3TO6A

Crystal structure of yeast esa1 hat domain complexed with h4k16coa bisubstrate inhibitor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
molecule keywords Histone acetyltransferase ESA1
molecule tags Transferase/transferase inhibitor
source organism Saccharomyces cerevisiae
total genus 80
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to6A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to6A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to6A02
4II9A 1IAWA 3BJAA 2C6YA 3D0SA 1P2FA 1ZG3A 1RUNA 4H89A 2JRTA 5EEHA 1M4DA 4EGYA 1P92A 1P4AA 3HRUA 2PI0A 5F48A 2UXNA 2J8RA 2QUFA 3T8RA 4RS2A 4OIQF 3TE4A 3QAHA 3BJOA 2X0LA 2YX7A 3WTTC 2PMHA 1SD5A 3R1KA 1WRJA 1IW7F 3T9YA 2MH2A 2Z11A 3O3KA 3WTVC 4UA3A 3V4GA 4LK0F 3M1EA 3REOA 4KOSA 2YPRA 1J5YA 3M8FA 2V79A 5DEQA 4YFJA 4M73A 4YIFA 2ISZA 4BHBA 3P2FA 4FX4A 2EB7A 2DTRA 5F6FA 2ZMEA 2XAHA 4LJZF 2A07F 1OR7A 2OQRA 2ZMEB 1LRZA 3WTXC 1S8NA 4ESFA 3BY6A 3EETA 2V1UA 3TCVA 4CHUA 1BC8C 5D5UB 5ILSA 3F6OA 4P5OA 3MWMA 4LGWA 4IUSA 1IRGA 5K5RA 2XKOA 4CAXA 2EFPA 4YFNF 3HSEA 1KQ9A 2XRNA 5E1WA 4OAEA 1UCRA 3I5UA 2J5PA 1K6OA 4IXAA 3WE2A 3EQLF 4N9HA 4O5VA 4KLWA 1LQ1A 2PQ8A 3ULQB 1Z6TA 1YTYA 1U6MA 1WI9A 3T90A 1EV7A 2W84A 2ACJA 3K69A 2OD5A 3WR7A 5H86A 1RZ4A 1WSUA 2DXQA 1XF8A 1S7OA 2QMLA 4XNHC 2CG4A 4EMSA 1R57A 4KT5C 3KLNA 2XAFA 1FLIA 4P96A 4CXFA 1HW1A 5JFRA 5K1YA 5JHUA 4HX7A 1YVKA 4MQVA 3D8PA 1HKTA 3WTYC 3BLNA 1FBSA 1IICA 4PSXA 2OA4A 4HNYB 1KU2A 4Y49C 2M30A 3R61A 4HX8A 4M9XA 2FSWA 4UV9A 5CJ9A 2OH1A 1L0CA 3BPXA 2VI7A 1NSLA 4D0PA 4BQAA 1EH6A 4EJVA 5DV5A 4A6DA 2M5WA 1FYKA 4HF1A 4Q4ZF 5H20A 2KIMA 1KZFA 2HYGD 3WU0A 5IT3A 3HSFA 1FYMA 1ZRFA 3IKTA 2WPWA 2UXXA 3SZPA 1M4IA 2DFIA 1J7KA 3GXOA 3I0TA 2O0YA 2D4PA 1U8RA 5HVQC 5H6QA 2ZW7A 6PAXA 4L9JA 1S60A 4NHJA 2FBKA 1J9IA 2B3VA 1RIOH 2GAUA 1XGMA 3FHZA 2A6HF 2B3UA 3TO6A 4G9YA 3KP6A 1S3ZA 4OMZA 3TKYA 3WGGA 4WWCA 2FS5A 1FWZA 4K30A 3TO7A 4J3GA 2NRAC 2NNYA 2EK5A 2KIUA 2EUIA 1ON0A 1BI2A 3VOEA 3R60A 3CUQC 3FXQA 3M9AA 1RUOA 2QQ9A 5L3GA 2XGXA 2Q0OA 1NE9A 3FMQA 4Y15A 1OYYA 2RC4A 3SXNA 4L5IA 3V7RA 4A5MA 4KVXA 3DPLC 3ABTA 1QO0D 1WWXA 1IN8A 3E6BA 1MDMB 3KP3A 4NSQA 3F8KA 5E8IA 2X7BA 1XE4A 2HGCA 5F49A 1Q2DA 4IPAA 4G6QA 5HMNA 2PFBA 2DAOA 2Q7BA 4WXCA 4EV0A 2HYFA 2J5OA 4UBRA 2IRFG 2F5IA 4QB9A 4HV5A 3F0AA 3P2HA 1DUXC 3KZZA 4GS4A 2VBQA 3O2PE 2Y48A 2UWMA 3TDUC 2IA2A 5DCMA 4UVBA 5CYVA 4RI1A 1Z4RA 4Z2YA 1T2KA 4RAYA 5JVTA 2F5DA 4JJXA 4EM1A 2FXFA 2FF4A 4EM2A 1IF1A 3DR8A 2OZHA 3SXOA 4AG9A 2O8XA 3SXYA 2F5CA 4N0BA 2NS0A 2EV5A 5KVRA 5FVJA 3L09A 4I02A 2ADUA 3R6SA 4XPLA 3HRTA 2HKXA 2G0BA 3RYOA 4DQ2A 3L2CA 1KU3A 3LSTA 3KFWX 3FXTA 4AVAA 1HBXG 2P5LC 4RGUA 2CFXA 3JAMK 2W57A 4MQ9F 1YVOA 2HQNA 2GXGA 3CUQA 3P9CA 1HSTA 3ZPLA 1LNWA 4M74A 2MA3A 2OZUA 4U7DA 4QWQA 1U2WA 5E1ZB 1FBQA 4F0YA 2FA5A 3DV8A 5H6RA 1HKSA 5FFXA 1SMTA 3KEOA 3DKWA 5BQTA 3I59B 4FD5A 5F46A 1BOAA 2KIFA 2P4WA 1KUYA 3DNSA 3FX3A 1PUEE 3J80Z 1ZRCA 4G7HF 2BV6A 1U5TC 4BH9A 3MFKA 2JZYA 2ETHA 3IKVA 4AIJA 3BROA 3LODA 3DPTA 1O3SA 3ABUA 4TV7A 1SFXA 3GY9A 3QB8A 2L54A 1CF7A 4UHTA 4YGOA 3GZ5A 5EBVA 1FBUA 5C88A 1CF7B 1LVAA 2A61A 2P5VA 2OQGA 2ZCWA 3BPVA 1B9NA 1ULYA 2IP2A 5DYMA 3ZN0A 1IB1E 2XVCA 4M3SA 3RPUA 3NQOA 4I7HA 4UV8A 4HLYA 3D2MA 2R7DA 3OV8A 3RYRA 1KU7A 4U7BA 2CWEA 2DK5A 3E3VA 2KRFA 2OU2A 1W7PB 3PQJA 2CNTA 1T0FA 3QP5A 2RN7A 5L3BA 2QM3A 3EFAA 2E1NA 4KOYA 4S05A 1TNTA 2HV2A 2H94A 5HLHA 3GEZA 3PP9A 1MD0A 3O6BB 2VOOA 1B9MA 3R9FA 2XAJA 2V6CA 1RXTA 5D5VB 2FNPA 4WF2A 3EXNA 4KIFA 4M85A 4IRIA 4KYWA 1XGOA 3HTSB 3LAJA 2REFA 2V1DA 1UB9A 1IRFA 1G3WA 3BDDA 3MQ0A 4HBLA 4U0VA 3H4QA 5E17F 3R9EA 3DEUA 2LF7A 2Z3YA 4JXQA 4EVYA 4CS0B 4R3LA 3MAJA 3GFLA 2EA4A 5KTAA 2V9VA 3N4MA 2O6GE 1TW2A 1U5TA 5HDKA 3LD2A 1FX7A 3RDIA 3E6DA 4YIIA 3TDZC 1W7PD 3FNCA 4IHTA 5ISVA 2DT5A 1U3EM 2HR3A 3C1DA 3JSOA 3WTUC 2LDUA 5IT9K 3IL2A 3SQNA 4L0ZB 2ZO4A 4FD4A 1XSVA 2VE8A 4HQMA 1PP7U 3IWFA 1MKMA 4PK2A 4WCGA 2IT0A 3K2ZA 2ZNZA 1REPC 2P7CB 4B5PB 4KOWA 4NF1A 2HKOA 3WTSC 3LAPA 2H6CA 1Z9CA 4KLVA 1I27A 2EV0A 1FSHA 1DPRA 5CVUA 2P6SA 2JLMA 2GIVA 1IXCA 1VHSA 1R00A 4OIOF 5E20A 4R3KA 4HW0A 5IT9Z 3TGNA 4XBFA 3DDDA 4KN4X 4YRHA 1TNSA 4YG2F 2STWA 2CQKA 4AD9A 2OZ6A 4Y17A 4HAMA 2CGPA 2FNAA 2F5EA 4OINF 2DPDA 2QVOA 1KUVA 4KORA 1QZZA 3KKWA 5J8CA 1W5SA 1FP2A 1EH7A 4P9FA 3G3ZA 2DK8A 4A6EA 1KUXA 3OWCA 3VFZA 4H0EA 4IHSA 2VQYA 5FFZA 3LQRA 4XPKA 2VONA 4RB3C 1YW8A 4QBJA 2JDCA 1YS6A 2B4DA 1LDJA 4KMUX 5JPHA 4JXRA 4CICA 2XV4S 1IYKA 1BI1A 2IVMA 4LLGF 3EO4A 3VWEA 3ROUA 2VXZA 5BS6A 3MZHA 3CDHA 3DP7A 2XKPA 4JWPA 5GCNA 3E6CC 1LEAA 3SHPA 1SAXA 3BZ6A 3QPTA 1ONVA 5HLGA 2NNNA 5D8LB 4I49A 2Y75A 1YGHA 3FF5A 3FYNA 5L3DA 4R79A 1FPQA 3HHHA 4HDVA 4RGSA 4UVAA 2ESNA 3R0AA 4R57A 2Z99A 1M4GA 1K79A 1J4JA 3D5LA 4A0YA 4KOUA 2Q8KA 2D45A 3LFKA 1LEBA 2Q4VA 5ED4A 3L00A 1S7FA 4HKFA 4U9ZA 5LGNA 4LK1F 5BMZA 5IV0A 2F2EA 1NMTA 3KE2A 2NYXA 4PK3A 4Q5SF 5J8FA 1WQ2A 4RB0A 3T5XA 2X4HA 3HSRA 4A0XA 1K78A 3R0JA 5D5XB 2DQLA 5DDGA 1O7LA 1IN5A 5LRSA 4EVIA 1K78B 2MC3A 4FD7A 1R36A 4LLLA 3GVAA 2Z10A 4NEXA 1J59A 1LDDA 3BOQA 1KQ0A 1TW3A 2YR2A 4ZYGA 4HQEA 5HDNA 