4DWSB

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
540
structure length
527
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 190
structure length 527
sequence length 540
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsB01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsB02
3PHAA 2CPUA 4OIFA 2VUYA 1QI5A 3ZM8A 4F66A 2QMJA 2QPSA 2GJRA 3S2CA 4PYSA 1G5AA 5DF0A 2VOTA 2OWCA 1UD3A 1KWGA 3CMGA 4JAWA 2WKLA 5IFTA 2PBOA 4H8VA 1D2KA 5CSUA 1CXIA 2VCCA 1VRXA 3QHNA 3VPLA 2XM1A 1JGIA 3G6MA 3T0DA 1V0MA 4W84A 2YKKA 1QNRA 3SCPA 3PBGA 5LA1A 1V0NA 2QMKA 4EAMA 1KGWA 2WBGA 2J7BA 3VILA 5E0CA 3SIMA 3WD4A 3EYPA 5GNXA 2X05A 3ZT7A 4B9ZA 1A3HA 2CBIA 1TMQA 1UH4A 3U5UA 1U33A 5A69A 3BAXA 2XVGA 4H41A 3VMOA 1JAEA 4E8CA 3ARQA 1QOXA 3J7HA 3N15A 2XVKA 3O6AA 4CD5A 2A3HA 5A6KA 4HMCA 1JFHA 3FW6A 3TP4A 2GDUA 2A3EA 1W9XA 1JXJA 3IJ7A 4PEEA 1U30A 1WAWA 2D22A 1XCXA 4XZBA 2XSAA 1ISYA 2D0GA 4KMQA 5CPSA 4BZYA 1H1NA 3VGEA 4RE2A 1UZ4A 2VX5A 5C8BB 3CZLA 2YL5A 3CZ8A 1ISVA 4D6FA 2YBUA 2VZVA 4MDOA 4TX6A 4H8UA 1BVNP 3TTOA 4AIUA 4PMUA 4MB1A 3SCOA 3VMNA 3W25A 4CD4A 2VZOA 3WFZA 2XUCA 2ZX9A 3IAQA 3WNLA 2YA0A 1OSEA 4XUYA 3ZJ6A 2QPUA 1CENA 2WVUA 4BA0A 1E6NA 3SUSA 1QHZA 3HMCA 4QLJA 4MTVA 2O9PA 4KRUA 3ZIZA 2EPOA 4X0NA 4PMDA 1PX3A 1UWSA 3AICA 3AZSA 4IPNB 1AQHA 3BGAA 1EIBA 4W85A 2VZTA 1MW1A 1E55A 2WMFA 4B3LA 2D24A 3NSMA 5CXPA 3WMSA 1AQMA 1EO7A 1PIGA 4U5KA 1IZJA 5AY7A 1BF2A 1PJ9A 2ZUNA 1L0PA 3VGBA 3WD0A 1NM9A 3GYCA 2J4GA 5DMYA 4DWSA 3MUZ1 2WMHA 3WMBA 1WP6A 4LYPA 4U3AA 4HTYA 3CHFA 2PC8A 1YQ2A 2WVVB 1CXEA 1B1YA 2GDVA 1B31A 1CGWA 2PWDA 1XGZA 3OLIA 4MB3A 4L4PA 1QBAA 3ZJ8A 4HZ7A 1WE5A 4MJ2A 3VNZA 1E4MM 1XSJA 5I23A 1SMAA 2DSZA 4OZOA 2YL6A 4UTFA 1UKSA 4UQAA 3PZIA 1MW3A 2J74A 3TTSA 5AC5A 3NSNA 2D3NA 3AXHA 1FHDA 4JCMA 5M3WA 1EOMA 2G3JA 4EK7A 5ECUA 1E0VA 2ZXQA 4YHEA 1XH2A 1E3ZA 3G6LA 3ZOAA 1M04A 2CETA 3MUY1 1JZ2A 3RILA 2WB5A 1X6LA 2WHMA 4ZE5A 7TAAA 1K6AA 3WH7A 1VB9A 1S46A 2Y4SA 4TVDA 1W1TA 3AIBA 3OLEA 4J3WA 3W29A 1E15A 1CGVA 4M8UA 4C7GA 1GOQA 1W1PA 3WH5A 1EDQA 4QCEA 4JL1A 3DECA 2V3FA 2J7CA 2E9BA 5GQBA 2XYLA 4DUVA 2DT1A 1SFSA 1VF8A 4PRWA 3AIWA 2WVTA 3MSDA 3THCA 3WF1A 1RP9A 4CCCA 3CBWA 4UOZA 1FP9A 3PZTA 1UG6A 2V3EA 4BQ5A 2ZUTA 2PBGA 2J75A 3M07A 4Y7EA 2CKSA 3WBEA 1JI2A 2ZXBA 3FNDA 2YJQA 3RM4A 4CN4A 4W5ZA 3W0KA 2GJXA 3WUBA 1GONA 3BAYA 2XFFA 1G94A 3UR7A 2BY2A 4U5IA 4W88A 5D8ZA 3ZT5A 1BYCA 4ZXOA 3A4AA 4UFLA 3GNRA 1HP4A 2WMIA 3WQVA 4PUEA 2ZUUA 2DSWA 1DWJM 1EDTA 4JKKA 4W7UA 2ZUWA 3VUPA 1JD7A 2WW5A 1V3KA 3E1F1 3U7BA 1WZKA 4BQ4A 2WHJA 1UR4A 4M1RA 5DT5A 4IISA 1LJYA 1UH2A 3RJXA 1JYVA 3CLWA 3GXFA 2PWEA 1KCLA 1TVNA 4NRSA 2WPGA 4E2OA 5BWFA 6A3HA 2WWCA 1PZ3A 3PZOA 4N42A 3AHZA 4D6JA 1B9ZA 3PTKA 3EDKA 3FHQA 3L2MA 3WUGA 2J7DA 3NDYA 1B3VA 3ZO9A 1GW1A 3WQ5A 3ALGA 3WMCA 1BYAA 4OKDA 3EBVA 3OGVA 2WCGA 2G3IA 4J3VA 4HU0A 1V6YA 2XJ7A 4IPLA 1OD0A 1Q6GA 3IJ9A 1VFUA 1R7OA 1AVAA 4PSPA 1HJQA 2J77A 4DM1A 1VJSA 1V3LA 1MYRA 5BRQA 5KZ6A 3L4XA 3UG5A 1OGGA 2WC4A 5KEZA 3UCQA 5JIWA 4DWSB 1MW0A 3SCRA 3BMWA 3IK2A 4KGLA 5C71A 1O6IA 1HX0A 1UUQA 1QHOA 4JFWA 2XVLA 2XPKA 2YBTA 4LPCA 4AZIA 2DT0A 4FLQA 2GJXB 1EHNA 3BSGA 4PMQA 1XD0A 3LPOA 5DT7A 1LG1A 1R7AA 4L4OA 4OBSA 2JF6A 4CKQA 3WELA 1IV8A 1CEOA 2JIEA 1E71M 1TFVA 1CLXA 3W82A 2WMIB 2PF0A 2BY3A 5EBAA 3PN8A 5I24A 5HOSA 2W63A 3BLPX 2W61A 4GI9A 1I1XA 4HA1A 2VJXA 1XV8A 3K4AA 4WKHA 1C92A 1RP8A 2VRKA 3WL0A 4GQQA 2FHCA 4DM2A 3AXIA 2WMJA 2YDRA 1PEZA 3QHMA 1LF1A 4Z2IA 4JFSA 2VQUA 4GI6A 1UH3A 1CIUA 3SCUA 4XV0A 4HOWA 1KR1A 4UQ9A 2VVNA 1V6VA 1HXJA 4GZEA 2WVVA 5EFDA 1KBKA 2XIIA 2XFRA 3VDBA 1Q6FA 1F4AA 1GVIA 4PTVA 4WSJA 5FCZA 2YDQA 2OYKA 1HNYA 3AROA 1EH9A 4EKJA 2E3ZA 3L4UA 3DYPA 2GK1A 4JFVA 1J01A 3AIVA 5A8NA 1W1VA 1XYZA 5I77A 1E4IA 1B30A 5E0FA 3CUGA 2F2HA 1I75A 4ATWA 1KXTA 2E8YA 4AZCB 4TX8A 1MQQA 5JH8A 5E6ZA 1G0CA 1E56A 1UR8A 1BTCA 5FKYA 4F9DA 2DGAA 3CUJA 2CERA 2YIHA 4D6IA 2DT3A 1QPKA 2VZUA 4JL2A 1ZBKA 2ZX8A 5A8PA 1GZJA 3WN6A 2AAAA 1W91A 1NWUA 1E1EA 2VTFA 2BV9A 4YN5A 2O9RA 3B9EA 4MJ4A 2XWEA 2DIEA 4CU6A 1C7SA 1V3JA 4FLSA 2BHUA 3FN9A 2QV4A 4W87A 3CH9A 2XSBA 4OBRA 3OA5A 1DWAM 3W38A 1KGUA 3K8MA 5I2UA 2ZX6A 3GBEA 3K46A 1M01A 5A6LA 5A94A 2V5CA 4UQCA 5CGMA 1J9YA 4PMVA 4B9YA 1NOFA 4WLCA 4URIA 1J0ZA 1GOKA 2OWXA 1VFOA 1GPFA 3W4RA 2C0HA 2EQDA 1BPLB 2MANA 4J3XA 4EE9A 1NWRA 1XC6A 3LMYA 1DHKA 4E8DA 4D6CA 3A6OA 3WH6A 3SCNA 3MMWA 1HJSA 4CVUA 2UY5A 5CZKA 1QW9A 4AD2A 4F79A 2C8NA 4XB3A 3SUWA 1SMDA 3EDEA 4AC1X 3ARUA 2QHAA 1JDAA 1GOMA 1HF6A 4XX6A 4AXNA 1Q6EA 2GSJA 2YLAA 4MADA 5FD0A 5F7UA 3TA9A 2UY4A 3WFLA 1EO5A 1H41A 4D1JA 4F9JA 4UFMA 1C8YA 1HJWA 1UKPA 4NI3A 1I1WA 2EPKX 3BH4A 1E43A 3N13A 4W7WA 4RL3A 3BCFA 4IM4A 1V3MA 1HKKA 4Z2JA 5FIPA 3TTYA 1ITCA 2G3MA 2CIPA 5ABFA 4K68A 2A3BA 1QVBA 3GH4A 4HZ8A 3CUHA 1UYQA 3NDZA 1MQRA 1Z32X 2BXZA 4QFUA 2IXVA 3I3BA 3PZMA 3L4VA 5CQ1A 3ARPA 1V08A 2ZWZA 4UZSA 2VC9A 4W89A 3VVGA 1UKOA 1JYWA 1H4PA 3VIMA 4LX4A 3MKKA 1EQPA 1KCKA 3SCVA 4Q7NA 3VGGA 1VEMA 1JYXA 3EMCA 3LPGA 1CXHA 5HNNA 1GOIA 4UR9A 1E6ZA 2Y8VA 1PX8A 4HA3A 3GM8A 4JCLA 1GQLA 3GH7A 4LYRA 1J10A 3PZQA 1UD2A 