4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
4GQQA 2BY0A 1RD6A 4Y7EA 3K1DA 2JF6A 5HOSA 1W9VA 1E70M 1VBRA 3OLIA 5CPSA 1MQPA 3WEMA 2J25A 2WYSA 2XTKA 1W3LA 2EPMX 4BS0A 5A6JA 2CEQA 5BXTA 1XYFA 4LQ1A 2EEXA 2WCGA 2FHBA 2V5DA 4BQ4A 1NWUA 4CU8A 2AAAA 4WLCA 5DO8A 1AQ0A 1IZJA 1DWIM 4P7QA 3SCSA 2PWGA 2W63A 5DT5A 4WF7A 1MFVA 3TTOA 1UR9A 4UTFA 5ABFB 2BFGA 5HNNA 3BAWA 4WKAA 4B9YA 1JGIA 4D6GA 4MB5A 4QFUA 3RIKA 4EK7A 3GYCA 3FAXA 3LPFA 2WZIA 4LPCA 2YDRA 2ZX7A 3OLDA 3AIEA 4YHGA 3OBAA 2VVSA 2E9MA 4W7UA 3FN9A 1UOKA 4AISA 1C3FA 1V3IA 1K9EA 3MUIA 1QHZA 1XD0A 3TTSA 4M80A 2F8QA 2BHUA 2FH8A 2XHYA 5BROA 3CZKA 4QLKA 4TX8A 3PZUA 3FNDA 3ZT5A 3SCWA 1B31A 4BF7A 3TP4A 3L4YA 1W9DM 1HKJA 3IJ9A 4ZE4A 2XIIA 1QNOA 1VFOA 4AWEA 4GZEA 2VZUA 5D4YA 4KRTA 1G5AA 4DM1A 1UKPA 1CGXA 3IAQA 1V3JA 4AZIA 3AMGA 3ZJKA 4R5EA 1E0WA 5BXRA 3FHAA 3UEQA 1HJVA 4OKDA 3II1A 3SUSA 3VIHA 4JFVA 3WQWA 5ABEA 1CGWA 1UA3A 2YL9A 2J7HA 3D5HA 1GPFA 3WQ4A 1CGTA 3WNLA 4FMVA 2QHAA 2X1IA 4HOXA 5CZKA 2ZX8A 4RE4A 3THDA 5A1AA 4AD1A 2YL5A 3PTKA 1W9PA 1HNYA 2V38A 2UWFA 2GJXA 1HJSA 3AHZA 1NWRA 1E3XA 4F79A 1UKOA 2JEPA 5HPCA 2D3LA 1L8NA 1HN1A 3AIRA 3VVGA 1L0PA 3EDKA 1E73M 5F7UA 4W7VA 1ZBCA 3PBGA 3W81A 1H09A 3ARSA 2E9BA 1LJYA 1UD8A 3A6OA 4AXNA 3RDKA 1X6LA 3N11A 1DWHM 1MW0A 3PZMA 2IXVA 3ARWA 2BNJA 3SUVA 4AZ6A 3LPPA 2DIJA 1V6YA 2CNCA 2X8RA 5M03A 1ZU8A 1EHAA 3SEPA 2VR5A 4UQBA 3SIMA 1TCMA 3N1AA 4BQ2A 3SCQA 3CBWA 5AC4A 3PTQA 3JUGA 3UR7A 2Y8KA 1MW1A 5AYIA 3RM8A 3VTRA 1EO5A 4AEFA 1EDGA 2FGLA 3GXFA 1E15A 4AY1A 1EQCA 4PTWA 4ZENA 3U5UA 1BF2A 1WB0A 3CHCA 3BXWA 3RPMA 1PX4A 1UR2A 1V03A 1WKYA 1UD3A 5D8ZA 1EXPA 5BXPA 2ESCA 5C71A 4UQAA 1BAGA 2XM2A 2PC8A 1TA3B 4CD7A 2GJPA 5EFDA 2WBKA 4D6FA 2EO7A 1M04A 1NQ6A 5LA2A 2BY3A 3F5LA 4TX6A 3VIMA 1KFWA 1KR1A 3LMYA 2YIHA 4ACZB 4UFLA 4XZWA 1BSIA 4H8VA 3WH8A 2XG9A 1E6QM 3VDBA 1C93A 1CDGA 5A2CA 1H3GA 1PX3A 1BPLB 1X1NA 4WKFA 1TE1A 4AZCA 1V02A 1UKQA 1V6XA 1YQ2A 4UNIA 1ITXA 5DFAA 2XSBA 4D1JA 4D1IA 3K4DA 3MUZ1 1UH2A 5E6YA 3VGHA 1ISZA 2UY4A 1UWTA 4C7DA 4AD0A 2G3NA 3GZAA 4KRUA 4L4OA 2V3EA 3CO4A 1VIWA 2XFFA 1JXKA 5JUVA 2AOSA 2VC9A 3AYRA 4TXEA 4W85A 1XCWA 2JIEA 4PMYA 3PZIA 2VNCA 4U3AA 4UQ9A 3S6TA 4ZEPA 4J3XA 4HPGA 3OGSA 3DHPA 1MWOA 3WEZA 3WNMA 1HJQA 1JFHA 2CHNA 2WLZA 4M29A 1E71M 2WWCA 3BAKA 3BSGA 1C90A 4PSRA 1DEDA 3VMOA 4ATLA 3VIOA 1OWQA 4HOWA 3MUY1 5JBDA 4U3CA 4QLJA 2WHJA 1H0GA 4MNJA 5A95A 3IJ7A 3GXDA 3MMDA 4RE3A 1C91A 4LX4A 1W91A 4FF5A 2ZX9A 3FW6A 3O2LA 2UY3A 2WWDA 4AIOA 4PCSA 1FH7A 3PZTA 4U33A 2WCSA 3VM7A 4GI9A 5DEZA 4V27A 3VGFA 2E8YA 4P7LA 2HISA 4UZSA 2O9PA 4P7OA 5FD0A 3WQ6A 1E5JA 4FLSA 1BFNA 1WDPA 2WSPA 2YJQA 5AYBA 1NM9A 5FIPA 2VO5A 5A6MA 1LL6A 2WBGA 1LLOA 3WBAA 2QMKA 1B90A 3WH7A 4LYRA 2XWEA 5HXMA 2XVPA 5A6LA 2Y8VA 3QHMA 2WHLA 2IXUA 3WD3A 1C92A 2WC3A 4C7GA 5ABFA 5I78A 2O9OA 3SUTA 1B2YA 3U7BA 1JFXA 1MYRA 4E4PA 1GUVA 3IK2A 3VO0A 1GQLA 3CUFA 2CKRA 1UR0A 2E40A 1W1PA 1QOXA 1CGVA 3L4XA 1US3A 2YOCA 4RE2A 1UWRA 3ZT7A 1E55A 1E3ZA 3RCNA 5AC5A 2GJRA 1CENA 4N42A 3L2MA 5A94A 1HKMA 2C0HA 4W5ZA 5E09A 3ARZA 1RH9A 4IUGA 3KL3A 2NW0A 2WNWA 4UFIA 2C8NA 3WUBA 1EHNA 2G4FA 1ZL1A 4HPHA 2V3FA 1BVNP 2JIWA 1W9UA 2F2HA 2BVTA 3EMZA 4W93A 2VX7A 2YLAA 4ATDA 4D6DA 5KEZA 2EPLX 2WMIA 1MW2A 1PX8A 4PN2A 4XV0A 2DT3A 4NRSA 1UH4A 2ZX6A 2X09A 3WDQA 4OUEA 4JCMA 3WNKA 3RMEA 3ZJ7A 1KWKA 1UR8A 4NZCA 3VU2A 3UR8A 3RILA 3WNNA 4UQDA 2CITA 5HBFA 1MW3A 2FDMA 2E3ZA 3ECQA 4WKHA 3AIWA 2BY1A 5CJ5A 1EDQA 5FKYA 3WDIA 1CGUA 3AIBA 4CD4A 3W37A 4DWSB 4UOJA 4P7RA 3FXYA 3OGRA 4IPLA 3RO8A 1B3VA 4AZ5A 4JFUA 4QDMA 1HT6A 1V08A 3NIYA 1CYGA 2W62A 5CGMA 5M3WA 1KWGA 2XIBA 2JEQA 2VJXA 1OM0A 3L4ZA 5IDIA 3T09A 2WM0A 2ZIDA 5IFTA 4MDOA 1C8XA 4D71A 4NSBA 1E40A 5EFFA 3ZJ6A 3I3EA 1DTUA 4JHOA 3ARUA 4JHZA 4AZHA 1BG9A 3EMQA 1SMAA 4W8LA 4JFWA 1JL8A 1CXLA 3HJEA 5EBAA 5EMYA 5A2BA 2PWFA 1VAHA 1GOWA 4MB1A 4XX6A 3WQ8A 1E56A 2WC7A 1TG7A 1C7SA 1J01A 1OSEA 1KCKA 1BHGA 1XC6A 2UY2A 5CXPA 2G3MA 2GDUA 2DPEA 2VMFA 5ABHA 3W29A 1P6WA 4JFTA 2G41A 1JAEA 3T0BA 2WANA 1E1FA 3DYOA 1UKTA 1KQYA 3AS1A 4MNMA 3WH5A 2DSVA 1ISXA 4M8UA 1TFVA 2DDXA 1B3XA 4H8HA 5ECUA 3CHEA 1JYXA 2GDVA 3APGA 2O9RA 2GK1B 2OYMA 1DWJM 1UWIA 2Z1SA 2PWDA 4D72A 4U31A 3VINA 1B1YA 1V3MA 3TA9A 1K9DA 2FHCA 3VIFA 4U5IA 1FH8A 4TVCA 1HIZA 2WMFA 1WCGA 3M7SA 3N12A 4PMZA 1JZ6A 5I0DA 2WW5A 1G01A 2VT0A 1W3KA 2A3HA 1ZBVA 1BYCA 3BAIA 3ALGA 5IXEA 1PIGA 3DYPA 4PRWA 4CN4A 1DP0A 2Z1KA 1TA3A 1KBBA 1OGBA 2YLLA 3EDEA 2VX4A 3L2LA 2BHYA 2XGBA 1OBAA 1OIFA 2WZEA 1UR1A 1WDQA 4HMCA 2DSWA 1WZMA 1OGGA 3WL0A 2XVNA 1XGZA 2EPOA 3W38A 3BH4A 3S2CA 3OZOA 1W2VA 2XVGA 2WKLA 1W3HA 4UFMA 2CESA 4ACZA 3CZ8A 4L4PA 1MQQA 2YL6A 4J3SA 1JYVA 4IISA 3ZT6A 1IT0A 1GZJA 4BA0A 5A8OA 1PZ2A 1H4PA 2VCCA 4CN6A 2WMKA 1LQ0A 1WE5A 4PMXA 3T0AA 2VI0A 4J3WA 3GH7A 4BZYA 1NOFA 1TUXA 2Y5EA 4U2YA 3TONA 5FL1A 3AHTA 2J4GA 1DWAM 2WMIB 1PEZA 2WVUA 5IFPA 2ZX5A 1EOKA 2YDSA 4XB3A 4AZGA 1H11A 1W2PA 1GQJA 3VX0A 3MMUA 1SMDA 1XYZA 1LG2A 4N0RA 1FOBA 2NT1A 1HF6A 2WLYA 1F4HA 2WVVB 4YN5A 4GIAA 3VUPA 2OSWA 1CLVA 3NCOA 1QHPA 3J7HA 3QHNA 3OGVA 5I6SA 