4DWSC

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
539
structure length
526
Chain Sequence
KPTENIPSPILVEDKYTEETYSRPDVNFEDGSQGNLSYTATRVCAPMYNHYVGDKTPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGEIYLKSISEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 184
structure length 526
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsC01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsC02
1EDTA 3A4AA 3ZT6A 1QHOA 1DHKA 1OSEA 2Z1SA 4V28A 1L8NA 1VFFA 4UFKA 3VGGA 4HA1A 3PN8A 3SIMA 3W6MA 2O9PA 2WBKA 1W1TA 2VNCA 3RILA 1NOWA 4BQ3A 2V38A 3F5JA 4LPCA 4WSKA 2VJXA 3WIJA 3CHCA 1GJWA 2J78A 2WC3A 4JFSA 4Z2LA 2O9TA 1MW1A 2VR5A 3BC9A 4WSJA 3ARUA 2FH6A 2GUYA 1KBBA 2W66A 5D8WA 3QR3A 5AC4A 4B3LA 2DSVA 5A2BA 5JUVA 3PTMA 3DHUA 2NSXA 1E3XA 2CBIA 1H0IA 5A6BA 4WJXA 1X6LA 5EB8A 3O9NA 2WKLA 2XYLA 3VDBA 3W27A 2VZTA 3WH8A 4JFVA 1DWAM 5CSYA 3FN9A 3AMLA 2O9OA 7A3HA 1E43A 2V3EA 3VMNA 1ZBCA 1NM9A 5GQBA 4AEEA 1UR4A 2CESA 1ITXA 1JYXA 2E8YA 1LQ0A 4UQAA 4YHGA 1XYFA 3WMCA 4CD4A 2WVVB 4F8XA 3POCA 4W5ZA 1WPCA 3AXXA 4CN6A 1E6ZA 4BS0A 3NYDA 1J12A 1W1VA 3ARTA 4MDPA 2ZUNA 4Z2GA 1HIZA 3L4TA 5GNYA 5A69A 4RE4A 1KFWA 3WDJA 4M29A 1EOKA 1W9XA 1EH9A 2ZWYA 1CGXA 1HN1A 2BVTA 1M03A 2MANA 1NWRA 2XFYA 5I3DA 3AS0A 2X05A 2ZOXA 4AW7A 1HF6A 2WHJA 2G4FA 3U57A 4L4PA 3BMVA 2X8RA 3VPLA 3GBEA 2GSJA 2DGAA 3EDEA 2ZXDA 4FLOA 4PCSA 3POHA 4HU0A 2X0HA 1KR1A 1PX3A 1FP8A 5FIPA 4AD0A 2V3FA 3VINA 3T2OA 1W3JA 2XIIA 1CGWA 3FAXA 2DEPA 4C7GA 1UQZA 4DWSD 4BCEA 3MV11 1A3HA 3DC0A 1V0KA 2VX7A 2W4XA 2VMFA 2VX6A 4AZ6A 4UOJA 1JD7A 1VAHA 1MWOA 1XYZA 1F4HA 2W67A 5I23A 1D2KA 2W5FA 3JUGA 4CN4A 4FLQA 2XFRA 4OBRA 2E9LA 2EEXA 4LGXA 4IPLA 4XZBA 3VIMA 2J7HA 2DIJA 1PIFA 1BYDA 3VIPA 6CGTA 3WF4A 3WD3A 3L4YA 3VIFA 2E40A 3AFBA 3ZJ6A 1BGAA 3PZ9A 3UG3A 4JAWA 5BCAA 2BHUA 5E70A 3LPPA 2YBUA 2GK1A 2YL9A 4UFHA 2E8ZA 5FL1A 4AIOA 2W62A 1JDDA 3WUFA 1CYGA 4ML4A 3AZSA 3PTQA 4GZEA 4P7OA 2XFFA 3VDCA 3WQWA 2WCAA 1V0MA 4H8HA 4KWUA 3W28A 3UEQA 1A47A 4PSRA 1OT2A 4W85A 1LJYA 2VQUA 2WMJA 3SCQA 2WMKA 3GXIA 1K9TA 3WEZA 2FGLA 4ZXOA 2XWDA 1NWUA 1G5AA 3MSDA 3WNMA 1LWHA 4HZ6A 4MB3A 1EHNA 1X1NA 4D1JA 4Z2HA 2OYLA 3EMQA 4A4AA 3AMKA 3AQUA 3GNOA 4ACYA 1PBGA 4UFLA 3OLEA 3EDFA 4UQDA 2IUZA 2A3EA 5FKYA 4AZCB 1MVYA 2WVVA 2W91A 1TR1A 4BF7A 4H8VA 1H3GA 4WKAA 2J77A 3T2QA 3B9DA 2ZX6A 3U5UA 3IAPA 3CZEA 1BQCA 4OIFA 4B15A 4MAVA 1HKIA 3VMOA 3CO4A 3WDPP 1V6UA 2FH8A 2VC9A 1LWJA 4EKJA 3MUIA 4W8BA 2VX5A 3I3DA 3PZOA 5A6MA 2WCSA 3WEOA 4HPHA 4QCFA 4P8UA 1CLVA 1UHVA 4UFIA 5A3HA 1HL9A 2QF8A 1SMDA 4PUDA 3VD7A 5D9OA 1PPIA 3WUEA 2DH3A 2VVSA 1GNXA 5CZKA 1JXJA 1V3HA 1ZJBA 3ZR5A 2GFTA 3WFLA 1JXKA 3WENA 4P7QA 1W91A 2IXUA 4YN5A 2D3LA 2ESCA 5TD4A 1ISYA 1PX4A 2Z1KA 1Q6EA 1JF6A 1GHSA 4J7RA 3PZVA 2WK2A 4HZ7A 1ISXA 2PWDA 5GNZA 5IFTA 4UOQA 3WQ8A 2WSKA 1MFVA 2XG9A 4GZJA 4EE9A 3BLKA 1FH9A 2YDQA 3LPFA 3QHOA 4UQ9A 5IHSA 1US2A 2WCGA 3FHQA 1H09A 2Y24A 3AMDA 3WH7A 4HOXA 4TUFA 1HXJA 4CKQA 3DYMA 1NP0A 3E1F1 3GXMA 1J11A 2VCBA 1W3LA 1NOFA 3AHTA 3NIYA 2EXOA 2Y8VA 4JKKA 3AROA 3PZTA 5LA0A 1TA3B 4Z2IA 5I79A 5EBAA 1I1WA 5ABHA 1AVAA 1TCMA 2WHKA 1HJXA 3SCRA 3VDAA 1XRVA 3VIKA 1FH7A 4M80A 4W8AA 1R7AA 4MB5A 4W7UA 2ZUVA 4UZUA 2VRKA 2C7FA 1UWIA 3VIIA 4H7VA 4HMCA 5ECUA 1CDGA 1CLXA 3EBVA 2QV4A 5DO8A 5AC5A 2OWCA 2WKGA 1QI3A 3RM4A 1UA7A 1VENA 3WKZA 3RIKA 3DECA 3HU7A 4AD4A 2PWEA 4CGTA 4TX8A 1UD5A 4AD2A 4WF7A 2BVYA 1B1YA 5CGMA 2QPUA 4TOQA 1TA3A 1TUXA 3ARSA 1BYAA 1JDAA 2EQDA 3PHAA 1W1YA 2CERA 3CZ8A 4TX6A 3WNNA 3APGA 1BAGA 3VIOA 4GI8A 1BG4A 7TAAA 1CXHA 1HJWA 2QHAA 3NSNA 4BQ5A 1XH2A 5BRPA 3ZJ7A 4W7WA 3W6LA 4JFTA 2VCCA 2J75A 3BXWA 1R85A 4ZXLA 1R87A 5DF0A 1KQYA 2YLAA 3OG2A 1LL7A 3ALFA 1V3IA 1V03A 3WF0A 3KL0A 2AMGA 1OB0A 2YA2A 2VL4A 1LG2A 1B0IA 1E6NA 2F2HA 1HP4A 1KXTA 2FHBA 4CVUA 1M7XA 2VZUA 4IUGA 2GVYA 3T09A 1JI1A 2G41A 4MJ2A 1QBBA 2WSPA 3L4ZA 5FL0A 4D6IA 3CPUA 3CBWA 2X09A 3AZRA 1BG9A 3CLWA 2WW5A 5D9MA 2NW0A 3SUTA 5A6JA 7CGTA 1V0NA 3OLGA 3ARVA 1GVIA 3BMWA 1IT0A 4CU8A 2CHNA 1V6XA 1KBKA 2J74A 3GH7A 1GUVA 5CPSA 4J3WA 5A6SA 1EGZA 3B9EA 1K9DA 1TMQA 4PMQA 3RM8A 3ZMRA 3VNZA 3FNDA 4JIEA 4M82A 5E6ZA 1HX0A 3UCQA 3L4XA 3W4RA 1KCLA 5LA1A 4W88A 5CPTA 2OYMA 3W82A 3VOCA 2DT3A 1BGGA 1VEMA 1B3XA 4EK7A 8CGTA 3CHDA 4J28A 1JGIA 2V3DA 5A94A 1W2VA 1W2PA 2BNJA 4M81A 2GDVA 3VDHA 5CG0A 4AC1X 3OGRA 1JFXA 3N9KA 4L4OA 2CYGA 1ZU8A 1VBUA 1H4PA 5A95A 3TTOA 4J27A 3BAIA 4PCTA 3OZPA 3KL3A 3TOPA 3T0DA 4FK9A 1I75A 4PBGA 4UNIA 1WO2A 4GQQA 1SFSA 5GNXA 1B31A 2YDRA 4J3XA 5M03A 1E1FA 3WEMA 4H8UA 4N42A 3UETA 2CETA 1C7TA 3VGBA 1DP0A 1PZ3A 2WVUA 1J01A 3FXYA 1W9VA 3ARQA 1E0WA 4CD6A 5M17A 5ABFB 1LL6A 3EDJA 2BHYA 4CD5A 3BH4A 2OSYA 4RL3A 1DTUA 1CECA 4PYSA 1H0GA 5HPCA 3LPOA 4AZ5A 3W53A 2ZWZA 1VF8A 4C7DA 2UY3A 1EQPA 2J7BA 3WQ5A 3EMZA 3MSGA 4P8WA 2ZX5A 1K9EA 1WE5A 1GQJA 1PIGA 1IV8A 3AICA 1D7FA 3IANA 3A3HA 4JHZA 1BVZA 1FP9A 2DSWA 3VD5A 4AIUA 3WDRA 2WMFA 1C8XA 3SUVA 4D6CA 3MMUA 1VJSA 1WCGA 2A3CA 2DSZA 4DWSC 3EMCA 3DYOA 1E0VA 1UD4A 2GJXB 2E9BA 4UTFA 1KXQA 1V02A 4R5EA 1G1YA 4XZWA 4CVWA 1CXLA 4PTXA 3N15A 1CNVA 1EOMA 4MPKA 1G0CA 4CUCA 3MMWA 3RM9A 