1BGGA 2OSYA 3CTTA 5DFAA 4YPJA 4A3HA 1TG7A 1OGBA 1OD8A 3GZAA 2WK2A 1BG9A 1CGYA 3MS8A 1UD5A 2E9MA 2EXOA 4LGXA 2BHZA 4W93A 4NRRA 3TTQA 1W3LA 6CGTA 3W6MA 5A2BA 3WH8A 1XH1A 2VZSA 5I6SA 3W27A 4IUGA 1WCGA 2BNJA 1W3KA 1JG9A 3DHPA 3T2QA 1ISWA 5CGTA 5HPOA 3ARTA 1QNQA 3U7VA 3AIUA 1GOOA 3MUAA 3ZT6A 3K4DA 4AW7A 1M53A 1PAMA 5A8MA 1BVZA 1G1YA 4J7RA 3O9NA 1HJUA 1W3JA 1GJWA 3WF2A 1R86A 4OOZA 1G01A 3VM7A 3U57A 1GQJA 2V3DA 4CN1A 4JHZA 4A3YA 1OCQA 2AOSA 4JIEA 4QCFA 3CO4A 3OB8A 4MNJA 4P8UA 2JFEX 3MMUA 2FGZA 1KWKA 2XFYA 3AYRA 3VX1A 5M5DA 3CPUA 3IANA 5HDRA 2DT2A 1OGSA 1US2A 2ZICA 1JNEA 5D4YA 4MB4A 1HL8A 7CGTA 3ZR6A 1J18A 2VRQA 5A6SA 1E40A 3N11A 1WZLA 1HVQA 2EPLX 1HIZA 2O9TA 4Z2GA 2A3CA 2FDMA 3T2PA 1XYFA 1HJXA 4FMVA 1CWYA 4CVWA 3CMJA 4JKMA 3N18A 5A8QA 1FFQA 3BXWA 4FF5A 4M24A 4AZCA 4MPKA 4ZFMA 3HN3A 4D1IA 3WF3A 1SR0A 1VFFA 2BVYA 1R85A 4UOJA 5JIPA 2VR5A 1KXQA 1HL9A 3BC9A 1VENA 2EEXA 1PPIA 2J8FA 4CUCA 3VD7A 1JF6A 3WIJA 1XSIA 3T0BA 2A3AA 4HMEA 1LL4A 1ZU8A 3W53A 1B0IA 3AMDA 5M17A 2ZXDA 3EDFA 4P7QA 1C91A 3VTRA 5E6YA 4FLRA 5I79A 4PCTA 3FHAA 3L4TA 1FH7A 2JEQA 3SUVA 2DH3A 3K8KA 1V0KA 1QI0A 3AMGA 1FHLA 2JE8A 1E4NA 5A2AA 4C7FA 3WD1A 1V02E 4PMZA 3QGVA 3F5LA 3WDQA 4GO8A 1N82A 5HXMA 3JUGA 1J0JA 1BGAA 4QDMA 1KXHA 2VX7A 3WQ6A 3DHUA 2ESCA 3GXDA 3WDJA 2ZUMA 5BXTA 3TOPA 1H5VA 2BY0A 2HVMA 4AY1A 3HU7A 4BCEA 3ARZA 1D7FA 2VL4A 4NZCA 3GXMA 1DWFM 4LXFA 1VEPA 3WQWA 1QW8A 3WUEA 3AXXA 1V03A 4ZENA 2ZOXA 2Y8KA 2EJ1A 1JL8A 1Q6DA 2YDSA 4HOZA 3ZQ9A 1UKTA 2WMKA 4PMNA 1OIFA 2ZUVA 1KB3A 4JKLA 1EGZA 5CSYA 3W28A 3OZPA 4CGTA 3GXIA 3II1A 3SEPA 4F8XA 2CHOA 5FOOA 3B8SA 3VD9A 4X0VA 1OINA 4KWUA 5I78A 3AJ7A 3SCQA 1IT0A 1XRVA 4UFHA 1SYTA 1HP5A 2D0HA 1CYGA 2XHYA 3NCOA 4WK9A 2OYMA 1JI1A 2WYSA 1J0HA 1UWTA 4ZE4A 2BS9A 3EDDA 3NUKA 1PIFA 4J27A 1W3HA 4S3JA 4P8VA 3KL3A 1VJZA 2FH6A 3WQ8A 2X0YA 1ITXA 1LWJA 4AISA 1E6XM 1JFXA 2J7EA 4AD4A 3VDCA 2ZIDA 3VD3A 1QHPA 2CYGA 2WHLA 4GINA 4PN2A 4HMDA 3WEZA 1GVYA 3PTQA 5JBFA 1K9FA 1VBUA 3AHTA 1V0LA 3SUUA 3WDIA 4BF7A 1QI3A 1VEOA 4W7VA 3VINA 3KEHA 3VGDA 2D2OA 2VRJA 2DH2A 2NW0A 1K9TA 3O2LA 4S3KA 5AYBA 4MAZA 3IAPA 4R27A 4QLKA 1ODUA 2WSKA 2QF8A 3CZGA 5EFFA 3W24A 1HJVA 5I0DA 1NP2A 2DSUA 1MFUA 5ABGA 2VT0A 3LPPA 3F4VA 1HN1A 1GHSA 2CCRA 1R8LA 2TAAA 4AZGA 4PMOA 2YA1A 1JIBA 3UR8A 3EDJA 1KQZA 1PX4A 3CZKA 3W81A 4BS0A 2HISA 2DDXA 4GKLA 5DEZA 4UFKA 3ZR5A 1X6NA 5BCAA 3UG4A 4CD7A 4JFUA 2W5FA 3KZSA 2DSVA 3N17A 1JD9A 1EDGA 3PZVA 1BG4A 3AIRA 3POHA 2VI0A 4KH2A 1TVPA 1BLIA 1H11A 4PBGA 4PSRA 2W62A 1GUVA 1C8XA 1FH9A 4B3KA 2VR4A 2X2YA 2IXUA 2BFGA 4UQEA 4OOUA 4CD6A 4CCEA 1KQYA 4AMCA 2WM0A 1HKIA 1QNSA 1UR0A 4H8HA 4GZJA 1ISXA 5D9NA 2FH8A 3L2LA 2VX6A 2WBKA 5I5RA 5EMYA 4CU8A 4AD1A 2J25A 1UWIA 2ZX5A 4AD5A 2CHNA 3UESA 3ARRA 3DC0A 5A6BD 2BVDA 1CZ1A 4TOQA 4JHOA 1V6XA 1US3A 1J0KA 3DYOA 1CECA 1J12A 1MFVA 1MXGA 3IJ8A 4J3SA 3OLDA 3RCNA 2XM2A 5BXPA 1H3GA 5D9OA 4WKAA 3MO4A 4H7VA 5FL1A 1J0YA 4AIOA 3M46A 1GQIA 2ZX7A 3VD4A 5A8OA 3AQUA 4GPNA 3NSXA 3RO8A 3VIIA 1TR1A 2BY1A 1MW2A 3BAJA 1H0IA 1KR0A 3OGSA 4HZ6A 4MDPA 1GQKA 3OG2A 1KXVA 3SCTA 2XWDA 1JAKA 3RM8A 2Y2WA 3VDAA 2GK1B 4UOQA 2XG9A 1HKMA 3VD5A 2WXDM 2WCAA 4Z2KA 5IHRA 4JZ5A 2X0HA 1OB0A 2CXGA 2WCSA 1ZL1A 2WC7A 1TE1A 3HJEA 4C7DA 2OWWA 1W1YA 5A3HA 2CEQA 3ZSSA 5BXRA 4P8WA 3WY1A 1AQ0A 4TVCA 3CIVA 3FXYA 3BLKA 3ZSTA 1X1NA 2WLYA 1BHGA 3VOCA 4AYSA 4HPHA 1WZMA 1ZBCA 1QBBA 1EXPA 5BYWA 3KL5A 1B3WA 2Y24A 4TUFA 4CCDA 4DWSD 1E5NA 4P7OA 5M03A 3MV01 4Z2LA 1ZBWA 1WB0A 3B9AA 1W2PA 2F61A 4MB5A 4D6EA 3MANA 1UQZA 2VURA 4UFJA 4D71A 1W9BM 1ISZA 5A95A 2PWGA 2VCBA 1CPUA 4QAWA 2WANA 2YA2A 2J62A 2VCAA 4E4PA 3WF4A 1LL7A 3PZGA 1YHTA 3S6TA 1UD8A 4H2CA 2QLYA 5A2CA 5LA0A 3VIFA 3VGFA 1WDPA 1DWGM 2WLZA 4ACZA 1W9VA 1OIMA 1E72M 3ZJKA 1GNXA 3WDHA 4Z2HA 3WQ4A 4HP5A 4A4AA 3AS2A 2CKRA 2GJPA 2G41A 2J7HA 3VNYA 4GI8A 2O92A 4PMXA 1H0GA 3N9KA 1QI4A 1JNDA 2OSXA 3AIEA 3WENA 4M82A 4CU7A 1KFWA 1CGXA 3OLGA 1V3HA 4U31A 3VIKA 4ML4A 4D72A 1LQ0A 3WSUA 3AMCA 3NYDA 4NSBA 1LLOA 4WKFA 1OT2A 6TAAA 2XIBA 3WNMA 1EHAA 1NARA 4V28A 3AMKA 1JZ7A 3MMDA 5CJ5A 1JZ6A 4OJYA 1UWUA 3UEQA 5GNYA 1OBAA 2Q8XA 2E0PA 2O9OA 3VX0A 1NWTA 1TA3A 1RPKA 3UG3A 3T2OA 4ATDA 3FAXA 4W5UA 3CUIA 4M56A 3AOFA 4W8AA 3K1DA 3B9DA 4KGJA 4PTWA 1WDSA 4TXEA 2ZE0A 4GIAA 4X9YA 2C7FA 1CGTA 4UFIA 3TONA 4UCFA 1QI2A 3AFBA 2DIJA 3DYMA 2WSPA 1B90A 3UETA 2VVSA 3SCSA 3ARSA 4J3UA 1H49A 1E6QM 1GOWA 5BROA 2W92A 1JDCA 1GORA 5ABEA 4JFTA 1PBGA 3WH9A 1PZ2A 2NT0A 2EBNA 4ACZB 3BAIA 2CESA 1WDRA 3N04A 1V6WA 1K9EA 3D5HA 3L4YA 1MQPA 2D23A 2PB1A 1M03A 3VMPA 1V3IA 1UZ1A 2DQXA 4UZUA 1Q4NX 1JZ4A 1NP0A 4GQRA 1V02A 2CITA 3FY1A 4XZWA 1E0WA 2XGIA 2FHBA 5ABHA 4MNKA 2YL9A 1FFRA 5A6BA 1LG2A 3VIHA 3F5JA 4DUWA 3MSGA 1NOUA 5BXSA 4MNMA 1MVYA 2OLHA 3GBDA 1RD6A 1H2JA 2UY2A 5AYIA 2W91A 1HKJA 1E6RA 2WWDA 3WD2A 1VFMA 4J3TA 4CD8A 1E4LA 5IXEA 1B3XA 3A4XA 1FOBA 3N1AA 2G8ZA 1TA3B 3GTNA 1FH8A 4W8LA 1P6WA 1G9HA 3AMLA 3AISA 4NF7A 4AZ6A 1UQYA 1DP0A 1ESWA 2EO7A 2G4FA 1VBRA 1C93A 1L8NA 1BFNA 4AD3A 3AIQA 1FA2A 1CNVA 1ECEA 3ECQA 3SCWA 8CGTA 1OWQA 4AZHA 1K9DA 5A6AA 2VO5A 2D1ZA 2B31A 3WL1A 4GO9A 