3TO7A

Crystal structure of yeast esa1 hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
molecule keywords Histone acetyltransferase ESA1
molecule tags Transferase
source organism Saccharomyces cerevisiae
total genus 79
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to7A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to7A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to7A02
2KJCA 2MA3A 5E1XA 2HQNA 3LODA 3R61A 4PSXA 3SHPA 4OMZA 4BXUA 3HOSA 1SFXA 3M8EA 1S60A 1R36A 2W57A 4UWIA 1J75A 4JLYA 2DW4A 2FU4A 3WR7A 4A6DA 2V1UA 2ELHA 3T8TA 5DV5A 1I6XA 4I0BA 3JSPA 4U0VA 4KUMA 4RS2A 4YIIA 1ZH5A 1S6LA 2VXKA 2QQAA 4L18B 2RKHA 1P4WA 3N97A 1EH8A 2REEA 3P9KA 4MHDA 2R8VA 3JSOA 4U0WA 3LFKA 5LLQA 4E2AA 3TFYA 2ZW6A 4R9MA 2PMHA 2EFWA 4EJOA 5A2QK 4KA4A 4U0YA 2ZXVA 2VOPA 4XLNF 4ZYEA 4H6UA 4I7HA 3F8MA 3WTTC 5L3GA 5FD5A 2ZW7A 3I58A 5DWNA 3ELKA 2FNPA 2G0BA 5CJ9A 3K2ZA 2FOKA 1SD5A 3F8NA 1IYKA 3K69A 1Z6TA 2L3DA 5JVTA 4XPDB 5E8GA 4BAYA 3WE2A 4L5IA 3CUQB 3RTRA 2QBYA 2JPCA 5DCMA 1LRZA 3ZMVA 4S04A 1ON2A 3RI4A 3FXUA 4U9YA 3KE2A 5AONA 3TGNA 1GHCA 1P0HA 4CAXA 3TTHA 3QOPA 3TO9A 5BPIA 2HQRA 2IA2A 2H94A 3ML6A 1CM0A 3K9UA 1XGSA 4KVOE 4H6ZA 2P7CB 4KVME 3K0LA 1ZGJA 3GW2A 4HF2A 3DNSA 2EV0A 3JTGA 3W6JB 2YX7A 1V4RA 4WXCA 2VZZA 5KTAA 3MZHA 1KUYA 3DF8A 3QU3A 5EEHA 1SD7A 2CWEA 5LEKA 2HDCA 3SXNA 5JHUA 4BHBA 3ISPA 1B4AA 4IJAA 5CYVA 2M87A 3FIXA 2CNSA 2P7VB 4NSQA 3L7WA 1MKMA 3PP9A 1J0RA 3C26A 4S05A 4MGRA 1J9IA 5ICCA 3CO6C 2NRAC 1ZRFA 3WGHA 4KLVA 2G7HA 4QC6A 1P6RA 4M85A 2STWA 1Y9KA 3U9GA 1ONVA 3S6FA 4L0YB 1XE4A 4X5KA 4Y17A 3M1EA 1XEBA 4L9JA 1XSXA 1DP7P 2VBXA 4PK3A 5HS9A 1E2XA 3LQRA 3O6BB 1WSUA 4KUBA 1ZYRF 3NRVA 4R3KA 1OR7A 3JUWA 3G8WA 2H27A 1T38A 2VBWA 2VT2A 1KZFA 3E6BA 5LHGA 2MC3A 2B4BA 4U7BA 3E5UA 3EY5A 1L0OC 1HQCA 5KVRA 1LVAA 1BO4A 4LG0A 4H89A 3JW4A 3IKTA 4JBAA 3HRTA 2XKOA 3R96A 3WTXC 3SXYA 1T98A 2VC1A 2GA1A 3HYIA 3SFZA 2HOEA 1YREA 1RO5A 5CVRA 2CGPA 3CDHA 2XAFA 2W85A 1O7LA 3RPUA 4CDGA 1R22A 5J8CA 2D1VA 3R60A 2P6FA 5DWMA 4RAZA 2OZ6A 4B5PA 2LSOA 1TQPA 5K5QA 1BN5A 1VTNC 4EVYA 5E1ZB 3V8KA 3ABUA 3TOBA 4B09A 4BH9A 5F64A 2BBYA 1I27A 3QP5A 4UVAA 3VFZA 2GQQA 1J5YA 3U1DA 2A3SA 4G94A 2QUFA 4GYGA 4G7HF 1USTA 3T5XA 4I01A 1YX0A 4R8HA 3O3KA 4P5OA 3PQJA 3GFLA 5IV0A 4KIGA 4UA3A 2X7BA 3KKWA 1S5KA 3GFMA 2EVNA 3CO7C 2FE3A 3LA3A 1I1DA 3V7SA 4FT8A 3M8FA 1USSA 2AJ6A 4EVIA 4KNYA 3TT2A 1XMAA 1ZG5A 1U8RA 2UWMA 5K1YA 1ZHFA 1B9MA 1WK4A 3HSRA 3OWCA 3KP3A 3GLXA 4H0EA 2XAQA 1XDSA 4YFKF 3EO4A 1KU9A 5L3CA 2REFA 5D4RA 1I21A 1Y0UA 2NAZA 2KKOA 3DV8A 4PSWA 5D8LB 5HMNA 4AVCA 3VEPA 1QPMA 4I09A 4ENKA 1DPUA 3HSEA 4RGRA 4K30A 1FBQA 3QPTA 1R58A 1FP1D 2WC2A 1P4XA 4P9UA 4FX4A 2DI3A 1RIOH 2E1CA 1HSJA 2MBFA 1I12A 2LF8A 2EA2A 3TKYA 5D8KB 4KZTA 5D5UB 1IF1A 2VC0A 1BOBA 2BUEA 2KIFA 4ZZLA 4ESFA 1FOKA 5D6FA 4B5PB 3J81Z 3CLOA 2FRHA 5BPDA 4RGXA 3PZJA 4M9ZA 1UFMA 3EETA 4RB1A 1WWXA 1KGSA 3KFWX 1GXPA 1Z4EA 4P9FA 1GHEA 4NXYA 2V6CA 2JEVA 3ZMDA 2CFXA 4WX9A 4MQVA 3TOAA 1YS6A 2B5GA 2EV5A 3OV8A 4OIRF 3WTYC 1P4NA 3LWFA 2Z9OA 4KOSA 5I0CA 3E3VA 3FZVA 3B73A 5DUIA 4P55A 1YYVA 1F1ZA 2Z10A 3C3WA 1KUVA 2Q0OA 2ZO4A 1O3SA 5AIPA 4DQ2A 1FLIA 3DXJF 4MHGA 4HNWB 5D5WB 1E17A 3T9YA 1IN5A 1YGHA 4OIQF 4F7ZA 2GANA 2PEXA 2WV0A 4Q48A 5JFRA 5DUKA 1VHSA 3K1NA 3RJPA 2JTVA 1XCBA 4CAVA 1CF7B 2Q44A 2A68F 4R1HA 4XSXF 3Q5FA 1NMTA 2QZ8A 4KOVA 4QB9A 4B8XA 1MJ9A 1HBXG 4LLGF 4EQQA 4L8AA 3BP8A 3RDIA 2QVOA 4UVBA 1BC8C 2GA2A 4HAMA 4WCGA 2I00A 1Z91A 1QSRA 2OA4A 1T2KA 3Q9VA 4GS4A 2P6SA 3LAPA 5ISVA 3D2PA 5EC4A 3I54A 2Q8KA 4KFCA 4K2EA 3KEQA 1S7NA 2A61A 3DR8A 2VN2A 3IWZA 2QQ9A 5H6QA 5F6FA 4MI4A 1WQ2A 3KEOA 1YW9A 4GCVA 1OZPA 4LMYA 4HQMA 2VBZA 1N71A 2O03A 3V4GA 2O8XA 1IN8A 2PMUA 5IT9Z 4YFJA 4RGSA 4WXDA 1IN7A 2FS5A 1IRFA 1IXCA 4MY0A 3V8IA 3RKWA 5EEGA 1GVJA 3GEZA 4L9TA 4I02A 2HEOA 2GIVA 4Y49C 2EK5A 5CVVA 1PP8F 2ZMEA 2HYGD 4IHSA 1OYYA 3FBUA 5EBVA 2M1BA 2D2WA 3GFJA 5LGNA 2R3SA 1XMKA 4HOBA 4E0AA 1SMTA 3I59A 2WTEA 2K86A 3FXRA 2G9WA 4KYWA 1H9TA 4G6QA 4ESJA 1TBXA 5LGTA 4LD5A 2BSWA 3CUOA 3OOPA 3WGGA 2VOOA 5LBQA 5BQTA 3UY5A 5CNPA 3S2WA 4FD5A 4RB2C 2R7HA 3SQNA 1HKSA 3R9EA 2ATRA 4JQFA 1MD0A 4KN4X 1R7JA 2EFOA 4HKFA 4AVPA 3LAJA 2F2EA 4A0YA 1K78A 4ORFA 1LDDA 2OQRA 2CYYA 2LDUA 1ZN2A 2ZCWA 4MQ9F 2CQKA 1Q2CA 3SHFA 2OQGA 3P2FA 5ILVA 3QRFF 4OIPF 4PDKA 1O57A 3GF2A 1IB1E 1TNTA 5ICGA 1K6OA 2MLKA 4KOWA 2PN6A 1NSLA 1IXSB 3IWGA 1RZ4A 2C27A 2OH1A 4AIJA 2QMLA 3J81K 2PC1A 2KIMA 4OMYA 4YG2F 2Q4YA 3S6GA 4HBLA 4AVBA 3W91A 2EA4A 1BOAA 2FIAA 3KP2A 4EJUA 1S3ZA 2JPBA 3F22A 1TQIA 2PR8A 4LK1F 3WTSC 2A6EF 3WU1B 1PU9A 1W7PA 1XD7A 4Y13A 3DKWA 1QZYA 4IXAA 1G3WA 3CXSA 3I59B 4JXRA 4PV6A 2E1NA 1LEAA 4LK0F 4HNXB 1QNTA 2GXGA 2EFQA 2JLMA 2HGCA 4MBUA 1FSHA 3FXTA 5FLXZ 5D5XB 3C18A 5D6EA 1G6NA 5F1RA 3E5QA 1AOYA 5E17F 1SFEA 3MWMA 5AIQA 2Z5UA 4TV7A 3BLNA 1Z4RA 2NNYA 3P9CA 4PK2A 1W5SA 1RI7A 1T39A 4WXHA 2PDOA 3L00A 3FWEA 2DXQA 2E7XA 3ZN1A 2A4NA 2DTRA 1IXRC 4KORA 1MJBA 2HS5A 1QSOA 2GWRA 4R3LA 1ON1A 3G3ZA 3TO7A 3ULQB 2K5TA 1KQ9A 3EC4A 1R1VA 3HHHA 1B6AA 3GYHX 4HYEA 2D4OA 3WE3A 1RXTA 4FD7A 2F5EA 2KCWA 