3AXIA 4JZ5A 1GOIA 4U2YA 5D8ZA 2D22A 3W0KA 2WWDA 3ZIZA 1QW9A 6TAAA 1GQIA 5JBFA 1GOKA 3WNKA 3TTQA 5FOOA 3KZSA 4V27A 1E4LA 1R8LA 2XIBA 2X1IA 3WBAA 2YA1A 1V6VA 1E55A 2VURA 5A8MA 3VU2A 1XSKA 4A3YA 2F61A 3NUKA 3AIEA 4AZ7A 3WUGA 1AQMA 5A6AA 3VGFA 3N13A 4PTVA 1W32A 2DH2A 4KRTA 4D72A 3ZT7A 2CEQA 1B9ZA 5E0CA 4GIAA 1XD1A 4EAMA 2UWFA 1WZKA 4H04A 2EPOA 1ECEA 3TONA 4C7FA 4E8DA 4Y7EA 1XV8A 3VUPA 1GQKA 4PRWA 3VD4A 2WANA 5AY7A 5LYRA 1ITCA 4GPNA 3WD0A 3WL0A 1UKSA 3AIBA 2PWGA 1QNRA 4MTVA 1CENA 1PZ2A 1Z32X 3BGAA 1XCXA 1OINA 1BLIA 4DM2A 4IISA 5E6YA 1XHGA 2VZOA 1OGSA 2VQTA 2YL5A 3AS2A 1FHLA 1HKKA 5A8NA 2CKSA 2PB1A 4QCEA 1UR8A 1WAWA 1XD0A 3KE0A 1XC6A 2FGZA 2XM2A 2ZICA 4Z2KA 4JFWA 2BY3A 5A2CA 1Q4NX 5A6KA 3N11A 4U3AA 4E2OA 4ZEPA 3GNRA 3FY1A 4KH2A 4AY1A 2YL6A 4F66A 2VX4A 2JIWA 3DHPA 3BLPX 2VVNA 1JNEA 4P7LA 3ECQA 2VI0A 3A4XA 5I2UA 4HA3A 1ZS2A 5CXPA 1E4NA 1KXHA 2ZUTA 1C90A 5JBEA 1WZMA 2ZXQA 1TFVA 1DWIM 2ZX8A 4WKHA 1UYQA 3RDKA 1QPKA 2JF6A 1WZAA 3RPMA 4HU8A 4GO8A 1V3JA 3L2LA 4GI9A 1ODUA 3WN6A 2WM0A 1OWQA 1E71M 1HJVA 1J0YA 4AYSA 3UR8A 3O6AA 2C0HA 2CBUA 1C7SA 1V08A 2QPSA 4F9DA 2BY1A 3NSXA 1W1PA 3GBDA 4MJ4A 2XVPA 1MW3A 5LA2A 2HISA 1C92A 5BXPA 1EO5A 3GDBA 3W25A 2YBTA 3PZNA 1JZ7A 3AIQA 1H5VA 2ZUUA 2A3HA 3VIGA 3AOFA 1ZJAA 3AYRA 1OGGA 1HKJA 1UWSA 2BY2A 2GJXA 4J3UA 1V3LA 1BHGA 2GJRA 2WZEA 4PMOA 3S2CA 1IZJA 2JEQA 5A8OA 1E4MM 2RGLA 5C70A 2OWXA 1GVYA 1FFQA 3AHZA 1OBAA 2EO7A 3CUJA 4NSBA 3CUFA 1RPKA 3WL1A 2XM1A 4MNMA 3ZO9A 2Q8XA 3NDZA 2G3JA 3CH9A 2X0YA 3VX0A 3A4WA 3D3AA 4DUWA 4CD8A 2VCAA 4MNKA 3CMGA 4HA4A 1CGYA 2F8QA 1MXGA 2Y2WA 5BYWA 1CGVA 2BXYA 3PZGA 2EPNA 4AWEA 1O7AA 1E5JA 4PMYA 3WH9A 1E73M 1CEOA 2EPKX 3BSGA 2O92A 1F4AA 1J18A 3QGVA 1UKQA 3FHAA 1JZ8A 2WWCA 2PWHA 4PMDA 3WQ6A 4PN2A 3M46A 2VR4A 2CPUA 2Y4SA 5AYIA 3GTNA 3OA5A 1E6SM 1UWQA 2VT0A 3UG4A 4DWSB 3FW6A 1UWUA 3VO0A 2YKKA 3CZLA 4F79A 4BQ2A 1Q6GA 1J0ZA 3A6OA 4U3CA 1MW2A 3GZAA 3N04A 4CCDA 2GJPA 1ISVA 2A3BA 2W63A 3W38A 3RJYA 2PI6A 3K8MA 3L2MA 1S46A 4E8CA 3CZKA 3WNOA 1TVNA 3IAQA 4EANA 2QMJA 2D2OA 1WDSA 2ZIDA 5BXTA 4Z2JA 1UH3A 3M7SA 1DWGM 1HJUA 5A6LA 3MUZ1 4QLJA 1KXVA 5KZ6A 1G9HA 5AYBA 2VTFA 1OCQA 1WDPA 4MB4A 4S3KA 3OLIA 4MB1A 4WK9A 3TP4A 1JYNA 1RP8A 4OOUA 1FHDA 4AZIA 1B3ZA 3EDKA 1HVXA 3VX1A 3ARPA 2CBVA 1JNDA 1QVBA 5CGTA 1OM0A 1SYTA 5GPRA 3K46A 2ZXAA 3GXDA 2J62A 1HNYA 4BA0A 3CTTA 1H11A 1E6XM 3NJ3A 4AD1A 4LQ1A 4OKDA 1EQCA 4W93A 3UERA 1UOKA 3AI0A 1SMAA 4D6EA 2E0PA 2V5CA 3MUY1 3SUUA 1BYCA 3K1DA 1M01A 5CSUA 2VRJA 1AQ0A 2OLHA 1J10A 2JF7A 1JZ6A 5EFDA 5BWFA 1UWTA 3QHMA 3L4UA 1BVNP 2WC4A 5I78A 2YOCA 1DEDA 3CGTA 3AIRA 1UD2A 4LYRA 4AEFA 1C93A 1HP5A 4ACZA 1L0PA 4K68A 4JCLA 4B9YA 1FFRA 1JF5A 1E40A 2J4GA 3EDDA 4W8LA 2XSAA 3K8LA 4J3TA 3SCWA 4W89A 2BV9A 3TTSA 3ARYA 2YA0A 5HBFA 2VO5A 5CQ1A 3WDIA 3MU7A 3W24A 3BAXA 1AQHA 4AZBA 2WLZA 1ODZA 4KRUA 4J3SA 3GH5A 2WAGA 4J3VA 1QW8A 3ZSTA 5IXEA 4D6FA 1RH9A 2AOSA 3VVGA 3WY1A 4ZENA 3AZTA 3MV01 3AYSA 1TE1A 3AISA 4UQCA 3L4WA 2CKRA 2GDUA 2HVMA 1U2YA 2NT0A 1QNOA 2J79A 2VUYA 1UA3A 1QNQA 2J7GA 3SCUA 3ARRA 1ZBWA 3NDYA 1JDCA 1GOQA 1VFOA 1V6YA 2XSBA 4Q22A 1JI2A 1E3ZA 5CLTA 4LXFA 3MKKA 2PF0A 3OGVA 4R27A 1J0HA 2E3ZA 3VGEA 3AMCA 1NWSA 1GJUA 1JIBA 3QOMA 2WC7A 1CGTA 1GCYA 5I6SA 1E15A 2WBGA 1G01A 2WVSA 4MDOA 1ISZA 1D3CA 1W3HA 2J7DA 4M1RA 1JAKA 1EDQA 1B3VA 1ZL1A 1UD3A 4YPJA 2J7EA 1KGUA 1CTNA 2D23A 3ARXA 1G94A 2VRQA 1B30A 3ARZA 1NWTA 4KGJA 3GH4A 3SCOA 3WD4A 1WP6A 4BQ4A 3BAYA 4M24A 1EIBA 1GHRA 5IHRA 4CCEA 4B16A 3CHEA 3PTKA 4ZFMA 2BFGA 5A2AA 2XVLA 5HDRA 4MNJA 2PWFA 3AHXA 1QI4A 2EBNA 4KMQA 1PAMA 2RGMA 4GO9A 1E6QM 2ZXBA 5DFAA 4URIA 4NRRA 2DPEA 3I3BA 4RE3A 3GNPA 4N0RA 2WMIA 1QBAA 1Q6DA 2J8GA 1OT1A 1UKTA 4NZCA 1JL8A 4ATWA 3U7BA 2G3IA 3MANA 4KGLA 4MADA 1NQ6A 1CPUA 1LG1A 1UKOA 5D9NA 4PMZA 3G6MA 1HJSA 3ZQ9A 1NOUA 2J8FA 4X9YA 1TZ7A 3CIVA 2WB5A 1J9YA 1DWJM 3HN3A 4CU7A 1GPFA 1W9DM 1B90A 4XB3A 1J0KA 3F5LA 1UD8A 1BYBA 4OJYA 3UR7A 3VIHA 2J47A 2JFEX 3THDA 4W84A 1EXPA 1E5NA 4XUYA 4JCMA 3RCNA 3B9AA 1V6WA 5EFFA 5E09A 1JAEA 3VKKA 5ABFA 3GM8A 4QP0A 1JZ3A 1BFNA 3LPGA 2AAAA 1CZ1A 1WDRA 1LLOA 4UCFA 4X0NA 2YDSA 4AD3A 1VRXA 5BXRA 1UQYA 3RJXA 1KB3A 1VJZA 1LF1A 4A3HA 3WMBA 3PBGA 2WXDM 2BS9A 3WFZA 2JEPA 5E9AA 3IJ9A 4IPNB 4CN1A 1FH8A 2DDXA 4YHEA 1JZ5A 4LYQA 3U5YA 1UKPA 2Y5EA 4JL1A 1WZLA 1QHZA 4U31A 3NCOA 4U5KA 4H41A 5A8PA 1J0IA 3WH6A 1CIUA 4AIEA 1UR9A 9CGTA 4UQBA 3OZOA 1HJQA 4V2XA 5JBDA 1HVQA 1K6AA 1EDGA 5A6BD 3WUBA 4P7RA 3ARWA 1E1EA 3VTRA 3IJ8A 2XUCA 5HNNA 1UZ1A 4GQRA 1H49A 4HOZA 1C8YA 3F5KA 1JFHA 3HMCA 4W86A 3AS1A 1YQ2A 3L4VA 3MUAA 2G3NA 2W92A 2BY0A 1EHAA 1MW0A 4QDMA 1VIWA 3AJ7A 1E6RA 4GZIA 1TG7A 4B3KA 4AMCA 1GORA 1WKYA 3F4VA 5BROA 1QI2A 1JD9A 3WDHA 4D6GA 4RE2A 2XGIA 1KWGA 4ACZB 4MAZA 1R7OA 1B3WA 1QOXA 2WHMA 1PJ9A 5BRQA 1ZBVA 3AHVA 3VGDA 1K9FA 1PEZA 1C3FA 1XCWA 3AXHA 3SEPA 4U5IA 3SCNA 1MXDA 2J7CA 3AMGA 1E9LA 3IK2A 1DWFM 4PUEA 1Q6FA 1TVPA 4QAWA 3OB8A 5C71A 2GK1B 1VFUA 3VM7A 3ZJ8A 2CXGA 5IDIA 3VD9A 2G3MA 3I3EA 4AD5A 5HXMA 1IZKA 4HTYA 4DWSA 4U33A 2WMGA 3WQVA 3HJEA 3LMYA 4PTWA 1DWHM 4OOZA 2JALA 8A3HA 1JYVA 1GZJA 3VD3A 3BCFA 3WNPA 2JE8A 4UFJA 