4TVUA 1A47A 1OM0A 1UR2A 3NJ3A 3WUFA 3CHDA 2WMGA 5BRPA 3M7SA 4YHGA 1BAGA 1O7AA 4AIEA 1CBGA 5CPQA 2GFTA 2JIWA 3VM5A 3WF0A 3T08A 1UR9A 3AZRA 1E5JA 1BYBA 4P7RA 2V5DA 2EPNA 5IFPA 2W67A 2E8ZA 5HPCA 4LYQA 2J7GA 3GDBA 2CBJA 3RIKA 1H09A 1XHGA 1ZJBA 4AEFA 4MAVA 3W26A 3ZJ7A 1E1FA 2AMGA 4PMYA 1BQCA 3VGHA 1VIWA 1AMYA 3OGRA 3PTMA 1XD1A 1WKYA 1E3XA 3AS3A 2YOCA 3EMZA 1TUXA 4H04A 2DEPA 3AS0A 2XGBA 4UNIA 2J79A 5LYRA 1JDDA 3L4WA 3ARVA 1UWQA 1MXDA 1ZS2A 4GZIA 2G3NA 5D9PA 3KE0A 5E9AA 4R5EA 4AZ7A 2X09A 4AZ5A 2W66A 2XTKA 1HVXA 1WPCA 4HA4A 1LL6A 1CDGA 1NOWA 4PUDA 1WNOA 3APGA 4BQ3A 3RJYA 3OIHA 1JZ5A 1EQCA 2V3GA 4J28A 2OYLA 4AEEA 1NWSA 1E9LA 3AHVA 4HPGA 3MUIA 3SUTA 3GNOA 1XCWA 2NT1A 1DWHM 3AHXA 5CPTA 4PTXA 1JZ8A 3T09A 1JYNA 4GXPA 4ZXLA 1B3ZA 3RMEA 1UA3A 4LQ1A 2Y5EA 3WKZA 3A4WA 5IHSA 5GNZA 4FK9A 2Z1KA 5A6MA 2J7FA 5GPRA 2J8GA 3CUFA 1CGUA 3WDPP 1FP8A 3ARWA 4AD0A 2JF7A 3WD3A 3ZMRA 3BSHA 1UWRA 1V6UA 3BAKA 2F8QA 2W4XA 2FGLA 1WDQA 2PWFA 2WZIA 1E6SM 3VKKA 4BQ2A 3KL0A 2UWFA 4DUXA 1F4HA 3QR3A 1EA9C 5D8WA 2WZEA 4V2XA 4N0RA 3OBAA 1UR1A 3MU7A 3N12A 3NIYA 9CGTA 2XVPA 4WJXA 2YLLA 4W86A 1Y7VA 4QLLA 3OZOA 1Q6CA 3EMQA 4D6DA 3CHCA 1ZJAA 3VIOA 1EOKA 1RH9A 1W9PA 1MWOA 3VU2A 5JBDA 4B16A 4WF7A 3SURA 2D3LA 1QNPA 1W9DM 3WNOA 5C70A 2RGLA 2YL8A 3CZEA 5JBEA 3WNPA 5LA2A 1DEDA 2VNCA 1CLVA 4W8BA 2DSKA 2J78A 3QHOA 1UD6A 3D3AA 2WVSA 2JALA 4AWEA 5CLWA 2E40A 4PMRA 1ODZA 1DWIM 1E0XA 3CZJA 3WBAA 3AI0A 1UKQA 4RE4A 4M29A 4TTUA 4HOXA 5A6JA 4U2YA 1DTUA 2VQTA 3RPMA 3VIGA 1WZAA 2X8RA 3AS1A 1GCYA 3WEOA 4DWSC 1E73M 3F5KA 2XVNA 5E09A 5EB8A 4OUEA 3BCDA 3ARYA 2CBVA 4TTGA 2WHKA 1QNOA 2ZXAA 1B3YA 4ACYA 1TZ7A 2ZUSA 1ZB5A 2E9LA 5DO8A 2Z1SA 4U3CA 4WSKA 8A3HA 3ARXA 5CLTA 5FL0A 1R87A 3QOMA 1VAHA 2X1IA 7A3HA 3POCA 3WEMA 1E6PA 2ZWYA 3CGTA 3PZNA 2RGMA 1UD4A 3A3HA 4P7NA 5TD4A 2NSXA 3A47A 4ZEPA 3WNNA 1C90A 5HBFA 4KRTA 1J0IA 1C3FA 2WAGA 4M80A 2D0FA 4M81A 3GH5A 1KBBA 5AC4A 4CN6A 2IUZA 4EANA 4HU8A 1JXKA 1NQ6A 4PCSA 1OT1A 2PWHA 1GJUA 3KWXA 1W32A 2CNCA 3AZTA 3AYSA 3PZUA 2UY3A 3PZ9A 4D6HA 2WKGA 1NH6A 1IZKA 1J11A 1UHVA 2WC3A 1U2YA 1D3CA 5D9MA 3RDKA 4U33A 1CXKA 1XSKA 3W6LA 2CBUA 3WNKA 1LWHA 2J47A 4WIWA 1HT6A 4D6GA 4ATLA 3BAWA 2OSWA 2WZHA 3VO0A 2E4TA 3UERA 4UQDA 4AZBA 4B15A 2EPMX 3K8LA 2BVTA 2BHYA 5I3DA 5IDIA 4P8XA 4UQBA 3GNPA 4MNLA 3VIPA 5JUVA 2JEPA 1E70M 1C7TA 5CG0A 1KGXA 1W9UA 1TCMA 1CXLA 3MV11 1JF5A 1GHRA 1XH0A 1M7XA 3RM9A 1JZ3A 3AHYA 5A1AA 4FLOA 3FAWA 2DPEA 2FHFA 1CTNA 3I3DA 1BYDA 2GVYA 5E70A 1BSIA 2BXYA 3I3EA 3T0AA 4QP0A 3CHEA 2VX4A 2V38A 2PI6A 3ALFA 4Q22A 3VDHA 1UOKA 3QOKA 1UA7A 2WNWA 1ZBVA 4V27A 3VIJA 3BMVA 3WDRA 1C8QA 2D20A 4U2ZA 1CXFA 3U5YA 3M6DA 3LPFA 4P7LA 1B2YA 1WO2A 1W2VA 3L4ZA 3W37A 2VMFA 4RE3A 3THDA 2GUYA 4PTMA 5ABFB
chains in the Genus database with same CATH superfamily
3PHAA 3ITCA 2GOKA 3QMTA 4WOQA 4IJCA 3PUEA 2Y5JA 3W1LA 1G5AA 3PSWA 1OVDA 1KWGA 1N2VA 2Z24A 4IMCA 5FF7A 3QYQA 1QXLA 2Y89A 1D2KA 1Q65A 1SW0A 3LUTA 4JTDA 3LCFA 3SECA 3SW6A 5CC5A 3GXTA 3HGSA 1V4YA 5LA1A 3NQ2A 2QMKA 2WBGA 3VILA 4GKTA 5E0CA 5RUBA 2IF4A 1K8XA 2QUMA 3OZMA 1LRNA 1RHCA 3H23A 5MKGA 5A6TC 3GHTA 4B5XA 1TMQA 3GFXA 3NNTA 3U5UA 2D2GA 3BAXA 3RFAA 4LEFA 3W71A 4E8CA 1QOXA 2XVKA 3O6AA 4CD5A 2A3HA 3GG8A 4QITA 2A3EA 4O19A 3TV8A 1JXJA 2OOFA 3IJ7A 1P6CA 4PEEA 3U4AA 2D22A 2XSAA 4PCNA 4BZYA 1K6WA 4QE4A 4IG2A 2VX5A 5C8BB 1JUEA 4XG1A 2YL5A 1GW9A 3KRBA 4NZ1A 1W37A 2XH4A 1LP6A 5FEWA 1O94A 3TTEA 3LGEA 1S5MA 1V8EA 3IIZA 1AQFA 4IP4A 3SCOA 2VN1A 4CD4A 5BWAA 3N6JA 3UY7A 2PCEA 4O1AA 3WNLA 2ZVIA 4FX6M 1XLDA 3ZJ6A 2WVUA 2XFWA 2D2JA 4O54A 3SUSA 1QHZA 1RQHA 2O9PA 3ZIZA 2EPOA 3NZPA 4X0NA 4PMDA 4RZ6A 3WLJA 3A24A 1VRDA 1PX3A 3AICA 3DEQA 1M1BA 3KTSA 1AQHA 1AG1O 3WLHA 1P43A 2WMFA 2D24A 1IWBA 5CXPA 4IP7A 4GY7A 5E0KA 1EO7A 3WMSA 2CXEA 3M43A 1P4CA 1PJ9A 2ZUNA 1HO4A 4ES4A 3S6OA 2OLAA 4JNZA 2BB0A 3GYCA 3T81A 5DMYA 1NDVA 2NVAA 4KFOA 4HTYA 2HNHA 4FNRA 5KZEA 2KZHA 3ATZA 1B1YA 2MNTA 3CUXA 4X2PA 5K9DA 4O1BA 3F2CA 1CGWA 1TPEA 4HJFA 3LI0A 4LUJA 3UJEA 3KTCA 3LV5A 3WLQA 3ZR4A 3FV9A 1AW2A 1HGYA 3KBVA 1E4MM 2H8XA 1FWSA 5I23A 1SMAA 2DSZA 4OZOA 3T40A 1MDLA 4UQAA 4EIVA 2J74A 3TTSA 2VDIA 4GUFA 3NSNA 1RBLA 2D3NA 3QGAC 4MKNA 4X61A 3VKJA 1AA1B 2AKZA 1PS9A 3DKJA 4E3TA 3LLFA 1E3ZA 1JPKA 1ZP4A 3ZOAA 1KBLA 1M04A 1TCDA 2Y8UA 3SI9A 3MUY1 1YPIA 4FR6A 2F84A 4L6DA 3JS3A 5CC6A 3GY1A 1QAPA 2Y4SA 3KOZA 3CXOA 2ZE3A 2BDQA 4XZ9A 4ZOAA 3GHUA 4CQ9A 2A79A 1Q85A 4Y2WA 3B40A 2FPTA 3I6CA 3LZ5A 2VFIA 4FAMA 3THAA 3IK8A 1TX0A 2E9BA 1OJXA 5GQBA 2DT1A 1SFSA 5HMSA 3P61A 1VF8A 4FOKA 4DO4A 3W7LA 4ZGYA 4XD3A 3LBCA 1XC4A 4L4LA 1O12A 1D3GA 2NSOA 3WF1A 3SJNA 3R5EA 3UP8A 1YNQA 2ZRYA 4UOZA 2ZUTA 3KAHA 3WK2A 4HHMA 4Y7EA 2CKSA 4LUSB 3FNDA 4RX0A 3UZWA 2YJQA 5D2XA 3W0KA 2EULA 1Q6LA 2BMBA 4FNTA 3XISA 1G94A 1FKHA 2BY2A 5DMMA 1GVRA 1UASA 4FA3A 3VZYA 1HP4A 3UZZA 2WMIA 5AHIA 1XLKA 2OQLA 1DWJM 1YTDA 1EDTA 2E5CA 5HMEA 4JKKA 3AWOA 3KDOA 4OWGA 1JD7A 3E1F1 3U7BA 4BQ4A 4DJDC 2WHJA 1FDJA 2PDJA 1VJIA 2ZFAA 3DG6A 4IISA 3U8GA 3CLWA 3GXFA 4E2OA 4NRSA 4OFCA 3RNDA 3AHZA 4A8RA 1B9ZA 4AC7C 1EJSC 1JCHB 3TW6A 4DZIA 1B3VA 4RZ5A 