2PRBA 4FHTA 2EFOA 3I58A 3P9KA 4HZFA 1S7LA 4ONUA 2Z5UA 4AG7A 2CYYA 2BEIA 3QU3A 5E96A 5CVJA 3FXRA 3BP8A 5D6FA 1DDNA 2PJPA 1YX0A 3CXQA 1R58A 4WXHA 2H09A 1XSDA 1LB2A 1R23A 4XSXF 4BHCA 4JLYA 1QSOA 4ZYDA 1QQIA 3GYAA 3GZ6A 3BJ8A 1IN4A 2JT1A 2Z33A 4I2OA 2BUEA 1Q2CA 2E1CA 5LHGA 5LEKA 2I79A 4PCQA 1ZLKA 1B6BA 4IRGA 2K27A 2QLZA 5DWNA 3VEPA 2KJCA 4G8XA 1I6XA 1RO5A 5HS8A 2HEOA 1R1VA 2ZBKA 2R8VA 1GVJA 2HTJA 3JTGA 4JK1X 4M9SA 4MTDA 2B5GA 2O03A 5LBQA 4UVCA 4EJWA 4LD5A 2B5GB 3IWZA 5IX3A 5CLSA 2PSWA 5FB2A 4MBUA 1HQCA 4BMHA 3HTUA 2RDPA 3EUHA 4AB7A 3N7ZA 2QBYA 1YS7A 1UHMA 2UZKA 5FLXK 2PBIA 3P7NA 3BJ6A 2CSOA 4A2UA 1W4MA 4ZYEA 3F21A 1P6RA 4XNHB 1IZ1A 1JXSA 2FL4A 2KCWA 3C18A 4MNUA 4GCVA 1BI0A 1DPUA 2HFHA 5LGTA 4IF5A 3EC4A 3NRVA 2QQBA 4RGRA 4ORFA 2BEOA 1PUAA 1RI7A 3CUOA 1GHCA 5DD4A 1JHFA 2QWWA 2IA1A 4P9UA 5BPDA 1IN6A 4RB1A 5DD8A 4X5KA 1S7KA 3E97A 5I0CA 3B8GA 2FIWA 1HKQA 1H0MA 4Y49B 3TOBA 1KQ8A 3FIXA 3D3SA 4UXNA 3IRRA 1QSTA 2VT3A 5FLXZ 2WC2A 1L3LA 3B73A 3LA2A 3WTZA 1OKRA 3CLOA 1J75A 2FOKA 1GXPA 3FB3A 2YSRA 3F3XA 4MHGA 3F8FA 1YW7A 2P6TA 4G7OF 1Q2YA 2J8NA 2PEXA 4U5YA 3HIFA 4M6YA 1XMAA 4ETSA 3U2RA 1ZARA 3E5XA 2VODA 1BJAA 5DCMB 3GKRA 3GF2A 3JTHA 3NEUA 4QLCU 4EGZA 1X3UA 5ICEA 3HHGA 1QBJA 2TDXA 3JW4A 3ZP5A 3FBUA 1C0WA 3TT2A 4RS8A 2IA0A 2J8MA 4CAWA 1CM0A 3FZVA 4BXUA 4GGGA 5ILUA 5DWMA 3WE3A 3C26A 4KOTA 1Z05A 4KUBA 4ESBA 4Q48A 1ZG5A 3TTHA 1BOBA 4KZTA 3CUQB 4IRHA 4RGXA 3RYPA 4CDGA 3FRMA 1B4AA 1YYVA 1HXDA 1O3TA 2FSRA 1UHWA 2JPBA 3V7SA 2IPQX 4CRZB 3F22A 4LG0A 3CTAA 1XGSA 3KEQA 2MLGA 4XLPF 2CO5A 2M1BA 4O6JA 3I53A 4G6DA 2EFNA 3JAMZ 2OBPA 2RQPA 3I54A 1G4DA 3CXPA 2K4BA 4P55A 5CVIA 1XDUA 1TLHB 3BWGA 4HNXB 1QGPA 2ELHA 3HYIA 2PG4A 1XMTA 3VWDA 3RIRA 2DLLA 4QVTA 4IF4A 1BO4A 1B1BA 1U6GA 4G94A 5F1RA 1VTNC 1Z6RA 2DW4A 3C7JA 3OOPA 2R3SA 3GFJA 4KUAA 4XRFA 4EQQA 4L9TA 1XGNA 5BPIA 1BC7C 2R98A 1O7FA 4OU0A 5F47A 1F1ZA 4KA4A 3Q9SA 4OADA 2Q44A 4CO8A 4HF2A 4AVBA 5BOXA 2QECA 4DNCA 1TQPA 2HUZA 4I0BA 1QSMA 1P4XA 3CO7C 2AJ6A 3G8WA 3QOPA 1OZPA 4AIKA 3MEXA 3F23A 4E8OA 4JBAA 5ICCA 3EDPA 3L7WA 4HNWB 1ZN2A 4KDPA 3LWFA 2FU4A 2OAZA 4KMFA 2QZ8A 2ZKZA 1MK4A 2C27A 3HUGA 1UFHA 1S5KA 1D8KA 1G6NA 3ECOA 4GO1A 3QP6A 4GYIA 1KYZA 4S04A 4PSWA 4FT8A 2FCKA 4PZJA 2GWRA 1MZBA 3L9FA 5LHIA 5IB0A 1MJ9A 3S6KA 5H84A 2O3FA 2DBBA 2B58A 2A68F 2L01A 1U5TB 2FRHA 2HQRA 2H6BA 2FQ3A 5ILVA 1G3SA 2V1XA 3ERED 3V8KA 2A5YB 4PDKA 4HOBA 3ZMSA 2HOEA 4IJAA 4BAYA 4NXYA 3MZYA 5HLIA 1H9TA 3S6FA 1B87A 2EFQA 2WV0A 2DPUA 2FE3A 1M1DA 1TQIA 3ZMUA 2BL1A 3J81K 3CO6C 5D5WB 4MJ8A 4UUVA 1R1TA 3DSBA 1VKCA 2R7HA 4U0WA 1QSNA 4R9MA 1S29A 4LUAA 5D6EA 2DQRA 2XAGA 1KA8A 4KNYA 2HS5A 4OMYA 4L9NA 4EJOA 3F8CA 3WTWC 2AXLA 2W24A 3U1DA 4LB5A 2A69F 2ZPAA 4QUSA 2ZXVA 3J7AO 3T1BA 4CZZA 2F5FA 3V8LA 2DI3A 3UY5A 2BSWA 2KJBA 2P0WA 4M71A 3GLXA 2L4AA 1Z4EA 2ZXJA 3TO9A 2HTSA 2VOPA 2JEVA 2P6EA 2W85A 1WKMA 2ZW6A 3F8NA 4K2EA 1Z9UA 4GXOA 4AIHA 4YFKF 2G7UA 2ZNYA 5JR3A 3GUDA 4L5JA 2XIGA 3S6GA 1SD4A 4HV6A 2E7WA 2WWYA 2P5KA 5K5OA 1YR0A 3G3SA 4MEXF 3I3GA 1YQAA 2AS5F 3WGIA 3F72A 4E70A 3PFIA 3W6XA 5TJJA 3VODA 4A12A 1T38A 1JHHA 4E2AA 1ON1A 2B4DB 4U88A 2L4MA 4KICA 1JGSA 1R22A 3F8BA 3GX4X 2VN2A 4XLNF 5D4SA 4AWXB 4HA8A 2LSOA 2B0LA 1XCBA 2BGCA 2HDCA 2GANA 3U9GA 1V3FA 3KETA 2D4OA 1TTYA 5TRDA 2EVNA 3EYYA 1ZH5A 4R87A 2EA2A 2COMA 2EV6A 2LNBA 4CGZA 1BIAA 4FX0A 3HRSA 1FY7A 5J6XA 4U9YA 1KYWA 1FSEA 2MBFA 1IIDA 4H6UA 4PV6A 2QYOA 3HOTA 1BBYA 2QQAA 1QSRA 3FM5A 4KOXA 3R9GA 1TQMA 4CRYB 2VBWA 3T8TA 2E7XA 1NHAA 1IXSB 2ISYA 3K9UA 3KZYA 4U0YA 2LKPA 4WK8F 1SD6A 1MJAA 2GA2A 1I5ZA 2FIAA 3HOSA 2K7LA 2Q04A 1HW5A 2R7FA 1ZGAA 1Y7RA 2VC1A 2GZWA 1QPMA 4ENMA 2DU9A 1QNTA 1V0CA 1L0OC 2FBIA 4BHPA 1B59A 3ZMVA 1D8JA 5E1XA 1R7JA 2CNMA 3FXUA 4OOIA 4KUMA 2ZJ2A 4JQFA 1IUYA 5L3EA 4ENNA 1S7NA 3RPQA 4MY0A 4JD6A 3LA3A 4ZH4F 2GE3A 2ARHA 3R96A 3TOAA 3ECHA 5F64A 5CNPA 2IW5A 1BM9A 4AVPA 2FXAA 2Q2EA 4B8XA 3GW2A 4NQWA 3MGDA 3E6MA 3WGHA 1F9NA 3EYIA 2VZZA 4QC6A 4OIRF 4XPDC 2K02A 3ZMDA 5D4RA 2A4NA 2M8EA 2H27A 2VBXA 3RKWA 2RVCA 2Q0YA 5JQ4A 2K4JA 2FMYA 3AAFA 2VEZA 5AIQA 3ZQ7A 1CJWA 5JI6A 1TIQA 1QZYA 4KIBA 2RNJA 4LLNA 3K1NA 3H3ZA 1J0RA 2D2WA 5ERIA 4MI4A 5KK1A 2LF8A 2ESHA 4WX9A 1K7AA 3HRMA 2BE5F 3K1PA 3W6SA 2NAZA 4HX4A 2G3AA 1YO5C 2W25A 3E5QA 4I98B 3DFGA 1ZRDA 3S2WA 3I71A 1GHEA 4I01A 1SD7A 1U78A 3PGPA 2PN6A 4L89A 1ZAOA 4H6ZA 2A3SA 1SFUA 1W5TA 1I12A 4E0AA 1XSXA 2BBYA 3KLOA 4R8HA 4M6XA 1ZREA 1IYLA 3JUWA 1ZYRF 2CNSA 4UWIA 2K86A 3I9SA 1T39A 1I1SA 1LJ9A 3WU1B 3K0LA 2QBYB 5LLQA 4MY3A 3QPHA 4PGGA 1KGSA 1HSJA 3K9TA 5K5QA 1GXQA 1N71A 3KP2A 3V8JA 3E0KA 5A2QK 2PR1A 4M72A 1FC3A 1SQHA 2EFWA 1I1GA 4HLXA 1OPCA 2JDDA 5E18F 2HQYA 3IRQA 2VE9A 4LX9A 1SFEA 2K5TA 3PQKA 1YIOA 2EJRA 1P0HA 4ENKA 1USTA 1XIXA 5FD5A 4KFCA 1RNLA 1YLFA 3N97A 2XUBA 2PMUA 4XPDB 1XD7A 3F5BA 3E5UA 2QIRA 1B6AA 2P8TA 1G3YA 1KU9A 3JSPA 1ON2A 2WTEA 1MDMA 5EC4A 4G7ZF 3VB2A 3H3UA 3PZJA 3IGRA 5KTDA 3G73A 3KCCA 3DQVC 3JVNA 2QENA 4RB2C 5A2QZ 1Y9KA 1BN5A 2XASA 5ICFA 5DCFA 4EJUA 2D1VA 5FGMA 3D2PA 1SMYF 3M7GA 3V7CA 1P4WA 2HZTA 5FD6A 1H9GA 3KP5A 1FOKA 5L3FA 2VBYA 1YLEA 5AONA 1Q1HA 1ZHFA 