1UH4A 2BHZA 4JHOA 1H1NA 1NH6A 2XGBA 4OZOA 3U7VA 4U2ZA 3SURA 5FD0A 3BCDA 4ATLA 5ABEA 2FHFA 2IXVA 3M07A 1EO7A 2XJ7A 3T2PA 3CUIA 2D0HA 1WB0A 5CLWA 5JIWA 3BAKA 4D1IA 1VB9A 1JZ2A 1VFMA 2DT1A 1V02E 4HP5A 1GOMA 3KEHA 2CITA 5D4YA 2V5DA 2WHLA 3WSUA 4TTUA 2EPMX 4X0VA 2D0FA 3ZSSA 5C8BB 3WD1A 3CMJA 4PSPA 2XWEA 2EPLX 1XH1A 2WMIB 5BXSA 2DT0A 3WQ4A 3PZQA 1UH2A 4FF5A 4GINA 3B8SA 1MQRA 4DM1A 2D1ZA 2YL8A 2DIEA 3A47A 1X6NA 5F7UA 3BAWA 4PMUA 4IM4A 5DEZA 2D3NA 3QHNA 3S6TA 3W81A 4TTGA 1FOBA 2B31A 1R86A 2VZSA 2YLLA 1AMYA 3ZM8A 3CZJA 4NRSA 3RO8A 1V3MA 2PBGA 3MS8A 4F9JA 5CPQA 4P8XA 1GQLA 2V3GA 3SCPA 2XVNA 5HOSA 4WLCA 1WNOA 2CHOA 1P6WA 4D71A 2DT2A 1RD6A 4FLSA 4W87A 3WF2A 2CNCA 4QLKA 3K4DA 3WELA 4QLLA 1MQPA 2DQXA 4PEEA 1XGZA 3DYPA 1ZB5A 1W9UA 3UESA 2WYSA 2FDMA 4BZYA 2YIHA 1VBRA 1O6IA 2J25A 1GONA 4XX6A 2X2YA 2ZUSA 3N17A 2WPGA 3SCSA 4HMDA 1Q6CA 4CD7A 2ZX7A 2EJ1A 3SCTA 3VILA 3TTYA 4LYPA 1PX8A 5IFPA 1MQQA 2ZUWA 1WDQA 1E0XA 1U33A 1U30A 4P7NA 2XVKA 2BXZA 1CXIA 2WVTA 5E0FA 3UG5A 1US3A 1BF2A 3CHFA 4ATDA 3ZJKA 4H2CA 3BSHA 1LL4A 3T0AA 1OGBA 4D6HA 1FA2A 3NSMA 5CJ5A 2UY5A 3W29A 1HKMA 4PMRA 1GOOA 3TA9A 3IJ7A 4CU6A 2WLYA 3RMEA 3AIVA 1KGXA 4Q7NA 3WBEA 4GKLA 3VIJA 4S3JA 4AXNA 2A3AA 2XHYA 3QOKA 3O2LA 1KR0A 1V3KA 4JKLA 3KWXA 5FCZA 2WNWA 5M3WA 2VZVA 3WNLA 1CGUA 1KWKA 4UR9A 1UR2A 5ABGA 5D9PA 3PZUA 2UY4A 4WIWA 4OUEA 2C8NA 3WH5A 4TXEA 3T08A 1H2JA 1W9PA 1OD8A 2BVDA 3D5HA 4W7VA 3PZMA 5HPOA 4E4PA 2TAAA 1XSJA 4GI6A 4WKFA 1KQZA 1MYRA 2XPKA 3ZT5A 3OLDA 1UZ4A 1W3KA 3J7HA 4OBSA 3N1AA 3WF1A 1NARA 3THCA 3ZR6A 4AZCA 1ISWA 4FLRA 3KL5A 3PZIA 3T0BA 3CUGA 4UOZA 1YHTA 2G8ZA 1J0JA 1HT6A 1N82A 5A8QA 4HMEA 1VEOA 4HPGA 4QFUA 4MNLA 1E4IA 1M04A 4AZGA 1CWYA 2E4TA 1W9BM 3WDQA 4NF7A 1BTCA 5I24A 3N18A 4CCCA 3W37A 4JL2A 3FAWA 5EMYA 2ZE0A 1CBGA 1UR1A 4XV0A 4TVDA 4AISA 4GXPA 3VMPA 4LX4A 1C91A 1BSIA 1UUQA 1OIFA 5DMYA 1UR0A 3G6LA 5JH8A 4UZSA 3AS3A 2XTKA 2DSUA 3VM5A 2QLYA 1VEPA 3WMSA 4W5UA 1HL8A 4D6JA 4TVCA 1CXEA 3ZOAA 3AHYA 2JIEA 3W26A 4UFMA 3OGSA 1XH0A 4NI3A 4M56A 4HOWA 3K8KA 5KEZA 2OWWA 3M6DA 2WMHA 3OBAA 1XSIA 1M53A 1OD0A 3SUSA 1OIMA 3GYCA 1KCKA 3ALGA 2ZUMA 4ZE5A 3VGHA 3VNYA 1QNPA 1SR0A 4DUVA 2D20A 3AIUA 2E9MA 1V0LA 5DT5A 3N12A 3SUWA 4JKMA 1UG6A 3II1A 5JIPA 1E56A 5M5DA 4HZ8A 2OSXA 2PC8A 3OIHA 1KGWA 1I1XA 3K4AA 1NP2A 5I5RA 1H41A 1CXFA 1RP9A 4ZE4A 1B2YA 4B9ZA 2CIPA 2J7FA 4PMVA 5A1AA 5DT7A 3SCVA 3EYPA 1EA9C 2UY2A 3BAJA 2CBJA 3CZGA 3WF3A 1UD6A 4FMVA 1B3YA 2WZIA 1QI5A 2DSKA 4PMXA 1CXKA 1E72M 2NT1A 4UQEA 4DUXA 4D6DA 2D24A 5I0DA 3MMDA 1E70M 2PBOA 3GXFA 1JZ4A 3WD2A 4M8UA 2WZHA 2D0GA 1QHPA 3MO4A 4P8VA 1GW1A 2OSWA 2CCRA 2Y8KA 1Y7VA 3AIWA 5I77A 1JG9A 2XVGA 4AZHA 1ZBKA 6A3HA 1E6PA 2YJQA 1JYWA 1ESWA 4TVUA 2O9RA 4JFUA 4PTMA 1C8QA 4PMNA 1QNSA 2QMKA 3CUHA 2VOTA 1BPLB 1MFUA 1QI0A 1UWRA 2FHCA 2ZX9A 1GOWA 2OYKA 2W61A
chains in the Genus database with same CATH superfamily
4ZQMA 3ZT6A 3TZFA 5J6EA 1PTGA 3S6DA 4PL2A 4HA1A 2C6QA 3GPKA 3WQCA 2H3BA 3DU0A 3SIMA 1DXEA 4JPGA 1M1BA 1POJA 3OQEA 3F5JA 4WSKA 1GK8A 3BLLA 5E1QA 2TMDA 4XSMA 1YBQB 3BC9A 4REQA 4WSJA 2GUYA 5D8WA 3QR3A 2PDGA 4GY1A 4LC8A 4B3LA 5A2BA 2D9FA 2ZRZA 4HNCA 4H7CA 3ODKA 3PBMA 3KAOA 4GVFA 1GEQA 4GIRA 4AEOA 4H7ZA 4OE7A 3P84A 4UCGA 4Q8VA 4IIHA 4HU3A 1OABA 2E09A 3C61A 3IIXA 2PPNA 3SJ3A 1VBGA 4DN1A 3VMNA 3NQVA 4AEEA 4BHYA 5LNVA 2E1WA 4WOQA 1D9EA 4O19A 2AL1A 4NI8A 1F9CA 4W5ZA 1CB2A 1WPCA 3AXXA 4CN6A 2XH4A 2R1PA 3S1WA 2PLJA 3ARTA 4F4RA 1F6PA 3T8QA 3B8VA 4L6HA 4RE4A 3WDJA 1RA5A 4JTDA 1EP1A 4M29A 2RUDA 1W9XA 1E9YB 1CGXA 2BVTA 4IF2A 3PBUA 4JX4A 2XFYA 2AQWA 4EAYA 3AS0A 3UF8A 1WX0A 1XKYA 2GSJA 1KRBC 2DGAA 3QH2A 3S5OA 4FLOA 5KZDA 1T96A 4ZB0A 1RK6A 1KR1A 1PX3A 5FIPA 2OX4A 4AD0A 4DBDA 2V3FA 2FZMA 2PN0A 1YDOA 2XIIA 3KADA 2KR7A 2E6YA 2Y88A 3FAXA 2C18A 1S1RA 3LGGA 4DWSD 4EXBA 4BCEA 3QYQA 1QFEA 1A3HA 2QUTA 3DC0A 3NOEA 1FKFA 1V0KA 2VX6A 3B03A 4AZ6A 5JQ9A 1JD7A 4HIBA 1XYZA 1F4HA 2W67A 3FEMA 4ZFCA 2Z1XA 1FWGC 3W1TA 4XZNX 4K37A 1T7LA 2ATMA 3HV8A 2XFRA 4IPLA 3BMXA 3H8AA 4PTDA 4XBJA 2J7HA 2DIJA 5C9RA 3G8EA 4IP7A 3RMJA 3SIZA 6CGTA 4C65A 4EVZA 3WF4A 3L4YA 3AFBA 2P8BA 3JXVA 2XP9A 4GE8A 2BHUA 5E70A 4GH3A 5TF0A 1VHCA 2EPHA 3UZ5A 2PRHA 4AVNA 4ERGA 1VFHA 2HRWA 4IX2A 2GK1A 4PB3A 2CLFA 4UFHA 2E8ZA 5FL1A 2PURA 1I0BA 3IJLA 2W62A 3WUFA 3W9ZA 4ML4A 1TZZA 3E5PA 3LZ3A 1ADSA 2XFFA 3WJZA 1DVJA 1VPYA 3WQWA 4DYEA 4KWUA 1YBQA 1N8IA 3W7QA 1NU5A 1XISA 4W85A 4JYDA 3W2MA 3PG8A 3NNTA 1K9TA 4ZXOA 3FOKA 3LXAA 2G50A 1G5AA 3QFWA 1OK4A 1RY0A 4MB3A 1EHNA 3RCYA 3EMQA 4A8IA 5D30A 4JICA 1VJIA 3WQGA 1W31A 5HKGA 4A2SA 2NQ9A 3VNDA 4IP4A 5FEPA 3KCEA 3SY8A 4GYFA 3ZLFA 1FWIC 3E12A 2IUZA 6XIAA 3NG3A 1TQJA 3NPWA 2GGEA 5LKYA 2H9AA 4HPXA 4HK7A 2BMBA 3QW3A 1H3GA 2J77A 3KBMA 4G9PA 3DX5A 3B9DA 5JXQA 3VZYA 1O66A 1X8CA 1OYCA 4OIFA 3GTFA 3MDUA 4MJZA 5JVLA 2BBFA 1LWIA 4I8YA 2NV2A 1XGDA 3WDPP 2JKPA 3UNTA 2VC9A 1LWJA 3O06A 4UC5A 1KM2A 4G7EB 4IT4A 4DBUA 4FAMA 5LGZA 1CLVA 3L68A 5A3HA 3VNIA 4DRKA 3NDOA 4Q3MA 4PUDA 1W3IA 3WUEA 2VVSA 3LHWA 2FVMA 1V3HA 2GFTA 3OBKA 2KGJA 4IQ2A 1Q7QA 2D3LA 5EMKA 2ESCA 4N4QA 4Z17A 2Z1KA 1LDCA 2MLXA 3VZXA 1TPFA 