA 4DM2A 2FGZA 4D6IA 1E43A 3WD0A 3JUGA 3VIFA 4D6GA 1BYBA 1FHLA 4AD3A 2OYLA 1VAHA 1CGUA 1CXEA 4CKQA 1LG1A 4P8UA 1SFSA 2D2OA 4RE2A 3SUWA 4TUFA 1JZ3A 4JL1A 3VD9A 4CU6A 2DT1A 3CMJA 5JBDA 3BLPX 1NWSA 1CENA 1VENA 5A8MA 1MXGA 1QOXA 5ECUA 4Q7NA 2MANA 3II1A 3EDKA 4QCEA 1JZ5A 3A47A 2HISA 1R8LA 4LPCA 1CEOA 3PZVA 4U33A 1XCWA 1H2JA 4AIOA 1VEPA 1BQCA 2BVYA 3AS2A 2VR5A 4WKAA 4CU8A 1NARA 5CLTA 2ZUTA 1KXVA 2ZUWA 1B31A 2PBOA 4S3JA 1E55A 5LA1A 3LPOA 4ZENA 4UFHA 2GUYA 4CGTA 2D0FA 2VCAA 5EMYA 4C7DA 3AXHA 2E8YA 1UWTA 2W61A 3VD3A 4CD5A 1XHGA 1E1FA 1E15A 1V0MA 4KRUA 3ARWA 5ABGA 2QHAA 1HKKA 2J8FA 3FN9A 2OLHA 4HZ8A 3SCRA 2O9TA 1V3LA 4F79A 2G4FA 1JYWA 4H8HA 3VNZA 1WPCA 3K46A 1H5VA 2ZOXA 3CUJA 4TTUA 2VQTA 1JYNA 1BLIA 1E70M 1QVBA 5I24A 1KCKA 1J0IA 3OZPA 5AYBA 5IFTA 1VIWA 2BHUA 2YOCA 1C8YA 5A8QA 4Z2LA 3WQ4A 1KBKA 5E09A 1UH2A 1E6XM 2EQDA 5ABFB 5A6AA 1LWJA 2E9MA 4OUEA 3CUHA 2W66A 4J3TA 2WBGA 4F8XA 1UR9A 1A3HA 1HVQA 2VMFA 3AMLA 3K1DA 4QCFA 3K4AA 3RPMA 1N82A 4AZCB 1W1YA 2F8QA 3VGHA 3HU7A 4CCCA 3UG5A 1G5AA 2XVGA 2OYMA 1E6RA 4FLQA 4M8UA 3KL5A 1TZ7A 4WIWA 4D6FA 3WUEA 1JI2A 5E9AA 3PZTA 3CUGA 4E2OA 3OG2A 3ZQ9A 4UQ9A 1TVPA 5AC5A 4MDPA 3TTQA 1R7AA 2J62A 2DSKA 5BXPA 2WMKA 2YL6A 1HJUA 5F7UA 1MYRA 3AI0A 3AHXA 3CHCA 4KGLA 1LQ0A 3WMSA 4IPNB 4AY1A 3MUAA 1LJYA 1UA7A 4WLCA 1CIUA 2J77A 1R85A 2PBGA 1JYXA 4W7WA 4TX8A 3K8KA
chains in the Genus database with same CATH superfamily
2BY2A 2HNEA 1K9TA 4FNQA 1A50A 3R94A 3VDBA 2CEQA 3S1XA 4YTQA 2WVVA 2QZRA 2HS6A 3GBEA 5A8PA 3GU2A 3ZOAA 2XISA 1DWGM 3TW7A 2X8RA 4A05A 4NJGA 2QJGA 3IUIA 1PZ0A 4N7QA 2J7FA 5CG7A 1XDJA 5DT7A 4JTAA 1JPKA 1H0IA 1RBOB 2PWFA 3FDGA 3P93A 5M17A 2ZXAA 4FI4A 2CKRA 4G2DA 3NQCA 1F6KA 4H8VA 4GUIA 3THAA 5EPDA 2HSAA 2WHKA 1B4KA 2J7BA 5K2ZA 1K6WA 2D24A 1GTEA 4BY3A 3GC5A 3CIVA 1ML1A 3H9RB 4B92A 1MW2A 2EPOA 4JHZA 1V93A 3B8DA 3CAVA 1X6LA 2CESA 1H11A 1NWUA 5HOSA 1J6OA 3RLVA 3KCLA 4WXZA 2ISFA 5JQ9A 1YTDA 3GAYA 3MWCA 2BWGA 4DF2A 2AQOA 3TQVA 2RH9A 1SVDA 4ADSA 1W2VA 1V7AA 4F9DA 4M1BA 4WGXA 3DHDA 5D75A 5AYYA 2XFFA 4L9XA 1RSCA 2W9MA 1RP8A 1J11A 5F4WA 2DGAA 3O5JA 1G4SA 1Y0OA 2Y8UA 2PLMA 4C6DA 3LCWA 5F1VA 4EWND 1UD3A 3KCOA 3VNYA 4YYFA 3B40A 4GPNA 4WXYA 1YW1A 4LNCA 4MWAB 4K1WA 3LHVA 3WNOA 3N2XA 4LB4A 3P60A 3R0DA 4ZPWR 4REQA 3M5VA 3PPCA 1FKIA 3VVGA 3RMEA 5HUAA 3PBVA 4PC8A 3VDAA 2PPNA 3QHOA 3O05A 2OSWA 3VUPA 2PDGA 3BMBA 3LDVA 3TA6A 1OFBA 1FKDA 4GISA 1I60A 4XKYB 5LHFA 2VCCA 3GVQA 2VHLA 1GQJA 3TN6A 1V6YA 2QGYA 1TRIA 3H7VA 2ZADA 4HHMA 3WNNA 1QZ2A 1IQ8A 1Q6CA 2PDPA 5BRBA 5CJNA 1MQPA 3ATYA 2OR2A 2IUZA 3DX5A 3KRBA 3APGA 1S5NA 3DC0A 3PY2A 3TMLA 1JUEA 1GEQA 3KBNA 1CPUA 1QPOA 5C7VA 3DCPA 1OCQA 2PU1A 2X09A 3KEHA 1VFTA 4NRRA 4C5ZA 3DHUA 5H6HA 3HMJG 2BS9A 2ZXQA 4ACZB 4K2SA 2ZFAA 1EQPA 4NJHA 3KW3A 4INFA 1CX9A 4ZEPA 3AIVA 4ERAA 3SCTA 5HJXA 1VIZA 5A2BA 5I00A 1KCXA 3I6RA 3AIEA 3R58A 4MADA 3F03K 3GXNA 4ZQCA 4QJ4B 5A8OA 3H4XA 3CIWA 3EIPA 2QCMA 1XDLA 1A5LC 1W37A 2J79A 4NZ5A 4CNNA 4DI8A 1WZMA 1K02A 1OINA 4IXHA 4C6CA 4C91A 5G4HC 1I9CB 2CW6A 4HTBA 1XGZA 4H04A 4O12A 1PCWA 1YQ2A 4X0NA 4UR9A 3VNIA 4Y9MA 1AQMA 1JCNA 3PTDA 3WQPA 1V5XA 1MNSA 4P7RA 3JYMA 2OKTA 1Q6QA 1MFUA 2DFAA 4JQAA 3WELA 2PGRA 3U2OA 3WLJA 4PCSA 1BTCA 2C6QA 3OA3A 3OGSA 1VBJA 2E6FA 2VWSA 2RKXA 4C1LA 4JY8A 3EOEA 4OT7A 5A2CA 1X8CA 2ZDSA 4IQCA 2FVKA 1S2WA 5D03A 1BF6A 3AIWA 2VD9A 3OVRA 3O15A 1NTHA 1K4GA 5FJOA 3AS0A 2ACSA 1UWUA 3WZ0E 2V38A 1Z48A 1UR8A 4PZVA 5EGRA 3F4CA 2ZZ5A 1GOMA 5T8GA 5CBIA 4GUHA 5DELA 2G37A 1SSDA 1JUKA 1XYLA 3TAKA 3VZYA 4PMVA 3F2CA 3BCDA 1GG0A 1EHNA 3OJGA 3QF0A 1M03A 1UQZA 3C8FA 1W5OA 4D8ZA 3F4DA 3UQAA 2GVJA 1EUNA 4PB5A 3UVIA 1AD4A 