4NCZA 4L9VA 5DUKA 3ZN1A 3ISPA 3T0YA 3F6VA 2GQQA 3I4PA 4A5NA 3IWGA 1ZG1A 4UNOA 2ATRA 1MGTA 2OZGA 2BYVE 3ZMZA 3LQQA 2STTA 2FE7A 2I00A 1K4JA 1MJBA 2EWNA 4GYGA 4HYEA 4ENJA 4R1HA 1S6LA 1D3YA 3RKYA 5FO5A 1Z91A 3CJNA 4L8AA 4EM0B 5HS9A 2O61A 4I09A 1Y0UA 1O57A 2Z0ZA 1S3JA 3DXJF 4XSZF 1Z7UA 4NB5A 2PDOA 4MEYF 2DO7A 2Q4YA 3J80K 5LGUA 2XHKA 4LG0B 1FNNA 1FYLA 1XEBA 3FM3A 1M44A 4CAVA 3Q9VA 4MGRA 4L18B 1XDSA 2L3DA 4MTEA 4CYDA 2ZW5A 2NMTA 4LB6B 4ZZLA 5CVRA 3R95A 2G9WA 1ZLJA 2P6FA 4A0ZA 1STZA 1TBXA 5ICGA 3I59A 3GYHX 2PLYA 2FBHA 2VBZA 4UWJA 3TFYA 3SFZA 2PR8A 1E2XA 4PGHA 2VZYA 1Z1DA 2RV8A 4ESJA 3V8IA 4KIGA 2FMLA 1ODDA 4ZBGA 1JE8A 1XB4A 2JPCA 4WXDA 4IVNA 3I64A 5D8KB 3NE7A 1F4KA 1PP8F 4Y13A 2GXBA 1LDKB 1ZGJA 4KVME 1A04A 1J2XA 1YFHA 1F5TA 4EJTA 1HW2A 2KKOA 2B4BA 1I21A 3K1MA 4KOVA 1OYWA 1W7PA 4Q47A 3B02A 2Y0MA 1BIBA 1EH8A 1R1UA 4LFUA 3FMSA 4ON0A 3BJ7A 2G7HA 4F6AA 1IXRC 1S7AA 3H92A 3Q5FA 4N9IA 3W6JB 4FD6A 3IHUA 5EEGA 1Y9WA 4YFXF 2REEA 3ZMTA 1BI3A 2ZFWA 3QU6A 1WWZA 1FP1D 2VT2A 3WODF 2G3TA 2CW0F 3C3WA 3S6HA 3R4KA 2XAQA 4I0AA 4O3MA 4KN7X 3IC7A 2RGVA 1O3QA 2ZW4A 1P4NA 1R5GA 1OYIA 1V4RA 4AVCA 1O3RA 2FEZA 3RJPA 1AOYA 3DR6A 4KVOE 2WPXA 5AIPA 2OB0A 1USSA 3RTRA 1D5VA 2CY2A 2Z9OA 1PDNC 1T6SA 4MHDA 1XCVA 2R1IA 3EY5A 2L02A 2MD5A 1R5HA 2PC1A 2RKHA 5LHHA 2VXKA 5KTCA 3GO5A 2D1HA 3FWEA 3WG9A 3SZTA 3W91A 2YU3A 5HH1A 1FT9A 3QRFF 1YK3A 3ML6A 5L3CA 2GA1A 5C82A 5LRRA 2YX4A 1T98A 1YG2A 4RAZA 2XROA 1OMIA 4HF0A 1YW9A 3P9IA 1IN7A 2JSCA 4ASNA 2MH9A 4M9ZA 3COAC 1YREA 1PU9A 4B5PA 1E17A 5DUIA 1FZPB 4BYYA 3LA7A 2M45A 4B09A 1DP7P 3GWZA 4OIPF 3DF8A 3J81Z 5HS7A 3ZZIA 1XMKA 2AE6A 4ZYHA 2HWVA 5CVVA 3KP7A 2VC0A 3MCZA 2IJLA 3ZJ0A 4HDUA 1WK4A 2M87A 1G3TA 3FMRA 3F8MA 1UFMA 2P7VB 5HDGA 1AWCA 3TQNA 2IL4A 5HOOA 2P6GA 4ZZDA 3RKXA 3M8EA 3SHFA 3KP4A 2MLKA 2A6EF 2O28A 3ELKA 5E8GA 4F7ZA 5LEJA 4LMYA 4BNCA 3RI4A 1XN7A 4L0YB 2JTVA 1CGPA 2H5MA 2FT0A 3CXSA 3GFMA 4B5OA 4OLLA 1I1DA 3GFIA 3W6KB
chains in the Genus database with same CATH superfamily
4II9A 5HNHA 1IAWA 2JJ7A 4AIDA 3CD6I 1BUSA 3B35A 3ZQIA 5JGFA 3BJAA 3OIOA 1EE3P 5EYRA 4HGUA 2C6YA 4RBOA 3D0SA 1E0EA 3SGBI 1YRNA 1P2FA 1ZG3A 3IH4A 1RUNA 2JRTA 1VQ4I 2WADA 2ODDA 4MPIA 1Z8XA 2PJBA 4H89A 3NAUA 5EEHA 4EGYA 1P92A 1YRNB 1FOXA 1M4DA 4OC2A 1P4AA 3HRUA 2PI0A 3M3YJ 5F48A 3O8HA 2UXNA 4FCYA 2J8RA 2QUFA 3T8RA 4XRMA 4RS2A 4OIQF 1KZHA 3TE4A 3QAHA 2ELKA 3BJOA 3S16J 5KHDA 2X0LA 2Y9ZA 1Y1WJ 2YX7A 4XLHA 3WTTC 2X85A 2PMHA 1SD5A 3R1KA 1ZLHA 1WRJA 1IW7F 3T9YA 2MH2A 2Z11A 3O3KA 3PFOA 1R5ID 5AG4A 3TW7A 2FJ1A 3WTVC 4UA3A 2JVGA 4LK0F 3V4GA 4FE4A 3M1EA 3S8PA 5M3FJ 2ZELA 3REOA 1LOKA 3ISZA 2QKMB 1LR8A 4KOSA 2YPRA 1J5YA 3M8FA 2V79A 5DEQA 1TIQA 3DTIA 4R8FA 4E7LA 4YFJA 4M73A 4YIFA 1RTQA 5CBMA 4YWYA 1XRYA 2DN0A 2ISZA 4BHBA 3IH2A 3P2FA 4FX4A 5TGTA 2EB7A 3H35A 2DTRA 5F6FA 2K9LA 2ZMEA 3CLQA 2XAHA 4LJZF 3CCQI 4GFBA 2A07F 4EWTA 1OR7A 3KPHA 2CWHA 2N8GA 2OQRA 2OPTA 2ZMEB 1DGRM 1LRZA 3WTXC 2YUSA 4NGQA 2W48A 1S8NA 4ESFA 4JX6A 2ODFA 2R5ZA 4M3DA 3BY6A 3EETA 2V1UA 5A28A 4B44A 3TCVA 2WYRA 4CHUA 2I5UA 5J4YA 1BC8C 3GTGJ 3AG3H 3OS0A 3HDDA 5D5UB 5ILSA 3FECA 3FXKA 1CE3A 1BLLE 4B43A 2E5NA 3F6OA 4P5OA 3PRTA 1QVUA 5B3SH 3MWMA 4LGWA 3OOUA 3AG4H 4IUSA 1IRGA 1MBGA 1Y8FA 5K5RA 2QQ8A 2XKOA 4HSRA 3OS1A 3IV5A 1HJAI 4CAXA 3PFEA 2EFPA 4YFNF 3HSEA 1OCOH 4ZYQA 1DU0A 5J4VA 1KQ9A 2XRNA 3G1OA 5E1WA 2K9NA 4ZDLA 3HG9A 1UCRA 3BT9A 3I5UA 4RMNA 4OAEA 2J5PA 1K6OA 4IXAA 2K9MA 3WE2A 5IOYA 3EQLF 1EA3A 4N9HA 4UFWA 4A39A 4O5VA 1IG7A 3GTLJ 2AQEA 4XKWA 1P9QC 4KLWA 2BXYA 1PVEA 2PQ8A 3ULQB 1Z6TA 2VKDA 1LQ1A 1YTYA 2NU0I 2LR8A 2NU1I 2SGFI 1WI9A 3L2QA 1U6MA 3CQZJ 5J40A 3WABA 3T90A 1EV7A 3D68A 3FK6A 3OXGA 2W84A 2XSDC 2ACJA 4CCKA 3OYKA 1JGGA 2CIJA 3AG1H 3G4SI 1MSFC 2O53A 3K69A 2OD5A 1GVDA 2DJNA 2F3CI 5H86A 1RZ4A 3WR7A 1WSUA 2DXQA 1XF8A 1S7OA 2QMLA 5LRJA 4XNHC 2JA1A 2CG4A 3SI2A 1QPIA 2DA6A 4XNHB 4EMSA 1OQYA 4BE2A 1R57A 5BWAB 3BLYA 4KT5C 5G22A 3KLNA 2XAFA 1FLIA 1HOMA 1BJZA 4P96A 4CXFA 2Q2EB 1HW1A 4NQWB 3G71I 4CAFA 3M8JA 5JFRA 2XEIA 5K1YA 5FUXA 4MCRA 5JHUA 1ULMA 4PJJA 3AL0B 2XGDA 2DMUA 4HX7A 2V1CC 1YVKA 4MQVA 4CPAA 3D8PA 1HKTA 1ETVA 3IC1A 3WTYC 3BLNA 1FBSA 4LQGA 1IICA 4PSXA 3LSGA 2OA4A 2CJSC 4HNYB 4OAZA 3HGYA 1LPQA 3J7AY 3EUAA 1KU2A 1T33A 4Y49C 1Y39A 3CF2A 2M30A 3R61A 3PNYA 3MN8A 4C68A 4HX8A 5EGOB 1TWAJ 4M9XA 2Q4ZA 3KQXA 5HVFA 2FSWA 4UV9A 5CJ9A 1LFWA 1T8IA 1R43A 4RAGA 4DYCA 2OH1A 4UCPA 1L0CA 1XC5A 3BPXA 4MLOA 1VQMI 2VI7A 3FIWA 1NSLA 4D0PA 4BQAA 3WC7A 1EH6A 2VL1A 2AFWA 1TOTA 4EJVA 5DV5A 5DM6F 2ZEPA 2KMRA 4AM3A 4A6DA 1IRXA 2M5WA 3ZQCA 1FYKA 4HF1A 2F4OB 2C6GA 4Q4ZF 5H20A 2ABZA 1ULNA 2KIMA 1KZFA 4CCMA 2AFXA 2HYGD 3H0DA 3WU0A 5IT3A 3HSFA 1FYMA 1ZRFA 3OL0A 1N13A 3H5AA 4GDFA 2IS4A 1TL8A 3IKTA 2ZEFA 2WPWA 1OCPA 2UXXA 3VDUA 3SZPA 1M4IA 4QIWN 2DFIA 1TF9A 1GYTA 1J7KA 3GXOA 2B7EA 3JRFA 4TWEA 3I0TA 4JZ0A 1Y8RB 5HQ8A 1IY5A 3L2RA 1SGNI 2O0YA 2K40A 4OIWA 1MBEA 2D4PA 1U8RA 5HVQC 3H9GA 5H6QA 2CJJA 4WJBA 2F8HA 3FF3A 4B3XA 2Z3LA 2ZW7A 3QOEA 6PAXA 1UVGA 4L9JA 1S60A 2K3FA 4NHJA 2FBKA 1J9IA 1CGJI 2B3VA 1RIOH 4NGTA 2GAUA 5J1QA 1XX6A 1XGMA 3FHZA 1BA5A 