4DWSD

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
539
structure length
532
Chain Sequence
PTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDKDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 191
structure length 532
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsD01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsD02
2CBUA 5FL1A 3AS0A 1BF2A 1GJUA 3U7VA 2V3DA 1MFUA 5FKYA 1W3HA 3DYPA 3VO0A 4E8DA 5A6KA 1GQKA 2CBJA 3QOKA 2EPLX 4J7RA 2FHBA 2EO7A 2W4XA 3PZIA 3WF4A 2W62A 4HMDA 3APGA 3WFLA 1UOKA 2ZX7A 4AD0A 7A3HA 3BAJA 3K8KA 4KRUA 2WMIB 2Y8KA 2J7EA 2CXGA 1E43A 2BS9A 1GNXA 2D20A 3N11A 4DUVA 3SURA 5I3DA 4ZEPA 4BCEA 2CKRA 1M53A 4MJ2A 3AS2A 1YQ2A 5BRPA 4UFLA 5JBFA 1GZJA 2J7CA 4B16A 3K46A 3DYOA 3AHZA 1OD8A 4W89A 1LL6A 1DP0A 2WK2A 4CCCA 2DSUA 2BVYA 3SCQA 4GKLA 2CHOA 3TTQA 1J0HA 1C8QA 4TX6A 2RGLA 2FHFA 1ISZA 3QOMA 4MB3A 4P8UA 3BC9A 4BQ2A 3L4VA 1L8NA 4GI9A 2GUYA 2EPMX 2ZUMA 1NM9A 2A3EA 2YA1A 4CD6A 1VBUA 1CBGA 2EJ1A 2YLLA 3BSGA 1G0CA 3GH5A 3UR7A 1HL8A 2NT0A 3KL0A 1V6WA 1E0VA 1RP9A 3B9EA 4AZBA 4U2ZA 4Q7NA 3CZKA 4LYPA 5HPOA 1CWYA 5GNZA 4BA0A 3UERA 1HJVA 3VILA 3ZIZA 3WD2A 4C7GA 3I3DA 3PZQA 1KBBA 1E5JA 3VIOA 3HJEA 4JFTA 1FFQA 1UD8A 3W29A 2QMJA 2VZOA 4J3SA 2OWWA 3RM8A 2VURA 3VTRA 4HA3A 4EKJA 4OIFA 1EQCA 5HDRA 3NDZA 1ISXA 4E2OA 3AQUA 4IPLA 1K9TA 1JZ7A 4H8UA 2XJ7A 3NIYA 3CGTA 4DWSB 1EDTA 1OGBA 2ZX9A 4PTVA 1W9XA 3A3HA 1BGGA 4ACZB 1GUVA 1SR0A 4LYQA 4H04A 3VD3A 4IISA 3O6AA 1BHGA 3EDKA 3WL1A 1BVNP 1E72M 1OBAA 3W6MA 5A8NA 4DUXA 5E09A 3CUHA 3WNNA 3AMKA 4UOJA 2IXVA 4ACZA 3BH4A 4UTFA 3GM8A 3VIFA 3SCUA 2CETA 4CU6A 1JFXA 3CZJA 3VD9A 1WE5A 1X1NA 1DTUA 5EB8A 1XV8A 3VM7A 5CG0A 1AQMA 2J77A 2E4TA 4AZHA 3AS1A 2JIWA 2D3LA 3WDIA 4HOXA 5AC4A 2PF0A 2PB1A 1LG2A 4WKFA 1XC6A 3WEZA 4NI3A 1QVBA 2DH3A 4OKDA 3ZT5A 4MNMA 4HPGA 4UQEA 1VFFA 2CITA 1JF5A 3PZMA 3VVGA 1E9LA 2JEPA 4FLQA 5E6ZA 2D23A 3FHQA 1BPLB 3N1AA 5LA2A 1HL9A 3WDQA 3VDCA 2YBTA 1AQ0A 4LXFA 4JFUA 2BXZA 3AMDA 2OSYA 3AIBA 4BQ5A 3K8MA 1J10A 2YLAA 4PMVA 1F4AA 2BHZA 2DSKA 1VFOA 1E6ZA 2X2YA 5C70A 3BAIA 3B8SA 2GDVA 1XYZA 3F5JA 4A4AA 1UR8A 4RE2A 5DT7A 3TP4A 2WANA 1UUQA 2VVNA 4M82A 5A6BA 4TVDA 1GVYA 2ZWYA 3RO8A 3POHA 2JALA 2VVSA 1UD4A 2VX7A 3MO4A 4X0VA 2V3GA 1EGZA 4UFKA 3W81A 2QF8A 2OSWA 1KR1A 1E3ZA 3WKZA 1E4NA 2E9LA 4AYSA 5BWFA 2XWDA 3AOFA 4KGJA 1XGZA 4QLLA 4PMNA 2VQUA 4MNJA 1NH6A 1E5NA 1ISYA 2VCAA 4D6GA 2VT0A 1DHKA 1MXDA 3BAXA 3CUGA 4MAZA 3WF3A 4PMRA 1OIFA 1UKPA 1ECEA 5FCZA 1V6VA 2ZOXA 2X09A 1CEOA 1KGWA 2E8YA 1SFSA 2EXOA 1JZ5A 3GXDA 1H5VA 4J3XA 5EMYA 1A3HA 1CGUA 4J3TA 1E0XA 4HU8A 2GJRA 1LWHA 1L0PA 3W6LA 2J47A 1VJSA 5BROA 1RD6A 3PTMA 2XWEA 4M8UA 3WN6A 3WFZA 1GW1A 1JI1A 4UQDA 2WAGA 3MSGA 3SCVA 5JBEA 4AZ5A 4V28A 4B15A 1VEMA 2C8NA 3GXIA 1KGUA 1QI2A 5I2UA 2DT0A 3WQWA 3PZ9A 2WVSA 4A3HA 4HTYA 2OYKA 2E9MA 2ZXAA 4QLJA 1OGSA 4H8HA 3DYMA 1EOKA 5BXSA 1PIFA 3KL3A 1KXHA 2XGBA 2EQDA 4ATDA 2DGAA 1DWGM 2GDUA 3T0AA 4ZE5A 5I77A 1JZ8A 2W5FA 5JUVA 2XTKA 5A8OA 4GZIA 2J7FA 5AYBA 2W92A 2XVPA 4MTVA 2X0HA 2XSBA 3W25A 1Q6FA 4GZEA 3N13A 3WNMA 5EBAA 2W91A 3ZJ8A 4UQAA 2OLHA 4IUGA 5E0CA 3NJ3A 4ZENA 1W1YA 3NSMA 4D71A 9CGTA 2ZICA 1JYNA 1QHPA 3AJ7A 1JD7A 2WHMA 3CBWA 3W24A 3RJYA 1MYRA 2CKSA 3I3BA 4JL1A 2J4GA 2UY5A 3VD4A 3AISA 2WCAA 5IFPA 2D3NA 1N82A 3GNPA 4LX4A 3WBAA 1XH2A 3BMWA 2MANA 1LL4A 3M6DA 3I3EA 3VGFA 3GXFA 5IHSA 2ZXBA 3AXHA 4ACYA 5CQ1A 2YDQA 3ARUA 1BG9A 2C0HA 2XIIA 1D3CA 3A4WA 1O7AA 1E1FA 1P6WA 1PX4A 1HJQA 2V5DA 1UKOA 1H0IA 3WD0A 2V3EA 1OWQA 2D0HA 5M3WA 4PMOA 2VRJA 5JH8A 1EDGA 1V6XA 1SYTA 3UG3A 3BAYA 2WSKA 1ZU8A 3W28A 3WD3A 1W9UA 1XCXA 1ZBCA 3W37A 1NOFA 2WLZA 3MS8A 2BNJA 3ARYA 1TE1A 3WDRA 4AC1X 4W85A 4Z2KA 4CU7A 5GQBA 4J28A 1ZJAA 1UH3A 4PRWA 2HISA 2NW0A 3FXYA 3CMJA 2CBVA 3MUAA 3UEQA 3CHCA 1J0KA 2CHNA 1KBKA 4MDPA 1RH9A 1UQYA 2XM2A 1XRVA 4CVUA 4JCMA 2YDRA 3W38A 5HOSA 4W88A 1OD0A 3WEOA 1JYXA 1BGAA 5IDIA 4D72A 4PMXA 1QOXA 1CZ1A 3F4VA 4JHZA 4P7LA 1HJWA 4RE3A 3FAWA 4YN5A 4W8AA 4GO9A 4XX6A 3WNKA 4UFJA 4TVUA 4X9YA 1LWJA 1W1VA 1FH8A 2QHAA 2NT1A 5E9AA 5CLTA 4HOWA 3BMVA 3GZAA 5FOOA 4JCLA 2VMFA 2XPKA 2VNCA 1B3ZA 3BSHA 5CSYA 1K9DA 3OBAA 1E4LA 2F61A 1C8XA 2WYSA 1V0MA 3K1DA 4YHEA 2WZEA 4F9JA 4GQQA 3SCPA 3ARSA 2GJXB 3AHTA 3AIVA 5AC5A 2FDMA 4YHGA 4GIAA 3WUGA 2WM0A 1JYVA 1HKJA 3IJ9A 3MMWA 3BAKA 2O9OA 2VC9A 3GBEA 5CGMA 2BV9A 2WHJA 1E0WA 3T09A 1H41A 1FP8A 2F2HA 4J3UA 3AYSA 1PZ3A 1GJWA 5JIWA 4WJXA 1AQHA 5BYWA 1IZJA 4PCSA 4Y7EA 3WELA 5AY7A 2YA0A 1WZMA 2DPEA 3ZT7A 4H8VA 2BVTA 2YL9A 4CVWA 1UD2A 2ZUNA 5I0DA 1QNPA 3AIEA 3WDJA 4UR9A 2WPGA 4J3VA 1W9VA 3WNPA 4CU8A 1QNSA 4PMDA 4CCDA 1FH7A 1TFVA 2XVKA 1J0IA 5GPRA 4W84A 1UR2A 1XSIA 4YPJA 1PZ2A 3G6MA 1E6NA 4KRTA 4M29A 4WKAA 1OCQA 3QHNA 3RILA 3CZEA 2WC3A 3EDJA 3TTOA 4MNKA 1VIWA 2CNCA 3RMEA 3L4UA 2WWDA 3NYDA 1LG1A 1UZ4A 5IXEA 1LF1A 1DWIM 1RPKA 1JYWA 3KE0A 1OM0A 1FHLA 4GI6A 3VMPA 3WH9A 1JAEA 1EHNA 4PMYA 3WQ6A 4M24A 1UKQA 4GQRA 3VIKA 1UWSA 5DEZA 3THCA 4PTMA 4WSJA 3T2OA 1K9EA 3AIRA 3OGSA 4M1RA 2JEQA 1HVXA 2YOCA 3RCNA 3WMCA 1CGVA 4QDMA 1CGYA 3AIUA 1XD0A 1OT2A 5DO8A 4JKKA 5FL0A 1Y7VA 4DM1A 