2CZVA 1NJJA 1KBIA 3MBFA 3REQB 1I2NA 5HR6A 2B7QA 1FXPA 1SO3A 4OVXA 4GGHA 1ALDA 4RKAA 3TFXA 3PA7A 2Q6ZA 2X05A 4J3ZA 4YTUA 3PTMA 1D3HA 1FH8A 4HN8A 5EYWA 3VIGA 1GJPA 2J8TA 2C91A 2OT0A 3H2AA 1OC6A 4ZQPA 1EZ2A 2EKGA 4LUTA 3JYJA 1NMWA 3VABA 5DX7A 1YTEA 2VGIA 3NSXA 1A5KC 4G8TA 3T78A 4FB7A 4XUGA 1HZYA 2G3JA 4Y6GA 3LRLA 2J7DA 4KWWA 3CK5A 1UJQA 3HURA 2W92A 3AZTA 3VIKA 3JR2A 4LYRA 4MF4A 3ANYA 1QDSA 3ITLA 1KXQA 2CLIA 3UQIA 4LAOA 5CPNA 4D9PA 5CXPA 4DJEA 3K8MA 3NZPA 3WJXA 1JF5A 1JD7A 3UR2A 3UJSA 2TSYA 1DVJA 4HSHA 4XTIA 2E6DA 3O5PA 2E09A 4MAVA 3QPEA 4D6CA 1I6NA 3OEXA 1JCYA 1ISWA 1BGGA 2Y8KA 4DBUA 2H6RA 2DVXA 3T0CA 5MF5A 1G94A 3ID7A 2UWFA 3QOKA 1Y5VA 2PDIA 5J5DA 4I7UA 3HGOA 3PWGA 1J0YA 1K8XA 2V69A 2WPBA 3E49A 3TYZA 5AHLA 5IDZA 2HVMA 1VHCA 2NXHA 2W3ZA 7REQA 4JY9A 3TZFA 2QF8A 1J2WA 4OTKA 4EANA 4WX2A 3CPRA 4GACA 2ZZ7A 1NFBA 1FD9A 4MKSA 3SECA 4DQWA 3OQ8A 2G95A 4PBGA 1W9BM 1AH0A 1P0KA 4DJED 3M5ZA 5CAKA 2QAPA 2QCFA 1BVNP 2WKGA 3BLKA 3UWEA 1O1ZA 3EWWA 1WBHA 3PF3A 4C7FA 2WJZA 3G24A 3UESA 5U4NA 3ZLFA 4JIEA 3NIYA 3BSHA 5A1AA 2D23A 3RYSA 4QFUA 1V3IA 1KTBA 3HIJA 2VC6A 1CB2A 1I45A 2DIKA 3FXYA 4IFKA 2CLKA 4NYUA 1O5RA 2HBVA 3CWOX 4FAMA 1EEXA 4OZOA 2CLHA 1YXYA 2OLAA 4L1GA 2VZUA 5HMFA 3FJNA 3KOFA 4Y9PA 3DBNA 4HA0A 3PZQA 4E2BA 1BSLA 1VKFA 4H83A 4TX6A 5AC7A 1Z6KA 2WCAA 3ERPA 3GTFA 3EX6A 2PDYA 2FHBA 1T11A 4NX5A 3QC3A 4C6LA 4LGXA 3FW6A 1WZKA 3UR8A 2M1IA 1XD1A 1OGBA 1TJRA 4AB4A 3SM0A 4O52A 1YPXA 3KLKA 2O7SA 4NYYA 1ENUA 1UR3M 3CJPA 3GQYA 3M0MA 3WQFA 2AL2B 2VFGA 5XIAA 4FN2A 5D30A 4N9DA 4O18A 3OB8A 2A2IA 3EWBX 2VM8A 2WMIA 2ONEA 1TPH1 3FAWA 1OM0A 4ZE5A 3UWWA 4H9TA 5HMEA 2HBXA 1NOUA 1J01A 1J5TA 3QMRA 2Z0IA 1US3A 4BS0A 4J3SA 5KZ6A 2P4VA 3V7PA 3M44A 5JH8A 4QT2A 4Q8UA 1VYRA 2ZWZA 2AGTA 3K4WA 3D3AA 5M3WA 3NI6A 3K4DA 4UFIA 1RY8A 5I2UA 1EFZA 2VDGA 3M6DA 1E0TA 1H3GA 4EAMA 1DV7A 3QV6A 1QPKA 1JXJA 3GIQA 3ZSSA 3OGRA 2BY1A 2NX9A 1IIGA 1E6PA 3ISIX 3N6QA 1O95A 2ZZ6A 2Y4SA 2CLLA 1RLDA 3NL5A 1PZ2A 2E7FA 1QNVA 1J5SA 2MLXA 4LV4A 3N73A 1LLOA 1GVOA 4I8DA 4Y8EA 4F9JA 1R9YA 3VILA 3KOYA 1WNOA 4CD4A 1CBGA 2OELA 3GR4A 4F48A 3R1ZA 3E1F1 5M03A 2I5IA 4DJDD 4ODRA 2VX7A 2BOGX 3RM9A 1QR7A 4LCRA 3CV7A 4IX0A 2H9AA 3W0KA 1E4MM 1QCWA 3C3UA 3GNNA 2DT3A 2HVOA 4YTSA 1JQVA 4PMXA 3PFMA 1GKQA 4FF5A 4JDBA 4QQUA 3ELFA 5CBBA 1QHPA 2H8XA 2NQHA 5DXYA 3K8LA 3E74A 1I8JA 1W32A 1EP2A 4PE8A 4EVZA 2HE5A 5C5YA 3KS5A 1RH9A 2AAAA 3DGRA 3L4YA 3G3MA 3UG3A 1DJZA 4IJRA 1FKLA 1POJA 2GDVA 3OA5A 2NQJA 3KS6A 3NL2A 3B8VA 1V0KA 1YX1A 2XWDA 4XBSA 4PUDA 5CEWA 3O5GA 4IISA 1VF8A 1BF2A 3UWYA 3LCXA 3L7RA 3AYSA 2UY4A 4L1XA 2VEMA 3A13A 2G41A 1UBPC 4KEMA 4TW6A 1PIGA 1L6FA 1OABA 2VEFA 2NSXA 2Z4GA 3U57A 3T4CA 3LGGA 4JYSA 4UCFA 3BLLA 4LXFA 4Q6JA 4KF1A 1V0LA 2ASHA 6XIMA 4IIGA 2PWUA 3RX2A 1SPQA 1KR0A 4TO8A 3EKGA 3EWXA 3AJ7A 3C2YA 3T9PA 1BKHA 4H9VA 3IAQA 4XK2A 4E2DA 4IF2A 2E5BA 3T8LA 3AHTA 3EBVA 3G1RA 5I3IA 1RPXA 1TB3A 2XSBA 3QYQA 3U6WA 3MSDA 1ITQA 3UT0A 3E3HA 5LNRA 4IX2A 3UY7A 4DZIA 3WEOA 3WLIA 1RQBA 2ISVA 3OIXA 4U2ZA 1B3ZA 3LXBA 4CQCA 1EX1A 1Q6DA 5D2TA 3IUHA 4CNUA 4GD0A 5DY2A 2DW6A 4YS1A 4HOXA 3RJXA 5D05A 3CNYA 4TU1A 4JYDA 3RHGA 1G7VA 1GVRA 4AZCA 3ITOA 5K9DA 1VPXA 3UNDA 3LOTA 1L2QA 1KCLA 2IPFA 1CNVA 5KMYA 2PRLA 3SCNA 3MA8A 1S2CA 1Q45A 3C2RA 3N3TA 4RV3A 2VNCA 4CU7A 2D2GA 4UB9A 1PEZA 3IJIA 3VINA 3GUWA 4GI6A 2F9RA 3TC3A 3GXDA 1E9LA 2V2DA 3QFWA 1F6PA 3H4WA 4UQCA 1JNSA 2B31A 5K3VA 3EOLA 3WMLA 4FALA 1QBBA 4Q32A 4PTVA 2Q09A 4Q8WA 1AUSL 3SURA 4M0XA 5TF0A 3GHTA 1ZGDA 4F0LA 3M5XA 1LQAA 4BEUA 2PI6A 3B9AA 1V6XA 3W29A 1WOBA 4WDTA 4WDWA 4LBUA 4MZYA 1HF6A 2A21A 4JFJA 4PTMA 1FWIC 4PUNA 1HNYA 3EPNA 5DITA 