1K9TA 4PMNA 1E6RA 1GQKA 2FGZA 2YDQA 4W89A 4H7VA 5JBFA 1XD1A 3ARXA 4AC1X 4M82A 3F4VA 3MUAA 5D9MA 2QF8A 4F8XA 2VX6A 2XUCA 3UG3A 1CXHA 1VF8A 2Y2WA 2ZWZA 2CBJA 4EAMA 1UA7A 3CH9A 4CCDA 2J62A 1QNSA 1JD7A 1PBGA 3EBVA 1XSKA 2GFTA 3GBEA 4S3JA 4YHEA 2CPUA 3W6MA 2VZVA 3B9DA 3BC9A 2F61A 1I1WA 3ARQA 5GPRA 1V6UA 3T2OA 4P8UA 2ZICA 5D9OA 1V0NA 3VM5A 6A3HA 1BTCA 1Q6FA 4Q22A 3KL0A 3WD2A 3GXMA 3BGAA 2A3CA 4NI3A 3WDRA 3WUGA 4AD4A 2QLYA 1LWJA 1GHSA 1WO2A 5CLTA 4KGLA 4GI6A 4PSPA 5GQBA 1E0VA 5A8MA 4PMRA 4KGJA 3VIJA 1HJWA 4HA3A 1C8QA 3G6LA 2PF0A 2W66A 3AHXA 3O6AA 4MAZA 3RM4A 1XV8A 3ZJ8A 3CUIA 5I2UA 2WHMA 3KE0A 4CGTA 1V3HA 1TMQA 4OJYA 3AHYA 1I1XA 1GVIA 1RP9A 2XYLA 4V28A 1TZ7A 4JAWA 1M7XA 4XUYA 1E72M 1H1NA 3CMGA 3T2QA 3W27A 1R8LA 3A4WA 2C7FA 2J78A 1V0LA 4H04A 4X9YA 1KQZA 4GO9A 3IJ8A 4EE9A 3VNZA 1A47A 4PTMA 4MADA 5ABGA 3OZPA 4W87A 1XH1A 1SYTA 1QBAA 4GXPA 3CHFA 1UUQA 5BRQA 4J3VA 1CEOA 2DIEA 3OLGA 1KCLA 1Q6CA 4NF7A 2YA0A 2IUZA 1J0HA 4MNLA 1C7TA 2BXYA 2XVKA 1CTNA 3NUKA 3EMCA 3ZOAA 2ZUWA 4PUDA 3VKKA 2EQDA 2W67A 3SUWA 3AIUA 3UG5A 3K4AA 1V0KA 2D1ZA 4AD2A 2VX5A 4P8XA 3AMLA 4WIWA 4LYPA 2ZXAA 4ML4A 2J7DA 1BGAA 4H2CA 1UWQA 1ITCA 1RP8A 1XRVA 2XFYA 1FA2A 4DWSA 3VX1A 1KGUA 4PTXA 1W1TA 1J10A 1NOWA 3WQ5A 1W1VA 4IM4A 3E1F1 1R86A 3CPUA 1H5VA 3BSHA 1QI5A 5M17A 1Z32X 4M24A 4UFKA 2G3JA 4UQEA 4KH2A 1VEOA 1EQPA 2D0GA 3HMCA 3PZ9A 4J3TA 3WFLA 1VRXA 3GNPA 3SCOA 4FLOA 3D3AA 1UWSA 4PMQA 3VDCA 1HL9A 5E6ZA 1GJUA 4WSKA 1KXQA 1E5NA 2GVYA 3WD4A 2D2OA 3HN3A 3MO4A 1B9ZA 1E9LA 5D8WA 3T0DA 1JD9A 3QOKA 1BYDA 1Q6DA 3EDDA 5I24A 3WF0A 4F9JA 4HOZA 2W91A 3AIVA 2VQUA 4GZJA 2ZXBA 1LL7A 3VMPA 1G9HA 4AD5A 1QW8A 1ISVA 1A3HA 1CXEA 1J11A 3B9AA 4FK9A 3ZMRA 1DWGM 2YKKA 4MB4A 3VGEA 1FHLA 3W24A 4UFJA 1CBGA 3EDJA 3PTMA 5GNYA 1HL8A 4HU0A 2QV4A 3PZGA 1B3WA 5CLWA 3WF2A 3AOFA 2W4XA 3THCA 1UD4A 6TAAA 4QP0A 1TVPA 2GK1A 2WC4A 2OSXA 4PUEA 3EYPA 1HKIA 1D2KA 3CUJA 4HZ6A 1VFUA 1NWSA 4DWSC 1FHDA 3ZIZA 1V3KA 5D9NA 1N82A 4AZ7A 4JKKA 4W7WA 2WKGA 2VRQA 4GKLA 4DUWA 4DM2A 5GNZA 1LF1A 2JALA 1QBBA 3GTNA 4W88A 5CG0A 1E6ZA 1EA9C 3DECA 2CERA 1JI2A 3LPOA 4B3KA 1B0IA 3M46A 2OSYA 4OBRA 5A6KA 1UQYA 1J9YA 3WD0A 1HX0A 2CBVA 3AJ7A 3LPGA 1JYNA 2E9LA 3EDFA 1XH0A 2YBTA 2WVSA 2ZUUA 3WENA 1R85A 3I3BA 2QMJA 2VVNA 2JFEX 3MMWA 5C70A 3MV01 5A6SA 1QI4A 2XPKA 2VTFA 2V3GA 3VIGA 3KZSA 4CU7A 4LGXA 2Y24A 1JDCA 4MTVA 1UD5A 5BWFA 4JIEA 4B15A 3MS8A 5A69A 4M56A 3AXIA 3KWXA 3NSXA 2PBGA 4Q7NA 1LWHA 3WELA 2EJ1A 1KXVA 5EB8A 4URIA 3OA5A 1CXKA 1SR0A 2Y4SA 1JZ5A 1FP9A 1E6SM 3VIPA 2CXGA 3UG4A 1BGGA 4K68A 3GXIA 1ISWA 3K8LA 4LXFA 1XHGA 3GNRA 3AZTA 2ZUVA 1XCXA 4PMUA 1UZ1A 2EBNA 1BLIA 1WPCA 4MAVA 3GH4A 2WVVA 1AQHA 1CLXA 2JE8A 2VL4A 2Q8XA 3BAJA 3VD9A 4OZOA 3WKZA 2DEPA 2VRKA 3ZSSA 4PBGA 1JNEA 1NWTA 3W4RA 1ODUA 4X0VA 2ZUTA 1W1YA 4GI8A 3SCUA 5JBEA 3WSUA 2X2YA 4PYSA 3MSDA 4TVDA 1FFRA 1V6VA 1R7OA 2J8GA 1NARA 3VMNA 2G8ZA 1JF6A 5DF0A 2BHZA 3CMJA 4JL1A 1U30A 4D6JA 1UG6A 3CGTA 3ARPA 4PMOA 1WAWA 2PWEA 2ZUNA 2E8ZA 1OIMA 3F5KA 2J7EA 1VJZA 1BVZA 2D0HA 3AS2A 8CGTA 3CZGA 3PHAA 1J0KA 3N9KA 2WAGA 3L4VA 2BS9A 2ZUSA 4PMDA 5I3DA 3DC0A 4DWSD 2VZSA 1DWFM 4Z2LA 4MB3A 4HA4A 1GOKA 2CIPA 4GPNA 2VR4A 2MANA 3AZRA 4HA1A 1WNOA 4W5UA 4FLQA 2ZE0A 3W26A 2NSXA 1UH3A 5CSYA 5M5DA 1O6IA 1OT1A 3MU7A 3MKKA 2ZWYA 3PZOA 4U5KA 1UD2A 4Z2KA 5LA1A 2YA2A 3WD1A 1H2JA 2D23A 5A8QA 2OWXA 2BY2A 3T2PA 4F9DA 1BYAA 5HDRA 3L4TA 1NP0A 3I3DA 1JDAA 3AS0A 3U5YA 1GVYA 3AHVA 4PTVA 3G6MA 1V6WA 4V2XA 4AD3A 1VEPA 4MJ4A 1IZKA 4HMDA 5DT7A 3WEOA 2QPSA 2AMGA 4GZIA 3VNYA 4F66A 3NDZA 1D3CA 2ZXQA 1JZ7A 1MFUA 1Y7VA 3WNOA 1EGZA 2DH3A 3WQVA 4J27A 4OBSA 2CYGA 3WF3A 4BQ3A 5AY7A 1US2A 3U7VA 5IHSA 4CVWA 4UQCA 1BYBA 2RGMA 1KR0A 1U2YA 2OYLA 4PCTA 3WDJA 4QLLA 3WIJA 4MJ2A 3GH5A 4CU6A 1OB0A 1QVBA 4J28A 3WUFA 2VZOA 4AYSA 2DSZA 2VOTA 4TTUA 4J7RA 4P8VA 3ARRA 1KXHA 2D0FA 3WMCA 4AMCA 1OD8A 3WUEA 3AMDA 5I77A 3AIQA 2VRJA 5E0FA 1WZLA 3WDPP 3CZLA 4B16A 4CCCA 3VIIA 2J79A 1HKKA 4UR9A 1GNXA 3ALFA 3FY1A 3W25A 3DHUA 3W53A 5A6AA 1MVYA 1J0IA 1GOOA 1QPKA 1UHVA 1HP4A 1J12A 3CZJA 4B9ZA 3VD3A 1E43A 1FFQA 1E4MM 4TUFA 3F5JA 2XM1A 4CVUA 2BXZA 1OD0A 1RPKA 3PZNA 2WVTA 3NJ3A 4Z2GA 2X0YA 3B8SA 5FOOA 1CZ1A 2OWWA 1GW1A 3AZSA 4W86A 4TTGA 5DMYA 3QHOA 4W8AA 2CETA 1HXJA 1CXIA 1MQRA 1SFSA 1X6NA 2D3NA 2VURA 3TTYA 4D6CA 4UOQA 5CGTA 4AIEA 3CUHA 3AYSA 3OB8A 1G1YA 4PMVA 2B31A 4LYQA 3BLKA 1M53A 1J0ZA 4HP5A 9CGTA 2J75A 3A4XA 2DT2A 1MXGA 2WB5A 2OYKA 1AMYA 2YL8A 1KBKA 2PBOA 1ZBKA 4Z2IA 1VEMA 4HZ7A 1B3ZA 4BCEA 3MV11 4ATWA 2XWDA 4JCLA 5BRPA 2X05A 2W61A 4C7FA 1BG4A 1G0CA 3SCVA 2J74A 3BAXA 1J18A 3KEHA 5A2AA 4HMEA 3W82A 4E2OA 3BMWA 3UERA 1QI2A 5BYWA 4QCFA 2V3DA 1GHRA 2E0PA 4WSJA 2YBUA 1ODZA 4DUXA 1O7AA 4JFSA 3KL5A 1UWUA 4ZXOA 3SURA 1VENA 2FHFA 1PJ9A 3WBEA 3IANA 1NH6A 1JZ4A 2BVYA 3ZQ9A 5LA0A 1WZAA 3QGVA 4U2ZA 1CGYA 3BCFA 2NT0A 4X0NA 5I23A 3GBDA 1M03A 4JL2A 3UESA 1HJUA 1QNQA 3WH9A 3ARYA 3VGBA 3N13A 4OIFA 2DQXA 3BMVA 2J7FA 3GNOA 3WN6A 2YA1A 5E9AA 2D20A 4AW7A 1XSJA 5CQ1A 3AI0A 4JZ5A 3PZVA 3VIKA 1ZB5A 1V3LA 1K9FA 2VCBA 1ZS2A 3K8MA 2WK2A 5CPQA 3ARTA 