4PZEA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzeA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzeA01
1YB4A 4Z0TA 1OI7A 1HETA 3IIEA 4IIUA 2O3UA 1BXZA 3PGJA 1ADCA 1TA4A 3BTUA 4CM4A 3NTRA 3KVOA 2YQ4A 2BFPA 3CSDA 1ZMTA 1E3LA 1BXGB 2I76A 5IZCA 4OM8A 1EVZA 2C29D 4KP7A 4YQZA 4MPDA 1Q7CA 4NBRA 1E6WA 4EUEA 1Z7EA 1C1DB 4MVJF 1XLTA 4LCEA 1RYEA 2H6EA 3IC5A 5T6BA 1UZMA 1SB8A 1X15A 1EK5A 2NWQA 1XDWA 1PWXA 4YRAA 2YYYA 4RDHA 2W98A 4WLNA 1LXCA 3HWRA 3GR6A 3H9EO 5CDYA 4OJNA 1PJCA 3B1FA 4J1SA 3I9JA 4GKVA 3H5AA 1QV7A 3ZWYA 2VUUA 1XG5A 1BGVA 4YQYA 1GADO 5F21A 5AXCA 1PR3A 2C07A 3PXXA 4QO7A 3TRIA 1R4MA 1Z7BA 1BWSA 3G0OA 3FBTA 1LDYA 1H6AA 2PA3A 4BMVA 3AI3A 4BNZA 4XQGA 1Q0HA 2NTNA 4YEDA 3NKLA 4CL8A 2GN8A 4CR7A 1LC3A 1A7AA 5JCJA 5TQVA 3WYBA 3GVHA 3E6AA 2EP5A 2P9EA 5DT9A 2NQTA 2X86A 5DOZA 2ZQZA 1EFLA 2DFVA 4RLHA 1YGYA 3BAZA 3B20A 5TNXA 1N7GA 2J3KA 3CTMA 1WZEA 4P38A 1DFHA 4DA9A 4XB1A 4RJTA 3V2GA 3OJFA 3RAJA 4GWKA 2D5CA 3JQGB 3PFWO 4IBOA 5DBGA 4FW8A 1QYCA 1PGJA 5IXSA 4GL4A 3KYBA 3VPFA 1NVMB 2Z1MA 4YRBA 3QWFA 3RUIA 1HDYA 2A92A 3UCXA 4ND3A 2Q1TA 1EQ2A 1T4DA 5ICSA 3HFGA 4WE3A 2GASA 3A9WA 5K0ZA 3UXYA 2BI7A 2DPHA 4CM4B 3C7DB 4LVCA 5IDWA 3Q2KA 3F5QA 2GR9A 4R51A 4TMFA 3VZQA 1KS9A 3GFGA 1E7MA 1FXSA 1JVBA 4KWHA 4NPCA 5K9ZA 4R01A 2YFQA 2O7QA 3SC4A 2IE0A 3T4EA 1OAAA 3QJ5A 1RYDA 3JCZA 3Q11A 1SOVA 1ISHA 3B1KA 1EDZA 2VHXA 3PYXA 2I3AA 2AQHA 1A27A 1QYWA 3GMSA 4PCVA 4A27A 1K6XA 1R4MB 4NJOA 3RVDA 4WCDA 3MTJA 1DDOA 1X14A 1XR3A 2BFAA 3JD4A 2O2YA 3D3EA 3TWOA 5KVSA 3K9QO 2X58A 4MVJA 5TC4A 2VNSA 2B37A 4EJ0A 1PGQA 3L77A 1CRWG 5FWNA 2Z5LA 2J8ZA 4NR0A 1QR6A 4Q3NA 1KOLA 4A7PA 4OSPA 1VSVA 2JFGA 3G1UA 3OMLA 3WGHA 3E5MA 5KJFA 4IZIA 1P33A 4RCVA 5IG2A 1ZFNA 4RF2A 3OJEA 2EWMA 3H5NA 4W9NC 3RIHA 2GDZA 3DZBA 1NR7A 3DFUA 1VM6A 2FN7A 3EAGA 3NJ8A 1YB1A 2B5VA 3F4BA 4CMCA 4E5MA 5TT0A 3COSA 5A9SB 1J4AA 2PR2A 3F46A 4IIVA 4MKRA 1JA9A 2EGHA 3UH1A 2HUNA 3C8MA 2Q2VA 2YZ7A 4Y6PA 1GQ2A 3JQEA 2XXBA 3GVCA 4J49A 1V3TA 2ZATA 4FC6A 4B3JA 4DLBA 1DBVO 3AM5A 4P8RA 1E6EA 4MP3A 3UW3A 3VKVA 1PZEA 2AW5A 3ZHZA 1BDBA 4EDFA 3QP9A 1P3DA 1DIHA 1HRDA 1LA2A 3I4FA 4J6FA 4E2ZA 3ZZNA 4JJFA 4BS9A 4YJGB 4YWJA 2FPGA 3IS3A 1MC4A 3E9QA 2DKNA 2X1HA 2CF6A 1YBAA 4J1QA 1J6UA 5IDXA 3RU7A 1E3EA 4XR9A 4FC7A 4K9DA 4CV2A 3VDQA 2JFHA 1DIGA 4U6QA 4NJMA 2HK8A 3Q1LA 4PZDA 1ZKMA 1IL0A 4XA8A 3WGIA 3ADPA 2VWGA 4BGEA 4EGFA 4M87A 1Y6JA 3PZRA 4R1SA 1D1SA 2QRKA 4YAIA 4YT8A 1LJ8A 1OBFO 2IODA 3GC6A 4DUPA 1DRWA 2R6JA 2F1KA 2Y1EA 3ETDA 4ND4A 4PLPA 1DC3A 3OSUA 4EJMA 2X8LA 2HMTA 1EFKA 1W0CA 2GERA 1LSUA 1D8AA 2OUIA 2VUTA 4YBZA 4E5PA 3VPXA 1CQIA 1D3AA 3ZHYA 4BKQA 3ZV5A 5AXBA 2BGMA 2FP4A 5EQDA 5H81A 3TJRA 2Y67A 3PJFA 2EJVA 3WXBA 4FFPA 3QVTA 1YL6A 2Y0EA 3ASUA 1B15A 1JQBA 3ROPA 1PS8A 3E9NA 3CEAA 1HE2A 3GDGA 4ND1A 1ULSA 1HXHA 4NBVA 4PLVA 1HDOA 2LDBA 3ASVA 4PG7A 1E6UA 1I5RA 5BSFA 2IYPA 4GX1A 4OXYA 1JAXA 1UAYA 4RPGA 4E5NA 2C5EA 4FBGA 2NQ8A 4J16A 2GLXA 3ZGYA 1LLQA 2GGSA 2UUOA 4I5FA 4LN1A 2J5RA 1XWFA 2HQ1A 2OHXA 3GPIA 4OQZA 8ADHA 1DC6A 3FR8A 3O8QA 4M49A 4XR4A 3C1TA 5JO9A 4DGSA 1VJ1A 2X22A 4PG4A 4HKTA 3EK2A 1JTVA 3GNSA 1H2BA 2E48A 1I3MA 4MVJI 5JMWA 3I3OA 5AOVA 1C0KA 1DFIA 3H2SA 1EDOA 4TKLA 4HFRA 3M1LA 5CEEA 1T2EA 3H5RA 1PS9A 1KERA 2O3JA 2P4QA 3JQAA 5CPFA 5B1YA 1P1IA 3KUXA 5LC1A 2ZKLA 1UXGA 1U2GA 4JGBA 4N5LA 4NJMB 5HS6A 3DHNA 3GRPA 3BA1A 3EUWA 1DLIA 3H9JA 3N7UA 2H9IA 1LSSA 3HB5X 2JJYA 3CUKA 2CVZA 4RVUA 2R00C 3K6JA 1F0YA 4JLWA 4II3A 1QKIA 1BW9A 1BVRA 4A0SA 5JDCA 3BXXA 4ZRMA 2ZB8A 4O1MA 4KOAA 3RFXA 3KLMX 3U9LA 1B8VA 5DNAA 3BTVA 2DBRA 4ALKA 5HTOA 3ONEA 3H4VA 4Q9NA 4WNCA 5ER6A 5L51A 2W2LD 2UV8A 4WPGA 2AMFA 2H5LA 3C7CB 2XOXA 4IPTA 4RPKA 4BO2A 5CDUA 2TMGA 1GV1A 2WE7A 2Z95A 4GVXA 4MJLA 3ON5A 5JDIC 5L4SA 4OSOA 2EKPA 2PGLA 1X0VA 3DBVO 4J7XA 4CLHA 1WDLA 3DBHA 4BB6A 4AJEA 2HCTA 1JAYA 1IY8A 4XYBA 4IDBA 4C4OA 2RH4A 1GQQA 4KDFA 5DOVA 2VZ8A 4B4WA 4L4RA 1X1TA 5KVCA 4PG8A 5T64A 2X5OA 4LVUA 2WWRA 1DHTA 3B70A 3GY0A 3KLPX 5F1PA 2HRBA 3HDQA 4YAJA 4B4OA 5A4DA 3TFQA 4RV9A 3F1KA 3CZMA 3HDYA 2DC1A 1IZ9A 5G2OA 4AJ2A 1T24A 1LRLA 1UDAA 4J1TA 5TLSA 3CINA 4J43A 3PP8A 3AM4A 2NVUA 2O48X 2QG4A 4LW8A 4U0JA 5ENDA 2QYTA 2D1YA 4KZPA 3S55A 1GYRA 3K30A 1TI7A 5JYEA 1SEPA 4BNHA 3JQAB 4S3MA 4U8GA 3LSYA 3TL2A 2HK7A 1ZK0A 1PJQA 3QWHA 4HP8A 3KM0A 1QG6A 3I6QA 4HXYA 2E49A 4ALIA 2EKLA 4NBTA 1BHSA 2P9CA 2QZZA 2V6BA 1E3IA 1H9BA 2UDPA 1U5AA 1U3UA 4HFJA 2HMVA 5EPOA 2X9NA 4CM7A 