4DWSD

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
539
structure length
532
Chain Sequence
PTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDKDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVKNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAKGHFISLDTPRTVKQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADSNQETIDMGPLYNPGKEIYLKSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 191
structure length 532
sequence length 539
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsD01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsD02
4UNIA 3T2QA 3GBDA 5M17A 4PMQA 4U5KA 1BG4A 3B9DA 1BTCA 2G3MA 1HKJA 4F8XA 2G41A 4TOQA 3VX1A 4UFLA 1JNDA 1TFVA 2VNCA 1E9LA 2E4TA 1JNEA 4OJYA 5C71A 1JZ8A 3DECA 3WH8A 3ZMRA 4NI3A 3ARVA 1DWAM 1OWQA 2E9MA 2EPLX 3FW6A 3QHOA 2VZUA 5AY7A 1VJSA 3BAKA 4YHEA 4JIEA 3WMBA 1H0IA 4UCFA 4AY1A 5FIPA 4MADA 1NOUA 1J11A 2OYMA 1H41A 3ARYA 1JXKA 1LF1A 1JDDA 3LPFA 2XWEA 3D5HA 2WMGA 3VNZA 3RM8A 2J8FA 4Z2IA 1LL7A 2DT0A 5BWFA 5M03A 1Q6EA 1VEPA 4LYPA 4PMZA 1J18A 5I2UA 3L4VA 2J25A 3M7SA 4D71A 8A3HA 1UD8A 3EBVA 5E6ZA 5A8MA 3MSGA 1ZBWA 4PEEA 5CSYA 1KBKA 4AZBA 1W3LA 1UQZA 5LYRA 1H1NA 5FKYA 3EMZA 3RJYA 4JFWA 3K46A 4ML4A 3PZVA 1JFXA 1MW2A 4L4PA 2EBNA 5I79A 5D9NA 2ESCA 4HMCA 1VAHA 3ZQ9A 1GOMA 3VGBA 1JL8A 1UUQA 1H0GA 1GVIA 3O6AA 1UG6A 3ARSA 1B3XA 5KZ6A 2JF7A 1MW3A 1GPFA 3DYPA 4J7RA 4P7RA 3AMGA 1GJUA 1DWFM 1GOIA 1CWYA 2UWFA 1GQIA 4ATDA 1VB9A 5JIWA 3OZPA 4GZJA 1MQQA 3HJEA 2YL9A 3BH4A 2E9LA 4UFIA 1D7FA 4HMDA 2QHAA 3VDHA 1E72M 3QHNA 2JALA 3VGGA 4KRTA 4F79A 2CERA 1EOKA 3L4WA 3AHYA 2IUZA 4U3AA 3ZSSA 2WLYA 4H2CA 2YIHA 4A4AA 3MV01 4EE9A 1G9HA 1H2JA 3ZJKA 4F9JA 4GO9A 3EDEA 1XYZA 2WPGA 2V38A 4Z2GA 3PTKA 1J9YA 2D22A 3VX0A 3CUFA 4CKQA 1E4IA 5AC4A 1JZ2A 4MJ4A 2DPEA 3CLWA 3VIKA 1HJXA 3AS3A 1UWQA 2W61A 4TVDA 1UKSA 4HOXA 1JI1A 2J79A 1W9PA 4AYSA 1VENA 1V02A 5JIPA 5EFFA 4UOJA 5A8PA 4LPCA 5D4YA 4AZHA 1JYVA 1E6RA 3BLPX 3WNLA 1GQJA 3PHAA 3SEPA 4C7GA 4WJXA 4CN4A 1CPUA 4D72A 1CGVA 5IHSA 3AZRA 3CHCA 2WK2A 3NJ3A 4Q7NA 3CUGA 2G8ZA 4GKLA 3L4YA 3CZEA 1UZ4A 1EHNA 4OBSA 1RH9A 2XIBA 3N13A 3GDBA 5CPSA 3OA5A 2WMFA 4P8UA 4CVUA 4ATWA 1SFSA 7A3HA 2O92A 2BXYA 1FA2A 2YDRA 1P6WA 2ZX9A 3GBEA 4ACZB 2J78A 4AD1A 3O9NA 3AHTA 1AVAA 3OG2A 3TTQA 4QAWA 1UR9A 1EDTA 2JIEA 3SCNA 4D6GA 1W1YA 1UQYA 4C7DA 2DGAA 3UERA 1K9FA 5M5DA 1E15A 2XUCA 3ZT5A 1E0XA 4IM4A 1KWGA 5IFPA 3AIUA 4YHGA 4CD7A 5JH8A 1LL6A 4FLOA 2VX6A 4PCTA 1GQKA 4CN6A 5A6LA 2WZHA 6CGTA 3POHA 1VFMA 2F2HA 4U5IA 4AW7A 1HP5A 5BRPA 4HA1A 2QMKA 1GCYA 1WZMA 2VT0A 4JL1A 5BCAA 1GQLA 2X2YA 5HOSA 4D6HA 1OGBA 1HJVA 2OWWA 3WNNA 3VNYA 3W82A 4HZ6A 1ZU8A 4W85A 4ACYA 5E6YA 2WMJA 3II1A 1R7OA 1BGGA 4B9YA 5DFAA 5A6BA 3AXXA 2WANA 2YLAA 2D24A 4LX4A 2YL8A 5CZKA 3VUPA 1E71M 2O9TA 1BVNP 1CDGA 4XZBA 3PZUA 1OIFA 4DUXA 1WE5A 4GI6A 3KL5A 3T0DA 3ZJ7A 2A3EA 2WWDA 2BFGA 1BGAA 3SUUA 4AZ6A 2OWXA 5D8WA 1QOXA 1XC6A 4X0NA 4D6EA 2WCAA 3BC9A 3PTMA 1W9BM 1UH3A 2WYSA 1G94A 2VVNA 2EO7A 4HP5A 3WDPP 4MAVA 4J3WA 1QNSA 4UZSA 4FLRA 5E09A 1VEOA 4PTWA 3L4ZA 1FFRA 3M6DA 2D3LA 3WDRA 1Y7VA 3AISA 3AQUA 1TVNA 3SCVA 4HOWA 2CIPA 2IXVA 3AICA 3KEHA 1JD9A 2FHCA 3APGA 1KQYA 1TG7A 3WL1A 1SMDA 2J74A 1WDRA 4BQ2A 2XVKA 2VRQA 4JCMA 1F4HA 2G4FA 4Z2KA 1VFFA 2XYLA 3MMDA 4RE4A 2DDXA 5JUVA 2WMIA 4QLJA 3PZIA 1KCKA 4AD4A 1OCQA 1V6WA 5GPRA 2XVNA 2E3ZA 1K9EA 4XX6A 3EDKA 4E2OA 3ARQA 1FHLA 3WDQA 2NW0A 4JAWA 1KCLA 5BRQA 4AZCB 2NT0A 3OGVA 3RILA 2WCGA 3G6LA 2G3JA 3AIBA 3WNKA 1B0IA 2PWDA 3WH5A 3WD4A 1J0HA 3T09A 1OSEA 1V03A 2Z1SA 1QI2A 1AQ0A 3GXDA 2O9PA 2EJ1A 2VOTA 1N82A 1WZAA 4MDOA 2WWCA 1WDQA 4ZEPA 1MVYA 2VQTA 4XB3A 7CGTA 3BAXA 1PIGA 2CCRA 1GZJA 4GO8A 1XHGA 3J7HA 4CD5A 1WDPA 1QVBA 3WNPA 4M81A 5E9AA 3AMLA 3AROA 3VVGA 3AMKA 3CHDA 6A3HA 1J0ZA 3F5KA 5AYIA 2GDUA 1H4PA 3A4WA 3WF3A 1U2YA 1V0MA 1V0KA 4FF5A 1F4AA 2W62A 3IJ9A 1HL8A 1M04A 1JYNA 1BYAA 4U33A 3LMYA 1GNXA 1H49A 4CU8A 1VBRA 2ZUUA 4PN2A 4W8LA 1ESWA 2Y5EA 1FP8A 3NCOA 2J62A 4LGXA 2J7DA 4CU7A 1QHOA 1M01A 3L2MA 1GUVA 3W37A 2GVYA 2ZX8A 3AOFA 2CKSA 1EDGA 1GHRA 4M82A 1ODZA 3T2PA 1CXHA 1MYRA 3WMCA 1LLOA 3CUJA 2BHYA 2WXDM 2DSUA 1PZ2A 3CUHA 5A2AA 1Q6GA 3WEZA 3ALFA 2BXZA 2ZUVA 1W1PA 3PZMA 3THCA 1K6AA 4P7LA 1TA3A 2VO5A 3FHQA 4KWUA 1C8QA 3OGRA 1GONA 2D3NA 3AIWA 5DT7A 2ZXBA 4PYSA 2QF8A 1RPKA 5A69A 1LQ0A 3IAQA 3BGAA 2HISA 2A3CA 1NM9A 2XSBA 4NZCA 4UFKA 4AIOA 3WN6A 3MV11 4PTVA 4CGTA 1R8LA 1EO5A 4YN5A 1UH4A 2VZOA 1OD0A 1B30A 4JHZA 5DMYA 1GORA 5CLWA 2J7GA 3IAPA 3CHEA 1LL4A 2WSKA 4P8VA 1MW0A 4M24A 3GYCA 4X9YA 4F66A 4MDPA 3ZJ8A 2WMKA 4GI8A 3VGHA 2VZSA 1UWIA 2Z1KA 2CBUA 3B8SA 1JXJA 1W9DM 1B3VA 1E3ZA 3N18A 4M8UA 1J0JA 3ARRA 5HDRA 1I1XA 2OYKA 1EA9C 3TP4A 3WUFA 2NT1A 2XFFA 1KR1A 1E6QM 2RGMA 4JKKA 1BYBA 4ATLA 3GZAA 2PWHA 3GH4A 5IHRA 1V6UA 1PBGA 3WQ6A 4TVUA 2X0HA 5KEZA 4JZ5A 7TAAA 4UTFA 4JFSA 2WMHA 1UWSA 4UQCA 1H5VA 1FFQA 1EXPA 3IJ8A 3W25A 2JFEX 3BSHA 2X8RA 2F8QA 1CECA 3MUAA 2QPUA 2WAGA 3CMGA 5JBFA 4BQ4A 5A6SA 2PWGA 4J3VA 3SCRA 3WMSA 1Q6DA 1KWKA 5E70A 2MANA 1SYTA 2V5DA 1JAKA 3CHFA 3WBEA 4KMQA 3WQ8A 2OLHA 1A3HA 3OBAA 3WQ4A 1B31A 2PWEA 2FGZA 4W7WA 4LYQA 2DT1A 