3WL1A 5CSUA 4ZXLA 4R27A 1PZ3A 5HPOA 2QPUA 4MPKA 2V5CA 3RM9A 2BV9A 1ZJBA 4AZBA 2WXDM 3SUUA 3IAPA 5IHRA 4E8DA 1IV8A 2OWCA 2ZXDA 3WH6A 1JDDA 4W8BA 1LG1A 1E1EA 3WF4A 1ISYA 1FP8A 3UETA 4QCEA 1LL4A 5A8PA 1GOMA 1ECEA 4M1RA 1H0IA 1PAMA 2A3EA 3AXXA 2D22A 2PI6A 1TVNA 2DT0A 3CUGA 3N04A 3VGDA 1W3JA 1UD6A 4NRRA 4JKLA 4JKMA 1H49A 1Q6EA 1GJWA 3A4AA 2UY5A 1E6XM 3FHQA 5I5RA 3POCA 3AS3A 4XZBA 2HVMA 5C8BB 1GQIA 2FH6A 1JXJA 5JIPA 3PN8A 3WFZA 4OOZA 1D7FA 1OGSA 2DSUA 2D24A 3N15A 4CKQA 4ZFMA 4UFHA 1U33A 2XGIA 1PPIA 1QW9A 1EH9A 4GINA 1E0XA 2W92A 1CPUA 3GDBA 5A8NA 5A6BA 2A3AA 1HJXA 1QNPA 1UR4A 1HVQA 4KWUA 5A3HA 3BCDA 1KGWA 3AXHA 3SCNA 3W0KA 4RL3A 1C8YA 3L4UA 4KMQA 1JAKA 2WMJA 5D9PA 2X0HA 3GM8A 5E70A 4AEEA 1H41A 3T08A 2EPNA 7TAAA 6CGTA 3NDYA 2A3BA 1B30A 5JIWA 2OLHA 1VFFA 1JF5A 5CPTA 4BQ5A 4UOZA 1EIBA 3AMKA 4IPNB 3ARVA 2J8FA 1OCQA 2J7CA 2ZUMA 2TAAA 2VUYA 2DSKA 1MXDA 4GQRA 3M6DA 2JF7A 1CIUA 3MSGA 1GOQA 1J0YA 2EPKX 1YHTA 4AIUA 1E4NA 3A47A 3AMCA 3POHA 2EXOA 4QAWA 2XFRA 4EKJA 1AQMA 2GJXB 3SCRA 1JIBA 1ZJAA 4Z2HA 3M07A 3NSMA 2DT1A 5GNXA 5LYRA 5TD4A 2GUYA 3W6LA 3O9NA 3VD4A 3FAWA 3CIVA 3VDHA 3AISA 1XSIA 1WDRA 3WMSA 1QI0A 1GORA 4CUCA 2PWHA 1E6PA 1V0MA 3SCTA 3OG2A 1E6NA 1JZ2A 4S3KA 3VDAA 4Z2JA 4PEEA 2CBIA 2VZTA 4EANA 4CN1A 2ZOXA 4TVUA 1CWYA 5E0CA 1QNRA 2WCAA 1KGXA 3QR3A 2O92A 2J47A 2WSKA 4H8UA 1B3YA 1UZ4A 7CGTA 3U57A 2CBUA 3PZQA 4ACYA 3TOPA 1W9BM 3CHDA 1JNDA 3L4WA 3WY1A 1EO7A 1JYWA 3QOMA 4E8CA 4ZE5A 2DH2A 3BAYA 4B3LA 4D6IA 4HU8A 2WPGA 1Q4NX 1OT2A 3ZR6A 3TTQA 3WDHA 1CNVA 5FL0A 3K46A 2WZHA 4HTYA 2PB1A 1JI1A 3AROA 4A4AA 3AQUA 3VD5A 3WF1A 1UYQA 3NYDA 1K6AA 4P7NA 1KXTA 3ZO9A 3AFBA 1WZKA 3RJXA 2W5FA 4MDPA 1ESWA 3N18A 5I79A 2DGAA 1UQZA 1ZBWA 1HP5A 3VD7A 3WMBA 4D6EA 1G94A 3ZR5A 5BXSA 1UKSA 4HZ8A 3VPLA 1XH2A 4M81A 1OINA 4YPJA 2E4TA 2WMHA 1AVAA 5JH8A 3B9EA 1HVXA 1W9XA 3CLWA 1M01A 1QHOA 1GOIA 2VQTA 4UZUA 3VILA 1PIFA 1BQCA 3CZEA 4AZCB 1S46A 1CXFA 2J7GA 3SCPA 2RGLA 1R7AA 4UCFA 4TOQA 4MNKA 1E4LA 3ZM8A 2XVLA 4GO8A 2CHOA 4WK9A 3CTTA 1EOMA 1NP2A 5FCZA 4CCEA 1I75A 3BLPX 1KB3A 2J77A 3VOCA 4DUVA 2XSAA 2VCAA 4FLRA 1GONA 2O9TA 1VFMA 1FH9A 2XJ7A 3HU7A 1W32A 3NSNA 1JZ8A 3W28A 3A3HA 1QI3A 1R87A 5KZ6A 4OOUA 1EDTA 1VJSA 1F4AA 1VBUA 5BCAA 2CCRA 1JG9A 2WHKA 2J7BA 3VGGA 4W84A 1CECA 1WDSA 8A3HA 4WJXA 3RJYA 4P8WA 1TR1A 2WMGA 4CD8A 2G3IA 2GSJA 3OLEA 5A6BD 2CKSA 1WP6A 1VB9A 1DHKA 3UCQA 3MANA 1Q6GA 1JZ3A 1GCYA 2BVDA 3DYMA 3WNPA 4CD6A 4D6HA 4H41A 1V02E 3N17A 4J3UA 1NOUA 4A3HA 7A3HA 1E4IA 3OIHA 1J0JA 3AICA 4A3YA 3ZSTA 4CD5A 3K8KA
chains in the Genus database with same CATH superfamily
4GQQA 4ZB2A 2IF4A 1QT1A 1W9VA 3W7QA 1J6PA 1HZYA 3P81A 4JQ1A 4NG3A 4XD5A 1V8EA 1WXYA 3W88A 4UBPC 2OOGA 2WYSA 1XLFA 1W3LA 2XTKA 2EPMX 2CEQA 4H6EA 3OOQA 5BXTA 2EEXA 1NWUA 2AAAA 4WLCA 1P4CA 3WYZA 1DWIM 1Q8AA 3IUHA 4P7QA 1A0DA 3W01A 5TNVA 1Q6QA 3GUWA 4DZAA 4XKYA 1UPMB 2GGJA 2BFGA 3QR0A 1OG0A 3KM8A 1E44A 3XINA 4B9YA 1JGIA 3UA4A 3EEZA 4D6GA 4MB5A 1K8ZA 3GYCA 1R9YA 3GTFA 3LPFA 2WZIA 5LKYA 2XGZA 2VN1A 3OBAA 1OFPA 4DJEC 2PDHA 2F6UA 2A4AA 4YL2A 4W7UA 1PCKA 3FK4A 1SW0A 1QCWA 3MHFA 2JK2A 2E25A 1V3IA 1QK2A 3S42A 3WO8A 4M80A 5AYZA 1UJPA 4QROA 3CZKA 4D8LA 2XDFA 1R2TA 3JW7A 4NVTA 3HGRA 1W9DM 3IJ9A 1MUMA 1VFOA 3G1DA 3NXLA 1FKTA 3AMGA 3UNDA 4XAYA 4LJ3A 3B97A 4W9QA 4NX0A 1PCWA 1PDZA 4O13A 4GWEA 3VIHA 1H7XA 3WQWA 1KV5A 3QF0A 3WQOA 1CGWA 4PULA 4CQCA 1X7FA 3PFMA 1QU4A 1WXJA 3S3GA 2IKHA 2B81A 4DZ3A 3I6CA 4FMVA 1B9BA 2X1IA 3AU6A 4G7EB 3L67A 4H3DA 4WVXA 3DHFA 2YL5A 2AKMA 1W9PA 1HNYA 5KSWA 1NDWA 3TN6A 2GJXA 2FKPA 1HJSA 3AHZA 4JEQA 4LAOA 1Q2RA 1TPUA 4GXMA 1PWMA 7PTDA 1FHUA 2PGEA 3AXKA 4JY9A 3UPWA 2NUWA 3MP4A 1TRDA 2ATSA 1POKA 1H09A 5EMMA 2VFDA 4ML9A 5LNRA 3GW3A 5I7GA 1EKOA 1ICPA 1V93A 1X6LA 4IMGA 1DWHM 3PZMA 1G69A 1P5QA 1JRCA 4AZ6A 1LBFA 2DIJA 2X8RA 1YMYA 2POTA 1ZU8A 3SEPA 4FX8A 3RYSA 3HB9A 1BVWA 1VFLA 3QVQA 3N1AA 3RLVA 5DCEA 4ENLA 2QJHA 3KHDA 2KFWA 2VM8A 2Y8KA 4O11A 3UR7A 4FZIA 4PL2A 1PSCA 4FI4A 1K1DA 3BCJA 2AQOA 3ID7A 4QJ3B 2J24A 1EQCA 2OEMA 3BXWA 3W84A 2BTMA 2VEGA 2D69A 4JXCA 4QJ1A 1PX4A 2DG4A 4Q8OA 2ESCA 2XPAA 1J6OA 1O5KA 2XM2A 4MVAA 1BKFA 3K4WA 4HARA 2GJPA 4O14A 4LEQA 2VENA 4WDUA 5LGZA 1M04A 4WGHA 2E5BA 3RUBL 2BY3A 1R47A 4FOKA 4TX6A 1J93A 5D30A 3TLLA 3WQCA 3LU2A 1U5VA 1VFHA 3OYXA 1E6QM 3SY8A 3VDBA 5DIUA 3LNPA 3LHWA 3G8EA 4UNIA 3IGSA 1ITXA 5DFAA 3K4DA 4I9TA 2FZBA 2QVNA 3FFSA 3R5EA 1UWTA 2Y89A 4WEVX 4PCPA 4AD0A 3GZAA 5HMEA 6XIAA 3TYDA 2PFHA 3S47A 2V3EA 3RU6A 1TV7A 3E0VA 1JXKA 1XFBA 3AWOA 2X40A 5DY2A 2VNCA 3GIQA 4K2SA 4GJIA 3S6TA 4HPGA 3F4WA 3LQLA 3OGSA 1XI3A 3DHPA 4HBKA 4LSBA 4C60A 1QW7A 2O56A 2CHNA 1F2JA 4M29A 1RR2A 3BSGA 2D2GA 2OZ0A 3LCIA 3NGFA 4IIGA 4HOWA 5BU9A 4Y8FA 4U3CA 4I9AA 4IPIA 4QLJA 1H0GA 1R30A 4UWMA 7ODCA 3KTSA 5AN7A 1W91A 1FWFC 2XIMA 3W2UA 4KBXA 3NR0A 1X98A 1X38A 3ZFHA 4AIOA 3VM7A 1VHCA 3UI6A 4F0KA 1YTDA 4DRIA 2HS8A 4P7LA 1F9CA 1FKIA 4JTQA 3TC5A 4DIPA 4MHBA 4TV6A 1W3TA 3WQ6A 2ZYFA 3LSCA 1WDPA 3RFWA 1T40A 4S3CA 1XLKA 4W9PA 2WBGA 3WBAA 3G1VA 1YIXA 5HXMA 3M64A 3QHMA 2I9UA 1XLLA 