3JQFC 5A1TA 3T4XA 5IDQA 4PLYA 4TSKA 4NFYA 2ZB4A 2GN4A 1PU2A 2VHYA 3GNQA 4BNWA 4CLDA 4CV0A 1G1AA 3IUPA 4YXFA 1GCOA 3P2YA 4FFRA 4GKBA 5EESA 1HZJA 3QWAA 4HNGA 2PZJA 4WLFA 3D3WB 5HS4A 1YOVA 1HSZA 5EN4A 4OH1A 4DPMA 2Q2WA 4FFNA 4BMNA 4ONEA 3WYCA 3G49A 3M2PA 1P0FA 3T7EA 1DXYA 2UAGA 4A5OA 1ENOA 2AE1A 2NLOA 2RHRA 3UOGA 4YPOA 3MOIA 4KQXA 1F8GA 1DC5A 1X7HA 1NFRA 1PGNA 3X2EA 3AJRA 3E8XA 3D4NA 2GF2A 4ID9A 3HJAA 5BSHA 4XGNA 5I7SA 4CMGA 1OOEA 4BO9A 3F5SA 3ZNOA 3AY3A 5GZ3A 5C37A 1MFPA 2AEFA 5THQA 3WGOA 2I99A 2X0IA 2ZTVA 3TDKA 3ZNNA 1I3NA 4PLZA 2GPTA 3WYEA 3D4OA 1ZSYA 5B12A 1LLCA 4B3HA 4TVOA 3NDJA 5IF3A 2OXIA 2HJRA 3D5QA 1B7GO 3FHLA 3DMTA 2XPCA 3DOOA 1J5PA 4RZIA 5CHEA 1YDWA 1HT0A 1W4ZA 4AJNA 3DHYA 2CMDA 1XGKA 3GZ4A 4ESOA 2X7HA 1GUFA 2VWQA 4LRTB 5T57A 4AJIA 5CDTA 2BGKA 2Z1NA 2YV1A 4DQUA 4ZQBA 4AJ4A 4L4XA 3BMCA 4G5HA 5F1OA 5I7FA 4FGWA 1XELA 1E92A 2JKVA 4TRJA 2C0CA 4Y98A 3CMCO 3NV9A 3CE6A 4E4YA 1UXHA 4HNHA 3OICA 1LDEA 3L6DA 1U2DA 3DFZA 2HMSA 3A14A 3IUSA 2GZ1A 4D79A 1B8UA 4HV4A 3NT2A 5DBFA 1HZZA 1U3VA 4ZVVA 4RQTA 1I10A 4P4LA 3TSCA 1P1JA 3F1LA 3ZHXA 3OF2A 3SJUA 3WQQA 1WNTA 3FTPA 5CAEA 1YOVB 3JD2A 4UVHA 1F12A 3OBBA 5G0SA 3QLJA 1N7HA 3MJEA 2I65A 2NM0A 1GV0A 1ADGA 3BMNA 3UCEA 3AUAA 5KNLA 4CMEA 2YV3A 3GUYA 4MVJM 4DMLA 1TEHA 4CMIA 2JCXA 3W6UA 3OQBA 4PFJA 1ZCJA 2A9FA 5G4KB 5KTKA 4N18A 3E1KA 3ETGA 3GF4A 2J3JA 4D46A 1EUDA 4IGFA 1YQDA 5JNLA 1QMGA 4K6CA 1T4BA 3GVPA 2Y93A 5DN9A 1NAIA 1YS4A 3NRCA 1I3KA 1Y5RA 3AOEA 4IS3A 4ZICA 1YBVA 4IY1A 1HE5A 2QW8A 3TQHA 3W8DA 2DLDA 4BB5A 2ET6A 3DXFA 1M2WA 2VTDA 1N5DA 4CM9A 1UXIA 2IXBA 4R9RA 4OIMA 4AJOA 2QYSA 3VH1A 3ZW9A 1K6JA 4K6FA 1XQ1A 1T2DA 3AM3A 3BZUA 3FRJA 2Q4BA 4CQMA 4MVJH 1DLJA 5DBIA 5JE8A 3WICA 3BMCB 3NDIA 4NNJA 1SBYA 1U1IA 5B4UA 1E3JA 3KBOA 1H94A 4IMPA 4JQCA 1D1TA 1GZ4A 3DMYA 2Y1CA 4NQZA 2E37A 2Y0DA 2VYND 1TLTA 2P68A 2X9VA 3UCFA 1ISIA 2AQKA 2NU6A 3AW9A 3VOSA 2FY8A 1HSOA 2IYOA 2VZ9A 1ZSVA 2V6FA 1VE9A 1GAEO 3WFIA 1T25A 3JTMA 5GZ1A 1JU9A 1NWHA 1QP8A 3TZCA 3Q3CA 2VRCD 4KDEA 4NHEA 3JQ9A 1VLLA 3KYCA 1FDVA 4GWGA 1AUPA 1P1RA 3GEGA 4Q3CA 4RLSA 3OM9A 1MB4A 3IMFA 3JD0A 3BHJA 4YAEA 1E5QA 2X0JA 3DHEA 4Y6SA 3S2EA 4XRGA 1HDCA 2B36A 5JC8A 2V65A 2Y68A 5MDHA 1P77A 3BMNB 1IYZA 1P1FA 3NGXA 2BFOA 4IM7A 1Y5MA 3O03A 4DIBA 1VJTA 4CMIB 4HX5A 1BVUA 4E5KA 2O4UX 3E82A 4WASA 5BR7A 1R4NA 3MJSA 3ZU4A 4BO0A 3HB4X 2C2XA 2CY0A 4YJFA 2Q4EA 4RF3A 4OXKA 1VPDA 2EGGA 4BNNA 3ZWNA 3K2BA 4UVEA 3RC1A 4R4JA 3Q9NA 2PGDA 2OOSA 3GEMA 1GYPA 4QXMA 5DDIP 3QWBA 3WWZA 3W6ZA 1EUZA 3OA0A 5COAA 1EE9A 5F5LA 2C54A 3OIDA 2RBEA 1AGNA 4IXWA 4J3FA 3JQ7A 5EINA 1A71A 1HE4A 4CM6A 4K28A 1JVSA 1SC6A 2Q50A 4CQMB 1UDBA 1TVEA 3Q6IA 3LYLA 1MG0A 3VVBA 1ZK4A 1B2LA 2EHDA 3DC2A 3RUFA 1X0XA 1EZ4A 4PLFA 3KV3O 4LMRA 2ILTA 1B8PA 3DOCA 4E6PA 1VL8A 3WWYA 3K73O 1IUKA 1GTMA 1KVQA 1PWZA 1E1KA 2HSDA 3CMMA 4IDCA 2BGLA 4W4TA 3LLSA 4IXTA 3HHPA 3UUWA 1H6BA 4J90A 1E77A 1LNQA 5AXAA 5CFZA 3LU1A 5DP2A 1F14A 1EEHA 2FMUA 1C0PA 4BV9A 1I3LA 4IINA 3KYCB 4D0RA 1ADFA 1U8FO 1WPQA 6ADHA 1B14A 2IXAA 5U9CA 2QHXA 2BD0A 3GOHA 4BNJA 2CDCA 2EJWA 4E2WA 5C5IA 3RASA 3GDFA 3Q9UA 1LDGA 4OQYA 2HMUA 4E0BA 1YH3A 2ZJ0A 2O7SA 1QYVA 3GGGA 2P9GA 3IDSA 1XHLA 4BUCA 3DZKA 2EW2A 3RJ5A 3V8BA 3I23A 5THKA 5H82A 1CIVA 1YJQA 1Y8QB 4DBZA 5TT1A 3JD1A 3TNLA 3U3XA 1PGOA 1N1EA 3DDNA 1EVJA 1DEHA 1T2FA 4UEOA 3FWNA 1O0SA 1R4NB 4CQLA 3HFSA 4XDZA 2H1SA 2IEDA 4YJFB 5T67A 1HEUA 2I67A 4FJ2A 2PD3A 4EZBA 5I9NA 3MJCA 3ST7A 3WGGA 1DAOA 3HN2A 5LCXA 1Y8RA 4NFSA 4O63O 2Y1OA 3EVNA 3I83A 3ANLA 2CZCA 2FR1A 5FI5A 4D3DA 1N2SA 3H3JA 3PHJA 4ALMA 2QRJA 3FNFA 3CH6A 4RVFA 1DJNA 4D45A 3JQ7B 2UVDA 1ZXBA 3MTGA 3O26A 2VUSA 3UICA 4XQEA 1UJMA 4GH5A 4BNLA 4WCFA 1DPGA 3RC7A 2V7PA 1LLDA 4FR5A 5F1KA 4Z0HO 1GZ3A 2WEKA 1HLDA 1JW9B 5KKCA 4J2HA 4NI5A 3FNGA 4XJSA 1LX6A 2VHVA 3RUHA 4BO8A 1R66A 4W82A 3IOYA 1LBEA 1FJHA 2EP7A 3RJ9A 1YB5A 3BTSA 4JK3A 5BQFA 4BO6A 3JD3A 1QLHA 4QX6A 3O4RA 3PIIA 1C0LA 2V6MA 2UUPA 4JP2A 1GDHA 1JLLA 4JNKA 3QA9A 4ALNA 5ADHA 3E48A 3EC7A 1RM5A 4RZHA 3OEYA 1T2CA 3GQVA 4NZ9A 5ILGA 5I9LA 1WP4A 1YVEI 3VVCA 2OP0A 4YT5A 1PX0A 3FTNA 4JIGA 1TB4A 2J5KA 3OQ6A 2FSVA 4XX0A 1PZHA 2JHGA 3FI9A 2NTVA 1MX3A 3NTOA 3QVWA 5GY7A 4DMMA 4JBGA 3TOXA 1QSGA 3ANNA 4I5DA 4XYEA 4R3WA 1AXGA 1GD1O 2W4QA 4XKJA 2VQ3A 3D64A 4CQLB 5JY1A 3SJ7A 4RDIA 3IQDB 1YQXA 2C59A 3RUEA 3BHMA 4JJGA 3ROMA 3B1JA 1WMBA 4BO1A 5IN5A 2VNAA 3IP3A 3GN1A 3PFFA 1K0UA 1IOLA 3KB6A 4J4BA 4WECA 5T5QA 3FR7A 