4KSAA 1WPKA 2A6HF 3KQZA 4F9VA 5LRKA 3DWLE 1UG2A 4UY8I 2B3UA 4X1EA 3TO6A 4G9YA 1EKEA 3KP6A 1KMAA 3ABMH 1S3ZA 1NG7A 4OMZA 3TKYA 3WGGA 1IY7A 4XORA 4WWCA 2FS5A 1FWZA 4K30A 5F04A 2AQFA 3TO7A 3VYUB 2NYQA 2CRGA 2NRAC 2WZNA 2QSGX 2NNYA 4J3GA 3S1MJ 2X48A 2EK5A 2KIUA 1CGII 2KIQA 2EUIA 1ON0A 3S2HJ 1BI2A 3VOEA 1JQGA 3R60A 4B11A 1N78A 2GU2A 4X2TA 3CUQC 3FXQA 5E3QA 3M9AA 3GMEA 3TX8A 1RUOA 2QQ9A 1LFPA 2O8KA 5L3GA 3BG9A 2XGXA 2KCWA 1HDPA 1R9TJ 2CUEA 4G12A 2CV1A 2Q0OA 4A3JJ 2RIJA 1DTDA 2DJIA 2X1DA 4PJ0C 1NE9A 3FMQA 2M2EA 4Y15A 2V1CA 1OYYA 2RC4A 3SXNA 4L5IA 3V7RA 4A5MA 4ZDOA 4KVXA 3DPLC 3ABTA 4CYOA 2H1LA 3IJ3A 1QO0D 1WWXA 2BCOA 1IN8A 3E6BA 3OR2C 3WG7H 3KP3A 5JLWA 1MDMB 2EBJA 1YE9A 4NSQA 3F8KA 1IV8A 5E8IA 2X7BA 2VQGA 1XE4A 2HGCA 4QTRA 5F49A 1A6IA 1Q2DA 4IPAA 2P81A 4G6QA 5HMNA 2PFBA 2DAOA 4XRSG 2AFUA 5FKOA 2Q7BA 4WXCA 4EV0A 2W82A 4NDLA 4PJNA 5TISC 1A2ZA 2HYFA 2J5OA 2CMPA 3G6EI 4UBRA 2IRFG 2F5IA 2E60A 1UHSA 4QB9A 3FHNA 4HV5A 3F0AA 3CC7I 2PRQA 3B7IA 4IHMA 5DS0A 2DYRH 1V5FA 2ZXHA 3BTCA 4BGDA 3P2HA 1DUXC 5CPRB 3KZZA 3L2VA 4GS4A 2ENNA 2VBQA 4M6VA 2JA6J 1R79A 3CJRB 2KMOA 2ECCA 3O2PE 2Y48A 4ZYAA 2LBFB 2BHZA 4BS9A 4OAYA 2UWMA 3TDUC 1TUSA 2IA2A 3A03A 2KMPA 1ETXA 2OJED 2X6YA 2K5CA 4UVBA 5CYVA 5DCMA 5KAFC 1YJNI 4RI1A 4F8ZA 1VI0A 4A24A 3DCFA 1Z4RA 1I50J 3R5AA 4Z2YA 3H5RA 2RNGA 3LOCA 4DBRA 1T2KA 3FEDA 3RZDJ 4RAYA 5JVTA 1HDUA 2F5DA 5IPAA 4EM1A 3OYIA 1IJWC 2FF4A 3K4LA 2SGQI 2I8DA 2FXFA 4EM2A 1IF1A 4UUTA 3I56I 2D5VA 2XB0X 2W1OA 3LSHA 2OZHA 2DF5A 1JKPC 3DR8A 3SXOA 1CPXA 2O8XA 4AG9A 3VYSB 3QWPA 3SXYA 4LIVA 2F5CA 3FISA 4N0BA 4BXFA 2DA3A 2NS0A 1A35A 2EV5A 2HC9A 2DA7A 5KVRA 5FVJA 3L09A 1VDDA 4I02A 2L2OA 2ADUA 2X1EA 3R6SA 5BNGA 3OYFA 1CHOI 1YU6C 4XPLA 3CP8A 4MCPA 2Q43A 3HRTA 3WC6A 2HKXA 1JKOC 2G0BA 3RYOA 2OUMA 4DQ2A 3L2CA 4M3EA 1KU3A 3LSTA 3KFWX 4KJZA 3FXTA 2H8WA 1T0FC 2PX9A 1HBXG 4AVAA 4D5FA 1HA8A 4L5EA 1K4SA 2OOTA 2P5LC 1B8IB 1F2OA 4RGUA 2CFXA 2Y9YA 4FQGA 2CU7A 1S5LC 2GIZA 3JAMK 2RQQA 3GZNB 1ZK8A 4IHYA 2W57A 1NG6A 1P7JA 4MQ9F 2GLFA 4K3NA 2L9SA 1YVOA 2HNHA 4MHPA 1MMGA 1CBXA 2HQNA 2GXGA 4MFPA 3CUQA 4P4BA 3P9CA 1HSTA 2PJ1A 2Z3OA 2HXOA 5EX0A 3ZPLA 1AMPA 1LNWA 4M74A 2CUZA 2MA3A 2OZUA 4U7DA 4C3IJ 1BW5A 2A20A 3D7FA 4QWQA 4UCMA 4B6DA 2K85A 2VJ5A 4OKOA 4OC3A 1U2WA 3K4BA 5E1ZB 3K4CA 1FBQA 1XX5A 4DYOA 2MD0A 2FA5A 4F0YA 2A5WA 3DV8A 5H6RA 1HKSA 5FFXA 1SMTA 3KEOA 3DKWA 5BQTA 3I59B 3FXLA 1HCRA 1RR8C 4FD5A 5F46A 2PJ8A 1BOAA 1U8BA 1PTQA 2KIFA 2P4WA 1JKQC 3VSLA 2Z2SB 1HEVA 1KUYA 3DNSA 3FX3A 4DJAA 2JWTA 2JEWA 4MO7A 4R7MA 4L9MA 4UXJA 1PUEE 3J80Z 1ZRCA 2DOFA 4G7HF 1P9GA 3TL4X 2BV6A 3A01A 1U5TC 3LNQA 3MKYB 2HVQA 1X4SA 3PNVA 4BH9A 4E6KG 2JZYA 1R6RA 3GCMA 1FIPA 2ETHA 4XKVA 3IKVA 5H2FC 3A01B 3CCUI 4AIJA 3BROA 5GPCA 2DEAA 5CPAA 1RR7A 3LODA 2UUZA 3DPTA 1IDYA 4CCOA 1O3SA 2ENZA 2TCTA 3OL3A 3ABUA 3ZXSA 1MMDA 5IP9J 3OYDA 1ZGWA 4TV7A 1SFXA 3GY9A 3QB8A 2L54A 1CF7A 4UHTA 4YGOA 3MN2A 3GZ5A 1QA6A 2DDAA 4M6GA 5EBVA 1FBUA 5C88A 1CF7B 1LVAA 2A61A 5EG0B 2Y0SN 2P5VA 2OQGA 2VQHA 3BR6A 3BR5A 1OLTA 3PUBA 2ZCWA 3BPVA 4UUSA 3LSRA 1R4MB 3VPRA 4A31A 1B9NA 1ULYA 2WSAA 2IP2A 5DYMA 3ZN0A 3B2YA 1IB1E 2FOWA 5EMIA 2XVCA 4UUSB 5FUVA 4CSWA 4M3SA 5AG6A 2E34A 2KLOA 3RPUA 1Y56A 2IEKA 3NQOA 4I7HA 4UV8A 3CCEI 2CV2A 4HLYA 1OVOA 3D2MA 3KZWA 4P4JA 1F57A 1Z21A 2R7DA 3FBNB 4MFEA 2JBJA 3PM1A 1YTPA 2NSMA 4RUHA 3OV8A 2X3TA 1DS2I 2LFBA 3RYRA 1KU7A 5J3LA 3B3VA 3PDNA 4U7BA 4MFZA 2CWEA 2DK5A 5A27A 4TNUA 4NJQA 3E3VA 2KRFA 2OU2A 1W7PB 3I3LA 2AFZA 2OV7A 2XSJC 3OYCA 3PQJA 5FJ8J 1MMNA 2ME0A 1Z2LA 2CNTA 1Z3YA 2PIZA 2HPIA 1ZG9A 1UAAA 3TMOA 1T0FA 3QP5A 1FTZA 2RN7A 4FASD 5L3BA 1R3NA 4A3IJ 2QM3A 3EFAA 2E1NA 2CTCA 4S05A 4KOYA 1TNTA 1XMXA 3GBGA 2HV2A 2H94A 1X1DA 4BKXA 4BU2A 3GEZA 5GADJ 1WHUA 5HLHA 3PP9A 1MD0A 2OD1A 2JW6A 3O6BB 2VOOA 1B9MA 3MKWB 2XAJA 3D5SC 3DBLB 1AKHB 2V6CA 1RXTA 3R9FA 5D5VB 2FNPA 4WF2A 5E3PA 3EXNA 4KIFA 4M85A 3C2GA 3HBLA 2IAIA 1OCRH 5J1UA 2BOAA 4IRIA 4KYWA 2EPFA 1G8XA 1XGOA 1GDTA 3HTSB 2C6PA 3LAJA 5EF6A 5IP7J 2REFA 4UEEA 2V1DA 5D8NA 1UB9A 1IRFA 1G3WA 2R7QA 2MC4A 1SGRI 3BDDA 3ZRGA 3MQ0A 4BQQA 3OY9A 3CPAA 4HBLA 4XR6A 2VQLA 4U0VA 4HG2A 2W7NA 4MFJA 2R4GA 3ZQHA 3H4QA 5E17F 1W1WE 2CS3A 3R9EA 3HOUJ 1Z77A 1MBFA 3DEUA 4CUGA 5DM7F 1VNDA 1MT1A 2LF7A 2XEGA 2Z3YA 4CGLA 5HVHA 4JXQA 1QQ9A 1CSOI 2PJ5A 3DBHB 3JRAA 1HEEA 3OYHA 4CS0B 4EVYA 4R3LA 3MAJA 3GFLA 1HPTA 2EA4A 2DA1A 5KTAA 4BY1J 2VKHA 4CCJA 2V9VA 3N4MA 4CA0A 4BEHB 3S3OA 1V5EA 1E3PA 2LG4A 2HOTA 3TC8A 2O6GE 1IOFA 1TW2A 1U5TA 5HDKA 1OFCX 3D7GA 2QQEA 3LD2A 3BQYA 3H0GJ 1X4PA 2CUJA 1FX7A 5EJCA 3RDIA 3E6DA 3HEFA 4YIIA 3TDZC 1W7PD 1YJWI 3K4JA 3FNCA 4IHTA 1BR1A 5ISVA 4S0HB 1G2HA 3I55I 2CQ7A 2DT5A 5F0CA 4ZDPA 1IO2A 2NU2I 1U3EM 1MBHA 3GLJA 2V6EA 2HR3A 3C1DA 3BI1A 3D67A 1MMAA 3JSOA 4R6TA 4ZI6A 3WTUC 2LDUA 3A1YA 5B66C 1CT4I 5IT9K 4J19A 3HJEA 3IL2A 3SQNA 4L0ZB 2ZO4A 4FD4A 1XSVA 2VE8A 4HQMA 2M4GA 4U87A 4AU7A 5K7HA 1PP7U 1MNMC 4YIRX 3IWFA 1MKMA 4X0GA 2N52A 4AYBN 2ZEDA 4PK2A 5J1YA 4WCGA 2IT0A 3VH9A 3K2ZA 2ZNZA 1REPC 1Y8QB 2P7CB 1NTCA 4B5PB 2CWFA 4KOWA 4NF1A 3CCMI 2HKOA 3WTSC 3LAPA 3RAMA 4WWVA 2PJ9A 