3GC4A 1KKOA 2WK2A 1ISXA 2PWDA 1VC4A 5CZTA 1OFAA 4XQ6A 2RURA 3QR0A 2B7NA 5HQEA 5IFTA 3OOBA 1FY6A 3W1QA 4BWLC 5HJYA 1ME8A 3MCNA 1DTNA 5I3HA 3BLKA 3WLJA 4UQ9A 1JPIA 3O5IA 1FKJA 1H09A 2OMAA 4NXKA 3FKRA 4ZS6A 1Q4WA 2QNEA 4KETA 4TUFA 4KCTA 1N7KA 3SGZA 1HXJA 2YGYA 3O6YX 4CKQA 3E1F1 5CSRA 3GXMA 1J11A 3W7PA 4OBTA 1W3LA 4XIMA 3AHTA 3IIOA 1WQ5A 2EXOA 2Y8VA 4FA3A 3V4BA 3LUOA 1H7OA 4Z2IA 5I79A 5EBAA 4XSLA 1I1WA 1ZP4A 1IXPA 3QF0A 2PBCA 2CC0A 3R0KA 2FZ8A 1K77A 4MB5A 4W7UA 2C7FA 4H7VA 4Q4KA 3FYPA 4J4KA 5CSSA 1CDGA 1AA1B 4I3GA 5DO8A 4UTUA 2C1IA 2WKGA 3UWUA 1UA7A 5AHEA 4WEVX 3WKZA 3RIKA 1MRQA 1G4TA 3M47A 4AD4A 5FJPA 4YVVA 4CGTA 4QJ1A 4AY8A 3STEA 1B1YA 3BPWA 2QPUA 3UGRA 3TK7A 2DFAA 1TA3A 5DN1A 1J96A 1JDAA 2EQDA 3PHAA 3A9IA 4N9BA 2CERA 3CZ8A 3APGA 4S3EA 4GI8A 5HUPA 4OFCA 7TAAA 1PHWA 3NSNA 3A3WA 1XH2A 2POTA 3M0MA 3ZJ7A 5MKGB 4UR8A 4W7WA 1NJJA 1EA0A 4O0QA 3LCLA 3USBA 1GKRA 4GYPA 3PWIA 1K8ZA 4MUZA 2VD9A 4AIBA 4R34A 1A0DA 3KL0A 2YA2A 1HGWA 5HMDA 1LG2A 1EFZA 1E6NA 1HP4A 2GJNA 3O5OA 2FHBA 4Y2WA 2Z2BA 4CVUA 1M7XA 2VZUA 4S3GA 4DBWA 3JW7A 2GVYA 2VUNA 3E5BA 4GUFA 3S2LA 4DJFD 1QBBA 4HSNA 3H2EA 1CI1A 2X09A 2NW0A 1IT8A 4R88A 3OLGA 3BMWA 3N34A 3E0LA 4Q4QA 1QU4A 3GH7A 4G2DA 1WOBA 1GUVA 2VEFA 1DXIA 5A6SA 1EGZA 3ZXWA 4PMQA 3O63A 3RM8A 1NVMA 3VXGA 4M82A 4X63A 5E6ZA 5CZSA 4IIFA 3TOYA 6ENLA 3IS4A 3AC0A 1TV2A 4WSHA 3TIMA 2OYMA 3KDOA 1BGGA 3IGUA 3O07A 1M7PA 4EK7A 3CHDA 3THUA 1JGIA 1D7KA 5GJPA 1W2VA 4PTNA 3HPFA 2DJLA 1EGMA 3OGRA 3QY7A 4L4OA 2ALRA 5A95A 1OFPA 3TTOA 1IEWA 2WNZA 4J27A 3A23A 2VWTA 4PCTA 3MHFA 1AW5A 2DUAA 3T0DA 3G3DA 4FK9A 1I75A 5PTDA 2XN2A 4UNIA 1WO2A 3H55A 3LA4A 3IGHX 1O12A 1FKRA 4N42A 3LHZA 4Y8EA 3UETA 2CETA 2FTYA 1DP0A 1OC7A 1PZ3A 4QE1A 1XLJA 4JY8A 1E0WA 1W9VA 2FFIA 3LENA 1LL6A 3CS2A 3EDJA 2XFWA 2WM1A 3BH4A 3WQOA 2OSYA 1RCXB 1OFDA 2Y70A 1W5PA 4ENLA 3CK5A 1QWGA 1MZHA 3PA7A 2ZWZA 4C7DA 2UY3A 4N9CA 4U86A 1XIFA 3MSGA 1WE5A 1GQJA 1XDMA 1W5NA 1DJHA 3AICA 1D7FA 3I10A 4OHQA 3SBFA 4IGSA 1ME7A 2VEIA 3AALA 4RNJA 1BVZA 3UJ2A 2DSWA 3VD5A 2QVHA 5REQB 1SPQA 2PU1A 3WDRA 3P0WA 4EOUA 3B8DA 4FSAA 2WMFA 1C8XA 4D6CA 1V79A 3DYOA 3WQDA 1YADA 3WLOA 5F2MA 1X7IA 3M5VA 5GPGA 2QZRA 1KXQA 4R5EA 4GFSA 4XZWA 4MPKA 2MF9A 4YCOA 3QV6A 4QM1A 4GXWA 4K8GA 4CUCA 3MMWA 4D8AA 4X61A 3AXIA 3BV4A 1GOIA 2D22A 4ORIA 4P2VA 1W1B1 5AC6A 5JBFA 1GOKA 2PEVA 3WNKA 4PCFA 3LRLA 1E4LA 3GHRA 3FXGA 2DVXA 2VURA 4PMJA 3VU2A 1XSKA 3S8HA 2QUVA 1SR9A 5FF3A 1PZ1A 4L1XA 3FJ6A 3NQGA 5D32A 3TUUA 2X1RA 4D72A 3GLCA 3ZT7A 3GSMA 2CEQA 1XD1A 4EAMA 1XIJA 4Q4OA 3KOXA 2YXXA 2QV5A 4O15A 4Y7EA 1R30A 1FWBC 3ATYA 1GQKA 4HGXA 3VD4A 2WANA 5HR6A 5AY7A 2VN1A 1ITCA 3WD0A 3AIBA 2HS6A 2PWGA 1QNRA 3BGAA 3WCZA 2F6XA 5E6YA 2VZOA 3WO8A 5BOFA 4S23A 2VQTA 2YL5A 3OVRA 1VKFA 2FB3A 4GBUA 2OZTA 5ENLA 3IHZA 2JZVA 1SGJA 3W1PA 4C6BA 1XC6A 3KE0A 3HQNA 4ASTA 3B0PA 3AYVA 4Z2KA 4KERA 3B97A 3N29A 3PRBA 3U9IA 5XIAA 2DUXA 3GNRA 1XI3A 3M0JA 4AY1A 4US5A 2Y89A 3I6RA 2CZDA 3GWQA 4P7LA 2BG5A 2JKAA 3PPCA 1P5QA 3GDKA 5JBEA 1UB3A 2ZXQA 1DWIM 3CO8A 2GDQA 3W1RA 1D8WA 2JBMA 5L6UA 4GI4A 4NHVA 4DAIA 3L2LA 3WN6A 4AHOA 2J8TA 2C0HA 1C7SA 2KZHA 4O4WA 3GAYA 3B9NA 1LT8A 3WBWA 2FYMA 3TWAA 3DI1A 3NSXA 4E2VA 2REQA 3GBDA 3T0CA 3M0XA 4YIWA 2HISA 2HDJA 3FSUA 3GDBA 1T99A 1WAUA 2A3HA 5I3KA 2FKEA 3AYRA 3VZZA 2OGYA 4R85A 1Q3NA 2ALDA 5KSWA 4G50A 1HKJA 1UWSA 3E9AA 1M6JA 1FCVA 1KM3A 2BY2A 2GOUA 4LAWA 2O7QA 2R24A 1IZJA 1I2RA 3O5JA 2FZNA 1M7OA 2XIMA 1E4MM 1TJ1A 3AHZA 3QTGA 1OBAA 1B5TA 3CUJA 4NSBA 4QRNA 3A5VA 2E5CA 4G1KA 3O5GA 4FOUA 3WL1A 1Z48A 5BRBA 3UWZA 1EYWA 1XLMA 2G3JA 3R1ZA 3CH9A 2P3ZA 2HE5A 3CMGA 3IJ6A 4MKVA 5L9FA 2Y2WA 1DKWA 5AC8A 1CGVA 2BXYA 1AL7A 5CH9A 3CQJA 3URQA 2HROA 3NZPA 3TCSA 3CAVA 3SJNA 3NZQA 2DZAA 1F8AB 1CEOA 1NDZA 3BGGA 1F4AA 1OZMA 1P43A 5GJMA 4ODKA 3FHAA 3T40A 1O4UA 1GVSA 2VM8A 1KT1A 3WG6A 2PWHA 4PN2A 3ABOA 3TH6A 4JTLA 3PR2A 3RAOA 3GTNA 3OA5A 2DZVA 3UG4A 4DWSB 1C9DA 1GYMA 1ME9A 3O3RA 1REQA 3NRKA 3LHYA 4O0ZA 4MGGA 1J0ZA 1A3XA 4KPLA 1VPXA 4CCDA 3R8GA 4JS3A 1JNTA 1ISVA 2A3BA 4RNIA 1OF8A 3H2OA 4E8CA 3ITVA 3CZKA 1V7YA 3M43A 1FJDA 3M6YA 4R0XA 3TLQA 1DE5A 3MA8A 4PODA 1G6CA 1UH3A 3W07A 4K6AA 3MUZ1 3VAVA 5HW7A 1H61A 5AYBA 1OCQA 1L1PA 4D2JA 4GZ7A 3QC3A 4MB1A 4AAJA 4RV8A 4M5PA 1D8CA 4N02A 1CT5A 4Z1AA 2CBVA 4BI6A 1Z41A 1JUEA 1W17A 1QVBA 3GZ3A 3T05A 3QY6A 3ANYA 3S5NA 4HNVA 3GXDA 2J62A 1H11A 3NJ3A 1EJSC 3P7YA 4OKDA 1EQCA 7ODCA 3SADA 2RHGA 4LEFA 1SMAA 5C55A 1M01A 5CSUA 1R3YA 2OLHA 4ZPVR 3R0DA 5BWFA 1BVNP 2WC4A 3NM1A 3U2OA 4FX8A 4XAPA 3WLRA 4KF1A 4AHPA 3AIRA 4TX9A 4ACZA 1OCNA 4ML9A 3KLKA 2QDGA 4K68A 3STPA 3FJLA 1JF5A 3FA4A 2J4GA 4OV9A 2P4VA 4W8LA 1YNYA 3K8LA 3FDKA 3TTSA 1FQ0A 3QRHA 5HBFA 4UMCA 2VO5A 5CQ1A 3WDIA 2QJNA 4H00A 3IUHA 2R14A 3GH5A 4Q4RA 5LXEA 3DXIA 2WAGA 1QW8A 4HSOA 1RH9A 2AOSA 3WY1A 3MO7A 3COTA 4UTLA 3CGMA 1ZCOA 3L4WA 1HKWA 3JYMA 4O17A 3KBJA 3TR9A 3BURA 2J7GA 3SCUA 5KTLA 4Q4PA 1ZBWA 1W8GA 3UPWA 1RY8A 2Z1BA 2JGYA 3TJIA 4H9ZA 1V6YA 2PDNA 3O5DA 2XSBA 2BGNE 3KVLA 1E3ZA 3SY1A 1XM3A 1BRLA 3MKKA 2NVCA 1B4KA 4Z0JA 2PPOA 2OQYA 1GJUA 1ROUA 1JIBA 3QOMA 3R6IA 4IHCA 1GCYA 5I6SA 4CNNA 