4YFXF 4Q4ZF 1TQMA 2RQPA 5HDNA 5HLIA 3D0SA 3WU0A 2Z33A 1T6SA 2FMYA 1U5TA 3MCZA 4CS0B 4M9XA 4P96A 2ZFWA 1TW3A 4L0ZB 2H6BA 3M7GA 3BROA 1OYWA 3GZ6A 1KYWA 5IT9K 3L09A 2CW0F 3VODA 5FO5A 1Y7RA 3IRRA 1KU2A 3F5BA 3DPTA 3HOTA 3BJOA 1HXDA 1TTYA 2H6CA 4MNUA 2JZYA 2VZYA 4NHJA 2FQ3A 5GCNA 3HTUA 4Y15A 2XAHA 4LUAA 1FYKA 1S7FA 1IW7F 2ZW5A 2FXFA 4NB5A 4A6EA 2FSRA 2QBYB 5DCMB 2DFIA 4HQEA 4CYDA 1REPC 1S7KA 4JJXA 3QB8A 2XAGA 1YTYA 1XGNA 2H09A 2ZXJA 1KU3A 1ZLKA 1V3FA 3JVNA 1RUNA 4PZJA 1HW1A 3JTHA 2VE9A 3IHUA 4L5JA 3BY6A 2PQ8A 1PUEE 2FF4A 2D1HA 1U5TC 3KZZA 4IUSA 5BOXA 3ZQ7A 3IKVA 1YQAA 2AE6A 5E96A 3F8BA 4UVCA 3DSBA 2V9VA 3GFIA 2DPUA 1V0CA 3W6SA 1LJ9A 4IF5A 3GWZA 2IRFG 1T0FA 5FVJA 2FE7A 2VODA 3I5UA 2P5VA 1YIOA 1QGPA 3RYPA 1G3YA 1YFHA 2BGCA 1O3RA 4KUAA 3H3UA 2Y48A 3MZYA 1D8JA 5E20A 1J59A 4PGHA 1F5TA 2OB0A 2EB7A 4OIOF 3BJAA 4HLXA 2Q0YA 2L4AA 4WF2A 2B3VA 3F72A 2UXXA 3T1BA 2OU2A 2HQYA 3I71A 4BHPA 3J80Z 1ZG1A 3HRMA 2CSOA 3RKXA 2B4DA 1QO0D 5FLXK 1BI3A 5BS6A 3MQ0A 2L54A 4ZH4F 5JR3A 2J5PA 3F8FA 3VOEA 3FF5A 1FZPB 4AD9A 3I9SA 2IA1A 2NYXA 2XGXA 4FD4A 1TW2A 1W4MA 2MD5A 4LG0B 2NNNA 2DAOA 2VI7A 3WTVC 4ASNA 4E70A 3HIFA 4ENJA 1RNLA 1S3JA 4UXNA 4HLYA 3LA2A 4HX7A 4BNCA 4U9ZA 2K7LA 4AG9A 3GO5A 3IC7A 1L0CA 2BYVE 2PFBA 4CAWA 3G3SA 3RYOA 2P6TA 4Z2YA 4EGZA 1TLHB 5H84A 4QBJA 3E6CC 4HA8A 3CJNA 4MTEA 4OU0A 1IYLA 5IX3A 4L9VA 1EH7A 1FSEA 4OAEA 4D0PA 5CLSA 3NEUA 5L3DA 3FB3A 4YRHA 5FB2A 1KQ0A 5F49A 5H86A 1ULYA 1QSMA 2UXNA 4UV8A 2RN7A 1Z9UA 1Z6RA 4KDPA 1JE8A 1CJWA 4R87A 1BIBA 2QYOA 3AAFA 3BOQA 2FXAA 4FHTA 2OAZA 1FYLA 1R57A 5LGUA 1LDJA 4KMFA 2FBKA 5ED4A 3F3XA 1IN4A 3BDDA 3P7NA 4ON0A 1YR0A 2I79A 2Y75A 4HF0A 1B87A 2Z99A 1HKQA 2G7UA 5L3FA 3RKYA 1KU7A 3E0KA 2MH9A 3ABTA 3R0AA 2HUZA 2RGVA 3PGPA 5F48A 3WTWC 1MJAA 2ZW4A 1K7AA 1M1DA 1MZBA 4XPKA 1SFUA 5L3BA 3FM3A 4CRYB 1IUYA 1OYIA 4F0YA 5A2QZ 4AWXB 2FEZA 5DD4A 3DDDA 4KICA 4EM0B 3I0TA 1LB2A 3K1PA 5LRRA 3DFGA 3FRMA 4I49A 2X0LA 1Y9WA 1OKRA 5DD8A 1U3EM 1BM9A 5F46A 3V8JA 5CVJA 5HS8A 4UHTA 4LLLA 1XDUA 1QSNA 1ZG3A 4XNHC 1KYZA 3L9FA 2EWNA 3W6KB 1DPRA 1ZGAA 5C82A 4JK1X 4L89A 2XV4S 2IVMA 2ZNYA 4IPAA 1M4GA 2P8TA 2A69F 2W24A 3KP6A 2LNBA 2B5GB 4M73A 4UUVA 3EYIA 4NCZA 1QZZA 3E5XA 1XB4A 1GXQA 2BE5F 1SMYF 1I1SA 1RUOA 1ZRCA 4ENMA 5ILUA 1AWCA 3HTSB 2YR2A 1HW2A 3FMSA 3DPLC 2OZHA 1P2FA 3GUDA 1XCVA 5HLHA 2M8EA 1TNSA 1IRGA 4ZYHA 2Z0ZA 4Y49B 2QENA 1ZAOA 4AIHA 2J5OA 4UBRA 4CO8A 4CRZB 1J4JA 2XRNA 2WPXA 1F4KA 5LHHA 2KIUA 2VONA 2CG4A 1YW7A 2IPQX 4EJWA 3FMRA 2M45A 4M6XA 2A07F 4CXFA 3ZMTA 1FWZA 2QLZA 4M72A 4CHUA 5JQ4A 1UFHA 4XBFA 3KP7A 5L3EA 1BBYA 2QM3A 2YSRA 4IHTA 2G3TA 2HYFA 2ISZA 4EJVA 3I3GA 4M9SA 3ZMSA 3HHGA 3J80K 1H0MA 1QBJA 2X4HA 3KLOA 1BJAA 2R7DA 3R95A 4L9NA 5HLGA 3T90A 2FMLA 3ECHA 1FX7A 1FBSA 1XN7A 4MJ8A 3DP7A 3R6SA 1KQ8A 2O28A 1SD4A 4IRGA 5C88A 2XVCA 3D5LA 4LB6B 4Q47A 4XRFA 1DDNA 4LGWA 1OPCA 1S7OA 2R98A 1HSTA 5IT3A 3C7JA 3JAMZ 4RAYA 4HX4A 3I64A 3F23A 2RVCA 4ZYDA 4HZFA 3F21A 2R1IA 3EUHA 1ON0A 4CICA 2H5MA 4M6YA 4LX9A 3K9TA 1J7KA 3CUQA 2ZMEB 1YVKA 5E8IA 5DYMA 4IRIA 1PDNC 4WWCA 2VT3A 3E6DA 4B5OA 2A5YB 3Q9SA 4N9IA 3P2HA 3GYAA 3FHZA 1SD6A 2R7FA 4PCQA 2CY2A 1YS7A 4IRHA 4J3GA 3QPHA 4UV9A 3B02A 5E1WA 3H3ZA 1I5ZA 3IL2A 2W25A 4ZYGA 1CGPA 1Q2YA 2UZKA 2XUBA 2XKPA 2HKOA 3FXQA 3QAHA 2EJRA 1KUXA 3R4KA 2XAJA 4KOTA 5ICFA 3QU6A 2ACJA 2W84A 1Z05A 3M9AA 2DT5A 3I4PA 3DR6A 4BHCA 3KETA 3CXQA 1R5GA 4G9YA 4LJZF 2F5FA 4A2UA 3MEXA 4HF1A 3BJ8A 3TE4A 2J8MA 3ZMZA 1K78B 2B0LA 3TO6A 1WRJA 2K27A 2IJLA 5HDGA 3ZMUA 1MDMA 4LLNA 4EMSA 1SQHA 1ZREA 1YVOA 3GKRA 5HH1A 1JHHA 4I0AA 5ILSA 3SZTA 2E7WA 1STZA 5KTDA 1FY7A 3TQNA 2FBHA 5FD6A 2RV8A 3EYYA 1W5TA 4XPDC 2XHKA 5E18F 3CUQC 5KTCA 1QQIA 4YIFA 2STTA 1M4DA 1S7AA 3LD2A 3EDPA 1G3TA 3IGRA 2KRFA 3TCVA 3VWDA 4CZZA 2PRBA 3KP4A 3F8KA 3V8LA 3ECOA 2ESNA 2CNMA 2P5KA 3KZYA 4A12A 1W7PB 1R00A 2ZNZA 4OOIA 1FNNA 2AXLA 5HOOA 2DPDA 1DUXC 3T0YA 2L4MA 3ROUA 3BJ7A 5HVQC 5CVUA 2IP2A 4HW0A 1R5HA 1FP2A 4ONUA 3WGIA 1LNWA 4UNOA 1WKMA 1K4JA 2GZWA 2ZJ2A 4BMHA 5IB0A 1G4DA 1ZARA 1WWZA 4AG7A 1IICA 1R1UA 2O61A 3KLNA 2FBIA 4HNYB 2NMTA 1XF8A 3N4MA 4RB0A 1MDMB 1EV7A 3T8RA 1Z7UA 4I2OA 2DO7A 1JHFA 4MTDA 4BYYA 1O3QA 1MK4A 4U88A 3GXOA 1F9NA 3U2RA 1FT9A 3C1DA 5H20A 4KOXA 2CO5A 2ESHA 2JDCA 3HRSA 4M3SA 2K4BA 2GXBA 1YK3A 2PLYA 1SAXA 4ENNA 1JXSA 4OLLA 1L3LA 2FCKA 3GY9A 4KOUA 3P9IA 2Y0MA 3EFAA 2LF7A 2Q4VA 3REOA 2VBQA 2HFHA 4IF4A 2BEIA 2HTJA 2PSWA 3L2CA 1ZRDA 2J8NA 1QSTA 3R9FA 1O3TA 1U5TB 5ICEA 3JAMK 3ZPLA 3K1MA 4Q5SF 3FM5A 1BC7C 4KLWA 1BI2A 3BWGA 2BV6A 5TJJA 2XROA 1KA8A 1JGSA 2VBYA 3E97A 5CVIA 5JPHA 3S6HA 6PAXA 4RB3C 1WI9A 2RC4A 4UWJA 3MAJA 1PUAA 4N0BA 2QWWA 2VXZA 2HR3A 4ZBGA 1FC3A 2TDXA 4XLPF 5LEJA 2F5IA 2IL4A 3KP5A 2CNTA 3O2PE 1EH6A 2GAUA 3G73A 1BI1A 5F47A 2P0WA 2DQLA 4O3MA 5LRSA 2YPRA 2NS0A 4HDUA 4RS8A 3F6OA 4CGZA 5DDGA 2PJPA 1O7FA 3D2MA 1XGMA 3NE7A 2J8RA 1FBUA 2DBBA 1HW5A 5ERIA 3GZ5A 3N7ZA 1R23A 4EM1A 1LDKB 2IA0A 3PQKA 4FX0A 2Z3YA 3DEUA 4NF1A 3I53A 3GX4X 3VB2A 2VEZA 1S29A 5J6XA 1XMTA 1IIDA 4HDVA 1UCRA 2V1DA 3BPXA 2HKXA 4RI1A 1LQ1A 4N9HA 3PFIA 3KCCA 1XSVA 4A5NA 1Z9CA 4WK8F 2MLGA 