3M46A 4J28A 3DFOA 3BCJA 3B06A 4JTFA 4R34A 5DN1A 1KB3A 2Y7DA 3WQ5A 1AL8A 4CQAA 3N12A 4GG9A 3EDDA 1V3MA 3KHDA 2WVVB 3N13A 1B5TA 1KBJA 3DKJA 5LNWA 2WMGA 4W88A 3VOHA 2ZBTA 3THUA 1P1XA 5H8PA 1W3TA 3TJLA 1EJWC 2YDRA 3TLQA 1V3JA 1E6SM 1G4TA 2PZ0A 4M5PA 2EO7A 3MT1A 2YBVA 5AVHA 2OCZA 1A53A 4UTTC 1HJXA 4DO5A 3U8GA 3TC5A 3WJYA 3HA1A 4PUEA 4UNLA 3HM7A 3SN0A 4O0KA 3DUGA 3TH6A 3SSJA 3PVFA 1H7WA 4RDYA 1Y5WA 4LJ3A 1FKGA 1WZAA 2XTKA 4JFUA 3UQBA 3UZXA 2OGYA 2OVLA 3N19B 2FDMA 3ARQA 3A6OA 5G4EA 1TTIA 4JX4A 4OECA 5CPTA 3W7OA 1OK6A 4M24A 4Q8TA 4F0RA 1VJZA 2P8BA 4DXXA 3P2VA 1ITUA 4MYAA 1V6WA 4IPJA 4H2CA 3RPDA 2ZRYA 3L12A 2WJEA 4NAEA 1W9PA 5DCBA 1NDVA 3RO8A 2V5JA 1THFD 3WL1A 1R6WA 2EPMX 3MCMA 3HO8A 3KBVA 4BQ3A 4LSBA 3NL3A 7TAAA 2HXUA 2B81A 4FAPA 1TELA 4TMBA 2A3LA 4L4LA 4M82A 4S2BA 2UY5A 5J8LA 1PV8A 1M7XA 1FWSA 3UW6A 1NQKA 4LC8A 1T99A 1P6CA 1R47A 1ZLPA 4Q22A 1JNTA 5KZEA 1QMLA 2Y89A 4REQB 1T96A 3AFBA 3TNOA 4DRMA 2ZRXA 3P82A 5D9PA 4A3YA 3BZJA 4W8LA 6ENLA 2EPNA 4QS6A 3T05A 1RQEA 5CSSA 1UC5A 5I09A 1QNPA 3ODKA 2D73A 3L2MA 1RV8A 2PCEA 4Z1AA 2H90A 3TCZA 1UR1A 5C70A 4JIHA 1I0DA 3TZNA 3HGRA 4D1JA 4P7QA 2XDFA 3WNLA 4HHLA 4Z1CA 4HPGA 1EA9C 3PUOA 1LOLA 3MUXA 1QUMA 2ZUUA 3NAVA 4DH0A 4MMWA 3KE0A 1EC7A 4KQNA 4ZSUA 4ADUA 1FHUA 2BG5A 4JTRA 5FJJA 2OEMA 2D0HA 1TMLA 4LNYA 2VR4A 1H5YA 3POCA 1GOQA 3KDOA 2LJ4A 4NI3A 4XV0A 1CGXA 4HYWA 1XGDA 3OIHA 1XC6A 3GNPA 3BWWA 4AZ5A 5FJIA 3KVLA 1NF0A 3OLIA 2NQZA 1SJCA 3UJRA 1W3KA 4PYSA 1YKWA 5E1QA 4XZLX 2G3NA 4DY1A 3W26A 4HVXA 1GOKA 1H60A 4IQDA 5CZSA 1ZCOA 2F6UA 1QFEA 2J13A 2R1NA 4V1XA 1X39A 2JGYA 3GG1A 1C9WA 3E0LA 1B9BA 5F2LA 4HNTA 3KHJA 4QZVB 2CPUA 4XD6A 4LAVA 3H8AA 3O63A 1UKTA 2QDGA 4ZXOA 5LIYX 3E2VA 3TOPA 4NG3A 3OODA 1VB9A 3T08A 3M0LA 3CIXA 4R9XA 4KCUA 4MB1A 3UJFA 3TTEA 3AWOA 5GJMA 3BUVA 4YIWA 4XBJA 4EXQA 1FXQA 1EP3A 1R86A 3TIMA 1PKMA 4N4PA 3VFLA 3W81A 4Q33A 3NM1A 4FNUA 3S9IA 3GXTA 3VKBA 3QHMA 2QQ6A 1ISYA 3SCQA 1QPLA 4J2MA 4Q8PA 2VO5A 1JPDX 2V5CA 5DFAA 4AD0A 4TQTA 5HUOA 1P4CA 4UBPC 1KT1A 4DO6A 1GVSA 4HCDA 1N8IA 3UVAA 3QZ6A 3VTRA 2PDFA 4EACA 3G1XA 4JEJA 4IQLA 3WF1A 3ITGA 2TYSA 1H4PA 3N04A 3CQJA 5A6KA 3EKLA 2BHZA 3FOKA 1B9ZA 4U10A 2EBNA 1FY6A 3CQIA 2DIJA 1UB3A 4Y7EA 3NL6A 2G4JA 4KIRA 2VFHA 4JHOA 1YNYA 4CD6A 4C1KA 3NRKA 4LUTB 4RX0A 2XVLA 2OWCA 2GVYA 3NGJA 1K4HA 1D7HA 1LL6A 2JKEA 2RFGA 4ZBCA 4WDUA 3BAXA 4FNRA 4QSHA 2XGBA 3CZEA 1O6IA 3UYCA 4GH1A 3TNBA 4FXFA 3VKAA 5HK4A 3B03A 4GHRA 1PKLA 2FAPA 4AEOA 2XH7A 3M7WA 3QV9A 3WD3A 3W1UA 3A3WA 3PR2A 2J24A 3H24A 2IKIA 1LROA 5A6TC 8TIMA 2Q3OA 3T2PA 1W5QA 8RUCA 3VM5A 4ZODA 4MSPA 1TE6A 1HXJA 4YN5A 1MRQA 3MU7A 3VFCA 2P5NA 5JVLA 3PBYA 3T7VA 2QAFA 4G1NA 5HNTA 4GQQA 4CLMA 2XIMA 1AH4A 3RDKA 2INFA 2C1HA 3HPZA 2Y5EA 4K3ZA 3T44A 4D6DA 3JVAA 4AEFA 3W1QA 3HMCA 1HT6A 1TPDA 3QY6A 5D8WA 1FKXA 1A4LA 2D0GA 3WJWA 4CN1A 2RUDA 2R6OA 7REQB 1FP8A 5KZMA 1W3IA 3O16A 4IQJA 3TW9A 3LQGA 4LANA 4GI8A 3IKGA 1UWRA 1DIKA 4O1BA 1ICSA 3W88A 4GMEA 2G50A 4FMVA 1M7OA 4HP5A 4Q4SA 2HPMA 1Z9AA 2W91A 4UMAA 3BTNA 5K4XA 4UDMA 2YBUA 3FS2A 1TSIA 2XVKA 1H1NA 2WO5A 4XG1A 3C6CA 1UP3A 3GTHA 1N2VA 1F73A 2Q02A 4NILA 3GTNA 3A22A 3M0VA 1JZ2A 1I75A 2B7PA 1ICQA 3W6MA 3N34A 4GZ7A 2VDIA 3CZ8A 3H4GA 2YPIA 4QXIA 3MHUA 3PG8A 3A12A 2E1WA 3LTSA 1CCWB 4IFKB 3TKFA 1XH1A 3TJ4A 2WMHA 4FR6A 5HWNA 1UC4A 1OFRA 1A0EA 1VJIA 4LTSA 4B9YA 5C8BB 5HNNA 1OYBA 4HZ6A 2XP5A 1C92A 1X1OA 5E6YA 1BPLB 5FIPA 3WNMA 3FSUA 4AD1A 5I02A 2FH8A 5I77A 2EG7A 2ZX8A 4XVDA 3R8RA 4N02A 4A2RA 2JQXA 2B0MA 4X3ZA 1XYAA 2I56A 1K8ZA 4NU7A 2NW0A 3LHYA 2O0TA 2PC8A 5A94A 3PZUA 2VOMA 2DZPA 3NPVA 5IHSA 2HS8A 1XLLA 2QCCA 4GKLA 2FIQA 2DQXA 1W0MA 3KBSA 