3IAM2 3GTMJ 2H6CA 3WC5A 2E19A 1Z9CA 5JVGF 4B14A 4KLVA 2UVOA 4A38A 1I27A 4Q36A 2KPMA 2EV0A 2Z3MA 2QGUA 1WVRA 1DPRA 5CVUA 1FSHA 4CYNA 2P6SA 2JLMA 2GIVA 1IXCA 1VHSA 1R00A 4OIOF 1A5JA 5E20A 4R3KA 4HW0A 5IT9Z 1GUUA 2DDBA 2QCOA 3TGNA 1EF4A 4MCQA 3PSFA 4XBFA 3DDDA 4CCLA 3FJUA 4KN4X 1PCAA 4YRHA 5LRGA 3W6KB 4DYQA 1TNSA 2JQ7A 3HLPA 4YG2F 2NVYJ 3VYTB 4A3FJ 2HOAA 3SEZA 2STWA 2CQKA 3UEYA 4AD9A 1SVLA 2OZ6A 3S93A 2DOEA 4Y17A 4HAMA 3S9MA 1P9ZA 3OSFA 2CGPA 2FNAA 1LFUP 3D7DA 2F5EA 2N1AB 3PNTA 4OINF 1B72A 3RZAA 4E7KA 4MFLA 4XLCA 2DPDA 1LAMA 4X8IA 5F1JA 5IB9A 2IBDA 2QVOA 2WAQA 3FK7A 5GPAA 1DP3A 1YW6A 1I6HJ 1KUVA 4KORA 4DJLA 3SDGA 1OBRA 1QZZA 3QWLA 3KKWA 4A69C 5J8CA 1W5SA 5KNLA 3HOVJ 4RAFA 4NC8A 1EH7A 1FP2A 5GAGJ 2M0MA 4P9FA 4MIMA 3G3ZA 3I4NJ 2GOXB 2BZTA 2LH9A 4LOCA 3B3TA 3QNVA 3X2QH 3SJEA 3H1CA 1FAQA 2QQ0A 5C4JJ 2DK8A 4A33A 4A6EA 4C3JJ 1KUXA 3OWCA 3VFZA 4H0EA 4IHSA 2VQYA 1S72I 1WKXA 2V9PA 1ZLIA 5FFZA 2R7TA 3LQRA 4XPKA 2Z3NA 4CZCA 4RB3C 1YW8A 2VONA 4QBJA 3HPHA 2JDCA 1YS6A 4XLEA 2B4DA 2ANPA 1LDJA 2ZSIB 2VL8A 4KMUX 2WY8Q 5JPHA 1ETWA 4JXRA 2L9NA 4CICA 3A02A 1LVKA 1I3QJ 4X6AJ 3E59A 3S1RJ 3KYDB 2X6OA 2LKSA 1U5KA 2XV4S 2GLOA 5GP9A 1IYKA 1BI1A 4E7ZA 2IVMA 4FISA 4B12A 1W36D 4LLGF 3EO4A 3VWEA 1SGYI 3ROUA 2VXZA 2DFEA 5BS6A 2R7WA 5M5WJ 3MZHA 3CDHA 3DP7A 2DOAA 4F91B 1CG2A 4CAEA 2XKPA 4A32A 4JWPA 5GCNA 3E6CC 1FARA 2ORVA 1LEAA 2EK9A 3SHPA 1SAXA 3QAYA 1ZR2A 3OYGA 5FRNA 3BZ6A 2LY9A 4E7JA 1XMBA 2AFSA 3O8GA 4J00A 3H8GA 3QPTA 1ONVA 5HLGA 4BJTA 1VQ6I 2NNNA 5D8LB 1WH5A 1UUCA 4HNVA 4I49A 1POGA 2Y75A 5M3MJ 4IK2A 4IQJA 4KSFA 3FKIJ 3FF5A 3K7AJ 1ETYA 2ORWA 1W0UA 1YGHA 3FYNA 1ARLA 5L3DA 1X58A 4R79A 2PVVA 1FPQA 3HHHA 3A9LA 3QYEA 2KP6A 2UV1A 4HDVA 1Z2IA 4PJLA 4NJRA 2R5ZB 1WJBA 4B10A 4RGSA 4UVAA 2ESNA 4UFVA 3R0AA 3K70D 1K61A 1DE4C 5LYIA 4R57A 2Z99A 1WJ5A 3BR0A 1M4GA 1K79A 1J4JA 3D5LA 4A0YA 1W5CC 2M34A 4KOUA 2Q8KA 2DTZA 1IV6A 4RA2A 2D45A 1VQLI 2FD5A 3LFKA 4DGWB 1LEBA 1ZG8A 2Q4VA 5ED4A 5E3RA 3GTQJ 3L00A 1S7FA 4C2ZA 2PJ4A 4HKFA 4U9ZA 5LGNA 4LK1F 1TZLA 5BMZA 5IV0A 3RQ4A 2F2EA 3MEKA 1WJFA 2VXDA 2GKRI 1CPSA 3KE2A 2NYXA 1NMTA 4M6HA 4PK3A 4Q5SF 2ID3A 3HOZJ 3S9NA 5J8FA 1WQ2A 4MFDA 4AYBA 3IUOA 4RB0A 3EUHC 3T5XA 3BHXA 4OC0A 1V55H 3CMYA 2X4HA 2QVPA 1V1IA 1ETOA 1MH4A 3HSRA 1QMUA 3B3WA 4A0XA 1JT0A 1K78A 3R0JA 5D5XB 2DQLA 5DDGA 1O7LA 2KCXA 4CYPA 1IN5A 4LIUA 1X3ZB 2M8GX 5LRSA 4EVIA 1K78B 2MC3A 2EBIA 1E3OC 4FD7A 4PK4A 1R36A 2DMNA 2Q7SA 2J9RA 2XGCA 4LLLA 3GVAA 2Z10A 2XF6A 3RKQA 5FUYA 4NEXA 2LY2A 4C7HA 2JBKA 4IOAF 2AO9A 2CUFA 1T95A 4YU9A 1J59A 4XONA 3LMMA 3QODA 1VQOI 2AHQA 5GAHJ 2NVXJ 1Z8TA 1LDDA 3BOQA 2F7VA 4A95A 1FT7A 2PIYA 1Z5RA 4HPSA 1KQ0A 1TW3A 2YR2A 4ZYGA 4HQEA 3KY9A 5HDNA 4MMOA 2PRBA 4FHTA 2EFOA 3I58A 3NH5A 4C2YA 3P9KA 4HZFA 1S7LA 4AB7A 5LFAA 4ONUA 1VGYA 2Z5UA 5F0HA 2POKA 4AG7A 2EH3A 1OCCH 2CYYA 2BEIA 3QU3A 5FUWA 5E96A 3I4MJ 2VJJA 5CVJA 4M3GA 3FXRA 3ZGKA 3BP8A 3HC7A 5D6FA 3S3NA 3IWWA 5G1ZA 2L8EA 1DDNA 1BMOA 2PJPA 2JZMA 1YX0A 5JHWC 2V53A 1R58A 3CXQA 2WY7Q 4WXHA 1BW6A 2PJ6A 2ROWA 4ZX8A 2DCEA 2A6TA 2H09A 4OWRB 1XSDA 1LB2A 5B1AH 3IP4B 1SFOJ 1R23A 4XSXF 4BHCA 4JLYA 1N25A 1QSOA 2PMZN 2E5RA 1RKTA 4FE7A 4ZYDA 1QQIA 2K9SA 2L9VA 1Z3XA 3GYAA 2GXAA 1AUGA 3GZ6A 1SVOA 3GTKJ 3BJ8A 2QKLB 4BJ6C 1IN4A 2JT1A 2Z33A 3JRDA 4I2OA 2BUEA 2BW3A 3ASOH 2AXTC 1Q2CA 2E1CA 5LHGA 4II2A 5LEKA 1XA6A 2I79A 4PCQA 2BW3B 1ZLKA 1TWCJ 2CQQA 4UXHA 2LMDA 1B6BA 4IRGA 2K27A 1F2PA 2QLZA 2Y31A 5DWNA 3VEPA 3H9QA 4EFDA 2KJCA 3SJMA 4G8XA 1I6XA 4UIBA 1RO5A 4NGSA 1APLC 4BE1A 1O4XA 5HS8A 2HEOA 1TBQR 1W3SA 1R1VA 2ZBKA 2R8VA 3MKLA 3KI9A 4BINA 2DIPA 1GVJA 2HTJA 3JTGA 4JK1X 1X2MA 4JYKA 4M9SA 2JA7J 1E3HA 4MTDA 2OC6A 4MFQA 2B5GA 2O03A 5LBQA 2E2IJ 4XK4A 1H88C 1ACIA 3FX6A 1Z0XA 4NGPA 4UVCA 4EJWA 4LD5A 1FYBA 1IGBA 2EINH 4Z6YA 2HQAA 1M4LA 3IWZA 1LR7A 5CLSA 3IAS2 2B5GB 2J9AA 3H3VK 2PSWA 4Q7AA 5IX3A 5FB2A 4B4CA 4MBUA 1HQCA 4BMHA 2MW8A 3HTUA 2RDPA 3EUHA 4HSTA 3MD2A 4PFOA 3N7ZA 5J47A 2QBYA 4ZJZA 1YS7A 2ZOFA 4PUSA 1UHMA 2UZKA 1V1HA 2X1CA 4MRIA 2E1MC 2PBIA 2JMWA 5FLXK 1AN1I 3P7NA 1GT0C 3CP2A 3BJ6A 2CSOA 4E7HA 4A2UA 1W4MA 4ZYEA 2CWGA 3F21A 1P6RA 3FXJA 1PJUA 1IZ1A 1JXSA 2VKEA 1IUFA 2SGDI 1YHQI 3C18A 4MNUA 1ITYA 2FL4A 1WGCA 3AG2H 1BI0A 4GCVA 5C4XJ 1DPUA 2HFHA 4O23A 3KL9A 1WJAA 5LGTA 3LACA 4IF5A 3EC4A 3NRVA 4V19K 4CGNA 2QQBA 4RGRA 4ORFA 2BEOA 1A36A 1PUAA 5G21A 3CUOA 1RI7A 1WFXA 5F27A 1GHCA 4FUUA 2IS2A 5DD4A 1JHFA 2QWWA 3UNGC 2V4JC 4FAIA 2IA1A 2HVSA 4P9UA 5BPDA 5E79C 1IN6A 3A0BC 3L2WA 4RB1A 1SC7A 3IU1A 2HQ5A 1LUJB 4RDUA 2N17A 5DD8A 4X5KA 3DTEA 5E3LA 9ANTA 1S7KA 3E97A 2IGKA 4NGMA 3GTJJ 5I0CA 3B8GA 2FIWA 1HKQA 1H0MA 4Y49B 5HLTA 1EJ9A 3TOBA 1KQ8A 3FIXA 1PYVA 3D3SA 3QTLD 3ZQFA 4FETA 1UELB 4UXNA 2VJ4A 1Y6IA 3R5BA 3IRRA 1QSTA 2VT3A 5FLXZ 3FBIB 1K7VA 4BY7J 3LSJA 5GTIC 1D1BA 2VI6A 2WC2A 3B73A 2VPRA 1L3LA 1TXRA 3LA2A 3KASA 3WTZA 3PB4X 1OKRA 3CLOA 1YOVB 1A31A 4MHZA 1MMSA 2VPLA 3C2BA 5JLXA 1J75A 2FOKA 1GXPA 3FB3A 2YSRA 3F3XA 4MHGA 3F8FA 1YW7A 2JUGA 3FH4A 2P6TA 5E3NA 1TF8A 4G7OF 1Q2YA 2J8NA 5KCMA 2PEXA 1LANA 4A3KJ 4U5YA 3HIFA 4M6YA 1XMAA 4ETSA 4A30A 1MIJA 2LP0A 3U2RA 