3R9GA 1U2WA 1B9NA 1K79A 3D8PA 3ZZIA 2EUIA 2ETHA 2L01A 2YX4A 3ZP5A 3MFKA 2V79A 1CF7A 1B1BA 2WPWA 3WODF 5TRDA 1YO5C 1U6GA 4AIKA 2O3FA 3J7AO 2ZKZA 2RDPA 3WTUC 1YG2A 2PI0A 4KT5C 4U7DA 5K5RA 3RIRA 1YLEA 2OBPA 4QVTA 2FT0A 3COAC 5FFXA 1P92A 1VKCA 2HZTA 2LKPA 3RPQA 4ESBA 2P5LC 2ZPAA 4OADA 4NQWA 2JT1A 5HDKA 2BEOA 2OZUA 5D5VB 2Z11A 5FFZA 2YU3A 2K4JA 3QP6A 2DK5A 1IZ1A 4JWPA 4F6AA 4KIFA 1J2XA 3LA7A 2L02A 3SXOA 2COMA 4EJTA 4EGYA 4GO1A 1UB9A 2B4DB 3ZN0A 3EXNA 3TDUC 3W6XA 5KK1A 1Z1DA 3HUGA 3HSFA 2D4PA 2EFPA 4O5VA 4JD6A 1YLFA 4YFNF 4MEYF 3D3SA 1C0WA 4QUSA 2M30A 4OINF 3NQOA 4KVXA 1P4AA 2MH2A 1NHAA 2O0YA 1XIXA 4AB7A 2PR1A 4GYIA 2K02A 5DCFA 4PGGA 5BMZA 4HX8A 3IRQA 2JDDA 1W7PD 1XGOA 1UHWA 4NEXA 2PBIA 4ETSA 2XASA 3VWEA 4KOYA 4XSZF 3FMQA 2QQBA 4HV6A 4MY3A 3CTAA 4RGUA 2Q04A 4KMUX 2IW5A 2FSWA 4XNHB 1MGTA 3F0AA 4MEXF 3V7RA 4DNCA 3V7CA 1NE9A 3F6VA 2P6GA 2OZGA 2HWVA 3WG9A 2QIRA 2ZBKA 3FNCA 2IT0A 1IN6A 1Q2DA 2DK8A 2FNAA 4KIBA 1M44A 4JXQA 1FYMA 1ODDA 4XPLA 4FD6A 5J8FA 2FL4A 1U6MA 2DLLA 4II9A 4QWQA 2QECA 4G7OF 3EQLF 4EV0A 1FPQA 2ISYA 3F8CA 3R0JA 3B8GA 3BPVA 2FA5A 1B6BA 3E6MA 3BZ6A 4HV5A 3CXPA 5D4SA 1PP7U 1HKTA 2VQYA 5H6RA 3WTZA 2C6YA 3MGDA 4BQAA 2HV2A 2B58A 5FGMA 3H4QA 2Q2EA 3H92A 1S7LA 1BIAA 3LSTA 5DEQA 1S8NA 1R1TA 2M5WA 1I1GA 2ARHA 1D3YA 2FIWA 2RNJA 4U5YA 2OD5A 4M71A 3TDZC 1M4IA 2O6GE 4LB5A 2DQRA 4KN7X 4A0ZA 2P4WA 1X3UA 3SZPA 2KJBA 5JI6A 3S6KA 3BJ6A 1ZLJA 1A04A 2V1XA 1TIQA 2B3UA 4AVAA 4GGGA 2A6HF 3FX3A 4GXOA 1BI0A 3LQQA 2XIGA 2WWYA 2VE8A 4A0XA 4G8XA 2HTSA 2F5DA 2BL1A 4G6DA 2Q7BA 4E8OA 2DU9A 2EFNA 4O6JA 1H9GA 4EM2A 3IWFA 2F5CA 4R79A 3DQVC 4IVNA 5LHIA 2PG4A 2ADUA 1YW8A 2GE3A 3ERED 2AS5F 4YGOA 1Q1HA 2D45A 2G3AA 4LFUA 4A5MA 2JRTA 1D8KA 1G3SA 1D5VA 1B59A 3R1KA 4G7ZF 4R57A 1U78A 2EV6A 4M74A 4I98B 3GVAA 1IAWA 1XSDA 3ZJ0A 3HRUA 4QLCU 5HS7A 1OMIA 5K5OA 2JSCA 3FYNA 2P6EA 3RYRA 4ZZDA 1UHMA 1LEBA
chains in the Genus database with same CATH superfamily
1LR7A 2ZMEC 3KY9A 2KJCA 2MA3A 3S16J 5E1XA 3D7GA 2HQNA 2X51A 3LODA 1K6YA 3R61A 2JA1A 1P9ZA 4PSXA 5IOZA 2PJ9A 3SHPA 5GAEJ 4OMZA 4BXUA 4F9UA 3B35A 1X1CA 3HOSA 1SFXA 3M8EA 2E2HJ 1YTPA 1MBKA 1S60A 1Z2LA 4NGMA 1R36A 2KZVA 5FRMA 2W57A 4UWIA 1J75A 1E3OC 2DB6A 4JLYA 3H8GA 3FX6A 2DW4A 2FU4A 4LQGA 3WR7A 1OISA 4V2GA 2PX9A 4A6DA 2G0EA 5C4XJ 1VNDA 5THWA 4C3IJ 2V1UA 2ELHA 3T8TA 5BNGA 5DV5A 1I6XA 1U9OA 4ZY2A 4I0BA 3TL4X 4U0VA 5EZGA 4KUMA 3JSPA 1JKPC 1MNMC 4RS2A 1HDLA 4PK4A 2GKVA 2M34A 2QGUA 2E35A 4YIIA 4W9YA 1ZH5A 1S6LA 2VXKA 1P9QC 1Y0NA 2CU7A 2QQAA 4L18B 3RQ4A 2RKHA 1ETKA 1P4WA 2OJED 2IEKA 3L2RA 3N97A 1DE4C 4UCNA 1X2NA 1VHOA 1EH8A 1KONA 2F7VA 4C3HJ 1ETYA 5JLWA 2REEA 3P9KA 4MHDA 2JQ7A 2R8VA 3IEHA 3JSOA 5F0CA 4U0WA 4B6DA 4MFKA 2FQ4A 3LFKA 3JRFA 5LLQA 4E2AA 2K9LA 1ZO0A 4IX7A 3TFYA 5LRGA 4MCQA 5C44J 2ZW6A 5E3NA 4R9MA 2PMHA 2EFWA 1HLVA 1ZLIA 4EJOA 5A2QK 2UUZA 3RO0A 1Y56A 3BR2A 4KA4A 1JGGA 1IGBA 3QWPA 5LYDA 4U0YA 1JUPA 1YRNA 2VOPA 2ZXVA 4UFVA 4XLNF 4ZYEA 1WZ2A 4I7HA 3W3CA 2L9SA 2JA6J 3VDPA 4H6UA 4MCPA 4CAXA 3G1MA 3S2DJ 2LY1A 3F8MA 5TGTA 3WTTC 2H8WA 2EBIA 3KYLA 4Y52J 3LMSA 3HC7A 5L3GA 1R6RA 5FD5A 3J7YJ 2ZW7A 2AFMA 3I58A 3DKXA 3HKZA 4C7IA 1RKTA 5DWNA 4B47A 5DM6F 3ELKA 3OYIA 2FNPA 3B4VC 2G0BA 4HEA2 4IQ4A 5CJ9A 3K2ZA 2FOKA 1SD5A 3F8NA 1JJ6C 2PMZN 1IYKA 4WWVA 3K69A 1Z6TA 2L3DA 5JVTA 5C3EJ 3GTOJ 2AHQA 3DU6A 3CDIA 3PRTA 4OAYA 5E8GA 3DLAA 4AC0A 2ZJPF 4P4JA 4BAYA 4XPDB 2X9DA 3WE2A 4L5IA 2B63J 2EZHA 3CUQB 3RTRA 2JPCA 2QBYA 5DCMA 1LRZA 3ZMVA 3K7AJ 4S04A 3GLLA 3TMOA 1ON2A 2Y2ZA 4IEJA 3RI4A 2VUMJ 1TUSA 3FXUA 2V8DA 3BXMA 3KE2A 3PEIA 2JRMA 4U9YA 5AONA 2VIXA 3TGNA 1GHCA 4DIQA 1CGII 1P0HA 2YUUA 2LBFA 3TTHA 2E1OA 3QOPA 4AVZA 3TO9A 5BPIA 2HQRA 1BLLE 2IA2A 2H94A 3ML6A 1PTQA 5HQ8A 1CM0A 3K9UA 1XGSA 2BW3A 3UGDA 4KVOE 4MFJA 4C2ZA 5F08A 4H6ZA 2P7CB 3DPUA 3LMMA 4KVME 2EINH 4RA2A 3K0LA 1OBRA 4B43A 1AKHB 1ZGJA 1TZLA 3GW2A 4HF2A 4R8FA 3DNSA 4A3FJ 2EV0A 3VPRA 3W6JB 2YX7A 3JTGA 1V4RA 4WXCA 4KJZA 4XIDA 3H5RA 2H1KA 2E2JJ 2VZZA 5KTAA 1M8CA 2CW7A 5KAFC 3MZHA 1KUYA 4UXHA 4UXIA 4NC7A 3CCQI 3DF8A 3PFEA 3QU3A 3R5CA 4XM3A 1M4LA 5EEHA 1SD7A 2CWEA 4B13A 2E5ZA 5LEKA 2HDCA 4LG3A 4BBHA 4HG2A 3WT4A 3SXNA 5JHUA 1AA7A 4BHBA 1AU7A 1LFPA 2BVMA 3ISPA 1B4AA 4IJAA 5CYVA 2M87A 3FIXA 2CNSA 6CPAA 3HOZJ 2P7VB 3MD2A 4NSQA 1NUBA 3L7WA 3S9MA 5CPRB 1MKMA 1U9NA 1X1DA 1VQ9I 1WGCA 3PP9A 1K61A 1MH3A 2X6WA 1J0RA 3OS1A 2YNEA 3C26A 5K8OA 4S05A 2NS8A 4MGRA 1J9IA 2DOFA 5EMIA 5ICCA 4HGUA 2O53A 1LKXA 3SI0A 3CO6C 2NRAC 5FUXA 2LY9A 3HOVJ 4R6TA 1JQGA 1ZRFA 3WGHA 4KLVA 3H5AA 2G7HA 4QC6A 1P6RA 4M85A 3OOUA 1ITYA 2A6TA 4C2UA 2STWA 2BOAA 1Y9KA 2LK2A 2EIJH 2BHZA 3U9GA 4IO9F 5DAEA 2IMOA 2DDBA 4UUTA 5DS9A 3PUBA 1ONVA 3S6FA 4L0YB 2K40A 1XE4A 1TBNA 1XMXA 1W0TA 2ARPF 3HPGA 2MC4A 1XPXA 4HNTA 4X5KA 4Y17A 2DMPA 1BPNA 2VJJA 3M1EA 1Z8WA 3QQAA 4HNVA 2I5UA 3B6CA 4ZJZA 4HNUA 1FEXA 1IDYA 1XEBA 4L9JA 1XSXA 1DP7P 2VBXA 4PK3A 5HS9A 4CYPA 4P4DA 2OPTA 1CHOI 3Q0VA 3N05A 5FUVA 1E2XA 3LQRA 2BUSA 3OXGA 3O6BB 1WSUA 1PTRA 2XEGA 4XLAA 3FVLA 4KUBA 2CTBA 2VQHA 1RPWA 1ZYRF 3NRVA 3SDGA 4R3KA 2CH0A 1OR7A 2WGCA 3JUWA 3G8WA 2H27A 1T38A 