3NL2A 1GW1A 1P0NA 4DRNA 3BMXA 4KCTA 1EJUC 2XJ7A 3GPKA 2FTWA 1ZAIA 1W8GA 2HVOA 2J77A 2Z0IA 4DELA 4PB4A 3P84A 1HTIA 4QISA 3LXBA 2OR2A 4WUIA 3A3XA 2V2CA 3DOPA 4DB7A 3KAGA 3PUOA 1MW0A 5C71A 2XVLA 5BXJA 4PR4A 2XPKA 5EGRA 3RLGA 1LUCB 2NQ9A 2GJXB 3BWWA 1E51A 3LPOA 4F4RA 1R7AA 4UNLA 5I3JA 1KM5A 1D8CA 3TYDA 3NAVA 3LI1A 4CKQA 1CB7B 1IV8A 3MHFA 3L23A 2PMQA 4B5UA 1TFVA 1CLXA 5H2ZA 2V6AA 5J8LA 2PF0A 1YE4A 4S3CA 1ICQA 1JGMA 2B81A 2A5HA 3ONCA 3BLPX 4O4VA 1UMYA 2VJXA 1GKQA 1XV8A 1C92A 3EWYA 3HV8A 1RP8A 3EWBX 3E96A 4NX5A 2FHCA 4DM2A 1M41A 1PEZA 1LF1A 4ZPWR 3EA3A 4JFSA 4K3ZA 4GNKB 4WXZA 5FJOA 1CIUA 2FZ8A 5I3GA 3SCUA 1J79A 4GZEA 3EXTA 5TF0A 2PWUA 3HQPA 3WK3A 1SJBA 1TPUA 5EFDA 2XIIA 2DZAA 3C5QA 3EB2A 1Q6FA 1IEWA 4BWLC 1O60A 2YDQA 5I09A 4NQ1A 1QPQA 1HNYA 2R1MA 1NIUA 3GU9A 2G96A 4D8LA 2VFDA 2GK1A 3AIVA 5A8NA 4C6BA 3MI3A 3S2LA 4A8IA 3TK7A 4ATWA 4X3ZA 4XAKA 1G0CA 3KHDA 1UR8A 1KLZA 4LALA 5FKYA 4QG6A 2CERA 4D6IA 1QPKA 3UT0A 5BZAA 2BOGX 2HSAA 3BICA 2Y7GA 3WK0A 1GZJA 4AVNA 2TODA 2O9RA 3B9EA 4CU6A 1TREA 2XZ7A 4FOUA 3W7CA 2QV4A 5F2IA 3OA5A 3NOYA 3IIPA 1PBKA 1JCNA 2NV2A 5I2UA 4GZ7A 1M01A 3A21A 5CGMA 5LNUA 1J9YA 4PMVA 1GOKA 2ANUA 1NEYA 4WEVX 2IPWA 3VNIA 3WLSA 4B91A 1LQ2A 2C0HA 1XIDA 4HSNA 4LS0A 1KBJA 4LUTA 4U28A 3SZ8A 2Q09A 1NTHA 3LMYA 1DHKA 4EWJA 1MMFA 4ALDA 2ZTKA 3ZVIA 1FHUA 3AUJA 2FKEA 3R25A 1IIHA 4F79A 1EWDA 1SMDA 4V1XA 1Q1CA 3EDEA 2EG8A 1P0DA 3SSJA 4G6CA 4XX6A 1Q6EA 4MADA 2NWRA 5FD0A 4A3UA 3F2DA 1BRLB 3W70A 2QCHA 3KRZA 1H41A 4UFMA 3TQPA 3KABA 1M68A 1X8FA 1HJWA 4ZB2A 1SW3A 3BH4A 4W7WA 3GU1A 1QW7A 4HIBA 4R3UA 3TN4A 1A5AA 3R11A 1NDWA 4QQ3A 3DBNA 2GDQA 2CIPA 2A3BA 3GH4A 1L8PA 3ITGA 1Z32X 2FDSA 4QFUA 1MO0A 3GK0A 5CQ1A 3CMFA 4W89A 3K13A 3B9NA 2POZA 1NSJA 3VIMA 4Z0SA 1Y0EA 1O5KA 4LU0A 4QJ1A 2YW3A 1YADA 4XVEA 2BODX 1YYAA 4GISA 5FJIA 1A5BA 1GQLA 4LYRA 4S39A 3TAKA 4ERAA 2C71A 5DMNA 3CTTA 4XBKA 1AJ0A 2GWGA 4A3HA 1OGBA 3KVMA 5CGQA 1E44A 2B7OA 1GEQA 2J9ZA 4Q4SA 4LGXA 3W2NA 4HNNA 4A22A 2CLHA 3CASA 1W3LA 1ROUA 4Q7BA 2GLKA 3W6MA 3NTPA 3U2EA 2VZSA 3O16A 3VOGA 2P3ZA 4B2DD 1RV8A 4S3FA 2GVEA 3R13A 1TJRA 3NL3A 3URAA 1JG9A 3DHPA 4FHAA 1X7IA 3PBUA 4BWLA 5AC7A 1H61A 2PLKA 5TNVA 1BVZA 1G1YA 4J7RA 2JK2A 3O9NA 3PF3A 4ZOEA 1ZSXA 3XINA 1R86A 4MUPA 2V3DA 2OZ3A 4CN1A 4JHZA 3TJIA 2AOSA 4E2VA 2PODA 4MLRA 4P8UA 4XBJA 2XFYA 5C7HA 3BMBA 3KAOA 2C15A 3CPUA 2DT2A 2ZICA 2ZR5A 1AZ1A 1H51A 3KVLA 1HL8A 1GRJA 4OVXA 1ZPTA 1GVFA 1D7IA 2P88A 3O5EA 1E40A 3N11A 3N14A 1WZLA 1HVQA 3E0WA 1HIZA 2DV0A 4Z2GA 2O9TA 3ANYA 4DJFC 5LNWA 3A5VA 4FMVA 5FF4A 2H6RA 1FWNA 2Z00A 3CMJA 3CH0A 4TQTA 3BXWA 2P4VA 3V5FA 4QX4A 1QK0A 5T9BG 2YCIX 2NQLA 4S38A 1TWDA 1QO2A 2P1FA 1S38A 1VFFA 1R85A 3P74A 4IPPA 4UOJA 3ZS4A 5JIPA 4DWDA 1Y5VA 4DLMA 1HL9A 4LVGA 4YTUA 3BC9A 2PFHA 1XSIA 2A3AA 4HMEA 4LUIA 1UPMB 4C6OA 3E12A 3D3FA 1AH0A 4P7QA 1C91A 3WJZA 1M9HA 2Z7KA 4FLRA 2Y62A 3RITA 4L72B 2QCCA 3H55A 5AHLA 2K8IA 1F76A 1EBGA 4F40A 2FVMA 4UTUA 3KS5A 4A3RA 2MPHA 5IM51 3MSYA 1KTCA 3KRSA 3E9AA 5D2VA 4PMZA 4JTSA 4O15A 1BGAA 4E4UA 3PFMA 4D2JA 3UVIA 4DNMA 4N9EA 1AZ2A 2ESCA 2MNRA 4DROA 2QDEA 3U2OA 4ERGA 2O7SA 1VYSX 1UUOA 3ITOA 2DG9A 1J96A 1XLJA 2HVMA 3ARZA 3O5FA 3GXMA 1DWFM 3LY0A 4LXFA 4A29A 1VEPA 3BCJA 3WQWA 2YB1A 3GC4A 3W1XA 4BI5A 4A2RA 3ZQ9A 1UKTA 4PMNA 3JU2A 4TW6A 1KB3A 1H7OA 5FF0A 1Q6IA 3W28A 1YXDA 4CGTA 1LT7A 1XLGA 2PDHA 3QV7A 3GR7A 3GTHA 3UYCA 4F8XA 3B8SA 3FA3A 4I8DA 1SZGA 3V0TA 3S5ZA 2ZADA 4X0VA 4Q7IA 4EF8A 1EQ3A 3CQJA 3QW4B 1FKJA 4EX4A 1O4UA 2IMRA 3W1MA 3IIXA 4L80A 4UFHA 1SYTA 1CYGA 1B4KA 2PEVA 1XFBA 4MLJA 2OYMA 1SFLA 4AAJA 4J27A 5FF2A 3T07A 4O53A 4NAFA 3KL3A 3EWDA 4PGLA 3UA3A 3WQ8A 2EAWA 1XX1A 4XK2A 4ADUA 4AISA 1AJ2A 3TXZA 1JFXA 1RD5A 2HZGA 1LRTA 3STFA 3VDCA 2ISSA 4WRHA 5AOUA 3L5MA 5BOEA 4GC4A 4WDUA 4RDVA 4GYPC 4O1EA 1XIBA 4GX8A 5JBFA 1OYCA 2NVCA 3H4GA 3SUUA 4N9CA 4BF7A 2GJNA 3N25A 4XD6A 1PO9A 3GDLA 2XP6A 2DH2A 3FVMA 2NW0A 1K9TA 5C55A 3O2LA 5XIMA 2FAPA 5AHNA 4XWUA 4KCUA 2J8TA 2A6NA 4QLKA 4TV6A 4X9SA 2XN0A 3P0WA 4ZO6A 2CZ5A 1MFUA 4PULA 2HK0A 4DBSA 3IVTA 2G97A 2TAAA 1TMHA 3MYPA 3DDMA 1HW6A 3DI1A 3L5LA 3G3MA 3NDOA 3IJQA 1X98A 2EGZA 2X1RA 4O0QA 2I9EA 1FKBA 2YZ5A 4QRNA 2NVDA 3ZR5A 1GTEA 4CD7A 1QWKA 1VKFA 4US5D 4DXVA 2YFNA 3ANUA 1VQTA 3HOJA 4G5DA 2RH9A 1BG4A 3POHA 2PURA 2Y1HA 2VI0A 2C1HA 4KH2A 4HK7A 1TVPA 1W1IE 1R3YA 2ONEA 3DI0A 4PUWA 1F05A 1R47A 1FH9A 4XBSA 1Q66A 4JIHA 2R1KA 3VA8A 4ZSTA 4AMCA 1PWMA 1HKIA 4H8HA 5D9NA 5I5RA 4JFMA 1JNTA 1G67A 3UBPC 1FWGC 3VNJA 4GQGA 1H7PA 2P76A 3UESA 3DC0A 3O8AA 2REQB 4TOQA 4GIEA 1CECA 4KPLA 2H8ZA 1FWFC 4Y9PA 3S46A 1JCTA 3LLDA 4TYOA 5FEZA 5D9OA 3M16A 4Q3MA 2WNQA 5CPNA 1FWDC 1R2RA 2HDJA 3A3WA 5BMWA 3TCZA 5A8OA 3AQUA 4GPNA 3FEQA 3NSXA 3VIIA 1TR1A 2BY1A 4E8GA 1MW2A 5D02A 1H0IA 1T6MA 4E2BA 4HQVA 1KXVA 2YCLB 2CC0A 1FWAC 5E9XA 3FSTA 2E6YA 2XG9A 3VD5A 1T7LA 3LNPA 2OEJA 1KFBA 4Z2KA 1F5ZA 5TBOA 5IHRA 1AL8A 4MZYA 1KO0A 2X0HA 1OB0A 5REQA 2CXGA 2HTMA 2YYUA 3IVUA 1YNYA 4C7DA 2OWWA 4HK5A 4NNBA 4P8WA 1AQ0A 4TVCA 4HA0A 3D46A 5LXEA 1SZEA 2GVJA 5AC6A 5HQMA 4JQ4A 1W3NA 1XUZA 5LIUX 3DHFA 1XBXA 4AYSA 1WV2A 4IT4A 