1GQJA 2OYMA 5LA0A 2BXYA 2EEXA 3AZRA 4DUWA 1GHSA 4D6JA 3ARXA 1E1EA 1TMQA 4PSRA 2YL8A 4TX8A 1E73M 3OLIA 2YA2A 1E15A 5BRQA 5CJ5A 3S6TA 3MU7A 1HX0A 5M5DA 3GYCA 4IPNB 3WY1A 1W3KA 1WO2A 4AD4A 3AXIA 1ZB5A 4HA4A 2AAAA 3LPGA 4HP5A 3VIIA 2WCGA 4LYRA 4D1JA 1WAWA 2J79A 6TAAA 2DQXA 1KWKA 1EXPA 1CLXA 3KZSA 3OG2A 3LPFA 3UETA 2XSAA 4CD7A 4W8BA 4UZUA 2ESCA 4MNLA 1JGIA 2Y5EA 1MVYA 3MSDA 2A3AA 1QI5A 3GTNA 1MW0A 3CPUA 4PMQA 2QV4A 3BLKA 2WC4A 1A47A 3FN9A 2HVMA 2GVYA 1R7AA 2JFEX 2UY3A 1IT0A 1TVPA 1FH9A 1H2JA 1SMDA 3GDBA 2XUCA 1UR9A 1QHZA 4OBRA 2DT3A 4U31A 1HVQA 1R8LA 4E8CA 2GFTA 3AHXA 3GXMA 1X6NA 1R87A 2XVNA 2ZUTA 2PWHA 1CGTA 3L4YA 3QHOA 3SUUA 1NP2A 3PZNA 3SEPA 5CPSA 4QLKA 1ZBKA 1B3XA 1PBGA 4UNIA 2D0GA 1GQLA 1ITXA 3VD5A 1V0NA 4HZ6A 4V2XA 3UR8A 3WENA 3ARPA 1CXFA 1M7XA 3L2MA 1B3YA 2Y8VA 1UWTA 3VPLA 4TXEA 3CHFA 2JF7A 3ZQ9A 3RM9A 3VIHA 1KR0A 3J7HA 1QW9A 3ZSSA 1B30A 2AMGA 3WUFA 1KFWA 1JNEA 3WMBA 4AIEA 5C71A 1BLIA 1V03A 3PZGA 3QGVA 1CDGA 4AZCB 1GHRA 5ABHA 1H3GA 4GINA 1TR1A 1JG9A 3VOCA 1M03A 4QCFA 3CUIA 1VENA 4B9ZA 5A94A 2G3JA 1Z32X 3OB8A 2GK1B 1PAMA 2PWDA 1WZAA 2ZWZA 2E40A 2PWGA 2PWFA 1WB0A 3MKKA 3VD7A 2GJXA 1PEZA 4AD2A 4XV0A 2FH8A 1VF8A 1JFHA 3QR3A 4D6IA 1C8YA 4NF7A 3IAQA 1LQ0A 1NWRA 3BGAA 1CLVA 4PSPA 2G3NA 2WB5A 3KEHA 3WNOA 3THDA 3HMCA 4LPCA 4M80A 1HKMA 4ZE4A 1J12A 2W67A 3CZLA 1FP9A 5D9PA 3WQ4A 3ALGA 3A47A 3IAPA 1CYGA 3WBEA 4UQBA 1TG7A 2VR4A 1CIUA 3AZTA 2C7FA 2GSJA 4OUEA 2J62A 4CUCA 4AWEA 5CXPA 4LQ1A 4XUYA 1UHVA 2VOTA 5I79A 1JDAA 1BSIA 3CH9A 3F5LA 1PIGA 3WUEA 3N17A 1JXKA 5A6BD 1EO7A 4BF7A 2D2OA 2IUZA 1OT1A 1W91A 1E6QM 1SMAA 1R7OA 2W63A 1F4HA 2Y4SA 2DT2A 2E9BA 5A8QA 1WZLA 2WHKA 1OB0A 3VU2A 1VFMA 2D1ZA 4U5IA 4JFWA 1PPIA 4W5ZA 1CECA 4DWSA 3L4XA 2XGIA 4GZJA 5A6JA 2CESA 2WMJA 1G5AA 5E0FA 1KQZA 1E71M 4HU0A 4UFMA 1DWJM 1GOQA 2XVLA 3W27A 3U57A 1VFUA 1H0GA 5HXMA 1KB3A 1KWGA 3ZR6A 3RIKA 4HZ8A 1UD3A 3JUGA 3AXXA 2QMKA 3SUTA 2D22A 3OZPA 4AZIA 4J3WA 1US2A 3EBVA 1UWUA 1BTCA 3FHAA 3VKKA 4AZ6A 1HKKA 2OSXA 3ARVA 1ZS2A 2EPNA 5FIPA 2VX4A 1QI4A 1VEOA 3VUPA 4H2CA 1J0ZA 1UD6A 5EFDA 4XZBA 4D6FA 4PYSA 1BYBA 5BXTA 1UWRA 4OJYA 1UKSA 3PN8A 4B3KA 1Q6DA 4TTGA 1JZ6A 3FNDA 2X05A 4CCEA 3CZGA 4ZXOA 3B9DA 2WVTA 4BQ4A 4NSBA 1BYDA 2CCRA 1YHTA 1GONA 2VCBA 2Y24A 3RDKA 1I1XA 3WH7A 1V6UA 3MUZ1 4M81A 5A2BA 2VZUA 4CN6A 2TAAA 4P7QA 1C92A 1GQIA 4ML4A 1JDCA 2ZIDA 3WUBA 5JIPA 1V02A 2PBOA 2G3MA 5I6SA 2WMKA 6A3HA 1JI2A 5M17A 1ZJBA 2XIBA 3D3AA 1JZ2A 1E6XM 3VMNA 2WKGA 4W87A 4GO8A 3ZJ7A 3CUJA 3MV11 3BAWA 2Z1KA 3AI0A 3IJ8A 1G01A 5A95A 4EE9A 1FHDA 5FD0A 3AMLA 5CPQA 2VJXA 4Z2JA 1CXKA 1VAHA 2QPSA 5JBDA 4UZSA 4U33A 1MQPA 4MB5A 2OWXA 3BXWA 2BY2A 1WNOA 2J78A 3MV01 5A8PA 4D6HA 7CGTA 2ZUUA 5A1AA 3K4DA 4AZCA 1UWIA 1ODZA 2E3ZA 2J7DA 1KCKA 3AHYA 4P8VA 3DECA 1ESWA 1BVZA 3O9NA 1QI0A 2BY3A 1RP8A 4KH2A 3EMQA 3N15A 4BZYA 2WMHA 4DM2A 1JXJA 1TVNA 4MDOA 1J0YA 3WD1A 3SCSA 3TTSA 1QBAA 1TZ7A 2VUYA 4QP0A 5A69A 2DSWA 3PTQA 3U7BA 2A3CA 2WXDM 2WMIA 3ZOAA 1J0JA 4UQ9A 1UYQA 4OZOA 1M01A 2JIEA 3SIMA 3MMDA 2PWEA 4Z2GA 1LL7A 3PZOA 3VIMA 4K68A 3HU7A 3AS3A 3TTYA 4H7VA 3AHVA 2B31A 2FHCA 1W3LA 3VDHA 2WBGA 2XYLA 1NWUA 1W9PA 4Z2HA 4FLRA 3SUVA 1DWAM 3GNOA 1G94A 1MW1A 3K4AA 4CGTA 1GORA 2G41A 5E6YA 4BQ3A 1MQQA 2DIEA 3W82A 1CNVA 4F8XA 2E8ZA 1ZL1A 1GOOA 1HJXA 1J11A 4EANA 3CO4A 1ODUA 3DHUA 4AY1A 1XCWA 1W2PA 1HN1A 1HIZA 3WQ8A 3NCOA 4WLCA 4HPHA 2VR5A 1V3LA 1JZ4A 1OSEA 2WVVB 2WWCA 1JZ3A 2YIHA 3WQ5A 2W66A 3VGHA 2EPOA 1J18A 1XYFA 1BFNA 5HPCA 3GH7A 1H4PA 1U2YA 2O9TA 4J27A 3WF2A 1HP5A 1XSJA 2DSVA 3PZVA 2W61A 5ABFB 2WNWA 5D9MA 1ISVA 3AIWA 2YL6A 4JAWA 1XD1A 3RM4A 1HXJA 5DMYA 1JNDA 5ABEA 2EBNA 3VIGA 1NP0A 3B9AA 3WQVA 2ZX5A 4FF5A 4HMCA 1K6AA 1FA2A 1V3KA 4KWUA 3LPOA 3U5YA 5KEZA 5C8BB 6CGTA 1WDPA 1KXTA 2Z1SA 4HA1A 4EAMA 1DWHM 5D9NA 1NWSA 4P8XA 3SCRA 2CEQA 2VRQA 3ARZA 1K9FA 3OGVA 1V0KA 4GPNA 1AVAA 4WIWA 5D8WA 1QNQA 1UG6A 1PX3A 1H49A 2J7HA 4U3AA 3WH8A 1R86A 3OA5A 1UA7A 1E3XA 2WKLA 3N18A 1GPFA 1C91A 2BY0A 5F7UA 2VZSA 1MFVA 1U33A 4TVCA 1PJ9A 3L2LA 4XB3A 3II1A 3L4TA 4E4PA 4C7FA 5A8MA 1PX8A 4WKHA 3WF1A 2J7GA 1OGGA 3WEMA 2YBUA 4XZWA 1MW3A 3K8LA 4UOZA 5A6MA 4JZ5A 1NQ6A 3M07A 3BLPX 4MJ4A 2A3BA 2ZXQA 1G9HA 1W3JA 3D5HA 4R27A 4QAWA 4W7WA 1AMYA 3AICA 3W26A 5ECUA 3VIPA 1J01A 3SCTA 1V6YA 1VBRA 3A4XA 3VMOA 4FLSA 4AZ7A 4UOQA 1QI3A 3BCFA 4UQCA 4OBSA 2WZHA 4CD8A 1XH0A 2O9PA 3KWXA 4L4OA 3U5UA 5AYIA 2VO5A 4PUDA 2V3FA 1E40A 2BVDA 1BQCA 2CBIA 3MMUA 4N42A 2JF6A 4V27A 4DWSC 1UH2A 1OINA 1WDQA 1TUXA 1UD5A 4UFIA 3PZUA 1S46A 3IK2A 5I24A 5BCAA 1W9DM 1E6PA 2OYLA 2J75A 3VGGA 1C90A 1I1WA 1QHOA 4F66A 2V5CA 5ABFA 1B0IA 4M56A 1B31A 3OIHA 1W1TA 1Q6GA 3CIVA 1EIBA 1EH9A 5CZKA 3VINA 3G6LA 3NSNA 2PBGA 3F5KA 1X6LA 2BY1A 3AMCA 2X0YA 2XG9A 4R5EA 1HJUA 2ZX6A 4AW7A 1QNOA 5A2CA 4L4PA 2WMGA 4MADA 1I75A 1WCGA 2X1IA 3T0BA 3VX0A 3TA9A 1HKIA 3IJ7A 1C3FA 3WMSA 3VGEA 3S2CA 5D4YA 4D1IA 5A3HA 3GH4A 1B3WA 4PUEA 2DSZA 1E55A 4ZXLA 1FFRA 3VIJA 1O6IA 2WCSA 5BXPA 5E70A 3ZO9A 2UY2A 3WNLA 2F8QA 3O2LA 4W5UA 2VQTA 3GNRA 4AEFA 1MXGA 2VZTA 3NDYA 3WDPP 4UFHA 3VX1A 3AFBA 4KMQA 3ZM8A 5DF0A 3VNYA 3QHMA 8CGTA 4W86A 