1LJYA 4PSPA 1FH9A 1V3IA 2BHZA 1NWSA 3I3EA 2YBTA 2D20A 4HPGA 4JFUA 2BVYA 4V2XA 1ZS2A 3UG4A 3CZ8A 2WC3A 2FHFA 4MB1A 1UD2A 3WY1A 3AXIA 1ZJAA 1OGSA 3FXYA 2WVUA 1OIMA 5EBAA 3MU7A 3WDJA 1LWHA 4UFHA 1QW8A 1FP9A 2WHMA 3W6MA 2PB1A 2CPUA 3VOCA 2V5CA 4J3SA 1V0LA 4JFTA 1A47A 3GXFA 4Z2LA 5CQ1A 1XSKA 2GJXB 3GXMA 3KL0A 1OM0A 1HVQA 3BAYA 2WHKA 2YDSA 3WFZA 4OIFA 5CJ5A 2PI6A 1NWUA 4HA4A 2YL6A 4BCEA 1W9XA 3AHZA 1OT1A 1AQMA 3WFLA 2ZUMA 1EQCA 4URIA 3SUSA 2W4XA 3MMUA 4PMRA 4PMOA 1Q6CA 3WD3A 1WZKA 4EANA 1KXTA 2J4GA 2CNCA 5IXEA 1DEDA 4MPKA 1US3A 3VDAA 2XWDA 3RJXA 1KXVA 3OLDA 1ZBVA 4W5UA 4CN1A 5LA2A 4M80A 4AZCA 3SUTA 2VVSA 4W8AA 4Y7EA 1K9TA 5BXRA 3AIEA 4TUFA 1J0YA 1WPCA 2W91A 3MUIA 1EIBA 3WQVA 2FH6A 1U33A 1V3HA 1EGZA 1FOBA 1KGXA 3GH5A 5A6AA 2J8GA 4J3UA 3SCOA 3PBGA 3HN3A 2QMJA 1UR8A 3BCFA 1HT6A 1Q4NX 4BS0A 4KRUA 4X0VA 1B3ZA 1J12A 3SCPA 3CZKA 3JUGA 1W3HA 4UFMA 3WD1A 3F4VA 9CGTA 4PMNA 3RO8A 2ZOXA 4WSJA 2ZUWA 4A3YA 1V08A 2Y4SA 3OB8A 2PWFA 2EQDA 4TXEA 1BYCA 1HJQA 2WM0A 1KR0A 3QOMA 4LXFA 1ISYA 1CXFA 1NOFA 3W26A 4B16A 4HU8A 8CGTA 3W38A 6TAAA 4MNLA 1QPKA 3MUZ1 1CXEA 2EPNA 1VF8A 2VC9A 3NDZA 1BLIA 4GI9A 1CGWA 1JZ6A 3RDKA 1CBGA 4W86A 4UQEA 3VIOA 3N11A 2X09A 1W2PA 1CENA 3UR8A 3N9KA 2FDMA 3AXHA 1MW1A 4R27A 1GHSA 1VIWA 2AMGA 3PN8A 2J7CA 4AEFA 1ISZA 2C8NA 2XVGA 2GK1B 1E56A 1JDCA 4PUDA 5A6KA 1UA7A 2GUYA 1B9ZA 4P7QA 4AIEA 1E4MM 5A95A 2ZUSA 1V0NA 2DT2A 1R87A 1V3MA 1Q6FA 2JF6A 4UQ9A 4K68A 4E8CA 1OINA 4ZE4A 2ZWYA 2ZWZA 2V3DA 2VJXA 3RCNA 1UWTA 3VDBA 1IZKA 3MSDA 4NRSA 1XH1A 4AD5A 1HX0A 1C91A 2YDQA 1G5AA 3RM9A 4U2ZA 4CD6A 1V6VA 1HL9A 5AC5A 3EYPA 4ZE5A 4J3XA 2V3FA 4FLSA 1MWOA 3VMOA 2E0PA 4QP0A 4IPLA 3EDDA 2XM2A 2J77A 4H8HA 5ABFB 4KGLA 3A6OA 1B2YA 5IFTA 1ZJBA 2WBKA 4RL3A 1O7AA 2PBGA 1EHAA 1ZBKA 1V3JA 2VR4A 2O9RA 3AMDA 1CGTA 4AD0A 4JKMA 4QCEA 1E1EA 3ZT7A 3WH9A 1H3GA 5IDIA 4WKFA 1JZ3A 4DM1A 1GW1A 5I6SA 2Y8VA 4WLCA 3VINA 1IZJA 3MO4A 4W88A 1W32A 3HU7A 1H11A 1TUXA 2D0GA 2XVPA 1EDQA 4TX8A 1WAWA 3WUGA 1V02E 3PZ9A 3MS8A 1PPIA 3VD5A 2XGBA 5BXTA 1KGWA 3AS2A 4HTYA 3CPUA 1JZ4A 2VCBA 4HZ8A 1QNPA 5DT5A 2VZVA 4MJ2A 3U57A 3LPGA 3RPMA 1KFWA 1OD8A 3WEOA 5GNZA 1CEOA 1E4NA 3WKZA 3VIHA 2D0FA 4BQ5A 3UG5A 1NP0A 1UOKA 1EQPA 5I5RA 2XFRA 4D1IA 1OB0A 2UY4A 3U5YA 3TTSA 3FAWA 4B15A 1CZ1A 1UWRA 1UD6A 4GIAA 1KGUA 5D9OA 1KXHA 3ARPA 2BY2A 2ZIDA 4DWSD 1FHDA 2BS9A 1E70M 1DWIM 1M53A 3A4XA 1JFHA 4CCDA 2VMFA 3UG3A 2UY3A 4R5EA 5A8QA 4AEEA 3U7BA 1HKKA 4IISA 3AS0A 3QOKA 3IK2A 3BMVA 3CIVA 1UD5A 2BY3A 4M56A 2A3AA 2NSXA 3PZTA 2UY2A 3BMWA 2CITA 4MNJA 4W5ZA 2A3BA 5A2BA 2CESA 1PAMA 3FAXA 3LPOA 3WDIA 3OLEA 3WF2A 1WKYA 2VX7A 3K8KA 3ECQA 4D1JA 4MTVA 2ZX5A 3AJ7A 4C7FA 3NSNA 4AD3A 1C92A 3AI0A 4UQBA 3MANA 2CBIA 4WKHA 2GJRA 1PX8A 3WUEA 4L4OA 4UQDA 2WNWA 3WSUA 1LWJA 2GJXA 4AZ5A 2CXGA 5A2CA 4Z2HA 2FGLA 4PCSA 1CLXA 3AFBA 3UEQA 1XD1A 1BQCA 4H8VA 2E9BA 2V3GA 1E6NA 3BXWA 2CHOA 4OBRA 1GJWA 2VCCA 1WCGA 3NYDA 3WQWA 3A3HA 3VIFA 3B9EA 4AZIA 1UR2A 1CGYA 3KZSA 4NF7A 1M7XA 3DHPA 2WZEA 3T08A 1JYWA 2ZUTA 4BF7A 2OSXA 3POCA 2YOCA 1CXKA 1CGUA 1R7AA 5HPOA 1VFUA 4MAZA 1NWRA 1HNYA 2YA0A 2VX4A 1DWHM 4PTMA 3VD7A 1QHPA 1UA3A 5HBFA 3K8LA 3W29A 1WB0A 3VTRA 5A6JA 5CGTA 1NARA 1TE1A 1RP9A 4B9ZA 4S3KA 2WVSA 2ZXAA 1K9DA 5JBDA 4AD2A 5DEZA 3M46A 1PZ3A 4PMYA 3N1AA 1G01A 1E6XM 1QI3A 5M3WA 1XYFA 1XH0A 4J28A 2D0HA 2W67A 3TOPA 1CLVA 1E55A 4CCCA 1MFUA 3ARWA 4N0RA 2DSZA 3K4AA 2YA2A 3ARUA 4CCEA 1BPLB 1S46A 4EAMA 1MXDA 4CUCA 3DYOA 3W4RA 1CTNA 3FY1A 2GDVA 4XZWA 3AMCA 2DSWA 2UY5A 3A4AA 2YLLA 1XSIA 2D2OA 1QBBA 4W7UA 4IUGA 2WLZA 5HPCA 4ACZA 1GVYA 4E8DA 4CD8A 3IANA 1OBAA 4GQRA 3FHAA 1TR1A 2GK1A 2C0HA 2ZX7A 2ZXQA 3GXIA 3UESA 1V6XA 3VIIA 2XHYA 2YL5A 3RM4A 4EKJA 3BCDA 5A6MA 1MQRA 1UKPA 3CMJA 5DF0A 4P7NA 4PRWA 1UYQA 2E8ZA 4B3KA 5FD0A 3PZGA 4U2YA 2E40A 1R86A 1ISVA 1TMQA 1ZL1A 5A3HA 1Z32X 1GOOA 1QBAA 5I0DA 2QLYA 3L2LA 4UOZA 2BHUA 5A1AA 1MQPA 3VGEA 1LG1A 5ABEA 1NOWA 3O2LA 3W6LA 3SIMA 4DWSB 3CUIA 1KQZA 4UOQA 4ZXLA 5I24A 4WF7A 3WQ5A 5ABFA 5BYWA 3KL3A 1W9VA 3WL0A 2BVTA 3VGFA 1C8XA 3AIVA 2WMIB 1SR0A 5A8OA 1EOMA 2J7HA 3RIKA 3WENA 1H09A 2PBOA 1MFVA 1W9UA 2V3EA 2CEQA 4AIUA 3SUWA 2XTKA 4LYRA 4CD4A 3FNDA 3VILA 4LQ1A 3I3DA 1UWUA 4TVCA 4OZOA 4FLQA 5E0CA 2AAAA 4ZXOA 2G3IA 1DWJM 4JFVA 3VIGA 4J27A 3ZIZA 1WO2A 2WVTA 3HMCA 3LPPA 3MUY1 1V3LA 2F61A 1HVXA 1X6NA 4ZENA 3WUBA 4D6FA 1E0VA 3ZR6A 3ZOAA 2WW5A 3GTNA 1DP0A 3N17A 1ZB5A 1DWGM 1OT2A 2D1ZA 2RGLA 3F5LA 1UH2A 4P8WA 3N15A 2WVVB 3VU2A 1EH9A 5BXPA 2EXOA 4HMEA 5CGMA 1HJWA 3WF4A 3AHVA 3ARTA 1UR1A 2IXUA 4WSKA 4PMXA 4PMDA 1HP4A 1HJSA 3UETA 2WCSA 5CLTA 3QR3A 3W53A 2WBGA 3OIHA 2WZIA 4JCLA 3NUKA 3W28A 1C93A 4H7VA 1U30A 4PSRA 3WELA 3NIYA 3CZJA 4H04A 1QHZA 1X6LA 2DH3A 2WSPA 3U5UA 4S3JA 4QDMA 4DUVA 1KXQA 3VMNA 4TX6A 1GOQA 1UZ1A 4BA0A 2OSYA 2GJPA 4GPNA 5I3DA 4U3CA 2BY1A 2GFTA 1VRXA 2DSVA 1E1FA 1TCMA 4MB4A 3SCQA 3SCTA 5GNYA 4XV0A 2BVDA 3ZR5A 4GZEA 3L4TA 3VD9A 2XJ7A 4H41A 1BYDA 3WBAA 4OKDA 3AZTA 4HZ7A 4YPJA 4NRRA 3I3BA 1BAGA 3EDFA 1TA3B 2VTFA 1UKOA 2DT3A 2VCAA 5HNNA 4UZUA 3SCWA 4PMVA 4D6IA 1W2VA 3OZOA 4CU6A 5CSUA 2W66A 3K1DA 3CZLA 4W84A 3OLGA 1IT0A 5EFDA 1E5NA 1QI5A 1UR0A 2VRJA 