4KRZA 4HPHA 4L4MA 2NX9A 2MLYA 1QBBA 1EXPA 4UTMA 4UTWC 3IRDA 1B3WA 2Y24A 3PUDA 4LBSA 4DJEC 4CCDA 5M03A 4M7TA 5BU6A 3MV01 1JVWA 2F61A 1XLCA 1KM4A 3GTXA 1XM3A 4D71A 4GIYA 4HMNA 5A95A 2PWGA 1PXGA 2VD8A 2AL1A 4QAWA 3GC2A 2J62A 3G0XA 4ZB5A 1YHTA 5D30A 3GLCA 3N4FA 3BUVA 3S6TA 1TSIA 2QLYA 3O0KA 5LA0A 1Q6QA 3KCEA 4XAPA 3UNDA 3TU9A 3WDHA 4O1FA 1DL3A 1FKLA 4NNAA 2AGKA 3QBUA 1DJXA 2GJPA 3FGCA 4EXAA 2J7HA 2O92A 4GUJA 3B7XA 3PVFA 1QI4A 5CPOA 3NOEA 3BV4A 5REQB 2KGJA 4B4FA 3GG0A 1XFCA 2VFFA 1ZJHA 4MUZA 2E5BA 1XBYA 4XAFA 4F0KA 2IPFA 1R0MA 1EHAA 2ZQSA 2Q8LA 2QQ6A 3AMKA 3T42A 1JZ7A 1W6TA 3P93A 5XIAA 2YXXA 5CJ5A 2G37A 1JZ6A 3Q94A 5G4EA 1RVGA 3H21A 4OBTA 2F4EA 3WG6A 1OBAA 3O5KA 2Q8XA 4UMBA 1S1RA 3SSZA 1RPKA 3UG3A 2HVNA 1JJKA 4KEUA 4K8GA 1IYXA 1QZ2A 4QR6A 1WDSA 1NFPA 1ONXA 3USBA 4WGHA 2ZE0A 3E5PA 4GIAA 4ZR8A 3IACA 1YDYA 3CYVA 3L67A 2ZC8A 4PUJA 3PUGA 4HHPA 2R1LA 2VVSA 5CZSA 4MM1A 4RNJA 3VOFA 1H49A 3HZ3A 3C61A 5BROA 3SN1A 3IJ6A 3MO7A 2NT0A 2JKPA 1MNSA 2QUVA 3TWAA 1V6WA 4GIVA 1RLCL 3UF9A 3S4TA 3D5HA 3L4YA 2VD9A 1H62A 3CQKA 4GUIA 1I2OA 2RSEA 1RBOB 3OYXA 4IJBA 4UZUA 1S2AA 4DZ3A 2CITA 3ABSA 3MSRA 3MB9A 1L1PA 3MHUA 1FFRA 4UMCA 1NMVA 3NGJA 2OFJA 2IQDA 5H8PA 1OFAA 2HWGA 3MSGA 1PDYA 3DKLA 4IMDA 3M1ZA 4ZFCA 1VPQA 4CNNA 3BO9A 5CJMA 2OG9A 1TQXA 3BG9A 1QMLA 3MUCA 5XINA 2PGRA 2X0SA 4CD8A 2Y7DA 4NNCA 1B3XA 4I5UA 3EX3A 1TA3B 3PJTA 3PG8A 3TLQA 4JPGA 2VXNA 4W8LA 3MY9A 5CZJA 1FKRA 2PDBA 2G4FA 4IIEA 1C93A 3LHYA 1L8NA 1XYLA 2BLEA 4AD3A 4AF0A 3WLLA 3ECQA 3MDYB 1ECEA 2ZA2A 2F6KA 2WSQA 3M5XA 2D1ZA 4E0CA 1OM0A 1UR2A 3HPZA 4YWSA 3CHDA 2WMGA 2E28A 2QVNA 1O7AA 4FF7A 1CBGA 5CPQA 3SB0A 3GVWA 4OGZA 3WF0A 1E5JA 1OYAA 4IWWA 3N34A 1G7UA 3PPCA 2W67A 4JQAA 5CH9A 3LB0A 1NJJA 4LYQA 3IUDA 2GQ9A 3PANA 3NQFA 4S3EA 3W26A 2AMGA 3VGHA 4Q8MA 2QT3A 3VCCA 1WKYA 1E3XA 1YXYA 4H04A 3P2VA 2VGFA 2G50A 1IX5A 1VD6A 1MXDA 4FXRA 1BXBA 4XD5A 4XZHA 5D9PA 3WYZA 3KE0A 5HTGA 3HFTA 1ZALA 3UZJA 3FVDA 4P61A 1KRBC 3W7QA 4L61A 2XTKA 5AN7A 3TN5A 3UD6A 4PUDA 1LL6A 1A0DA 2OKOA 1WNOA 1EQCA 5K4ZA 3TMLA 2OYLA 1NVMA 4HPGA 3TC6A 4LANA 3GTIA 2V2HA 2QCMA 1FWCC 4DF1A 1VHNA 4ODRA 1I2NA 1DXIA 3T09A 2Z6JA 3T0TA 3RMEA 1UA3A 4HBEA 3A4WA 1DHPA 4A2SA 5IHSA 3KX6A 4QG8A 5CZ0A 1SJCA 1TV7A 5A6MA 2J7FA 1U22A 1CGUA 3BPWA 3R8RA 1FWHC 3BSHA 4WQ6A 3I10A 1IEIA 2W4XA 2IW0A 2ZZ3A 2XU2A 2ZRZA 2PWFA 2EF9A 4NZ4A 3F03K 3VKKA 5AYZA 4BQ2A 5K9XA 3QR3A 4KQNA 3I7SA 4BEUA 3OW1A 1BWLA 4FR1A 3ABRA 2E6FA 3HTWA 1OC7A 1ZCOA 2YR1A 3NIYA 2ZQVA 2P5NA 5LXXA 3FOKA 2YLLA 4W86A 2VKZG 4QBXA 4PC8A 1Q6CA 2FVKA 3LOTA 2ZDRA 3CHCA 1XIGA 1VFSA 2FVLA 3RUBL 3T8LA 4JS3A 1EOKA 1W9PA 1MWOA 3VU2A 4IMEA 3W76A 3P0XA 3WNOA 1IGWA 4JTEA 3IJIA 2YL8A 1DEDA 3IGUA 4AVOA 2VNCA 4F2BA 4V15A 1CLVA 3VNKA 3QPYA 3G1AA 4W8BA 4DXXA 6PTDA 3V3WA 4J3ZA 4EACA 1UD6A 4AG0A 1P48A 4PMRA 1DWIM 1X6UA 3O06A 4HOXA 4U2YA 3OU8A 5LNVA 3RPMA 2J88A 5TAOA 1J6YA 3TA6A 4DWSC 3BZGA 1CW2A 3GIYA 2DJLA 3BCDA 2WSRA 2X1TA 5F2MA 3U6WA 3KM8A 3A4JA 4RUBA 1TZ7A 3BOLA 4LVDA 3GHRA 2RDXA 2BBFA 4N6EA 1ZB5A 3UA4A 1UZHA 4JFKA 3ARXA 3WBXA 3APYA 1YKWA 4DZ5A 3W7DA 3DERA 4LAOA 1MZRA 2C18A 1L2UA 4A21A 3G1HA 3W9ZA 4GABA 2DZSA 3CGTA 1MUWA 5IBXA 2V8ZA 4YU1A 2NSXA 4DRSA 2QF7A 1T0OA 3MT1A 1C90A 1V7YA 1J0IA 3UWEA 2D0FA 5DBTA 5GJNA 5AC4A 4JFLA 3ATYA 3FYYA 4D8AA 4NIRA 1FRBA 4HU8A 4PCSA 1X8CA 3I6EA 2WV8A 2PWHA 3USZA 1WYIA 2VWSA 2CNCA 3B04A 3AYSA 4D6HA 3KZ7A 1H7RA 4DPQA 1IZKA 2AQOA 5D9MA 3WLNA 4PBFA 1CXKA 1R2TA 2GWNA 1LWHA 4J40A 4WIWA 2PC4A 3QTGA 3SQMA 2X40A 3NQ6A 2PTDA 4H9UA 4B15A 1YDOA 2BHYA 4M3PA 5IDIA 4UQBA 1ZNNA 4Q4QA 2FPYA 1XRFA 1UP2A 3VIPA 4F0MA 5JUVA 4LUTB 5FA5A 1C7TA 1F40A 1J5SA 3R0KA 4LBRA 3GD6A 1GHRA 3H7UA 1F8IA 1M7XA 3OG3A 4N7QA 5A1AA 1FWJC 2VEPA 2PPOA 3I3DA 3H7RA 1XIHA 5E70A 1EX5A 4QP0A 3CHEA 4DZAA 3P5ZA 3KVJA 2PI6A 3LEPA 1ITUA 3KCOA 4Q22A 3VDHA 2NV9A 1UA7A 2WNWA 4V27A 2Y6ZA 1TZZA 2GGEA 3VIJA 1IIGA 3I4KA 2C1IA 3BOXA 1C8QA 4LW7A 3VAVA 1CXFA 4H19A 3F7JA 1OABA 4X22A 4ASTA 1IR2A 2PPGA 4MY1A 2L5HA 7TIMA 2ABAA 1A5LC 3KLLA 3MP5A 2R94A 3THDA 1KRAC 3NTYA 1IT7A 5ABFB 2CPUA 1S2WA 1QI5A 3VCRA 4F66A 2VM8A 1XP3A 4RV8A 3NZ1A 3NVDA 4PYSA 2FZ9A 5MHBA 1SM9A 4IFOA 2LLEA 2LJ4A 4PH6A 2WKLA 2VCCA 1VRXA 3G6MA 4RKAA 3VKDA 1FHVA 4UTLA 4Q8NA 4GK8A 4B2DA 3SRDA 2YKKA 3SCPA 4YTSA 1VCGA 4PL1A 1V0NA 3HG4A 4EAMA 1DJGA 3V75A 4ICCX 4YYFA 4NXKA 2J7BA 3PR9A 3TWBA 3GU0A 2A3LA 2QJHA 5GNXA 2X05A 3MBFA 5G4WA 3UWVA 3HMJG 1SUXA 1KFKA 9XIMA 2RFGA 3UPBA 1RALA 4H41A 2ADAA 3VMOA 1A7XA 1I2QA 3O7UA 3T05A 2GGIA 3DFHA 2V81A 4LNCA 5A6KA 1JFHA 3FW6A 1W9XA 1PINA 4JN6A 4AYGA 1XCXA 1RJPA 3KBNA 4RE2A 1UZ4A 3D47A 2VOMA 2QJIA 3CZLA 4IIDA 3O1NA 2GGHA 3ITLA 1BVNP 2DZXA 2VHLA 3TTOA 1HO1A 1KM6A 2OELA 1LM1A 4GACA 4MB1A 4DEFA 1UIOA 1DQUA 3UWUA 3UJ2A 2V82A 1K4HA 4DH0A 1MXSA 1FKTA 1SW7A 2DUXA 2V5JA 4Z17A 3UF8A 3M7WA 3LGDA 1TR9A 3QPEA 1Q63A 1TPB1 2DUAA 2IKIA 1AFSA 1UWSA 1GVOA 1EIBA 1KW1A 2VZTA 1MW1A 1TJPA 1E55A 1F61A 3NSMA 4JYFA 4CQCA 3ANVA 1PIGA 1IZJA 3SADA 2NQHA 1L0PA 3N9SA 4RNIA 3OQ8A 2OT1A 2V67A 2PDCA 3ORWA 4RZ4A 1R6WA 3MUZ1 1XLFA 4LYPA 3N73A 3CHFA 4HD5A 2WVVB 1CXEA 4PBEA 