1R46A 3QC0A 2WBGA 1G01A 2WVSA 4MDOA 1SM9A 1D3CA 1V7AA 3W23A 3NO3A 2J7DA 4M1RA 2DY3A 1R2TA 2GVLA 3GG1A 2J7EA 5H6HA 1PUDA 1KGUA 2D23A 2A3LA 3BVJA 1MDRA 3RX4A 1F8IA 3SGGA 1EP3A 1B30A 3GW3A 4C6OA 4BQ4A 4S1FA 1NQKA 4M3PA 2A0NA 1GHRA 1TPEA 2VDIA 2HNEA 5KETA 3MYOA 1P7TA 3VOJA 4MNJA 2PWFA 4Z1BA 4IICA 1F74A 4GO9A 2R1MA 4AXKA 1QPOA 2IKJA 4NJKA 1Q45A 1GPWA 5C0QA 4C1NB 1ZTVA 3I3BA 3UA4A 4A8NA 3GNPA 1A5UA 1Q6DA 2J6VA 3NQCA 5MF5A 1YATA 1OT1A 3IIZA 4HJFA 3U7BA 4H6KA 4KGLA 1PV8A 1UMLA 4OV4A 1LG1A 1HJSA 4AH7A 5CPNA 4ZTYA 1ML1A 3QMRA 4LV9A 1PWLA 1P0EA 3BW3A 1VCFA 3CIVA 4W9TA 1J9YA 5D37A 1DWJM 4QTGA 4I7WA 1W9DM 2F4EA 3WQEA 1AZ2A 4NZ5A 1HW6A 3DH7A 3H21A 1BYBA 3N73A 3NQDA 2WSQA 4IMEA 2JFEX 4JCMA 3RCNA 2E28A 4KR0B 5EFFA 5E09A 3N9SA 1JR1A 2PDKA 4IG2B 3TYDA 1XLGA 4MSPA 3RHGA 1BFNA 1KRCC 4ZB5A 4IFKB 3ZS4A 3VOGA 4DNMA 1WDRA 3N25A 4JN6A 2YXGA 3GG7A 4ICCX 2ON3A 3RJXA 3F03K 1VJZA 3WMBA 4MFEA 3PBGA 2WXDM 3WFZA 2HEJA 2X40A 4IPNB 4CN1A 4O4VA 1FWWA 2ZVRA 1QO5A 2FJUB 2DG4A 4F0RA 4GNVA 1K4HA 2QGHA 4IMCA 4FAPA 2GQ9A 4LAUA 3KP0A 2VGBA 1UC4A 2FKPA 3C2RA 1J0IA 3TN3A 1CIUA 4AIEA 2ITKA 4ONVA 3W1NA 1A3WA 1YDNA 5JBDA 3QV7A 1K6AA 3PUDA 1J2WA 1EDGA 1RV8A 3WUBA 3ITTA 3HGJA 1P48A 3IJ8A 2NUWA 5HNNA 1UZ1A 4WXYA 1H49A 1OCBA 1FKLA 3F5KA 2IKIA 3PS7A 3GTYX 4B5UA 3AS1A 1BXBA 3E0FA 3PNZA 1BQGA 2G3NA 4LFYA 2W92A 1PCWA 1M5YA 1T0OA 1DJNA 2FTPA 4MYAA 1E6RA 1TG7A 3A4JA 3WQPA 1GORA 3F4VA 4O16A 1JD9A 1IGWA 2A85A 2XGIA 1KWGA 4IIBA 2OGJA 3KCLA 4MAZA 2WSYA 5E9XA 1B3WA 1V77A 5BRQA 1ZBVA 4PRTA 4OVXA 2DUZA 1K9FA 4DVOA 3O5RA 3SEPA 4U5IA 2Y85A 3R2GA 1PHQA 2OEKA 4TR9A 1MXDA 2J7CA 3AMGA 3IK2A 4PH6A 3OZYA 2I5GA 4K7VA 1VFUA 3VM7A 3KVJA 5IDIA 1BWKA 3I3EA 3LM3A 4U33A 4ZO9A 4QX4A 1R38A 3CV6A 2Z7GA 4OOZA 4HCHA 4BF9A 4GMEA 1CX9A 3OVQA 2JE8A 2OU4A 1MXSA 4EPEC 4JHOA 1XBYA 1H1NA 3NL5A 4YTSA 1I60A 1NELA 4XZHA 1G4PA 3SURA 1IXNA 4KEZA 3BCDA 3GR4A 3R7MA 4DF2A 2OFJA 1SVDA 2MNTA 4EF9A 3RX3A 2ZE3A 4MSSA 4HBOA 3B8WA 3PJTA 1VFLA 5CLWA 3BAKA 3L5MA 5U7SA 3G1YA 3VDGA 3E2SA 3W00A 3TN4A 4HP5A 4GQGA 1SZGA 1QASA 1AFSA 1R9HA 3GXNA 7ENLA 1RK5A 3S5YA 2WMIB 1PTAA 3WQ4A 1DV7A 1LLWA 4C6EA 3THAA 3DFQA 1X6NA 1OFQA 1SSGA 4PMUA 4IM4A 2JK2A 5DEZA 4F0LA 5HULA 2CZFA 4DZ2A 1D7JA 1LRTA 4C5ZA 5BXJA 1FOBA 1ZLPA 2VZSA 5HNRA 4IIDA 3W87A 3ZM8A 5DBTA 3CZJA 4XVEA 3OEXA 5C9ZA 3G1FA 3MS8A 3RR1A 4HNUA 4AX7A 1Z8AA 5K3VA 2J88A 4XKYA 5HMEA 2AAMA 4D71A 4FLSA 3RLVA 3WF2A 1QPQA 3UI5A 3WELA 2P1FA 1MQPA 1WOAA 4PEEA 1W9UA 2WYSA 1VBRA 1FUYA 1GONA 3I7QA 4PL1A 1KD0A 3MCOA 2FZDA 4NNBA 3S0CA 4MYXA 1Q6CA 4CD7A 2ZX7A 3VILA 3SCTA 3EKZA 3VKJA 4ZO8A 2Q8ZA 1JUKA 3U2EA 1MUCA 4OGZA 1JQXA 1E0XA 3ZVHA 1A4LA 5H91A 2BOEX 1CXIA 1US3A 1W54A 4ATDA 3EGJA 2QJJA 3SW6A 1A5NC 2QW5A 1FA2A 1RJRA 3WK3A 5CJ5A 2UY5A 1XLEA 1VRDA 3ANUA 4GGQA 1P0KA 2OLAA 3IJ7A 3P8JA 3RG6A 3TWBA 3W7HA 1LOSA 2Y7GA 4ZA0A 4PUKA 2Q02A 3UP8A 5DCDA 2FPVA 3M7WA 2R8WA 8TIMA 2IW0A 3O2LA 4ZOCA 4AYGA 3KHJA 1CGUA 2VEKA 5D9PA 1YE4A 3PZUA 4WIWA 1A5SA 1Q8AA 1KM1A 2DZTA 1EX1A 1H2JA 1W9PA 4NVTA 4DZIA 3DKJA 2DZBA 2V5KA 4XKYB 2HXUA 1MYRA 2XPKA 1GEHA 1UZ4A 4S38A 2IPJA 3W1AA 1V6TA 2H8XA 3VKBA 1PYMA 4JY9A 4XAFA 4ZMGA 1AZ1A 3T0BA 3CUGA 4DUOA 1YHTA 4L80A 4UOZA 1HT6A 5LXXA 1N82A 2YFOA 1N1AA 4HPGA 3QJAA 2AKZA 4MNLA 1Y8BA 4XIAA 1M04A 3AUOA 1TWZA 3PF3A 2XP4A 4Y9OA 1LYXA 5DLCA 3UFYA 3V5FA 4BKNA 4LF1A 4Q8MA 4AISA 3R94A 3VMPA 1KLYA 5DMYA 3G6LA 5G4HC 4I9MA 3OU8A 2DSUA 3VM5A 2VGIA 3STFA 4IT1A 1F3EA 2OOFA 2NX3A 4UFMA 3OGSA 1XH0A 2YDAA 4NI3A 3V16A 1FXQA 4HOWA 3CWNA 2PA6A 2OWWA 1OADA 3NQFA 3OBAA 4DRMA 1WBJA 4JTSA 3C2FA 1OIMA 3NPXA 4GNJA 2INFA 3VNYA 4DUVA 1FBAA 2P5NA 2D20A 4Q8NA 2E9MA 2GPTA 3E96A 2PF8A 4JKMA 4GUGA 2QQ6A 3II1A 4KESA 5M5DA 4IQJA 4O28A 7XIMA 3NXFA 3OIHA 3K4AA 1NP2A 2G3FA 1H41A 1CXFA 5I5RA 4B9ZA 5AKQA 2QUNA 2QR6A 3KBVA 1DIOA 1EA9C 1EJVC 3NTYA 3TDBA 2X1TA 3CZGA 1O5QA 3KAGA 1K3UA 4ZQPA 5A5WA 4BI7A 2DSKA 2IMRA 1E72M 3NGJA 2NT1A 3EWXA 3EOUA 2D24A 1L6YA 1E70M 1Y5XA 4O14A 4OQVA 3W2LA 4HNLA 1GW1A 3MO4A 1JG9A 2PDWA 1YXDA 4MWAE 3FJ4A 3F7JA 3QEZA 4A2RA 3H22A 4W9OA 2VOTA 1BPLB 2FHCA 3FK4A 1FCQA 3HFYA 2OYKA 1EDTA 1TIWA 3A4AA 3URBA 1TPB1 2Z1SA 1AH4A 1L8NA 3GFXA 1VFFA 4UFKA 4KFPA 3NGFA 4GD0A 4QS6A 1RBLA 5K2ZA 4LPCA 3LERA 3P60A 3WIJA 3CHCA 1GJWA 3DFPA 1Y5VA 1TCDA 4JFSA 4Z2LA 1D7IA 2CZ5A 1F6KA 5ABTA 3GD6A 2P0OA 1KBBA 2W66A 3SN0A 1K7XA 4LBUA 2ZR4A 4C02B 4GG9A 4LUJA 5AHFA 3HPXA 4C6PA 5ECVA 2QDDA 5A6BA 4QT2A 3CEUA 3NQEA 1X6LA 5EB8A 2WKLA 4O1BA 2QJHA 5AHIA 1O5KA 3JRKA 5FEXA 1WKFA 3WH8A 1YLVA 1DWAM 3H12A 2VWSA 4DH0A 3AMLA 4LNCA 3ZWSA 7A3HA 5AOUA 5G5IA 1RBAA 1N55A 1ZBCA 5GQBA 2NQLA 4YHGA 1XYFA 3WMCA 1TTIA 3K13A 2RFGA 1O5XA 1DPMA 4F8XA 4Q8OA 4U28A 3DFYA 3R43A 2VEPA 4FR6A 3G0UA 4BS0A 1JULA 1W1VA 4MDPA 3B04A 4L6OA 1B3OA 3C52A 1JDFA 1SZNA 1KFWA 5C6MA 4EACA 4YXGA 2RDTA 4JQ1A 5HTGA 4LAMA 3TC5A 2ZWYA 3P5YA 3TE9A 3FJNA 3L5LA 4GFIA 2CLHA 1M03A 1KW1A 3QQWA 1J4IA 4X3ZA 2ZZ4A 2C14A 2ZOXA 3A3XA 2WHJA 3GU9A 1FX6A 2G4FA 3U57A 3N2XA 3O6DA 3DG3A 2X8RA 5LIXX 3HGOA 3EOOA 1ZCCA 2X0HA 5AHLA 1DL3A 3V75A 5AYYA 3BANA 4L9XA 4DXKA 4IQCA 3SDOA 2QAFA 1ONRA 1CGWA 4C7GA 