3ZO9A 2BY0A 1E0WA 3WH7A 3VD3A 3BLKA 3NDYA 1PEZA 1C8YA 3W27A 3CTTA 2DQXA 2JEPA 1B3YA 1C7TA 3WDHA 1ISWA 4PUEA 4GINA 5FCZA 2WB5A 3NSMA 3S2CA 1BSIA 3CZGA 2HVMA 2XGIA 4TTGA 2FHBA 4M29A 4QCFA 1JZ5A 4AC1X 1QNOA 1D2KA 4QFUA 5CXPA 2ZE0A 2VX5A 1QW9A 3UR7A 2ZX6A 3WD0A 1QNQA 1WDSA 2JIWA 1XCXA 1XD0A 3K8MA 1QNRA 2YJQA 1ITCA 1R85A 4A3HA 4V27A 3KWXA 4U31A 3W0KA 5FL0A 1CXIA 5ABGA 1CIUA 3VKKA 4MNKA 3AHXA 3CBWA 4F9DA 1HXJA 1TZ7A 2VZTA 1E5JA 4M1RA 1L8NA 5FL1A 5AYBA 4B3LA 2VQUA 3MMWA 3PZNA 4Z2JA 1XCWA 2X1IA 3N12A 1I1WA 4OUEA 5FOOA 1W3JA 2PF0A 1BG9A 2ZXDA 3UCQA 5EMYA 3L4UA 5D9MA 1BVZA 3TA9A 4CVWA 2X05A 2EPMX 1VFOA 2O9OA 1WNOA 3WNMA 1AQHA 4BZYA 1C3FA 4WIWA 5DO8A 3CO4A 3SCSA 4HPHA 1JYXA 4JKLA 1JF5A 3DC0A 3T2OA 3SURA 1E73M 2DIJA 4DM2A 1D3CA 2ZICA 3DYMA 1V6YA 3VO0A 1JI2A 5A6BD 2CETA 3AZSA 1UKQA 5F7UA 4XUYA 1XGZA 1G0CA 1DHKA 1UD3A 3FN9A 1VJZA 2CKRA 4Q22A 3G6MA 1YQ2A 1BF2A 1ZBCA 3VIPA 4MNMA 3GNOA 5CPTA 2DSKA 1AMYA 5A8NA 1HJUA 1ISXA 3BAIA 2VRKA 1XRVA 3B9AA 1UD4A 2WHJA 2YA1A 4RE2A 3AS1A 1E40A 2WC4A 1JIBA 3S6TA 5BROA 2XG9A 4DWSC 3WH6A 1J0IA 3W81A 3T0AA 5D9PA 3VMPA 3SUVA 1PIFA 1IV8A 4GZIA 5C70A 5CPQA 5HXMA 1JD7A 1FH8A 4MB5A 5I23A 1HN1A 1ITXA 3K4DA 4EK7A 4JHOA 4DWSA 3TTYA 1MXGA 4H8UA 1PX3A 3M07A 1VBUA 3AYRA 3ALGA 2EPKX 3GNRA 1NH6A 1UR4A 5BXSA 3L4XA 2PC8A 2YBUA 2CBJA 5EB8A 5A94A 1W1TA 2DEPA 2CBVA 1E43A 1HKMA 4HA3A 2OYLA 4PBGA 2B31A 4GQQA 2JE8A 4W8BA 3TTOA 3PTQA 4W7VA 1QI0A 2VI0A 1E4LA 2FH8A 4V28A 1L0PA 1NP2A 1TVPA 4W87A 2J7FA 3ZT6A 4QLKA 3D3AA 3VPLA 1KB3A 1E3XA 2J7BA 4AZGA 2WKLA 4N42A 2CHNA 2JEQA 2CYGA 1E6ZA 5LA1A 1NQ6A 3DHUA 3VIJA 1JGIA 3WF1A 3ZJ6A 4AZ7A 3WIJA 3NSXA 1CNVA 4W93A 1EO7A 2XVLA 2OSWA 2XM1A 3VM5A 4BQ3A 2OWCA 3TONA 1OGGA 3ZM8A 1B3WA 1DTUA 3U7VA 2WVVA 4IPNB 1XV8A 2Y8KA 3OLIA 4NSBA 3RMEA 1YHTA 4ZFMA 1C90A 1O6IA 1I75A 4AXNA 1GOWA 4GXPA 1X1NA 4OOUA 1C7SA 4KH2A 1JDAA 1RP8A 3BSGA 5ECUA 4D6DA 4PTXA 3WEMA 2A3HA 4TTUA 1CYGA 2YKKA 3AYSA 1V3KA 3QHMA 2BV9A 3THDA 1W91A 4RE3A 5C8BB 2BNJA 2WKGA 5ABHA 3E1F1 2XFYA 4J3TA 4AWEA 1SMAA 3EMQA 2Y2WA 1PJ9A 2EEXA 3WF0A 1HF6A 3OGSA 3VIMA 1J0KA 3WNOA 3VGDA 4P8XA 1GOKA 1WP6A 3AIQA 3VM7A 1B90A 4FMVA 1UHVA 1W3KA 2C7FA 1J10A 3QGVA 2VR5A 3N04A 4AMCA 2WC7A 3IJ7A 1JG9A 4WKAA 1FH7A 5GNXA 3F5JA 4QLLA 2QV4A 1ECEA 3ARXA 2J7EA 4KGJA 4JL2A 4PMUA 4W89A 3VDCA 3AIRA 3MKKA 2VUYA 4HOZA 1PX4A 2XPKA 4OOZA 2J47A 2W63A 3ARZA 3GH7A 4DUWA 3CH9A 4D6CA 2AOSA 1E6PA 1JF6A 4UR9A 1QI4A 3BAJA 1VEMA 2EPOA 5I78A 1ODUA 1HIZA 2D23A 2J75A 5CG0A 1M03A 1UKTA 4WK9A 1XSJA 4FK9A 1WZLA 2Q8XA 5LA0A 1CXLA 1BFNA 2TAAA 4UFJA 3WD2A 3KE0A 3A47A 1RD6A 1JZ7A 1HKIA 4E4PA 5I77A 3VD4A 4MB3A 2G3NA 3EDJA 5JBEA 3PZQA 2DH2A 2Y24A 1B1YA 1W1VA 1XH2A 2XSAA 5E0FA 1US2A 1G1YA 2QPSA 1NWTA 4UQAA 2VL4A 3CGTA 5TD4A 4AISA 3BAWA 3W24A 5D8ZA 3SCUA 3T0BA 2W92A 2DIEA 2ZUNA 3EMCA 2VURA 2W5FA 3GM8A 3ZSTA 1J01A 1KBBA 2GSJA 1LG2A 1CGXA 1E6SM 3GNPA 2E8YA 4P7OA 2WHLA 1BHGA 2X0YA 4HU0A 2XIIA 4D6JA 1JAEA 3PZOA 5GQBA
chains in the Genus database with same CATH superfamily
4G2DA 1WXYA 2ZBTA 3GBDA 4U5KA 4JIIX 3B9DA 1UBPC 3UJ2A 3R0UA 4UTKA 1JNDA 1K3UA 5DMNA 4PMJA 4YL2A 3DECA 3AO0A 3UCDA 3GU1A 1XIIA 3ARVA 2E9MA 3H55A 3QHOA 3GKAA 4ASTA 1WDDA 5AY7A 4YHEA 4LANA 3TR9A 3S1UA 6TIMA 3TEVA 4ADTA 3UBPC 1B4EA 3OBEA 1XDMA 1I6NA 4UCFA 1XFBA 3VKCA 4DI8A 1ZUAX 5MF5A 2DZVA 4HNOA 2OYMA 2I9UA 3PUEA 4R0XA 2HRWA 4NZJA 4HHPA 3RM8A 1HFBA 5M03A 2R14A 1VEPA 2FVKA 3HGRA 4F0HA 3QFEA 3R1ZA 4DIAA 3BLLA 2ZDSA 4M6QA 2F2KA 4Q33A 4BF5A 8A3HA 1VQTA 2UBPC 3EBVA 3MSGA 1VH7A 3E0WA 4PEEA 5CSYA 1J5SA 3O15A 3NO5A 4AZBA 5LYRA 2E6FA 1P1XA 2ZFAA 3VKDA 4QG8A 2ESCA 4HMCA 4DXXA 3G1SA 3GUWA 2BLEA 3LNPA 2R94A 5FEWA 4HBEA 1FWWA 3H7VA 1KM6A 3BJTA 2XN2A 4FX7A 2Z0IA 3GG8A 1LRQA 1CWYA 3H2FA 3QPYA 3ENLA 4JTQA 1VB9A 2C1IA 1IIGA 3TQ0A 1K7FA 5KZEA 4AIBA 4UMBA 3SIZA 1FWAC 3OVPA 2A21A 1PDZA 1ONWA 1ZNNA 3VGGA 4KRTA 3IIVA 4F79A 4JIRA 3AHYA 2YIHA 4A4AA 4Z1YA 3LD5A 1W8GA 3RK8A 1H2JA 3I6TA 3ZJKA 3BGJA 2CWNA 3NQBA 2J9ZA 3TYDA 4G7EB 4Z2GA 4GJ1A 3PTKA 3CUFA 4QG9A 3ITCA 3V5FA 1MI3A 3USBA 1GW9A 4FNQA 4PCNA 3FV9A 4GBUA 2BDQA 4LAZA 2DPEA 4GYPC 3AS3A 2ZZ1A 1IEQA 2INFA 2W61A 4TVDA 3RF9A 3ZVHB 1TUFA 4HOXA 7ODCA 3GAYA 4PL2A 4C6IA 1JI1A 4AYSA 5EFFA 4UOJA 4LPCA 3CAWA 4AZHA 1E6RA 1RAKA 2Z1WA 4C6DA 1H1YA 3O5QA 4C7GA 3DFYA 1BKSA 1NEYA 2C79A 3CHCA 2DVUA 2WK2A 3OTRA 5BWAA 2P4VA 3KHJA 4B4FA 3CZEA 1RCOB 3EEGA 2XIBA 4OBSA 2GJLA 3KOYA 3OVRA 5I3FA 3C3UA 3RHGA 3O07A 3W84A 4QNWA 1MXSA 6PTDA 4O52A 2BXYA 4O0QA 1Z8AA 4LEFA 2J78A 2O7QA 3W1AA 3AHTA 1AVAA 3SZ8A 3E5BA 3WK3A 3LB0A 5HKGA 1AJ2A 3GW3A 1QPLA 4HSNA 1W1YA 1F07A 3KP1A 1SPQA 2ZQ0A 3KAHA 4WZHA 4DJFC 2XUCA 1E0XA 3BMXA 4HNNA 4IM4A 1WYIA 3H9RB 1QFEA 2OOFA 5D33A 4PCTA 3SRFA 3N2XA 2WZHA 1YW5A 4Z0SA 4FB7A 1TRIA 1GCYA 2VT0A 1Z69A 1ENUA 5BCAA 1GQLA 3W1XA 3M1ZA 1HJVA 1ME9A 4JN7A 4HZ6A 4Q8WA 1M41A 2YB4A 4DNHA 3LEPA 3QF0A 1XPGA 1EC9A 1G69A 3O6YX 3Q37A 4GXMA 3B0VC 3YPIA 3AXXA 3MUCA 2YLAA 1W5NA 1TMHA 3BOFA 1BVNP 5HQMA 3DFSA 4XZBA 3PZUA 1LBFA 2CLOA 1WE5A 4GI6A 5DCBA 5C9ZA 4HK6A 3G18A 1PIIA 4DNMA 2PP1A 3K13A 3LUTA 1YTDA 2BFGA 4HPNA 2PBCA 3SUUA 4GXWA 5D8WA 2GWGA 4D6EA 