3FKRA 3KLKA 4ZQCA 4LUSA 3H26A 2JGQA 3ES8A 4OE7A 3W22A 1PKNA 5IDZA 4MB3A 4IFKA 1T99A 3ZJ8A 4HZ7A 4MJ2A 1XSJA 4C6NA 5HINA 2YL6A 3QSRA 2E1DA 2H3DA 1ENUA 1HKVA 4G50A 1UKSA 3HQOA 3H53A 2KX9A 4H9VA 3VOHA 4IHCA 5AC5A 4XSMA 1FHDA 4JCMA 3G18A 5M3WA 3IJDA 3KHJA 4EK7A 1MRAA 2PGEA 1IR1A 4YHEA 1EP3A 1XH2A 4H7ZA 3QV9A 2J9XA 2CETA 4JIQA 3WZ0E 3RILA 3OHIA 5AHEA 4R9XA 4ZE5A 5JH1A 3SM0A 1I0BA 3PY2A 4TVDA 1W1TA 3MYOA 4MJZA 3WO8A 4WXYA 3HF3A 3W29A 3O5GA 2HK1A 5K2ZA 4GG9A 1E15A 1YATA 2UV8G 3H2MA 1CGVA 4MZ1A 3A23A 4M8UA 4C7GA 1ICSA 3WH5A 3E6EA 3B3DA 3DH7A 1KCZA 3RX4A 1SQ7A 2XYLA 3F4WA 4DNHA 3Q4DA 1D8WA 5D33A 1EZ2A 4GUGA 3EY6A 2CZDA 1F8MA 4NHVA 1X1OA 2WVTA 3MSDA 3G2GA 4F48A 3THCA 2CLMA 5HQLA 3WJWA 3P62A 3C2OA 3CBWA 3PZTA 4BQ5A 3N29A 3WBEA 1JI2A 3OP2A 3RM4A 4CN4A 1R3QA 2A2IA 3KCLA 3UR7A 4U84A 4W88A 4UTIA 3O5JA 3GIQA 3C4UA 4RPPA 2M1IA 3FYOA 1EPXA 4KFPA 3UZ5A 4XQ6A 4FZIA 1M7JA 4W7UA 2ZUWA 4AWUA 2WW5A 1V3KA 1UBPC 2PCQA 3LHZA 4M1RA 5HW6A 1W56A 2FQIA 4HBKA 5EBUA 3W1AA 2F6UA 6A3HA 2WWCA 3Q65A 1A80A 2QGYA 4D6JA 1NFGA 3HGRA 3DFPA 3FHQA 3L2MA 4JYDA 3ZO9A 3WQ5A 2FTYA 2NUXA 1BYAA 4OKDA 5T26A 3NM1A 3QQWA 1PKMA 1A3WA 2PDUA 2I57A 4UWMA 1IQ8A 1Q6GA 5DO2A 3IJ9A 3MW7A 1AVAA 4QNWA 3BW3A 1FWIC 2X7VA 2G3FA 2Y7FA 1XINA 5BRQA 5KZ6A 3W7PA 3U2ZA 2WC4A 2UZ9A 3SCRA 2WJDA 3BMWA 4ZQMA 4I9JA 1IEXA 2OTDA 1QR7A 3OZYA 3BANA 4YNGA 2BGQA 1VFTA 1O6IA 3SGGA 3IV8A 4LPCA 3F4DA 4UMAA 3MPGA 3GNDA 1XD0A 2QAPA 4PB5A 3LCXA 4L4OA 2JF6A 1QO5A 1BWKA 3WELA 4IL2A 3IKDA 2JIEA 2PU0A 3B4UA 3LNMA 4YVPA 3W82A 4H6KA 2X41A 2ZRWA 5EBAA 3PN8A 3LMZA 4L65A 2FB3A 3EX6A 3HM7A 3PK7A 3V36A 1I1XA 4HA1A 2J6VA 3K4AA 3H22A 2XP7A 1M65A 1ADSA 4GQQA 5H91A 7XIMA 1PWLA 3S1VA 2QNEA 3PR2A 3VAWA 4JD4A 2Z25A 1SO6A 1G4PA 1L9WA 1PTGA 2YW4A 3OVGA 4UQ9A 3UJRA 4WR3A 5EU9A 4UNKA 4NAEB 4EAYA 1I2RA 3VDBA 3VKCA 4Z0JA 1F4AA 1ME9A 3QV8A 4PTVA 5FCZA 3LA4A 1VPYA 2B0MA 3L4UA 3QPZA 3DYPA 1ZK6A 5AC8A 1F73A 4LRSA 1N1AA 5I77A 1E4IA 1C29A 4LJ3A 1I75A 3O5QA 4ZTXA 3S1UA 2QIIA 1G6CA 3NXLA 1L6FA 4XKMA 1XW8A 2A21A 1QUMA 1BTCA 1VBHA 2HS8A 2DGAA 3CUJA 2YIHA 1MSSA 4PFHA 4IIGA 3FA4A 1ZBKA 1W1B1 3O5LA 3H2AA 4QIUA 2AAAA 2DP3A 1E1EA 2VTFA 2BV9A 3OBEA 4BF9A 3HPSA 1C9DA 1XG4A 1UCWA 1V3JA 2BHUA 4TO8A 3GNNA 4IJRA 1W5OA 2ZX6A 3ABZA 1ZZMA 4W4QA 3JRKA 4QQUA 3QZAA 4UQCA 1MNZA 4B9YA 4DXKA 4Y90A 3FAPA 5DANA 5B80A 4Z1CA 5D2YA 4GLEA 1WDDA 1GPFA 2PWVA 2EQDA 2MANA 3DBPA 4EE9A 4DRJA 1NWRA 2HNEA 2P50A 2PP0A 1XC6A 1WBJA 4NNRA 5D03A 4D6CA 3WH6A 3SCNA 4EPDC 1QW9A 4MWAA 4ZPTR 3N3MA 4AD2A 1ZFJA 4WSHA 3NURA 2Q3RA 3SUWA 1IE7C 3OTRA 1JRCA 3UWYA 1JULA 2YCJA 3LXCA 2CLKA 3P6LA 1YDVA 4GVGA 3N2BA 1ML1A 5C2XA 4HB7A 3DG7A 4Q4KA 4NJHA 3TQVA 4D1JA 4AH7A 3RHGA 3CO8A 1OY0A 1UBSA 4IZGA 4NI3A 1GK8A 2F38A 3YPIA 4RL3A 2GYIA 4H7CA 3E0IA 4Z2JA 5FIPA 4GXMA 2OEKA 4NJGA 5DIVA 3KXQA 4DUOA 3W6YA 4IGHA 4RXFA 2QCDB 3CUHA 3TZNA 3CQIA 2BXZA 3C8FA 3C2VA 1P0EA 2IXVA 3I3BA 1X96A 3CQHA 2ZWZA 2NQ5A 4RNFA 4FNPA 3VVGA 3PWAA 1R3WA 1EKOA 2TPSA 3LRMA 3BURA 1H4PA 3MKKA 3W23A 4Q7NA 3EGJA 4LY4A 2SFPA 3EMCA 3EOUA 4YVXA 3C0QA 4GIRA 4WY0B 3B8WA 3TJLA 2Y8VA 4UC5A 2WNZA 1A0EA 1PX8A 4HA3A 1U1HA 1H50A 3GH7A 1AW5A 4QS5A 1ZRQA 1BGGA 3QMSA 5D38A 4QDPA 4YPJA 1TG7A 3GZAA 3UPWA 1CGYA 3MS8A 3B0UX 2E9MA 2I16A 3WFAA 5KSWA 4NAEA 4NRRA 3TTQA 3DFSA 4ODKA 3VC5A 1XH1A 3WH8A 1S2VA 1ZUAX 5I6SA 4IUGA 4JX5A 1WCGA 3KFTA 4H1ZA 4IX2A 6TIMA 3K4DA 1WOAA 2ZZ4A 4AW7A 1PHQA 1PIIA 2ZZ6A 4GGBA 3V5OA 4OOZA 5CPMA 1G01A 3VM7A 1GTHA 3EAUA 1OCQA 4ZQOA 2DQWA 3GHSA 3GKAA 3CO4A 3OB8A 2VGBA 4MNJA 3NEVA 3MCOA 3BK0A 2GSEA 2RAGA 2Q71A 5M5DA 3IANA 3GS6A 1OGSA 5HK4A 4E6MA 5G1YA 5D4YA 1PE1A 3G24A 3P3BA 3K2GA 3STEA 4Q4MA 3UGVA 1OZQA 1J18A 1B4EA 5A6SA 4G56A 2GVLA 4JTRA 1TYGA 3C0JA 3BL3A 1A5KC 1XYAA 3FX4A 3UNTA 1HJXA 4L6HA 1O5XA 5GJMA 4LB4A 4MFEA 1GZ1A 3SGZA 4AFYA 3E0FA 4X60A 4M24A 5AKQA 4AZCA 3P60A 4MWAB 5FJTA 1VYPX 2WKJA 3AYTA 3F4NA 3H12A 3HN3A 1SR0A 4HHLA 3R0UA 2PZ0A 5I7GA 4XTDA 5F1VA 1C9WA 1R46A 4DBDA 1RA5A 2J8FA 3VD7A 1XLAA 1JF6A 4H9MA 3W2MA 3T0BA 3IV3A 1IEVA 3W53A 3AMDA 1IF2A 2ZXDA 3EDFA 5I79A 3UPMA 3RG6A 2PDQA 1QPOA 3ZLFA 3C0LA 4GH3A 4DVOA 2DH3A 3PP7A 1P6BA 1D7KA 3M0MA 1WA3A 3AMGA 5J04A 4TU1A 1E4NA 3R8GA 2REQA 3WD1A 1TQJA 2PTWA 1NAL1 1OF8A 3H4WA 1TCOC 5H1WA 4J4NA 5G2HA 1S1PA 1N82A 4GO8A 3JUGA 4R85A 5HXMA 2XSXA 3T8QA 4HN8A 5DQPA 2VX7A 2WJFA 3EPNA 3N9RA 3KZPA 3WQ6A 1EGMA 4R7JA 1YNPA 3CWNA 4XIMA 4KIEA 4AY7A 4HKPA 5C6MA 2HQAA 1MI3A 3TOPA 4AY1A 1DXFA 1X7FA 4YTRA 3GW3A 5GJPA 3SY5A 3W1NA 4IXHA 2ITKA 4LRTA 2Y85A 1VFHA 4POCA 1QW8A 3WUEA 4ZENA 4WD0A 3EIPA 1OCNA 2XIJA 2ZOXA 3E2RA 5BOOA 2OU4A 2EJ1A 1JL8A 2YDSA 9XIAA 4HOZA 1K4GA 2GQ3A 1V7AA 4KCVA 2GJLA 4ZO8A 2B7NA 2Q5AA 3NXFA 2JGYA 3GXIA 4NI8A 5IRPA 1JCMP 3V35A 1IXQA 2A7PA 3WK1A 3IWPA 1XRVA 2Z1VA 3WJXA 1HP5A 3WQDA 3B8DA 1OX6A 2QDHA 4WK9A 4WHBA 3SY8A 1JI1A 4C90A 1J0HA 4IQLA 1NF0A 1N55A 1PIFA 3CL6A 1H5YA 4S3JA 4P8VA 2FH6A 1H7XA 4LAZA 2BASA 3MWCA 4H9YA 4MWAE 2Y61A 1D6OA 4K7YA 1E6XM 4R33A 1Y5XA 4JEJA 4AD4A 2ZIDA 3VD3A 1QHPA 5T9CE 4HMDA 3BE7A 1GVYA 2FMOA 3K30A 2ISVA 1TTIA 1JR1A 3R4IA 1K9FA 3SJ3A 1BKFA 3G1DA 3LXAA 