2VBWA 1TXRA 1QRYA 4DGWB 2VT2A 1KZFA 2HVQA 3E6BA 3UR3C 1WH7A 5LHGA 2R92J 3L2VA 3TT2A 2V8GA 1HF0A 4G1PA 2MC3A 2B4BA 3ZQIA 4U7BA 3E5UA 5HLTA 2LKSA 3EY5A 1L0OC 1HQCA 2YS9A 5KVRA 2PJ2A 1LVAA 5F09A 1BO4A 4LG0A 1Q7LA 3JW4A 4LITA 3IKTA 4H89A 4JBAA 3HRTA 4IHWA 1ARMA 2XKOA 4F8ZA 3CD6I 4LQ6A 1Y1CA 3R96A 3WTXC 1MBJA 4PJ0C 3SXYA 1T98A 3CMYA 2VC1A 1SGPI 3R5AA 4E7KA 2GA1A 3ASNH 3KYCB 1VQMI 3HYIA 1OCOH 3SFZA 1VQ8I 2HOEA 1YREA 3OVOA 3RNZA 5KAIC 1RO5A 1OFCX 4PPZA 5CVRA 4E4HA 2PJCA 2CGPA 2QYVA 2N17A 3MZ8A 1XOVA 3CDHA 5FUWA 2ZENA 2XAFA 2W85A 1HOMA 5EG0B 4QPQA 1O7LA 3A0HC 3HM5A 3RPUA 4CDGA 1A6IA 3JREA 5KHDA 4CGOA 3IIBA 1R22A 2IXSA 3CP8A 3IH2A 3GTKJ 5J8CA 2D1VA 4OVOA 3R60A 2OTJI 2P6FA 5DWMA 3RAMA 1HDUA 4RAZA 1D0ZA 2OZ6A 4B5PA 2LSOA 3BCAA 3H9JA 1ETWA 1TQPA 5K5QA 1VQPI 3LNQA 5E3MA 1BN5A 1VTNC 2NU1I 4XLFA 5G1ZA 4EVYA 2V7FA 1JT0A 5DS0A 5E1ZB 4CYQA 4MPIA 2CUJA 3V8KA 3ABUA 2NYQA 3TOBA 4B09A 4BH9A 2VL1A 5F64A 2PJRA 1HEVA 2BBYA 1I27A 3QP5A 4UVAA 3VFZA 2MABA 2GQQA 1J5YA 4BEHA 5HNFA 1N78A 3HGGA 4MFZA 2KMOA 3U1DA 2A3SA 4G94A 2QUFA 4GYGA 1USTA 4G7HF 3JRBA 2DOEA 4M6VA 3T5XA 4I01A 2XSDC 1QVUA 2E2IJ 4R8HA 1YX0A 1Z21A 3O3KA 1F2OA 4P5OA 3PQJA 3H0DA 2L2OA 3BTJA 3S9NA 3AFHA 2TRTA 3GFLA 3K4CA 5IV0A 2QKMB 1MSFC 4KIGA 2NVTJ 3PJRA 4UA3A 2NVYJ 3CXLA 1TKFA 2BCOA 3LACA 5GTIC 2X7BA 3IJ3A 3KKWA 1S5KA 3FXJA 3CP2A 3A03A 3CCYA 2XEFA 3GFMA 2XRLA 3CO7C 2FE3A 2EVNA 1OR7C 3LA3A 1UUCA 2ELKA 3V7SA 1BL0A 4FT8A 4ZDOA 2VKVA 4AUXA 1I1DA 2W1OA 4B10A 3M8FA 1USSA 2AJ6A 4EVIA 4KNYA 1DS2I 2PVWA 1XMAA 1ZG5A 1U8RA 2UWMA 5K1YA 4MXUA 1ZHFA 1B9MA 1WK4A 3HSRA 1GVDA 3KP3A 2N52A 3OWCA 3S3MA 3GLXA 4H0EA 2XAQA 3AKZA 1XDSA 2Q43A 4YFKF 3EO4A 2B9SA 4H4KC 3DEEA 1KU9A 5L3CA 1RFHA 2REFA 5D4RA 3PNVA 1I21A 3ISXA 1MMDA 1Y0UA 2NAZA 2KKOA 3ASOH 3DV8A 2X52A 4B4CA 5GTHC 4PSWA 5D8LB 4CH7A 4AYBA 5HMNA 2NVQJ 4AVCA 3OYMA 3VEPA 2SGEI 3FEDA 1QPMA 4I09A 4ENKA 3A2KA 1DPUA 3HSEA 4RGRA 4K30A 1FBQA 2ZSIB 3QPTA 1R58A 1FP1D 4UCMA 2WC2A 5J40A 3CDXA 3UEJA 1IU8A 3KI9A 1P4XA 4P9UA 4FX4A 1VF9A 2DI3A 1RIOH 4P10A 2E1CA 3QYBA 2WAFA 1HSJA 1MW7A 2MBFA 3H0GJ 1I12A 5D29A 1WHUA 2LF8A 2EA2A 1QQ9A 2DXIA 1Y1WJ 2ZEFA 3WC6A 5AG7A 5LFAA 3TKYA 5D8KB 3EPZA 1OCPA 1XBTA 4M3GA 4KZTA 3PB6X 5D5UB 1IF1A 3DWLE 2VC0A 1BOBA 2BUEA 2KIFA 4BQOA 2EWBA 4ZZLA 2MYSA 3QPSA 4ESFA 1FOKA 1T0FC 1A2ZA 4FUUA 5J1UA 5CCMA 1XBUA 1PPFI 2QQEA 1W36D 4JZ0A 5D6FA 1EKEA 1SGQI 3J81Z 2YU9J 2ENZA 1KBFA 4B5PB 3CLOA 5IYCJ 1IJWC 3TBIA 1HEEA 3FXOA 3LSJA 1QHGA 4E7IA 2AO9A 2FRHA 5BPDA 2G9DA 3S3NA 2Q4ZA 5B5EC 4RGXA 2HYJA 4XLEA 4RDUA 3L1PA 3W6VA 2JW6A 3D7FA 3PZJA 4UB8C 1T56A 1UFMA 3EETA 4M9ZA 4RB1A 3BHXA 3HLPA 3B6AA 5BWAB 1W0UA 1WWXA 1J09A 1KGSA 3KFWX 1GXPA 3JR9A 1Z4EA 4P9FA 1GHEA 4BEHB 2VKEA 3KR4A 4MHZA 2V6CA 2JEVA 4NXYA 3ZMDA 2CFXA 4MQVA 4WX9A 3TOAA 2WAEA 3G2BA 2X85A 1YS6A 5FKLA 2EV5A 3OV8A 4OIRF 2R93J 3BZKA 3WTYC 1NK3P 1P4NA 4CAFA 3LWFA 3G6EI 3DEWA 2Z9OA 1BR2A 1DTDA 3IU2A 4KOSA 4A93J 4OIDA 5LRJA 5I0CA 2PJ1A 3CZ6A 3E3VA 3FZVA 1ETOA 2BY1A 3B73A 5DUIA 4P55A 1G2HA 5EJCA 4IAVA 2CQ7A 4IKFA 3I4MJ 4O23A 2R4GA 1YYVA 3SEZA 1F1ZA 3GOXA 2Z10A 3C3WA 2FJ1A 4J00A 4MO7A 4HSTA 4PXBA 2LREA 1KUVA 2DMNA 2Q0OA 2XF7A 3ZRGA 4IOAF 1TT5B 4BBSJ 2ZO4A 1B72A 5AG4A 3SJFA 1O3SA 2HC9A 3G1OA 5AIPA 4DQ2A 1FLIA 1LCPA 3G1LA 1ZLHA 2CUZA 3DXJF 4MHGA 1ZR4A 2JWTA 4HNWB 5D5WB 4YIRX 1E17A 4DYCA 3DTIA 2WV1A 1I3AA 1VQLI 3T9YA 1IN5A 1YGHA 4OIQF 3CCVI 1N25A 3SEQA 4F7ZA 2GANA 2XEIA 3NH5A 4D9JA 2PEXA 4B3AA 2WV0A 3S14J 1VQ5I 1EE3P 2DYSH 4Q48A 1D0YA 5JFRA 5GPAA 5M3FJ 3KHXA 4TNUA 1Z7LA 3GB0A 1WJDA 2KLOA 5DUKA 1XMBA 5LYFA 2DN0A 3AG3H 4A3DJ 3BR0A 1VHSA 3K1NA 2Q7SA 3RJPA 2JTVA 1XCBA 4CAVA 1XG1A 3G4SI 1CF7B 1HDDC 2Q44A 2DEAA 5H2FC 2A68F 1P9GA 4R1HA 4XSXF 3Q5FA 1NMTA 2QZ8A 2XB0X 4KOVA 4M6GA 1MIJA 4QB9A 4DOZA 2WY7Q 2K9HA 4B8XA 2PJAA 2POKA 2QJ8A 4ZYQA 1MJ9A 3BR3A 3W2WA 1HBXG 3NA6A 2IJZA 4LLGF 4EQQA 2GU2A 2ANPA 5HNHA 2SGDI 2JUCA 4A3KJ 1W5CC 3BP8A 1UELB 4L8AA 3RDIA 2V1NA 3FDYA 4SGBI 4PJNA 2QVOA 4UVBA 4NJQA 1RC9A 1BC8C 4NGTA 1EF4A 2GA2A 4HAMA 2IS1A 1QMUA 4WCGA 2R7WA 2AFWA 2W00A 4MIMA 4BJ5C 3J7ZI 1Z91A 2I00A 4CCNA 3K2KA 1QSRA 2CF4A 2KP6A 2OA4A 1N13A 1T2KA 3Q9VA 2NS7A 4BJTA 4GS4A 4NQWB 3FXLA 2E19A 2P6SA 3LAPA 5ISVA 3VYSB 3D2PA 4UFWA 2F4OB 1LAPA 5EC4A 3I54A 3TEDA 2Q8KA 4KFCA 3S32A 2E5RA 4K2EA 3KEQA 1S7NA 2A61A 4AM3A 3DR8A 2VN2A 3IWZA 2QQ9A 5H6QA 3S1MJ 2AFZA 4CGMA 5F6FA 4RUHA 2VASA 4MI4A 2JA8J 3VYTB 3DGVA 1FIPA 1WQ2A 1YW9A 3KEOA 3AL0C 3HUVA 4A30A 1MBFA 4GCVA 3PL8A 2ID6A 4MRIA 1OZPA 2DA2A 4BDZA 3U21A 3I55I 4LMYA 4BACA 4HQMA 2VBZA 1N71A 2KDOA 2PJ7A 2O03A 2K5CA 5JLXA 5E3RA 4NGPA 4E7ZA 1QPIA 3V4GA 4CCOA 2O8XA 1IN8A 2PMUA 3B2YA 5IT9Z 4YFJA 4RGSA 3HUGB 2GOMA 4WXDA 1IN7A 2Y9ZA 1RR7A 1Z8LA 4HPSA 9ANTA 1Z8TA 2FS5A 1IRFA 4A2ZA 2V9PA 4F55A 4B12A 3SFIA 1Y6IA 2H8RA 1IXCA 3VATA 5K7HA 3NARA 3SDBA 1X10A 5FLVA 3BQZA 2IS2A 4MY0A 3V8IA 3RKWA 3OR1C 3E59A 5EEGA 1GVJA 1VQ4I 1S72I 4C2MJ 3GEZA 4L9TA 4I02A 2QF7A 2EH3A 2HEOA 2F8HA 2Y0SN 1PYTB 3PUFA 2GIVA 3KQZA 4M6HA 2YNCA 4Y49C 4BDYA 3GTPJ 2EK5A 5CVVA 1PP8F 2ZMEA 3HEFA 1RKWA 2HYGD 2LB7A 2WADA 4IHSA 1ARLA 