3JRKA 1IGSA 3PTMA 2G0WA 2EO7A 4HP5A 5FACA 4J3WA 1T8QA 4H1ZA 4NAEB 4UZSA 1M3UA 4FLRA 2E25A 3N4FA 4KCWA 2H8ZA 4WHBA 3EGJA 4AVFA 3V5OA 3DFOA 2HQAA 2HXTA 1FFRA 3M6DA 3KVJA 3CWNA 3LU2A 5EMLA 4E38A 2IXVA 2V69A 3I65A 1PBKA 4ALDA 2IQ0A 4DZ3A 1WBHA 4ML9A 4MGVA 2OFNA 3E0LA 4BQ2A 3W01A 2XVKA 1YE6A 4S3EA 5CAKA 4QS5A 2XYLA 3SSJA 1UPMB 1VGAA 4RE4A 1U22A 4JIQA 2WMIA 2UV8G 1KCKA 3BLEA 1I2OA 3NM3A 4NNBA 1K9EA 2CHRA 4H6EA 4E2OA 3NA8A 1FHLA 3B06A 3SI9A 1OC7A 4JAWA 4AZCB 3R8GA 2RURA 4TNSA 1FWGC 3AIBA 4IQCA 3WNKA 2CLHA 4FAMA 3WD4A 3CTLA 4C1KA 1WQ5A 7XIMA 4LVGA 2PE4A 3WO8A 1R2SA 1XKYA 3USZA 2WWCA 2Z2AA 1Q6QA 4ZEPA 3DGRA 7CGTA 4ZOCA 1PIGA 2CCRA 3A9BA 1GZJA 2Y5SA 4M1BA 3HQOA 2QCNA 1QVBA 2D2HA 3I6RA 5CZSA 5H2ZA 3N34A 2OEJA 1TZZA 1JUKA 4L1XA 1VKFA 4HZMA 1J0ZA 2PGFA 4JDBA 2YXOA 3DG3A 3WF3A 1H4PA 5CC5A 4FF5A 4A3UA 1F4AA 1HL8A 5T9CE 3O8AA 1A4LA 4U33A 1DL3A 3VK5A 2PS2A 1GNXA 1KC7A 3ES7A 4CU8A 2FDSA 1VBRA 4I8YA 3M5YA 2J62A 4LGXA 1QJWA 3FYPA 3L2MA 3GG0A 3PBMA 3PANA 2ZX8A 4EPDC 3AOFA 2CKSA 3W1NA 1EDGA 1GHRA 1S5WA 2JGYA 3T2PA 4KQNA 3VAWA 1QPNA 3ITOA 3WMCA 3CUJA 4G7EA 4HYWA 3W1UA 3TC3A 4GY7A 1TVLA 4NI8A 3O5MA 1JCJA 1MZHA 4Q3MA 3ALFA 2BXZA 3PUGA 4E2DA 4G8TA 3TFCA 3CQHA 1J4EA 4ODKA 4H6KA 3FHQA 3NO1A 4C6NA 1S5VA 3WQPA 1FXPA 3OGRA 1JCXA 2ZZ4A 2ACSA 1KTBA 1EWDA 2BMBA 2QF8A 4JTDA 2FJUB 2A3CA 2XSBA 3EWZA 4DZAA 4NZCA 1Q6LA 3WN6A 4PTVA 3V1HA 4L3NA 4CGTA 3P6LA 2MF9A 4KRZA 1PWMA 1QPOA 4YN5A 4FOUA 1UH4A 1EC7A 1B30A 3ANUA 4JHZA 4DVOA 5FEXA 2XFWA 1NFPA 2J7GA 3IAPA 1LL4A 2WSKA 4AQLA 2PDLA 1EUAA 3M41A 2P0IA 4QS6A 5FJUA 1SW3A 1UWIA 3IK8A 2Z1KA 3OG3A 4B5SA 2PCQA 4DZ2A 1B3VA 4H6RA 3BTNA 1NFGA 3DFHA 4ADSA 3DAQA 2GDQA 3T9PA 1DJWA 2OYKA 1EA9C 3TP4A 1TJ0A 1VZWA 1KR1A 2XFFA 3B9NA 2RGMA 1F76A 3MP4A 3S47A 2PDFA 4ATLA 3GZAA 2ITKA 1H50A 3QZAA 5KEZA 2Q3OA 3G8RA 2ZZ2A 3MI3A 1UWSA 1EXPA 3IJ8A 4JTGA 3BSHA 4K3ZA 3N25A 3UG8A 3WJSA 2E6DA 3MUAA 2QPUA 3TYBA 4DZIA 5BOEA 3CMGA 1XLJA 4I6VA 3UJSA 1F6KA 5IBXA 3RGCA 5A6SA 5G1YA 2PWGA 4BWLA 4HMNA 2XIOA 1KWKA 2Y0FA 3B8DA 5CJNA 1SYTA 4RE0A 2V5DA 1JAKA 4KMQA 4ZS6A 1JPMA 1YDOA 4U10A 1V51A 3LCWA 2XIMA 2OZTA 3N3MA 2DT1A 1XLMA 3G1VA 3I3EA 1J79A 4JFUA 2VUNA 1XF0A 2BVYA 3UG4A 5J6EA 2WC3A 3CNYA 3IJLA 4GYJA 1UD2A 4A8IA 3BQ5A 3KZ7A 3JU2A 4PUWA 4S3BA 1OGSA 4JNZA 2WVUA 3EX6A 1R9XA 2B7NA 2QGYA 3DH7A 3N4AA 4HYRA 3T55A 3W6MA 3AXKA 4KEVA 3LI0A 2CPUA 4NAEA 3VOCA 1JR1A 2Z26A 2BODX 4Y9NA 4JFTA 5F1VA 4Z2LA 5CQ1A 3TMQA 1XSKA 3BGGA 3GXMA 1K4GA 2Z4GA 4C60A 5LNRA 1OM0A 3NO3A 3TW9A 1KM3A 2WHKA 2YDSA 3WFZA 3QV8A 2NVAA 3QMRA 3VNIA 2PI6A 1I0DA 1NWUA 3SAZA 3U9IA 4MSPA 4HA4A 4TW8A 1EQ3A 1YBQB 1AQMA 1TPUA 4JY8A 3GB6A 3MTWA 1IF2A 2I7GA 1JCMP 1JDEA 4PMRA 4PMOA 3WLIA 4LAXA 4EANA 1W26A 3B03A 1DE5A 1DEDA 4MPKA 3VDAA 3CL8A 3N6HA 1ZBVA 4AZCA 5D2YA 3SUTA 2VVSA 1K9TA 3AIEA 3TWAA 6ENLA 1EIBA 1U33A 1V3HA 1N55A 2XINA 5LKYA 5A6AA 3SO7A 3SCOA 1EEXA 5EMJA 3HN3A 3UY8A 3MSYA 4LUYA 2Y1HA 4DPQA 1TPWA 1VR6A 1Q4NX 2PURA 4KRUA 1B3ZA 1J12A 3SCPA 1B3OA 3SDOA 4CQCA 3WD1A 4GCAA 3F4VA 2R82A 1FKRA 1SZGA 4HKPA 5EY5A 4WSJA 2ZUWA 5FF4A 2Y4SA 3OB8A 2EQDA 2V9DA 1NTHA 1BYCA 2WM0A 1KR0A 3QOMA 3RLHA 4LXFA 4B16A 8CGTA 1SGJA 2H6RA 2R6OA 1TCDA 2EPNA 1VF8A 5CPMA 1BLIA 4GI9A 3RUBL 4RW3A 3P0XA 3RDKA 5CBIA 4XZIA 4PA8A 4W86A 2I5QA 1YIXA 4RUBA 4OU1A 1SO5A 3UR8A 2QJNA 4R27A 5ECVA 3SR7A 1FKDA 2EG8A 3PN8A 4TYOA 1ISZA 3G1DA 2GK1B 3CAQA 3GY1A 4C6KA 3KM8A 1JDCA 5A6KA 3GYEA 3WBYA 1G7UA 3C86A 1H7RA 4CLMA 4AFYA 4BY3A 3TDFA 1IZCA 5TBOA 2DT2A 1V3MA 1Q6FA 2OOGA 4ZE4A 2V3DA 3Q45A 3XISA 4QZVB 4IJBA 4AD5A 4XK2A 3R94A 1RBLA 1TPDA 1Z41A 2YDQA 1F6PA 1V6VA 3NQ6A 3K5XA 4LT9A 1EX5A 4LNCA 4ZE5A 1FKTA 4FLSA 1MWOA 3NVTA 3GU0A 5HWMA 4IPLA 5H8MA 4H8HA 2HK1A 4KGLA 2WSYA 1FWFC 2J8TA 3INPA 1ZJBA 3GIYA 1O7AA 1POKA 4RZ6A 2ZKMX 3IRDA 4OFCA 4AD0A 1F05A 3UXIA 3T40A 1E1EA 3H2AA 3WH9A 1H3GA 3V0SA 4WKFA 5I6SA 3VINA 4WDXA 4BFAA 3F2DA 4V1YA 4CCZA 2OZ0A 1X98A 4TX8A 1WAWA 2VM8A 1JNTA 3NL5A 3SFWA 2B7OA 1OFOA 5BXTA 1UC5A 3GDKA 3CEUA 2XDFA 4H19A 1XC4A 5CSRA 2VCBA 1QNPA 4Q4SA 1Q13A 4H7ZA 3U57A 4YCPA 3DU0A 5DRCA 4IUOA 3SY1A 1E4NA 4GNJA 2D0FA 4BQ5A 2KI3A 4D1IA 2UY4A 3TTSA 2ISSA 1QPRA 1NDYA 2Y7DA 3BPWA 3P8IA 2DU2A 3KOZA 1UD6A 2QCFA 4XKMA 1XIGA 1A4MA 2NZLA 3ARPA 3PNZA 4DWSD 4RV3A 3A4XA 2VFDA 2YX0A 2Z25A 2P53A 3UG3A 1RJRA 1VD6A 4R5EA 3AXMA 4XUGA 1MRAA 1HKKA 4MHBA 3HG4A 2GVJA 2RFGA 4JFKA 3T0TA 4QT3A 3NZPA 3UNDA 2OQYA 1M9HA 2GLKA 3UR2A 3LPOA 1Q45A 1YLVA 1J2WA 2OZ3A 2XH2A 3N73A 5AHIA 3R58A 2VR2A 3RN6A 4ZOEA 3VOGA 4F0SA 2P88A 3GTIA 3H2MA 2A7RA 3L0KA 2CBIA 3DKLA 2Y7GA 2J27A 1EJSC 4L4OA 3C0SA 4U86A 2Y8UA 5A2CA 3DI0A 5EMMA 3R43A 4J4NA 3AFBA 4DJEC 3MI2A 4EACA 4H8VA 1XIDA 1YBQA 2ISWA 4PUUA 5TIMA 1A3XA 1GKPA 4WJEA 3FDKA 3MYOA 3A3HA 1PS9A 3KZSA 3TE9A 4NF7A 4WSHA 1YTEA 3PS7A 2PGWA 4L4MA 4EAYA 2OSXA 2YOCA 2NX9A 2BBFA 3KS6A 4MWAE 1R7AA 4MAZA 4K8GA 1NWRA 1H63A 2K8IA 2YA0A 2VX4A 1EF3A 3H7UA 3DESA 2QCEA 2Y7FA 5MKGA 1HGYA 3BLIA 4J5NA 3HPXA 2IF4A 3VTRA 4DWDA 4W4QA 1NARA 4ZOBA 1K9DA 4C90A 1YPIA 3F1QA 3M46A 2XU2A 2NQJA 3JYJA 4M7TA 4L64A 3N1AA 1XISA 2X16A 4OTKA 2W67A 3MZNA 4OQVA 1CLVA 4I9MA 3FA3A 1MFUA 2BB0A 3ARWA 