2AG8A 3L4BA 4EITA 5JYDA 3GVIA 3ICPA 5EL0A 1V3VA 2WTBA 1ZW1A 2OORA 2GN6A 2Y0CA 5I8ZA 3ROKA 4B7CA 2Q1WA 3ZW8A 4FJ1A 2CFCA 1XKQA 3UGKA 4G65A 4HY3A 2O3QA 3K5PA 4CMHA 1GU7A 5CDGA 2ZCUA 1GUZA 2B4RO 4G2NA 2BHLA 4ZU3A 2DVMA 5I9MA 5FYDA 4N5MA 3TF5A 7ADHA 4DQVA 1T1RA 2EEZA 4IUYA 4XDYA 3S2FA 5TRTA 1A5ZA 4AJ1A 2CUKA 4CLXA 4EEXA 3JQBC 3RROA 3JQ6A 2CDAA 3L4SO 4F3YA 2VCYA 5CDSA 1BSVA 4CM5A 1Z82A 3WIDA 2PKQP 2GNAA 3U62A 5A02A 1NQTA 5G0WA 3RUAA 4YT4A 1LSOA 1DHRA 1NPTO 2VOJA 3AY6A 4MO2A 4PG6A 1E7SA 2W2KA 2IRWA 2D8AA 2YDXA 1PQWA 2DTDA 3GNTA 4BIIA 1CYDA 4LGVA 1U5CA 3R0IA 3ZWOA 3ZI0A 1ZVMA 2VHWA 1HE3A 3FWZA 3HADA 2ZTUA 1XA0A 1DOHA 4LSWA 4YACA 2DT5A 3GFBA 4WUVA 4RGBA 5EQFA 1K6IA 2WDZA 2X0RA 1I30A 3H8VA 4LRSB 1DFGA 4PLHA 1FDSA 4XGKA 1QRRA 1I2BA 3A4VA 1UUFA 3DZFA 3GEDA 4PRLA 3NX4A 4JP3A 1DIRA 5L3ZA 4MVJG 4MDHA 4P4GA 4CPDA 5IZ4A 2WYVA 4UULA 1YO6A 4KUHA 1U8XX 2WD8A 4Q3EA 3FSRA 3SEFA 1ZZEA 1LI4A 2G76A 4FCCA 3VZPA 2YQ5A 4GBJA 4OOFA 5EJ2A 3PYLA 3NUGA 1ZSNA 4C7KA 5A04A 1CDOA 4BGVA 1PJ3A 2O50A 1NFFA 3PQDA 1KVRA 1UZLA 1KVSA 3ITKA 3QWIA 1YL5A 1Q7GA 4GI2A 5IAAA 1SOWA 4BGUA 3CZRA 5CPBA 3C7AA 1SB9A 1BMDA 9LDTA 1PJBA 4EYEA 5KCZA 3WGQA 4H16A 4M54A 1KEUA 1ONNA 4R41A 3UVEA 4JXKA 3OFSA 4UUOA 5ILOA 3S2IA 2NVWA 3C85A 5HM8A 1SCUA 4DLLA 3H65A 2WD7A 1ZK2A 3VAZA 1IPFA 1XU7A 4CUKA 1E7WA 5T8KC 4UVIA 3WB9A 2YHIA 4AJJA 1UP7A 2W2KB 5IN4A 3K2EA 4C7JA 3G1TA 4DC0A 2EG9A 5A9TA 4IDGA 4NDNE 4CLOA 1NQ5A 4E31A 2BI8A 4O6VA 3A1NA 1ZBQA 2HAEA 5C7LO 3PRJA 3KEOA 3WBFA 3WNQA 5BSEA 3RWBA 3PK0A 4AVYA 4CL3A 2CSUA 1QXSA 3HQ4O 2FR0A 3KSDO 5KJCA 2GYYA 1NASA 1ENYA 2PZLA 4E2YA 1KVTA 4CJXA 3KSZO 4GSLA 4CUZA 5ENVA 2A94A 2NU9A 1JN0A 2PFGA 3H7AA 4Q3DA 2WSBA 1VKNA 4W9NA 3UAGA 3MOGA 4ZQHA 3W1VA 3JQCA 1HTBA 4A2CA 4BNXA 4F6CA 5A3VA 4D0SA 2B35A 3LC2O 3ANMA 1KETA 4L76A 3I1JA 3I9KA 4JJIA 4GPD1 2ZIZA 1Q0LA 3GDOA 1MA0A 1ZNQO 5I8WA 4O0LA 2BLLA 1I33A 1UH5A 3RI3A 5TS3A 4WNIA 3PTZA 2CNBA 5G4LA 4GMGA 4BKUA 4CMEC 1YQGA 3O8QB 1PJ4A 2WMDA 3GRKA 3CXRA 1YWGO 3O38A 5JPIA 4PZEA 3E18A 3OJLA 5CG1A 4D43A 1HYGA 5I7EA 1ZK3A 4FDAA 1HDZA 4WLVA 1B3RA 3IL2A 3FPLA 4FD3A 2JCYA 4B7XA 3DONA 3K96A 1M6WA 2WD7B 3GA0A 3R3SA 3JQDA 1MP0A 1UDCA 4R16A 5K6AC 2YHIB 1H9AA 3LVFO 1YONA 4MP6A 3HE3A 4CLOB 2ZTMA 3HG7A 1PJSA 4CM8A 1ZEJA 4TZTA 3GHYA 1Q7BA 2NUAA 3BYZA 1PEDA 4WOKA 4OMUA 3CKYA 1R0KA 4BKPA 1N8KA 1SZJG 1BW9B 3A06A 2OMEA 1A9YA 3EY4A 3VTZA 3PJEA 3VZRA 1R15A 1Y1PA 1YKFA 1UXKA 2Q2QA 2VN8A 3DBRA 3I9OA 5AQ1A 3W8EA 1X1EA 1V6AA 3G3EA 1FK8A 3ULKA 3C1AA 3KSUA 1ZJZA 3CTVA 3JYPA 1J0XO 7MDHA 3TL3A 1P44A 2Q45A 4BNGA 1HYEA 3KRTA 1F06A 2RHCA 1GY8A 1R6DA 2YHUA 1VSUA 3DBHB 1NHWA 3S1LA 5JCJD 3JYNA 4ALLA 2FHSA 3EVTA 1WMAA 3LF2A 2QRLA 3QIVA 3HUDA 2DUWA 4PLWA 1HDRA 3RU9A 4S1VA 5JCXA 5JFOA 4ZD6A 3WQSB 1O94A 1PQUA 2JCVA 1AHHA 3VPGA 4DRYA 1A7KA 1ZEMA 4TRRA 2ZTLA 4IJWA 3VTFA 2E6UX 4MKZA 2NNLD 2VWHA 4XGIA 1IZ0A 3WR5A 1T2AA 1M75A 1LQUA 3VPSA 4BNYA 4FGSA 2NVUB 4BNVA 1H0KA 4ZGWA 3OH8A 4NH4A 4Y9DA 2B69A 4IJKA 2VYVD 4FQ8A 2PLAA 5KJ6A 4QT0A 2VOEA 1SEVA 4Z9YA 3AUUA 5JO0A 3IJRA 4DWVA 1SMKA 3PQEA 2AG5A 3LT0A 3L6OO 1OFGA 4CLRA 1SPXA 2TMDA 4UEJA 3HSKA 1LDMA 1L7EA 1GPJA 4UAGA 1AE1A 4CM8B 3PHLA 1YRLA 2R00A 3WS7A 1ISFA 2JL1A 2AEMA 1PL7A 3PWKA 5FI3A 2NADA 4RVSA 2Q99A 2IZ1A 3QVXA 3ICCA 4CMJA 1O5IA 3EMKA 3ZHBA 2C5AA 4TRNA 3DBRB 3IKTA 1RM4A 3NT5A 3W8FA 3JV7A 4RL6A 5IZCC 3ZWVA 2JAPA 2RIRA 1MC5A 1P74A 3WSVA 4JBIA 4I9NA 3IJPA 2F00A 2CDBA 2G1UA 1VC2A 2VT3A 3ONFA 4WOJA 5JDIA 4FJ0A 1Y7TA 5CEJA 4XQ9A 1ZIDA 4QTZA 3U4DA 3QVSA 4IJUA 2E82A 1B0AA 3MZ0A 3C3XA 4W6ZA 3DZJA 4NK5A 4OKNA 1LDNA 3H3FA 4I5GA 5FFFA 3P19A 5J23A 1IHYA 1WVGA 4KQWA 3PLNA 6LDHA 4CMKA 3SXPA 1M6HA 4BVAA 1ID1A 1WDKA 2ZB3A 3N74A 1NBOA 2JD1A 4QFDA 5FF9A 2PNFA 3PJDA 4BHTA 1EBUA 3E9MA 5F3RA 3V1UA 3WQRA 3EZYA 1H6DA 1U7HA 1ENZA 3LT4A 4BNUA 4II2A 4DYDA 1KIFA 3WGTA 3FPCA 1EUCA 4IQ0A 4R1TA 4R1UA 5LDGA 1X7DA 1ZXLA 2G17A 2EV9A 4IQGA 2O2SA 5BNFA 1B16A 3RUDA 2WE8A 3M6IA 2I5PO 5L9AA 1XU9A 3NAQA 5KIAA 4FIZA 1GZ6A 3DTYA 3ZU2A 4N5NA 4CODB 2P5UA 3WDSA 4EBFA 3P2OA 4R54A 2PH3A 4OL9A 5ER9A 4AICA 2G0TA 2J6IA 4M1QA 4TROA 3EGOA 1O89A 2I6TA 4BO5A 3BMQA 1KEWA 3WX0A 3JQFA 1ZUD1 1U3WA 1HF3A 5F5NA 3RBXA 5JAMA 3PDJA 2QX7A 1FDWA 1VL0A 3JYQA 4R9SA 4XD2A 3LZ6A 3F3SA 3KOUA 5DCUA 4H15A 4RPJA 3LT2A 4E33A 1PR9A 1DAPA 4OOEA 4MOWA 4NBWA 4WLOA 4CLEA 2O4CA 3VPHA 1IULA 1KBZA 2X23A 4Q3AA 1PQPA 4Y8VA 3H6KA 1PZGA 2DQ4A 3INRA 3EDMA 1A72A 4GVLA 3H2ZA 1NM5A 