4JXCA 1QI3A 3VINA 3KEHA 3VGDA 2D2OA 4JN8A 1EJTC 3WLMA 2OMAA 4Q4PA 5AYBA 3IAPA 4R27A 2NUYA 4FNUA 4MMWA 2QF8A 1W31A 2ZQTA 5EFFA 5FJJA 3LHTA 3W24A 5ABGA 2VT0A 3LPPA 3TJXA 2RKXA 1FCQA 4AZGA 4PMOA 2VFEA 1K70A 3W1UA 4QNEA 3CZKA 2Y0FA 3RYSA 1SJAA 2XIQA 3W81A 2FZDA 2DDXA 3CNYA 4UFKA 2ALRA 1X6NA 1FKXA 1FKWA 5BCAA 5HNRA 4XZLX 2A85A 4JFUA 2NX1A 2W5FA 2BOEX 1OFEA 2W0UA 2I9UA 1JD9A 3PNZA 1FWTA 3AIRA 3ZVHA 4PBGA 1LOLA 3E74A 4GA8A 5CAKA 1GUVA 1UP0A 4A35A 3IGSA 2HJPA 1HL2A 2WM0A 5DRCA 3VE7A 1QNSA 1UR0A 4AQLA 4GZJA 1ISXA 4NAFB 2FH8A 1XGDA 3L2LA 3BLDA 2CU0A 4ILSA 3FA5A 4C65A 1BSLA 1YW1A 3CAKA 2OQYA 2ZX5A 3D6NA 3EOSA 5A6BD 4JHOA 4PRRA 1ROTA 4UUIA 2CZVA 1XISA 1J12A 1MFVA 3OYZA 4US5A 1EC7A 3RCNA 4BR1A 3OJGA 2CLOA 3WQPA 5FL1A 2OCZA 1A5UA 3S3GA 4DRMA 5M2FX 3O5IA 4KR0B 3LCWA 4O50A 2XDFA 4MDPA 1GQKA 3LTYA 5FAJA 1XIEA 2XWDA 1F2JA 1JAKA 4H01A 5A5WA 4NUWA 4YL2A 3RM8A 1RCXB 4ONVA 2NZLA 3NG3A 2GK1B 3PBYA 1K7XA 2C13A 3G22A 1HKMA 3NI6A 4DJDA 2Q6ZA 3HPAA 1XS2A 1D7JA 1TPWA 4LC8A 2HPMA 1QASA 2WC7A 1TE1A 4IFRA 1D3HA 5A3HA 2CEQA 3ZSSA 2ZYFA 3BVJA 1EA0A 1FVPA 3ICJA 3UW6A 3MVIA 3DUGA 1EJWC 4QT3A 5AYXA 2MUCA 2VC7A 1BHGA 3CC1A 3VOCA 2W6RA 3TYCA 2QS8A 4Y6GA 2JKAA 4YYCA 4IT6A 2OT0A 1P5QA 3KL5A 1REQB 3KACA 1RCOB 1DJIA 4P7OA 5CCZA 2ACRA 2V9DA 4I9TA 1WB0A 1W2PA 4MB5A 4D6EA 1QT1A 3MANA 3C6CA 4JTJA 2VURA 3UU0A 4K1GA 3KS6A 1H1YA 3S1WA 5T91A 2CHRA 3TZFA 4O52A 4KEZA 3MVTA 1J2BA 2B4GA 2VCAA 4MG4A 1LL7A 2I5QA 3LRKA 2RJHA 1JVNA 4IGMA 1G4EA 2INZA 1I9CB 1A5OC 1UD8A 4H2CA 3M4HA 5G5IA 1XLBA 4LAUA 3VIFA 3VGFA 1WDPA 3DFTA 1FKKA 4ACZA 1RXOB 1W9VA 4E4FA 1OIMA 3C0SA 2PDNA 5HULA 2DVTA 4Z2HA 3WQ4A 2JQXA 4JIPA 2CKRA 4FX7A 2CZEA 1BKHA 4JNMA 1XR2A 3GU2A 3TW7A 4C91A 4PMXA 4LY8A 3R2GA 4LFYA 1JNDA 3W1QA 4TX9A 1O5RA 3S8HA 1KFWA 1CGXA 1PB0A 1ZY9A 4U31A 4ML4A 4D72A 3WSUA 2NLIA 1RUSA 1BXCA 3DXIA 1OT2A 4FN2A 3WNMA 2Z1BA 1NARA 4V28A 3Q45A 1PKYA 3W7NA 3ODKA 4H6QA 2O7QA 1BQGA 4OJYA 1A5SA 2JZVA 2O9OA 3LLXA 4RCXA 3T2OA 4GUHA 2PDLA 4W5UA 1XYBA 1Q6HA 3PA7A 1OFOA 3AOFA 4NJKA 4W8AA 3TQ0A 3U4FA 3K1DA 3B9DA 4O10A 3P81A 1S3HA 1KTNA 5D2WA 3T6CA 1RBAA 4G2DA 1H7NA 4TXEA 4X9YA 1Q6UA 1D7HA 4IICA 5A8GA 3W00A 2D9FA 3SBFA 1T11A 1QI2A 2XN2A 5DX7A 4G7EA 3CAWA 3PC0A 3ARSA 3IUIA 4I6KA 3S42A 3RF9A 1E6QM 1JDCA 5ABEA 4JFTA 3IGXA 1Z48A 4GVIA 1PBGA 3EXSA 3W2KA 1VIZA 2QULA 2IKHA 4ACZB 3BAIA 2CESA 4S2BA 1WDRA 3HIJA 1Y5WA 2PU1A 1RSCA 4QSHA 2PB1A 1DIKA 3LCGA 2ASHA 1TV5A 4YTTA 1QJWA 3W74A 1XJBA 4RXGA 1C9HA 3CWHA 4BFAA 3UY8A 4G2PA 1V02A 2RURA 3UZXA 3CEUA 4AUBA 2BSLA 2HRWA 4IQJA 4F0LA 4DLFA 2D69A 5ABHA 3GDMA 4C6QA 3MHGA 3QR0A 1UC5A 3F5JA 3NPWA 1Q6RA 5K9CA 1XLMA 5BXSA 3TE9A 4MNMA 1W5MA 1MVYA 4XD4A 2OLHA 3GR4A 1AD1A 1H2JA 3W88A 3T55A 7ENLA 2PDXA 1E6RA 3WD2A 3ABXA 1AL7A 1VFMA 1CCWB 4DYKA 1E4LA 3A4XA 1FOBA 1YRRA 3N1AA 2G8ZA 4IIBA 4LV4A 4R0XA 3GTNA 1FTXA 2AKMA 4KESA 1FUYA 1AW1A 3T4CA 3AISA 4YS1A 3EX2A 4AZ6A 4S3BA 1ESWA 2EO7A 4HN4A 1G4SA 1WXZA 1BFNA 5BRBA 4LVAA 3C3NA 1CNVA 3RGTA 1PL9A 4MY9A 4AZHA 5A6AA 2VO5A 3MZ2A 3BQ6A 4NU7A 1XYCA 2B31A 3WL1A 1HG3A 4TVUA 1A47A 2VCDA 5K4XA 4CQ8A 3NJ3A 5FJUA 5BRPA 2Q8ZA 5HWMA 3DN5A 2GL5A 1JDEA 3E2QA 3MC5A 2I5GA 1UR9A 1BYBA 3A9IA 2EPNA 4PUKA 3NQ8A 3W1PA 1RQEA 2J7GA 3DESA 3S83A 1H09A 2YFOA 3PULA 1E1FA 2B5UB 3SQSA 3SR7A 3KAFA 3FGCB 1XD1A 3AS3A 4MKVA 2YOCA 2DEPA 2XGBA 1JPDX 4UNIA 1JDDA 3L4WA 3ARVA 1VS1A 1UWQA 1TPH1 2PRHA 1SGJA 2G3NA 1OC6A 3M9YA 3B9OA 4LCSA 4ORIA 4H9ZA 3EWZA 3VOJA 1CDGA 1NOWA 2J9YA 4BQ3A 3OIHA 3BW2A 4J28A 3LU2A 3GWQA 4AEEA 1OC5A 3AHVA 1UROA 3MUIA 1I8JA 2RJGA 5C54A 2VEFA 1XCWA 2EKGA 2H9AA 3H2FA 1T5AA 3RX2A 1POKA 2IQ0A 1B3ZA 1X97A 3CUZA 3T7VA 3WKZA 3R6IA 4FK9A 3KP0A 4XTIA 3G8RA 3CUFA 3WDPP 1FP8A 3ARWA 4DO5A 5CC7A 4RJEA 1N7KA 3ZMRA 4AX6A 3EB4A 2F8QA 2J27A 1I4NA 4TX0A 3KL0A 3RLUA 2HEJA 5DCDA 3GO2A 4CNUA 1EA9C 1M7PA 4Z1YA 3OBAA 1UR1A 3OIXA 3UYIA 3PFRA 1XIJA 1J4EA 3M6YA 1Q8JA 4ZO9A 1NELA 1Y7VA 3M5VA 2ZR6A 4WX2A 2KE0A 4QLLA 4JGDA 3H8AA 2FTPA 1ZJAA 3H6OA 2VEMA 4GJJA 3VIOA 1KD0A 3LSCA 5B8IC 4RV3A 1RH9A 1SSDA 5JBDA 3MDUA 3RPDA 3GW0A 3Q67A 1LORA 3QMRA 3SURA 1ADDA 1QNPA 2D3LA 4IQ2A 1W9DM 1N8FA 3PS7A 4JHMA 1KTBA 3TLLA 5JBEA 2QJJA 3CWOX 4U85A 2A7NA 5LIYX 3TSBA 2WVSA 2JALA 4AWEA 5CLWA 3NO1A 4IL0A 4YMZA 2E40A 1E0XA 4OU1A 3MTWA 3NZGA 3WBAA 3AI0A 1UKQA 3LX9A 4AWSA 4M29A 4TTUA 5A6JA 1DTUA 1WZAA 3WEOA 4ITZA 5GPGA 2P3EA 4R9OA 4JIIX 3MI2A 1AJZA 2PTYA 1E73M 1AK5A 2XVNA 4ADSA 1HUVA 5EB8A 4OUEA 2OEMA 3R94A 3P82A 1T41A 1B3YA 4PUNA 4FPSA 4B5VA 2E9LA 3QN3A 3JYJA 4WSKA 5AZ1A 1IXNA 3FYPA 1XIMA 1R87A 4Y8FA 4I3GA 1E6PA 2ZWYA 1J6OA 3NPUA 3PZNA 3A3HA 3M0IA 3TOYA 1FKFA 3UQBA 4ZEPA 5HBFA 1RY8A 3M64A 1KBBA 4CN6A 2IUZA 2LPVA 1PTDA 1OCJA 3FLUA 1NQ6A 4BEQA 1OT1A 3CV1A 2YCEA 3BJTA 3INPA 4E38A 4BKNA 4I5XA 1K03A 1EYEA 1GJUA 4IQCA 5EY5A 3AZTA 3UJSA 2ISWA 3PZ9A 2Z4GA 4WDTA 1UHVA 1XLIA 4U33A 2PV3A 3G1RA 3WNKA 2J47A 4C6FA 3ITYA 1AUSL 4GJ1A 4D6GA 4YJ5A 4JOMA 2GGJA 3LCHA 5HJLA 5I03A 2PLCA 5EMJA 3K8LA 1YLVA 1JQVA 5I3DA 4JX6A 1WQ5A 4MNLA 1TPC1 4DRIA 2O55A 3COTA 1QDSA 4LBUA 2JEPA 1E70M 3WLIA 1CXLA 1K7FA 1T96A 4RZBA 1XH0A 3RM9A 