3EXRA 4NG3A 2C91A 1FCBA 1IR1A 3U2CA 3MV11 3KAIA 3LLDA 2PE4A 3ZZ1A 2ZZ6A 4FALA 4IQEA 1MWOA 4JDYA 3EWZA 5I23A 1D2KA 2W5FA 3V1HA 4FLQA 1KBIA 2CLEA 2VFDA 2Z6JA 4LGXA 1XP3A 3VIMA 1U5HA 4DRNA 5G1TA 1JCXA 3C2EA 3PAJA 1PIFA 4XISA 2O4MA 3E38A 2CLOA 4E0CA 2ZA2A 3CQHA 3VIFA 3TSMA 3ZJ6A 1BKFA 4GUIA 3PZ9A 4V15A 4DRPA 3WLIA 2PWVA 4HK5A 3KX6A 3UXDA 4DO4A 2X2GA 4AIOA 1JDDA 1XIBA 3UXIA 2VXNA 4LAXA 1Z69A 1NF0A 1YIXA 4P7OA 1G67A 3W7OA 4BFAA 4GCXA 3WLPA 3VDCA 2WCAA 5HA7A 1TELA 1V0MA 3URNA 3W28A 3UBPC 4FNQA 2ZFAA 3NEVA 1DORA 2D2JA 1ZCNA 1ZQ5A 3B8TA 3H26A 3VFLA 3GXIA 4HJWA 3GU2A 3OW1A 1D3HA 4FZIA 3H7RA 4AC7C 4IQLA 1X1NA 4D1JA 3XIMA 4M7TA 2R1LA 2DIKA 1TV8A 1EWDA 3RF9A 3V5CA 1QRQA 1YDVA 5D2XA 1PBGA 3IRSA 4ACYA 4DNHA 1FKKA 4UFLA 2ANUA 3LTYA 3G0SA 4UQDA 1K02A 4LU0A 4PBFA 4AZCB 3KTXA 4R53A 4WGHA 2EG7A 2TODA 4BF7A 4H8VA 1O94A 1J4HA 2EJAA 1XPGA 3KS6A 3U5UA 5T91A 1SZRA 2IF4A 4NZ4A 4J40A 1HKIA 3V5OA 2QDHA 2FH8A 1Q6UA 3M64A 4KEVA 2Y0FA 3LY0A 4W8BA 3TCEA 5A6MA 5HWBA 4OECA 2WCSA 1ALDA 1YRRA 3OIXA 3WEOA 3TEVA 3DGBA 5G4EA 3EX2A 2IPWA 2QF8A 4RK8A 1LTDA 5D9OA 4Y6GA 5CBBA 1JVWA 4PBEA 4DF1A 3ONBA 3WFLA 1JXKA 3WENA 4IH3A 2JGQA 5EYWA 4YN5A 4QGCA 1D3GA 1PX4A 4CLMA 4WD0A 3DHDA 4WY0A 3ZVHB 4GH1A 4MKNA 1FD9A 4HZ7A 1Y65A 3B9OA 1ZP3A 3KLLA 3CWHA 3HG5A 4ZQNA 4QJ4B 4KCUA 2XG9A 4KQZA 2XIJA 4EE9A 3VE9A 1DHPA 2YDQA 4QSHA 3WH0A 3LPFA 4NJIA 3ANVA 3MUXA 3FHQA 3TQPA 3N14A 5T26A 3AMDA 3A64A 1ZSXA 1JPDX 1LZOA 1GKQA 1NP0A 5AECA 2VCBA 1UUOA 3KW3A 1NOFA 2J13A 3GKAA 3NIYA 5EA9A 3AROA 3PZTA 5XINA 4TV6A 1LT7A 3IK4A 3W71A 1QPRA 1TCMA 5DCEA 2WHKA 4Q4MA 1UOZA 3ITCA 3NA8A 1XRVA 3VDAA 3PUEA 4M80A 4RLIA 1J6PA 4UZUA 2VRKA 3BLEA 3VIIA 1IX5A 4KKXA 1YMYA 3EBVA 5DCBA 2PDCA 3L0KA 3CAKA 2DZSA 1XUZA 5FF2A 1TJPA 1TVLA 1R3VA 4UUIA 1US0A 3DG7A 1TPH1 5H2ZA 1UD5A 4RV3A 4YMZA 3U2ZA 4AD2A 4RCXA 1A50A 2BVWA 4Z08A 4TOQA 4GRSA 4JTFA 1PXGA 1TJ0A 3LHVA 1Z7AA 5DXYA 4K36A 2I5QA 2ZZ1A 1ZAHA 3H2FA 1BG4A 1RJPA 1HJWA 1JUBA 3VNJA 2OODA 2QCDA 4DJDD 4G6CA 1YNQA 2VCCA 3G1DA 1R87A 2X30A 3EB2A 1KQYA 2YLAA 4RJEA 2PLMA 3ALFA 1XRSA 1V3IA 3QN3A 5I03A 3BUVA 4PFMA 4HQVA 2AMGA 1OB0A 5CC7A 2X0SA 5DMLA 1B0IA 4O1EA 3S9ZA 4GIVA 3E0IA 3G8RA 4MPQA 4MJ2A 2WSPA 3L4ZA 1KFCA 4D6IA 3E02A 3CPUA 3SUTA 2YSWA 5F4XA 1BG9A 2WW5A 5D9MA 4D8ZA 2NWRA 3LS9A 7CGTA 1V0NA 9RUBA 1EP2A 1WXYA 1IT0A 2CHNA 1IWAA 4I9AA 4KWOA 1OHLA 4LAOA 2WJFA 1G69A 3L65A 4FXRA 1Y0OA 3W7KA 1NMWA 1XR2A 3P62A 2V2DA 2H90A 4IXXA 1K9DA 4J3ZA 2VGFA 3VNZA 3FNDA 3L4XA 3HGSA 3VE7A 3W4RA 3ITLA 4G7FA 3A22A 3VOCA 3VC6A 1PWMA 1VEMA 3GG8A 8CGTA 3HV9A 2SFPA 4RNHA 4IMDA 3ZWTA 3E3HA 4M81A 4NAEA 3VDHA 1THFD 3O7UA 3N9KA 1VPQA 1VYSX 4EPDC 3F2CA 1H7WA 2CYGA 1ZU8A 1R9YA 3EKGA 4TIMA 3ATZA 1EF3A 3BAIA 4KQNA 1FKHA 2Q09A 4JNYA 2V68A 3OZPA 4UR7A 3TOPA 4E8GA 3O5KA 2F2DA 4PBGA 1YEYA 1SFSA 1B31A 1TREA 3W7RA 3LQLA 1T5AA 1C8VA 3WEMA 4H8UA 3H24A 1UP2A 3VGBA 4A3UA 5F1VA 3PRAA 3T4CA 4CCZA 1A49A 1J01A 1YXCA 3ARQA 4V33A 4CD6A 4EXQA 5ABFB 3W85A 4CD5A 2BHYA 2PDLA 2INEA 3N2MA 1DTUA 1KFJA 1H0GA 4PGLA 2K8IA 4ODNA 4TNSA 4F0SA 4JN8A 1GGOA 1VF8A 4MMWA 4P8WA 3JS3A 4AVFA 4LCQA 3QZ6A 2KE0A 2XH2A 3IANA 4JTRA 4A8RA 4AFYA 2WJZA 3W7CA 3PBYA 2W9MA 2YXOA 2RJGA 3GHUA 4IMGA 1XIIA 1XG3A 3SN4A 4QIUA 3KS5A 3EPNA 2HBXA 3KUMA 4WGXA 1E0VA 1M7JA 3CL6A 2E9BA 1CB7B 3RU6A 1XBXA 4CVWA 3N15A 1CNVA 2PS2A 4GIYA 1QUMA 3L0GA 4C6QA 1G0CA 1M3UA 1GJPA 5I09A 3F1QA 4JZ5A 1Z44A 1BXNA 3LUTA 4U2YA 5I06A 3OYXA 4IT6A 1QPFA 3P80A 4IJCA 2DZUA 3O5LA 1LP6A 6TAAA 1J93A 3VOHA 2RH9A 3TTQA 4DI9A 4LANA 3DUGA 2NXIA 5FOOA 3KTCA 4WHBA 2XIBA 1R8LA 1UBPC 3KRUA 1V6VA 4M6PA 5A8MA 1R2SA 1AQMA 3VGFA 3O0FA 4YTUA 1H1ZA 2VC6A 3IK8A 3BG5A 3UWQA 1I0DA 1RQHA 3XINA 1W26A 4IIGA 5E0CA 1WZKA 4H04A 2ISVA 3DENA 3CPRA 3TJ4A 3TONA 2NQHA 5F2GA 4C7FA 3BL3A 4JYFA 3PJUA 3VUPA 3C2YA 2LJ4A 3EWYA 2PTXA 4MTVA 1PZ2A 2R82A 3ABXA 3AWOA 4RW5A 4ZQCA 3D3FA 1OINA 4M6UA 4DM2A 3E2RA 4ILSA 1KTBA 2HVOA 2OLSA 1FHLA 2NXHA 2ACRA 2PB1A 9XIAA 4G56A 4YLWA 1WAWA 2G0WA 2OELA 4FEZA 5K9DA 4S3AA 3OPSA 3LG3A 3PBWA 3N11A 3GNNA 1ADDA 4E2OA 2PZNA 3RRXA 3QBUA 3FY1A 1X96A 1UZDA 2VX4A 4ZO6A 4LB4A 3YPIA 4FNRA 4HA3A 1C90A 5XIMA 5D38A 1WZMA 1TFVA 4ODMA 3RDKA 1QPKA 3RPMA 4HU8A 3N3MA 4GO8A 5D33A 1V3JA 3BG9A 1R5YA 1OWQA 4JFIA 1DBTA 5E0KA 3O6AA 1S5NA 2GJLA 2M2AA 1L8PA 3IARA 3ITXA 2QT3A 4MJ4A 3FV9A 1EJWC 4Q33A 1FVPA 3ZR4A 3TSBA 5BXPA 2PSNA 3TYBA 3PZNA 4DJEC 3SFKA 1JZ7A 3AIQA 2ZUUA 1W1A1 4O10A 3GR8A 3AOFA 3TAOA 1OGGA 2ZRYA 1B9BA 1S2TA 4HYVA 4K3ZA 2QEZA 4Y90A 1V3LA 1VCVA 2GJRA 2WZEA 4Q6JA 1VQTA 3B3DA 2PUZA 1EJ7L 2OO0A 5LNRA 2Z7KA 3EXSA 3GVRA 2QIIA 2JEQA 2P50A 4N9DA 3UG8A 4NX5A 1U22A 3LN3A 3LNMA 3U8GA 4Q4SA 4DRSA 3PSWA 3CWOX 1I6NA 4XAYA 3N19B 1EEXA 3ZO9A 4HT3A 3TQKA 4LJ3A 3VX0A 2DP3A 4DUWA 2V8ZA 4CD8A 4MG4A 1DJIA 2F8QA 4UTTA 1TJ2A 4AWEA 3MTWA 1O7AA 1MRAA 2VELA 3H2CA 3WH9A 1Q6RA 3KOYA 3VYLA 2EPKX 1RR2A 1AUSL 2QCGA 3CPGA 5EMLA 3O05A 1UKQA 2VD8A 3B40A 4JTAA 1JZ8A 3LXCA 1OX4B 3UU0A 3P2VA 3RLUA 1UWQA 2VT0A 4JOMA 2V63A 3VNMA 1XLDA 2D2GA 3KRZA 1QWKA 2YKKA 3W6YA 4DO7A 4FS9A 3H9RB 4N2YA 2TSYA 1XINA 3WBXA 2P88A 1G7UA 3UWVA 2JQXA 3F2BA 2YW4A 2W63A 