2YKKA 1VB9A 4D6EA 1TA3A 4PN2A 2WSPA 1KXVA 4ATLA 1IV8A 4H41A 1W2VA 4AIOA 5A2AA 1XSKA 1E6RA 1GOWA 2YL5A 1NOUA 3WH6A 2WVVA 4HMEA 3ECQA 4QFUA 3W53A 4AISA 4HOZA 4LGXA 4JKLA 2A3HA 2VRKA 4Q22A 3NSXA 4FMVA 2G3IA 3WH5A 4GXPA 3RPMA 3CHEA 1JIBA 2O9RA 4U2YA 3A6OA 4IM4A 2VZVA 2XM1A 1UA3A 1Q6EA 3AROA 4D6DA 5BXRA 2ZUWA 4Z2LA 1D2KA 3TONA 2J7BA 1V3MA 1ITCA 1KQYA 2GJPA 1CXLA 2UWFA 4WSKA 2DIJA 2XFFA 3ARWA 1DWFM 1US3A 3ALFA 1QNRA 2VL4A 4RE4A 3ZSTA 2DEPA 4C7DA 2WC7A 1M04A 5I5RA 3CTTA 4URIA 2J74A 4JIEA 2QPUA 4QCEA 4ZFMA 3VDBA 1BYCA 3OZOA 4PBGA 4WK9A 3EDFA 3DHPA 2NSXA 5EFFA 3ZMRA 4F79A 3FAXA 3ZJ6A 1QW8A 4AZGA 4S3JA 3ARTA 4ATWA 3T2QA 4PTWA 2VI0A 3AMGA 1J9YA 1MWOA 5M03A 1JD9A 4PCTA 1GCYA 1UQZA 1MW2A 1CGWA 1HF6A 3L4ZA 5GNXA 2WBKA 3WIJA 4JFVA 2UY4A 2FGLA 3VM5A 2D24A 3SCOA 2YJQA 1R85A 1EOMA 4GI8A 1FOBA 3SCWA 3M7SA 2X8RA 8A3HA 1HJSA 2J25A 2FGZA 4DWSD 1VRXA 4W8LA 2GK1A 1EA9C 4WF7A 1HT6A 4P7NA 3N12A 1GVIA 2ZUVA 4MPKA 1W1PA 3MUY1 3UESA 3ZR5A 3POCA 1ZBWA 1IZKA 3ARQA 1LLOA 1V02E 1KCLA 1B3VA 2DDXA 4NRSA 2E0PA 3EMCA 5DFAA 2EPKX 3EMZA 4B9YA 2ZUSA 2J8FA 3NUKA 3FW6A 3LPPA 4CD5A 5HBFA 4MB4A 1BG4A 1JDDA 2XFYA 3SUWA 2G4FA 1XHGA 4A3YA 1VJZA 1JL8A 1LJYA 1WPCA 3AZSA 5CPTA 4EK7A 1KGXA 3HN3A 1UWQA 2VX5A 4D6CA 3CLWA 3VGDA 4JKMA 1CPUA 3ZJKA 1HNYA 3VGBA 3CHDA 3M46A 4AD3A 2WLYA 1B9ZA 4KGLA 2WW5A 2VTFA 3PTKA 2YDSA 5LYRA 3UG4A 2VX6A 4BS0A 1CXIA 1Q4NX 2WZIA 3WD4A 4PMZA 2CYGA 5HNNA 3WF0A 1C93A 1WKYA 5D9OA 5D8ZA 1H1NA 1WP6A 3TOPA 3T08A 1E4MM 1XH1A 3PHAA 3N9KA 4W7UA 4S3KA 4PEEA 3RJXA 1UR4A 2AOSA 2PC8A 1UR0A 3AYRA 5A6LA 1BAGA 3GBDA 1E4IA 4P7OA 2QLYA 5IFTA 2FH6A 2CIPA 2Y2WA 1CENA 3VDAA 4JL2A 2D0FA 4OOUA 2WMFA 3T0DA 3OLEA 3WL0A 1GOMA 4U3CA 1UH4A 1HP4A 3SCNA 5A6SA 4FLOA 1W9BM 5ABGA 2CERA 4Z2IA 3OLGA 3EDEA 1GOIA 1V3HA 1ISWA 2ZE0A 1TCMA 1QBBA 3SUSA 3W0KA 1ZBVA 4RL3A 4W93A 3UG5A 1EO5A 2V38A 3FY1A 1CXEA 5I78A 5TD4A 4MB1A 3W4RA 1E6SM 1OIMA 3DC0A 1WDSA 4HZ7A 3AIQA 2JE8A 2ZX8A 3PZTA 3UCQA 3WSUA 1C7TA 1V3JA 3CMGA 3OLDA 1JF6A 4CD4A 1V08A 3LMYA 4NZCA 1U30A 1QPKA 2G8ZA 1B1YA 3OGRA 5CSUA 3CUFA 3MUIA 1JAKA 4X0NA 2XVGA 4U5KA 5A6AA 2WHLA 1H11A 2PI6A 1B90A 4TUFA 1GOKA 5DT5A 5IHRA 5I23A 4N0RA 3MANA 1C7SA 3WDHA 3CZ8A 1V3IA 2ZXDA 4AEEA 1V0LA 1EDQA 1MQRA 1NOWA 4AD1A 1UR1A 7TAAA 3EYPA 2DH2A 4JFSA 3PBGA 1CTNA 4B3LA 2IXUA 1TA3B 4F9DA 3EDDA 2BFGA 4AMCA 4AXNA 3VNZA 4CN4A 3E1F1 1BYAA 4TTUA 3BCDA 5GNYA 1NWTA 4FK9A 1Q6CA 2CPUA 2WVUA 2Q8XA 1CXHA 1G1YA 1NARA 4OOZA 2DT1A 3L4WA 2J8GA 1DEDA 3T2PA 1E56A 4P8WA 2OWCA 3A4AA 3ARRA 4CN1A 3ZT6A 1B2YA 1UKTA 1WZKA 3KL5A 4P7RA 4PTXA 2O92A 2RGMA 2BHYA 1D7FA 4CKQA 5LA1A 2BHUA 1EHAA 2XFRA 2XHYA 1VEPA 1W32A 4NRRA 1KXQA 4JHOA 1EQPA 5KZ6A 4UCFA 2VCCA 1E70M 3IANA 1CGXA 4MAVA 4PMUA 4AD5A 1H09A 1UZ1A 1WDRA 5CLWA 4AIUA 4W7VA 5CGTA 4TOQA 3N04A
chains in the Genus database with same CATH superfamily
3H8AA 1GJUA 3G5EA 3QZAA 5C9WA 4QG6A 1L6GA 5FKYA 1RXOB 4H6RA 3S5NA 3IGUA 5A6KA 1GQKA 2CBJA 4NHVA 2W62A 3APGA 1NSGA 2Y8KA 5KITA 2J7EA 1E43A 1NJJA 2F23A 3VNIA 5LNWA 1V6TA 4P2VA 3RPTA 4MJ2A 3NOYA 3CL6A 2HPIA 3E5PA 1HFBA 4UFLA 4S39A 5C2XA 3K46A 1QZ2A 1K70A 1OD8A 2PLKA 4W9QA 1KNWA 1V5XA 3RK8A 3TN6A 2CHOA 1J0HA 1GZ1A 3VDGA 1AH0A 1ISZA 3WLIA 4G6CA 3THUA 4MB3A 4P8UA 3L4VA 4GI9A 1XBYA 2P5NA 2EPMX 2A3EA 4LOCA 3GWQA 2OGJA 2CHRA 1OFOA 1G0CA 2XFWA 1HL8A 4GYPC 2NT0A 3KL0A 1VLIA 4NAEA 6XIMA 4LAYA 1A0CA 1E0VA 1PVNA 1P6BA 4U2ZA 5FA5A 2REQB 1BL4A 5HPOA 3WD2A 2VCDA 1KBBA 1E5JA 3HPAA 1I2OA 4IMEA 1FFQA 4JFTA 4JN6A 2F7FA 1XISA 4AY7A 5I7GA 4O13A 4O1CA 4S3AA 3RM8A 3OTRA 3WJZA 4JIPA 2NVAA 2V8ZA 5HDRA 1YNYA 3CQJA 2TPSA 4ERIA 2EULA 2XJ7A 1TUFA 3S2LA 2ZQTA 1BGGA 1XLBA 1SR0A 1LROA 4H04A 1VC4A 4IISA 3PUOA 3GPKA 5HWCA 1EA0A 2Z29A 3BVJA 1E72M 2NLYA 3W6MA 4GIEA 3B8DA 4EF8A 2RQSA 3W7GA 4QDWA 4ACZA 4WVXA 4UTFA 3VIFA 3SCUA 3MVIA 3SN1A 3EOOA 3VC6A 3MTWA 4OHQA 5D09A 3VD9A 2V67A 1XV8A 1XLCA 7XIMA 4HMNA 4NL1A 5CG0A 2F9RA 3TYBA 2DZPA 3HTWA 1T6MA 2V63A 4MY9A 1EJXC 3BW4A 4ZOBA 1IF2A 4EVZA 5HWMA 1MEHA 3R10A 3PFMA 4A8RA 2PF0A 2ABBA 5B80A 3C0LA 3EWUA 4OKDA 4MNMA 3UWQA 3WJXA 4HPGA 3GTYX 1QO5A 4QHRA 4KRZA 3HV9A 3SRDA 3O5PA 3W00A 4DZIA 2FYMA 1JEZA 3PS7A 2JEPA 3VE7A 3ORWA 1P48A 2QJIA 1BPLB 4H19A 3N1AA 4MLRA 1HL9A 3W71A 1ZAHA 4L4LA 3VDCA 1T96A 3AIBA 4MWAB 4XQ6A 2UBPC 3Q4DA 3HGRA 4PMVA 3CO8A 4LAOA 1OFPA 2TSYA 1MDRA 3KCJA 3B8SA 2GDVA 3LGGA 3LLFA 4NAFA 2PLMA 4N9CA 4QNEA 1UR8A 3BLDA 2ZR4A 2AGTA 4V1YA 2VVNA 1LRNA 3IUIA 4LANA 1TREA 3R11A 1GVYA 2ZWYA 2ONEA 2JALA 2G96A 4UFKA 3W81A 1KR1A 2OELA 4GIYA 5XINA 4AYSA 1XDLA 4IQJA 3CC1A 1J5SA 2C16A 3S3GA 4QLLA 4PMNA 5AZ0A 1GVEA 2RJHA 1SZEA 4YYCA 1UUOA 4JEQA 3TXVA 5FCZA 1S2WA 4Z08A 2X09A 1KGWA 3GXPA 4G2DA 2E8YA 3GNNA 2KX9A 3DZ1A 1OX4A 2EXOA 1H5VA 4JQ4A 4LV9A 1MEIA 2NXHA 4J3XA 1Q66A 4FSAA 1OCNA 5EMYA 1R9YA 1A3HA 4O8AA 5LHFA 2WQPA 2PRHA 4FXFA 2H6RA 1VFLA 4KIEA 4A05A 2OG9A 2NQHA 1D7IA 3E0VA 2XWEA 1F9CA 4DJFC 4AX6A 2ON3A 3O0KA 3TLQA 1OYBA 1DHPA 1QI2A 1X38A 4L65A 4DO6A 5B8IC 2F6UA 5I2UA 4G50A 2JKEA 4ROQA 2OYKA 1FCUA 3QR1A 4JNMA 2OQLA 3S1WA 4IFKA 4QLJA 1EOKA 1PIFA 1KXHA 3ATZA 2NV9A 2XGBA 2EQDA 5KETA 4ATDA 