3AHYA 1GKPA 4FLOA 5DMLA 1BWVA 1H1ZA 2YGYA 4EXBA 2DPEA 4DY1A 1BYDA 2O4MA 2GVYA 3NZRA 3I3EA 1MUMA 3T0AA 2E77A 2VX4A 1PSCA 4RR4A 3ALFA 1FBAA 4L9ZA 3V16A 3NVTA 1OG0A 1UOKA 1GEHA 2NLYA 1A50A 3EWCA 1KBIA 4U2ZA 3E2SA 4O16A 4HNUA 4GY1A 4QZVB 3M6DA 2FJUB 4J4KA 3LPFA 1TELA 1B2YA 1UOZA 1CLKA 1LLWA 3L4ZA 2GSHA 3O5PA 1TUFA 3PAJA 4JTAA 3Q37A 2VUYA 3QZ6A 1ME7A 2JBMA 1XRTA 1ZCNA 4NJIA 3BLOA 3V4BA 5DF0A 5I02A 2WSYA 1UD3A 2OWCA 4WOZA 3CMGA 3M0KA 2ON3A 4JAWA 4GH1A 1Z42A 1SPQA 5IFTA 2PBOA 1XDMA 5CSUA 1CXIA 1EEXA 4KT2A 3QHNA 3VPLA 5G1TA 2XM1A 4C6IA 4LCRA 1V0MA 1I2PA 4S1FA 4W84A 4WY0A 3W7GA 5HA7A 4AMAA 2RUSA 1KGWA 1XQKA 3W75A 3SIMA 5FSDC 1OX4B 4J5NA 3WD4A 3I65A 4DI8A 1R30A 4FP1A 1EGVA 1UH4A 4K7VA 5DCBA 4GOAA 4HT3A 3VABA 1U33A 2PDFA 4EWND 4Q33A 4C6EA 3KAIA 1TTPA 3OVPA 1JAEA 3W86A 2OPJA 2QCNA 3N15A 3FDGA 2GDUA 5F1UA 1V93A 3L5AA 1U30A 3UR2A 1WAWA 1IHIA 3G1XA 3S0CA 4XZBA 1I0DA 4C5ZA 1ISYA 4R53A 4HGXA 1Q7QA 4KMQA 4ZO7A 4NT0A 1H1NA 3HQNA 3K4WA 4YIWA 4US6A 1Z3NA 3BGGA 5D04C 3CZ8A 3F4CA 2YBUA 2VZVA 4H8UA 4JTUA 4AIUA 2PD5A 4PMUA 3VMNA 2OVLA 3WFZA 3CU2A 2XUCA 3CHVA 3T44A 4XUYA 2QPUA 3AWNA 4DRKA 1XICA 4ODOA 4BA0A 1E6NA 4KWOA 3HMCA 4QE1A 2ZZ2A 4IPNB 3LCLA 4G7EB 4W85A 1X38A 2OZTA 3MQTA 2PBCA 3LENA 1UJPA 3PBVA 4ECLA 3W2JA 1KFCA 3VK5A 3UI5A 1AQMA 1Q13A 4U5KA 1GYNA 1BF2A 3PBWA 2G95A 3VGBA 4GYJA 3HFYA 4BI7A 1NM9A 3SGUA 2X1UA 4ERIA 4DWSA 2E68A 4BJHA 3HV9A 1WP6A 3O5DA 2PC8A 4MZ8A 4HYRA 3W2LA 1B31A 2PWDA 3R12A 4O57A 1RJRA 1XGZA 3OLIA 3N2CA 3I6RA 3EXRA 4L4PA 3URNA 4LOCA 1QBAA 4NZJA 4MYAA 2OFNA 3P8IA 4UTFA 5HWNA 3PZIA 1MW3A 2QCFA 3AXHA 1SU5A 3UXIA 2DZWA 1P0BA 2E25A 1MZHA 2HXTA 2QV5A 3PJUA 1EOMA 1XI3A 5ECUA 3T9PA 1E0VA 2ZXQA 4O1CA 5AFDA 4KF1A 4J2MA 3S9ZA 3GXNA 3BLFA 4FXSA 2I1OA 4IPXA 1M7OA 1NDZA 2WB5A 1KKOA 3JXVA 1S5VA 7TAAA 1P7TB 4FO4A 5SWUA 1U5HA 1S46A 1DORA 3TFCA 4WJ8A 4GQ0A 3AIBA 4J3WA 4G8TA 2PA6A 2W79A 2W9MA 1EDQA 4QCEA 2P8CA 4JL1A 3DECA 2XGZA 4N2YA 2EG7A 2J7CA 5BW6A 1QK2A 1L6SA 4DUVA 1NMWA 4J35A 4NYYA 2PF8A 1K77A 4L1WA 2VGGA 3ZLGA 1F3WA 3AIWA 2WM1A 3R8HA 5DIUA 1RP9A 3U9IA 3DX5A 4CCCA 1FP9A 5AVHA 3TXVA 2PBGA 3AO0A 1E9ZB 1XXXA 2E6AA 3O5OA 4W5ZA 4LVFA 3RX3A 1IT8A 2OX1A 3UGRA 3ZT5A 2NV1A 4ZXOA 1ECQA 3N4AA 3RXZA 2LGOA 4UFLA 3GNRA 4JIRA 4REQB 1S2UA 4ZTYA 2ZUUA 1DIDA 1XUUA 5BMXA 3NQCA 3LV6A 4K1WA 1UR4A 1UH2A 4QM1A 2PWEA 1KCLA 4C6LA 5BWFA 1GT8A 2XP8A 4N42A 3PPGA 1IEQA 1L6GA 4EVZA 1SO5A 2J7DA 1YTEA 3LYEA 3ALGA 3WMCA 5U7SA 4GYFA 3WLTA 4MSPA 3KCJA 3OGVA 4Q8TA 2WCGA 3UQNA 2G3IA 4HU0A 4J2PA 1BRLA 1ZAHA 2B7PA 2ISFA 4P5UA 5F2GA 4UCGA 1QPFA 4DRHA 5DELA 3ZFHA 1S2TA 3TR2A 1V3LA 1R9ZA 1UZDA 1MYRA 4Q8QA 3L4XA 1SSGA 3UG5A 1OGGA 3UCQA 4DWSB 3PRDA 2KAUC 1W0MA 3B4YA 3MI6A 2VELA 3T0CA 1XCFA 3KBWA 1HX0A 4Y9MA 1QHOA 4JFWA 1EC8A 1JCJA 2YBTA 3ITVA 1XRSA 3IIVA 4AZIA 1W5NA 2ZBTA 1EHNA 4PMQA 3A9BA 2XZ9A 3NQ7A 3HPFA 2VYOA 4QSFA 4DBEA 1CEOA 1ZQ5A 2C0AA 2BY3A 2FIQA 1K1DA 3C2RA 2N87A 5HOSA 3BZJA 3B06A 1W26A 5LHFA 2W63A 3IGHX 2W61A 2GOUA 4WKHA 3SRHA 1LTDA 2PE4A 3WL0A 4YCPA 3AXIA 4MIMA 4Z2IA 2VQUA 6REQA 2DFAA 4A3QA 4XV0A 1XQLA 1KR1A 3TYEA 4HOWA 5CBIA 3LHUA 1HXJA 1P7TA 1GYMA 3SIZA 3FJ4A 4HTBA 3GZ3A 2GQ8A 2XFRA 1PVNA 1GVIA 3QXBA 2NXHA 4WSJA 2RHGA 4EPBC 2OYKA 4HJWA 2YXGA 1EH9A 1Q6OA 4MY8A 5EYWA 3VFCA 1TJ1A 1VLWA 2PDKA 4ZA0A 5EMKA 3B0YA 4JFVA 1V6TA 1J01A 1W1VA 1B30A 1TKKA 5E0FA 3CUGA 4UTTC 2F2HA 1O68A 2QJNA 4HHHA 4ZCWA 1MQQA 5E6ZA 3KUMA 3UFYA 1E56A 2YDAA 4HNOA 1BXNA 1PZ1A 3LRLA 5JQ9A 4CQDA 1D9EA 3GX9A 2ZX8A 3CV2A 1W91A 3TQKA 4YN5A 3NYZA 1A4MA 3RAOA 2DIEA 3IEBA 4W87A 3FN9A 3CH9A 2XSBA 1DWAM 2INFA 1MEHA 3K8MA 2DY3A 3GRIA 4ZQPA 3GBEA 5A6LA 2V5CA 4WLCA 1OADA 2OLSA 1EFZA 1WKDA 2V5LA 3IARA 3L65A 4JQ3A 2DG3A 1BPLB 1VZWA 2UBPC 2VFHA 4JDBA 3MMWA 4CVUA 4AHPA 5CZKA 1PTAA 2C8NA 1H7WA 1RQBA 5KTLA 2C1GA 4AC1X 3ARUA 2VDHA 2QHAA 4X63A 2OOGA 1HF6A 4JTLA 4B5WA 1NF7A 4NP7A 2CFFA 3SFWA 1EC9A 3WFLA 5FEPA 3S9YA 7REQA 5LZLA 4MVAA 1KV5A 4H83A 1EJ7L 1I1WA 4JNYA 2EPKX 5U4NA 2C19A 3K1GA 3P80A 3STCA 4NXSA 1PYMA 3W1TA 1EF3A 2DW7A 4NJJA 3M0ZA 4CNPA 1HKKA 2G3MA 4MWAD 5ABFA 4D9PA 1HZYA 3E5BA 1LUCA 5HANA 1UYQA 2MLXA 3NDZA 1MQRA 3ONBA 2PLMA 3QV6A 3PZMA 2PUZA 4DJFA 3EWWA 1V08A 3R79A 5T8GA 5IBXC 1UKOA 4LX4A 1UP3A 2VDGA 1KCKA 4KWWA 1GQNA 3WBWA 1JYXA 4INFA 3FSUA 1A5NC 2HCVA 1CXHA 3GUWA 2PP1A 5HNNA 2E09A 4OUIA 3AXMA 1TIMA 3GM8A 4JCLA 1J10A 3LERA 2X7WA 2XH7A 1UD2A 5C2CA 5MF5A 2OSYA 4AEOA 1F9CA 1NQKA 1FWRA 1FAPA 1UD5A 1W3IA 3LM3A 2C79A 2F7FA 3UCDA 4DF0A 1XBZA 2BHZA 3U0HA 4Y96A 3LTSA 1GWJA 6CGTA 3IUHA 5A2BA 3QJAA 4UTTA 1SO4A 3S5SA 1UMLA 4XUGA 3V1HA 3W27A 1W3KA 2ZZ7A 1ISWA 5CGTA 7REQB 4M7SA 3AIUA 3F1QA 4B3ZA 3MUAA 4Y9AA 1TJ2A 3ZT6A 5LNSA 3SDOA 4C6CA 5K7JA 1W3JA 1GJWA 4FB7A 2WOQA 2PRLA 2FKPA 2WNNA 4IIHA 5HWBA 1TB3A 1GQJA 4K36A 3U57A 1UR3M 3CGNA 3BJSA 4A3YA 4JIEA 2JFEX 1KWKA 1YEYA 3G1FA 3ZVHB 4OV4A 3AYRA 1L6YA 2ETNA 1US2A 3QY7A 1JNEA 3ZR6A 5CBJA 3EEGA 2EPLX 2A3CA 2FDMA 3ZWSA 3T2PA 1XYFA 1OK4A 4CVWA 4MJMA 4JKMA 1MEIA 5ENLA 1ALDA 4IUOA 4HPXA 5A8QA 3HQ1A 1FFQA 3UXLA 3B8IA 1GPWA 1SVDA 4JTIA 4MPKA 3A64A 4ZFMA 3L7RA 3O6CA 3WF3A 1EUA<