1XIDA 1XGEA 4O11A 4UC5A 1FWBC 3MP3A 5DY3A 2Z2BA 1JGMA 3LHTA 4NUWA 1ADDA 4EX4A 4ODKA 3ABXA 1A3XA 4WJEA 4IGMA 1Q2RA 1B2YA 2WMIB 5J6EA 1D7KA 3EPMA 8XIAA 1SMDA 4UTKA 2WZEA 4U85A 3CUXA 2CLMA 4ORIA 1XIHA 2OWXA 4MY1A 3IJ8A 2ABBA 2QUNA 4MG4A 4Q8VA 3O5KA 2ETNA 2DT0A 3ITCA 5FL1A 4Q8OA 2VZSA 3EA1A 1O66A 3DI0A 4GH3A 4HA1A 4MPQA 1A4MA 4MKVA 1HW6A 2A4AA 2Z2UA 3TU9A 1Q2SA 1FKHA 4N19A 1KA9F 3GBDA 1H1YA 5FKYA 4MYXA 4UOQA 1TR9A 2MNTA 1VBGA 4JIIX 5E0CA 3EEGA 1ZU8A 2ODOA 2IMRA 1XM3A 3H2EA 1SR9A 3RLHA 4QAIA 3RXZA 3G2GA 2E8ZA 3VNDA 1M3UA 3BAYA 5BW6A 3P3BA 2RHGA 4NZ4A 1ZP3A 4JQ2A 2VZOA 4W87A 4JX5A 1WDRA 1DXIA 3QGVA 5E93A 3VX0A 2XYLA 4QDPA 3TTYA 2QUVA 3PBUA 1AQ0A 1HIZA 4LF2A 4NIRA 1E43A 3WD0A 3VIFA 1KM0A 2H9AB 4DF1A 1CXEA 3FFSA 4UIOA 3B9OA 2X30A 4DUOA 1JZ3A 4TUFA 4PBFA 3VD9A 2PEVA 1D7IA 2DT1A 3ZWSA 3UGVA 4C6BA 1CENA 3V3WA 3PB2A 1MXGA 1QASA 4Q7NA 4JNZA 2MANA 4GWEA 3NXLA 4W9PA 3SGZA 3A47A 4O19A 1R8LA 3E38A 4U33A 1H2JA 2FPVA 2Z2AA 3AS2A 3W7KA 3URAA 2PDNA 4GC4A 3G0UA 4PUUA 3UXAA 4EPEC 4HIBA 1E55A 4CEUC 5LA1A 2VXNA 1JR1A 1UWTA 1N7KA 1XHGA 4KRUA 4HCLA 2AQWA 2J8FA 2OLHA 2PPOA 1MEWA 1GGOA 1H5VA 1U22A 2ZOXA 4Q8MA 2HMCA 4Q7IA 3CUJA 3UWVA 4S23A 1M68A 1BLIA 1E70M 1QVBA 3IKDA 4B2DA 2Y6ZA 2A85A 3KCJA 3G1VA 5AYBA 3UU0A 3UCDA 4HJWA 1YADA 3OBKA 4YWIA 2YCEA 4H6EA 5A8QA 1KBKA 1E6XM 5HQMA 4NZFA 4J2PA 3M0ZA 1D7JA 4C90A 2KI3A 3R13A 3PR9A 3U4FA 3PP7A 1A3HA 3UA4A 2PTWA 2VMFA 1WDDA 4H6KA 4O14A 3K4AA 3M16A 1F8MA 1W56A 3SGUA 4AZCB 1W1YA 2F8QA 3VGHA 1TPB1 3NG3A 3HU7A 5RUBA 3QPZA 5BMWA 2ZVRA 4FLQA 1TZ7A 4IFRA 4WIWA 1J8VA 1D8CA 1JI2A 3MJYA 2LGOA 1YPFA 1X1ZA 1DJYA 4O50A 3ZQ9A 1TVPA 2J27A 4QISA 1P48A 4MDPA 3ZFHA 4P5UA 1MYRA 3HQ1A 4KGLA 1DJXA 1RD5A 1LQ0A 1SFTA 3MUAA 1LJYA 2J77A 4UTIA 4TX8A 3MHFA 5HINA 3KAIA 4MFEA 3WO8A 2QPXA 1JF6A 3DDMA 3ABZA 3GH4A 3IK2A 2NT0A 4UFJA 3ZT5A 3F2BA 1KV5A 4MJ2A 3M0XA 2DUAA 3SEPA 2XGZA 4JYFA 3EDFA 3P14A 2JKPA 2GYIA 3B0UX 3WK3A 5XINA 1HJSA 3W83A 2VR2A 2BGNE 4RW5A 3AIQA 2VVNA 5A6MA 2FTYA 4QIUA 3H2OA 3QQ0A 3UETA 1IR2A 1EPXA 2OOGA 1C7TA 1Q6UA 2F6XA 5TNVA 3BAWA 3SUVA 2Z7KA 4Q8NA 3I10A 1ZBWA 3PZOA 1YEYA 2P3ZA 4HK6A 4X60A 5TD4A 1J2BA 3R7MA 4QG8A 3OBEA 2H3BA 3QW3A 4H6RA 2V0TA 4EIVA 3PAOA 5A8NA 3V5OA 1KW1A 8CGTA 4PSPA 1Q6OA 3I7QA 5EKYA 5ABTA 7PTDA 2WK2A 1BVZA 3G1SA 3NZRA 1KC7A 3TR9A 2BHYA 3RU8X 4V27A 2CFFA 1RAKA 5A3HA 2A3AA 3QSRA 5AYIA 1P5BA 3TJIA 1BFNA 1Q3NA 3TP4A 2Y5JA 4UR8A 2D2HA 3IGUA 4NAEB 4ZQMA 4U86A 2VQUA 3WDIA 5DBTA 1C3FA 1HL8A 2FKEA 1W9DM 3CTTA 1Q6GA 4ML9A 3GY1A 1TKKA 1QW7A 2WANA 3CUFA 2IKGA 4DIAA 3OYXA 3W1XA 1L8NA 1W9XA 4O1FA 4ZS6A 3LENA 3W1AA 3WUFA 1R0MA 1TO3A 5JH2A 1KGWA 3T2OA 2IQDA 5DIVA 4TV5A 1WKFA 2GGIA 1KFEA 1UD4A 2XSAA 5AY7A 3F4NA 5CZ0A 1XIBA 4LY8A 4MNMA 2VZTA 1Y5XA 3TQPA 1DIOA 3BK0A 2ZCGA 1K1DA 4HZMA 1IF2A 1FX6A 4AVNA 5M5DA 5C9WA 4YLWA 2VELA 1VCVA 3WD1A 2VFEA 2CZDA 1KM1A 4O17A 3FKKA 4AZ7A 3E2QA 5AHIA 4Q3MA 2NQ9A 1EJ7L 3BMWA 1FWGC 1W1PA 3IAPA 2WLZA 4S3CA 5REQA 2VX6A 3KRUA 3RF9A 3BZGA 1XINA 1EHAA 3D46A 5IBXC 1HP4A 2DZBA 1UUQA 1P6BA 3TR2A 3KOZA 5D38A 3S42A 2OQHA 1RUSA 3FVDA 3PJTA 3PNUA 4UTWC 3RM8A 3GO2A 3CGTA 3MKKA 1HGWA 1HJWA 3H2MA 4L56A 4NI8A 2C71A 4J1OA 3CHEA 2QGHA 4H41A 4NP7A 1PXGA 1DHKA 4GIYA 3WH9A 2XG9A 2ZRUA 5C6MA 2C15A 4ZSTA 2ISDA 1FA2A 4P7OA 2XH0A 1ZS2A 4EWJA 3STFA 1X6UA 3HN3A 2VZVA 3KVMA 4EF9A 2E6YA 3UZJA 4DRIA 4IZGA 3GTYX 2XWEA 1XCXA 1GJUA 3N29A 3SQSA 1QXLA 4XZ9A 4GNKB 3TW6A 3SSZA 4XO6A 3W1LA 3UBPC 3N3MA 2WB5A 1E4IA 2ZUMA 1OF6A 1I1WA 4ZB5A 1KM4A 2WHJA 1Z8AA 3S2CA 5IOBA 4DYKA 1L6GA 2GJXA 2BV9A 1OQFA 3EPOA 3H53A 3U48A 4QDMA 2CHOA 4CD8A 2Z7GA 3CC1A 4RXFA 4XD4A 1B90A 4JXCA 1YXDA 2Z6JA 2QUMA 