3S83A 5HQEA 1GW9A 1M7OA 5D75A 1V51A 1X97A 1FRBA 2XTKA 2C6QA 5AYBA 4JX5A 2XVPA 3B0XA 4IUGA 1WOAA 1XUUA 3IUHA 1QK2A 5F4SA 2R6OA 3T8LA 2ZICA 4NAFB 3AJ7A 1QOPA 2DUAA 1KFKA 3W24A 3CBWA 4ZQNA 3RJYA 3N9SA 2Y7FA 2Z2AA 3B7XA 2XIJA 5AHFA 2DW7A 3NAVA 2J4GA 2UY5A 4HU3A 4GKTA 3AISA 2D3NA 1N82A 3GNPA 3W7NA 2BOEX 2WJEA 2FTPA 1ZPTA 3QBUA 3I6CA 2YDQA 3W75A 3UY7A 4UUIA 3RUBL 1D3CA 1DJZA 1H0IA 1UKOA 3RX3A 1XRFA 2D0HA 4E38A 4AVNA 3UG3A 2YPIA 2SFPA 2AL2A 3W28A 3WD3A 4MJMA 2WNNA 4X63A 2BNJA 1KLYA 3ARYA 3OVPA 2H90A 3CV1A 4LWWA 2REQA 4GVFA 3A22A 3LYEA 4J28A 4B4FA 2DVXA 2PDHA 3C8NA 2NW0A 5HW8A 3MZ2A 1X96A 1PUDA 2BSLA 1KBKA 4FX8A 4MZ8A 1UQYA 2XM2A 1XRVA 4JCMA 3TJXA 4JFKA 5HOSA 4QITA 3CQ0A 1OD0A 1YDYA 2CZDA 4R9OA 1BGAA 4D72A 3CYJA 3E9AA 1QOXA 4UBPC 1N55A 1LOLA 2ZDRA 4ZTYA 3WNKA 4TVUA 4PL1A 1FCVA 4X9YA 1RBOB 3NFUA 4HOWA 2CLLA 3GZAA 2V30A 3KRZA 4X60A 5I3IA 2CLMA 5EMUA 4JCLA 4I6VA 4XSMA 2A7RA 1B3ZA 4LVDA 1B4KA 1E4LA 3A5VA 1T41A 2PCEA 3TJLA 5BOOA 4YHEA 1P0EA 1VBHA 2WZEA 1ME7A 3SCPA 1O1ZA 2GJXB 4DJEC 2E5DA 2E68A 1JPIA 4KWOA 1VCGA 4H9VA 1WBHA 3BAKA 4RUBA 2O9OA 2WSRA 3TYZA 5E93A 5EPDA 2VC9A 2A0NA 5CGMA 1FXQA 2IQDA 2PDCA 1TWSA 4J3UA 3AYSA 3P67A 1XLHA 3GW0A 3DG7A 3FA5A 5AY7A 3THQA 3TDBA 1TMLA 3M44A 2DPEA 1M5WA 2BVTA 1YEYA 3NVDA 4XISA 1QNPA 3M64A 4CCDA 3KVMA 1YX1A 1L6FA 1SU5A 3P7YA 1AA1B 4F2TA 3BJTA 4AWTA 4HCHA 2R24A 1RZMA 5FJTA 1R3VA 4M29A 3U8GA 4HPJA 3QHNA 2WC3A 5C7VA 3E38A 5HUPA 4LB3A 4FA3A 3NM3A 3RMEA 1QPNA 3L4UA 4O57A 3NYDA 4GUGA 2FQIA 1OM0A 3TYAA 2PTZA 3HG3A 3THCA 4GH3A 1THFD 4K1WA 3AIRA 4H9TA 3OGSA 2P50A 1Y65A 1TCOC 3WMCA 3N2MA 4QDMA 1SFJA 1XD0A 2XPAA 2HZGA 1NY1A 4L5ZA 5DO8A 2WJFA 3H54A 2BXYA 3DGBA 4D9PA 5FSDC 2ZZ2A 3MWAA 4D6JA 1TMQA 1KFCA 1QATA 4I9JA 4QAIA 5BRQA 1IWBA 5J8LA 3SFKA 2HS8A 4YTTA 5M5DA 3UU0A 2OT0A 4RV8A 1VFTA 3HURA 1QWKA 3MCNA 1AW2A 4JIIX 5K2ZA 4FNSA 1W3KA 1ZCNA 5K9XA 1WO2A 3LI0A 3AXIA 1ZB5A 3VIIA 4LYRA 1NDWA 3W01A 1A0DA 1WAWA 4TO8A 4KT2A 2DQXA 3UP8A 2B5UB 5AN7A 1T99A 1IGSA 4HYVA 4WRHA 3MO7A 3WBYA 2QIIA 4RNHA 4MNLA 1PXGA 5I02A 2HCVA 2A3AA 3UZYA 1SJBA 5AVHA 9XIAA 1MW0A 2F2DA 2WC4A 1A47A 1EGVA 3FN9A 1UC4A 3L7RA 3P14A 1KCXA 1R7AA 5SWUA 3LENA 3BICA 5D2YA 4WX2A 1WBJA 1HVQA 1R8LA 2JKAA 3G1FA 1X6NA 5DQPA 4LUTA 2XVNA 1U22A 2ABAA 1CGTA 1C8VA 3W88A 2PTYA 1NP2A 5CPSA 4ODQA 4QLKA 1XLEA 3SM0A 2L2SA 3LEPA 3KUMA 4L6HA 3TLLA 2D0GA 3N19B 2YB1A 3SDOA 4HZ6A 3VC5A 4OU1A 1BVWA 2B81A 5K9CA 3HQOA 3UR8A 3VNMA 1LWIA 2EG6A 1TELA 4BF8A 4AHPA 4EWND 2V69A 1RQHA 2JF7A 3VIHA 1KR0A 1B30A 1DJHA 4HU4A 2VDHA 1V03A 2RDUA 1CDGA 3KAGA 4GRSA 3UR5A 1F3WA 2ZZ7A 4QS6A 1GHRA 5TQLA 2BODX 1O5RA 1TR1A 1IXPA 4F0KA 3CUIA 1VENA 4B9ZA 2G3JA 1Z32X 2AQWA 4PB3A 4YNGA 2PWDA 2ZWZA 5LIXX 2E40A 1S1PA 2PWFA 4HPXA 4NJJA 3FGCB 4CQ8A 1FKHA 4HIBA 1BSLA 3WJSA 2Y7DA 3MYPA 5HATA 3S5YA 3QR3A 5G5IA 2C14A 5DCBA 1LQ0A 3GVGA 2ZQSA 1CLVA 4PSPA 7PTDA 4HHLA 5AHMA 3LUOA 2OKTA 3MKCA 4DBSA 2P8CA 4JNYA 3BJFA 2ISFA 4N4QA 3DFHA 1EX1A 1J12A 4DIAA 3BLFA 3OZMA 3CZLA 1VLWA 1EJVC 3KOFA 3IAPA 3WBEA 1JNTA 2VR4A 1VYRA 5FJIA 4IMAA 4AWEA 3ANYA 4CUCA 1OFBA 4IIDA 5LXXA 1AMKA 3TA6A 3AAMA 4LQ1A 2FGBA 3CH9A 3O5RA 2X41A 2JGYA 1RBLA 3PB2A 4PUUA 4TYOA 3NDOA 2RSEA 2C79A 2D2OA 4PE8A 1VP5A 4X2PA 5CGQA 2PD9A 1SO6A 4GCAA 3CGMA 1WOBA 2Y4SA 4C6NA 3REQB 2DT2A 3PG8A 1SGJA 3LCGA 1KFLA 2UZ9A 3VNDA 4U5IA 4JFWA 1PPIA 4K3ZA 4F0SA 1NDZA 1QTWA 1H51A 1P7TA 5E0FA 1E71M 5I07A 3UJFA 1UASA 1MEWA 2Y63A 4HNNA 4DZAA 1GOQA 3W1QA 3ZR6A 4DVOA 1I2NA 1AH4A 5HUAA 2FVKA 3I4KA 2DY3A 4AG0A 1TO3A 3AU6A 4IP7A 1IT7A 3F2BA 3VKKA 2VFIA 3CWNA 4A2RA 5HNTA 3NXFA 2UV8G 1AL8A 2OSXA 1UMYA 5H8PA 3ARVA 3I7RA 1IXNA 2VX4A 5D04C 3T0CA 2FVMA 3KWSA 1QI4A 3TW9A 1UD6A 4YIWA 1IXOA 3A12A 4XZBA 4PYSA 3QZ6A 3TFCA 4O54A 5L6UA 1UKSA 1PHWA 1PYFA 1Z41A 3FNDA 3KBNA 3TAKA 2WVTA 1YHTA 1GONA 1J6PA 1IHIA 3DI0A 1F6YA 4A29A 4S3CA 1JVNA 3MUZ1 5HULA 4Y9OA 3SJ3A 4H7CA 3G8RA 4CN6A 1C92A 4XTDA 4JGDA 2HJPA 2WMKA 5C0QA 2E1DA 6A3HA 3UWWA 1WA3A 5M17A 4S3GA 4M51A 5DO2A 4Q4SA 3UZ5A 3AI0A 4Y8FA 5A95A 3CAQA 5AZ1A 4DZ2A 5FD0A 3AMLA 2EG8A 3HG5A 4GJ1A 2AMXA 2VJXA 5CPQA 4XIMA 3PR9A 4UZSA 2GOKA 4U33A 3BW3A 3GNDA 4IPJA 2OWXA 4GX9A 2E6FA 1SO5A 3ZS4A 2XDFA 1WNOA 4S3EA 4O50A 4D6HA 3JYMA 1XIHA 7CGTA 2IS7A 4IP5A 5G1YA 3B9OA 3K4DA 4AZCA 1ODZA 1Y0EA 2FB2A 2J7DA 4DF0A 3AHYA 4P8VA 1ESWA 1DQXA 1CX9A 1QI0A 1MXSA 4IIGA 5A6TC 2R1KA 5KMYA 2XP3A 1CT5A 5EMLA 1CB7B 3W2NA 1TVNA 2LLEA 4C6IA 1Q7MA 1YDOA 3GYEA 3WD1A 3SCSA 4J4NA 6REQB 2D2GA 4ZOAA 3O05A 3PTQA 5B7ZA 3AYTA 2WXDM 4ZODA 1Q6LA 2QQ6A 1J0JA 2DZSA 3R0UA 2JIEA 3TK7A 3BOLA 2BASA 3LX9A 3KRSA 4K68A 4RZBA 4U28A 4ICNA 1W5MA 3OZYA 3ONBA 2B31A 2FHCA 1W3LA 2PDBA 3CQKA 3TYUA 3V35A 2XYLA 2HK1A 3I65A 4GYKA 3IACA 1DWAM 3GNOA 1REQA 1G94A 2DZWA 2DJLA 4CGTA 5E6YA 2DIEA 3EB4A 1CNVA 2Z1BA 1D9EA 5BWAA 2F4EA 1F7BA 3FKKA 2D9FA 9XIMA 3Q2DA 1F61A 2GVLA 5BW6A 4AY1A 4DO7A 2I5IA 2PA6A 4R88A 3WQ8A 4HPHA 1OZQA 2VR5A 1OSEA 2WVVB 4JOMA 1Q2RA 4N02A 1TB3A 2GVJA 4IQDA 3RLGA 1XYFA 3CTLA 5FF2A 2XN2A 1EWEA 2XISA 2DSVA 2W61A 2Y0FA 3KHJA 1TPVA 4S3FA 5ABFB 3A13A 5D9MA 3OYXA 1I2PA 3AIWA 2YL6A 1XD1A 5ABEA 1EJTC 