4FXJA 2ZQVA 4RX0A 3KACA 3I4EA 2Z26A 3B0XA 1RQBA 4G7EA 3EAUA 1TVNA 4O52A 2NUXA 1E9IA 2J24A 2PDFA 1Q6IA 4HB7A 2D2OA 1WDSA 4XD6A 5A6LA 5JH2A 1XLFA 2MUCA 4QLJA 1VHNA 1G9HA 3W86A 3I6TA 1WDPA 3OLIA 3G1XA 4TYOA 3WK2A 4WK9A 2A7PA 4QZVB 1IEVA 6REQA 2DORA 4W4QA 1F3WA 2IKGA 1B3ZA 4EXAA 2GVGA 4KFNA 1OC6A 1GKPA 5IM51 5BOOA 3K46A 2ZXAA 5T9CE 4LQ1A 1NTHA 1GZGA 3UERA 1RD5A 3B4YA 4GHRA 2PCEA 3BW4A 3AJXA 3HQ1A 4D6EA 2V5CA 3MUY1 3LOTA 1AQ0A 2AKMA 4QNWA 2JF7A 2PTYA 3RN6A 3GFYA 2XGZA 1UWTA 4IPPA 4B2DD 3FSTA 1EPXA 5LNSA 4ITZA 3NM3A 3GUWA 3STGA 1DJYA 2AL2B 3CT2A 4ZOBA 3S83A 2Z0IA 3MWCA 3QLLA 4DXXA 4AEFA 5MHBA 3LXBA 1E40A 2BB0A 4C5YA 3EDDA 4IFOA 2RKXA 3SCWA 4GCAA 4WXZA 4Q8WA 3W24A 3BAXA 4AZBA 4DJFA 2WLZA 3G1RA 3BTNA 1ODZA 4X22A 1FWHC 1XBZA 3T7VA 1VYPX 5I7GA 4GOAA 4J3VA 3UYIA 3VOIA 3NPUA 4R7WA 4JIQA 4D6FA 3VVGA 1NF7A 3MCMA 1EL3A 3DGRA 1EBGA 1VIZA 2GDUA 4WDTA 3W2JA 2NT0A 2DQWA 1L6WA 2J79A 4QE4A 5AZ0A 3TJLA 4PCNA 1SJDA 3TTEA 1LRQA 4UTJA 1D6OA 1ROTA 3PUGA 3A5FA 5HUOA 2WQPA 1JI2A 2W0UA 5CLTA 2Z00A 3ISIX 3OGVA 1J0HA 2VENA 2L2SA 2E3ZA 4Q7BA 3JZUA 3AMCA 3BZGA 3MSYA 5E5CA 3F4NA 4CNUA 1E15A 2HCVA 1SQ7A 1ISZA 1F40A 3UJRA 1OFBA 3H4WA 2Y6ZA 1QXLA 2OQHA 4ROQA 1ZL1A 2BDQA 2DU2A 1UD3A 3DERA 1XL9A 1WKEA 3OOQA 3P5ZA 4R3UA 3D6NA 4ODLA 3Q45A 2RUQA 2FVKA 2HTMA 2C1HA 2Y7FA 4KGJA 3GH4A 3SCOA 3TN6A 3WD4A 1WP6A 3GFZA 3BAYA 1PKMA 5IHRA 1MEWA 3SR7A 3PTKA 4FX6M 3RLHA 1LM1A 1E0UA 3C0SA 3KVMA 4QJ5B 1AD4A 2XVLA 4YCPA 1QI4A 2EBNA 4KMQA 1PAMA 3PSVA 5K4ZA 2RGMA 3PPHA 3L23A 5HW6A 5DRCA 3VK5A 1E6QM 2ZXBA 1NDYA 4URIA 5DFAA 4JIRA 4FIRA 4M7SA 1WYIA 1YXYA 2QGYA 4KCWA 4N0RA 2J6XA 2WMIA 4JN7A 3CNYA 1QBAA 2RQSA 2NLIA 2R6OA 2J8GA 5BU6A 1UKTA 4GISA 2B7PA 1H62A 4JX5A 5DANA 1UKOA 3WLHA 4C91A 4PMZA 4DPQA 4ORMA 4QEEA 1NOUA 1GZ1A 4HZMA 3GDTA 3WLMA 2PTWA 1J0KA 1TWSA 1CCWB 3UNDA 3F5LA 5CJMA 2ETNA 3L7RA 1E5NA 2WZTA 4XUYA 1U1UA 1V6WA 2Q3OA 4QHRA 4L7ZA 3FGCB 1GG0A 3T81A 4ZVJA 3KBWA 3VKKA 1R3WA 5ABFA 1BKSA 2M1IA 1Q2SA 3GC5A 3LPGA 2AAAA 3UD6A 2OO6A 4X0NA 4GVHA 4C6CA 1UQYA 4CQDA 4DX3A 1LF1A 4A3HA 2BODX 1LBMA 4OUIA 1TZ9A 4EPKA 3MJMA 5E9AA 3IJ9A 3LV6A 3UWWA 2GL5A 3VNLA 4LYQA 1P6BA 3PWGA 2WV8A 4RR4A 2Y5EA 4DRJA 5CZ0A 1XKJA 3KOFA 4FNTA 4H41A 3CM4A 4GY0A 1SFJA 3WH6A 3APTA 4QSFA 3OZOA 1HJQA 1Z89A 1HVQA 2O0TA 2PV1A 3GXTA 3KRSA 4ZB2A 3RLGA 3GG0A 2OG9A 1PZ0A 4ICNA 3LCIA 1XBVA 4DO6A 4Y8FA 1RCQA 4IMFA 4ZQRA 4K39A 1KV5A 1EHAA 3LI1A 3QXBA 4GYJA 4QDMA 1VIWA 1TB3A 2IKHA 3U0HA 7PTDA 4OTKA 1F76A 2C13A 1TJRA 3N2TA 3WDHA 4XZLX 4ACZB 3F4WA 5IDZA 3H2MA 1R7OA 5AB3A 2PRMA 2OOGA 2E5BA 3TR2A 3FDGA 3ID7A 3AHVA 3O1NA 1C3FA 4YWIA 4ADUA 3W7GA 1U5JA 3M0ZA 3WLLA 1E9LA 4ROPA 4PUEA 1Q6FA 4UB9A 4QAWA 3OB8A 2Z29A 2GK1B 5CEWA 2CHRA 1FKWA 4C90A 5CBIA 1ONEA 2NUYA 4AD5A 3VD9A 4OT7A 3GUGA 3EEGA 2PU0A 4HTYA 3C3NA 4F2TA 4PTWA 4O1AA 1DJXA 1DWHM 2JALA 3MBDA 4GXMA 2O55A 3BCFA 3BO9A 1NH6A 1N2VA 1LOQA 1OFRA 2HZGA 5CKSA 4OZOA 3U7VA 1X1OA 4ATLA 5ABEA 2FHFA 3M07A 4WZHA 1O5RA 3BE7A 1KKRA 3T2PA 4DWDA 1LORA 3LBOA 4EIVA 2KFWA 4DF0A 2C3ZA 4N7QA 4D1IA 1AH3A 1JZ2A 1RUSA 1VFMA 5C9XA 1V02E 5HWJA 4M51A 4A8LA 1GWJA 3WSUA 4LAKA 4HHPA 3TAKA 2EPMX 3MDWA 2D0FA 4O13A 4X0VA 5C8BB 2FB2A 4GQBA 4JTGA 3NQBA 4PSPA 2Z24A 2EG8A 2QCHA 3PZQA 3T4WA 3RITA 4EF8A 4TV5A 4QE5A 1K8XA 4DM1A 2D1ZA 3RR4A 3O5EA 1MO0A 5F7UA 4E3TA 4RNFA 1ZALA 2UZ5A 3C86A 3AXKA 2LGOA 2XPBA 3FLUA 3RCMA 3FFSA 3RO8A 3LCXA 3MZ2A 3TN5A 4DZAA 5HOSA 5HJXA 1QAPA 1XDJA 4XD3A 3OHIA 2DT2A 4XAGA 1RD6A 2GWNA 2ZC8A 5G4WA 3K4DA 1AODA 4QLLA 2DQXA 4RZ6A 3UESA 1ZJIA 1R3TA 3R0UA 3HJZA 2DV0A 4HBKA 4GY7A 1KRMA 2J25A 3G1VA 2V5LA 3Q4DA 4XX6A 4J5NA 3MKVA 1S2CA 3BARA 3TTYA 1RALA 3C6CA 4QDPA 1EQ3A 1U33A 1XJBA 3JR2A 1U30A 2BXZA 1T41A 3R89A 4O53A 4TO8A 4IIEA 3GVVA 3CHFA 3RU8X 3BSHA 1OGBA 3TXZA 2B0MA 3GU1A 4IOTA 5FEZA 2CWNA 1QK0A 2YW3A 3MI3A 1XWYA 3KCJA 4MY1A 1SJAA 4TQTA 3TA9A 2N87A 3WBEA 5K9XA 4A35A 3LHTA 3DAQA 4NQ1A 5EMUA 4LTSA 4IP5A 4JTUA 4R7JA 2F2KA 3BLIA 2VZVA 1KWKA 4WJEA 1UR2A 4NAEB 1OG0A 3VC5A 3NO1A 7REQB 5D03A 2UY4A 3EY6A 4B92A 4TXEA 3T08A 1TWIA 3PZMA 1SSDA 5IRPA 3KOWA 1VLWA 4GI6A 1JCTA 2ZQTA 3MC5A 3S4TA 4QEHA 1QOQA 1W3KA 3CYVA 2OXNA 3N1AA 3WF1A 1K4GA 1NARA 3KL5A 4F0HA 1S3HA 1Q85A 1ZY9A 1J0JA 5A8QA 4HCDA 4HMEA 3QY8A 4QFUA 4BF8A 5HUAA 4FP1A 3KOZA 3TXVA 2EG6A 4HHHA 3N6JA 1SU5A 1BTCA 4NF7A 3LCHA 4L56A 4MZ8A 3W37A 1VH7A 3FAWA 5EMYA 2ZE0A 4NZ3A 5FJRA 1AJ0A 4TVDA 2Q71A 3NFUA 4GXPA 4J35A 1BSIA 2AQOA 3MZNA 2V67A 4Z1DA 2QLYA 3IVTA 3WMSA 3EB4A 4D6JA 1B54A 4TVCA 1VP5A 3AHYA 3CTLA 4B3ZA 3KZPA 2H3DA 1CW2A 3M6DA 1TRDA 4RDYA 3W83A 1O60A 1XSIA 1M53A 3DG6A 5G1YA 1OD0A 3QM3A 3HG3A 3SUSA 3GYCA 3TV8A 1KCKA 1YNPA 3AU6A 2ZUMA 4RW3A 3EX1A 1NDWA 1H7NA 2ZDSA 4DAFA 2E67A 1OYBA 2V5BA 1YTKA 3SB0A 2POZA 1ICPA 1UG6A 2DZWA 3P61A 2FAPA 4NP7A 1OYAA 3PR9A 1UC5A 2XIQA 1I1XA 1OK6A 3T8LA 1ZJHA 2GQ3A 2J27A 1RP9A 1B2YA 4LUSB 4ZO7A 2CIPA 3HB9A 4LNYA 4XAZA 3LM7A 5AYXA 3DOPA 5TBOA 3SCVA 3EYPA 2A21A 4ODPA 1ECQA 3QZAA 2CBJA 3WF3A 2E77A 4JTTA 1UD6A 4FMVA 1HFBA 5KZMA 3LK6A 2WZIA 1QI5A 4YL2A 4NT0A 1CXKA 4GWEA 3N6HA 5G2WA 3T44A 5LNUA 1RZMA 3UQAA 3NXLA 1VYRA 3W75A 4AMAA 