3SJNA 3PZMA 3TYEA 4WK9A 4KGJA 5H1WA 1EYWA 5E0FA 1HP5A 1J0KA 1GKRA 1DIDA 4ES4A 3CQHA 4OBRA 3T0AA 3L5MA 1P0EA 3TX9A 4DX3A 1MXSA 3LX9A 1F07A 2BXVA 1AH3A 4LUJA 1FWFC 3DAQA 3LLXA 3VD7A 3HBLA 1JNDA 2NT1A 3GM8A 2XINA 4GC3A 1HG3A 4JCMA 1TCMA 1WO2A 1LLWA 1F9CA 4W8BA 4ZGYA 4Z1BA 3CQKA 4G1KA 1XXXA 4WY0A 2OEJA 1UWAA 3N1AA 2X0YA 3A3XA 3F5JA 1ZRQA 3H7RA 4IPIA 2NV9A 3UJEA 3LCFA 3R89A 2B5UB 1Q7ZA 3SN4A 5KITA 3RGCA 3I6CA 1V0NA 2ALRA 3OLGA 1DE5A 3MQTA 3H2FA 3TEVA 2QCLA 3LPFA 1I2QA 4L4MA 3NPUA 2EPLX 1A5UA 4BZYA 4GO8A 2D2JA 4K8GA 1MW3A 3MBDA 4X2RA 3T0TA 4GXPA 1FQ0A 1YW5A 3S1WA 1LTDA 4Z0JA 3KZPA 4W7VA 2VJXA 2Z27A 1VS1A 3MCOA 3W02A 3MVTA 4QP0A 3UF9A 2A0NA 4ZMGA 1ADSA 1G1YA 3A5VA 3A64A 3UI6A 4P8XA 4HA3A 1QO2A 1QNSA 1DJQA 4E2VA 4S3GA 1H41A 4JZ5A 1SZFA 2OMAA 4FOJA 1PTDA 4YHGA 1IXPA 3LGDA 1A5OC 3C0SA 1HL2A 4F0MA 4Z42C 3JS3A 1SGJA 1Z42A 4B5SA 3MSYA 4H2HA 3B0YA 2J7EA 4RJEA 2R9RA 2BDQA 3C0LA 4LAUA 1RBAA 1K9FA 4CEXC 2CBUA 3DFQA 2OFNA 4D1IA 3VPLA 2O9RA 1E0WA 1UOKA 1TX2A 1OX4A 3OW1A 2BP1A 5FJPA 3TE9A 1DJNA 3KL3A 3WMCA 4XUYA 2RGLA 4ATLA 3T1GA 2G97A 2YGYA 2GQ9A 4JTIA 3EY6A 2VRKA 4H9XA 4XSMA 3ABSA 1U79A 1NU5A 4PTDA 5G2IA 3MWAA 3NEHA 2CBVA 2V67A 3GIYA 4ZTYA 1QHZA 1PUDA 1R7OA 4GBUA 1KNWA 3VDHA 1UH3A 1ITXA 4UZUA 4UTTA 4IIHA 5B7YA 1TV8A 4M56A 4O13A 3URQA 2XVPA 2ZTKA 1OG0A 4LU0A 3T40A 2ANUA 4UQDA 1K6AA 3JU2A 3OO2A 3IGSA 2FTPA 2PPGA 3QMSA 1VEMA 2GJNA 3QJAA 4PMZA 2V2HA 3I3DA 3NQBA 5AC8A 1SSGA 1YNPA 1H09A 1XPYA 2ZX6A 4M6UA 1H63A 3FAXA 7A3HA 2F2HA 4G7EA 2XP3A 3NR0A 2R91A 2EF9A 1H49A 2VGBA 2WSYA 4O0ZA 4DUWA 1J79A 3QC0A 1EGVA 3QLLA 4JD4A 3BV7A 4AC1X 1VPYA 3WJSA 3O5IA 1VFHA 4I5RA 1ME8A 1QJWA 2I17A 2QXWA 5C7HA 1LP6A 1NFPA 4EPKA 3ABRA 2RSEA 2VUNA 4LT9A 3S1UA 3K2GA 1UR0A 2NV2A 3W37A 1IIHA 1ROTA 2UY3A 3MANA 5D4YA 2YYUA 3MS8A 2YL8A 2I16A 2YA2A 3B4YA 2EULA 2EJAA 3FX4A 4NQ1A 1TVNA 5I78A 2QUUA 1A0CA 3C86A 3ZYZA 3NDYA 4KCVA 1XX1A 3GUGA 2LKNA 4IT4A 1GG1A 4E8DA 3G77A 1AMYA 1D9EA 5I5RA 2C14A 2JIEA 3W3OA 5A6BD 2O92A 3OPSA 5FSDC 3CZJA 4JIRA 3WK2A 3T6CA 3IACA 3URBA 3AXXA 4H9MA 3VOCA 4L6OA 2VN1A 3LQLA 3WCZA 4A3RA 3P7YA 5HPOA 1LZOA 3VAVA 1VBUA 4LVDA 1VLIA 5EMUA 3NO1A 3UQNA 3R0KA 5FAJA 3WD4A 4FO4A 3WQDA 3MUCA 4YTTA 1OB0A 3KRSA 4YTRA 3UR5A 3WIJA 4ODNA 3RLUA 4H19A 3LTYA 3A24A 2ZXDA 1OFDA 2Y2WA 4YVVA 5AFDA 4LYQA 1H61A 1W17A 3U2CA 5IFPA 4LVGA 3TROA 4GYJA 3U2ZA 2OJPA 2X41A 1GZJA 2PFHA 2H3DA 3TYUA 3T0BA 2GLKA 3LUTA 4IICA 4OOUA 2DQWA 5DANA 4L4PA 1B3YA 5F4SA 3DFTA 1M01A 4LBSA 3GFXA 1XRSA 1XFBA 1M7JA 4OU1A 3PNZA 5CKSA 2M2AA 3I4EA 1H7PA 4KIEA 4GJJA 4UUIA 3O5DA 4QJ5B 4ZTXA 3S4TA 2K8IA 6TIMA 4GVFA 1Q85A 1XG3A 4MUPA 4BWLC 3N2OA 1LL7A 4O10A 4JN8A 2P10A 3VMOA 3UGRA 1XSKA 5AHNA 4HMEA 4K37A 3QM3A 1KFWA 1FKFA 1KFBA 2FVMA 2CWXA 2ZR6A 3WLTA 2ALDA 4S3KA 5I3KA 1JD9A 4FNPA 5C2XA 5F4XA 3IWPA 3SFKA 4XBKA 3LYEA 2RDXA 1K7EA 1A80A 4UTHA 1V6TA 1TTPA 4GJ1A 1PAMA 3UYIA 1JXKA 4PMYA 5BYWA 1BHGA 4DHGA 1PVNA 3NQ2A 1AA1B 3O1NA 4O4VA 2XN0A 3PPHA 4DBSA 2ZX5A 1H7OA 2OOFA 4KBXA 3H7UA 4U31A 3TQKA 4LCQA 2PDBA 3PS7A 1TR1A 4GGQA 1W1TA 3EMQA 2FH6A 3ZVHA 1L1PA 3MCNA 3OLEA 4U3AA 3W00A 3LI1A 3NPXA 3UNTA 3QY8A 1EWDA 4I90A 2W67A 3DIPA 3QBUA 3ES8A 1P0DA 3GR8A 3V1HA 1A3WA 2E5CA 3KLLA 4FX7A 3VGEA 1DQWA 1JDEA 3B8TA 1RVKA 4JFLA 5LGZA 3EWDA 1D3CA 3HV8A 3W87A 2VRJA 4L9YA 4J3VA 3BMXA 3MI6A 2V5BA 2ZR4A 1EO7A 5FJRA 5ABEA 4AIBA 3O5LA 4Q4RA 3WLNA 4H7ZA 3VIOA 4LAKA 3AU6A 3KDNA 4HBKA 4A4AA 2HRWA 2DIEA 3PUDA 1S38A 4HPNA 3JZUA 1OYAA 4GCAA 4PCTA 1XYFA 4KFPA 1DTUA 3AHVA 4S3AA 1XLJA 3IHZA 4QJ3B 1XICA 2ITKA 3OOBA 2ZZ3A 3APTA 1XF0A 3B4UA 4DROA 3F4VA 3M0KA 3AWNA 1EB3A 2IXUA 1F8AB 4TW8A 2A6LA 4P7LA 3BGAA 