4QDPA 4DX3A 2BASA 3O1NA 4REQB 2WO5A 5I78A 6REQB 4NKCA 1B2YA 2HZGA 1H7OA 3U7BA 2FZDA 4GG9A 4E4PA 5DXYA 4GKTA 2PGWA 3LHVA 3IK2A 5HQLA 1GQLA 3CUFA 1UR0A 3LA4A 2CLHA 1TB3A 1CGVA 3KW3A 2YOCA 5LXEA 3GDKA 3R1ZA 4LVAA 4JQ2A 2C0HA 4IMCA 3S6OA 3U8GA 3KL3A 4NNBA 2BOEX 3GAYA 4XIMA 3OEXA 1AW5A 3W3OA 2G4FA 3MTWA 1ZTVA 3V5CA 1W9UA 2F2HA 4GXWA 2F4EA 2CLMA 1H51A 1XCFA 2VX7A 2YLAA 2FVLA 4D6DA 2H90A 4DBUA 3TUUA 4S2BA 4XV0A 4MZYA 3W7JA 1VS1A 3TKFA 3M0XA 4OUEA 1KM5A 1OC5A 3RMEA 4GMEA 1KWKA 4ZCWA 4HJFA 3IIZA 3VU2A 3UR8A 3RILA 2CZVA 3KCOA 3O5LA 2O4MA 3VZYA 1T7LA 1VPXA 3UCDA 2Y7DA 2XU2A 3P14A 3L23A 2QUVA 2MNTA 2AL2A 3FYPA 5CJ5A 2W79A 1EDQA 1IEWA 1CGUA 3AIBA 3WQPA 2Z1WA 4UOJA 3FXYA 3V35A 4JFUA 4TO8A 4IT6A 5CGMA 4GBUA 1KBLA 2XIBA 2JEQA 3L4ZA 5IDIA 3OZYA 2RQSA 1O5QA 2PDMA 2WQPA 2WM0A 3NPXA 3QYQA 4NSBA 3G18A 4OHQA 4IFKB 3I3EA 4AZHA 4TW6A 1RPXA 3KABA 4ODOA 2NX9A 4JFWA 4IP5A 1CXLA 1SUXA 2QIWA 4O12A 1JCYA 3WQ8A 2VOMA 1FX6A 1C7SA 1K02A 4ZA0A 3O5DA 2DZXA 2DVUA 2X42A 2UY2A 5HR7A 5CXPA 1EZ2A 4O0QA 5ENLA 1TE6A 3VKDA 3BE7A 2VMFA 1NJJA 4HYWA 2IQ0A 1XBXA 3W29A 2A5HA 3B8VA 1KO0A 1VCFA 2QZRA 4JFTA 1JAEA 4LH8A 2WANA 2GUUA 3M5ZA 3AS1A 4MNMA 3LI1A 1Q6LA 2DSVA 1B3XA 4H8HA 5ECUA 3BQ5A 2OODA 5K3VA 4JOMA 3H12A 4PB4A 2OYMA 1DWJM 1B1YA 2XH4A 2I1OA 3TC6A 1Y0OA 4D2JA 2C79A 3QSTA 1DQXA 3O0FA 1JZ6A 2H8ZA 2VT0A 5F1UA 4ZVJA 1ZBVA 1VYPX 3MJMA 4O1FA 3V0TA 5IXEA 3ITOA 1PIGA 2Y78A 3DYPA 4C1NB 1DP0A 1TA3A 1OGBA 2VX4A 1C8VA 1OIFA 3AU2A 1EJUC 5L9FA 3N2BA 3U2CA 1WZMA 2PTYA 3PWGA 2EPOA 1LRQA 3W38A 3KADA 4ODPA 3SAZA 1C9WA 2J13A 1DKWA 1SSDA 1Z8AA 4G6CA 3KVJA 2CESA 3G77A 2ZRYA 4BF5A 1MQQA 1H7RA 1XBYA 2CHRA 2GWGA 4FXFA 4XZNX 3NOYA 3QSRA 1WE5A 5GJMA 3GH7A 5D2YA 1EPVA 4GNVA 3OODA 4MSPA 3TONA 4JDYA 3TJIA 2J4GA 5EMUA 1DWAM 4JTUA 5IFPA 4MWAD 3T9PA 2VEFA 4XB3A 3RG6A 1GZ1A 1W2PA 1GQJA 2Z6IA 3APTA 3RLUA 1JULA 2QYGA 4BF9A 2QAPA 1KTBA 3GR8A 2DG9A 1F4HA 3VUPA 4O4VA 3BJFA 1MRQA 4WY0F 1XIDA 3EKLA 2WZMA 5G4WA 2YDQA 3T4WA 2OO0A 3E0WA 4GGHA 2E09A 1JRBA 1LRNA 1BF6A 1OFQA 1EEPA 2YSWA 4C1LA 2ASHA 1IF2A 2ANUA 2VX6A 5DBTA 4GRSA 1YW1A 4KQNA 3V36A 2DJLA 4QZVB 1QNSA 1PS9A 2RKXA 5G2WA 2PC4A 1H7WA 4S3JA 4YHEA 5CJNA 1A3XA 4DZ2A 1EP3A 5CGQA 2NZLA 5GPRA 3DIPA 4S3DA 4X2RA 2H9AA 1V0NA 3F1QA 1FKFA 5G1MA 4GABA 3H2NA 3BGAA 3N6JA 3HG5A 3IIVA 2QLYA 5CLTA 2Z7GA 4GI6A 5HA7A 2PPGA 3HG2A 2ACQA 3C0LA 4DQWA 3VDGA 3VIJA 1HJWA 2PDKA 1FCQA 2WNNA 3SQSA 3RM4A 3GVVA 2HNEA 2PRHA 4GIEA 1XBVA 5FEZA 5CPOA 2RUQA 2WHMA 3BW3A 1RLCL 3AHYA 3QMRA 4ZMGA 4TYOA 1FCVA 2Z1VA 1YW5A 1PHQA 3T2QA 1T41A 2C7FA 4RNIA 3G1FA 5ABTA 2QCGA 2C19A 4IQ2A 3H4XA 2FJUB 4DAIA 2PTXA 3CL8A 4JHMA 2CLFA 4FXJA 4EE9A 2PWVA 2QS8A 4X22A 5E93A 1GEQA 5HNTA 1ZLPA 3M41A 3PC0A 4W87A 1W31A 1QBAA 3CHFA 1UUQA 3A13A 4J3VA 1CEOA 2DIEA 2XP6A 4IMFA 4O0KA 2OGJA 1X39A 3K13A 5FJTA 3JZUA 2VKZG 4NF7A 1DQWA 4PL1A 2XVKA 4IF2A 4N02A 4LCRA 2ZUWA 4PUDA 3NXFA 2W67A 1AODA 3UG5A 1P43A 3B7XA 2D1ZA 4QS5A 4WIWA 3KZPA 4LYPA 1NIUA 2ZXAA 4ADUA 1RCOB 3W70A 1WYIA 4C6EA 4K8EA 1ITCA 4PMJA 4PTXA 3M9YA 4H4IA 4ZGYA 1PXGA 1SO4A 1AD4A 4EVZA 5EMKA 3A3WA 3I6TA 3T4CA 2RUCA 4JD4A 4M24A 4UFKA 1RY0A 1Z42A 4HNTA 3G1AA 1QDSA 1SZRA 4JQ3A 3FA3A 4FLOA 3A21A 4WHBA 1UWSA 3P5ZA 4KS0A 1GJUA 1K4GA 3P5YA 3R0DA 1KXQA 1B4EA 3HPXA 4AF0B 1E9LA 1DV7A 2BGSA 4L1WA 2BODX 3CL6A 5H8UA 1OFEA 1Z3NA 3WF0A 4LAWA 4HOZA 4KPLA 2HJPA 1ADOA 1ZHAA 3H26A 5E9XA 5CBIA 1BWVA 2PDYA 3S0CA 1XYCA 1A7XA 4ADSA 5CKSA 4MY9A 1DXFA 1RQEA 3SN4A 4L64A 3GHSA 4QXIA 3PZGA 3WLRA 3CV6A 2PE4A 2VELA 1N2VA 4P5UA 3CQ0A 4QP0A 4YNGA 1TVPA 2WC4A 4LWWA 3PP7A 4H9XA 1FWEC 1O1HA 2IPGA 1VFUA 3GW0A 1QPOA 1NWSA 3KP1A 1A4LA 3I68A 4WDXA 1CB2A 1XC4A 4DUWA 2Z2BA 4RDYA 4HCDA 2BVWA 3KAHA 3L65A 1KW1A 2UZ5A 4W88A 3DG6A 1OFRA 4M5PA 3TYZA 1MMFA 4B4HA 3TQPA 2B0MA 4B3KA 2P0IA 3M46A 1TWDA 2OSYA 4OBRA 2GJNA 4RW3A 2WVSA 1FRBA 3VZXA 3WENA 1R85A 2C91A 3I3BA 3CAKA 2VVNA 3GK0A 2WQDA 4IMEA 1PDYA 3VIGA 1FWJC 2PDFA 2IW0A 1TTJA 3A5FA 4AY7A 2JGYA 1P5BA 3LYEA 1JDCA 1UD5A 2ZZ4A 3C61A 3EA2A 3SFKA 3KWXA 3OU8A 4DY1A 1LWHA 1ZCNA 4AB4A 1KFJA 3QLLA 4LC8A 2Y4SA 3P62A 4OV4A 4K68A 4NJHA 1XDLA 4LXFA 1XHGA 3GNRA 1ZGDA 2H8XA 4GGBA 3B8IA 4YVXA 3TC3A 1JCJA 1BLIA 4ZQCA 3I4KA 3EB3A 4LYKA 4OZOA 1JNEA 1NWTA 3W4RA 4XO6A 1XPGA 1NF7A 4QE4A 4PEKA 2I7GA 3FS2A 4RDVA 4J9JA 3MSDA 1WKDA 3UJFA 2QPXA 1Q6HA 1K77A 4IGHA 3S1WA 3F2DA 3VMNA 5G5IA 5C2CA 4XKMA 4MYXA 5DF0A 2Y88A 2OXNA 4JL1A 5DLCA 3E0IA 4D6JA 1QWKA 2ISFA 4PMOA 1WAWA 3B04A 1WKEA 4K6AA 4ZPVR 3STGA 3IHZA 2BOGX 2G5WA 2D0HA 3AS2A 4NI8A 1SU5A 3PAJA 8CGTA 3CZGA 1GPWA 1J96A 1A5CA 3SGUA 3EGJA 1ZCCA 4R9XA 2YCKX 5H8MA 4QEHA 2QEZA 2ZRVA 2CFFA 2VZSA 3HIJA 4NXSA 2AGKA 4MB3A 4HA4A 2C71A 2AAMA 4IIFA 2MANA 4R0XA 4J2MA 2BDQA 2OU4A 3P84A 5CSYA 9XIAA 3LEPA 4YWSA 3WQEA 4U5KA 1UD2A 4Z2KA 2YA2A 2OWXA 4IJCA 1BYAA 5HDRA 3PG8A 5B8IC 1NP0A 8XIMA 3I3DA 3IEBA 4BK9A 1UMLA 4EAYA 3KLLA 3AS0A 3AHVA 1ZAIA 2BBFA 1ICSA 1Q6IA 5HQEA 2X1TA 1Q7QA 4L6HA 1LOSA 5DT7A 2VC5A 3G1YA 2AMGA 1RJRA 4A35A 2XP9A 2ZXQA 2Z6JA 3LHUA 1JR1A 2NV9A 2PF8A 1EGZA 3O06A 3WQVA 4X60A 2CYGA 3MHGA 4NL1A 