1NP0A 5I3FA 2ZX5A 3O7UA 3OP2A 4KEVA 2ZC1A 1V3KA 1R2TA 3U5YA 4MF4A 5KEZA 6CGTA 2MLZA 4EAMA 3DU0A 5D9NA 1NWSA 2CEQA 3FOKA 1K9FA 3GHSA 2X30A 3OBEA 3G24A 1PX3A 1H49A 2J7HA 1EJUC 2RDWA 4XKYB 5LNRA 3NNTA 2BOFX 4YWSA 2QCCA 3LNMA 3DUGA 2CLFA 3DN5A 3BLOA 3VAVA 1PJ9A 4M7TA 4NAEB 2YYUA 1KBJA 4XB3A 2X7WA 4KBXA 2CZ5A 3CV6A 4H4IA 1Y5VA 2I57A 4MKVA 3S6DA 4DPPA 4HYRA 3K8LA 4AWSA 4Y9PA 4LBRA 4E0CA 4UOZA 1OG6A 1NQ6A 4D2JA 1YE6A 2Z2UA 4ITZA 4C6MA 1KTBA 4HJWA 2ZXQA 4MJ4A 4R27A 4ORIA 4H00A 4JD4A 3FDKA 1FXPA 3A4XA 4FLSA 1KFBA 4UOQA 1QI3A 3WLKX 3BCFA 2OEKA 4UQCA 2WZHA 3KWXA 4XAGA 3U2EA 2J9XA 1TRIA 1F05A 4LF1A 3L68A 4MZ1A 2NVCA 2JZVA 3UXLA 1PIIA 5HMEA 2CXEA 3B0PA 4M3PA 3TKFA 4N42A 2PPPA 3UGVA 2BGQA 3L5LA 1SZGA 3NG3A 1TUXA 4GIVA 1UD5A 3QY8A 3IRDA 1LOSA 4ALDA 3IK2A 3BLEA 5I24A 5BCAA 4UTKA 1XYMA 1C90A 4RKAA 4RZ5A 1HXVA 1B31A 3OIHA 5CZKA 3RU8X 3NSNA 1KM5A 2PBGA 3F5KA 2VHLA 1X6LA 3AMCA 2X0YA 1EF2A 3B03A 3GTHA 4XO7A 1E1CB 4R5EA 2ZX6A 3MI2A 4NQ1A 3D46A 1QNOA 4LAKA 1OADA 1BXBA 2QJNA 3GKAA 2XIMA 1EB3A 2ZRYA 1Q7QA 4HKPA 3VX0A 2E5BA 3IJ7A 1N8WA 3VGEA 3GH4A 4PUEA 2DSZA 2BLEA 4LYKA 1XM3A 3VIJA 3W1NA 4QROA 1TPUA 2QCMA 2WCSA 1UBPC 3WNLA 1R9ZA 4W5UA 3GNRA 3IHZA 1I9CB 2H9AB 2IPFA 3NDYA 3KVJA 1N2VA 3HFTA 4UFHA 3AFBA 5DXXA 5DF0A 4BK9A 2A6NA 2CLPA 3UI4A 3NZ1A 1YNQA 4W9TA 3ES8A 3SN0A 1DJGA 4L4MA 3RN6A 1UUMA 4TR9A 2WSPA 1KXVA 4ATLA 4HNOA 1GOWA 1K8YA 3LSCA 4TW7A 1AL7A 2X7VA 4FHAA 3PULA 4LGXA 4WY0A 4L61A 1W5OA 1FWTA 2D2HA 2PWUA 2VYOA 4FMVA 1E9YB 1A50A 2G3IA 2R9RA 4LH8A 3RGTA 3BANA 1TWWA 1TQJA 3C3NA 2VC5A 3R6IA 1Q6HA 3LGEA 4D6DA 5BXRA 1QASA 2G5WA 3GNXA 4JTQA 2J7BA 1GJPA 3RX4A 3TMQA 4ZOCA 4EF9A 2EAWA 1A3WA 2GJPA 1HGYA 3HQ1A 4GQ0A 3N4AA 1JCHB 3H2FA 1JCJA 2XFFA 1US3A 2X1UA 3P5YA 1FWRA 2VL4A 2DG3A 4C7DA 4XZLX 1XLJA 1G4EA 1X8CA 3VAWA 1YXCA 2C1IA 3VDBA 1BYCA 5TNVA 4WK9A 2Q09A 1XW8A 2ZA2A 4AYGA 2V68A 4GXMA 1YW1A 2BG5A 3MC5A 4F79A 3FAXA 3O5KA 4JIQA 5C54A 4IH3A 2VI0A 3PWIA 2VEFA 1J9YA 1HO4A 1GCYA 3LBOA 1MW2A 4KFOA 2FB3A 6ALDA 5I3JA 4WDTA 3WIJA 4JFVA 4S23A 5JU6A 2YW4A 2FGLA 3VM5A 2D24A 2PCQA 5HNRA 1IYXA 3SCWA 1ZQ5A 3P60A 3E0LA 2FPTA 5HT1A 3MKVA 1H60A 3R8HA 4P7NA 2HBXA 3N12A 5AC8A 1UCWA 3LDVA 3NA8A 1Z9AA 3SI9A 2BBFA 1PBKA 1RA0A 3POCA 5FEPA 1ZBWA 3ARQA 1RD5A 1KCLA 4PFHA 1B3VA 2DDXA 3Q37A 2E0PA 5DFAA 4EXAA 3IUDA 4IPXA 3H4GA 1DJYA 5HBFA 4GX8A 4ERAA 3PSWA 2PTDA 2XFYA 3MHFA 3SGUA 4A3YA 4EK7A 1RAKA 1WQ5A 4NXKA 3NPXA 5I09A 4NASA 4HSOA 2VX5A 3HFYA 3T05A 6XIAA 3CLWA 3N73A 2G97A 2QDEA 2VGBA 1A5SA 4BFAA 3M46A 2WLYA 1SJCA 1B9ZA 5E0KA 1FKSA 1Z3NA 5K4XA 3NL6A 3GQYA 5HW6A 3PTKA 4NJHA 1AD4A 3MHGA 1CXIA 4PMZA 3V1HA 1YPFA 4DRPA 1DE6A 3TOPA 2GGJA 1E4MM 1XH1A 3PHAA 3GHRA 2OO0A 4W7UA 4RNIA 3RJXA 2PC8A 5A6LA 3W23A 4C1NA 5AYXA 4C5ZA 1ONRA 5F2MA 1CENA 3VDAA 2ACSA 3EA1A 3T0DA 3OLEA 3WL0A 2A2IA 1I60A 3SGZA 4N9EA 5A6SA 3P80A 3NYZA 1IR1A 1XINA 1TPDA 2GVGA 2R1MA 4UXDA 1Y5WA 3OLGA 3EDEA 1TCMA 3VK5A 4RL3A 2WNQA 2P1FA 1K4HA 1CXEA 4I7UA 3CAWA 4AXKA 1NFBA 3QQWA 3MP3A 3QJAA 1H7OA 3W4RA 3GIYA 5KZEA 1OIMA 3GHTA 4ZO8A 1XXXA 3TUUA 1HZYA 2DZXA 3PZTA 3UCQA 3LZ3A 1C7TA 3ODKA 5G4WA 3ABQA 2YCLA 1V08A 3GD6A 3LMYA 2Y70A 2G8ZA 1B1YA 3OGRA 5HA7A 3MUIA 3WBWA 4RCXA 2YW3A 1A5KC 2GGHA 2XVGA 4E2DA 4EPBC 1OK4A 2WHLA 1OX6A 3UWYA 1J4IA 3RLHA 1B90A 2QJMA 3O5GA 2EF9A 1GOKA 3WQPA 3LLXA 3ITXA 3P74A 4ZOEA 4N0RA 3GVRA 4KKXA 3WDHA 5FACA 1V3IA 3U9IA 4AEEA 4HNTA 1BKFA 1B57A 1NOWA 4AD1A 4GNJA 3EYPA 1GRJA 2IMRA 3UZXA 1LLWA 3NZRA 4D8LA 2I7GA 4A21A 4B3LA 3OQ8A 2BFGA 4AMCA 2XP8A 4TTUA 3WX7A 5GNYA 1NWTA 2QCLA 4I7WA 2CPUA 3VYLA 1ADOA 1NARA 4P5UA 1U5VA 3SQMA 3B8WA 4HB7A 5H1WA 4DRSA 1DEDA 3T2PA 2GZXA 1E56A 2OWCA 3A4AA 3ARRA 2IKHA 1W3NA 4UMCA 2QJHA 3AO0A 3KADA 2GJLA 3V16A 3IVSA 3P8JA 3T40A 3T1GA 1DL3A 2DG4A 4CCZA 1EHAA 1LUCB 3S0CA 4NRRA 1EQPA 4UCFA 3NQCA 1Q45A 2ZTKA 5EL1A 1KTCA 3CEPA 4WDUA 2NV1A 2CBUA 2D73A 3AS0A 4DZ3A 4A2SA 1AW1A 1EUNA 1UP3A 2J27A 1W3HA 2PZNA 2VP8A 1D7JA 1OC5A 4FOJA 2EPLX 4AVOA 2W4XA 4NZFA 3PZIA 4IL0A 3WF4A 3WFLA 1XP3A 3GUWA 2ZX7A 2E7FA 4QBXA 4KRUA 2WMIB 1Z7AA 1GKRA 3NPUA 2BS9A 2D20A 2DVUA 4DUVA 1GWJA 4BCEA 2HWGA 2PDMA 2NLIA 4B5TA 4MSSA 2PURA 4B5VA 5CAHA 3M7WA 2J7CA 4B16A 4DJFA 3PA7A 2AKMA 3JYJA 4CQ9A 3O5IA 2AAMA 3SCQA 4GKLA 3OVRA 4RXGA 3PUGA 1C8QA 3FYOA 5EBUA 4TX6A 4ENLA 1FWIC 1TJPA 2RGLA 2FHFA 1I0BA 4ORMA 1VRDA 3T4WA 1FWGC 4WXZA 2GUYA 5CH9A 2YA1A 4CD6A 2YLLA 4O0KA 1PTDA 2QDGA 3EKZA 2CLOA 9RUBA 3RCYA 4LEFA 3S1XA 4LYPA 4XVEA 3IKDA 3UERA 4C7GA 4XTIA 4BY3A 3PZQA 3KBMA 4GNKB 3VIOA 3AWNA 3CNYA 4YCOA 3W29A 3V7PA 1K03A 4YWIA 4HA3A 1VQTA 4OIFA 2QF7A 2W0UA 3UXKA 4GABA 1ISXA 4H8UA 3NIYA 3CGTA 3TROA 2OR2A 1EDTA 4FNUA 1OGBA 5BNKA 1F3TA 4ZPWR 1GUVA 4F4RA 4IX2A 1VH7A 4JTFA 3O6AA 4HSHA 4DH0A 3H9RB 1VS1A 5A8NA 2PD5A 5E09A 2QV5A 4GUHA 4TNSA 2PDNA 1XI3A 4UOJA 2IXVA 1SQ7A 1QFEA 3GM8A 2OLAA 3G8EA 4ML9A 1K4GA 4YS1A 3CZJA 1WE5A 1DTUA 2ISWA 5EB8A 4A3RA 4WHBA 3VM7A 1AQMA 2J77A 4RZ4A 1TYGA 2JIWA 3UCCA 4ZMGA 1XLDA 4AWUA 3WDIA 5C6MA 4HOXA 5AC4A 2O4MA 3NM1A 1JCMP 1EP3A 2PB1A 2YFNA 4WKFA 3KX6A 1XC6A 4MFEA 3MCMA 4X9SA 3BWWA 1NAL1 2VFDA 4KETA 2FFIA 1QVBA 