5G4WA 4WQ6A 4YMZA 4DAIA 1R3RA 1XLHA 1O60A 4PB4A 5BWFA 2ZUVA 2ZZ4A 1M6JA 2DZSA 4R9OA 1Q7MA 3LCGA 1NMVA 4W9QA 5D9OA 3WNPA 1TWSA 5BMXA 5MKGA 4W89A 1Q4NX 5JBEA 1T6MA 1S46A 2Y70A 2Z1WA 3D0CA 3A3HA 3W07A 2F84A 2TAAA 4QEEA 2IQ0A 1RA5A 4PL2A 3KABA 4JPGA 1ROUA 4D72A 1FCBA 4Y9OA 2W4XA 3XIMA 1KKRA 2O4MA 4G2PA 3SCVA 3TXZA 4IQ2A 1SJDA 4JIQA 2XJ7A 1IXOA 4DZ2A 2XZ7A 3ZIZA 1HO4A 3NSNA 3BOLA 2DY3A 3L4ZA 5GQBA 5G2HA 5AHEA 4AXNA 2ZTJA 1GYLA 4QNEA 4Q7BA 1S1PA 1OX5A 1NEYA 1ODUA 4EXBA 2GK1A 1GWJA 3O5FA 2GFTA 3VKKA 5SWUA 4X0VA 4PL1A 1X98A 2UY2A 3W85A 1O94A 1XUZA 3KL0A 2ZICA 1BEUA 3WH0A 3TAOA 1SMAA 4M1RA 1TV2A 4GI4A 5LIWX 4GRSA 4IJBA 3UJ2A 4C65A 3L4VA 2DJLA 5CGTA 3S3GA 4WDXA 1W1B1 2CXGA 3VD5A 4GVHA 2C1GA 3KACA 4PODA 5HMSA 4NNBA 3VIPA 4UNKA 4MLJA 5GNYA 3TJXA 4JEQA 3QFEA 5DXXA 4FK9A 4BJHA 1ISZA 2OB3A 4NL1A 2QPUA 2Z26A 4YXGA 4HNUA 4WSHA 4CUCA 5JIPA 2BVTA 5KTLA 2OX4A 4N6FA 2REQA 3GHUA 4JFSA 4KWUA 1DXFA 3WLLA 3L9CA 2VFFA 5AVNA 1DJHA 5A6LA 4HOZA 2AMGA 3WLOA 4KCWA 4ZE4A 4NJIA 1E6ZA 1W8GA 4DJFA 1KFJA 3N25A 1OVDA 2J6VA 4J3UA 2WKLA 4CCZA 1GK8A 1M41A 3O5QA 3BJFA 4YPJA 5DMMA 1IWPA 4Z2HA 1V3KA 5K7JA 3UPMA 3PTKA 5K4ZA 1PX4A 5HW6A 4DRJA 1V51A 3CHFA 3NVDA 3TSBA 4QROA 1Q65A 1E3ZA 5AC4A 3V5FA 4E5TA 5IHRA 4HU4A 2E6AA 2Y1HA 4HYVA 4AW7A 5C9ZA 4GINA 3URNA 1MW1A 1VPQA 2PP3A 4HU3A 3VMNA 4V1YA 4UFMA 5CQ1A 4ZB0A 5TIMA 3LCIA 5B7ZA 2WJFA 2QPSA 4BA0A 3EZ4A 4R27A 1MEHA 3T0DA 2J9ZA 4KEZA 1V6VA 3QMTA 4FOUA 5LA0A 2WSRA 4X63A 1LRTA 3DFYA 4GYPC 1W1IE 4AD2A 4G50A 3UPWA 3ZM8A 2GOUA 5HW7A 4M7TA 1TZZA 5REQB 3RUBL 1A47A 2SFPA 3MB9A 3Q37A 3AIUA 2AOSA 5LIKX 3QY7A 3N2BA 4O57A 1ZBCA 1N55A 4PCFA 3CGMA 5I3DA 2Z6IA 1DQXA 4F0KA 4EPDC 2IF4A 4QJ1A 1GZ1A 1SZNA 5B80A 1JYVA 1VGAA 3S47A 2CLPA 1XLDA 4G9PA 4LUSA 3VC5A 4G56A 4H9UA 4D8AA 4X61A 3ARUA 5IRPA 4UQAA 1GNXA 4ZQNA 4CVUA 3DERA 3GWQA 5CZKA 4S3FA 5AOUA 1US2A 2ZQUA 2VTFA 4FLSA 4ZO6A 2PP1A 1OFAA 1WBJA 3B97A 2RJGA 2FGBA 3AIRA 2E9LA 4BCEA 4RR4A 3EYPA 3FJ6A 4JTHA 5HR7A 3P74A 1G4EA 1V02E 4R3UA 1ZBVA 1YDVA 3CQ0A 5AN7A 4H01A 1ZCNA 4Z2IA 3BG5A 1QW9A 1JI1A 2EHHA 1J0ZA 1QI2A 1UKPA 2G3MA 4TOQA 1YE4A 4XAFA 4WSKA 3W22A 3BXWA 2GJXB 2R1LA 3EOOA 1PDYA 1FWAC 2E40A 3WK1A 4F2TA 3COTA 1TJ2A 2QT3A 3BG9A 1MUCA 3WH6A 4I7VA 2V30A 1NIUA 4OFCA 1TV7A 4NKCA 2ESCA 4GXWA 1XI3A 4D6HA 2WCSA 1QOPA 4XB3A 4FEZA 1A5SA 4OV9A 3P80A 3GZAA 5A5WA 2WC4A 3WH5A 4JNYA 2PD5A 1PHWA 1JEZA 2Z29A 2QJJA 4TTGA 2V3DA 1PZ1A 2YW3A 4BF5A 4LEFA 2PPPA 4CN4A 4GUGA 1FKJA 2A5HA 2CLOA 1FFQA 1P6WA 3L2IA 4JICA 3ZLGA 1IT0A 2INEA 1H7XA 1F61A 3VX1A 3GU1A 1A5MC 5KEZA 1VR6A 3IIZA 1T8XA 2GJLA 4WY0B 4CN6A 3MVIA 4R7OA 8XIMA 2QMKA 2A3EA 3USBA 2ISSA 1J96A 2WBKA 4AYGA 2R24A 1G0CA 4RCXA 3LHUA 2AGKA 4IIBA 2WNQA 3ZT6A 2DZVA 3O06A 3L4TA 3DN5A 2G3IA 2FHCA 1Q66A 4ICMA 1H51A 1LORA 2YCLA 1V79A 4ASTA 4AISA 3OZYA 2RUSA 3BC9A 1E0UA 1E40A 4J5NA 3WDHA 2GQ3A 3STEA 1PPIA 2J9XA 3FYYA 2XPBA 3OHMB 4I9JA 4UR7A 1L9WA 2PUZA 4HD5A 5FA5A 5MHBA 5E5CA 3ZMRA 4D8LA 4ODOA 3ME3A 4HNOA 1XCFA 4HK7A 3MMDA 2QVNA 4A35A 1GYMA 1ME9A 1EZWA 4N6EA 4B5VA 1EKOA 2CWNA 2F2DA 2QCDA 2G3FA 5E0KA 1VEOA 2GVLA 2DZUA 4ZPVR 3KBMA 2XM1A 1EJRC 3T8QA 4AQLA 1TRDA 1EA0A 1Y0EA 1SFJA 5CBJA 1DOSA 3UG8A 2FFCA 1JZ4A 2E1DA 1YDYA 4DWSC 4C6IA 3BSGA 4IXXA 4GABA 3G8EA 4DRPA 1KGUA 4KR0B 3NWRA 4GNJA 3ZWTA 3CZLA 2A3BA 3S2NA 1XFCA 2VEPA 2BY3A 5HBFA 1VCGA 3E9AA 3D47A 1I0BA 1K8CA 3D6NA 1OX4B 2BVDA 4KEVA 3NA8A 1D2KA 1XPGA 2VOTA 4KW2A 4F40A 4WY0F 5D2WA 1OFEA 2F4EA 1PKNA 1R3YA 4JCLA 1ISXA 3MKVA 4OJYA 3CHVA 4O28A 5LYRA 4WF7A 3TYDA 3EXSA 1FKBA 2A7NA 1BTMA 3LLDA 2FZ9A 5HMDA 2XGIA 4A2SA 3GU0A 4P8VA 5G1TA 2GVGA 1S2AA 4OIFA 2DSUA 5AB3A 1DP0A 4H8UA 