2PDCA 1M5YA 4JYDA 1TTPA 3F03K 4UMAA 4CCEA 3KTCA 4LTSA 4CNTA 3W4RA 1QOQA 3FY1A 1FCUA 2DSWA 3H4GA 4GC4A 2YLLA 3NDOA 3UI4A 4F0RA 5DITA 3LN3A 2WLZA 1TSIA 1GVYA 1ZJIA 3IANA 2O55A 3B4UA 5C54A 4LS2A 1OBAA 3W7NA 3TN5A 4EPKA 5FA5A 2GK1A 3SQSA 4FNSA 2KZHA 1RY0A 3T42A 1Z7AA 3NGJA 3TN6A 1V6XA 4PC8A 1XLAA 3A13A 2J6XA 2KAUC 4QSFA 3LSBA 4H00A 4C91A 1M7OA 3HV8A 5K2ZA 1DJZA 5G4WA 1SFTA 1MQRA 1F8IA 1UKPA 3CMJA 1GQNA 1E9YB 1Q7QA 1DV7A 4B3KA 3PZGA 2PRMA 2VELA 4FXSA 1OFQA 4EF9A 1Z32X 1TQJA 2HPMA 3EX2A 4J2MA 3LTSA 1MQPA 1XINA 4IMGA 3PBYA 4OWGA 1A5NC 1LG1A 5ABEA 3O2LA 3W6LA 1T5AA 4O0KA 4DWSB 1TZ9A 2I56A 1PZ1A 3FOKA 5BYWA 4ZPTR 3CL7A 3WL0A 2PBOA 2H3DA 3NXLA 3RR4A 2CEQA 3IKDA 1PKNA 4DIPA 4CD4A 3T0CA 3M44A 4LQ1A 4FIQA 4A21A 1TR9A 4YMZA 3IJQA 3M0IA 3VIGA 3H21A 4ZR8A 3GFYA 3HMCA 1JCNA 1XBVA 4FR1A 1HVXA 4FN2A 3WUBA 3UF8A 5I09A 1AJZA 1OC6A 1MNZA 4NZ1A 3ZR6A 3M4HA 4QRNA 3SW6A 4ZTXA 1DWGM 2NLYA 3GVGA 4M6PA 4PB5A 2RGLA 3LERA 3F5LA 3BL3A 3CH0A 3RPTA 4Y96A 3UP8A 3VU2A 1A5OC 4O1BA 1EH9A 4DN1A 1JVNA 2VDGA 2EXOA 4HMEA 5CGMA 3L67A 3BLOA 4E5TA 2XIQA 1UR1A 3PF3A 3QLDA 3O06A 3A12A 2PPOA 2VXNA 3UETA 4QQUA 2XH7A 1M68A 5CLTA 4Q8OA 2CW6A 4W9QA 1A5MC 3BQ6A 1RK6A 1U30A 4ZQCA 3WELA 5MHBA 3CZJA 1QWKA 1X6LA 2WSPA 4JICA 3QW3A 4QDMA 3VMNA 4IPXA 2A2IA 4AHPA 3PAOA 4BA0A 1PCWA 4JQ2A 1TCMA 5CC3A 1EGMA 2W6RA 4FS9A 5DANA 5REQB 3UPWA 5GNYA 3PRDA 2EG6A 4YIWA 3WBAA 1BYDA 3NEHA 2WNZA 1BAGA 3EDFA 2VCAA 1HL2A 4QQ3A 2HV5A 4Z1AA 4P5UA 4ZGYA 2GPTA 2OTDA 4V33A 2EULA 5CSUA 3P7YA 2Z1BA 3PJWA 1UR0A 1W1A1 4YNGA 2VRJA 3VD3A 3BLKA 1R2TA 3W27A 1OK6A 3RX2A 1XLKA 2JEPA 4HNLA 4K7YA 3QR0A 5FJTA 2WB5A 4LU0A 2PDPA 2RDUA 1S2CA 2IKIA 2HVMA 4XZMX 1EP2A 1QMLA 4BJHA 4TTGA 1QNOA 3RLVA 1H7XA 3NPWA 1KT1A 2ODOA 4GJIA 1QW9A 3WD0A 1QNQA 3NQFA 4N19A 5H91A 4ZFCA 3LZ5A 1Q8JA 2YJQA 1R85A 1TWDA 3W0KA 1Y5VA 5FL0A 4MZ1A 1BF6A 1QU4A 3CO8A 1CIUA 5CC7A 1R6WA 2VFEA 1TZ7A 4Q4OA 4JTCA 3BJSA 4LS0A 2NXHA 4Z2JA 1XCWA 3W2JA 1WKFA 1I1WA 2ZXDA 1BG9A 2ATMA 5EMYA 1AJ0A 5D9MA 2WQDA 4GHRA 3OZMA 4UUIA 3GVRA 2O9OA 1WNOA 2PDMA 3GXNA 2YBVA 3S46A 2XSXA 4WIWA 5XIMA 5DO8A 3IGXA 3SCSA 2Q71A 3C6CA 4JKLA 1JF5A 4KESA 1JULA 3SURA 2GVLA 2QJGA 4DM2A 4EXAA 5A6BD 4EPEC 3AZSA 2O4MA 2DW6A 3E9AA 2G50A 3IJDA 1J2BA 5BMXA 5T9BG 2ZC8A 1J93A 3R79A 5DIVA 4IQEA 2CKRA 1ZP4A 2PTZA 5IDZA 4Q22A 3WK0A 4DLFA 3P80A 1RA5A 9XIMA 2XP4A 3OHIA 1ZSXA 9XIAA 2C18A 3D6NA 1AMYA 3BAIA 4PEKA 1RR2A 1W54A 3MCMA 3RCMA 3QZ6A 3BLFA 1FWEC 1VLIA 1JIBA 1TELA 2REQB 2G4JA 3WLPA 2PGEA 1F9CA 1JPIA 3GTYX 3WH6A 1J0IA 3TMLA 5D9PA 4PUKA 1QZ2A 3VMPA 1RQEA 2R91A 1XBXA 3EX3A 3W7JA 3FVDA 1J4HA 5CPQA 3IKGA 4MKVA 1X38A 1XRSA 4IT4A 4YYFA 1PUDA 4DWSA 2FVMA 1MXGA 1PX3A 2ETNA 3M07A 1ZP3A 4B4HA 2HE5A 3DERA 1NH6A 5BXSA 1AK5A 1W1TA 1E43A 2NXIA 1TPB1 3D47A 5BRBA 2OYLA 4GQQA 2JE8A 2P3ZA 4W8BA 1ZRQA 4FF7A 2VI0A 3TH6A 5IM51 5D05A 4V28A 2IPWA 4NKCA 1TVPA 2J7FA 3E2VA 2PDWA 3ZT6A 4BF9A 3C2YA 3D3AA 4EF8A 3BW3A 4AZGA 1OHLA 3E12A 4GGQA 2NVDA 2WKLA 4FEZA 3VNDA 5LA1A 3DHUA 2C0AA 4OHQA 3MVIA 3LRLA 2ZYFA 3AC0A 1B3WA 1DTUA 1KM5A 4IPNB 3E2SA 4R34A 2Y8KA 4NSBA 3ZR4A 1YMYA 1YXDA 1Q6UA 2QULA 3CASA 1O6IA 3Q94A 1I75A 1GOWA 3S1XA 1X1NA 2PZNA 3LCXA 4KH2A 2ZA3A 3PY2A 2GQ3A 1RP8A 3QN3A 4PTXA 5C7HA 3WEMA 4TTUA 1CYGA 3STCA 2C91A 3CIWA 4HNVA 5C8BB 2RJGA 5ABHA 4MKNA 2ZR5A 2XFYA 3CAVA 5AECA 2Q3RA 2G96A 1UP3A 2Y2WA 3CV6A 4S38A 1HF6A 1ADDA 2CWXA 5I7GA 3VM7A 1J10A 3IHZA 1E9ZB 1OYCA 3QGVA 2X7VA 3N04A 3MC5A 4AMCA 1BKHA 4ZPWR 5K9XA 3QR1A 3DEQA 2NWSA 1RQHA 3O5PA 2QV4A 5REQA 3TUUA 3C3NA 4AYGA 2J7EA 3LUOA 2PWUA 4S23A 2EJAA 3TDBA 3S6DA 3AIRA 2VUYA 3TLQA 4HOZA 1GVQA 4S3FA 4UR9A 1FKSA 3BAJA 3RITA 2QXWA 1ODUA 3F4CA 4PUMA 4Y8FA 5EKYA 1SU5A 2D23A 2VC5A 4IGHA 2RUCA 1M7JA 2YCEA 4NVTA 3URAA 1BFNA 2C1HA 1SZFA 4J40A 1GKRA 4ZOAA 3A47A 1HKIA 4E4PA 3FSTA 3VD4A 4MB3A 1L2UA 1EP3A 2C6QA 3WQFA 1PDYA 1EPVA 3PZQA 1S1RA 4L9YA 2DH2A 2H8XA 1WV2A 2Y24A 4F0LA 1XH2A 5EMUA 2BGQA 2XSAA 3B8TA 2ZVIA 2VD8A 1X96A 1QK2A 1J6OA 3DG7A 4YVVA 2VL4A 3T0BA 2W92A 1H51A 1NAL1 4NNRA 2VURA 4Q4PA 1L6SA 2ZADA 1E6SM 1TJ1A 3GNPA 2E8YA 4P7OA 2X0YA 2XIIA 3R5EA 4D6JA 1THFD 3B8WA 1W5MA 3NQ2A 4UTUA 4DUOA 3PZOA 4BI7A 1M5WA 3SADA 4PMQA 1BG4A 2AGKA 2Z6JA 4XWUA 2QCHA 3RG6A 1HKJA 3CC1A 4KCUA 3V5CA 3LA4A 1EYEA 4QX4A 3I4EA 3VX1A 4UFLA 1N8IA 1WKEA 5CBBA 2R9RA 4OJYA 3UXDA 2PLMA 4X2PA 4F40A 1NU5A 4NI3A 4GFIA 1Q85A 3FW6A 2VZUA 1VJSA 3BAKA 4LF1A 3WFAA 2E77A 2F2DA 1LCOA 1NSJA 1SSDA 2ZZ3A 1H0IA 4M0XA 3KTXA 1NOUA 4UWMA 4NX5A 3T8QA 1K8XA 4R88A 2XWEA 4KKXA 3D5HA 3VNZA 3IV3A 4DRQA 1JDFA 1LL7A 5BWFA 3LHTA 2GQ8A 4AUBA 1CT5A 1KTCA 1U83A 3L4VA 4ICNA 3W7GA 5LZLA 1UD8A 3GDMA 1KRCC 2UZ5A 2NV1A 5FKYA 3RJYA 4JFWA 4QISA 4L80A 1JFXA 4L4PA 2EBNA 3M47A 5HNTA 5D9NA 1OC5A 3ATYA 1GRJA 5AHFA 3VGBA 1JL8A 2BG5A 1H0GA 3ARSA 4KWWA 3VFCA 1MW3A 3AMGA 4IT1A 2P1FA 4ZPVR 1GOIA 3BE7A 1LOSA 2UWFA 3V1PA 3AU6A 4Q4RA 4HJFA 1N1AA 4B5XA 4JQ4A 1MQQA 3HJEA 1ZAHA 2YL9A 5I07A 2E9LA 3CGNA 1HW6A 4L9ZA 3ERPA 3VDHA 3KAGA 4ROQA 2YR1A 2CERA 1EOKA 1F3XA 1AW2A 1P5BA 3EXSA 4U3AA 4EE9A 2QUTA 4DX3A 5GJMA 3EDEA 2WPGA 2V38A 4HD5A 1GYMA 1J9YA 2D22A 3VX0A 4G7FA 3TYEA 4ZTYA 1UCWA 4Z0JA 