3GTMJ 3D00A 1ZGWA 1OYYA 3OXFA 2VRWB 3FBUA 5EBVA 2IAIA 3OIOA 3LSIA 1X19A 2M1BA 2D2WA 3GFJA 1HC8A 5LGNA 4YELA 2R3SA 2HVRA 4FCYA 2DA5A 1X74A 1CSOI 4OC0A 3IO1A 1XMKA 4HOBA 1F43A 1HPTA 4E0AA 3SGBI 3OXLA 1SMTA 3I59A 1Y1BA 2WTEA 2OD1A 2K86A 3FXRA 2G9WA 2E34A 3VDXA 4KYWA 1LE8A 1H9TA 2ZEGA 4MJ8A 4G6QA 2A20A 4ESJA 1TBXA 3D1NI 5LGTA 4LD5A 4XKCA 2BSWA 3CUOA 2HXOA 3PDNA 3OOPA 4C2YA 4DJAA 3WGGA 5J3LA 2VOOA 4MFPA 5LBQA 5BQTA 2AQEA 4QPOA 1V1IA 5CNPA 3UY5A 3S2WA 3H5ZA 4FD5A 4RB2C 2KMQA 4M3FA 2M9HA 4XOTA 3FSYA 2R7HA 3OYKA 3SQNA 1HKSA 3R9EA 2ATRA 5EYRA 4JQFA 1MD0A 1ZQ3P 3LFUA 4KN4X 2VKDA 1FIAA 1R7JA 2EFOA 3CMEI 2ZXIA 3V38A 4FASD 1H89C 4HKFA 3QODA 4AVPA 3HB9A 3LAJA 2Q51A 2KMRA 3GBGA 1ULKA 2DPSA 3PIOF 2X1EA 2F2EA 4A0YA 1K78A 4ORFA 1LDDA 2OQRA 2AQFA 2EQRA 2CYYA 3ZQHA 1HJAI 3OIPA 3MEKA 2LDUA 1ZN2A 2ZCWA 2WSAA 3KGQA 2GVIA 2W4SA 1X58A 4MQ9F 2CQKA 1Q2CA 5GAGJ 3DBRB 1LFWA 2Z3NA 3SHFA 4H2KA 1F36A 2OQGA 3RU0A 3P2FA 3OS2A 4BL0B 4Y33A 2Z3LA 2M0MA 5ILVA 1IY6A 4GM5A 3TP3A 3QRFF 4OIPF 3D68A 1TOTA 3LL7A 2AFUA 4PDKA 4X2TA 1D1CA 4BUPA 1NXUA 1O57A 1H8AC 2W48A 2B7EA 4XN3A 1ENHA 3LSMA 3CCEI 2J87A 1I50J 2JN6A 3GF2A 4P44A 1IB1E 1TNTA 5ICGA 1K6OA 2MLKA 3HKZN 4KOWA 2Z3PA 2PN6A 1NSLA 1IXSB 1UMQA 4QSHA 1RZ4A 1WGTA 4E7JA 3IWGA 4MHNA 3GTQJ 2C27A 2KPMA 2OH1A 4AIJA 4PJLA 2QMLA 3J81K 4ZYAA 2PC1A 2KIMA 2Q2EB 1WJCA 4OMYA 4RBOA 4YG2F 1SGDI 2V26A 2Q4YA 1VGYA 3S6GA 4HBLA 2BOLA 4AVBA 4CGLA 2CFOA 3W91A 4A95A 2EA4A 2M8GX 2OUMA 2XB5A 1R43A 1BOAA 2FIAA 3KP2A 3Q0WA 4W97A 1ELMP 4EJUA 3QTLD 1S3ZA 2JPBA 3QWLA 1W3SA 3ONQA 4MFEA 3F22A 1SGRI 5CKTA 3A01A 1TQIA 1UG0A 3NH8A 3KQXA 2PR8A 4LK1F 2CW8A 3WTSC 2A6EF 3AG4H 3WU1B 1BW6A 1W7PA 1PU9A 1XD7A 1P7IA 2EZLA 4JX6A 4Y13A 2CQXA 1K7TA 4ZX8A 2ZELA 3DKWA 1QZYA 3LSGA 4IXAA 3OSGA 1FJLA 1G3WA 1SFOJ 3CXSA 2PIZA 4CCJA 2K9MA 2OR4A 3I59B 1AHDP 4JXRA 4PV6A 2E1NA 1LEAA 2Y69H 3TP0A 4LK0F 2QSGX 4HNXB 1QNTA 2GXGA 2EFQA 2JLMA 2HGCA 4XKVA 4MBUA 4IOCF 2KZGA 1JKQC 1FSHA 3KX2A 3FXTA 5FLXZ 1H88C 4JP0A 3MRUA 5D5XB 2LTPA 4RAFA 3CMAI 3C18A 5D6EA 3VDUA 1G6NA 2RB7A 3L2UA 3K10A 2WAQA 3GZNB 3H1CA 3E5QA 2IGOA 5F1RA 2M4GA 3K2AA 1VIXA 3RPUD 1AOYA 4ZY0A 5E17F 1SFEA 4FQGA 4I99C 2QKLB 2B5GA 3MWMA 5AIQA 1I39A 5E3OA 2QSHX 2F6CA 2Z5UA 4TV7A 3BLNA 1FTTA 1IOFA 1Z4RA 2NNYA 3P9CA 4PK2A 4MCRA 5JM6A 2PJ0A 4XKWA 1W5SA 2IBDA 4Z6YA 1RI7A 4BGDA 2GLFA 1T39A 4WXHA 2DIPA 3JRUA 2PDOA 3L2WA 3L00A 3FWEA 2RFHA 2HI3A 4D7MA 2DXQA 1ZR2A 3R5DA 2E7XA 3JRIA 3ZN1A 3SI2A 3ZCOA 2A4NA 2DTRA 1TC3C 2F4IA 1IXRC 2HDDA 2CS3A 4KORA 1FOWA 1MJBA 1IRZA 2HS5A 1QSOA 3RSNA 2GWRA 4R3LA 4I6ZA 1PYVA 5EGOB 1T33A 2I10A 1ON1A 2KCXA 2ELIA 4B14A 3G3ZA 3TO7A 2ODDA 1TURA 2EK9A 3BR6A 4N4NB 1AN1I 1CGJI 4R76A 3ULQB 2K5TA 1KQ9A 2ZOGA 2R7TA 3EC4A 5JHWC 4A3MJ 4FTHA 4R7MA 3SGQI 3D5SC 1R1VA 3HHHA 2Z3KA 3QYEA 4OMEA 5JGFA 1B6AA 2R7XA 3JRCA 3GYHX 4HYEA 2D4OA 3W2AA 3WE3A 4IHXA 2X1DA 4D1QA 3ZGKA 1RXTA 4FD7A 2F5EA 1V1HA 4ZTJA 2KCWA 4YFXF 4Q4ZF 1S9HA 1TQMA 2K9SA 2RQPA 5HLIA 5HDNA 3A9LA 3D0SA 4XRSA 1NH3A 3WU0A 2Z33A 3P5JA 3CESA 2IQ6A 2W7NA 5IY5H 3VARA 1T6SA 3K4LA 1YITI 2O9LA 3FBNB 2ERWA 4UUSA 2FMYA 1U5TA 3MCZA 4CS0B 4M9XA 3CF2A 4P96A 1JKRC 2ZFWA 3OYLA 1TW3A 4L0ZB 1Z2IA 2M4KA 2O5RA 3UEYA 2H6BA 3M7GA 2LD5A 4NGQA 5HXDA 3BROA 1F2PA 3FHNA 1OYWA 3GZ6A 1KYWA 2FVGA 5IT9K 2MD0A 5IYBJ 3L09A 3OL0A 2BY0A 2CW0F 3FBIB 4YU9A 2XGEA 3VODA 5FO5A 2ECBA 2KFDA 2E73A 1UJ8A 3S9LA 1Y7RA 2PJ8A 3IRRA 2NVUB 1TIHA 1KU2A 3ABLH 3F5BA 1PUFA 3DPTA 1FMVA 4A3LJ 3HOTA 1CPSA 2LVSA 2KISA 2MSYA 2XAUA 3BJOA 4RM3A 2DJNA 1HXDA 1MNEA 1GV2A 3ABKH 1YRNB 1TTYA 2ME0A 1JUSA 3ABMH 1TWFJ 3CC7I 4E1RA 1VQ6I 2L9NA 3AG1H 2H6CA 4MNUA 3S8PA 1DP3A 2JZYA 2VZYA 1CT2I 3VWBA 1UVFA 3ERMA 2C6GA 3K70C 2OC6A 3PFYA 2FQ3A 2D5VA 4NHJA 3VSKA 3E1SA 3HTUA 3FEEA 1ETXA 2E1MB 1A36A 1V54H 4Y15A 1OMUA 2XAHA 1FNOA 4XONA 4LUAA 1FYKA 1S7FA 1IW7F 2ZW5A 1WPKA 2FXFA 1CP6A 4NB5A 9WGAA 4A6EA 1SC7A 1TBOA 2FSRA 4X8IA 4MHYA 2QBYB 2EIMH 2KDZA 5DCMB 2DFIA 1V55H 4HQEA 4CYDA 1REPC 4ZDPA 1S7KA 3AG2H 1QA6A 4DUKA 2N1AB 3HXLA 4II2A 4JJXA 3QB8A 2XAGA 4AU7A 2LBFB 1PVEA 1T08B 2HXIA 3DCFA 4CYCA 3JRDA 2BXZA 1XGNA 3W2VA 2H09A 1YTYA 2ZXJA 4YEJA 3CZXA 1KU3A 1ELLP 2Z16A 1ZLKA 5M5XJ 5K8PA 1TKJA 2BW3B 3ZXSA 1KMAA 1K4SA 1V3FA 1R71A 2XPVA 4HPQA 3JVNA 1RUNA 4PZJA 2KRCA 3PIPF 2Y30A 1VI0A 1HW1A 1WCMJ 3JTHA 3BG7A 2VE9A 2PIYA 3IHUA 4A31A 2CQQA 3EUKL 4KT6A 4L5JA 3LWUA 3BY6A 1D1BA 2PQ8A 2ZFUA 3NE8A 1PUEE 2FF4A 2GIZA 4BD9A 2D1HA 1U5TC 4G6TB 3KZZA 4IUSA 4M3BA 5BOXA 3ZQ7A 1CBXA 5AG6A 4XORA 3FECA 3PB9X 3IKVA 1YQAA 2AE6A 2OOTA 3BJIA 2W0TA 4NGRA 3MKZA 3F8BA 5E96A 4UVCA 1OCTC 2CRGA 3DSBA 4E6KG 4XICA 3CC2I 4IK2A 2K9NA 3LSRA 2V9VA 2CJJA 4C9YA 2JYYA 3GFIA 5EX0A 3PBBA 4FETA 4A94A 2DPUA 1R3NA 1IUFA 1LJ9A 1A31A 1V0CA 4IF5A 5B3SH 1VQOI 3GWZA 3W6SA 2IRFG 1WTJA 1D0XA 1R79A 1T0FA 5FVJA 1TWGJ 2FE7A 1E3HA 2VODA 3H9QA 3FXMA 3I5UA 2P5VA 1YIOA 2PE3A 3BTCA 1QGPA 2L7MP 1G3YA 3RYPA 4X3RA 1YFHA 2BGCA 3GCMA 4A3GJ 4XOPA 2LKXA 1O3RA 2FD5A 1RETA 4KUAA 3IWWA 4A3JJ 4OC5A 3H3UA 3V42A 2Y48A 3MZYA 1D8JA 4RM2A 4GI3C 3HPHA 5E20A 1J59A 3H3VK 5GADJ 4PGHA 2J9RA 1F5TA 1XS9A 2OB0A 2L7FP 