1FJDA 3EMZA 6CGTA 3KZ7A 5LGXA 4AZBA 5CGQA 1EJSC 4UQEA 4K7YA 3V18A 1CZ1A 1TMQA 2CZFA 4Q4PA 5CLWA 2J6XA 4H9YA 2BMBA 1TREA 3C56A 3NYZA 3P0XA 3B0XA 1B6CA 1GONA 4BKNA 1F5ZA 2RDTA 3PANA 3ZT7A 3T4WA 1JCLA 3LPPA 3MYOA 3GNXA 2WVTA 2Z24A 3UI4A 4B4HA 1JG9A 3DHPA 4OV4A 2W27A 2VC5A 4G7EB 5FF2A 4TX0A 2WJDA 2PGWA 2J4GA 3MUY1 1XLKA 3H70A 5D32A 2YYTA 1E9YB 1E56A 4C6MA 3I7SA 3CPGA 4IIEA 1EOMA 4S3EA 3TCEA 2MUCA 1ITCA 1CXLA 4R33A 5BWAA 4RZ5A 2IW0A 1GHRA 4BF7A 3LG3A 1UIPA 3P5YA 3PBGA 5BNKA 4ERIA 3LUOA 1PSCA 1IGSA 4DZAA 4DRKA 3WEZA 1K9EA 2GSEA 3WLHA 4J4OA 1QBAA 2HTMA 2XIIA 2VURA 2Y7FA 3O07A 4I6KA 4ICCX 5D2XA 3RFWA 3FLUA 3FYOA 3MMWA 4IIFA 3G6LA 5FEWA 1FH9A 2VT0A 2OLSA 3WKZA 5AZ0A 2D3LA 1XRFA 4MKNA 3T07A 4LC6A 2PWGA 4DPPA 3OG3A 3W74A 4WOZA 1F40A 3EXTA 2J88A 4N42A 1UKSA 3RNDA 1DTNA 4PR4A 3K1GA 2CLFA 3NDOA 2X1UA 3QKEA 1J4IA 1OSEA 3L2LA 1QPQA 4HNCA 1P5QA 5CCZA 4S3BA 1KT0A 2WZMA 5IBXA 1EP1A 1C93A 1UW9A 2NX3A 3RRXA 4RUBA 4H6QA 4ZR8A 4O0QA 4BQ5A 3PPGA 5CC7A 4UTWA 4LYPA 4LX4A 2JEPA 3SR7A 1UH4A 2WSKA 4O16A 4DUXA 2E9BA 1G69A 3FXGA 1TIMA 1HXVA 1F8IA 5BOOA 4KFOA 4RK8A 2WQPA 3IPWA 4QE5A 3U0HA 4IL0A 1YMYA 4US6A 1BSIA 1XLMA 4DZ5A 4ZA0A 3EWZA 1YXCA 2X7VA 1OFQA 2ZZ1A 3KOWA 4NASA 3OTRA 3R10A 3AUJA 4D6GA 2PP0A 1FHLA 3LSBA 5FJTA 2OYLA 4N9CA 3C4UA 4CKQA 4P8UA 1SFSA 2D2OA 3AAMA 2I5GA 4JL1A 2YFNA 1F7BA 5GVJA 5JBDA 1EBGA 3GDRA 3VE7A 1PHQA 3L23A 1O1HA 1LCOA 2X1SA 5GPGA 1VBHA 2PDWA 4DJDC 1CEOA 1XDMA 1XCWA 2ZRZA 1P0NA 3S1GA 5GJPA 3SY5A 1K3UA 3S6OA 4WKAA 4CU8A 4NZ3A 1NARA 5CLTA 2NSOA 3BW3A 3GHRA 1B31A 2OODA 5I3GA 3N2TA 4FX8A 4ZENA 4UFHA 4DRNA 2D0FA 5EMYA 4X22A 4C7DA 5LNSA 3AXHA 2HNHA 2W61A 4CD5A 2X40A 3QV7A 1ZJHA 4X2PA 2WM1A 4GVGA 2O7QA 3IIXA 4HZ8A 4B5UA 2O9TA 1V3LA 4H8HA 3VNZA 1WPCA 3NFUA 3UXDA 2P53A 2NXGA 3PWIA 2VQTA 4BHYA 3ZVHB 1JYNA 5I24A 1J0IA 1JPHA 3PBMA 2BHUA 2YOCA 2PV3A 3L5LA 3WQ4A 5FF3A 3K13A 1UH2A 3KUMA 1LWJA 4OUEA 3AALA 3NQ6A 1G67A 1AG1O 3CUHA 5ECVA 2W66A 3CEUA 1VFSA 4JHMA 2WBGA 3PWAA 1QU4A 1H50A 6REQA 1OHLA 1LRQA 3K1DA 2NV1A 3NQGA 3UZZA 2XP9A 1U5HA 3NZ1A 2B7OA 4LF1A 4R0XA 2PF8A 1E6RA 3U2EA 4M8UA 4C6PA 2MLZA 1Q7QA 4D6FA 5E9AA 5EMKA 1EC9A 2POTA 3NTPA 4KS0A 1EIXA 4K39A 3B04A 4UQ9A 2KE0A 2PRHA 3TTQA 1R7AA 5BXPA 4IGNA 4WVXA 3W7GA 2YL6A 1HJUA 3E12A 4HCHA 5F7UA 3AI0A 4A6GA 3CHCA 1XP3A 3PJWA 3KX6A 1XKYA 1VQTA 4YJ5A 3W2MA 1J6PA 5HUPA 1C9HA 1TPEA 1UA7A 3ATZA 4AF0A 4DF0A 1R85A 3BURA 3KVJA 2P76A 1EYMA 1JYXA 3OYZA 2X42A 3B9NA 4E0CA 4ODQA 3RO6A 1P7TA 3GTXA 3STCA 4AIEA 1HKIA 4I9TA 1Q6EA 1XSIA 1RY0A 1T0OA 2NX1A 4PA8A 3Q4DA 4IMAA 3NQEA 2HK0A 5MKGB 2IPJA 2WV8A 3CO8A 3CLWA 5U7SA 1SQ7A 3KTCA 1R3VA 5I79A 1RXOB 3EDJA 3TVAA 5DCEA 4TIMA 3SBFA 4C6KA 1AL7A 1MMFA 4IUGA 4EE9A 1Q4WA 2GUUA 1JCJA 3MSRA 5DMLA 2LPVA 1Q63A 3CXOA 1WUEA 1G9HA 3UY8A 2PWVA 2EG6A 4KQZA 3HGSA 3AYVA 2GK1B 3K5XA 4MGGA 3ZXWA 1U83A 2EKCA 3ZJKA 5LKYA 5F2GA 3S46A 4C1NA 1BYCA 1TJ0A 1GVFA 3WDQA 4ZB2A 4DBWA 1LQ2A 2GWGA 3CMFA 1KQZA 3ALFA 4DAFA 5LIUX 1S2VA 2ZQTA 2RQSA 4NJKA 1XLCA 1J12A 2X0HA 1K8YA 5LZLA 2YDQA 3RM4A 1GUVA 1GQKA 2NLYA 4D6EA 5CPMA 1A5NC 2HCVA 1UA3A 2IKJA 3NO3A 4L4OA 3H12A 3VD4A 3NTYA 3QV8A 2JF6A 4ALDA 4ZCWA 1GORA 1AW2A 4FXRA 4AZ6A 1IZCA 2REQB 4DWDA 3LY0A 3LBMA 4AH7A 1NSJA 1TPVA 1SO6A 5FACA 3CWNA 4H7CA 3AZRA 3LGEA 3W71A 1ZB5A 4TW7A 4B3LA 1KFCA 4H4IA 1TA3A 1SO4A 3LK6A 1CI1A 5H91A 1U5JA 4E38A 3GSMA 4PMNA 4LUIA 4MIMA 1W3LA 3GW3A 2Z1SA 1NELA 5CZJA 3BV4A 2YB1A 2BX7A 2PDLA 4GK8A 1JZ6A 4MSSA 1DKWA 5AKQA 4KERA 3QVQA 3W1TA 1NOFA 1JPMA 3GDBA 1XIEA 2IQTA 2VYOA 1B3VA 3ICJA 5FEZA 3TTOA 3RGTA 1WXYA 3G1HA 2ZE3A 1QTWA 1L6SA 2WZHA 3BLEA 4DNHA 3WUBA 2EXOA 4MHBA 3C2FA 1Y8BA 4DYEA 1F3EA 