1E4IA 4CKQA 3M0MA 1OYAA 3PVFA 2ISFA 1A5BA 1C9DA 1UWQA 1GTHA 3QC0A 2KR7A 4QR6A 4JTSA 2J79A 4KF1A 3TK7A 1W9PA 4QJ3B 3H7RA 1OX4B 2FPVA 4DH0A 3RXZA 1HKWA 4L6DA 2ZA1A 2WNNA 3DDMA 4GE8A 1VRDA 2VGGA 2BOFX 3WZ0E 3SEPA 2OT1A 2PDBA 4H9VA 5E0KA 4D72A 4JX4A 4C6OA 1DVJA 3NJ3A 4DBDA 2XIJA 2XPAA 3GHUA 1UZ4A 3QY8A 3GDBA 4IZGA 4MIMA 3EKLA 5CPSA 3OA5A 1GOXA 2WMFA 1SFSA 1RLDA 2QR6A 3Q65A 2PTWA 4K2SA 1M65A 1FA2A 1P6WA 2ZX9A 3GBEA 4ACZB 3KOWA 2C14A 5SWUA 3IV8A 2HDJA 1B54A 4QAWA 3SCNA 3UFYA 4NYUA 1HZYA 4YWSA 4BHYA 1OG0A 2NV2A 1K9FA 1EKOA 1UMYA 4HSOA 3UXLA 1E15A 3ZT5A 3TJXA 3BV7A 1QT1A 1AD4A 3OQEA 1KWGA 1KM0A 4CD7A 3PTDA 1Q4WA 1FWDC 4CN6A 4LAWA 1KRMA 1ZFJA 2OJPA 4ZSTA 1PWLA 2F2HA 4AW7A 4U5IA 3QFWA 3LDVA 4JL1A 3ABSA 3H54A 3CK5A 2X2YA 4L56A 5HOSA 3WNNA 4LUSB 3W82A 4IIDA 1ZU8A 4YTQA 5U7SA 4W85A 3EA2A 4DF2A 2WMJA 3II1A 3W2MA 4XTIA 2F21A 1BGGA 1IGWA 4PTNA 1AA1B 5DFAA 5A6BA 4Q7BA 2DZAA 3E0IA 1ZCOA 5FJPA 2D24A 5CZKA 3VUPA 2OCZA 4MWAC 1BVWA 2TMDA 2FKPA 3UGRA 1VBHA 3GVVA 5DBTA 1LWIA 4W9OA 4DUXA 3T0DA 3S9YA 1F61A 3S1GA 2YCJA 3ZJ7A 3QGKC 3WQCA 2A3EA 4C65A 1I2NA 1BGAA 1TJ2A 4PGLA 2OWXA 4X0NA 1MUCA 3FS2A 1W9BM 3CPGA 1P5QA 4P61A 3ABXA 1OX6A 1G94A 2VVNA 3H26A 4B91A 3WDPP 2PTYA 1B6CA 2ZE3A 1VHCA 4OGZA 1KBJA 3O5GA 3BMBA 5H1WA 4J2PA 4FA3A 2BASA 4MOZA 2PPNA 4KS0A 3HQ1A 1O5XA 1Y7VA 3AISA 3N4EA 3OYXA 3AICA 3O16A 3KEHA 1CX9A 2FHCA 4DO4A 1RCQA 4EPBC 1TG7A 1YEYA 4XAPA 1X39A 3QM3A 2OG9A 1WDRA 2OELA 1FUYA 1FKFA 4XKYA 2VRQA 1FKGA 4GUJA 2G4FA 3P67A 4Z2KA 1Z6KA 3TFXA 3PZIA 3E3HA 2XP6A 3Q2DA 1FKBA 1TIMA 3W7PA 4XAGA 3KBMA 3FYOA 1FVPA 5LHFA 4XX6A 3D46A 1TPH1 3KLKA 3ARQA 4NJHA 1Z48A 3G1YA 3SSZA 1XYMA 3LGDA 4N2YA 2WKJA 2NT0A 3RILA 2WCGA 3GHSA 2G3JA 3JR2A 4IIHA 4IX0A 1B0IA 3WH5A 1OSEA 2Z1SA 1QI2A 5HTGA 1N8FA 4WGHA 3NZQA 1DJGA 1KNWA 4LH8A 1N82A 4MDOA 1IXQA 3PJUA 2ZCGA 4PB3A 1WDQA 4A2SA 1MVYA 1W1B1 3IVTA 4G1NA 3LI1A 2FZNA 4GRSA 1XHGA 1SZEA 8XIMA 1ONRA 4CD5A 1NDZA 1DIDA 4C1NB 3ELFA 5KMYA 4ZB2A 1OF6A 3GD6A 3MHFA 2GOKA 3AROA 1SUXA 3VVGA 3AMKA 3CHDA 6A3HA 3F5KA 5C9WA 4DI9A 2RHGA 3W7QA 1SZRA 4CQAA 3R25A 1U2YA 1V0MA 1XP3A 2B7QA 2QV5A 3WK1A 1M04A 4W8LA 3W23A 2Y5EA 1UC4A 2J7DA 5D37A 3L23A 1GUVA 5BNKA 3C52A 2RDXA 1ODZA 1MYRA 1LLOA 4ORMA 2BHYA 4GVIA 2WXDM 1EP1A 4B5VA 4S1FA 3WEZA 2INEA 4GQ0A 4LC6A 3PZMA 3STPA 1K6AA 3RCYA 3OBKA 4DRJA 3L7RA 4EWND 3CUZA 1DQUA 1TA3A 1TX2A 2VO5A 2QJIA 4ZVJA 3QQWA 4IQJA 2XZ7A 1C8QA 3C8FA 3AIWA 4HTBA 4GLEA 1A5CA 3TCSA 5A69A 3EKGA 2HISA 4UFKA 4J9JA 4AIOA 1T11A 3W75A 3RFWA 1YE4A 1R8LA 2XZ9A 3B3DA 4IP5A 4NILA 3UVAA 1OD0A 1XLGA 5CLWA 3KADA 2YFOA 4MLRA 4P8VA 4AU0A 3GYCA 3ZJ8A 4GI8A 3NQ8A 2A85A 3B8SA 1F6YA 4Q32A 4AY8A 1W9DM 3N18A 4XBKA 3NQVA 1I1XA 3O5JA 2Y7EA 1ROUA 1NF0A 1AUSL 1A5KC 1BYBA 4GGHA 5IHRA 1V6UA 1PBGA 2BVWA 3NL6A 4DBUA 3UU0A 3TCEA 4KT2A 4BWLC 2DUAA 4IMFA 1LZOA 4O12A 2Z6IA 2ZR6A 1A50A 1PTAA 2JFEX 1W5PA 3WMLA 2F8QA 1ZK6A 1BTMA 3C4UA 3E2QA 3V3WA 3W2KA 4IG2B 3FFSA 3RMJA 5JBFA 1FY6A 3BDKA 4WRHA 3VDGA 1O1HA 2RH9A 4J3VA 1PB0A 4QM1A 2CLMA 1B4KA 2ZRUA 1TTIA 3OBAA 4XBJA 3A5VA 1K7EA 1LQAA 1B31A 2FGZA 1FCVA 3T8LA 3FJ6A 3K2GA 1DJXA 4AF0B 2BHZA 1NWSA 1AFSA 3ZLHA 2YBTA 1FDYA 1I0BA 4RKAA 3NI6A 5FF0A 4IX2A 1IEIA 4V2XA 1BXNA 3CZ8A 4O13A 2ZC1A 3TYUA 2FHFA 3M0YA 4ZB0A 1DBTA 1RVGA 1DQWA 3AXIA 2IKGA 3P81A 2PDQA 1V79A 2F7FA 5EBAA 4RW5A 3WDJA 4WDTA 1LWHA 5AOUA 1XYAA 5LNWA 1ZENA 1Q6IA 2V5CA 1IR1A 1V0LA 3GR4A 3GXFA 3W83A 1K8ZA 3CT7A 2POZA 5F1UA 1V4YA 4K36A 1O5QA 4JTUA 3KL0A 3S1VA 3BAYA 1O60A 2PFHA 1JRCA 4KEUA 2IPGA 1ZCNA 1G4PA 2YL6A 4BCEA 2AQWA 5HUAA 3AHZA 2WPBA 1P0KA 1TPC1 2AMXA 5C2GA 2H9AB 2ZUMA 1LP6A 4RR4A 3OVQA 2M1IA 4Q8UA 1EQCA 2W4XA 3V16A 3MMUA 1UROA 4M3PA 5HAOA 2OGYA 1EBHA 1WZKA 1XQKA 1KXTA 2J4GA 3A3XA 1JPHA 2XWDA 1D7JA 3DC8A 5LNSA 3U4FA 5XINA 5D02A 2W91A 3BZJA 2GQAA 2O7SA 3BG3A 4Y6GA 3V36A 5CH9A 2E7FA 3OZYA 3WX7A 3PBGA 5JXQA 3S8HA 2QMJA 1K70A 3BCFA 1AH4A 4BS0A 4CNSA 3MDYB 4K39A 4ZO7A 1W3HA 1IX5A 1O12A 3OIXA 4XD5A 4PMNA 1WKDA 3JVAA 1V08A 4C1NA 4MMWA 2DVTA 4FOJA 4TXEA 1W56A 4R53A 3CXOA 2J24A 3B97A 4MSSA 3BURA 4FXRA 1RJPA 1SZNA 5T8GA 3ABOA 4EX4A 1QPKA 2YCKX 1L2QA 1PO9A 1JZ6A 1VFTA 1W1ZA 2E1DA 1D8CA 1NELA 4UR7A 1OK4A 3M64A 1GHSA 1E9IA 1BWKA 4AEFA 3KRSA 4MF4A 2ASHA 9RUBA 5DMMA 1UA7A 3R0DA 2FLIA 2BSLA 3P61A 4FZIA 2C71A 4H9UA 2VEIA 3EOSA 3CQJA 1ZALA 3WBWA 2GGEA 2HVNA 1AH3A 4GIEA 3G3MA 3W7LA 3UQAA 3MO7A 2VJXA 1Q1CA 1K1DA 4IT6A 1UWTA 1TE6A 4GISA 1IZKA 3UYCA 1HX0A 4PULA 1XM3A 3WG6A 1C91A 4FXFA 3AUOA 5HR7A 3EY6A 4CD6A 2R8WA 4J3XA 4W9PA 4NJIA 3W76A 4Y9AA 5ABFB 2QCGA 1B2YA 5HMDA 2L5HA 4NASA 4AB4A 2KFWA 3MW7A 2VR4A 4L6HA 2O9RA 3AMDA 5C9UA 3ZVIA 5DQPA 3ZT7A 5FSDC 5IDIA 4R7JA 4LWWA 4IMAA 5G2IA 2Y8VA 5BOOA 1TYGA 4WLCA 5FJJA 3PFRA 2HWGA 3ISIX 4W88A 4UCGA 3HU7A 5JVLA 4K1GA 5LGXA 2OQLA 1I2RA 4C6QA 4NT0A 3UY7A 3PZ9A 3MS8A 3VD5A 1KGWA 2DZXA 5HMSA 1JZ4A 4HZ8A 1FHVA 4AH7A 2VZVA 3TJ4A 3LPGA 3RPMA 1KFWA 1CEOA 3WKZA 3VIHA 2VFHA 4LY4A 3EZ4A 3UWEA 1R0MA 3W74A 1IEWA 3MDWA 4QIUA 3PUDA 4IG2A 3U5YA 3FGCA 3FAWA 4B15A 4UTJA 1KGUA 2VDIA 2QCDB 2QCLA 3C56A 4BF8A 4WUIA 2ON3A 1FHDA 1E70M 1JFHA 2UY3A 5FI8A 3QJAA 1A49A 5KETA 3AS0A 