2LH9A 2EB7A 4OIOF 3BG5A 3BJAA 4HLXA 4UEFA 2RAEA 3E7LA 2X3TA 2Q0YA 2DKVA 1NG6A 3OL4A 4QTRA 2L4AA 4WF2A 4CUGA 2B3VA 2LYCA 4BE1A 2A05A 4A3CJ 3F72A 4AMLA 1YMEA 4BE0A 2UXXA 3T1BA 2OU2A 2R7RA 2ZB9A 4NNJA 5GPCA 1Z7KB 2HQYA 5IB9A 3I71A 3CJRB 4BHPA 3OYNA 2HOSA 3SZGA 3J80Z 1ZG1A 1SFKA 2CSOA 2LR8A 3HRMA 3RKXA 4NDLA 1QO0D 2GM4A 5E3PA 2B4DA 2WZNA 3CMMA 1BI3A 4II3A 5FLXK 1DS3I 3FK6A 5BS6A 2X6YA 1IRXA 3MQ0A 5GP9A 2L54A 5CQGA 4ZH4F 5JR3A 2J5PA 3F8FA 3U1KA 3FF5A 3VOEA 4B6ZA 1FZPB 4AD9A 5K8MA 4A33A 4EWTA 4P1WA 3I9SA 2IA1A 3GIUA 2NYXA 2XGXA 4FD4A 1FOYA 3PSFA 1TW2A 3FIWA 1W4MA 3CJQB 2MD5A 3L2NA 1M8BA 4LG0B 2X1CA 2ZC2A 3BI0A 3FKJA 2NNNA 2DAOA 2QQ0A 3HH2C 3OR2C 2VI7A 3CT9A 5IOYA 3WTVC 4ASNA 4DBQA 2SGPI 4E70A 3HIFA 2VI6A 4ENJA 1RNLA 3OWTA 4PQAA 2JBKA 1MT1A 5CCLA 1S3JA 3K4JA 5FKOA 5K7ZA 3B3VA 4UXNA 4HLYA 1CG2A 3LA2A 4HX7A 4BNCA 4U9ZA 2K7LA 4AG9A 2OV7A 3GO5A 3IC7A 2R7QA 5J1QA 2ZEMA 1L0CA 2BYVE 2PFBA 4CAWA 3G3SA 3BI1A 5D8NA 3RYOA 2P6TA 4Z2YA 4A3EJ 1W4RA 5EX3A 4UB6C 1UHAA 4RLQA 5FKMA 1GDTA 2AXTC 2R5YA 4EGZA 2DMUA 4CAEA 3D7DA 3SI1A 1TP4A 1IOIA 1TLHB 5H84A 4QBJA 5F1JA 3E6CC 3UKGA 3OL3A 3BQYA 4HA8A 3CJNA 4MTEA 4OU0A 4BBRJ 2HPMA 2NU4I 1IYLA 3KR5A 1XX5A 4RMNA 5IX3A 4L9VA 3Q3SA 4OC2A 4Y7NJ 1EH7A 3Q0UA 4UEZA 3O8GA 3OMYA 1FSEA 4OAEA 4D0PA 5CLSA 3WC5A 3JCUC 2F5VA 3RZOJ 2X6XA 3NEUA 4C7HA 2PJRB 5L3DA 2LUYA 2JA2A 2HNHA 1G59A 3FB3A 1O4XA 3BC8A 5FB2A 4YRHA 1KQ0A 2CQNA 2P81A 5F49A 5H86A 1ULYA 1QSMA 2UXNA 2O8KA 4UV8A 4E7HA 2RN7A 4EFDA 1Z9UA 3MVPA 2VQCA 4AXVA 2ZSHB 4OP4A 1Z6RA 1R49A 4KDPA 1HA8A 1JE8A 1CJWA 4R87A 1BIBA 2QYOA 3AAFA 3BOQA 1SAUA 2FXAA 4FHTA 1IDZA 3IUOA 3NWTA 2DJIA 2OCCH 3PSIA 2NU0I 2OAZA 1JWQA 1FYLA 1R57A 1MMNA 5LGUA 1LDJA 4KMFA 2YQPA 2FBKA 5ED4A 3F3XA 2EPFA 2CWGA 1BAVA 1IN4A 3QNVA 3BDDA 3P7NA 5EZHA 4ON0A 3L2QA 1BW5A 2Y75A 1GYTA 1YR0A 2I79A 5ELYA 2EO8A 5HI7A 3MKLA 4HF0A 1LOKA 1B87A 2Z99A 5J47A 1HKQA 2G7UA 3K4MA 3RKYA 3FK7A 5L3FA 1KU7A 2M7BA 3QAYA 4F92B 4DYOA 1XC5A 3E0KA 4Y3OA 3ZQQA 2MH9A 1WJEA 2EK8A 3ABTA 3R0AA 2BHYA 2HUZA 2JVGA 2RGVA 3PGPA 4B11A 5F48A 3WTWC 1Z3XA 1MJAA 3QOEA 2LRDA 2ZW4A 2LC2A 3VE5A 5DTDA 1K7AA 5KCMA 1M1DA 2M0CA 4BINA 2VJ4A 2QVPA 4MHPA 2E36A 2Z3MA 1MZBA 3J7AY 1BR4A 4XPKA 1SFUA 5FRNA 5L3BA 3FM3A 2H1LA 2RREA 3LSKA 2F3CI 1IUYA 1Y7EA 1OYIA 3UOEA 2ZEHA 3CPAA 5A2QZ 4CRYB 2QSFX 4AWXB 4F0YA 2FEZA 5DD4A 3DDDA 4KICA 4EM0B 1SGYI 3I0TA 1YOVB 3K1PA 5LRRA 4YRVA 1LB2A 3DFGA 4V19K 1VQNI 3FRMA 4I49A 3WC7A 2X0LA 1Y9WA 1OKRA 2HPIA 4MFQA 5DD8A 2QA4I 3H8EA 2DT6A 1DGRM 5LYLA 1U3EM 2R5YB 1ORKA 3HG9A 1BM9A 5F46A 1OQYA 2CV0A 2DF5A 3V8JA 1IGNA 5CVJA 4ABZA 4UHTA 5HS8A 4IHVA 4LLLA 1XDUA 1QSNA 1ZG3A 4XNHC 1KYZA 3TW6A 3L9FA 2EWNA 3W6KB 3PB8X 3BTLA 1DPRA 1ZGAA 5C82A 4JK1X 1R9TJ 4L89A 4RAGA 2UZ3A 2XV4S 5K8NA 2IVMA 2ZNYA 4IPAA 4M3EA 1TWHJ 4CGNA 4Y4RA 2DMQA 2JUGA 2P8TA 5EEAA 1M4GA 2A69F 2W24A 1X1AA 3KP6A 2LNBA 3AL0B 1R0RI 5GCNA 2B5GB 4M73A 4KS9A 1AUGA 4UUVA 3H35A 2CUEA 2V53A 4P45A 3EYIA 1YJ9I 2WCYA 1LANA 4NCZA 2OF7A 4DYQA 4C68A 1QZZA 3E5XA 1BPMA 2X6OA 2XGCA 1XB4A 3I1UA 3BR5A 1GXQA 2BE5F 2GKTI 1SMYF 1I1SA 1Y39A 1RRJA 4XMYA 1RUOA 1K4TA 1ZRCA 4ENMA 5ILUA 1XTAA 1AWCA 3HTSB 4XLHA 3WG7H 4WP4A 3B3CA 2YR2A 1B72B 4JX4A 4P4EA 1HW2A 1MMSA 3FMSA 5G21A 3DPLC 2OZHA 4MMOA 1P2FA 2BY2A 3GUDA 2ECCA 2L0KA 1XCVA 4PXDA 1YHQI 5HLHA 3OYDA 2M8EA 1TNSA 1R5ID 5B66C 1IV6A 4ZI6A 2BVLA 5IP7J 5DM7F 4FWUA 2Z3OA 3C2GA 1IRGA 2RNGA 1QZEA 4JYWA 4ZYHA 2Z0ZA 1GLNA 2QENA 1ZAOA 4AIHA 4Y49B 2W82A 2J5OA 3HOYJ 4UBRA 3BG3A 4CO8A 1W1WE 2CXAA 3WHBA 2XPUA 4CRZB 3CPXA 2DA4A 1J4JA 1SGEI 2XRNA 1TBQR 5IYDJ 2WPXA 1F4KA 5LHHA 2JXDA 2KIUA 5FJ8J 2VONA 2JBJA 4ZY1A 2CG4A 1YW7A 2IPQX 1B8IA 4EJWA 2AFXA 1MBHA 4PJJA 3GLJA 3FMRA 2M45A 1WI3A 1MH4A 4M6XA 2WB1N 1Y8QB 2A07F 1YSJA 4CXFA 3ZMTA 2NSMA 1FWZA 2IS6A 2DTZA 1K7UA 1QHHD 2QLZA 4M72A 4CHUA 1EJ9A 1UFHA 5JQ4A 3B3SA 1LUJB 4XBFA 3KP7A 3PNYA 3PB7X 3A02A 3ISZA 5L3EA 1BBYA 2QM3A 2YSRA 3A4CA 4IHTA 1UVGA 4F52A 2G3TA 2ZEOA 2HYFA 2ISZA 4EJVA 2A5WA 3I3GA 4M9SA 1BMOA 3ZQGA 3ZMSA 4ZX9A 3BR1A 4CGPA 4BS9A 3HHGA 3J80K 1S20A 4UEEA 1H0MA 1X3WB 1QBJA 1JUMA 3S2HJ 2X4HA 3KLOA 3FH4A 1BJAA 2R7DA 3R95A 2DA3A 3PM1A 2BXYA 2UV1A 4L9NA 4BU2A 5HLGA 4B3XA 3SEKC 1AMPA 2FMLA 3T90A 3WHCA 3ECHA 1FX7A 1FBSA 1GUUA 1NTCA 1XN7A 4XRSG 1NK2P 3DP7A 3R6SA 2VPRA 3HJEA 1SD4A 4IRGA 1KQ8A 2O28A 2XVCA 3D5LA 4V2FA 4LB6B 4J19A 2ME6A 4Q47A 1SGNI 2Y9YA 4PXCA 5K7FA 4XRFA 2P6AC 3OYBA 1CX8A 3S93A 1DDNA 4LGWA 4PXEA 2MW8A 2QQDA 4KISA 1OPCA 1S7OA 4BE2A 1WKXA 2GKRI 2PJ4A 4OAZA 3D5RC 2R98A 3MN8A 1VQ7I 1HSTA 1E0EA 5IT3A 2WAQN 3C7JA 3JAMZ 2JA5J 3MN2A 4RAYA 3SYTA 3RZAA 4HX4A 3OYGA 1LAMA 3I64A 3IWEA 3F23A 3TC8A 3GUXA 1IG7A 2OVOA 3NAUA 4AIDA 1FYBA 5M5YJ 2RVCA 4ZYDA 4F3QA 4HZFA 2LP0A 3PO3J 4EMEA 3F21A 2R1IA 1ULNA 3GTGJ 2VKHA 3EUHA 3M8JA 3BTIA 1ON0A 4CICA 4BXFA 2JK3A 3C2BA 2H5MA 4M6YA 4LX9A 5HVFA 3PO2J 2DODA 3I9V2 1ZG7A 2Y0SA 4P4FA 3K9TA 3SJGA 2QEXI 1J7KA 1TGSI 1MSEC 3CUQA 3I3LA 2ZMEB 1MMGA 1YVKA 4K3NA 4UCPA 5E8IA 3HDDA 1FOXA 1MBEA 4ZGYB 5DYMA 4IRIA 1KWMA 1PDNC 3PB4X 4A39A 4WWCA 1WGXA 2VT3A 3E6DA 1LR9A 1IY7A 4B5OA 2A5YB 4XN0A 3Q9SA 