5I0DA 3O6CA 1A7XA 3GIQA 3RGCA 1PIIA 3QPZA 1SFTA 3SAZA 3T78A 4AG0A 1S2AA 4P8VA 2RSEA 1Y7VA 3AIWA 1RQEA 2XVGA 1IQ8A 3AU2A 3N2BA 1ZBKA 2WPBA 1JYWA 3Q58A 2Q5AA 2O9RA 1SJBA 4HYRA 4PTMA 1C8QA 4DQWA 1S2UA 4PMNA 3CUHA 1MFUA 3W3OA 3GY1A 5I3IA 3O0KA 2W61A 3EA1A 1DHKA 1TX2A 4F3HA 4F2BA 2I1OA 5H8MA 1QJWA 2O9PA 3S9IA 1W1TA 2VNCA 3RILA 1NOWA 4BQ3A 2PMQA 2B81A 1J6YA 1QK2A 4HHLA 1XIMA 5JH1A 4PUNA 3GU0A 2O9TA 4F2UA 3PAOA 2VR5A 3PB0A 3ARUA 4KW2A 2OCZA 5AC4A 3W74A 3GTXA 3RPDA 4NAFB 5JUVA 3PTMA 3DHUA 1E3XA 3RX2A 2CBIA 2Q3RA 3EX3A 3O9NA 2WJEA 3M5ZA 3CC1A 3W27A 3O16A 5DITA 4D9PA 2YYTA 3FS2A 4JFVA 1FDJA 5CSYA 4BWLA 2J9XA 2AQVA 1SZFA 2O9OA 3ERPA 4H6EA 4IMAA 5J5RA 4LUTB 3T9PA 5DIUA 1JRCA 1FDYA 1UR4A 2CESA 3G22A 4UDMA 2V69A 4UQAA 3S2MA 2YYUA 1AJ2A 3I4KA 2WVVB 3QQ0A 3EEZA 4O1FA 3QLDA 3V18A 3NYDA 4FPSA 2YZRA 2YZ5A 1XICA 4HTBA 1F73A 2V0TA 2XP8A 2ZUNA 4Z2GA 2NQ5A 5GNYA 1QATA 4Q8UA 4NXSA 3PWAA 2HXTA 2ZTJA 4UTTC 3KBSA 1EH9A 4O1DA 3S2JA 1KM4A 2DJXA 5LIKX 4HSHA 3CH0A 5I3DA 3L0NA 4QNEA 4LUTA 3BMVA 2HSAA 2YCKX 3W7DA 4S3DA 3GHSA 3HMJG 1RLDA 2I16A 4I8DA 3POHA 4HU0A 1UR3M 5DX7A 3UVAA 2CXEA 1DYSA 1FP8A 4Z1CA 4QG9A 1X6UA 2I17A 5KMYA 3REQB 1XYAA 2DEPA 2G5WA 1UQZA 5K4XA 1TPDA 4GK8A 1K7EA 2VFHA 4ZOAA 4DYKA 2IQ0A 4DJEA 4QR6A 3BQ5A 1C9HA 1POKA 2Q6ZA 3BQ6A 4UOJA 2QCFA 3TC3A 1HO4A 3JUGA 4QG6A 1Q8JA 3MMTA 2B7QA 4RDVA 2EHHA 4GYKA 2QCEA 1TMLA 3T42A 1KA9F 3DBPA 4Q32A 4U10A 3H53A 4ZSTA 5BU9A 5D2WA 1T40A 1BGAA 3UG3A 3NL2A 4JAWA 5BCAA 4XBSA 4DLFA 2OQLA 1X39A 2YL9A 3LX9A 1VS1A 1PKNA 2DVUA 5BOEA 5CBJA 2RDXA 1XLBA 2ZBTA 4GZEA 3Q67A 4E4FA 3WBYA 1EUAA 1WDDA 3R25A 4H8HA 2PLKA 2VOMA 1A47A 4PSRA 3CEPA 1OT2A 3LEPA 2VQUA 4FX7A 3SCQA 1TMHA 3THQA 2WMKA 3IVUA 3WEZA 3M44A 2FGLA 1NWUA 1YTDA 1KBLA 4JTQA 3MSDA 4JFMA 1N8WA 3WNMA 1TUFA 4CQ9A 1LWHA 4O18A 3FX4A 4DROA 4Z2HA 2OYLA 3QKZA 4A4AA 1PINA 4UBPC 3TNBA 2V6AA 1J5TA 3AMKA 3PY2A 3C8NA 4HBEA 1X1ZA 4XZMX 1TRIA 1ZAJA 2B5UB 3OBEA 5LIWX 3TC6A 3VKAA 3NQMA 2WVVA 2NVAA 2W91A 5E93A 4Q8PA 1VLIA 3WJYA 1E1CA 4TMCA 4JTCA 5BWAA 4WKAA 1Q6OA 5BMWA 3L66A 3IAPA 4HN4A 3IRDA 3CZEA 4BEQA 2PGEA 1FWEC 3IGXA 3IPWA 2PDYA 4JHMA 3UR5A 3GYEA 4B15A 1HTIA 1NY1A 4QT3A 3HBLA 1S5WA 1J8VA 2WNNA 3CO4A 4L3NA 1V6UA 3CXOA 1BEUA 2ADAA 3I7RA 3KRBA 3MUIA 2VX5A 3I3DA 3PZOA 4PB4A 5CAHA 4HPHA 4QCFA 2GWGA 1UHVA 1KCZA 4UFIA 3BSMA 1AG1O 5LSMA 1HL9A 3UXAA 1PVNA 3VD7A 3NZGA 1PPIA 2DH3A 1GNXA 1Q6QA 5CZKA 1ZJBA 3M0LA 4U84A 4P7QA 1W91A 5TD4A 1ISYA 2NLYA 2H8ZA 2FZ9A 1R47A 3CLMA 1OFEA 3H4XA 5C2CA 1GHSA 3PZVA 2E6FA 1XDLA 3PNUA 1HO1A 2QXWA 4HU4A 5GNZA 3OP2A 1PKLA 4CNPA 2WSKA 1EYMA 2P53A 3BW2A 1MFVA 3EXTA 4GZJA 4O11A 1H7PA 4B91A 1FH9A 3QHOA 5DY2A 3CB3A 5IHSA 5DY3A 1US2A 1XW8A 1KTNA 4KWSA 2Y24A 3WH7A 4HOXA 5LZLA 4QDWA 1FWTA 1OEPA 3DYMA 5FF4A 1WA3A 3AO0A 2EF9A 2YCLB 3CV1A 4HYWA 4JKKA 4WCJA 4TW8A 1R3RA 1TA3B 2GLKA 2WNQA 1JRBA 1XLCA 3NI6A 4GLEA 4HPJA 1XS2A 1K03A 2BGSA 5ABHA 1L2QA 5T9BG 4HARA 4GUHA 3W1MA 3SCRA 1IZCA 2XZ9A 3UJEA 3EOSA 3WZ0E 4GUJA 1R7AA 2ZUVA 1JGMA 3S42A 2WQDA 1BSLA 1UZHA 1JPHA 3TLLA 2OKTA 1YW1A 3MW7A 4GKTA 4UTHA 5HWCA 2OEMA 4ECLA 2OWCA 5AC5A 3BLOA 4UIOA 3PM6A 3V0UA 5HR7A 2NVDA 4ZPTR 3K2GA 3E2QA 3DECA 3FVMA 1F5ZA 1WUEA 1BF6A 2X1SA 4LC6A 1XXXA 2PWEA 4TX8A 3CAQA 3KAHA 2E1DA 4LUIA 4WF7A 4DRIA 2BVYA 4CQ8A 3I6CA 3G1HA 5CGMA 4KIEA 1RVKA 1TUXA 3ARSA 3HQOA 4NNAA 2YBVA 3WNNA 2HWGA 3VIOA 1GTHA 3QR1A 4A05A 2QHAA 1AW1A 1DJWA 1V93A 3LLFA 5AZ1A 4H83A 4DIAA 4JFTA 4XO7A 2J75A 4Q7IA 2Y1HA 4DPPA 5JU6A 1MMFA 4ZXLA 1DIDA 4L1GA 3GK0A 1DJGA 5DF0A 3NAVA 1LL7A 3P81A 2TPSA 1V03A 1E1CB 3OVPA 3DBNA 3DEQA 2ZZ2A 3B8IA 4O12A 2F2HA 1FAPA 4XD4A 1KC7A 3T09A 2GQ8A 1TWWA 5C2GA 1JI1A 2G41A 3BCJA 1OX6A 1R3QA 5FL0A 4UTWA 3CBWA 3CLWA 1EZ2A 1C9WA 3U3HA 3ARVA 5HINA 4GA8A 1KBKA 2KX9A 1O1ZA 1XIGA 2PDMA 1HUVA 4O1CA 4J3WA 4L5ZA 3DDMA 1K8YA 2PCQA 3ZMRA 2PFHA 3MT1A 2VFEA 4JIEA 3CT7A 1XIHA 5FF7A 1HX0A 3UCQA 4JBRA 5LA1A 4KBXA 1W5OA 1MNZA 3CU2A 1B3XA 2I57A 2V3DA 3C0QA 3D46A 5FJJA 3GNDA 1GVRA 2GDVA 4LH8A 2A6LA 4AC1X 4Y9PA 3V36A 4LAZA 1NAL1 1VBUA 2WZMA 3T0TA 4H9TA 5DRIA 4LB3A 5B7ZA 1ELSA 3HQPA 5RUBA 3W02A 3KL3A 4EP8C 2GVJA 2A7NA 4RKAA 4GQQA 5GNXA 2YDRA 3UPBA 1XC4A 4J3XA 3HO8A 4XTDA 1E1FA 1U83A 1C7TA 1FKTA 4HNTA 4NJGA 1J79A 2WVUA 1Q7MA 2Z1VA 3FXYA 1F07A 3N9RA 4H01A 1JPKA 1NSJA 1L6FA 3OVGA 4RL3A 4LRSA 5AHNA 3RGTA 1RA0A 4PYSA 3SRKA 1GTEA 4C6MA 5LIYX 2VP8A 2W27A 5U4NA 5HPCA 3LPOA 3REQA 3G24A 3CHVA 2HMCA 2EGZA 3W53A 3Q94A 3P6LA 4JXCA 1EQPA 4QBXA 1Q1CA 2J7BA 3WQ5A 2E7FA 3W2UA 3GB6A 1PIGA 2IPFA 5K7JA 1F6YA 3A3HA 1GVEA 3NL6A 4AB4A 2KO7A 1J2BA 3M0HA 4IL0A 1SO5A 1FP9A 4QG8A 3MWAA 3C2OA 2HS8A 2G96A 4IJRA 3SUVA 3NO5A 3O5MA 1SW7A 1VJSA 1WCGA 2A3CA 3GXPA 3AWNA 4ZSUA 2EULA 2IQDA 2GJXB 4NY2A 4UTFA 4DYJA 1K70A 4S2BA 3UI4A 1G1YA 1CXLA 1EOMA 1EZWA 1UPPA 3TQVA 1H5YA 2NZLA 3RM9A 3F4CA 3T07A 5LIUX 5D8ZA 1JPMA 2WWDA 3EWCA 3UA3A 3VNKA 1QW9A 1W56A 1GQIA 5HNTA 2VKZG 4Z0SA 3WJSA 4LAYA 3FA5A 4DJFC 3KZSA 4V27A 3TC7A 1I9CB 3GVWA 3LB0A 4UNLA 3OTRA 3PP7A 1U1JA 4A3YA 1P7TB 2YB1A 2I9EA 3FIGA 5A6AA 1W6TA 4YJ5A 2VEMA 3ME3A 4PTVA 2F23A 1W32A 2DH2A 4KRTA 2W3ZA 4DRQA 1B9ZA 1Q6L