5E1QA 1H5YA 3L5MA 3BMVA 1UD5A 3HB9A 4M56A 2A3AA 3GC5A 5DMLA 4XIAA 3BVJA 2CC0A 5A2BA 4IQ2A 1PAMA 4JTFA 1J5TA 2NXGA 5AZ1A 3WF2A 3K8KA 3ECQA 4NP7A 3O5OA 3RAOA 3DBNA 3QBUA 5LNVA 3TR2A 5H6HA 4UQBA 1ZTVA 3UW6A 4JXCA 1PX8A 5I06A 4GUHA 1ADOA 3WUEA 3JS3A 2WNWA 1XLLA 4KETA 1LWJA 3WH0A 2FB2A 2FGBA 4Z2HA 3VC5A 4GABA 2DY3A 3R12A 1EA0A 1CLXA 1G4SA 3LSCA 3BUVA 3UEQA 2PTXA 1IT7A 4DZ5A 4H01A 4PH6A 5D2TA 4PCPA 2B7PA 3BXWA 4L4LA 4RPPA 4DJDD 2VCCA 1K03A 2H9AA 3VIFA 3B9EA 2VENA 1UR2A 2HSAA 5F2MA 1HTIA 2WZEA 3F7JA 3T08A 1H62A 1BKFA 3FEMA 4BF7A 2ONEA 3CYVA 3UQBA 1OADA 4GJJA 1TPVA 1CGUA 3GLCA 2OO0A 1VFUA 4JQAA 3S4TA 2I57A 4MYAA 3DX5A 2AKZA 1DWHM 2NSOA 4DXVA 4UNKA 3VD7A 1UA3A 5DX7A 3K8LA 1S38A 1VCGA 1RP9A 5DEZA 1AW1A 2E1WA 4JNMA 3NOYA 4PMYA 1ZJHA 3OQ8A 2WQPA 5HT1A 3G1XA 1X1ZA 1L6GA 5M3WA 1D7KA 4D8LA 3K4WA 3GO2A 1E55A 4UTTA 3MHGA 3W6YA 3RGTA 4N0RA 2DSZA 2DP3A 2XISA 3ARUA 4P2VA 3TTEA 1S46A 1MXDA 3FJNA 4XD4A 2WZTA 3U8GA 4CUCA 2OT0A 1CTNA 4GH1A 1TTQA 4XZWA 4MY9A 1P7TB 5AVNA 2UY5A 2OO6A 6ALDA 3L65A 1XSIA 2D2OA 1QBBA 4W7UA 3O1NA 5J8LA 1H7PA 3DZ1A 1P0BA 5HPCA 3G3DA 5LHEA 2VKZG 5EL1A 5FSEC 3GX9A 2SFPA 1V8EA 2HROA 5D75A 1VS1A 3ITYA 1TR1A 3H70A 2C0HA 2PUZA 3VIIA 2YXXA 4N9EA 4XIMA 4EKJA 5DF0A 5JU6A 5FAJA 4Q8QA 2V0TA 4U2YA 5JH2A 2Z2UA 4H9XA 3DFNA 4JX6A 2GUBA 4JTKA 1GOOA 2X1SA 4KCTA 4QHRA 5DY2A 1EJRC 5A1AA 1UBSA 3BJFA 3VGEA 3VCNA 3AU2A 3NYZA 5I03A 3N2CA 2VEPA 3UPBA 1POJA 2G37A 3SIMA 1DXFA 3LRMA 1ONEA 4UOQA 4ZXLA 2PDGA 5ABFA 3KL3A 3NL2A 1W9VA 4GY0A 3VGFA 1C8XA 4DHGA 1SR0A 2WMIB 5A8OA 1EOMA 1ONXA 2J7HA 3WENA 1W9UA 4DQWA 1W3NA 3SUWA 1PKLA 1L9WA 2XTKA 4LYRA 1TV4A 3I3DA 1UWUA 3XIMA 4OZOA 1ITQA 4FLQA 1IYXA 2AAAA 4D2JA 1X7FA 2G3IA 3M5VA 4KBXA 3SB0A 1TPEA 3ZIZA 3EWCA 3THQA 4JX5A 3UI5A 1NIUA 2V5KA 2WVTA 4QEHA 3MUY1 3TN3A 1X6NA 4ZENA 1GJPA 3TC6A 1FWIC 3GSMA 4RDYA 4J3ZA 3ZOAA 3GTNA 5HJXA 1NSGA 5LIWX 1K7XA 3N2MA 4P8WA 1E51A 2LJ4A 2FZ9A 1U5HA 2RQSA 1CCWB 4C6MA 3PPFA 5BXPA 1FBAA 2P5NA 1H7NA 3O5EA 1HJWA 3QQ1A 4IGMA 3C2FA 3R0KA 2ISVA 1IT8A 4PMDA 1L1PA 3M0KA 4US5D 3GFZA 2EKGA 4JTIA 1PTDA 3Q67A 3VZYA 1SJCA 2WZIA 2QCDA 3OIHA 3B8VA 3NUKA 3W28A 1C93A 4JTHA 1YNPA 3KUMA 1J96A 4H7VA 4O4VA 1W17A 4Q8MA 3NIYA 3W1QA 3VOFA 5K4XA 5D2WA 1IQ8A 4DUVA 2ABBA 1GOQA 2DZBA 5L9FA 2GYIA 1JQVA 4H6QA 4U3CA 2BY1A 2DZWA 2GFTA 3IGSA 3BK0A 1X1OA 2C19A 4A29A 5HINA 1DIKA 2BVDA 5EA9A 4J4KA 3O6DA 4GZEA 4X61A 3L4TA 3AJXA 3EB3A 2XJ7A 1VBJA 4H41A 1LUCB 4N9CA 4OKDA 5XIAA 3KHDA 4HU4A 1I2PA 4Q4MA 3C2VA 2FAPA 4TMCA 3GAKA 1UKOA 2A79A 4UIOA 3AAMA 2DT3A 5HNNA 1BWVA 4PMVA 4D6IA 4PBFA 1W2VA 3OZOA 2TODA 4CU6A 4YTTA 1L8PA 3CZLA 4W84A 3VOIA 1E5NA 5HWBA 1QI5A 4G50A 3NFUA 3W2NA 3GZ3A 2PTDA 2BY0A 3MCNA 3OPSA 4AWTA 4QNEA 2PV1A 1I9CB 3GTXA 3MCOA 1ISWA 4NZ5A 2OLAA 6REQB 4IFOA 5FCZA 3G1AA 3O05A 1M1BA 3CZGA 1FXQA 3HM7A 4TW7A 3UA3A 3CQ0A 2J9YA 3U2OA 4QCFA 3MKCA 3GTFA 1FWRA 3W22A 5AFDA 4FNPA 5CXPA 2V81A 3TN4A 1YXYA 3SJ3A 2GSHA 1XCXA 3O5KA 5EGRA 3EOUA 3CHVA 3K8MA 3KWXA 3ZLGA 3WQDA 2PAJA 1NMVA 1CXIA 1DQXA 3SQMA 1G7VA 3VKKA 1HQTA 1Q7MA 4MNKA 3FEQA 3AHXA 1YYAA 4F9DA 1U1UA 2VZTA 1E5JA 3T44A 3OP2A 5FL1A 1JGMA 4HK7A 3MMWA 3VAVA 1UB3A 4LAMA 4I5RA 3LCHA 3TA9A 4CVWA 2X05A 2HNHA 2CLKA 4JYFA 2EPMX 3FCPA 1L6YA 2YW4A 1C3FA 3BWWA 3DG6A 2DZSA 4YTUA 3DC0A 3GW0A 2QUVA 1MDLA 3WLLA 1P7TA 2RAGA 4XVDA 1OY0A 3ONBA 4MZ8A 3M9YA 1JI2A 2CETA 1WUFA 4TR9A 4HT3A 3N2OA 3GDLA 1PYFA 4INFA 2XP5A 1W0MA 2FTPA 3UJRA 1VJZA 3LOTA 4AVOA 3MSRA 4IJCA 4A22A 1TWSA 1XLHA 1OCBA 5D30A 4Z42C 2DV0A 3HPAA 5CPTA 4X22A 1HJUA 2VRKA 5EBUA 2RUSA 3MT1A 1ELSA 3TXVA 4RE2A 3AS1A 1E40A 2WC4A 1LLZA 3CU2A 1U79A 4PB4A 3O5FA 4NY2A 4DWSC 1XG4A 3W81A 3T0AA 4L7ZA 2POTA 3KVMA 4CNNA 3UXKA 1D3GA 1F2JA 5C70A 1S2VA 5HXMA 3VUSA 4MB5A 2E09A 1HN1A 3TA6A 4JHOA 4EXQA 3ZS4A 3TTYA 4R3UA 3S2MA 4RDZA 4HVXA 1VBUA 1XIBA 3CGMA 1R3RA 3ALGA 3M5XA 3WJWA 4I9AA 2EPKX 2ATSA 2HPIA 1NVMA 3KS5A 5EB8A 5A94A 2DEPA 1HXVA 3QLLA 4XZNX 4PBGA 2B31A 2PDNA 1RLCL 4W7VA 3L2IA 1MUWA 4CNUA 3LENA 3REQA 3LS9A 2Z7GA 4AWSA 1L0PA 4GCXA 3PJXA 4QLKA 4ODRA 3VPLA 3NQMA 3CUXA 4N42A 2VHLA 5H8UA 2CHNA 1IXPA 2CYGA 3TU9A 1NQ6A 2DG9A 1JGIA 3ZJ6A 4B5WA 1CNVA 1UUOA 5A5WA 1EO7A 1SW7A 2XVLA 3GC4A 2XP8A 2OWCA 2Z7KA 4O54A 6XIAA 3TQVA 1A3WA 3PWAA 4ZSUA 2ZZ5A 4ZFMA 1JUEA 3LHZA 3M0XA 1ZZMA 1GGOA 4GXPA 4OOUA 1C7SA 4DJDA 1JDAA 2GJNA 1KKRA 3H2CA 4LS1A 4F2UA 2YKKA 3QHMA 2Z1XA 4DLMA 1WXJA 3H2NA 5BW6A 4AWUA 2WKGA 4J3TA 4AWEA 3MQTA 2WJZA 1SMAA 4K1WA 3TZNA 3NTPA 3VGDA 4P8XA 1WP6A 3W88A 1UHVA 1W3KA 1TREA 3M6YA 2VR5A 3N3TA 3IJ7A 5B7YA 3VKAA 4E0CA 1FH7A 5GNXA 4QLLA 3CWOX 3SQLA 1DJQA 3ARXA 1FWTA 4NJJA 4LCSA 4C6JA 2FFCA 4ZQNA 3BARA 1KFKA 1LUCA 3MKKA 3B8UA 5CGQA 1K77A 1PX4A 2XPKA 3W73A 1X6UA 2OODA 5FJOA 1UJPA 1E6PA 3H22A 1JF6A 1VEMA 2FZDA 4NJKA 5I78A 2QAFA 3KP0A 5K7JA 1Q65A 6XIMA 2J75A 4OUIA 5CG0A 1UKTA 5FF2A 3O0KA 2FTWA 4FK9A 5I00A 3QPZA 4UFJA 1SJBA 3TOYA 1K8CA 4H9TA 4XG1A 4QE5A 1RD6A 3ID7A 5I77A 1JEZA 6REQA 1H60A 2GQ9A 3B0UX 4RNIA 3E02A 1VFLA 1W1VA 1ZGDA 4XZLX 3LHUA 1GG0A 4U28A 3DN5A 3APYA 2ACRA 4C1LA 5FESA 2QPSA 1YPFA 1NWTA 4AISA 3W24A 5D8ZA 1TV3A 5J5RA 4DAFA 4QE4A 3NVDA 3EMCA 2W5FA 1QAPA 