4BQ3A 2VUNA 1BYBA 2RGMA 3BMXA 1KR0A 1U2YA 2OYLA 4JFMA 3VFCA 4PCTA 2VHLA 4ODLA 1SW3A 4IFOA 3WLHA 1OB0A 3CMFA 4J28A 3WUFA 2OELA 4AYSA 2OQLA 2VOTA 4J7RA 3HMJG 1UP3A 3O5QA 5BRBA 1OD8A 3A3XA 3VXGA 3WUEA 5I77A 1NEYA 1NDVA 5E0FA 4KCVA 4LBRA 3VIIA 1K4HA 2XIOA 1HKKA 2NVCA 3ALFA 1VIZA 3FY1A 3W25A 3DHUA 4JIRA 3OA3A 3SO7A 1MVYA 1DPMA 2E5DA 1UHVA 1HP4A 3OQ8A 3V18A 4B9ZA 3NURA 1E43A 2QCDA 3W74A 3B0UX 1VGAA 2OVLA 4TUFA 5HWNA 2KZHA 2BXZA 3JS3A 3PJUA 3FGCA 1IE7C 3PZNA 3QQ1A 1KC7A 1CZ1A 3BJSA 4C6JA 2OWWA 3APYA 3GDMA 3LM3A 2XP8A 5FJUA 3UXIA 1HG3A 1MQRA 3VCNA 3FYOA 1XDJA 3TTYA 3SRHA 1D3GA 5CGTA 3CUHA 3AYSA 1G1YA 4TV5A 1A49A 5L6UA 4TU1A 4LYQA 4S3BA 2CZ5A 4LS0A 1IGSA 1U5HA 3SW6A 2DT2A 1F3EA 2REQB 3PULA 2ON3A 2YL8A 1KBKA 2A2IA 3HOJA 2PBOA 3M0IA 3TH6A 4O28A 4RNJA 1EYEA 3BQ6A 4EF8A 5DRCA 4JS3A 4K38A 2QDHA 2TPSA 3BICA 4BCEA 3LTPA 4ATWA 4H9UA 1ZP3A 3S2MA 4UTWC 9XIMA 1VCVA 2X05A 6XIMA 1DJXA 4RZBA 4J3ZA 2V8ZA 5E5CA 4DHGA 1IX5A 5A2AA 1R2SA 3I4EA 3BMWA 1TJ2A 5AHIA 5I3FA 3UERA 4GCAA 4I6VA 2V5LA 4LS2A 3DN5A 2YBUA 3BSMA 2QJNA 3PJWA 4KEZA 3WG6A 5HMFA 3SURA 1VENA 1UZDA 3Q4DA 3WBEA 1NH6A 1JZ4A 2BVYA 3ZQ9A 2EULA 5EPDA 3P8IA 3QY8A 2VFEA 2WNQA 4LUSA 4A3RA 1OCBA 3IWPA 3BCFA 2NT0A 1WA3A 4X0NA 3W1LA 2Y5JA 4HYRA 4JL2A 3UESA 3KOZA 1HJUA 1E9IA 5TAOA 4OIFA 3BMVA 1AZ2A 3S4TA 5CC3A 2D20A 1SJDA 5CQ1A 5I09A 4ROQA 1K9FA 2VCBA 1ELSA 3W72A 5K4XA 1KRCC 4GD0A 2BGQA 5RUBA 1D9EA 1REQA 3A22A 4NP7A 4RDWA 1ZENA 4UTUA 1PZ3A 5KINA 1R38A 3GKAA 2BV9A 5T9BG 1ZJBA 2P88A 3SZ8A 4IPPA 3NQGA 4O16A 1UC5A 3WH6A 1S5NA 3DUGA 2HS6A 1LG1A 1RBOB 3GHRA 3EPMA 4G56A 1ENUA 3LZ3A 4XKYB 2OTDA 2FIQA 3CS2A 2ONEA 1RY8A 1H0IA 4IHCA 4XISA 5DX7A 3CUGA 3VGDA 2C3ZA 1G6CA 4ROPA 1FD9A 3W7PA 4G2DA 2NX1A 1H49A 1ZAHA 3A4AA 2J66A 1E6XM 2DZAA 3T05A 4IIEA 3W7RA 1SZFA 3MDYB 4XZBA 1VKFA 2HVMA 4S2CA 2PMQA 3EEGA 1RZMA 3KACA 4R9OA 2E6YA 3CYVA 1W3NA 1D7FA 4H2HA 2DSUA 2D24A 2QR6A 1U33A 2XGIA 3L0GA 1QW9A 1AW2A 2XIJA 1PYFA 1H62A 1E0XA 2W92A 4ZQOA 1E9YB 2Z7KA 5B7YA 1A5OC 1KGWA 3SCNA 3W0KA 2WMJA 5D9PA 1HL2A 1N55A 5HNRA 6CGTA 1JF5A 4BQ5A 5I3IA 1XLEA 5J6EA 3GSMA 1UBSA 2ZUMA 3UWYA 2DSKA 3M5YA 2DUXA 2J8TA 4LNYA 3TW6A 1UP0A 4L9YA 1LCOA 2IS7A 2VDIA 3CYJA 3E2RA 2VD8A 3LV6A 2HVNA 2JF7A 1TO3A 3N9RA 1WAUA 3A47A 4QAWA 1SZEA 1UC4A 4EKJA 4KEUA 2GJXB 1VFSA 1XIJA 4Y96A 3QR1A 3H21A 3O9NA 3EWUA 3KVLA 1BEUA 1S5MA 3CIVA 2ZDSA 2Q8LA 3VDHA 1WDRA 5FJRA 1DIEA 3WMSA 3KTCA 1QI0A 2E6FA 2A0NA 1GORA 2QCMA 1E6PA 1V0MA 4US6A 3SCTA 3OG2A 4F0LA 4Y90A 3O5KA 3VDAA 4QQUA 1L6WA 4UMCA 5HJYA 4B91A 2Y70A 1CWYA 3KTXA 3LOTA 3TAOA 1KGXA 3M7WA 1B3YA 1UZ4A 7CGTA 2HCVA 3TOPA 2PURA 1OCJA 3CHDA 1IZCA 3GQYA 3L4WA 4JFJA 1EO7A 1QPQA 3PB0A 3QOMA 5G1TA 4E8CA 4ZE5A 1J2BA 2GOKA 4HU8A 1OCNA 1Q4NX 2CZEA 4DYEA 2HXUA 2X2GA 1OT2A 3ZR6A 3TTQA 3U2ZA 1CNVA 4O1AA 4M6UA 3STCA 5FL0A 1ZALA 2HWGA 3NM1A 4ODMA 3VD5A 4Z1BA 1Q7MA 5FF4A 1UYQA 3NYDA 4O15A 2Y62A 2W5FA 2YCJA 1FKBA 2DGAA 5I79A 1ZBWA 3WMBA 2YDAA 2V69A 1G94A 2F6KA 4LF1A 4NILA 1NELA 1EFZA 1UKSA 4NASA 4HZ8A 3PUOA 2VDGA 1OINA 4YPJA 4JTIA 3B0XA 1AVAA 4LUYA 4Q6XA 1ADDA 2GZXA 3IVUA 3Q94A 1LUCA 1M01A 5B7ZA 3B0PA 1GOIA 5EL1A 4CQBA 1PINA 4GK8A 4UZUA 1DQUA 3EWZA 3R79A 3BGGA 2YGYA 4FAMA 1XLDA 1S46A 1CXFA 1H5YA 1P0DA 3N4FA 3IKGA 1X97A 4O57A 3SFWA 2OQHA 4DWDA 1OFBA 4NJGA 4CCEA 4A8IA 3BLPX 5HWCA 2J77A 1UUMA 1UWAA 2YZRA 3RGCA 3E0FA 2FGBA 3UWZA 4RK8A 2R1NA 2IQDA 4Z1DA 4FLRA 3W1RA 2O9TA 1CT5A 1FH9A 1LRTA 2XJ7A 5HT1A 1MRAA 1W32A 3V7PA 4GC3A 3TCEA 4Z1CA 1K8CA 3BO9A 1MNSA 1VJSA 5BCAA 1A5SA 1W1ZA 2W9MA 3MA8A 3GC4A 3W07A 3UZZA 1Q6UA 1K7XA 3IKDA 1EYMA 3OLEA 1N8FA 5K9XA 2CKSA 3QPZA 3H4WA 3MANA 3DENA 1VLIA 2P4VA 2BVDA 2INFA 4H19A 3WNPA 2Q8ZA 3WLTA 3W85A 4WDWA 1NOUA 7A3HA 1F3WA 1E4IA 3COTA 4CD5A 1QO2A 2A7RA 1UB3A 2D2JA 3W1TA 3OLIA 4UTKA 4JYSA 2Z1BA 1MQPA 3WEMA 1PHWA 1MO0A 3GYEA 5A6JA 1N7KA 1XYFA 1MDLA 4LQ1A 2WCGA 5KZDA 2FHBA 2V5DA 4BQ4A 3KDOA 2XH2A 1ONEA 1AQ0A 3UZWA 4ZL1A 3RMJA 3SCSA 3BDKA 5D02A 1UP2A 4WF7A 2QNEA 1H1ZA 3TTOA 1AA1B 1A4MA 1X1ZA 3M16A 4UTFA 3R11A 4E4UA 3BAWA 1ME8A 1VQTA 4YU1A 4WKAA 4A21A 1KTNA 2Q71A 1XDMA 1W8SA 2M2AA 1GTHA 3RIKA 3E2SA 3KX6A 1HKVA 2ZX7A 3OLDA 4YHGA 3ZXWA 2E9MA 1JGMA 4R7WA 4PCFA 4S3FA 1C3FA 2RSEA 1K9EA 2E1DA 5IRPA 4Y8EA 1QHZA 3CT2A 5CSRA 3WMLA 3O8AA 4QLKA 3FNDA 3ZT5A 3SCWA 4HTBA 3MSRA 4ILSA 3VE9A 1FDZA 4ZE4A 1QMLA 4GZEA 4DRJA 3P0WA 5D4YA 4KRTA 1G5AA 4DLMA 1CGXA 1M7JA 1MEHA 3IAQA 5TIMA 1V3JA 4P2VA 4WD0A 3MDUA 1VYSX 1E0WA 3OZMA 4LBUA 3ZVHA 1OC7A 4GNJA 3EKZA 2RDTA 3M5XA 4OKDA 1WV2A 3SUSA 1T6MA 2AL2B 5ABEA 2OG9A 1FKGA 2J7HA 3T0TA 1GPFA 1WKFA 2ODOA 3WNLA 4JTGA 4XBJA 1V77A 4HOXA 1R9XA 2ZX8A 5A1AA 4QBXA 4AD1A 2V38A 3U4AA 3IGUA 4WJEA 4KETA 2GOUA 1YLVA 3W7GA 5LSMA 1IQ8A 4F79A 2JEPA 2PWUA 1FBAA 2D3LA 1L8NA 3AIRA 1Q66A 4LUIA 1UMYA 3EDKA 3W1AA 2X1SA 3FVMA 1E73M 4FN2A 3W81A 2E5CA 4GQ0A 1K8YA 1PVNA 3T1GA 1KFKA 3R94A 4UTHA 3ARWA 2BNJA 2FMNA 4A2SA 4AUBA 1RBAA 2X7WA 4E8GA 3T42A 2J6XA 1P0EA 5BNKA 2POZA 2MLYA 4GQBA 3KP0A 4G8TA 4BQ2A 4I7WA 3LENA 5U7SA 1HO1A 5AC4A 3O5RA 1FVPA 4E3TA 5AYIA 4M6QA 3PUGA 3VTRA 1EO5A 