3TYBA 3KXQA 3QEZA 2POZA 2DDXA 4A3UA 3GTIA 3ITVA 2NXIA 5BXTA 4GQGA 3N17A 4UOZA 2E67A 1T41A 2PLJA 1FVPA 3SI9A 3TC6A 2R14A 5K9XA 5A2AA 4GQBA 3EGJA 3IJ9A 3WENA 2VCBA 4OKDA 1GW1A 1B57A 2OWWA 3BW4A 1O5KA 1TQXA 3RITA 2F2KA 3RN6A 3ORWA 4GX8A 1QAPA 3MMTA 3WN6A 4QTGA 3R25A 2Q5AA 4QSFA 1X97A 3DENA 1CTNA 4TR9A 3S2LA 3KTXA 4X9YA 3CB3A 3OU8A 4DO4A 3ANVA 5HANA 3O6DA 2XUCA 3GIPA 1QATA 1LT7A 2DEPA 4F66A 4LUSB 1IR1A 4GGBA 2VFDA 5HWCA 2ZA2A 5FSEC 4XVEA 1PIIA 3BOFA 2G96A 2OU4A 4BWLA 1LBLA 4PMUA 3O6CA 1MUMA 2Q8LA 1CECA 4YYCA 4PUJA 3TWBA 2FGLA 4IP4A 1HJQA 4AWEA 1R5YA 1XQKA 1VFUA 1FP9A 1E72M 1RALA 1K70A 1O5QA 3GDMA 4GX9A 3IV3A 1V3HA 4AEEA 3M41A 2Y78A 4GQRA 4NXSA 4HOWA 3LNMA 2HXTA 3BAIA 3MDWA 4HSOA 3VC6A 1U1JA 2FPTA 2ZKMX 1OWQA 1QW8A 1ZJBA 3TN3A 2F7FA 1UQYA 1PDZA 3DU0A 4HBEA 5FF4A 3CYJA 3QZEA 1KFKA 4Q4QA 5HPCA 1JCMP 4UFKA 3MI3A 3GRIA 2OSXA 2KGJA 3NOYA 3WQEA 2F21A 2ATMA 2GJRA 4HGXA 2JK2A 1E51A 1T7LA 3DOPA 3S5ZA 5TQLA 2FZMA 2HV5A 1MW0A 4AY7A 3WQVA 1W9VA 1EJXC 1MXDA 3SADA 4M81A 3G22A 1IEXA 3I3BA 1OCBA 3T55A 5EBAA 1WCGA 3UA3A 1JFXA 1BL4A 3GG8A 1YPIA 2FJUB 1ESWA 4IG2A 3TYAA 2E77A 4U5KA 2ZQ0A 3ZJ7A 4PUMA 3G0XA 4BQ4A 2E5DA 4E8CA 5IXEA 5HJYA 3UG4A 3W2LA 1RD6A 3SCOA 4LS2A 3V75A 3SRFA 2PURA 1B3XA 2Y7EA 4Y96A 1QNRA 3G18A 1BQGA 4JDYA 2J47A 4D6JA 1J18A 4ODLA 1CXIA 3N4FA 4GUFA 2Y62A 4GYFA 5I3HA 4K8EA 4IH3A 3DI1A 3NUKA 2YCLB 4HPXA 3H22A 4RPQA 3U3HA 1XWYA 1B1YA 1UUOA 5CC3A 2PODA 4FR1A 2BZNA 1DE6A 1UR2A 1ZPTA 2H8ZA 3AMKA 4P2VA 4CD7A 4UFLA 1PKYA 1V77A 5I07A 4GA8A 2HQAA 3EMCA 4CQ9A 4LEQA 4GIVA 1TX0A 2FFIA 5EBUA 5EMLA 5HNRA 2QCDB 2RGMA 1KFLA 2VENA 4KWOA 2GOKA 2ZDRA 2GGEA 3GVWA 2OT1A 2VC9A 2PDCA 5DMNA 3AYRA 3ARYA 1C8QA 3VOFA 1US0A 1CB7B 4JFTA 3RCMA 3CHDA 3HJEA 3TK7A 1MNZA 1X7IA 1FKSA 3ZR6A 3F5LA 3GDTA 3RFAA 5D2VA 4AVOA 5BCAA 3GB6A 5JXQA 3FAPA 3GR7A 3VI2A 4AFYA 3N2MA 3NQMA 4W86A 4YU1A 1IYXA 4DN1A 3VM7A 1S1RA 1J9YA 4BI7A 3GC2A 3R4IA 4OE7A 1LG2A 1PS9A 3RILA 1Q6IA 2VWTA 3AHZA 3SQMA 3UZ5A 4LBRA 3IK8A 3DYPA 2YDSA 2YJQA 1S39A 4KRZA 1K7FA 2GL5A 4DI9A 4FOKA 1EH9A 1C9DA 1DBTA 2UZ5A 2ADAA 3HB9A 1WDPA 3PZGA 3GW0A 3PPFA 2JGQA 3LXAA 1UASA 3QGKC 3L0GA 1XUUA 1S5MA 3SCWA 3LHWA 1EDGA 1EX5A 2FB2A 4F4RA 4DZ3A 1R3TA 5FCZA 2PU0A 3WLMA 2IKHA 1MI3A 3P67A 2YLLA 1RVGA 1TMHA 4L80A 3SDOA 3WDJA 4WD0A 1TE1A 1L2UA 2NWRA 2AMXA 1JDFA 1XR2A 2ZX7A 4M29A 2C0AA 2GUBA 4AU0A 1X6NA 1OIMA 4GO9A 4JTUA 3PULA 3AIBA 1UKOA 4O54A 4JFMA 1J0JA 1JUBA 4FHAA 3NQAA 3AZSA 4L6HA 2YXOA 3KM8A 3OLDA 4MB3A 3MMUA 1GYNA 4FNSA 4HYRA 5FAGA 3VCNA 3AC0A 3O6YX 4H00A 4IHCA 3C2OA 4JOMA 3S9ZA 1QOQA 4K6AA 4R5EA 1YYAA 3W01A 3LBCA 1LYXA 4WHBA 1TQJA 1JDCA 2W0UA 2ZXBA 3RJYA 4LRSA 4PSRA 4LY4A 1JZ8A 5KSWA 4JN7A 3NURA 4MJ4A 4ZQRA 4URIA 1ONXA 3ECQA 4GZJA 3UEQA 4MFDA 4XO7A 3SO7A 3UERA 1EXPA 1H1ZA 1X7FA 5CPLA 5C2GA 2P88A 3W7HA 4W85A 1HKMA 3M7SA 2PDKA 1V6UA 3LNPA 2JFEX 3OZOA 1KO0A 4D71A 4GYPA 3MTWA 4AVFA 2XIBA 1WDSA 3V0SA 1E6QM 1NM9A 3B9EA 1IX5A 1A49A 3EX4A 3GNOA 4IWWA 4MY9A 2ISWA 1V7YA 1KRCC 2ICSA 5GJNA 4NZCA 4EPBC 1ZHAA 5AYXA 1UMYA 2V3FA 2WVUA 1SW0A 1XD0A 2Y0FA 4PB3A 2J25A 4F2BA 1SUXA 5HNUA 1XYMA 4E4PA 1AW5A 5A6JA 3IGXA 4LALA 1IHIA 2VC7A 4NNRA 3W1RA 1L0PA 1MWOA 1R2TA 3W70A 4TV6A 3B7XA 2ACQA 2O9OA 2PB1A 3W6LA 4B5NA 2YZ5A 3PSWA 4TNSA 3R2GA 1OD0A 2EAWA 1PTGA 2QLYA 4UTFA 1JAKA 3U7VA 3R11A 3GX9A 4H3DA 2QF7A 3GE7A 3PZ9A 3VIJA 1Z7AA 4MVAA 2DG4A 3EEZA 3KRZA 1UOZA 2KR7A 3L4XA 4GVIA 1FTXA 2HDJA 3DFNA 2DP3A 1GPFA 1ZAIA 3W7EA 1XBYA 1J4HA 2XFYA 3BLIA 4TX9A 4J3WA 4QIBA 1NP0A 3MC5A 1LBMA 1RJQA 1YRRA 5FL0A 1H7RA 5HKGA 1HX0A 3BICA 3CBWA 2BXZA 4QX4A 2ZX9A 4B4FA 3W27A 1SZGA 5EMJA 2LLEA 2QCGA 2PDJA 1ZK6A 3GXMA