4KSAA 4I76A 4GDFA 4N9IA 3D66A 3P2HA 3GYAA 1KBEA 2HU9A 3FHZA 1SD6A 2R7FA 4PCQA 2CY2A 1YS7A 1N75A 4IRHA 1B8IB 3QPHA 1GV5A 4UV9A 4J3GA 3BT9A 3B02A 5IPAA 5E1WA 2F48A 1I6HJ 2E71A 1VZ0A 4F0XA 2L7KA 3H3ZA 5FKNA 1UAAA 1I5ZA 3BG9A 3VSLA 1AKHA 4PJMA 3OYAA 3IL2A 1OMTA 2WVJA 2W25A 4ZYGA 4OKOA 2YUSA 1CGPA 1LE8B 1Q2YA 1FMWA 2UZKA 4D5CA 2XUBA 5IP6A 2B0UC 2XKPA 3I56I 2HKOA 3FXQA 3QAHA 2EJRA 1V5EA 3R4KA 1ETQA 3OS0A 1KUXA 1VHEA 1MMAA 3RQIA 1TKHA 2XAJA 4KOTA 3LOCA 4NC6A 4F9VA 5ICFA 3QU6A 2ZJRF 2Q1ZB 3DU5A 2W84A 1Z05A 2ACJA 1CPXA 3M9AA 2DT5A 3I4PA 3DR6A 1W36C 4YWYA 5LRKA 4CSWA 4BHCA 4FE7A 3KETA 3CXQA 1TBRR 3S1NJ 1R5GA 4G9YA 3S15J 4LJZF 2F5FA 4A2UA 3MEXA 1TL8A 4HF1A 1YQEA 3KZWA 2C1CA 3BJ8A 2AFOA 3TE4A 4M3DA 2J8MA 4LOCA 3ZMZA 1K78B 3E0JB 2B0LA 2VJ5A 1WRJA 3TO6A 4X6AJ 2ELJA 2K27A 2WBMA 3DBHB 3HOXJ 2BO9A 2VB6A 2IJLA 4DJLA 5HDGA 3ZMUA 2K85A 5HODA 4ONWA 4A38A 1MDMA 4LLNA 4EMSA 1SQHA 4X0GA 1ZREA 3GMEA 1YVOA 3GKRA 4G12A 2EZIA 2EZKA 5HH1A 3JRAA 1JHHA 4I0AA 5ILSA 3SZTA 3FJUA 1R4MB 5TISC 1MNDA 4IQJA 2E7WA 2BZTA 4CZCA 3BLYA 4J01A 1STZA 1TWCJ 3UNGC 1AYEA 5KTDA 5F04A 5LD2C 5AG5A 2DPTA 3EUHC 2PJ5A 3RBUA 4PUSA 3IH3A 1FY7A 3TQNA 2FBHA 1D5YA 5FD6A 3DBLB 1VQKI 2EILH 2N8GA 2RV8A 3EYYA 1W5TA 4XPDC 4EEFG 2XHKA 5E18F 3CUQC 2JA7J 4JCVE 2BY3A 1QQIA 1CE3A 1LFBA 4YIFA 5KTCA 2STTA 1M4DA 1S7AA 3LD2A 2MGQA 5F0HA 2IS4A 3EDPA 1G3TA 2KL4A 3IGRA 2KRFA 1RR8C 1Z3YA 3CLQA 1YE9A 3TCVA 3VWDA 1HDQA 1JJ8C 3JRHA 4CZZA 1U8BA 4LIVA 1LFUP 2PRBA 3KP4A 3F8KA 2WUUA 5A27A 4BJ6C 2VXDA 4ANJA 3FXKA 3V8LA 3I4NJ 4MCSA 1BJZA 2ZEDA 1ERDA 2ICWG 4OWRB 3A01B 3ECOA 2ESNA 2CV2A 1A5JA 2PVVA 3CCSI 1IY5A 2P5KA 3KZYA 1F57A 4A12A 2CNMA 1W7PB 1R00A 2ZNZA 1IV8A 4OOIA 2LFBA 4HRIA 1FNNA 3GTJJ 1HCRA 2AXLA 5HOOA 2KMUA 2DPDA 1BUSA 5HVGA 2SGQI 3TJQA 3FKIJ 5HVHA 1DUXC 1U5KA 1SVLA 2DFFA 3T0YA 4BQNA 2L4MA 3ROUA 4GFBA 5HVQC 1YW6A 3BJ7A 5CVUA 2IP2A 3M1CA 4HW0A 1R5HA 1FP2A 2M3AA 3H5NA 3HGYA 4DYRA 2OTLI 4ONUA 1SANA 2Z2SB 3WGIA 1LNWA 4UNOA 1WKMA 1ZK8A 2E5NA 1K4JA 2GZWA 2LY2A 2DA7A 1BA5A 2ZJ2A 4BMHA 2B8TA 3KL9A 5EG0A 1HDPA 5IB0A 1Y1VJ 3CCMI 1G4DA 5JH9A 5CPAA 1ZARA 1JKOC 1WWZA 4AG7A 4U87A 1IICA 1R1UA 3PFOA 2NXNB 3KLNA 2O61A 2FBIA 2C6PA 4HNYB 2NMTA 1V5GA 3K6GA 2JJ7A 4E1PA 1XF8A 5F27A 2KQRA 4RB0A 3N4MA 1EV7A 3OYJA 1MDMB 3IH4A 3CC4I 2CTCA 1U0JA 2PMZA 2I8DA 1POGA 3T8RA 4EATA 1Z7UA 4I2OA 2DO7A 2L9VA 1JHFA 4MLOA 4MTDA 4BYYA 2DFEA 2CIJA 1O3QA 1MK4A 4U88A 3GXOA 1F9NA 3U2RA 2DDAA 4X1EA 1S7EA 2DCEA 2CWFA 2UVOA 3OYCA 1FT9A 2E1MC 3C1DA 5H20A 4KOXA 1WFXA 2XRCA 4A37A 2CO5A 3QPLA 2DFHA 2ESHA 2JDCA 3HRSA 4M3SA 1JTXA 2M5XA 2K4BA 4A3IJ 2GXBA 2PLYA 1YK3A 3H8FA 1SAXA 5G20A 4QIWN 4ENNA 1JXSA 4OLLA 1L3LA 4JYKA 4B44A 2FCKA 2XPWA 3GY9A 4KOUA 4Q36A 2WYRA 1WJFA 3S1RJ 3P9IA 2Y0MA 3CQZJ 3EFAA 2LF7A 3KEYA 2LG4A 2Q4VA 4OC3A 1ETVA 1GT0C 2WA0A 1N77A 3REOA 2VBQA 2HFHA 2HVSA 4IF4A 2GLOA 3IV5A 5J4YA 2BEIA 4CYOA 2HTJA 2PSWA 3L2CA 1ZRDA 2J8NA 2DA1A 1QSTA 2JEWA 1CT0I 2F4MB 3R9FA 1O3TA 3D4UA 2XF5A 5M5WJ 4UUSB 1U5TB 1WH5A 5ICEA 5A28A 2GOXB 2ABZA 3B7IA 3JAMK 5EDNA 3ZPLA 3K1MA 4KITB 4Q5SF 1SVMA 3FM5A 1BC7C 4B1RA 1VDDA 2PRQA 4AYBN 3JTKA 1XA6A 4KLWA 1BI2A 3UGIA 2IGKA 3BWGA 3UGLA 1D1AA 1UZCA 3VH9A 2BV6A 5TJJA 1FTZA 2XROA 1Q1VA 5JHFA 1KA8A 4E7SA 1JGSA 2VBYA 2RIJA 3E97A 2CWHA 2M2EA 1ZELA 5CVIA 2K3PA 2KMPA 5F0FA 4UF4A 1Y8RB 1DQUA 3S6HA 6PAXA 5JPHA 4RB3C 1WI9A 1PUFB 2RC4A 2GLJA 2R5ZA 4UWJA 2VQGA 3NFZA 1TT0A 2EIKH 2JMWA 3MAJA 1DU0A 1PUAA 4N0BA 2QWWA 1OCRH 2VXZA 3IU1A 2V4JC 1PJUA 2HR3A 1YJWI 1FC3A 4ZBGA 2TDXA 1YJNI 1BR1A 4XLPF 1Z67A 2ORWA 5LEJA 5CQEA 2F5IA 2IL4A 3KP5A 2R7SA 3M4OJ 2NU2I 2FUG2 3O2PE 2CNTA 4KSIA 1EH6A 2GAUA 1X3ZB 3G73A 1Z0XA 1BI1A 3KYDB 5E3LA 5F47A 3KIOA 4CPAA 2P0WA 4KSFA 1A35A 3CCLI 2DYRH 2DQLA 1T95A 2M7AA 4CCLA 4O3MA 5LRSA 2YPRA 1Z5RA 2NS0A 4DZPA 4HDUA 1Y0RA 4RS8A 2FX0A 4UXJA 2V8VA 2FNFX 3F6OA 4CGZA 1LPQA 2R7VA 3NWSA 1MBGA 3S3OA 2L9RA 3S17J 1YX5A 5DDGA 3X2QH 1TF8A 3SJMA 2PJPA 1O7FA 3D2MA 1XGMA 2R7UA 4CYCB 3NE7A 2J8RA 1FBUA 2DBBA 1HW5A 2HQAA 2KT0A 5ERIA 3GZ5A 3N7ZA 5C88A 1CT4I 1R23A 4EM1A 4CCMA 1LDKB 3FC3A 2XF6A 5E3QA 4ZC3A 2IA0A 4L5EA 3PQKA 2LEOA 4D7NA 4Q38A 4FX0A 4A3BJ 2Z3YA 3DEUA 4NF1A 1R4NB 3I53A 3GX4X 1K7VA 3VB2A 2VEZA 3CCJI 2KIQA 1S29A 5J6XA 2DT7B 2PJ6A 4GXHA 1XMTA 3KASA 3HOWJ 2ZEPA 1M1EB 4XLCA 1IIDA 4HDVA 1UCRA 2V1DA 3BPXA 2HKXA 3MKWB 3N5FA 4IL6C 4RI1A 3D67A 2HQ5A 1X4SA 1LQ1A 4N9HA 3PFIA 4FKDA 3KCCA 3OIQA 1XSVA 4A5NA 1Z9CA 2JSPA 4WK8F 2MLGA 3R9GA 1U2WA 1B9NA 4W1UA 4C30A 1JI8A 1K79A 1FT7A 4TWEA 2R7OA 3D8PA 2HOAA 3ZZIA 4PFOA 2KHMA 3V7ZA 3IAS2 2EUIA 2ETHA 1PCAA 1K83J 2L01A 2YX4A 3ZP5A 4FE4A 4NBQA 3MFKA 1YW4A 2V79A 1CF7A 1B1BA 2WPWA 3WODF 4Q7AA 2FOWA 2PJ3A 3DTKA 5TRDA 1UHSA 3O8HA 2K3FA 1YO5C 2ODFA 4CYNA 5J4VA 1U6GA 4AIKA 4LIUA 3HBLA 1I3QJ 2O3FA 3ZQCA 2R5ZB 3J7AO 1OJLA 1RESA 2ZKZA 2RDPA 4D5FA 1YG2A 5C4JJ 3WTUC 2PI0A 2L7ZA 4KT5C 2GFQA 4U7DA 5K5RA 3RIRA 4FAIA 3R5BA 2RQQA 3OYHA 2HOTA 1YLEA 2OBPA 2ZXHA 4QVTA 3MKYB 2FT0A 2ID3A 3COAC 5FFXA 4CA0A 1P92A 1VKCA 3OSFA 1YLOA 2HZTA 2LKPA 1KZHA 3RPQA 4ESBA 4UFXA 2P5LC 2ZPAA 3HL2A 1T8IA 4A24A 4OADA 2V8HA 4NC8A 