4GLLA 4YRDA 5BSGA 3HNPA 2X6TA 3WFJA 3BMOA 4J1NA 4PVCA 4PN3A 2EF1A 3DOJA 3I9LA 5JSFA 1LTHR 2W2LA 1GEEA 2VWPA 1P1HA 4U7WA 4DIOA 3JYOA 1GPDG 4NU5A 1MXFA 1D4FA 4GAEA 4PZCA 4IS2A 1P31A 1U4OA 4U0KA 3WG9A 4L9RA 3L9XA 2FPIA 4NIMA 2QQ5A 1UP4A 2HO5A 4WJZA 1UP6A 1NR1A 4L74A 1XEAA 3AI1A 4B7UA 4DQXA 4YJHA 3Q0EA 1ZK1A 4XJTA 5A05A 4A73A 4YJDA 3I6IA 2DTEA 1UXJA 4CUJA 1ML3A 1O6ZA 3N58A 4EI2A 1P45A 8LDHA 1E7QA 4CMAA 4ND5A 1CF2O 3PGXA 1C1XA 5EERA 3L07A 4MIOA 2FPPA 4L0QA 3WSWA 2PY6A 3L4BC 1Q0QA 5TJHA 4D44A 3HN7A 4QFCA 1JWAB 2W90A 4IDDA 3PWSA 1YBMA 1ARZA 2D5AA 2AA3A 1LEHA 5HWSA 1E3SA 3JQAD 3BMQB 2NU8A 3H9GA 1NVTA 3DAPA 3U49A 4DLAA 2HLPA 2EKQA 1S6YA 4BO7A 1W6UA 2JD2A 4ZJUA 3R3JA 3AY7A 1DB3A 5JAQA 1LSJA 2ZYAA 3NTQA 4JN6B 4MKXA 3GT0A 4INAA 3UN1A 2GD1O 1O8CA 3U5TA 1IB6A 1ZO8A 5JAIA 1E1NA 3KYDA 2IZZA 1GQYA 4M55A 2Y99A 3ZWWA 1MXHA 3PI7A 4EUFA 1E1MA 2GSDA 4HBGA 4XYMA 3GMDA 3NEPX 3FF4A 3INTA 5KVQA 4QO8A 3OQ1A 1R16A 4H3VA 2QZ9A 3BMOB 4HWKA 3LC1O 3E5RA 4L4SA 4WEOA 2A35A 3PIDA 4DIFA 3DZIA 4B3IA 3FBGA 2XXJA 3WLFA 3TZHA 2FWMX 1PJTA 2FRDA 1O95A 3O9ZA 3FD8A 3ADOA 3ENNA 2I9PA 1PL8A 3GHHA 3PDUA 1NQAO 3QRWA 2LDXA 1L1FA 1QLJA 3LC7O 4J91A 1G0NA 1ONOA 3EYWA 1VJ0A 3D5TA 3OEWA 4G81A 1RM0A 3AUSA 2P2SA 4FOOA 4RVGA 3WMWA 2ZB7A 3I5MA 1CJCA 5EMHA 5KWEA 3UFXA 1Y9EA 4FFLA 1I8TA 2OZPA 2UYYA 4FSHA 4UVDA 9LDBA 1BDMA 4L75A 4YJHB 2PZMA 4R68A 3VKUA 1R12A 3BHIA 4UEKA 4PIVA 3RUCA 1NX6A 3U4HA 2BMAA 3V1YA 4WK6A 3MWEB 5COQA 4FB5A 5JMPA 1C1XB 4RO0A 3I4CA 4IJVA 4HADA 3OETA 1B26A 3W4KA 1PS0A 5COBA 5A9SA 1XSEA 2P5YA 5I7VA 2C2YA 2GN9A 3AUTA 4X54A 4D3FA 4GX0A 1O9BA 2CF5A 1E0DA 3UF0A 2W8ZA 2FSSA 3ZNPA 1DC4A 2D2IA 4EJ6A 2G5CA 4FOSA 3I9NA 2VYVA 1Q2XA 3QSGA 4R1NA 4ND2A 3UKOA 5JS6A 4R69A 1M76A 2YFHA 4MVJE 4YVFA 1I32A 4DXHA 1KEPA 3ZV4A 1GEGA 2OGUA 4GLOA 3ABIA 3KYDB 4YJGA 1DIBA 4LSMA 1RJWA 2PD6A 2HKIA 2PV7A 1AHIA 1QYDA 2A4KA 3OIFA 4BV8A 3DB2A 3DL2A 3GLQA 1GFSA 1SAYA 4MIYA 5CEFA 3TPCA 5KVVA 4IMRA 3HZZA 1S7CA 3OECA 3FN4A 4IDEA 4Z3KA 2YW9A 2OBYA 4MP8A 1UR5A 5L53A 4UUPA 3GAZA 4E5YA 4A26A 1KEVA 1M66A 3ONDA 4MVJP 1J49A 1RM3A 4AJHA 2VZ0A 4CV1A 5MGBA 1H93A 1X7GA 1V8BA 3SC6A 1HL3A 1PJ2A 2AXQA 5JDCC 2ZK7A 4Z9FA 3RBVA 1F8FA 4OYRA 5DF1A 1Y8RB 4WLUA 3EHEA 3GG2A 2J3HA 5A03A 3MWDB 2C20A 3F6YA 1EK6A 4OAQA 1PTJA 3RFTA 3ZDFA 4BMSA 1V9LA 2BKAA 2NU7A 1JKIA 1PJLA 3INGA 1T26A 3WJ7A 4M89A 4XIJA 1EQUA 2D59A 3T7CA 4K26A 4ZN6A 4PGFA 4J4TA 5L45A 3IAHA 3RQSA 4O59O 2X0NA 4AFNA 5L7YA 2GO1A 4XQCA 4Q39A 3VHRA 3OA2A 4ZQEA 4WCFB 4BQRA 1G6KA 2DM6A 4TZKA 5B4VA 4DL9A 3L6EA 4E13A 1OC2A 2RH8A 2X5KO 3GN2A 1E5LA 3WBBA 1V3UA 3AU9A 1LLUA 2DBQA 1HDXA 2IZ0A 4MIEA 4XZ3A 3VZSA 3SVTA 2E4AA 4CV3A 2HJSA 3GVXA 1PZFA 2GZ3A 4XB2A 3IKVA 2GCGA 1PIWA 4BNTA 1LRJA 3PHHA 2D0IA 2G82A 4R5HA 1D7OA 4FN4A 4Y67A 5ES3A 1R0SA 4HFMA 5DCYA 4P22A 2VHZA 4E12A 4NFHA 3PEFA 1Z75A 4TRMA 2VYNA 3U09A 5AYVA 2B0JA 3DZHA 1WWKA 5KJEA 5G0VA 5L4LA 3EZLA 1KC1A 1ORRA 2ZYDA 5L7TA 3WNVA 1I24A 1ENPA 1V0JA 2VTEA 2PWZA 1ISJA 4RF5A 1R37A 4AJLA 1NPYA 2VRCA 2PD4A 4YAKA 4YA6A 2R2GA 5A9RA 3ZV6A 4J0FA 4WEQA 5HRUA 1I2ZA 3TOZA 1EBFA 4NMHA 4Z0PA 1M67A 1Y81A 4JX8A 4R3NA 3W4IA 1ZJYA 1WZIA 4K1LA 1JKFA 3BIOA 5A5FA 3KEQA 4J9UE 4CM3A 5EIOA 2YV2A 3AWDA 4IDAA 4QEDA 4BQPA 2JFFA 2OBNA 2EIHA 1TT5A 1T1SA 1WXDA 4J7UA 1YJ8A 3D4PA 4NK4A 1MLDA 2ZYGA 1SNYA 4L73A 1U3TA 1U7TA 2P4HX 2Y1DA 3GAFA 5A3JA 3PPIA 2DBZA 4DYVA 1WAMA 4U5QA 1DRUA 1E1LA 1U28A 3VH4A 4YYZA 2QIOA 4BNFA 3D1LA 2WYUA 4CM9D 3RBZA 2I3GA 3ZWAA 5JXWA 3ZWBA 4BO3A 3SBOA 2J5QA 1MG5A 2EERA 3S2GA 4NBUA 3WTBA 4D3SA 1XQ6A 4B8WA 5C7IO 3NDRA 4I08A 3GZNA 5G0TA 4RPHA 4CQMD 1N92A 3RD5A 4DVJA 3D0OA 1BRMA 1X13A 4ITUA 2DFDA 4ZRNA 4F46A 4FPXA 2BFMA 1K5HA 4XRRA 3DWFA 5TIIA 2Q1SA 4FS3A 5L95A 1R0LA 2AE2A 1KVUA 3GPDG 4RPLA 5GMOA 4OHUA 1VL6A 3DMTC 5AVOA 3CPSA 4Z6KA 3ENKA 4KTTE 1B3BA 4RVHA 4EUHA 2D3TA 4DREA 5JY6A 3GK3A 2NSDA 4Q3BA 3HDJA 3WTCA 1FDTA 4W7HA 1NYTA 3QHAA 4E30A 3QY9A 3DO5A 4KUEA 3MCVA 4NU6A 3VH3A 3WOHA 2GZ2A 1QYXA 5L7WA 5LDHA 4PLCA 5FEUA 4J4HA 2B5WA 2AHRA 3VDRA 5C3MA 1I2CA 3WGYA 4UREA 5ICMA 3ZH2A 5JBIA 3PZBA 3MJTA 5HBRA 2HMWA 4B8ZA 1NAHA 1VI2A 1NP3A 1WLYA 3OJ0A 1YXMA 3IP1A 3P7MA 4YB8A 3FCOA 5C7OO 1QV6A 1MFZA 2VRBA 4JROA 1GUYA 3RCBA 3F4LA 3VC7A 5B4TA 1IHXA 1K2WA 1TT5B 2DTXA 2EXXA 5DZSA 4DC1A 1MGOA 3D3WA 4A03A 4ALJA 4RORA 2BELA 2JHFA 1N1GA 4M8SA 5KOIA 3DEYX 3U4CA 4GMFA 1Q1NA 4XEHA 2AQIA 4Z3DA 3PVZA 3QVOA 3DR3A 5BNTA 1FMCA 4AL4A 3KHUA 1ISGA 4TWRA 