1ZARA 3MVPA 2DXIA 1TBOA 2EO8A 4XLFA 3E5XA 3UR3C 4PXEA 2M4KA 4IHXA 1TBNA 2VODA 1BJAA 1D1AA 2GBYA 5DCMB 3GKRA 3GF2A 3JTHA 3NA6A 5E3MA 2XPUA 3NEUA 4QLCU 3RZOJ 4EGZA 2YUUA 1X3UA 5ICEA 1X1PA 3Q0VA 5FLMJ 3HHGA 1QBJA 2TDXA 4ZX9A 1FEXA 3BTJA 3IO1A 2R7UA 2AFMA 3JW4A 3ZP5A 2KL4A 5K7FA 4C2TA 1KWMA 3CMAI 3FBUA 1C0WA 3GTOJ 2BVLA 3TT2A 4RS8A 2IA0A 1P7IA 3S1QJ 2J8MA 3IWEA 2OF7A 4XICA 1ERDA 3CCSI 4EEFG 4CAWA 2WGCA 1CM0A 1VIXA 2XEJA 4UFXA 2L7MP 2NU3I 2V8HA 3FZVA 3M07A 4BXUA 1ULKA 1NH3A 4GGGA 2PJ7A 1LR9A 4UCNA 1ZELA 5ILUA 5IYCJ 5DWMA 2ZENA 5CQEA 3TW6A 3WE3A 4XN0A 3RNZA 3ZCOA 1FTTA 4OVOA 2R7XA 1MSEC 5LYDA 2PMZA 3RO0A 3C26A 4P4FA 2NXNB 3HOXJ 4V2FA 1Z05A 3CCJI 4KOTA 4KUBA 4ZGYB 3ZOBA 2GVIA 3JR9A 4R76A 4ESBA 4Q48A 4E7IA 4I6ZA 1ZG5A 3TTHA 2ZC2A 4V2GA 1BOBA 4KZTA 2KZGA 2AFOA 3CUQB 4IRHA 5CQGA 3K2AA 4NGRA 1WTJA 2QF7A 4RGXA 3RYPA 4CDGA 2R93J 3FRMA 3QYBA 1B4AA 3FC3A 5IY5H 1YYVA 1HXDA 3PFYA 5GTHC 1O3TA 1UHWA 2B0UC 2FSRA 1K83J 2JPBA 3QQAA 3BR3A 3V7SA 1PYTB 3CT9A 2IPQX 2ZJPF 4CRZB 3F22A 4LG0A 2DKVA 3CTAA 3HZJA 1XGSA 2ELJA 3LFUA 1GV2A 3KEQA 2MLGA 4XLPF 2MG4A 1WJDA 2R7SA 2KDOA 4XM3A 3JRBA 2RFHA 2CO5A 1FMVA 2M1BA 3IEHA 4O6JA 2LUYA 2Y2ZA 4C2UA 2H1KA 3I53A 2E36A 2LK2A 4G6DA 3ISXA 2IQ6A 3D00A 2EFNA 3JAMZ 1MBKA 2EIJH 2OBPA 2YQPA 2RQPA 3G1LA 3I54A 1G4DA 2KT0A 1D0ZA 2SGEI 3CXPA 2K4BA 4P55A 5CVIA 1XDUA 3BXMA 3VARA 1TLHB 2V8GA 3BWGA 4HNXB 4FBEA 3K10A 1QGPA 2ELHA 4F3QA 3HYIA 2PG4A 4DZJA 1XMTA 3VWDA 3QPSA 3RIRA 2DLLA 4QVTA 1PPFI 1OJLA 4IF4A 4H2KA 1BO4A 1ZG7A 1B1BA 2BY0A 1U6GA 1LE8A 3W2WA 1Y1BA 4G94A 5F1RA 4BBRJ 1R0RI 1WI3A 1YJ9I 1LE8B 1VTNC 2O5RA 3SJXA 1HDQA 1Z6RA 2DW4A 3AKZA 3UGDA 2WB1N 1V5GA 2KMUA 3C7JA 3JRHA 3MZ8A 2PJ3A 4F55A 2Y30A 3OOPA 2R3SA 4CYCA 2Q51A 3OXLA 3GFJA 2VKVA 1FJLA 4KUAA 3OYLA 4XRFA 2IMOA 4EQQA 4L9TA 1X19A 1SAUA 4ONWA 1XGNA 3V38A 2XGEA 2KRCA 4NBQA 2M7BA 2LKXA 5BPIA 1BC7C 4I99C 2MABA 2E2HJ 1IRZA 2R98A 1O7FA 4OU0A 1IY6A 3OIPA 4M6IA 5F47A 1F1ZA 4KA4A 1Q7LA 3Q9SA 2UZ3A 4OADA 2XF7A 2Q44A 4CO8A 4HF2A 4AVBA 5BOXA 5EZGA 1QVTA 2CF4A 2QECA 4DNCA 3OVOA 2XF5A 4BL0B 3NWSA 3UEJA 1TQPA 5IOZA 1CP6A 2HUZA 5K8MA 4KITB 3AFHA 4I0BA 4ZY2A 4J01A 1WJEA 2G0EA 1J09A 1WJCA 4ITVA 1QSMA 1P4XA 3UGIA 2DMQA 3DEEA 3CO7C 3SI1A 1X3WB 2R5YA 1TKJA 4ZY1A 2AJ6A 1ARMA 3QOPA 3G8WA 1OZPA 1Z8LA 2E35A 3BQZA 2R5YB 3MEXA 4AIKA 3BJIA 1BPMA 2DPSA 4NFRA 2EQRA 3F23A 4C7IA 4E8OA 4JBAA 2DODA 3PO2J 5ICCA 2VQCA 2O7OA 3EDPA 1BR2A 3L7WA 2RREA 2MFZA 4C30A 4HNWB 3BR2A 1ZN2A 4KDPA 4XNFA 1HDLA 3C2HA 3LWFA 1N75A 2HDWA 4C2MJ 2HOSA 2FU4A 2OAZA 4BBSJ 3LL7A 4KMFA 2QZ8A 1XTAA 2ZKZA 2NVQJ 5FLVA 3OIQA 1MK4A 4GXHA 2C27A 4Y52J 1VFCA 1RETA 3HUGA 1UFHA 1S5KA 3DPUA 3KIOA 2LRDA 4AUXA 2CW7A 1D8KA 3UKGA 3H5NA 3B3CA 2K9QA 3OYJA 1G6NA 1TBRR 3ECOA 2ECBA 3LSKA 4GO1A 1OISA 3K2KA 3QP6A 4GYIA 1ELMP 1KYZA 1ETKA 2XPVA 3BCAA 4SGBI 4S04A 3TJQA 3OYBA 2IGOA 1FOWA 3KR4A 4PSWA 3H5ZA 4FT8A 3SJGA 2FCKA 4PZJA 2JA8J 3E2IA 2GWRA 1MZBA 3CMEI 1FMWA 2RAEA 3L9FA 2JXDA 3IIBA 3RPUD 3PB8X 2ZSHB 1CX8A 1ZR4A 5LHIA 3VDPA 4PXCA 4F9UA 3BZCA 5IB0A 1MJ9A 3S6KA 5H84A 2O3FA 5J1RA 2DBBA 1QHHD 2B58A 1FIAA 2A68F 2L01A 5CKTA 4JJXA 3PB7X 3R5DA 3BZKA 1U5TB 2FRHA 3TP3A 2HQRA 2H6BA 1VQPI 3ESWB 4MXUA 1Q1VA 2FQ3A 4Q38A 5ILVA 1G3SA 2NS7A 2M3AA 1JKRC 3PIOF 1NXUA 3CCLI 2F48A 2HDDA 1X2NA 1Y0RA 2V1XA 3OR1C 3ERED 1YI2I 1XJOA 3V8KA 2A5YB 4PDKA 2ZJQF 2K9HA 4HOBA 3ZMSA 2DPTA 2HOEA 2M0CA 5KAIC 4IJAA 4BAYA 4NXYA 1TWFJ 3MZYA 3VATA 5HLIA 1TURA 2E5ZA 3L2UA 2TRTA 4H4KC 3PUFA 1H9TA 3S6FA 4RM2A 2LYCA 2L9RA 1B87A 2EFQA 2PJ2A 5K8OA 2WV0A 5LD2C 2DPUA 2FE3A 4XKCA 1M1DA 2X51A 1TQIA 3ZMUA 2QQDA 3CZXA 3TP0A 2BL1A 1QRYA 3J81K 3CO6C 1D5YA 5DTDA 5D5WB 4MJ8A 1D1CA 2DA5A 1VQ9I 3HOWJ 4PQAA 4UUVA 1R1TA 2M9HA 4E1RA 3BI0A 1T08B 3DSBA 5JH9A 1VKCA 2R7HA 4U0WA 2BVMA 1QSNA 3FVLA 3OWTA 1S29A 1JJ8C 3LMSA 4R9MA 1ZKGA 4B13A 3KYLA 1U9OA 2OTLI 2Z16A 4LUAA 5D6EA 3NARA 2DQRA 2OR4A 2XAGA 4X3RA 1KA8A 1LCPA 1ORKA 2E1OA 3I1UA 3DKYA 2HS5A 5HODA 4KNYA 1DQUA 2BHYA 5EDNA 2F4MB 2WVJA 4OMYA 4L9NA 4EJOA 3F8CA 3E0JB 3CCVI 1BR4A 2ZEHA 3WTWC 2F6CA 2AXLA 5F08A 5AG5A 1GV5A 2W24A 2JYYA 3U1DA 4LB5A 2A69F 2ZPAA 4QUSA 2ZXVA 3A0HC 3J7AO 3T1BA 4CGMA 4CZZA 4GM5A 2F5FA 3ZQLA 3V8LA 2DI3A 4IX7A 3UY5A 2NS8A 2BSWA 1S20A 2KJBA 2WB1A 2Y0SA 4CGPA 2JSPA 2P0WA 4M71A 2Z3PA 2F5VA 3GLXA 1VF9A 2L4AA 4XOTA 1Z4EA 2GFQA 3Q3SA 3FSYA 2ZXJA 2DA4A 2A05A 4NC7A 2HTSA 1LKXA 3TO9A 2VOPA 2JEVA 2Q1ZB 1AU7A 2GREA 2H8RA 4N4NB 3JRCA 2P6EA 2ZEGA 1JTXA 2W85A 1RFHA 1WKMA 1B72B 3DEWA 2ZW6A 3WT4A 3F8NA 3GOXA 2KQRA 4K2EA 1KBFA 5HVGA 4M3BA 1Y1CA 1Z9UA 5M5XJ 3A2KA 2V8VA 4GXOA 5CCLA 4AIHA 4YFKF 4XMYA 3S2DJ 2G7UA 2ZNYA 3SGQI 1PCEA 2QPOA 4QPOA 3BTIA 5JR3A 3HUVA 3GUDA 3JTKA 5F09A 4L5JA 2XIGA 2L0KA 1SD4A 3S6GA 3J7ZI 4DOZA 4HV6A 4UEFA 2E7WA 2WWYA 2P5KA 5K5OA 1XG1A 3D5RC 4HNTA 1YR0A 3G3SA 4MEXF 3I3GA 1YQAA 1KBEA 2AS5F 3WGIA 3F72A 4D1QA 4E70A 4DUKA 2LEOA 3PFIA 2FX0A 3W6XA 1I3AA 5TJJA 3VODA 4A12A 3K6GA 1IGNA 1T38A 2NOGA 1JHHA 4Z65A 2KRHA 2V26A 2EK8A 4E2AA 4W97A 1XFOA 1ON1A 4XLAA 2B8TA 2B4DB 3NWTA 4U88A 2L4MA 1XS9A 3DTKA 2QSFX 4KICA 1JGSA 1R22A 5IP6A 2YU9J 3AL0C 3F8BA 4UXIA 