4NQWA 2JT1A 5HDKA 2BEOA 2OZUA 5D5VB 2Z11A 1XX6A 5M3MJ 3B3TA 5FFZA 2YU3A 2K4JA 2NU3I 3QP6A 1P7JA 1X2MA 2DK5A 1LVKA 3ZOBA 1IZ1A 4JWPA 3QYFA 4KIFA 1JTYA 5GAHJ 4A32A 4F91B 1J2XA 4F6AA 3LA7A 4NGNA 2ENNA 2L02A 3IC1A 2IGNA 3C2HA 3SXOA 3H9GA 2COMA 4EJTA 1S5LC 2DMTA 4OC1A 4EGYA 4GO1A 1UB9A 4BY7J 2JVHA 4C2TA 2V9KA 2XGDA 3S1QJ 3ZN0A 2B4DB 3CJTB 3EXNA 3TDUC 3W6XA 5JVGF 3K4KA 5KK1A 1Z1DA 3HUGA 4BKXA 3IFEA 5FROA 3HSFA 2ZXWH 2D4PA 5J1YA 2EFPA 4O5VA 4JD6A 4OIWA 1YLFA 4YFNF 2ORVA 1V5FA 3RKQA 1Z8XA 4MEYF 3D3SA 2HDWA 4C3JJ 4RN7A 1C0WA 1LR8A 5B1BH 5I4MA 4QUSA 2M30A 2ROWA 2ZEEA 4NGSA 1EA3A 3K4BA 3NQOA 4OINF 4KVXA 3GTLJ 1G8XA 1P4AA 2MH2A 2HB6A 4XL9A 1NHAA 2O0YA 2CJSC 4C2XA 4E7LA 1XIXA 3T8WA 2VQLA 4AB7A 3ZQLA 2PR1A 4GYIA 1Y0YA 2V77A 2K02A 5DCFA 4PGGA 5BMZA 2GXAA 1RTQA 3TX8A 4HX8A 3IRQA 4IHYA 2JDDA 2XC7A 1W7PD 2DOAA 1XGOA 1UHWA 2YNDA 3SJEA 4ITVA 4NEXA 2PBIA 4ETSA 3PBEA 2XASA 4IHMA 3HOUJ 4KOYA 3VWEA 4XSZF 3JRGA 3FMQA 2E60A 2N71A 1WJBA 2L7XA 2QQBA 4HV6A 4MY3A 3CTAA 4RGUA 3CF5F 2Q04A 1X4PA 3CDLA 4KMUX 1ZTRA 2IW5A 2FSWA 3VYRB 1WJAA 4UIBA 4XNHB 2EBJA 1YIJI 3WABA 5CBMA 1YI2I 1MGTA 5E79C 2XDVA 3RCOA 3F0AA 3DKYA 3CCUI 4MEXF 3MMYB 1DU6A 3V7RA 3PNTA 4DNCA 3V7CA 1NE9A 2COBA 3LSPA 2C6CA 3F6VA 2P6GA 2OZGA 4RLFA 2HWVA 3WG9A 2QIRA 2ZBKA 3FNCA 2IT0A 2CMPA 1OLTA 1JT6A 3KZIC 4DZJA 4MFLA 1IN6A 4P4IA 1SEUA 4BY1J 2DK8A 1Q2DA 3FMCA 2R0QC 1OYVI 2FNAA 4KIBA 1WJ5A 1X4OA 1M44A 2QPOA 4JXQA 1FYMA 3A1YA 1ODDA 1TF9A 4XPLA 4FD6A 3BZCA 3BG6A 5J8FA 2KRHA 1FAQA 2FL4A 2ZJQF 2VL8A 3K70D 4B48A 2AFSA 1U6MA 1OCCH 2DLLA 4II9A 4QWQA 2CV1A 1IO2A 2QECA 4G7OF 2VPLA 3EQLF 4EV0A 2GREA 1FPQA 3NH4A 2ISYA 3F8CA 3R0JA 3B8GA 1ZKGA 3BPVA 2FA5A 2LMDA 1B6BA 3E6MA 2MG4A 5FUYA 3BZ6A 2MFZA 2V6EA 1X1BA 1Z77A 2LOOA 2NOGA 4HV5A 5D4SA 3CXPA 1E3PA 3F9KA 1TWAJ 1UG2A 5B1AH 2GBYA 2OCEA 4ZTFA 1PP7U 1HKTA 3DTEA 3FISA 1FARA 5LYIA 4OC4A 2YGWA 1QVTA 3EUAA 5H6RA 2VQYA 3KPHA 3WTZA 5AGEA 2C6YA 4IZZA 3IAM2 2LLKA 3MGDA 4BQAA 2HV2A 4P4BA 2B58A 4XK4A 2JZMA 5FGMA 3H4QA 4XRMA 2Q2EA 2K9QA 3H92A 1S7LA 2V1CA 1APLC 4DW6A 1H0ZA 3BCBA 1BIAA 3LSTA 3M07A 4BQQA 5IP9J 4L9MA 2X48A 4F93B 2VJIA 5DEQA 3FSXA 4MFDA 3FF3A 1S8NA 1R1TA 2L8EA 2M5WA 3UFFA 1I1GA 2ARHA 3F0CA 1D3YA 2FIWA 2RNJA 3RZDJ 2J9AA 4U5YA 1WVRA 7CPAA 2OD5A 4XNFA 3ZQFA 4M71A 1ULMA 3TDZC 1M4IA 2O6GE 4LB5A 2PJBA 3H36A 2DQRA 4KN7X 4A0ZA 2P4WA 2QQ8A 1X3UA 2XSJC 2O4HA 3OY9A 1CQTA 3OYEA 4NFRA 3SZPA 2KJBA 2Z1DA 5JI6A 3DLJA 3S6KA 5J1RA 3BJ6A 3SJXA 1ZLJA 4UIAA 1A04A 2CUFA 2V1XA 3WU2C 4CCKA 4DBRA 2VLAA 4BXXJ 1TIQA 4A69C 3IP4B 2B3UA 1IW4A 1ACIA 3KHZA 4AVAA 4Z65A 3HZJA 3TW7A 3G71I 4UY8I 4GGGA 1CP7A 2I3CA 2A6HF 2ZOFA 3CCRI 3FX3A 4GXOA 1XFOA 3B3WA 7WGAA 1BI0A 2SGFI 1YU6C 2QCOA 3LQQA 2XIGA 1IC8A 3OYFA 2TCTA 2WWYA 2DA6A 2VE8A 4XR6A 4A0XA 2QQCA 4S0HB 2R7ZJ 2IGMA 4G8XA 2HTSA 3A0BC 2F5DA 2WY8Q 2BL1A 4G6DA 5EF6A 3VYUB 2Q7BA 2L5QA 4E8OA 2DU9A 2EFNA 1X1PA 4O6JA 1H9GA 2NOJB 4EM2A 3IWFA 2F5CA 4XKBA 3DLLF 4R79A 2O7OA 3DQVC 3LSHA 3K4NA 4JX5A 5KNLA 4IVNA 1YX3A 5LHIA 1SVOA 2PG4A 4GRIA 1Y8FA 1OCZH 2ADUA 4XQFA 5G22A 1YW8A 3E2IA 4HSRA 2GE3A 1QU3A 3ERED 2AS5F 4YGOA 1Q1HA 3M3YJ 1XRYA 4M6IA 2HZDA 1VFCA 2D45A 1OVOA 1H8LA 4LFUA 1A6QA 1UWYA 4JOMA 4A5MA 1X12A 2Y31A 2G3AA 2PCUA 3D7HA 4FBEA 2JRTA 4N4OB 1D8KA 1G3SA 1PJRA 2NVXJ 1NSAA 1D5VA 1B59A 3ESWB 3R1KA 4G7ZF 4WJBA 1ZG8A 4R57A 5EGOA 1U78A 2EV6A 1XJOA 4NJRA 4M74A 8CPAA 4ZDLA 3ZR8X 4I98B 1PCEA 3GVAA 1IAWA 1XSDA 1ZG9A 3ZJ0A 3HRUA 1Q9BA 2XEJA 4P6YA 4QLCU 5FKKA 5HS7A 1OMIA 4NUBA 5K5OA 5FLMJ 4FISA 2JSCA 4PFPA 1DGWY 3FYNA 1NG7A 2P6EA 3RYRA 4ZZDA 2V1CC 2WB1A 2YNCC 1UHMA 1LEBA
chains in the Genus database with same CATH topology
2KJCA 2MA3A 5E1XA 2HQNA 3LODA 3R61A 4PSXA 3SHPA 4OMZA 4BXUA 3HOSA 1SFXA 3M8EA 1S60A 1R36A 2W57A 4UWIA 1J75A 4JLYA 2DW4A 2FU4A 3WR7A 4A6DA 2V1UA 2ELHA 3T8TA 5DV5A 1I6XA 4I0BA 3JSPA 4U0VA 4KUMA 4RS2A 4YIIA 1ZH5A 1S6LA 2VXKA 2QQAA 4L18B 2RKHA 1P4WA 3N97A 4UCNA 1EH8A 2REEA 3P9KA 4MHDA 2R8VA 3JSOA 4U0WA 4MFKA 3LFKA 5LLQA 4E2AA 1ZO0A 3TFYA 2ZW6A 4R9MA 2PMHA 2EFWA 4EJOA 5A2QK 4KA4A 4U0YA 2ZXVA 2VOPA 4UFVA 4XLNF 4ZYEA 4H6UA 4I7HA 3F8MA 3WTTC 5L3GA 5FD5A 2ZW7A 3I58A 4C7IA 5DWNA 3ELKA 2FNPA 2G0BA 5CJ9A 3K2ZA 2FOKA 1SD5A 3F8NA 1IYKA 3K69A 1Z6TA 2L3DA 5JVTA 4XPDB 5E8GA 4BAYA 3WE2A 4L5IA 3CUQB 3RTRA 2QBYA 2JPCA 5DCMA 1LRZA 3ZMVA 4S04A 1ON2A 3RI4A 3FXUA 4U9YA 3KE2A 5AONA 3TGNA 1GHCA 1P0HA 4CAXA 3TTHA 3QOPA 3TO9A 5BPIA 2HQRA 2IA2A 2H94A 3ML6A 1CM0A 3K9UA 1XGSA 4KVOE 4MFJA 4C2ZA 4H6ZA 2P7CB 4KVME 3K0LA 1ZGJA 3GW2A 4HF2A 3DNSA 2EV0A 3JTGA 3W6JB 2YX7A 1V4RA 4WXCA 2VZZA 5KTAA 3MZHA 1KUYA 3DF8A 3QU3A 5EEHA 1SD7A 2CWEA 4B13A 5LEKA 2HDCA 4BBHA 3SXNA 5JHUA 4BHBA 3ISPA 1B4AA 4IJAA 5CYVA 2M87A 3FIXA 2CNSA 2P7VB 4NSQA 3L7WA 1MKMA 3PP9A 1J0RA 3C26A 2YNEA 4S05A 4MGRA 1J9IA 5ICCA 3CO6C 2NRAC 1ZRFA 3WGHA 4KLVA 2G7HA 4QC6A 1P6RA 4M85A 2STWA 1Y9KA 3U9GA 1ONVA 3S6FA 4L0YB 1XE4A 4X5KA 4Y17A 3M1EA 1XEBA 4L9JA 1XSXA 1DP7P 2VBXA 4PK3A 5HS9A 4CYPA 1E2XA 3LQRA 3O6BB 1WSUA 4KUBA 1ZYRF 3NRVA 4R3KA 1OR7A 3JUWA 3G8WA 2H27A 1T38A 2VBWA 2VT2A 1KZFA 3E6BA 5LHGA 2MC3A 2B4BA 4U7B