4AJKA 4LK3A 4J9VA 5AXDA 5L4NA 3ITDA 1LQTA 3JQBA 2IDZA 3LQFA 3FNHA 2FR8A 3DTTA 3GZNB 3QW2A 1XCBA 2GRAA 1FF9A 3F47A 5JAZA 3QE3A 2WYWA 4YAGA 1G0OA 2BH9A 4GQAA 1UAGA 3PWZA 5IDYA 3AOEC 4FFMA 1E3WA 2YJZA 4UUNA 2PKQO 3F9IA 1NXQA 3OHSX 5U1PA 1NQOA 1NVGA 2HK9A 5L40A 1K3TA 1C0IA 2Y66A 4E2XA 3ZU5A 3L9WA 4CR6A 4F6LA 4IDFA 4EW6A 1LU9A 4WKGA 1E7YA 2Q49A 3I52A 1P9LA 2O3SA 3QV1A 4GSKA 2HRZA 1NHGA 1XIVA 5U4QA 3GG9A 4OKIA 4QSMA 2Q3EA 4L8VA 3KO8A 3RKUA 1Y9AA 3ETEA 5TGDA 1YDEA 4YCAA 2OL4A 2B4TO 2NVBA 2NTJA 4XYGA 3U0BA 1CEQA 2I66A 4AG3A 3NGLA 1U4SA 4XYLA 3HDHA 3BTOA 3JQ8A 4YTEA 4I5EA 4Z9XA 1YL7A 1HLPA 3NJ4A 2OFPA 2RAFA 2H63A 4URFA 1RWBA 3ORFA 4W7IA 3PLRA 3JQ9C 1Z73A 1U9JA 3P5SA 1LC0A 4H7PA 3M2TA 1PSDA 4O5OA 1A4UA 3MJ4A 4PVDA 3S8MA 4UUMA 2X5JO 2B4QA 2VT2A 3ROQA 3TZ6A 4M86A 3V5NA 3GGOA 3K8ZA 2Y05A 4UVGA 3VH2A 5IJZA 4LISA 1MUUA 4KMSA 4PG5A 3K92A 5G4KA 1BTOA 4Y6RA 1KY4A 3AOGA 3DBLA 3G79A 3LT1A 3U4IA 3KTDA 4A10A 1FDUA 2AEJA 3UHAA 1A4IA 3NT4A 3X2FA 4RVDA 3AFMA 2Q1UA 3RFVA 4PLGA 4HUJA 3JYLA 4EEZA 2POQX 4GGPA 4ZHSA 1GL3A 1I0ZA 1RKXA 2NACA 3Q2IA 3PHGA 3ZN2A 1H2HA 1DRVA 1UZNA 5T8KA 3WMXA 4BKOA 1OZAA 4OXNA 2DUUA 4I1IA 3AU8A 4P4NA 1E3WB 2Q46A 2SCUA 1CWUA 3B6ZA 1WDMA 3PQFA 4DPLA 3G17A 5G0UA 4MINA 3SLKA 2V6GA 1NWCA 4WLEA 3LLVA 1EVIA 2OO5A 1C3VA 4RQUA 4RF4A 2JD0A 4IGEA 2NV6A 3OP4A 4AJPA 5KKAA 1PL6A 1DJQA 3H9QA 1JKJA 1KC3A 3ZU3A 5A06A 3JSAA 3NYWA 4YT2A 3RC9A 3LF1A 1SO8A 4JCOA 3DAFA 3RSHA 1KYQA 2WM3A 4GGOA 3KZVA 1XYGA 1P1KA 2C7GA 4CR8A 3STHA 1K89A 3QQPA 1Z6ZA 3R6DA 4MVJD 2PGJA 1ADBA 4PRKA 3JQ8B 2WJPA 4KUGA 4CM1A 3OJOA 5GZ6A 5H83A 1L7DA 4QECA 3WGZA 2PZKA 2CD9A 3KETA 4N7RA 3DAGA 4N54A 3DQPA 3ZNQA 2DBVO 1IE3A 4TQGA 1DO8A 4W99A 4XCVA 2X9GA 4DTIA 2XF8A 1EVYA 4QQRA 4J2OA 2HU2A 5BT9A 1I01A 2B83A 3AFNA 3A28A 5DP1A 1GR0A 3KXDA 3WLEA 3W4JA 2CVOA 1IPEA 1OC4A 3DZGA 1DSSG 5JW6A 4J7CA 4CMBA 4KTVE 5ITVA 2OP1A 4YR9A 2ZCVA 1ZH8A 1W8DA 2D4AA 2FZEA 3LDHA 3MJVA 5CP8A 1ISMA 3DBLB 2O23A 3RKRA 2JAHA 1TT7A 2PK3A 4IQ8A 2DU8A 4YDRA 4E3ZA 1LDBA 3WJAA 2AQ8A 2HDHA 5ITWA 4ILKA 5JLAA 1JWBB 1N9GA 1H6CA 2C7VA 4BGIA 4D41A 1A9ZA 2O3TA 5DCWA 1AN9A 1Z45A 2BF7A 5K6AA 3D7LA 3ZCXA 2J3IA 4B4VA 1BG6A 3AK4A 4CLRB 4BNMA 4BKRA 1CERA 1EMDA 4J0EA 5CG2A 1F17A 1BXKA 3SX2A 4OGWA 4JBHA 5B37A 1HDGO 1MV8A 1VKOA 3V2UA 5TSDA 1LUAA 1HWYA 1E7RA 1EE2A 4LCJA 1V35A 4WCFC 1DIAA 1GCUA 1JDJA 2GUGA 4D42A 2PTGA 4NG5A 1H5QA 1CETA 3MEQA 1NNUA 1BXGA 5TJ9A 1ULUA 2XAAA 3TZKA 1ZMOA 4I8XA 1NFQA 4XWYA 2ZQYA 1C1DA 2YY7A 1YE3A 4BL5A 3ZWPA 4ROSA 1NPDA 4U6SA 2DAPA 5DULA 3GGPA 1TXGA 4B79A 3C1OA 2Y1FA 3V2HA 3OIGA 4BOYA 2CVQA 4DBVO 4BNKA 4I9UA 3L0DA 4HFNA 2X4GA 2ZJ1A 3E03A 4KWIA 4BO4A 4PLTA 4D7AA 3PYMA 4DPKA 2BRUA 3FNEA 3I9MA 1HYHA 4F45A 2C82A 1WW8A 4BNIA 4GX5A 3CIFA 4ZQGA 5HA5A 5IFLA 3C24A 4I9HA 4GX2A 2YDYA 5A5EA 3SLGA 1I36A 1QORA 5IXYA 1Y8QA 2PH5A 3GH3A 3ZV3A 4E21A 4QUKA 3GUCA 2P91A 2EW8A 1KY5A 1OMOA 1ONPA 4LMPA 4TVBA 4XIYA 1PGPA 3PHIA 2DPGA 2IEBA 2O3RA 1RPNA 1Z74A 5TX7A 5JC1A 1VRWA 4ZA2A 3V1TC 3K31A 1N9GB 3PJGA 3LK7A 4WGGA 1P0CA 3WIEA 4B4UA 5TF4A 2Y1GA 3TN7A 1W73A 3RC2A 3TFOA 4E32A 1C14A 4OO3A 3JQGA 4IZHA 3ZWXA 3ZWCA 2YUTA 5KJ1A 1AXEA 4TKMA 2FOIA 4ZQFA 4R5MA 2FZWA 3R1IA 5BNIA 3TZQA 1NTOA 3AI2A 3EW7A 2RCYA 3H9UA 4FFOA 2PKRA 3ZWMA 1LRKA 1HKUA 1GYQA 3M1AA 1CQJA
chains in the Genus database with same CATH superfamily
1Z6XA 2WMOB 3KFVA 4MWEA 1HETA 1NXTA 1YE5A 3I2FA 4N3BA 1NSFA 4QGSA 1QQBA 1AB6A 1S8OA 1F38A 1BXZA 1GSAA 4XVHA 1TA4A 3BTUA 4CM4A 5KNBD 4L5IA 3NTRA 4IX1A 2Z2ZA 4IOLA 2YQ4A 4O08A 1ZMTA 1BXGB 4KP7A 4IXDA 2AZ4A 2G3YA 2GB4A 4EL0A 2IF2A 4YQZA 4ARZB 5IBCA 2NXJA 2D1RA 4NBRA 2H1CA 4V3CA 1U7DA 2QYHA 2VAXA 3ER6A 3KP1A 4Z86A 2PLNA 4EG4A 2V1UA 4MNTA 3VJMA 2JIZA 4GGMX 1P8AA 1X15A 2NWQA 1EK5A 4IIHA 1A82A 1NBIA 3ILVA 5CCDA 2IVFA 4OQLA 1L7QA 3LUFA 1DBPA 4DLNA 4JC5A 1LXCA 3H9EO 2N9UA 2IITA 5C32A 1KFBB 3VR6H 2IIVA 1PJCA 3SM3A 4RZXA 4ER7A 3CPHA 1M2HA 1VFNA 3I9JA 2Q9CA 3H5AA 4MQFB 5K8VA 2FFHA 2NZUG 1G55A 4GOKA 2IYUA 4M1TA 4NP6A 2LBPA 3IEIA 5AIBA 2MR6A 2WZBA 3V8RA 5IUJC 3FBTA 4C7XA 1V4BA 3K32A 3AI3A 4BNZA 4QGFA 2X1VA 4XQGA 1Q0HA 3AX6A 4ZEOA 3SHQA 4AG6A 3DT9A 5EKXA 4QKQA 3LHIA 4HLCA 3NLLA 4CR7A 2EKBA 1MW8X 1LC3A 5TQ2B 3LHSA 1U0EA 1NLYA 1QFZA 1TQ8A 2BFCA 2CXNA 2ZYHA 3UJCA 1DQRA 3WYBA 1N75A 4OLHA 1X1CA 1TU4A 4Y1GA 1A1VA 1U2PA 5DT9A 1OH7A 1DO0A 4N9QA 4NCJA 3VJRA 4UAUA 3QBTA 2H07A 1NLMA 3TG8A 5KOHB 4PCAA 3NHFA 5JFTA 5D3KA 1TECE 1Z47A 3GBSA 