4L80A 4AEFA 4V33A 3GXFA 3R43A 4I7UA 1E15A 4AY1A 2FQIA 4UB9A 3XISA 4FNTA 1WB0A 2GQ9A 3M43A 3CHCA 2OPJA 4J4OA 1XS2A 1V03A 5C71A 2ZZ5A 4NJKA 1BAGA 1FWCC 5FF3A 2YZ5A 4CD7A 1TA3B 4LC6A 3UWVA 2AQVA 1PKMA 1KBJA 4FP1A 4ZO9A 1TYGA 2ITKA 1FXPA 5CZSA 2EO7A 4IP7A 1NQ6A 5LA2A 3E02A 4O4WA 3LCHA 2FFCA 3F5LA 3GTIA 1GYMA 2V63A 1XP3A 3LMYA 2YIHA 4UFLA 4XZWA 2YCLA 3NQ2A 4H8VA 4IL2A 2XG9A 2RURA 1CDGA 1Z44A 3N9SA 1H3GA 1PX3A 4AZCA 2ISDA 2G97A 3U3HA 4QJ5B 4LT9A 1V79A 3MUZ1 1UH2A 5BOEA 4YXGA 1ISZA 3A5VA 3VNMA 4R53A 3S9IA 4UTLA 4L4OA 1S1PA 4CNTA 3CO4A 2XFFA 3YPIA 3NG3A 4PMYA 4DELA 3NL6A 4UQ9A 3TNOA 3PNUA 1OF8A 1HJQA 1JFHA 4IFKA 2WLZA 3UJ2A 2PDCA 3A4JA 4PSRA 2CW6A 4XVEA 1XFCA 3LGDA 4GYPC 1VBHA 4LANA 4XAKA 3MUY1 4FOUA 3U6WA 4ERGA 3VCCA 2OOFA 4QNWA 3O2LA 2UY3A 3S2LA 5FJPA 4U33A 3CV2A 4JPGA 5DEZA 5FEWA 2GUBA 4V27A 2ISVA 4UCGA 2PCQA 4UZSA 2O9PA 5LNUA 2WM1A 3H54A 2H9AB 5FD0A 5HULA 2JQXA 2CLIA 4FLSA 1BFNA 3I7QA 2WSPA 2Y6ZA 1NM9A 4Q8TA 5FIPA 3SJ3A 3IK8A 3GB6A 2YXGA 3PBWA 2MLXA 3HJZA 2W3ZA 1MUCA 4AWSA 4QITA 1I9CB 4N9BA 3WBWA 4CEUC 3H2EA 3O15A 2JGQA 5A6LA 4S3EA 4GA8A 3GDRA 1F3XA 3WD3A 5LNVA 1R3RA 1L1PA 1I60A 5ABFA 2QF7A 4ITZA 2ZA1A 2O9OA 3SUTA 1NSGA 4I9MA 5C55A 3S5ZA 3A9BA 4ADTA 4MWAA 2AQWA 2ZTKA 1G7UA 1GUVA 3VO0A 2ZQUA 2CKRA 3AYVA 3LCFA 3L4XA 1US3A 4INFA 1XIBA 4RE2A 1UWRA 1D7KA 1EJWC 3ZT7A 1E55A 1E3ZA 5AC5A 2NVDA 4KWOA 3GO2A 5E09A 4IUGA 2NW0A 3FEMA 2C8NA 4F2BA 4GYJA 1KCXA 1O60A 3P7YA 1D8WA 1ZL1A 3R8RA 2NLIA 2JIWA 3EMZA 1EIXA 1THFD 4ATDA 3TYEA 4C6NA 1MW2A 1PX8A 4PN2A 4O1EA 3O16A 4NNAA 1UH4A 4L6OA 2ZX6A 2HRWA 3WNKA 1DJZA 3S1GA 1TTIA 3LCLA 1UR8A 2QAFA 3DG7A 5FEPA 4HK5A 3HO8A 2R8WA 4UQDA 3ZLHA 2YPIA 2NQ5A 3NOEA 3O0KA 6ENLA 5D2TA 2FDMA 2E3ZA 2OT1A 3TN3A 3AO0A 2XSXA 2BY1A 1HTIA 5FKYA 3WDIA 2QUMA 3AAMA 4CD4A 1UIOA 5HWBA 3OGRA 4IPLA 3RO8A 4DRQA 5JH1A 4AZ5A 3W6YA 5AFDA 4C02B 4MIMA 3TA6A 1J4EA 1IXNA 3LG3A 1UW9A 1KWGA 3OBEA 3BUVA 1LWIA 3IIXA 3SIZA 3NQMA 2ZR5A 5IFTA 4MDOA 1C8XA 1IWPA 3R7MA 3TC7A 2Z25A 1XKYA 5EFFA 3ZJ6A 1DTUA 3TQVA 2V82A 4W8LA 3PK7A 3R12A 1JL8A 2V6AA 2VC6A 4GYKA 2OX1A 1SW7A 5EBAA 3NVTA 3TFCA 4KF1A 1GOWA 4FNRA 2P8CA 3TCZA 1JEZA 2RUSA 1E56A 3EWWA 2GL5A 4XAFA 1Q6OA 1J01A 3R6IA 1LLZA 4XK2A 1W17A 2DPEA 1R46A 2WJZA 3HFYA 5BMWA 4NHVA 2J9YA 3MW7A 3BW2A 4O17A 4HNNA 1UKTA 1KQYA 2B4GA 4ZSUA 1TX0A 2DDXA 3CHEA 3M47A 2DUAA 4QIBA 3IJDA 4XBSA 4QS6A 2RDUA 4DI8A 3TA9A 2FHCA 4Y9NA 1HIZA 2WMFA 2KR7A 1WCGA 3M7SA 2OLAA 4PMZA 1G01A 4Z17A 1W3KA 1JDFA 2BB0A 4AMAA 3PR9A 3GU9A 4UC5A 2YLLA 4HSHA 2BP1A 4TR9A 2W27A 3GDTA 4EP8C 2XVNA 3EWXA 3D3FA 4KWSA 3SDOA 3BH4A 3S2CA 1W2VA 2XVGA 3PSVA 3HQ1A 1XUZA 5DITA 1W3HA 4L4PA 1EUAA 1JYVA 3O07A 4XAPA 1GZJA 3MBFA 1OZQA 4BA0A 5A8OA 5C9XA 3UPMA 1H4PA 2OR2A 3JYMA 3OIXA 3E12A 1LQ0A 4PUMA 4AH7A 4F0SA 4WR3A 2P5NA 3PVFA 4DJDC 3TW9A 4U2YA 3MP5A 2WVUA 4U28A 2YDSA 1QASA 2OEJA 4L65A 3VX0A 3OOBA 3MMUA 4QIUA 3V0SA 4NIRA 1T96A 3O5IA 1FOBA 1HF6A 4YN5A 4N19A 3ENLA 5CC5A 4CNOA 5DXXA 4HSOA 3NCOA 4JBRA 4NJJA 3OGVA 5I6SA 1SFJA 1YRRA 4PMNA 1E6RA 1GQKA 1Z48A 2FGZA 4W89A 5G4EA 1F5ZA 5JBFA 2FZNA 1OJXA 1S3TC 3IARA 3MUAA 3STPA 5IM51 2A85A 3WLNA 5EYWA 4ODNA 1UA7A 4CCDA 5D33A 4O8AA 5XINA 4A3UA 3W6MA 4BR1A 4C6QA 1PKYA 3NAVA 3SSZA 1M7OA 3NRKA 1TSIA 2J88A 1V6UA 4P8UA 3M0LA 2ZICA 3NQDA 1ONXA 5EMJA 1KRMA 3VM5A 6A3HA 1EWEA 4V1XA 1Q6FA 4Q22A 3URNA 2W6RA 4JTAA 1I6NA 3GXMA 3WDRA 1W6TA 4AD4A 2QCFA 1ICQA 1WO2A 1O5RA 3O6DA 1E0VA 3TW7A 1TVLA 4F48A 5A8MA 1H60A 1OABA 2PLKA 4XZHA 3C0SA 3V5OA 2I16A 4AAJA 2YB4A 1UZHA 3OTRA 3ZJ8A 3SN1A 3BV4A 3N2TA 4CGTA 1V3HA 3SADA 4I6KA 2B7NA 3W73A 5CJMA 1HGWA 1I1XA 3GG8A 1RP9A 3GXTA 3LDVA 4V28A 3UQIA 4KKXA 2V9DA 1E72M 1H1NA 3CMGA 3KVMA 3O3RA 1H7NA 3A4WA 5AC6A 1MUWA 1FKRA 4X9YA 5HUOA 4GO9A 1RD5A 3L21A 4Q3MA 1XR2A 4CNUA 1KKRA 5ABGA 4IX0A 3VE7A 5BRQA 1CCWB 5D2VA 3TLQA 4HNUA 1HFBA 2YA0A 5I03A 2IUZA 1J0HA 1CTNA 1MEIA 3EMCA 4MY8A 3RPTA 3VKKA 2EQDA 1AFSA 4BJHA 4E5TA 3RITA 3STEA 1V0KA 4MOZA 3TZFA 3MBDA 2VX5A 4P8XA 2V5KA 3R2GA 5LIXX 1T11A 4M7TA 3CNYA 2W0UA 2ETNA 1FCUA 2J7DA 4H2CA 4AVOA 3W2KA 3TXVA 3CUZA 3FYYA 1XRVA 2PSNA 4ODQA 2QCDB 1EGMA 3URBA 3N2CA 4LUTA 3WQ5A 1QPNA 3CUXA 3CPUA 3EX4A 1DJIA 5M17A 1VEOA 1LBMA 4JTSA 3ANYA 3K30A 2DZPA 3PZ9A 3WFLA 3C4UA 1VRXA 3D3AA 4HK7A 1IR1A 2PUZA 5C7VA 4DB7A 5E6ZA 7REQB 4TIMA 3WD4A 4GZ7A 3MO4A 1B9ZA 5D8WA 1JD9A 2PDNA 1BYDA 1Q6DA 3VKJA 3EDDA 5I24A 3HQPA 2EHHA 4MFDA 1TX2A 2W91A 2NXGA 2ZXBA 4TX9A 1V6TA 4P61A 4AD5A 3PRAA 1OQFA 3NL3A 1NQKA 3GTXA 3ZMRA 2VWSA 2NUXA 2YKKA 5GVJA 3VGEA 1FHLA 4JQAA 3C0QA 3LXCA 4UFJA 4MJZA 3EDJA 3PTMA 1GRJA 4HU0A 2VDHA 3M0MA 2F84A 1FWTA 2PPNA 3F4NA 4N2YA 1ROUA 3QKZA 1GVRA 3WF2A 2AMXA 4MPQA 4LAVA 6TAAA 1KM3A 2GK1A 3W7HA 1YTKA 4HZ6A 4ODRA 2OGYA 4XSMA 3S83A 4AZ7A 4YWIA 4W7WA 4E2BA 4GKLA 4DAFA 1LF1A 2JALA 3O6YX 4KCUA 2Q3OA 4LUSB 3VK5A 3DERA 4IG2A 1E6ZA 1EA9C 2CERA 3GU1A 3DEQA 4U85A 4O1CA 1B0IA 3ITVA 1LBLA 3WD0A 4PH6A 3AJ7A 3T55A 1TPH1 3EDFA 2YBTA 4QDWA 5LNWA 2ZUUA 1FWSA 3ES8A 4S38A 3NEHA 5C70A 3VNJA 1Q8JA 2PS2A 1KV8A 3MKVA 3KWSA 2Y24A 4OGZA 4MTVA 1REQB 4JIEA 3WK2A 