2Q3OA 1E1CA 4EXQA 3ZT5A 3EX4A 1QPOA 3QLLA 2OODA 1S38A 4GE8A 2DU2A 3EX1A 1VFFA 3CEUA 1EEXA 2GJNA 4D8ZA 1JF5A 3RF9A 1T8XA 3PZMA 3UA3A 2ANUA 4FLQA 1ZP4A 3H55A 2D23A 4GY0A 3FHQA 3NOEA 5LA2A 3W7JA 3N9RA 2RDXA 4MPQA 3YPIA 1GTHA 2BXZA 1AK5A 2A85A 2CLHA 1RR2A 1QWGA 4J3ZA 1J10A 2YLAA 1EUAA 3PUEA 5J04A 1F4AA 3EPMA 3ZLGA 4AB4A 2X2YA 5C70A 4ZTXA 1SM9A 4XG1A 4LNYA 3F5JA 2XP4A 4XBJA 4RE2A 3KZ7A 5C9UA 3U0HA 4M82A 3PRAA 5A6BA 4TVDA 2ZCGA 4MYAA 5KSWA 3POHA 2VX7A 3MO4A 4FXJA 1EGZA 3W3OA 2LGOA 1E3ZA 4KCVA 4Q3MA 3EEZA 2XWDA 3URNA 4GIRA 4QR6A 4MNJA 1ISYA 2Z26A 2Y62A 2J13A 4ZQOA 1M68A 3HPZA 4D6GA 2XIOA 1DHKA 3BAXA 3O6CA 4ODOA 1XBVA 1QR7A 4DEFA 1E9IA 1OIFA 1V6VA 3KAHA 1A4MA 3P81A 1JZ5A 3GXDA 1PDYA 2PRLA 2AKZA 3DHFA 3S9ZA 5DBTA 4C1NB 3FXGA 1VJSA 3V4BA 3C86A 3PTMA 1ITQA 3WFZA 1GW1A 4DI8A 3MSGA 5F2IA 1MUCA 4GFIA 2P4VA 5DIVA 2J24A 4V28A 4B15A 2QCGA 1VEMA 2C8NA 3O5FA 2PDGA 3LBMA 2DT0A 3PZ9A 4A3HA 3IIPA 2E9MA 2ZXAA 3UD6A 5BXSA 3KL3A 5DANA 4HARA 3FJ6A 3EB3A 4O19A 3T0AA 3M47A 4LCQA 4QXIA 5I77A 4DAIA 1JZ8A 4KWWA 2NQ9A 1XIMA 1LZOA 1GGOA 3SN4A 3W25A 1Q6FA 4OT7A 4FAPA 2W91A 3ZJ8A 3DAQA 3KRBA 3W73A 3NJ3A 4ZENA 4MSPA 3TWAA 3NSMA 2H8XA 4DBUA 2OJPA 2B4GA 4D71A 3ITGA 1Q85A 1YDNA 2VR2A 2Q8LA 4IG2A 1KV8A 2ZZ3A 2VDGA 3BJSA 4O1DA 5FEXA 4QG8A 4XO6A 2HNEA 4PTDA 2PGFA 1VJIA 4B92A 4K7YA 3R5EA 3W1MA 3EA3A 2XP7A 1FKXA 3S4TA 1WUFA 1JCLA 3M6DA 4H7ZA 2ACRA 3GXFA 2ZXBA 3UJRA 1TKKA 3B40A 2RUDA 4ACYA 4EPDC 3RPDA 3BGGA 1I6NA 3NR0A 4C1KA 3GDTA 1BG9A 1P6WA 1PX4A 3LTYA 2V5DA 2PS2A 4PUJA 3N25A 4NJIA 5H8UA 3HO8A 3L9CA 4FPSA 2CWNA 1SZNA 2PLCA 3BAYA 2WSKA 2FLIA 1W1ZA 3L5AA 4KEZA 1K77A 3MB9A 4L6OA 5FJJA 3MJMA 2WLZA 4AC1X 4W85A 1J79A 4Z2KA 1D8WA 2QDHA 4UTWA 2J66A 5G2HA 1S2CA 4CU7A 3VOFA 4MGVA 4DF2A 1A49A 1M3UA 2PC4A 4US5D 1JCYA 3LNPA 1QU4A 3QW3A 3OOQA 1KM4A 3MDYB 2CBVA 4GGBA 4M19A 3UEQA 4ICCX 4J5NA 3P62A 1SO4A 4MDPA 1RH9A 2YCEA 2POZA 4IPPA 2OZ8A 2YDRA 3W38A 3WEOA 1ZJHA 5D02A 5IDIA 1CZ1A 4RE3A 4P7LA 3QGKC 3R79A 4XX6A 2I5GA 1BEUA 1EJRC 4DYEA 4RW5A 3NL2A 2VEKA 4XAFA 4IJBA 4AHOA 2QHAA 2YDAA 1Q63A 5CSSA 5GJNA 2CU0A 3ISIX 2VMFA 3VA8A 3MUXA 3GRIA 1K9DA 4RNFA 4JY8A 3DXIA 3GC4A 3K1DA 1NQKA 4HK5A 1KM3A 4GQQA 1Q1CA 2PDLA 3AHTA 3WFAA 3ELFA 1OHLA 3WQCA 3TC6A 1P0NA 4RK8A 3UWVA 2VGFA 2BV9A 2PV2A 1O94A 2WHJA 3T09A 4UMAA 1H41A 1TV2A 1FP8A 4L1GA 4LW7A 5IDZA 3U4AA 3M43A 1A5NC 5I00A 1GJWA 3O8AA 3O0FA 1AQHA 2M2AA 3S9YA 1IZJA 3DC8A 3OA3A 3WELA 2YA0A 1WZMA 3WBXA 5HUOA 1IEXA 2YL9A 1RJQA 4GUJA 3VKAA 3JW7A 3GR7A 3HV8A 4UR9A 4J3VA 3NL5A 4CU8A 1O4UA 4PMDA 1FH7A 1TFVA 1H1YA 1JUBA 3MBDA 3I6EA 4XZNX 1XSIA 3BMXA 4O8RA 1PZ2A 1OZMA 1E6NA 4KRTA 4UTIA 3V5CA 3CZEA 5CPOA 3EDJA 3TTOA 3BV7A 3A9IA 1VIWA 5FI8A 4Z1DA 1FWHC 1R38A 1LG1A 5IXEA 1LF1A 1RPKA 4XZMX 1JYWA 4JYEA 1FHLA 3TIMA 2ISDA 3VMPA 5CAKA 1OEPA 1EHNA 1J2WA 4M24A 3TE9A 2Q71A 1H61A 4W9PA 5EYWA 3FA3A 1O12A 4CEUC 3VZZA 1K9EA 2G95A 4M1RA 1HVXA 3O5JA 1GKPA 2ZYFA 3EX2A 3OVQA 2IPJA 1XYBA 4HGXA 4I8DA 3F4DA 2XH2A 3H4XA 1Y7VA 3S6OA 4AIBA 1GQJA 3IIXA 2ASHA 4JTUA 3O5OA 1V8EA 2HV5A 4AVFA 3FJLA 4C65A 4QEEA 3LN3A 2YA2A 4C6QA 5I06A 1P0DA 4JFJA 1HX0A 3N2CA 3NQVA 2VC7A 4PRRA 5G2IA 3I7SA 4HA4A 3LPGA 1HQTA 3XISA 2WCGA 3NPVA 1H50A 2HE5A 4CNUA 3UNDA 1EXPA 3OG2A 4Z1YA 4ZGYA 3W74A 2WJZA 2P3ZA 4J2PA 4LALA 4UZUA 1EBGA 4LCRA 4LUSB 1MVYA 1PTGA 3MSDA 1QI5A 3GTNA 1FAPA 1Q6QA 2EKGA 2A6LA 4PMQA 1EGMA 4S3DA 3W2KA 3Q94A 4I90A 3LQLA 4F48A 1VPYA 1ITUA 4PA8A 1TVPA 1H2JA 1GOXA 4DRJA 1FVPA 1UBSA 4C91A 3AHXA 2WNZA 3VFLA 3GXMA 1HKWA 2Q01A 1R87A 3EOUA 2ZUTA 1JDEA 3T7VA 3PZNA 3SEPA 5F4XA 1B3XA 2WSQA 4UNIA 1VHNA 1OC7A 4M6VA 5EMMA 4DELA 1ITXA 4IIBA 2RKXA 4V2XA 3WENA 3KBSA 3ITYA 1TX0A 1TR9A 1CXFA 1F3EA 1M7XA 2BXVA 3L2MA 4C6BA 1KM1A 3VKDA 1ICPA 4QTGA 1M6JA 3MW7A 4GYPA 1VFHA 3VPLA 4ONVA 3RFAA 2V5JA 3W07A 1QW9A 1XDMA 4FNQA 3ZSSA 2AMGA 1N7KA 2QCNA 3WUFA 1JNEA 2GUBA 1JRBA 4LAWA 4TQTA 4AZCB 1XLIA 2Z0IA 2C3ZA 4HZMA 4G56A 5MKGA 1D7HA 3I6TA 5DITA 3TW7A 2A5HA 1MNSA 3F4CA 4WDWA 4QSHA 2XZ7A 2GK1B 1PAMA 1H7NA 1WZAA 4JQ2A 3ITLA 1WB0A 3MKKA 3VD7A 3B05A 4AD2A 4XV0A 4AF0A 1VF8A 3L0NA 1JFHA 1TV7A 1C8YA 3GG8A 4K8EA 5D32A 2FKEA 2XH0A 4UTLA 1Y8BA 4NXSA 1MMFA 3W85A 4I7VA 1UROA 2W67A 1NTHA 2FZ8A 3AUOA 1KTNA 2JK2A 1UWAA 4ECLA 3ALGA 1LT8A 3KACA 1X39A 5MHBA 3LXAA 2NVDA 4G5DA 2GSJA 3FVDA 2J62A 3GAYA 4Q8TA 1QRQA 1Y5XA 4DRKA 1XLLA 4G7FA 2V6AA 1XS2A 3TEVA 1OFDA 4C02B 4RLIA 3WUEA 1O5XA 4IJRA 1JXKA 5A6BD 2C71A 3UWUA 2OQHA 1EO7A 3M0VA 2IUZA 2PU0A 1PCWA 5I03A 1E6QM 4U84A 3HB9A 2VGIA 1KKOA 5B7YA 2WHKA 3QMRA 1OB0A 2GVEA 1VFMA 2D1ZA 5A5WA 3PNUA 1FKTA 1HUVA 4LNCA 4GZJA 5A6JA 3EWDA 2G50A 4MVAA 4Q6JA 3B9NA 4HU0A 4LF2A 4UFMA 4P61A 3NO1A 3FIGA 4HNLA 4WY0B 3TQKA 3U2CA 1H0GA 1KB3A 5MF5A 3M1ZA 3W76A 3JUGA 3AXXA 1FWDC 4JTJA 2PAJA 3ITCA 1NVMA 4J3WA 1BTCA 3FHAA 2ETNA 1XWYA 2P0OA 1V77A 1XIGA 1HKKA 4C6OA 4US6A 1B3OA 3OU8A 4B5NA 2EPNA 5FIPA 1VPXA 3NQDA 4M5PA 3VUPA 1FCQA 1S5WA 3QPZA 2R1PA 2X0SA 4BR1A 4YMZA 5BXTA 1W5NA 1UWRA 2VFGA 4JQ3A 1OG0A 3C4UA 4S2BA 3C0SA 1Q6DA 2RUQA 1PSCA 4TTGA 3L65A 3UVIA 2X1SA 4L1WA 4ODLA 2YX0A 2Y24A 1ONWA 5T26A 3WH7A 4CQCA 4IGHA 1IEQA 