3CTMA 1WZEA 1XJWA 4J0QA 2J0QA 3V2GA 3OJFA 4LRWA 3PFWO 1XJ0A 2D5CA 4LJ9A 5DBGA 1BRTA 2YNMA 4S0XA 4F8YA 3KYBA 2FHPA 5A6VA 1NVMB 4OJTA 1TJ4A 1WULS 2Z1MA 4LXIA 4YRBA 1OAKA 1G9SA 1K7XB 2ZYRA 4XGQA 3A1TA 3QKRA 3ENQA 4RABA 3QXSA 4ND3A 5JASA 1GPH1 1NNLA 5ULLA 2XA2A 3AF3A 3E2MA 1C7QA 1T4DA 4D8VA 1P17A 4BFLA 5BNZA 4N7JA 5AW8A 3GEEA 4EPRA 4BMYA 1AUQA 2JHAA 1YRYE 4HDAA 4G1CA 1M2OA 1VXRA 4PV7A 4UTOA 3WP1B 5IX8A 5K0ZA 4MS3B 1RCTE 5ABPA 2OCYC 4QDXA 4RETA 2OHFA 2JC3A 2ZS9A 3S4YA 2QX9A 4MDFA 1PBNA 1P75A 1Z6PA 4Y1FA 3U13A 4H7EA 4TMFA 3F3KA 1E7MA 4ZOBA 3VSDA 1ZNWA 4C6TB 4NPCA 1Z16A 5CT6A 3T06B 1U1CA 2JI9A 2O7QA 2ZSDA 4XJVA 3SC4A 2HHHB 2AT1A 3T4EA 1LX7A 3BFVA 1A4XA 4QTUB 4HB0A 5EP3A 4E5SA 2AOXA 2HLDA 3OTOB 1OAAA 3QJ5A 1DP4A 4JSRA 4LDAA 4BLQA 4QJ5A 2C5LA 5EE3A 1SWVA 1SOVA 4TKZA 5IHXA 2HTFA 2I3AA 2PZBA 1UQUA 1KXJA 1QX3A 4W8HA 1ECCA 1RYZA 1RQGA 1GCAA 2JFQA 2KHZA 5FBVB 2V0CA 1ZGAA 1E4YA 1GTL1 2G71A 3QVVA 1Z2AA 4A27A 1EX1A 3RVDA 4BTVA 4UM9B 1YCDA 2VK2A 4XWAA 4Q3OA 4DJ5X 2O2YA 3D3EA 2VSQA 2WUFA 2PX4A 2H1VA 3OX3A 4I14A 5JADA 1S7GA 4C6RA 5IT4A 2AFVA 3PQ6A 3JVEA 2VNSA 2R86A 2A6PA 3RJZA 3KZOA 3D6UA 5E2BA 3L77A 4DCPA 2F8SA 4OG2A 2C77A 1RJGA 3FIUA 4YRPA 3MD0A 5LOVF 3CX6A 5FWNA 3TD2A 4NR0A 1J2JA 2WKSA 4IJ6A 5AVKA 4OSPA 1Y6FA 2C8JA 1E9FA 1SUAA 1Q19A 3WGHA 5BMVB 2XYHA 2G7MC 2WUEA 2OE2A 3TSZA 1XZGA 2OV4A 1CVRA 2RGEA 5FPHA 2EWMA 3FDFA 2WT9A 4W9NC 2Y4OA 2CLHB 2F9LA 2BFFA 3TDNA 4HVTA 4JJ7A 3ENWA 5F4ZA 2WJJA 5J1TB 4OI1A 2VTKA 1JNYA 3KUCA 3NJ8A 4K1XA 3SOZA 2QTVB 2ID4A 3F4BA 4W1SA 3I0ZA 7AT1A 5TT0A 3LCCA 1J4AA 3F46A 4IIVA 2A5DA 3L4EA 5AW5A 3I92A 2QUZA 3PITA 3IEPA 3KWJA 4OHCA 4G24A 5DGCA 3UW3A 2O0HA 3WY9A 3H11B 5BRJA 4EY4A 2OD9A 2Q2VA 2YICA 3LBIA 4L3VA 4Y6PA 3JQEA 3BCRA 3OEED 2XXBA 4H4CA 3GVCA 3BIXA 1FTQA 1N0VC 1Q21A 3VKVA 1CT9A 1N3YA 3IQEA 4KC0A 1BE6A 1PNVA 1Y89A 2AW5A 4M98A 4NVRA 5DBOA 4LV5B 4Y2HA 3UGQA 2HJGA 2ORVA 1Z3CA 2WBLC 3Q9SA 4EY8A 5HQTA 1DIHA 3NAGA 4IIJF 1LA2A 5EJFA 3WL7A 1GA6A 5AD1A 1KO8A 1R1DA 4P0QB 1F2DA 3BZWA 5FI1B 1H3NA 3K8YA 3ESAA 4NYJR 1DAMA 2FPLA 3TR5A 2FPGA 1EFDN 4YO8A 1QO7A 3E9QA 3SQXA 1OHHD 4S24A 1B0ZA 1KJNA 4CT0A 3IOMA 1J6UA 1Q1QA 3AHFA 4PS1A 1E3EA 2FUG1 4XR9A 3SR0A 4FC7A 3UMRA 3GJYA 4TLLB 3VDQA 1UBUS 5L3SB 2JFHA 1DIGA 3QNMA 4O25A 3ZC3A 1VG0B 2QRNA 2WY2D 3Q1LA 4EKGA 2CK3D 3HC7A 3EIOA 1PR6A 3C2QA 3NIWA 1AQNA 2OSBA 2VWGA 4H7JA 4BGEA 3PQ8A 4EGFA 1APBA 2WJGA 1A9QA 1XU4A 1D1SA 2B25A 4YAIA 5EZYB 2I1VB 4LX8A 2BE9A 1OBFO 1IY1A 2EJTA 3G23A 2XTZA 3BH7A 4MH0R 2XV1A 5HMMA 1JR3A 2R6JA 5JNUA 3I72A 4EJMA 5F2OA 1XZMA 2HMTA 5B3KA 2GERA 1RWKA 5CBKA 4JB0A 1IONA 3T5TA 4H4DA 4YUYA 2VUTA 4DCTA 1Y3DE 2HA2A 2X8AA 5EKDA 4E5PA 1CIJA 3PSHA 1L5QA 3W7AA 2XEXA 4NHOA 5SYNA 4EG3A 5CYPA 5F7ZA 3NBYC 5CX1B 5AXBA 5ALDA 5I7WA 4X95A 1GITA 3DC7A 3NKVA 5H81A 2Y67A 2SKCA 2DLCX 1G8GA 2H65A 1Z0ZA 1ZL0A 1YL6A 3LQ4A 2ZETA 1CRPA 2X2FA 2OZVA 3OTQA 1PRYA 3QYAA 1XZNA 2IOFA 1P2TA 4HQLA 5CHYA 3WHKA 1H5UA 1Z28A 2OMKA 4PLVA 4NBVA 4HNUA 2OHVA 1E6UA 1I5RA 3LV8A 4XD7A 3CLHA 4YALA 3COYA 2PH7A 1JAXA 1UAYA 3OEHD 4GP6A 3ZCUA 4FBGA 2Q8NA 1AUXA 3LSTA 2IHZA 2NQ8A 4J16A 4AZ0B 4I5FA 1LLQA 2GGSA 2VDNB 3M1IA 3RJTA 4EG6A 2D0OB 1KKMA 5EHIA 4G4GA 3GO4A 4UXJA 4R8RA 1BQEA 1CR2A 8ADHA 1P3JA 3GLSA 3U2QA 3O8QA 2Z5FA 4P5PA 1QHNA 4MCIA 3C1TA 3LBHA 4PYMA 5JO9A 2HQBA 3FTQA 3EK2A 3B53X 3EZ7A 2QROA 4IIGA 5FNVB 3T1VA 1V8OA 5JMWA 4Y2RA 2UZAA 1ZGZA 1RRPA 5AOVA 5K0JA 3OKFA 4TKLA 2RI0A 4AC9A 4BECA 1T1IA 4CFZA 2C2GA 2MDTA 2O3JA 2NZVG 2OXFA 2CLCX 3K9WA 5B1YA 2IYSA 1D4OA 3KUXA 4PONA 3KQQA 5LC1A 5LQCA 4CEHA 4WA7A 1UXGA 1U2GA 2WOJA 3OF3A 4N5LA 4C29A 4EKIA 1LNZA 1IZ8A 3H83A 1B76A 3U1VA 3EXHB 3DHNA 4G5OA 3QKUA 1DLIA 2GTPA 2CDRA 2I4IA 1R9JA 2HJWA 3CYFA 3QUCA 2HPAA 1S0UA 3CUKA 2COKA 1GILA 4JAVC 3JRNA 4UOQA 2R00C 3SR4A 1BXRA 1QKIA 1CUIA 4V0SA 3BXXA 5GM1A 2ZB8A 1L7NA 3O1JC 4B83A 4OHFA 1T4CB 4AF8A 2O5VA 3MWFA 4DA6A 4KCGA 3BTVA 1J8QA 2AN4A 2DBRA 2FWRA 3LGAA 3FYSA 4KYIB 5LMCA 3ADCA 3A4TA 4YCNA 5HTOA 1DAKA 2GVNA 3H4VA 1B8NA 2NAFA 3I12A 2W2LD 3PPWA 1K7FB 4F3TA 3HPRA 4LMBA 3B3AA 3SJCA 1CQIB 1X80A 1RADA 2G0NA 3RODA 1SHTX 4F3CA 2E1PA 4BO2A 5I4KA 3EJWA 2TMGA 4EW1A 2FP4B 1LPSA 1GV1A 2AFHB 2Z95A 1NG9A 4PC2A 3RYIA 2IHNA 3IUNA 5JDIC 2XYPA 2EKPA 2QJOA 2XUKA 2ZU6A 1E20A 1WDLA 3DBHA 1BCSA 2REBA 3V4ZA 4BB6A 5JECA 2HCTA 1JA0A 1JAYA 1IY8A 2BCGY 5P21A 2Z98A 1RZUA 3HWSA 4G86A 4IDBA 1NZFA 2DWCA 1K08A 1FTNA 1GQQA 4JSTA 5FLKA 4ZCPA 1GNLA 4C4OA 