1TGSI 2LVSA 3GX4X 4ABZA 1JUPA 2VN2A 4XLNF 5D4SA 4AWXB 3A4CA 4HA8A 5K7ZA 3DLLF 3S17J 2LSOA 1R71A 5EEAA 2B0LA 1XCBA 4P45A 2BGCA 1H8AC 2HDCA 2LLKA 2GANA 3U9GA 1V3FA 4IKFA 1XPXA 1IW4A 2GKVA 3KETA 2D4OA 3OL4A 3SJFA 1TTYA 5TRDA 2EVNA 5K8NA 2N71A 2BXZA 3EYYA 4C9YA 1HF0A 3VWBA 2EA2A 1ZH5A 4R87A 2CTBA 2COMA 2EV6A 2LNBA 4CGZA 3Q0WA 1H89C 1BIAA 4LQ6A 1S9HA 4FX0A 3HRSA 1FY7A 2DMPA 5J6XA 2KDZA 4HNUA 1NK3P 3KYCB 2GM4A 3NE8A 3B6CA 4U9YA 4FWUA 1KYWA 1FSEA 2MBFA 2OCCH 1IIDA 4H6UA 2QYOA 4PV6A 1TIHA 3D4UA 2WUUA 3HOTA 2PJ0A 4QSHA 1BBYA 2QQAA 2EZHA 1QSRA 3FM5A 4KOXA 3R9GA 2V1NA 1QZEA 1TQMA 2VBWA 4RN7A 1X4OA 4CRYB 5HI7A 3T8TA 2ME6A 2E7XA 3PIPF 1NHAA 8CPAA 1IXSB 2ISYA 3CZ6A 4BQNA 4CH7A 5JHFA 4C3HJ 2G9DA 3ZQQA 4MHYA 1H0ZA 1ELLP 4PXDA 2JVHA 2DYSH 3KZYA 3QYFA 2LKPA 4U0YA 4WK8F 3K9UA 1SD6A 1MJAA 2GA2A 1I5ZA 3RSNA 2L7XA 4W9YA 2NVTJ 2FIAA 2VASA 3HOSA 2K7LA 3TEDA 2Q04A 4IEJA 3JRGA 1HW5A 2R7FA 1ZGAA 3DGVA 2MYSA 1OYVI 1Y7RA 1V54H 2VC1A 2GZWA 1QPMA 2DU9A 1QNTA 4ENMA 1IOIA 1L0OC 2FBIA 1V0CA 5AG7A 4BHPA 1B59A 3ZMVA 1D8JA 3DBRB 5E1XA 4E1PA 4IAVA 1PJRA 1JT6A 3BG3A 1R7JA 2CNMA 2WA0A 3FXUA 2ZEEA 4G1PA 2XEFA 1X12A 3B6AA 4OOIA 5FKNA 1YSJA 4KUMA 2ZJ2A 4JQFA 1IUYA 5L3EA 4ENNA 1S7NA 3RPQA 3W2AA 4MY0A 5ELYA 4JD6A 1K4TA 2EIKH 4XN3A 2WAFA 3LA3A 1N77A 4ZH4F 2GE3A 3CDXA 4M3FA 2OTJI 2BY2A 5IYBJ 4AMLA 2ARHA 3JREA 4NC6A 4DYRA 3VSKA 1YMEA 5HXDA 4XKBA 1NSAA 3R96A 2IGMA 3FXMA 5EX3A 3TOAA 1Y1VJ 3ASNH 2KFDA 3ECHA 3HM5A 5F64A 2R92J 1D0XA 1ZO0A 5CNPA 2WV1A 2IW5A 4P1WA 1BM9A 4AVPA 2FXAA 2Q2EA 4B8XA 3GW2A 4NQWA 4DBQA 3MGDA 3E6MA 3WGHA 1F9NA 3EYIA 2VZZA 1VZ0A 4QC6A 1T56A 4OIRF 4XPDC 2K02A 3ZMDA 2ZJRF 5D4RA 2R7VA 2A4NA 2M8EA 3B4VC 1WZ2A 3R5CA 4P4EA 1RC9A 1UZCA 1S7EA 2H27A 3VDXA 2PE3A 3CJTB 2VBXA 3RKWA 2RVCA 2Q0YA 5JQ4A 2OCEA 2ELIA 2ICWG 4FKDA 2K4JA 2FMYA 4HRIA 3AAFA 2VEZA 3TBIA 5AIQA 3ZQ7A 4B3AA 5JI6A 1CJWA 3I9V2 2Z1DA 2ARPF 1VQNI 1QZYA 4KIBA 3CXLA 2RNJA 5EGOA 4LLNA 3CPXA 3K1NA 3H3ZA 1J0RA 1U9NA 2D2WA 5ERIA 1Z8WA 4KT6A 3HPGA 4MI4A 4BBHA 1OCZH 5KK1A 2OVOA 2LF8A 2ESHA 1CT2I 2I3CA 4WX9A 4RLFA 1K7AA 1XBTA 4E4HA 3HRMA 1TKFA 2XDVA 2XAUA 5DAEA 3FDYA 2BE5F 3K1PA 3KHZA 4BDZA 3W6SA 2NAZA 2DFFA 1OMUA 1A6QA 3H8FA 4HX4A 2Y69H 2VJIA 1YO5C 2G3AA 2XPWA 3CMMA 3DLAA 5AGEA 3LWUA 2W25A 3E5QA 2PJRA 5JM6A 3LSPA 4A93J 2HB6A 4I98B 3DFGA 1ZRDA 2GKTI 7WGAA 4XOPA 3MMYB 3S2WA 2PJRB 2PCUA 2LY1A 2NU4I 2WAEA 4I76A 2VLAA 3I71A 1GHEA 3M1CA 1WGXA 1SD7A 4I01A 1U78A 2XRCA 3PGPA 2PN6A 4KSIA 3MKZA 4L89A 2GOMA 1AYEA 4IL6C 3ZQGA 4B6ZA 1ZAOA 5FKKA 4H6ZA 3L2NA 2A3SA 1SFUA 1W5TA 1I12A 3HH2C 2ZXIA 4EMEA 4E0AA 2NOJB 9WGAA 3W3CA 2HI3A 1JI8A 1XSXA 3H36A 2HZDA 3SEQA 7CPAA 4D9JA 3UFFA 2BBYA 3KLOA 5EZHA 4R8HA 2DT7B 3V42A 2FUG2 1PTRA 2VIXA 4M6XA 1ZREA 1IYLA 3JUWA 1ZYRF 4D7MA 4ZTFA 2CNSA 4UWIA 2HYJA 1TT0A 2K86A 2B9SA 3I9SA 2W4SA 1T39A 5FRMA 1I1SA 1LJ9A 3WU1B 3K0LA 2QBYB 3N5FA 5LLQA 4MY3A 2JA5J 2FVGA 3QPHA 4PGGA 4A94A 1KGSA 1HSJA 1JTYA 3EPZA 5M5YJ 3K9TA 5K5QA 1GLNA 1GXQA 3WHCA 1MW7A 1N71A 3KP2A 3V8JA 4D7NA 4GRIA 3E0KA 5A2QK 1SGDI 2PR1A 4A3GJ 3IFEA 3OYMA 4M72A 1FC3A 3D7HA 1SQHA 2EFWA 1I1GA 4HLXA 2VB6A 1OPCA 1UJ8A 2JDDA 1RRJA 5E18F 4UIAA 2DT6A 3DU6A 2HQYA 3IRQA 3E1SA 2V7FA 2VE9A 4LX9A 1SFEA 5G20A 2EZKA 2L7FP 4BUPA 3G1MA 3K4MA 3PQKA 4XQFA 1YIOA 3VE5A 2K5TA 2V77A 2EJRA 3BR1A 3CDLA 1P0HA 4ENKA 5F0FA 4QPQA 1USTA 2IS1A 1XIXA 5FD5A 1ZTRA 4BACA 1RNLA 1YLFA 4LITA 4KFCA 4A3CJ 3PEIA 3N97A 2XUBA 1SGQI 2PMUA 4XPDB 1XD7A 2QA4I 3F5BA 3E5UA 2QIRA 1B6AA 2P8TA 1G3YA 1KU9A 4JP0A 3JSPA 1SGPI 1Z7KB 1U0JA 2HU9A 1ON2A 1DS3I 1VQ8I 2WTEA 1MDMA 5EC4A 2HVRA 1Y0NA 1Y0YA 1NK2P 4G7ZF 3VB2A 3H3UA 3PZJA 3IGRA 4ZTJA 5KTDA 3G73A 3ABLH 3KCCA 3DQVC 2XC7A 4A3BJ 2ERWA 3JVNA 2QENA 3J7YJ 4RB2C 5A2QZ 2CQXA 2ID6A 1Y9KA 5THWA 2WCYA 5K8PA 1BN5A 2X6XA 2XASA 2C1CA 3H8EA 4FTHA 1YITI 3KZIC 4F0XA 5ICFA 1DU6A 1TWGJ 5DCFA 4EJUA 4BQOA 2D1VA 2KISA 3IH3A 5FGMA 2LTPA 3S15J 1YLOA 3D2PA 3KX2A 1SMYF 3M7GA 3ONQA 3V7CA 3P5JA 1P4WA 2R7ZJ 2V9KA 2HZTA 3S32A 1YQEA 1Y7EA 1D0YA 4BJ5C 2KHMA 2CFOA 5FD6A 1H9GA 2LBFA 3KP5A 1FOKA 1JWQA 5L3FA 4P44A 2VBYA 1YLEA 5AONA 4YEJA 3L1PA 1Z7LA 5GAEJ 3IU2A 2SGPI 4F52A 1Q1HA 2IXSA 1ZHFA 3DU5A 4NCZA 4NUBA 4L9VA 5DUKA 3ZN1A 2IGNA 3ISPA 4IQ4A 3T0YA 4P4DA 3F6VA 2HPMA 3ERMA 3E7LA 5B1BH 2GQQA 2L5QA 3I4PA 5FKMA 4UB8C 4A5NA 3IWGA 3W6VA 4F93B 2COBA 1ZG1A 4UNOA 2ATRA 1MGTA 3SEKC 2OZGA 2BYVE 3ZMZA 2KZVA 3LQQA 2STTA 2FE7A 2I00A 1K4JA 3HKZN 3Q0UA 1MJBA 1X1CA 2EWNA 4GYGA 4HYEA 4ENJA 1CP7A 4R1HA 2L7KA 1OMTA 1S6LA 4Y4RA 1H8LA 1UWYA 1D3YA 3RKYA 2E1MB 3NH8A 1WH7A 2LOOA 5FO5A 1IDZA 1Z91A 1XBUA 1JJ6C 3CJNA 3GIUA 4PXBA 4L8AA 4EM0B 4RM3A 1B8IA 3D66A 5HS9A 4NGNA 3OXFA 3OYNA 1ETQA 5E3OA 3CF5F 2O61A 2M5XA 2LB7A 4I09A 1Y0UA 1O57A 2MGQA 4A3LJ 2Z0ZA 1S3JA 3SI0A 3DXJF 4XSZF 2W0TA 1Z7UA 4NB5A 1IU8A 2PDOA 4MEYF 3RQIA 2DO7A 2Q4YA 3J80K 3F9KA 4XIDA 1X1AA 3GTPJ 5LGUA 2XHKA 1MH3A 1FNNA 3FXOA 1FYLA 4LG0B 4AVZA 5CCMA 3FM3A 5FROA 1M44A 1XEBA 2IJZA 4CAVA 1TT5B 1SANA 3Q9VA 4OC1A 3GB0A 2YNEA 4MGRA 4YELA 4L18B 1XDSA 2L3DA 4MTEA 4CYDA 2ZW5A 1CT0I 2NMTA 4LB6B 2JRMA 2YNCC 4ZZLA 5CVRA 3R95A 2G9WA 2DMTA 1ZLJA 