1KBIA 3ZSTA 1KBBA 2GSJA 1CGXA 4DRSA 3DFQA 3V7PA 2QKFA 3KBJA 1PL9A 5GQBA 4UNIA 3T2QA 1F8MA 1GVSA 5M17A 5AN7A 4IFKA 1VPYA 1BTCA 2VYOA 2G3MA 4F8XA 2MPHA 3N29A 2FMNA 5DN1A 2G41A 3EWUA 3GFXA 4TOQA 2VNCA 5C2XA 1W37A 3WLKX 4DRIA 2Y88A 1JZ8A 3CAKA 1DWAM 1OWQA 7REQA 3VOJA 5G5IA 3IGUA 4HHLA 3MBFA 5FIPA 1J11A 4ONVA 4BI5A 2PV2A 1R3TA 3IIPA 1A5LC 2WO5A 3QVQA 1JDDA 3LPFA 2PGRA 3S42A 2V63A 1OFDA 1A0EA 3SRHA 4Z2IA 3NPVA 1Z89A 4FAPA 1G67A 4L6OA 4LYPA 2B81A 3FKRA 1HO1A 4PMZA 5I2UA 3PR2A 2J25A 3TV8A 3BOXA 2VDHA 5E6ZA 5A8MA 4RDVA 1ZBWA 5C5YA 4A35A 1W3LA 3L9CA 3O5RA 1H1NA 2VEMA 1Q2RA 3EMZA 3K46A 4ML4A 3PZVA 1A80A 3LHWA 1Z3NA 1VAHA 4K7VA 4MLJA 1VJIA 4JFJA 3ZQ9A 4PBEA 5DY3A 1S1PA 4PRTA 1GVIA 3LHVA 5FF3A 2WNQA 3WQEA 2Q8ZA 4X9SA 2JF7A 3R6IA 1GPFA 4J7RA 4P7RA 2VD9A 5CKSA 2LLEA 4US5A 3I6EA 2X2GA 2IMRA 3BV4A 3ITLA 2KE0A 1FDZA 4LUIA 5HWCA 3FA4A 1IXOA 3NZ1A 2ZQTA 2QHAA 1MZRA 1E72M 3QHNA 4LY8A 4NZ4A 2JALA 3KW3A 3CMFA 4MG4A 2D69A 2IUZA 4UTWA 3ZSSA 1YRRA 4O1EA 3MV01 1G9HA 1YDVA 3GVQA 1XLBA 1UOZA 3UVIA 4GO9A 3GKFA 1S5NA 3TJIA 1YNYA 5FJIA 4GUIA 2VGBA 5AC4A 1JZ2A 4G5DA 4MJ4A 3CLWA 3VIKA 3UQNA 4LW7A 3W72A 2HTMA 3LBMA 5MKGB 3F4WA 1UKSA 3W86A 4U84A 2J88A 1S2TA 4ZCWA 4AXKA 1UZDA 4WDUA 3QSRA 1V02A 5JIPA 5HNUA 5A8PA 1SJDA 3OHMB 3E74A 5D2XA 1JYVA 2EF9A 4AMAA 3MP3A 3UQIA 1GQJA 3PHAA 4WJXA 4XD3A 1CGVA 5IHSA 3AZRA 4Q7NA 4U85A 3L4YA 4GKLA 1RH9A 1TV2A 4KQZA 5F4WA 4MGGA 4E2VA 4X3ZA 5AHLA 3FJLA 1TTJA 5LXEA 2YDRA 2DFAA 4AD1A 3GG7A 3DHFA 3OG2A 3ME3A 3TTQA 1OEPA 1ZQ5A 2YB1A 1EDTA 2JIEA 1UQYA 2QZRA 2Z00A 3EPOA 3PJTA 3V4BA 3APTA 3GIQA 5CSSA 3UXAA 4HARA 1V7AA 2R1LA 5M5DA 3VCCA 5F2IA 2VEKA 3KAFA 1KCXA 3GWQA 3AIUA 1S2AA 1EZ2A 3S5OA 2VX6A 4JN8A 3RX3A 5A6LA 1P6BA 3POHA 1VFMA 3NAVA 1QDSA 1A53A 2QMKA 3DUGA 4Q8NA 4IL2A 1WOAA 1YXCA 1VPXA 4NZFA 4I7VA 2AQOA 5LIUX 2HVOA 4D6HA 1NY1A 3PWIA 2QPXA 1XQLA 2QCCA 1OFAA 3KCLA 5TQLA 2XP3A 4QDWA 1AQFA 4QT2A 3UZJA 2IPJA 1R7OA 2IKJA 3G77A 2WANA 3B9OA 3STEA 1X97A 2F84A 1E71M 2E5CA 3KRUA 4Q6XA 1O5RA 1SO3A 2PA6A 1XYLA 4OT7A 4IPPA 3PAJA 1DE6A 4Z1DA 4NXKA 3LK6A 1QOXA 2WCAA 4IMDA 1QUMA 3BC9A 2WYSA 1BSLA 2OEKA 3O5IA 3QY6A 5T26A 3PC0A 1VEOA 3B05A 5ABTA 5PTDA 1RALA 2D3LA 4LAKA 4JN6A 3AQUA 4ADUA 1TVNA 2CIPA 3I7QA 4L65A 4WX2A 1OABA 3APGA 3W7CA 5HR6A 1Q5MA 1EFZA 4JNYA 4LBUA 1VFFA 2FIQA 3MMDA 1LT8A 3S1WA 5JUVA 1GPWA 1AZ1A 4KIRA 1V6WA 3MKVA 2XVNA 3EDKA 4GYKA 3WDQA 2P0OA 3GS6A 2A6NA 1DKWA 1Q3NA 3C2OA 3KBNA 3HURA 4YXGA 2C15A 2CZDA 3EWDA 2ZRWA 1J0HA 1OYBA 3S83A 3MYPA 4YVXA 4XAFA 1V03A 3KCEA 3MUXA 1OX5A 4TV6A 4LF2A 4DRKA 1V5XA 2O9PA 3KOXA 3W1PA 1EL3A 3UT0A 3EWYA 1LROA 4HHHA 3RFAA 2ALDA 3TSDA 2VQTA 4XB3A 4Y9PA 3BAXA 5BMWA 4XQ6A 5JH1A 3CT2A 3COTA 3TQPA 5GJPA 4GGBA 4M81A 1RA0A 3R2GA 4N4PA 2QDEA 1TWZA 3B0PA 5AYIA 2TRSA 1T8XA 4GD0A 4GMEA 1VCVA 3IJ9A 1BYAA 4RX0A 3LMYA 3EWWA 1H49A 1NDWA 4G56A 4CU7A 1OJXA 1QHOA 3IVSA 2UZ9A 2X40A 1XIEA 5CEWA 4IGNA 4PFHA 5HWJA 1NF7A 4JY9A 1XW8A 3N6QA 3KFTA 2HBXA 4HK5A 4F0MA 4O2TA 5HW8A 1HO4A 4V15A 3U3HA 1PZ2A 3CUHA 1ICQA 2DZPA 4I5XA 1Q6GA 4GIRA 1Y5WA 2ZUVA 1W1PA 4IWWA 3THCA 4NAFB 2QVHA 5AVHA 1ML1A 3PULA 3SY8A 1XLDA 4KWUA 1FKXA 4GIYA 2E67A 5DT7A 2D3NA 5DELA 4PYSA 1RPKA 4AHOA 5DO2A 3IEBA 2QJJA 1Y8BA 4GNVA 4HQVA 3MV11 1FRBA 2INZA 2OGJA 3DENA 4ODQA 3CM4A 2VZOA 1UUMA 1JUBA 1R46A 3HOJA 4YTSA 1RQBA 5DMYA 4H8NA 4RZ4A 2I1OA 2JKAA 3CHEA 2QCMA 3DFTA 1MW0A 4M24A 4ZODA 3O5DA 4Q6JA 4R33A 4MDPA 5DRIA 2WMKA 4JS3A 3VGHA 3FK4A 3TAKA 2PU0A 1Z42A 3N19B 4M8UA 3VFLA 3QH2A 1J0JA 3URQA 5HDRA 5K9DA 1Y0OA 4HNCA 3WUFA 3S6OA 2GGIA 1TV8A 4O28A 2YXGA 4JKKA 4NYYA 2PWHA 3HO8A 4ZO9A 4YCOA 3N2TA 4TVUA 2X0HA 4XVEA 1IEXA 3CS2A 1TB3A 4UTFA 4JFSA 2VWTA 2JZVA 4JYEA 4UQCA 1H5VA 3UF9A 1FFQA 3W25A 1S3TC 1XJBA 3VOHA 1SFJA 3LBCA 1CECA 4AX7A 2Z29A 3MP5A 4LYKA 4BQ4A 2VCDA 2FMOA 1WX0A 3NQEA 2F38A 3GU2A 5HUOA 3IIOA 5E70A 3EA1A 5H8PA 3A5FA 3CHFA 3WBEA 3IUHA 4ZA0A 3LXAA 3L0GA 3WQ8A 2OLHA 3S5YA 4DRMA 1PSCA 4NNAA 2VC7A 4WQ6A 5A6TC 3KRZA 3PB0A 3W1LA 2P3EA 1ME8A 4W7WA 1MNSA 1TQXA 1LJYA 4PSPA 5G2HA 5C55A 2PDXA 4HPGA 2F23A 3JZUA 1ZS2A 2W9MA 2EG7A 4MB1A 3WY1A 1W3IA 3HIJA 1US0A 2J6VA 3FXYA 1OIMA 3MU7A 1BXBA 1AD1A 1QPFA 4DYEA 1QW8A 4J35A 2PB1A 3UPMA 2V30A 3V35A 1Y5XA 1A47A 4O11A 5I02A 4TO8A 4FHAA 3QTPA 2GJXB 2OFJA 4I9JA 4FOKA 2P8BA 1IHIA 4LB3A 1QK0A 4LAOA 1HVQA 3LQLA 2OKTA 1QR7A 1R3VA 3R11A 4C5YA 4ENLA 1W9XA 1OT1A 1XGEA 3WFLA 3MJMA 2B0MA 1RZMA 2YFNA 1EJ7L 3TWBA 3L12A 1Q6CA 3EXTA 3WD3A 4Q8VA 1I4NA 1US3A 4ZL1A 4KERA 3RJXA 5KTLA 1KXVA 3OLDA 3D0CA 4CN1A 3WJZA 4M80A 4PTDA 4Y7EA 2MNRA 1DIEA 1J0YA 2ACQA 3VNJA 1FOBA 4EP8C 4UC5A 4Y9MA 3FIGA 4AX6A 1UR8A 1HT6A 3W7HA 3CZKA 3JUGA 4UFMA 4AEOA 4M6UA 1T41A 4UTHA 5LIXX 2ZOXA 2HCVA 3CQKA 3VXGA 1VFSA 2XPBA 2PD5A 4HCHA 2QNEA 5I98A 4A2RA 1CXFA 1NOFA 1QPQA 3W26A 3W38A 4NUWA 4MNLA 1GG1A 1FQ0A 2RUDA 3OU8A 1XICA 3NDZA 4KW2A 2IPFA 3HFYA 2ICSA 1FJDA 1CBGA 4QSHA 1ME7A 3VIOA 1CB7B 3P82A 2X09A 1W2PA 3N9RA 1ZAJA 2RUQA 2ZZ7A 2V8ZA 3RYSA 3JXVA 2X1UA 3MPGA 2FDMA 2DIKA 3KABA 1MW1A 2VEFA 2TSYA 2AMGA 5I3JA 4LUTB 3NG3A 2J7CA 2C8NA 2J13A 2XVGA 1O4UA 1E56A 2FZMA 1XIFA 2D2GA 1U1HA 4PUDA 2DJLA 5A95A 4Q8PA 2ZUSA