4ZI3A 5G53C 4B4WA 3S5JA 2D1FA 5LJIA 3DCJA 4DCOA 1STOA 2DFPA 5K6TA 3PA8A 2X41A 5T64A 2JRCA 1LBTA 2K7FA 3JWEA 2ZZNA 2IFTA 2WWIA 2HRBA 1E4EB 5KMGA 1TO1E 2QW1A 1K63A 5DBHX 3M82A 5A4DA 2PEZA 2A7QA 2F3TA 4LJ4A 1DRJA 3NCTA 2QD3A 4EPXA 3IV6A 2NO7A 2YZMA 4KXQA 4L9SA 3H6GA 1XC7A 1C1YA 1IXZA 4GSYA 4J1TA 5G2OA 3R7SA 3TOSA 3WQHA 1ZRHA 4J43A 2JLUA 4URWR 3AM4A 2HSWA 5C3UA 4ZVRA 4CF3A 2QYTA 1NU8A 4INZA 1UWVA 4BNHA 1QIIA 5TVGA 3G5TA 3JQAB 1XZBA 3Q6NA 3WRXC 4KMRA 3DF7A 4FILA 4UHFA 5EJAA 4HP8A 4I3HA 1QG6A 3UEOA 1R88A 2XCRB 3ZDDA 2UVPA 2EKLA 3DMGA 2Q6TA 4NBTA 5TPZA 3UXMA 1P2VA 1E3IA 1KAOA 4DJAA 5IWCA 4GLFA 4HFJA 1G3RA 2HMVA 5EPOA 2X9NA 2VSNA 4MA4A 3VBCA 1QFMA 2PEYA 3EUAA 1JU3A 2ECKA 2HNAA 2NSLA 5ECYA 1TGYA 3RFFA 2V4MA 3U3KA 1N6RA 4HDSA 4DV7B 4PLYA 1W4LA 4TSKA 4J03A 3W6NA 2GN4A 4MPTA 2EBFX 3ZY6A 3PX2A 5DVZA 1R8XA 1GCOA 2PE5A 4NF2A 5GIPE 5EESA 2C5HA 5HS4A 4M9ZA 4XPIB 1C1HA 1OV6A 1QHSA 1XD9A 4DPMA 3GLGE 1UC4B 2VSXA 5CGQB 2I91A 5EXXA 1MTZA 4ONEA 4YRMA 3VKGA 4I0WB 1P0FA 2W6PA 1TYAE 2UAGA 4CG0A 5KNDD 2NLOA 1VLHA 3A6LA 4PX9A 1M8KA 2ZRGA 5LZ9A 4KZKA 1FS5A 4TWZA 1X7HA 3X2EA 1PGNA 3AJRA 3E8XA 3H4MA 2WSSD 4HEHA 1Q50A 2BFDA 3FBWA 4Q1FA 3P8ZA 3HJAA 3RTEA 1T5OA 1Y42X 4XGNA 4CMGA 4DDMA 5DI3B 1W44A 2RH5A 5GZ3A 5IPFA 3GWGA 2AEFA 1CY4A 4IRUB 5KTNA 4IKEA 1QGAA 5THQA 1AKNA 3G5LA 3I8XA 3ZHTA 1JTEA 3ZNNA 4PRZA 4NNOA 3R4CA 4NKRA 4ZK6A 3ORYA 5C8YB 4PLZA 4C2UA 4G26A 2GYUA 2GPTA 3WYEA 1GCGA 1JSRA 2D13A 4JLSA 1RQ7A 4JKIA 1DU4A 1LLCA 3U4MA 4NV3A 3KB8A 5HRCA 4M83A 2HJRA 1EFHA 2WG0A 3FHLA 3NMUF 3A6EA 2ENWA 3GXOA 2PSHA 4OP1A 1HLGA 4YY3B 1J5PA 1L5RA 2WU1A 2BR3A 1YDWA 2J67A 3N8GA 4A1OA 1W4ZA 3B78A 3GB9A 2YJGA 5DIFA 3D3KA 5LBTA 3LTNC 1XGKA 3GZ4A 5KREA 2Q5OA 4D5EA 2VWQA 5T57A 4LRTB 1CUHA 4U2DA 4QZVA 4PNPA 4S35A 4B85A 1ZL2A 4DQUA 2BFBA 2PRIA 4EHLA 3I09A 4L7VA 1BX3A 2R8RA 1OASA 1SZPA 2E4VA 3I34X 1CS0B 1P0IA 2DECA 2PWYA 4KL8S 5E7MA 5KYTA 3OIYA 3FKSD 1VMIA 4KK4A 1GNVA 3UMVA 3MSXA 3THYA 1HQKA 3EIEA 3K1AA 5D2CA 3RT7A 3LECA 1JIVA 2FZCA 4ZPXA 4O2BB 4OREX 3KOWA 1U2DA 1W2WB 2JGRA 3DWIA 3DFZA 1PQ4A 4FZJA 5EMMA 1LI7A 3VR4D 3KQLA 4BMZA 4HV4A 5I7AA 1DTWA 2Z6UA 4DNOA 3ROXA 1UDWA 4HUTA 1L5OA 2VUIB 4ZVVA 4K7JA 1AD2A 1Z8FA 1NMXA 1I10A 2GK7A 5IAKA 1NMSA 3AIIA 1BWPA 2CEKA 2W2QA 3GLVA 2AJDA 5C31A 2PPVA 3OF2A 3SJUA 3FTPA 1PW7A 1K97A 2RJNA 4CHGA 5CAEA 1RBYA 4E1BA 2YVKA 3HCFA 2QZJA 4I2VA 1TMGE 1IM2A 1CY0A 1F12A 3OBBA 2PMKA 3GGSA 4JVNA 4BFUA 4ZGGA 3GLIE 3TQFA 2PTHA 1KQOA 1L7VC 5LA6F 2I65A 4X41A 3C3BA 3DMFA 3AVVA 1IAQA 5HJEA 3BMNA 1KRWA 2V7BA 1BE1A 5KNLA 1OYOA 4CMEA 4ZYZA 5DYYA 2Q5FA 1TEHA 1O6CA 3MCTA 2ASVA 4CMIA 1R6UA 3OQBA 4M88A 3OCCA 4RM3A 3RE1A 5JHHB 2WNIA 1BROA 3PXUA 4N18A 2OXEA 4YRKA 3E1KA 3E0XA 3ETGA 1SCJA 1NKTA 2J3JA 2XGSA 4B4DA 2C2BA 4JVOA 4IGFA 1YQDA 1O95C 4C1BA 2L18A 2MMGA 2ZUBA 2R68A 4RNDB 4D97A 1QDUA 3A2MA 4KDCA 3F2VA 1Q84A 4FUQA 1B00A 3R24A 5DN9A 1A8IA 1BKYA 3A2KA 1SXJB 1Y5RA 2JEOA 2HLNA 1F4VA 3WWDA 2BDEA 2IS1A 2V9ZA 4WADA 3TQHA 3W8DA 2G9ZA 3IP9A 1IN5A 2IP2A 3LP6A 1J99A 1G1MA 3JWIA 3GLIA 1UXIA 3UK0A 1KTIA 4OIMA 5BWCA 1E9EA 1VPWA 1RHUA 1U5BB 1K6JA 3HRIA 4PPGA 3IAFA 1GFZA 4PXYA 1T2DA 1UWLA 1M74A 4KQIA 2Q4BA 4JEMA 2CJWB 4P32A 3WICA 5LKRA 5BSVA 4F0JA 1VPTA 2PQ6A 2WJHA 3EODA 1U1IA 4KXMA 4UNQA 3AJAA 1H94A 4EY6A 1MGPA 1YK1A 3QYPA 4IMPA 1CU1A 1PFWA 1YQWA 2B6HA 2HHLA 1GZ4A 2HJHA 2OTCA 1PG0A 2XKJE 3DMYA 3DAYA 3PCXA 4HZIA 4NQZA 5LQRA 2Y0DA 2VYND 2P68A 1TYEB 3EARA 2AQKA 3EHDA 3UPTA 3VOSA 1RAFA 3LPNA 3OUTA 4N3AA 4Q0MA 1V96A 3HB7A 3IPCA 4M0EA 3UB4A 4JBLA 4AU1A 4D82A 3PUYA 2A1IA 1ZC3A 3IVRA 3CEPB 3Q8KA 3TZCA 2ZE8A 3CZ4A 3EQ9A 3P9IA 4EI9A 5I7OA 4UZFA 4Z8YA 1EJ2A 5J2TB 3U7QA 2OCGA 3LXXA 3KYCA 3E84A 2XX3A 1FDVA 4BMCA 4GWGA 1AUPA 2HHCA 2ZSFA 3GEGA 4Q3CA 3IMFA 2PZ8A 1EX9A 4B3TB 1E18A 1RBZA 5CDHA 2FKNA 4XRGA 2QPAA 3AXTA 5CFQA 2DXIA 1Z29A 4HUQA 4ME6A 4F56A 4PE5B 2V65A 1OXMA 2G80A 4LHZA 4RVCA 1CZRA 4YUAA 5KSYA 5MDHA 2W6CX 3OO1A 2QYOA 2HFJA 3NGXA 2EWWA 3RPEA 4IM7A 4EW2A 2R6GA 2WFZA 1X1QA 1Y5MA 4Q00A 1VJTA 1Q7EA 1USWA 4LOIA 1BVUA 2EEPA 1ORVA 2O4UX 5IT5A 2QTZA 2OZKA 2PL5A 4WASA 3OUZA 4JEUA 4RANA 3FUWA 4QYTA 3ZU4A 4BO0A 3O8DA 2P9TA 2CY0A 2WM2A 3GROA 4YJFA 5BR8B 2OG1A 1OYVA 3W5HA 1B42A 3RVMA 2ZWIA 1AN0A 2O0KA 2Z3WA 3ICOA 4UVEA 3RC1A 3SHVA 1W93A 4R4JA 5MN4A 1GYPA 3BRWD 4QUEA 1JDSA 3WWZA 5B6JA 4F60A 5M04A 4AY3A 1EUZA 4G5QA 3OA0A 5AJWA 3CNBA 1KJYA 1Y4SA 1EE9A 2C54A 3HKBB 1T0BA 3OIDA 4IXWA 1YS2X 3HJRA 1A71A 