2P6FA 4A0ZA 4CYQA 1UG0A 1I39A 1STZA 1TBXA 3FEEA 4PJMA 5ICGA 3I59A 3GYHX 2BY1A 1ZQ3P 2PLYA 5LYLA 2DFHA 1HLVA 3OS2A 2FBHA 1F43A 3NH4A 2VBZA 2CV0A 3GLLA 3RBUA 1LFBA 1X10A 4UWJA 3KHXA 4A2ZA 2DA2A 2LC2A 1Q9BA 2R7RA 4MFKA 3TFYA 1RKWA 3SFZA 2PR8A 2L7ZA 1E2XA 1HDDC 1BPNA 4PGHA 2VZYA 3VYRB 1Z1DA 1AHDP 1VQKI 4A37A 2RV8A 1RESA 3BCBA 4YRVA 4ESJA 2HXIA 3OYEA 3V8IA 2R0QC 4CYCB 4KIGA 2FMLA 3LSMA 1ODDA 4ZBGA 1JE8A 1XB4A 1HC8A 1IC8A 2JPCA 4HEA2 4IVNA 4WXDA 3I64A 5D8KB 3CCRI 3NE7A 1X1BA 3CJQB 1X74A 2ZFUA 3BTLA 1F4KA 5EG0A 2IS6A 1PP8F 2CH0A 3OSGA 4BXXJ 4B1RA 3LSIA 4Y13A 2GXBA 4IZZA 2XB5A 4AXVA 1LDKB 1WCMJ 4IOCF 3S3MA 1ZGJA 1CQTA 4OC5A 3T8WA 4KVME 1A04A 4Y33A 1YIJI 1J2XA 4G6TB 3DLJA 3S9LA 2CQNA 1TWHJ 4N4OB 5C44J 1YFHA 1F5TA 1KONA 2BY3A 2BO9A 4BDYA 2WAQN 4EJTA 3NFZA 1HW2A 3KGQA 4OMEA 3FSXA 2KKOA 2B4BA 1I21A 3K1MA 1FNOA 4PFPA 4KOVA 1OYWA 1W7PA 4Q47A 2VRWB 3B02A 2Y0MA 1Z67A 2RB7A 1BIBA 1EH8A 1W4RA 1R1UA 4LFUA 1QHGA 3FMSA 4ON0A 3UGLA 3BJ7A 4UEZA 2G7HA 4NNJA 4OIDA 4F6AA 1WGTA 1IXRC 4IHWA 1S7AA 3H92A 3M4OJ 2QQCA 1SEUA 3Q5FA 4II3A 2DB6A 4N9IA 3QPLA 1AKHA 3W6JB 2E2JJ 1W36C 3FKJA 4FD6A 4GI3C 3IHUA 5EEGA 3HXLA 1BAVA 3HUGB 1Y9WA 4YFXF 3U21A 1FOYA 3CC4I 3UOEA 5DS9A 2REEA 2PVWA 2C6CA 3ZMTA 5D29A 1BI3A 2ZOGA 1QU3A 1R4NB 4A3EJ 2ZFWA 3QU6A 1NUBA 2E71A 1WWZA 3JRUA 4HPQA 3EUKL 1FP1D 2VT2A 4JX5A 5FKLA 4JOMA 3WODF 2CW0F 2G3TA 2EIMH 2ZEOA 3C3WA 3S6HA 3R4KA 1K7TA 2QYVA 4F92B 3SDBA 1RPWA 1VHEA 2YNCA 2QSHX 2XAQA 4I0AA 4O3MA 4KN7X 3F0CA 3IC7A 2RGVA 1O3QA 2ZW4A 4E7SA 1R5GA 1P4NA 1OYIA 1V4RA 3HL2A 1VHOA 2QJ8A 1O3RA 2V8DA 4AVCA 2FEZA 4CGOA 3OYAA 3RJPA 1AOYA 3DR6A 4ANJA 1VQ7I 5HNFA 4KVOE 2WPXA 5IYDJ 3HKZA 5AIPA 1F36A 1USSA 2NVUB 3RTRA 2OB0A 4JCVE 1D5VA 3K70C 2CY2A 2MSYA 4BEHA 1MBJA 2Z9OA 1JUSA 2VUMJ 2O9LA 3BG5A 1PDNC 2EILH 3HOYJ 1T6SA 4BE0A 4MHDA 1MNDA 2ZEMA 4ZC3A 1LAPA 3KR5A 1XCVA 2ZXWH 2R1IA 4W1UA 3EY5A 2L02A 2MD5A 1R5HA 2PJAA 2JK3A 2PC1A 3K4KA 2RKHA 2X9DA 2W00A 4C2XA 1K6YA 5LHHA 1M8BA 2VXKA 3HB9A 2QEXI 5KTCA 3GO5A 2D1HA 3FWEA 2I10A 4Y3OA 3SZTA 3WG9A 3W91A 2YU3A 2BUSA 5HH1A 1FT9A 3QRFF 2GLJA 3BC8A 3RU0A 2LREA 1YK3A 3ML6A 2YGWA 5L3CA 4OC4A 1G59A 2GA1A 2M7AA 2X52A 4JYWA 5C82A 1M8CA 3HGGA 3N05A 5LRRA 2YX4A 1T98A 1YG2A 4LG3A 4JX4A 2XRLA 4RAZA 3DKXA 2ZB9A 1OMIA 4HF0A 4XL9A 4Y7NJ 2XROA 1R49A 2PJCA 4UB6C 1YW9A 2CXAA 1JUMA 3P9IA 2Z3KA 1IN7A 3JRIA 2JSCA 3S1NJ 6CPAA 5B5EC 4ASNA 2B63J 2MH9A 2F4IA 3K4NA 1K7UA 4KS9A 2R7OA 4M9ZA 3COAC 3PSIA 4EATA 1YREA 2EZLA 2K3PA 2J87A 4A3MJ 1YX5A 1PU9A 4B5PA 1E17A 2YS9A 1SVMA 3CCYA 5DUIA 2JN6A 1FZPB 3BG6A 4DZPA 2YNDA 4P6YA 5I4MA 4MCSA 3KEYA 2ZMEC 3LA7A 4BYYA 4D5CA 2O4HA 3H9JA 1OR7C 2M45A 2LD5A 2E73A 1SFKA 4B09A 1TC3C 4DIQA 3V7ZA 1OCTC 1DP7P 4AC0A 1YW4A 1W0TA 2WBMA 3GWZA 3PL8A 4OIPF 3FMCA 3MRUA 3PJRA 3DF8A 3J81Z 5HS7A 2KMQA 3PBBA 3ZZIA 1XMKA 2AE6A 3D1NI 4ZYHA 3W2VA 4IHVA 2HWVA 5CVVA 3BG7A 1TKHA 4ZY0A 4UF4A 4WP4A 1ENHA 3KP7A 4PPZA 2VC0A 3MCZA 2IJLA 3ZJ0A 3ABKH 4HDUA 2X6WA 3PB9X 3SFIA 4A3DJ 1WK4A 2JUCA 3RCOA 1PUFA 3PBEA 2EZIA 2M87A 1G3TA 3FMRA 3F8MA 3U1KA 3ZR8X 1PUFB 2P6AC 1UFMA 3CESA 2P7VB 5HDGA 1AWCA 2FNFX 3TQNA 2IL4A 3SZGA 5HOOA 2P6GA 3CC2I 4ZZDA 3RKXA 3M8EA 3PO3J 1VQ5I 3SHFA 4DW6A 1UHAA 3KP4A 2MLKA 4CCNA 4KISA 3B3SA 3SYTA 2A6EF 3WU2C 3MFKA 2O28A 4IO9F 3ELKA 4OP4A 5E8GA 4F7ZA 5LEJA 1DGWY 5LYFA 1TP4A 2CW8A 1AA7A 1MNEA 4B48A 4MHNA 1M1EB 4RLQA 3JCUC 3S14J 5C3EJ 1SGEI 1UVFA 4P4IA 4LMYA 3GUXA 4BD9A 4BNCA 1BL0A 1UMQA 3PB6X 2FQ4A 2JA2A 3RI4A 1XN7A 4L0YB 2JTVA 1CGPA 2H5MA 2FT0A 3CXSA 4XRSA 2BOLA 3GFMA 4B47A 1YX3A 2EWBA 4OLLA 3WHBA 1I1DA 1XOVA 4P10A 4B5OA 3OMYA 3GFIA 3CDIA 3G2BA
chains in the Genus database with same CATH topology
4II9A 1IAWA 3BJAA 2C6YA 3D0SA 1P2FA 1ZG3A 1RUNA 4H89A 2JRTA 5EEHA 1M4DA 4EGYA 1P92A 1P4AA 3HRUA 2PI0A 5F48A 2UXNA 2J8RA 2QUFA 3T8RA 4RS2A 4OIQF 3TE4A 3QAHA 3BJOA 2X0LA 2YX7A 3WTTC 2PMHA 1SD5A 3R1KA 1WRJA 1IW7F 3T9YA 2MH2A 2Z11A 3O3KA 5AG4A 3WTVC 4UA3A 3V4GA 4LK0F 3M1EA 3REOA 4KOSA 2YPRA 1J5YA 3M8FA 2V79A 5DEQA 4YFJA 4M73A 4YIFA 2ISZA 4BHBA 3P2FA 4FX4A 2EB7A 2DTRA 5F6FA 2ZMEA 2XAHA 4LJZF 2A07F 1OR7A 2OQRA 2ZMEB 1LRZA 3WTXC 1S8NA 4ESFA 5A28A 3BY6A 3EETA 2V1UA 3TCVA 4CHUA 1BC8C 5D5UB 5ILSA 3F6OA 4P5OA 3MWMA 4LGWA 4IUSA 1IRGA 5K5RA 2XKOA 4CAXA 2EFPA 4YFNF 3HSEA 1KQ9A 2XRNA 5E1WA 4OAEA 1UCRA 3I5UA 2J5PA 1K6OA 4IXAA 4UFWA 3WE2A 3EQLF 4N9HA 4O5VA 4KLWA 1LQ1A 2PQ8A 3ULQB 1Z6TA 1YTYA 1U6MA 5A27A 1WI9A 3T90A 1EV7A 2W84A 2ACJA 3K69A 2OD5A 3WR7A 5H86A 1RZ4A 1WSUA 2DXQA 1XF8A 1S7OA 2QMLA 4XNHC 2CG4A 4EMSA 1R57A 5BWAB 4KT5C 5G22A 3KLNA 2XAFA 1FLIA 4P96A 4CXFA 1HW1A 4CAFA 5JFRA 5K1YA 5JHUA 4HX7A 1YVKA 4MQVA 3D8PA 1HKTA 3WTYC 3BLNA 1FBSA 1IICA 4PSXA 2OA4A 4HNYB 1KU2A 4Y49C 2M30A 3R61A 4C68A 4HX8A 4M9XA 2FSWA 4UV9A 5CJ9A 4UCPA 2OH1A 1L0CA 3BPXA 2VI7A 1NSLA 4D0PA 4BQAA 1EH6A 4EJVA 5DV5A 4A6DA 2M5WA 1FYKA 4HF1A 4Q4ZF 5H20A 2KIMA 1KZFA 2HYGD 3WU0A 5IT3A 3HSFA 1FYMA 1ZRFA 3IKTA 2WPWA 2UXXA 3SZPA 1M4IA 2DFIA 1J7KA 3GXOA 3I0TA 2O0YA 2D4PA 1U8RA 5HVQC 5H6QA 2Z3LA 2ZW7A 6PAXA 4L9JA 1S60A 4NHJA 2FBKA 1J9IA 2B3VA 1RIOH 2GAUA 1XGMA 3FHZA 4KSAA 2A6HF 2B3UA