4PUWA 3GG7A 5HMDA 3KBNA 1C9DA 3NSXA 3PA7A 2PBGA 4HCHA 3W23A 3T40A 3CAWA 3LBCA 3WELA 4GVFA 2EJ1A 3TYCA 4U10A 1KXVA 2WSRA 5KETA 5JMUA 1CXKA 1FP9A 3FA4A 1E6SM 3VIPA 2CXGA 3GY1A 1OK4A 1RXOB 1HKWA 4PMUA 1RHCA 3JYJA 1P0BA 4QE1A 1AQHA 3UWEA 2WVVA 4KEVA 2JE8A 5C2XA 5REQB 2Q8XA 3BAJA 4WUIA 2VRKA 2C15A 3I65A 3UP8A 4Q4PA 5K7JA 3V0UA 1TUFA 5GJNA 1XLCA 1QPRA 1FFRA 1R7OA 2REQA 4ZODA 1EL3A 4A8RA 4Z08A 4UR7A 2F2DA 5H2ZA 2PP3A 1UROA 2Y0FA 1UG6A 1YPFA 1RJQA 2PGFA 1DORA 3MQTA 2ZUNA 2E8ZA 4O54A 3CQKA 3S1XA 1FWHC 3VABA 4C6FA 4MKNA 1J0KA 4RV8A 1KRBC 3N9KA 1ME9A 4IQDA 4WCJA 1YADA 5LGXA 2BS9A 3DGRA 4ZSTA 9RUBA 1RUSA 1FDJA 1I2OA 4AEOA 4PR4A 1FWDC 1VFTA 4DWSD 3RU8X 1DWFM 3EA3A 4I9JA 4Z2LA 2VYOA 4S1FA 4DPQA 4DO6A 2CIPA 1I2NA 3AZRA 1KNWA 1QOPA 1IWAA 4KQZA 4W5UA 4I5RA 4HHLA 4YJ5A 2ZE0A 3W26A 2ALDA 1O6IA 1XLAA 3MU7A 3PZOA 4DH0A 1Z6KA 5LA1A 4X3ZA 1H2JA 4C6LA 2BY2A 3TJXA 3TN4A 4A8NA 3E0LA 3L4TA 1I2PA 1A50A 4ONVA 4E2DA 2B7QA 3NZPA 4ECLA 1JDAA 3QEZA 4JNYA 2G3FA 1V6WA 1BKHA 3Q58A 3TR2A 3NM3A 3MC5A 4KWVA 4DRSA 2VGIA 4HMDA 1PO9A 2RFGA 2QPSA 4XAZA 3TMQA 3AALA 4YTQA 1YPIA 2WOQA 3DI0A 2ZTJA 1LQ2A 1TPWA 2DH3A 4OBSA 4J27A 1JPHA 3E2VA 4H6QA 1US2A 3P80A 1Q5MA 2KX9A 4CVWA 4BF8A 3USBA 1G4EA 4AVNA 3WDJA 1XGEA 5AECA 1UIPA 1ZPTA 2J6VA 3QV7A 4US5D 3OVPA 5CAKA 2A7NA 4TTUA 4ZOAA 4AMCA 1V51A 1MXSA 3MCNA 1WZLA 3WDPP 1KLYA 3GAKA 2XP5A 1TV2A 3KCLA 1NMWA 4UR9A 2OQYA 4GUFA 4ODKA 1X8FA 1DTNA 4FHAA 3PTDA 1GOOA 4FS9A 4ZQMA 5CPLA 3H24A 3P0XA 4GLEA 1GEHA 2ACRA 2HVOA 1FFQA 2YCEA 1E4MM 3F5JA 2XM1A 3NDOA 2BG5A 3H53A 2RJGA 2G96A 1JDEA 1Z89A 4W8AA 1HXJA 2X1UA 1CXIA 1SFSA 2D3NA 1F76A 1KT0A 2B31A 3IVSA 4GACA 1LUCB 3LMZA 1M53A 3Q37A 3A4XA 1MXGA 2WB5A 3ITCA 4MUZA 2ABAA 1AMYA 3CPRA 4PB3A 1ZBKA 2IPFA 2Y8UA 1VEMA 3ATYA 1B3ZA 1ROTA 3MV11 5KMYA 1AL8A 2OMAA 3L68A 4PA8A 2C1HA 4JCLA 1L8PA 5JXQA 1BG4A 3OYZA 1TKKA 2M1IA 3KEHA 1R3SA 5FACA 1QI2A 3CB8A 1WQ5A 5FI8A 3UY8A 4O8RA 4QCFA 4ZO6A 2V3DA 4LAMA 1R2RA 3UBPC 4WSJA 1S2TA 3B03A 4DF0A 4ERIA 3LK6A 4IGSA 5T9CE 1UWUA 4HU3A 1IEVA 1PJ9A 4GCXA 1AD1A 3M44A 1LROA 6TIMA 3TJLA 5F2LA 1SFTA 2DJXA 1D8CA 4HN8A 1WZAA 3QGVA 5T26A 1B3OA 1FKXA 1W5QA 1S2AA 3UYCA 3NTPA 2X41A 3GBDA 2G4JA 1QNQA 3QC0A 1YBQA 3T81A 2ZC1A 3W02A 3ELFA 4RZ5A 3ZS4A 4E0CA 2YA1A 4CLMA 1EZWA 5E9AA 3EPNA 3UZYA 1QZ2A 1YEYA 4AW7A 1S2UA 3AI0A 3NZQA 3D47A 1AJ2A 3PZVA 1DJYA 4XBKA 1KKOA 4HHMA 2WK2A 2RHGA 5CPQA 1LT8A 4DJDD 5EKYA 5CPMA 4IJBA 4A05A 4Y2WA 2OO6A 3IGHX 2QPUA 3WLKX 4MPKA 3R13A 2V5CA 5DY3A 3SN0A 2PZ0A 2R1PA 2WXDM 1GOXA 3SUUA 3IAPA 4IGNA 1IV8A 3OQEA 4FR1A 4X9SA 1JDDA 1EF3A 5HQMA 4QCEA 2PA6A 4L9ZA 1LL4A 3O63A 1BXBA 3TJ4A 3KBVA 3BANA 2PI6A 2KE0A 4OV9A 3JZEA 1W3JA 3ITYA 4A29A 4NRRA 3WLOA 3MVTA 1B57A 1Q6EA 2FZ8A 1DL3A 3H55A 3R8HA 3TEVA 3PF3A 3AS3A 1M5WA 1XIIA 3CT7A 3HPAA 3HGSA 3L7RA 3BOXA 4NZFA 4RDZA 3PN8A 1OGSA 3N15A 4ZFMA 4UFHA 4H01A 3IV3A 1BWKA 3CO8A 3QZ6A 4PUJA 2A3AA 1TREA 3W2MA 3N19B 1XXXA 1C8YA 1GVOA 2I5GA 2VC7A 3LY0A 3GTYX 4DXXA 1M5YA 4DI9A 1R9ZA 4AEEA 3K5XA 3ZVHB 2OLHA 4UOZA 3VKBA 2OZ3A 4IPNB 3S5NA 2J7CA 3THUA 4ES4A 1XYMA 2WZTA 3WBYA 4GQRA 1IHIA 3M6DA 1F61A 3MYPA 5HR6A 1YPXA 3KRBA 3U9IA 1GOQA 1J0YA 2PV3A 2EPKX 1YHTA 4AIUA 3POHA 1KM4A 4RV3A 3MZ2A 1SGJA 3SCRA 1JIBA 1EC9A 1FWWA 2WJDA 4BHYA 1F6YA 3BARA 3WFAA 1ME7A 3ODKA 4QSFA 3RAOA 4D9PA 3R10A 3RRXA 1AH4A 1L9WA 3AISA 4HN4A 2VCDA 3C0JA 2FKEA 4K3ZA 4CUCA 1M1BA 1NF0A 3NYZA 4NZJA 5IDZA 3U4FA 1EX1A 2NX3A 4HB7A 1E6NA 4S3KA 4PEEA 4Q6JA 2VZTA 3WBXA 2RDXA 3GG0A 1B54A 2ZOXA 1BKSA 2WCAA 2A6LA 3VA8A 4PODA 3UFYA 2J47A 4TX0A 1KT1A 5FAGA 4K8HA 4ASTA 1Q6RA 1F05A 1T8XA 2INZA 1S1RA 4WJ8A 5LXXA 1A5UA 3L5LA 2OJPA 3C8FA 3NPVA 3BAYA 1JQVA 3TK7A 3V75A 3T6CA 2BWGA 3GTHA 3CWHA 1GVEA 1V7YA 4BKNA 3K46A 3LHYA 2V30A 2XIQA 3KHJA 2PB1A 3ITTA 2PDWA 5HTGA 2X1RA 3N2MA 3NWRA 3C5QA 3WF1A 1XIGA 2ALRA 1FWGC 2TMDA 4LAXA 1OEPA 3E38A 4P7NA 3AFBA 1WZKA 1PZ0A 3IIPA 4KR0B 3JRKA 2KGJA 5BXSA 1O94A 3TXZA 1KM0A 2HV5A 2GVGA 1A5KC 4DO4A 3GU2A 3VPLA 2DZWA 3W7MA 1XG3A 4M81A 2JKPA 1ZP4A 4QGCA 5JH8A 1OK6A 3G1XA 1HVXA 3Q45A 3CLWA 2YCLB 1FKSA 2DORA 5FA5A 3D6NA 4AZCB 4FAPA 2ADAA 2BZNA 2C1IA 4HSNA 1FKHA 4FNQA 4UCFA 4PUNA 4GX9A 1EOMA 3H2MA 4Q4OA 1NP2A 2GQ3A 1QXLA 5FCZA 1I75A 5AYYA 4HZMA 4YVVA 3DFHA 1MEWA 2ISWA 5E0KA 4DUVA 1S5TA 4WOZA 5AVHA 3S1VA 1XG4A 4LAKA 2XSAA 1IIHA 5DRIA 3EWDA 1XIMA 5EGRA 4JYDA 3CM4A 4IJRA 4ZO8A 3N6QA 4AX6A 3W28A 4GGQA 1QI3A 3G1SA 3AWNA 2G37A 4LU0A 1I0BA 1Q45A 8A3HA 4WJXA 1MDRA 3KLKA 3PBYA 4P8WA 3BVJA 3DZ1A 2FZMA 3P60A 5AZ0A 2GSJA 5A6BD 1K6WA 5KTLA 1VB9A 4CQDA 2TODA 3UJRA 2HSAA 5BZAA 3UGVA 2QCNA 4B5SA 5I00A 4U84A 4MGGA 4J3UA 2P3ZA 1JCXA 2VFHA 4Y9PA 3ZSTA 3K8KA 5K9CA 5HMSA 1IR2A 2BY0A 2R9RA 2JF6A 1QNVA 5HOSA 1E70M 4S23A 3G0XA 4JFLA 1AQFA 3IJLA 1XLMA 2XP3A 1JCNA 1QATA 3BLDA 2OFJA 4DEFA 3UWWA 2OCZA 1TWZA 2IQTA 4CU8A 3C6CA 5DO8A 2CWNA 1CB7B 2HBXA 5BW6A 4LVGA 3ABXA 3UJSA 4MZ1A 1MFVA 2ZQ0A 3TSDA 3ZWSA 4I7VA 1TWIA 5ABFB 1ALDA 3B9NA 4E38A 2AKZA 4XTDA 3RK8A 2O0TA 4MWAB 4PRRA 1J5SA 3A64A 4EK7A 2GQAA 3E6EA 4LPCA 4H7CA 4FOJA 4FPSA 1C9HA 5D2XA 4BWLA 3FN9A 