5A2BA 4BEQA 4RPPA 4WD0A 4HCDA 4P7QA 1JDCA 4XAPA 2G3MA 5J5RA 3QSTA 4QS5A 1NMVA 4LUYA 2OO6A 1ZENA 1JI2A 1ZJBA 4ZB5A 2FZNA 3D3AA 1JZ2A 3OOBA 1E6XM 4W87A 4GO8A 3ZJ7A 4NZ3A 4DRNA 3ITTA 2Z1KA 2PDKA 3KAOA 1G01A 3GR8A 3EIPA 2DQWA 2QCHA 1CXKA 1VAHA 2QPSA 2V2CA 5HJYA 4V1XA 3TYEA 4O14A 3BXWA 3U6WA 2AL1A 1XIBA 5A8PA 3MV01 3DX5A 1LBLA 5A1AA 3M41A 3WQFA 1XYLA 1RVGA 3NQGA 3DESA 4ZL1A 3O07A 4BHYA 4GUFA 2BY3A 4YTUA 3LHTA 2EPHA 3EMQA 3CM4A 3N15A 4NX0A 3S5OA 4FF7A 2HK0A 4IUOA 3OIXA 4BZYA 3QQ0A 4QP0A 5A69A 3OW1A 4L80A 3U7BA 1L2UA 3IRSA 2Q3RA 2MPHA 2Z7GA 2W79A 1M01A 1O66A 1PB0A 4KW2A 1P0KA 4Z2GA 3VIMA 2R82A 4PMJA 4IJCA 3HU7A 2Y6ZA 4NZJA 3UWZA 5C9XA 5C5YA 3E12A 3VDHA 5CBIA 3V0UA 4GQBA 4NYUA 2OZ0A 1WV2A 1NWUA 4Z2HA 4AEOA 4FLRA 2V5BA 1ZAIA 1M41A 2WPBA 5ECVA 1I4NA 2ISSA 3AXMA 3W82A 3CIXA 3LS9A 3EKLA 4GD0A 3RMJA 4RW3A 2AL2B 3IIVA 4PTNA 1W2PA 4GGQA 1ZAJA 5DLCA 4NT0A 3BG3A 3IGXA 1HIZA 4TIMA 1W3IA 4WLCA 3UQIA 2PP0A 1JZ3A 3PPFA 3E2VA 4RE0A 3GR4A 4JTIA 2VUNA 3KOYA 1BFNA 5HPCA 3GH7A 1H4PA 5GVJA 2O9TA 4H9UA 4IXHA 3WF2A 5JMUA 2ZDSA 3M0JA 3PZVA 4FXSA 4CQBA 2DORA 5HW7A 4R34A 3IGHX 1T0OA 1HXJA 1JNDA 4LVAA 1CB2A 3H7VA 1PZ0A 3LV5A 3WQVA 2NUWA 2Y88A 4KWUA 3R13A 2Z00A 1MO0A 4HA1A 1OF6A 3GU1A 2VWSA 4LRSA 3UCDA 3KCEA 3G1RA 4XZIA 4OUIA 3ARZA 2OPJA 1MNZA 5EU9A 4Q33A 1AVAA 2N87A 5D8WA 1UG6A 1OCJA 4XK2A 1M7JA 4U3AA 4Y9MA 3SADA 3WH8A 1R86A 3W7PA 1E3XA 2WKLA 4BJHA 1R0MA 1ZNNA 3N18A 1XLKA 3TWBA 2VZSA 2VGGA 1MFVA 4G7EB 3GTIA 4XD5A 3L2LA 1DVJA 1BWKA 5FJPA 3UZZA 3II1A 1DYSA 4E4PA 4C7FA 3R43A 3O63A 1U5JA 3WF1A 1OGGA 1DXIA 3CAKA 4PR4A 1MW3A 4I8YA 5CCZA 5A6MA 4FXRA 3M07A 3DFPA 4IHCA 1W3JA 5LKYA 4QAWA 4W7WA 3TX9A 4JS3A 3T4CA 3W26A 5ECUA 1VBRA 2WV8A 2DZUA 4AZ7A 3WO8A 4H83A 2ZTJA 4OBSA 4CD8A 4DT4A 1LT7A 4UC5A 4YJ5A 4DLFA 2QULA 3O16A 3U5UA 1SUXA 3PUDA 1BXCA 5ENLA 4PUNA 3TOYA 3H7UA 2MNRA 5M2FX 3H2OA 3MMUA 3M0HA 4V27A 4DWSC 3W9ZA 1KT1A 1WDQA 3K2GA 3S47A 4A3UA 1ZSXA 2EKCA 4UFIA 3F4WA 1W9DM 4L56A 3C2YA 3Q58A 1OVDA 2V5CA 4M56A 1W1TA 1XG4A 1EIBA 4DRHA 3VINA 3PBVA 1LORA 3FSTA 2BY1A 3UYIA 4KCUA 2ZRWA 1ROTA 4CQAA 3S5SA 5A2CA 1VCFA 1A53A 2DG9A 4TX9A 2QGHA 5GJMA 1WCGA 4G8TA 2V2DA 4C6KA 5H2ZA 2X1IA 4WSHA 3QXBA 4IPIA 4D1IA 4Z1BA 2PWVA 1J6YA 3FYYA 1UIOA 1TMHA 1FKDA 1FY6A 1RLDA 4MIMA 2F8QA 3O2LA 4PC8A 2QAPA 1LBMA 3GIQA 1QO2A 2A7NA 3SRHA 2ZR6A 3ZM8A 4IQLA 2QS8A 3VNYA 4XSLA 5CC6A 1KRMA 2YKKA 4D6EA 1RA5A 1SR9A 5HWBA 1TA3A 5LGXA 1DKWA 3QFWA 3ABRA 4Z1AA 1IV8A 4MWAC 1DE5A 2YL5A 3N34A 3QN3A 2WVVA 4QFUA 3W53A 5LSMA 3QZEA 2A3HA 3TSMA 3TNOA 1BKSA 3NSXA 1EJ7L 3E0WA 3AWOA 1Q8JA 3WH5A 4GXPA 3RPMA 1TJ0A 1JIBA 2O9RA 2V0TA 4JTTA 2XIQA 3N4FA 3JR2A 4IM4A 4M0XA 2VZVA 2XM1A 3A5FA 4UR7A 3KVKA 1Q6EA 1TJ2A 1P1XA 3PPCA 4Z2LA 2K8IA 1TV5A 3WCZA 4MY8A 4N6FA 3ZWSA 5FF3A 1BTMA 2XN1A 2QUVA 4ODRA 3H2CA 3K4WA 4AQLA 1KQYA 3O5EA 2QT3A 1CXLA 2ACUA 3VCRA 2DIJA 1TV4A 3APTA 2VD8A 4IMCA 1QNRA 1XJBA 1GG0A 3FA4A 3ZSTA 1C29A 2WC7A 1G4SA 5I5RA 3CTTA 1UPMB 2Z25A 4JX6A 1YE4A 2J74A 4QCEA 4ZFMA 3OZOA 5A8GA 1EJWC 3EDFA 2C1GA 3LCWA 4GGHA 4F0RA 2FPYA 5EFFA 3VE9A 4TMCA 3AJXA 4QEHA 4AZGA 2NWSA 1MWOA 5LIKX 5D30A 4FX6M 3Q65A 2HVNA 1CGWA 2OLSA 2QIWA 1NF7A 5HWJA 4C6LA 1JR1A 1ZP3A 4O4VA 3PJUA 4H3DA 3HPFA 4UTTA 3HF3A 4KQNA 1NELA 3D47A 2WO5A 1BF6A 3PK7A 2FGZA 2ZRZA 4W8LA 1T8QA 1U1UA 2QCDA 2GK1A 1ZY9A 1GVIA 4C6FA 3MCOA 1X7FA 4FB7A 4ZQPA 2ZUVA 1TTQA 2Z4GA 1W1PA 3UESA 1WUEA 3ZR5A 4XIAA 1IZKA 1UP2A 1V02E 4PCNA 1FWEC 3FX4A 4OQVA 2EPKX 3EMZA 4B9YA 1EYWA 3FW6A 2GGEA 3C3UA 3LPPA 4MB4A 2Q5AA 1BG4A 2IKJA 1W0MA 3FJNA 4ZO9A 3O06A 1VFSA 4JTAA 1YPXA 4N2YA 3VGDA 4L9XA 3QV9A 2KAUC 4MWAA 1YIXA 1UMLA 2EJAA 4O10A 3CHDA 3QGAC 3DFYA 2YDSA 3QTPA 1XFCA 1Q4NX 5TF0A 5HNNA 3RAOA 1C93A 3WMLA 4WQ6A 3T08A 2Z6IA 1UR4A 4ADSA 4DIPA 3AYRA 1BAGA 3PFRA 3GBDA 1E4IA 2OOFA 4P7OA 3TSDA 5IFTA 1WXYA 4LC6A 1ZZMA 2Y2WA 4OOUA 2WMFA 3KTCA 1QW7A 1GOMA 4U3CA 1AFSA 3H21A 3T44A 2MLYA 1W9BM 1R3QA 5ABGA 5D33A 1NIUA 1ISWA 2ZE0A 1QBBA 3CV7A 4UB9A 2OFJA 3SUSA 3UYCA 3BOFA 4FOKA 1B4EA 2MNTA 4QJ3B 5TAOA 2ZFAA 2QCDB 3A23A 2QDDA 1WDSA 2JE8A 4HHPA 3WSUA 3CMGA 3OODA 3T42A 3TXZA 3CMFA 1Q5MA 1QPKA 3BG5A 1TZ9A 1H7RA 2QNEA 1ICQA 4A22A 2Y78A 3MMTA 2W9MA 1JAKA 3NQEA 4U5KA 5HNUA 1XUZA 1OFQA 4TUFA 3A3WA 1AJZA 5DT5A 1MI3A 3W70A 4MOZA 3MANA 1FHUA 1EDQA 5CJMA 1MQRA 3WLQA 7TAAA 4F0LA 4GUIA 2QUNA 2XZ9A 3PBGA 2J9YA 2BWGA 1M65A 2G3FA 3EDDA 3A21A 5C2GA 4NG3A 2Z1WA 1EFZA 4AXNA 4GISA 3VNZA 4CN4A 1EC7A 3ZWTA 3E1F1 4Q8QA 3BCDA 4UNKA 4FK9A 4GHRA 2Q8XA 2PGRA 3S5ZA 4QG9A 2QCFA 5CJNA 1G1YA 1RUSA 1U1JA 3DKLA 4OOZA 4NKCA 2JGQA 3L4WA 1NF0A 1MDLA 4XD3A 1AODA 4CN1A 3BARA 1B2YA 3KL5A 3LOTA 4PULA 3NEHA 3VI2A 3T9PA 2PBCA 3OBKA 4H1ZA 3CIWA 1W32A 1KXQA 3QYQA 3TDFA 2OFNA 3M0YA 4UTMA 2GDQA 4QE4A 4PMUA 2H3BA 4AD5A 1JNSA 1A5UA 1E9ZB 4AIUA 5CGTA 5CPMA 4ZSTA 1BF2A 4ZSUA 3LCIA 2G4JA 1F5ZA 4PB5A 2V3DA 1MFUA 2VEGA 1K7FA 4OFCA 4LUJA 4E8DA 4HVXA 2FHBA 3B8TA 4JTGA 4AD0A 7A3HA 3BAJA 3WJYA 1BD0A 1J93A 1YTDA 2BP1A 1R3YA 3EB2A 3N11A 3SURA 5I3DA 4LY8A 4ZEPA 3H6OA 1R5YA 4HK6A 5HINA 4XKYA 2CKRA 3V75A 3AUJA 3W7OA 1X7IA 2QAFA 3AS2A 3OVGA 3MY9A 1YATA 5JBFA 1GZJA 1IEVA 3DYOA 3DERA 1EPVA 4L9ZA 4Y6GA 1LL6A 3RNDA 2DSUA 3ZLHA 2BVYA 2Y7EA 2KI3A 2E77A 3T07A 3LCLA 3COTA 2F6XA 2PE4A 3QH2A 5BU9A 2JKPA 2WZMA 4LVBA 1R47A 2ZUMA 1NM9A 2ZQVA 1R9HA 4HYWA 1XX1A 2EJ1A 1W5QA 3BSGA 3PPHA 1VD6A 4JYSA 3P84A 4CLMA 3GH5A 4IGNA 3UR7A 2ZZ4A 4YXGA 2O55A 1RP9A 2C19A 2RURA 3CZKA 4J1OA 3UNTA 4E2VA 4HNCA 1CWYA 5BMWA 5GNZA 4BA0A 2RH9A 1HJVA 5JH2A 3ZIZA 2GSHA 5HQMA 4IFOA 5F1VA 3LHUA 3T0TA 1Z69A 4G1NA 3WYZA 3HJEA 4GG9A 2QMJA 3LM7A 3CASA 3L2IA 3SRKA 3DBNA 2VZOA 4J3SA 3LI1A 2OWWA 2VURA 4HBEA 1OQFA 2BDQA 4I5RA 4EKJA 3C5QA 5AB3A 4IT4A 3S8HA 4QIUA 5DY2A 4DWSB 1RK6A 2WKJA 2IKIA 4RDYA 1W9XA 3A3HA 3S46A 4X22A 3M5XA 3VD3A 3NI6A 1BHGA 2DJXA 3WL1A 1BVNP 1W26A 2P88A 3CUHA 1GZGA 4MY1A 3PBYA 2GWGA 2OEMA 3BH4A 4POCA 5T91A 2E6AA 1FD9A 4CU6A 4EP8C 4O1EA 4DZHA 1X1NA 3D0CA 4XAZA 3ZYZA 2Y5JA 1DORA 2FAPA 1IEIA 3KLKA 3AS1A 1M9HA 3KAIA 2QJJA 2Z27A 3TZFA 1XDJA 1EF3A 4IMDA 1FKLA 3LU2A 3EPNA 4JTCA 4A8LA 2CZEA 4B5UA 3MI3A 3WEZA 4RDWA 3A3XA 2DH3A 5AKQA 1NDVA 3UZJA 8XIMA 3ANUA 2TYSA 1VYSX 3OG3A 2PGWA 2NX3A 5CZSA 3OEXA 3F03K 4Y96A 3VVGA 1J8VA 3W2LA 3KCLA 3N6JA 1S2UA 3H70A 2TMDA 3IVUA 2NX1A 3C8FA 1F2JA 4G1KA 4JFUA 3GXNA 4O15A 3O5QA 3DG3A 3K8MA 1PZ1A 1VGAA 4B2DD 1A5CA 3EWCA 2BHZA 1Z42A 3QRHA 4EOUA 3BAIA 1XYZA 4A4AA 2ZRUA 4Z1CA 1C9WA 3ANVA 3IJLA 4IXXA 5FJRA 4BI7A 4FNRA 1YLVA 1JCTA 4PRTA 3TC5A 4DWDA 4PH6A 1OY0A 1UUQA 2NXIA 3I7QA 4DZ5A 3UPBA 4LUSA 3M0ZA 3QKEA 3RO8A 1QDSA 2ZA1A 3EAUA 2VVSA 4O52A 2V3GA 1FKKA 2OSWA 2YSWA 4E5TA 2XH7A 2X2GA 3GZ3A 1R2RA 1W8GA 3AOFA 2RDTA 1RJPA 2VQUA 1RJRA 1E5NA 2VCAA 4FO4A 4US5A 5XIMA 3CUGA 4MAZA 4GZ7A 3L21A 3WF3A 4PMRA 4OGZA 3MPGA 1RCQA 1XPYA 2ZOXA 4OV9A 1CEOA 1XL9A 5H8MA 1BRLA 1G67A 2QW5A 1CGUA 2XP9A 3TU9A 1E0XA 2ITKA 3GDKA 4O12A 1WKEA 4UTUA 3WH0A 3KXQA 4H6KA 1LWHA 3N2OA 4F2UA 3VNLA 5HMSA 3LLDA 4M8UA 3WN6A 3VABA 4KEUA 1P7TB 2WAGA 3IPWA 3LCFA 2HBVA 5JBEA 3B8VA 3E5BA 4C5YA 3ZZ1A 2CC0A 4L7ZA 1UPPA 1YDVA 3H24A 3GXIA 3VKCA 2I16A 5C55A 2PMQA 3WQWA 1U5HA 1ADSA 4LUTB 1KFJA 4N19A 2DIKA 4HTYA 1OGSA 4O28A 4H8HA 4WCJA 1L6YA 2OX1A 1W17A 1ME9A 3EXRA 2DW6A 2DGAA 2C13A 4FP1A 1FJDA 1K3UA 1Z48A 3SB0A 1J4EA 3T55A 2W5FA 3NQ2A 4O2TA 3ABOA 2X0HA 2XSBA 4IT6A 4Q4OA 3N13A 4AUBA 4UQAA 2OLHA 1J96A 4RDVA 2V9DA 4HA0A 1A7XA 5BOEA 4KS0A 2Y85A 3U2OA 3IEBA 3QMSA 9CGTA 1UR3M 1QHPA 4ZCWA 1JD7A 4GVHA 1JCNA 1O1HA 1MYRA 1W54A 3GKFA 1PTAA 3O1NA 4JL1A 3VD4A 4CNNA 4LX4A 1XH2A 4Q7IA 4LBSA 1LL4A 3I3EA 4C90A 4DNHA 3B8UA 5CQ1A 3ARUA 3B4UA 3UZWA 2XIIA 4GY1A 1OWQA 4GI4A 1EDGA 3BE7A 4PBFA 4PZVA 4JTSA 1SYTA 5D03A 3NTYA 4NIRA 1BKHA 4PBEA 1Q13A 1W9UA 4QE5A 4DNMA 1XCXA 1NOFA 3MS8A 3O6YX 3WDRA 2YCIX 3S1VA 5HANA 3WLSA 1REQB 2YCLB 5GQBA 4Q4PA 2Q6ZA 4J40A 4DXVA 1UH3A 2FIQA 4B5XA 2HISA 3FXYA 3ID7A 3UI6A 3CMJA 3GG1A 1I8JA 3MUAA 3UW6A 3CHCA 5F2LA 3CH0A 3GE7A 4GH1A 1NFGA 4YYFA 4CVUA 2B0MA 1H7WA 3U2ZA 4RJEA 3LB0A 3UQAA 5XIAA 1S5NA 3C2FA 4GACA 5D2TA 3F4VA 4NY2A 2W27A 1HKVA 3FAWA 1WXZA 1D7KA 3IIOA 3C52A 4GO9A 1R9XA 4B90A 4UFJA 3L12A 2OGYA 4IFRA 1W1VA 3UF8A 1FH8A 3HPXA 3C6CA 1TIWA 5FOOA 1H1ZA 2XPKA 1ECQA 2PEVA 5G4EA 2MLXA 3TNBA 3OBAA 2J8TA 1L6SA 2F61A 2WYSA 1V0MA 2F21A 4E2BA 3MA8A 4ZZ9A 2P76A 1ZRQA 3QV8A 4R9XA 4JQAA 3AIVA 2PN0A 2QKFA 5AC5A 3S9IA 4YHGA 4GIAA 3K30A 3DOPA 1DQWA 1XG3A 3SBFA 3MMWA 5G4HC 3K1GA 3TJIA 1S5VA 3STPA 3NXLA 3CS2A 1XIIA 2GQAA 1E0WA 4YVXA 4RXFA 2F2HA 4IP4A 5JIWA 4FX7A 4OBTA 3A64A 5F2GA 3QPYA 4PCSA 1SO3A 4DJDC 4K39A 2Z2BA 3S1GA 3W87A 4GMEA 4H8VA 2ZVRA 1YBQB 1F74A 4CVWA 1UD2A 1PE1A 2R94A 2ZUNA 3HJZA 5I0DA 3WDJA 4NYYA 4WJ8A 1W9VA 2CLKA 3WNPA 4RPQA 1QNSA 4B5WA 4UTHA 5KINA 5G1MA 2XVKA 2Z28A 4W84A 1UR2A 3W1PA 3UJ2A 3CQHA 4JDBA 1A4LA 4YPJA 3B0YA 4WKAA 3NURA 5LGZA 1OCQA 3SSJA 1XBZA 1DQUA 1GVFA 1T7LA 2R91A 1LP6A 3PRBA 1TV8A 5BRBA 1T11A 1XGDA 4C6PA 1EYMA 2ATSA 1W5PA 4DROA 1DWIM 2FPVA 3G1AA 3KE0A 1P5BA 3LRMA 4A6GA 4GI6A 3WH9A 1JAEA 4PMYA 3WQ6A 1UWSA 5DEZA 3L0KA 1EQ3A 2DZVA 4PTMA 1RQBA 1Z8AA 4HSNA 2JEQA 3RCNA 4JIRA 4FEZA 3QKZA 3ZLFA 1OT2A 2QPXA 4WZHA 4JKKA 5FL0A 1ZCOA 2M1IA 2OYMA 1FWCC 5LA0A 2EEXA 1RVKA 3K5XA 3IWPA 4I5XA 3A9BA 4LC8A 4DUWA 1DXEA 3FEMA 2FZBA 4DXKA 4LVGA 1TPEA 1ZHAA 4MFDA 3JZEA 1E73M 3ENLA 1Q6RA 3DHDA 1KBIA 1RPXA 1U79A 5CJ5A 3NQMA 4QX4A 3S6TA 1YADA 1R3RA 3CB8A 3RX2A 2DZBA 4K36A 4ZS6A 3GYCA 2HPMA 2I9UA 5HJXA 2FTYA 3DBPA 4AD4A 1CLKA 4BWLA 2NZLA 1W3TA 2F84A 2QCEA 3R8GA 1VBGA 2J79A 5DRCA 1KWKA 3R4IA 3HA1A 4Z17A 3R0DA 2FDSA 1KC7A 1LM1A 2XSAA 1QNVA 4GFSA 4GWEA 1P4CA 2W3ZA 4XBSA 1JGIA 2BGSA 3PBUA 3C2RA 2ACQA 4ASTA 3CU2A 3CPUA 3L66A 1DTNA 4M1BA 1XIFA 1XIDA 3BLKA 4MWAD 4YCPA 5AC6A 4ZA0A 2HROA 2HVMA 3H7RA 2JFEX 4YTQA 2UY3A 1CI1A 3MHUA 1GVSA 2ATMA 3LK6A 1UR9A 1QHZA 4OBRA 3SSZA 4E8CA 1FQ0A 1Z6KA 1YXDA 2GFTA 4HHMA 4DJDA 1QPLA 4L1XA 2PWHA 3L4YA 4AHQA 2QYGA 3UI5A 3MSYA 5HTGA 4MG4A 3EGJA 1ZBKA 1ELSA 4GA8A 1QPRA 5D2WA 1F6KA 3R2GA 3UGRA 1TVLA 1V0NA 4LAZA 4G9PA 3OHMB 1B3YA 2Y8VA 3S1UA 3SAZA 8TIMA 4ZPVR 2A79A 2IKGA 3R7MA 5DMLA 1KM0A 4GBUA 2C15A 1FKJA 3DFSA 4ZB2A 2RUCA 2RJGA 3PZGA 3QGVA 3WQEA 1P1MA 1H3GA 4GINA 2HXUA 5LNUA 1M03A 4PUKA 4LUIA 1GEQA 1X1ZA 3STCA 2P10A