5FF7A 1UOKA 1QWGA 2DG3A 4DROA 3NTYA 3CC1A 3BV7A 3MUIA 3S1UA 4KIRA 3ME3A 3V1HA 3VC6A 3QW3A 1XINA 2BHUA 4L1GA 2XHYA 4J5NA 5BROA 4XAGA 2QDGA 1M65A 3CJPA 3EOEA 3PZUA 3W76A 2EKCA 4EXQA 4OT7A 3L4YA 3CV1A 2PP0A 4WXZA 2XIIA 1VR6A 1QNOA 3UXKA 2Q5AA 1W5NA 3GWQA 3W1UA 1F40A 1Q85A 4QX4A 3ZJKA 3UT0A 1U83A 1FQ0A 3FHAA 3EB4A 2PBCA 3FDGA 3UEQA 3TYAA 1XLIA 4A8LA 4JFVA 1UA3A 3PS7A 3D5HA 3GX9A 4HT3A 4L56A 3WQ4A 1CGTA 1P0NA 1PTGA 3H9RB 2Q02A 2QKFA 3W7EA 2QHAA 2HEJA 5CZKA 4AG0A 3KBJA 3S5SA 4RE4A 1GKRA 2TSYA 3THDA 1DJQA 1NU5A 3PTKA 2NXIA 1ECQA 3G3MA 2UWFA 2FTPA 5BWAA 3KFTA 1MNZA 4M0XA 3KCJA 5C2GA 1NWRA 3R58A 3UZXA 3OP2A 4UIOA 4G1NA 5HPCA 2D9FA 4Q8MA 3DAQA 2P3EA 2OZTA 4MYAA 2KI3A 5F7UA 3C2OA 1LZOA 4W7VA 1ZBCA 3PBGA 3UI4A 2M08A 3THAA 5J8LA 1LJYA 1XGDA 4AXNA 4DVOA 4NAFA 1ONWA 3N11A 1MW0A 2IXVA 1XPYA 3DFPA 1RK5A 1YDNA 1Q7ZA 3KAIA 1V6YA 2CNCA 2QCCA 2V5JA 4Y9AA 5M03A 3EB2A 3D46A 1LOQA 1EHAA 4Y9OA 1PIIA 2VR5A 4EOUA 5JVLA 1TCMA 3GNDA 4ORIA 3BZGA 3SCQA 2ZKMX 3CBWA 3GNXA 3P2VA 1MW1A 3PANA 5A5WA 3RM8A 4KESA 2CU0A 3FLUA 4DJED 2FGLA 3EXTA 4PTWA 2R24A 4YIWA 2EKGA 4W9OA 3KUMA 1NY1A 5LIKX 3QPYA 3RPMA 3UNTA 1U22A 1UR2A 3H2CA 1WKYA 2FPTA 5D8ZA 1EXPA 5BXPA 4C6CA 3NFUA 4QT3A 2PC8A 4ICNA 4HNCA 1D3HA 2NXHA 4R7OA 5EFDA 3HG4A 2WBKA 4D6FA 4QSHA 3ZLFA 1XJBA 5CG7A 1T99A 3DGBA 3U2OA 1JPDX 3OBKA 1UCWA 1P1XA 3EOSA 3VOHA 4JNZA 3WLSA 3VIMA 3ONBA 1KR1A 4RLIA 2FLIA 2VXNA 1BSIA 4B3ZA 4C5ZA 4E2VA 5FJOA 1X1NA 1W1IE 1TE1A 4YCOA 1V02A 2O4QA 1YQ2A 4EXBA 2XSBA 4O50A 1SJCA 1D7JA 2QGHA 4D8ZA 4D1JA 5FF0A 2UY4A 4C7DA 3M4HA 2G3NA 4GUJA 4KRUA 2AGTA 3L12A 4F2UA 3IPWA 2F9RA 2Z29A 2B7PA 5JUVA 2AOSA 1XIFA 4TXEA 2XZ9A 1XCWA 2BX7A 2OX4A 1M3UA 3GLCA 3PZIA 2CC0A 3BPWA 4HQVA 4ZEPA 4CNPA 3LRMA 4GYFA 1R3WA 2VEPA 3KRZA 5HW7A 1AJ0A 4GJ1A 2C18A 3WEZA 4Q4SA 3RR1A 1E71M 4JTFA 5AHEA 1DEDA 3VMOA 5DMNA 1RBLA 3VIOA 3LERA 5JBDA 1NFBA 5AYXA 2P8BA 3DI1A 2WHJA 1G4TA 4MJMA 2PV1A 3LSBA 3IJ7A 1RK6A 3GXDA 4LAYA 2HBVA 3MMDA 4RE3A 2V81A 4DJFA 4FF5A 4GUIA 2WWDA 3CASA 4S3GA 1WBHA 1Y0EA 2WCSA 3FIGA 3TU9A 3CEPA 3QV9A 2E8YA 3VOJA 3NZRA 1I4NA 1ONRA 4IXXA 1E5JA 3DCPA 4DPPA 2KO7A 1FWRA 3WQDA 1S5VA 4GJJA 2YJQA 2G95A 5CH9A 3G0UA 5A6MA 1LL6A 3F7JA 1GGOA 2HQAA 1B90A 3WH7A 4LYRA 4DYJA 1M7PA 2Y8VA 3LCGA 2ABBA 2WHLA 3IGXA 2IXUA 4R7JA 3QC3A 4C7GA 3CTLA 3O7UA 1W5MA 3WLMA 2I56A 3DFYA 2PP1A 1I8JA 1JFXA 3RO6A 1VRDA 2N87A 2DZBA 1FHVA 2F6XA 1W1PA 1QOXA 2OB3A 3T8QA 3SI9A 2GJRA 1CENA 5TBOA 4N42A 3LQGA 3S9YA 5A94A 3MUXA 3E2QA 4GX8A 4TNSA 3E9AA 1EHNA 2DUZA 3WQGA 1MZHA 4W93A 1OF6A 2UV8G 5KEZA 1LM1A 3UI5A 1JUEA 1OX4A 5C6MA 3TN5A 1M68A 1WUEA 4XZ9A 2DT3A 4NRSA 1EB3A 2X09A 2VR2A 3TSBA 4GY1A 4Y6GA 3ZJ7A 4HA0A 4NZCA 3B0YA 1V5XA 4EPBC 4QM1A 3LHTA 2OLSA 3BLEA 1MW3A 1AL7A 2GDQA 3KCEA 3ECQA 2XPBA 1S2VA 3MB9A 5HUPA 3ZVIA 3VNIA 3O5OA 3I10A 4P7RA 3HV9A 1FJDA 4PBFA 2ZBTA 4GUHA 4LUTB 1TTQA 3QQWA 4HMNA 1SM9A 2QDEA 2H6RA 3V16A 1W54A 1FKDA 1HT6A 4DBWA 5HW6A 4B5WA 3NIYA 1QPLA 1CYGA 2Q01A 2W62A 4J2PA 1DYSA 4YS1A 1WOAA 4UTTC 2FMOA 3T09A 4ZS6A 3EWBX 3H70A 1LORA 4ZFCA 1E40A 4JHZA 1BG9A 3BOFA 3EMQA 1SMAA 3DOPA 3INPA 2ZRWA 4HPNA 5EMYA 2VFGA 2PWFA 2ATMA 4Q8VA 3C86A 4IFRA 2LKNA 4MB1A 4Z0SA 2D73A 2B7OA 3D0CA 1POJA 3N6HA 3KDNA 3KZ7A 2G3MA 5C9UA 3RCYA 3GD6A 3TR9A 2Y7FA 1ZJIA 3H4GA 5BMXA 1P6WA 2XN1A 3IRDA 1ISXA 4M8UA 4GVIA 4YTSA 5AC8A 3QRHA 1EQ3A 7ENLA 3KAFA 2LLEA 1VPYA 2GK1B 4QG9A 1UWIA 4D72A 5AKQA 4U31A 3JR2A 4IQEA 1NAL1 1TPEA 4LY4A 1DIDA 1FH8A 4TVCA 3WZ0E 1BD0A 1N8IA 3N12A 3KOFA 1ZNNA 3HQNA 5I0DA 2WW5A 2PV2A 2A3HA 3H8AA 2A21A 1BYCA 3LHZA 4JNMA 4C5YA 2EG8A 2L5HA 4IG2B 1K70A 4PRWA 3B8TA 2XGBA 4LOCA 2WZEA 4HCLA 1UR1A 1WDQA 4HMCA 3DC8A 4JDBA 1OGGA 3WL0A 4A6GA 5PTDA 1BRLA 3OZOA 2TYSA 4PTNA 1M9HA 4PFHA 5HK4A 3HG3A 4LV9A 1XBZA 1K8XA 3DDMA 4ACZA 3MHUA 2YL6A 1TPDA 2YXOA 3ZT6A 3LN3A 1H63A 2VCCA 4ZPTR 4CN6A 3MSYA 4DXVA 4XD6A 3AJXA 2Q6ZA 4PMXA 5H91A 3UD6A 4BZYA 1TUXA 1WX0A 4IPXA 3Q2DA 3WQFA 1Q13A 4BY3A 1X96A 5FL1A 3IJIA 1F7BA 4IT4A 1FY6A 4LB4A 2WMIB 1PEZA 2ZX5A 2QJMA 2QT3A 2WKJA 4FO4A 5DO2A 4AZGA 5T8GA 2PDJA 1XYZA 1LG2A 1SFLA 4FNUA 1IIGA 2WVVB 1Z9AA 3BLOA 2OSWA 5KITA 3GC2A 1X6UA 2Z27A 4ZR8A 1RQBA 5CBJA 4IX2A 3QHNA 7REQA 7XIMA 5DCBA 1K9TA 3PJXA 4HK6A 2PDXA 1OX6A 4AHQA 4OVXA 1XD1A 5D09A 4NX5A 3ARXA 4M82A 3PUDA 1WDDA 3MKCA 3DH7A 4AC7C 4DBEA 3NO5A 5D9MA 4LALA 1DXIA 4HGXA 2QF8A 4F8XA 2XUCA 4ZOBA 3UG3A 1E1CA 1P48A 3VCRA 3CWOX 2ZWZA 1CLKA 4MKVA 4ZB0A 4EAMA 3CH9A 2J62A 1VJIA 1PBGA 3EBVA 1XSKA 3LLDA 3GBEA 3VFLA 1A5LC 2I17A 1XLBA 5F2IA 4DBDA 1I1WA 3ARQA 1Z41A 4QG6A 3T2OA 3VOFA 1SZNA 5D9OA 4M19A 1BTCA 1TRIA 3GHTA 2QV5A 3WD2A 4UUIA 4S3AA 1CW2A 5B80A 5F4WA 2A3CA 2PRLA 1NTHA 4C6KA 3WUGA 2V67A 4KGLA 4PSPA 5GQBA 4L5ZA 2DFAA 3DG3A 4XZLX 4KGJA 1C8QA 3G6LA 2PF0A 2W66A 3LGGA 5IBXC 4RUBA 4C90A 2ZZ6A 1XRFA 4HD5A 1XV8A 1RALA 4PFMA 1PV8A 2R91A 4GI4A 3KE0A 3BK0A 4OJYA 3MY9A 1GVIA 2XYLA 1YATA 4JAWA 4J1OA 4XUYA 5D04C 3W27A 3LUOA 3IJQA 3S5OA 2ZQTA 1KQZA 4GYPA 4R85A 5DBUA 1FKJA 2GSEA 3VNZA 1VHNA 3WK1A 3BJTA 1DJWA 4MADA 1IEIA 1SYTA 1K7FA 4GXPA 2GGEA 2HK1A 3OLGA 1KCLA