1HE4A 3G2OA 4G4SO 4R0NA 4K28A 1SVOA 5H16A 1F7VA 5LM3A 1SC6A 1AKUA 2Q50A 2RI1A 4C4YA 1IQ0A 1GG9A 3MWEA 5J63A 1RQPA 2BY4A 3EDYA 3KOYA 5TPWB 5HJ7A 1ZK4A 1ZWKA 2ZI7A 1OFUX 1B2LA 3DC2A 1OXBB 4G9EA 3RUFA 4ENVA 4ZALA 1Z7YA 4H7IA 3ACBA 4L6CA 1VRCA 3TRDA 4FP9A 3AJEA 3K73O 1MAHA 1GTMA 3EG9B 1JAIA 4YJ2A 2BGLA 5GOZA 1ZNXA 3HHPA 3ZI7A 3L02A 4GUDA 5AXAA 1R6BX 3QFRA 1JR6A 3LU1A 1JV2B 3F96A 4KGXA 4ERNA 4R9VA 1C0PA 4F04A 3WK5A 1PYOA 5EY5B 5H3CA 5HIJA 1WNFA 2C88A 4Q4DA 4P1ZA 1WPQA 1UM8A 3KXIA 1V8ZA 4I6GA 4V2IA 1BN7A 2IXAA 5HEKA 4P98A 2BD0A 3GOHA 3PVSA 3TE7A 4D0GA 5DGDA 3E9RA 1N3BA 4C0JA 4HQKA 3GDFA 4OX9B 2NZJA 4X6LA 2HMUA 3IAS1 3O4VA 4X60A 4E0BA 2Z3ZA 5K01A 1UK6A 1QYVA 2P3OA 2P9GA 5KSPA 2M1ZA 1XZJA 2FH5B 4AWAA 2EW2A 5AVTA 3V8BA 1PWHA 3BK1A 3HO6A 4UD6A 5H82A 1R6XA 2ZBQA 5KTRA 1THGA 1SY7A 4YXWA 3ZE7A 4DBZA 4DV0B 3KZMA 3FPSA 1RQXA 3DDNA 3BXGA 4YP7A 3VNBA 1T0UA 4EJ2A 1T2FA 1VQ1A 2WICA 5AUQA 1O0SA 4ZZ1A 1EJ6A 2RAVA 5EWMA 2I4MA 1FVOA 4XDZA 4YCJA 4AZTA 3L7MA 5FDFA 1V9CA 4FJ2A 4OQEA 2INGX 4NMLA 3ST7A 2WWTA 3JWJA 3HN2A 5HBGA 4U7JA 1YDGA 3WGGA 1Y8RA 3UC9A 4AWXA 4BEVA 3HH8A 3QFCA 4NFSA 4REMA 3VISA 1TZBA 3EVNA 4KJZA 2YJTD 2C2OA 3OZDA 3ANLA 4X0EA 1RTKA 3WKAA 3M9WA 5IH7A 5JARA 5LMNB 2JFNA 1H2FA 2DH6A 4NTZA 1J56A 3FX2A 4B6EA 4L15A 1D9XA 1R64A 4B47A 2JGIA 1WQ1R 3FNFA 3V4OA 3AUXA 2FF7A 5AO9A 4D45A 5C52B 4TXHA 5LN1A 3BGWA 2JAQA 1ODIA 2B61A 3OCUA 2QAIA 2PDAA 1UJMA 4XQEA 4RE6A 4BNLA 2V7PA 4FR5A 1L4MA 1GZ3A 1UDXA 2GBIA 3VZBA 3LCMA 3DVRX 3RV3A 4EVIA 4UFPA 1BOFA 2F1IA 2H18A 5KKCA 3A11A 1ZRSA 2FN4A 3FNGA 3PS9A 4XJSA 5JRZA 4CEHB 4ENUA 1FYWA 3M49A 1HORA 3EOZA 4EQ6B 1FJHA 1HFJA 3B7GA 2WG2A 4LYDA 1TO6A 2F8TA 2LR0A 5LMUB 3PQ2A 5DJ5A 3L2OB 5CYFA 2PMWB 1XTIA 3CUTA 3I9V1 4LYAA 1WMEA 1M0TA 4REQB 2ZZMA 2C98A 1FY2A 3ET5A 5AOBA 5JNTA 3DW1X 3OU2A 2R62A 4RQAA 2V6MA 5LPNA 3G8CA 3AF5A 2UUPA 4JP2A 1JLLA 3QA9A 4N39A 4LA4A 1QO9A 3ZH9B 1EDBA 3GQVA 2ZR7A 3VVCA 4FU0A 2OP0A 4YT5A 3FTNA 3OZAA 4JIGA 2FSVA 2OY0A 4NESA 1WCV1 3OCWA 5LNK1 2Z5GA 1Z0UA 2HOQA 2C95A 3ZX5A 2JHGA 1KK2A 5B3AA 1G3UA 3OZXA 3PXGA 1MNAA 2JK1A 2QTFA 2REOA 3UYLA 3WYNA 2FEKA 1MX3A 3NTOA 3QVWA 5GY7A 4JBGA 1TD9A 1V5FA 3ANNA 1TFRA 4I5DA 4BJ3A 1A9TA 4XYEA 1P61B 3T5PA 2D62A 3KELA 2QMOA 5GONA 4PGGA 4FFDA 2YIJA 4XKJA 2OYRA 1GRRA 1I1NA 3SJ7A 1OXXK 1MIOA 3B38A 5KNDH 1ST3A 2FYTA 3SXUB 3F49S 3BHMA 1L4YA 4Z2AA 3B1JA 1WMBA 3RJMA 3UWOA 5ALMA 3NG1A 3A27A 3KVNA 4J4BA 2KB0A 4D5GA 1AMUA 5JYDA 1KL7A 2R66A 1KP3A 3ICPA 1PWEA 4QHTA 5HJ5A 3K6RA 5JSZA 1V3VA 4URZR 1QU2A 1ZW1A 4JY7A 3V34A 1C80A 1Y6RA 2JAWA 1ODCA 1Q95A 2Q1WA 3DTVB 1HMPA 4FYHA 1U9YA 4PHTA 3UGKA 3N0TA 1UBHS 2XTNA 2YFYA 1RAIA 3K5PA 1IXKA 4HY3A 4LYEA 1KDRA 1RTTA 3AF2A 4QXQA 5G3YA 1BS1A 2VSOA 2ZT6A 3FCAA 4FMPA 4UCXA 3W9SA 5CDGA 6GPBA 1R5JA 4G2NA 1RKVA 3Q4GA 3MPOA 4N5MA 1HO3A 2H9AA 3J80A 7ADHA 2JI8A 1T8RA 1T1RA 3S8EA 5TRTA 1J1ZA 2CUKA 3O8BA 1Z07A 1JB1A 2DFNA 2H3EA 5FA8A 1J8DA 1JEQB 2FR8C 5CDSA 1TM5E 1W29A 5KAMA 3GP5A 2AOWA 2VP6A 1Z82A 2AG0A 1V4NA 1AZSC 4E70A 2GNAA 2GX6A 2AZMA 5A02A 2FN9A 1OXKB 5TR9A 3TXYA 4G0ZA 3GYBA 3LX4A 2RMKA 2VOJA 2R0QC 1X8KA 3SM9A 1JX6A 2XGOA 1TM2A 3MBIA 3AINA 2YDXA 5A3RA 1PQWA 2NAPA 3HEMA 4TTRA 1EYZA 5EWLB 4ABTA 3G02A 4J1TC 5K09A 1UJ2A 4F9FA 5KHAA 3O3MB 2ONZA 3EGCA 5CFNA 3GJ0A 3Q8XB 1U5CA 4BU0A 3MNFA 4U2EA 3REOA 3I64A 3IURA 3R0IA 1KYIA 1B8OA 2GTHA 4V0LA 3WLSA 2CKDA 5C2JB 2F8MA 3P4XA 1Z3IX 2ZTUA 3KAQA 1XA0A 1XRQA 3I30X 4LSWA 4TVSA 4WUVA 3UATA 4RGBA 1T3GA 1CQWA 1OU4A 4ARUA 3VNUA 3IT2A 3U3DA 1DFGA 4PLHA 4XGKA 3R2JA 1QRRA 2V98A 3A4VA 5L3ZA 3JASA 3WHPA 1KZ1A 1DIRA 1J23A 1TM3E 1XRRA 2JZNA 3KOXA 4FHZA 4MVJG 3FFBA 1OBHA 1JQJC 1QC5A 2X0DA 3SHFA 4CPDA 4QNNA 2R97A 1EKXA 4UULA 1BS2A 2OPHA 2E4ZA 3TD9A 1V26A 4DM7A 2W6ZA 1U8XX 1DQZA 3BD7A 4GXRA 3FSRA 4OBEA 5G3ZA 4V02A 3U3MA 1F8YA 1RBQA 1RWVA 2QVLA 4OLBA 3DPUA 2YQ5A 4OOFA 5G02A 1Y80A 4R0MA 1JS1X 1SQ6A 4AURA 1UMDA 4DR4B 4C7KA 2X19A 3FLAA 4FFSA 5ALJA 1CDOA 3GFSA 5HILA 3RVLA 2AF4C 3JR7A 2BGRA 1PJ3A 2O50A 2HWWA 5EJEA 3HCAA 2HGSA 5KEIA 5F5XA 2WK1A 5E7QA 4E09A 4E4RA 3SYRA 5AVYA 1CD5A 5CIWA 1QF9A 2ISQA 3ITKA 1U0TA 4AP9A 2ZXFA 1QRTA 1YL5A 3UWPA 1I1QB 4C78A 1NVEA 2J33A 3C7AA 3ZE8A 5KCZA 1NL3A 2FZ5A 4LY9A 5LXTA 3PNQA 4D3YA 1KEUA 1ONNA 4R41A 1QR2A 2C04A 3C7KA 3F67A 3UVEA 4CKEB 4DSUA 2OKGA 2V97A 3LPLA 1MT0A 3V3KA 1YNOA 1CHNA 4FBLA 4MQMA 1R9MA 4ARVA 4QTTB 4M0PA 4ZIRA 2OZLA 4WINA 4OQMA 3KKOA 4DLLA 1UZAA 1D2GA 1NXXA 2VAMA 3IBCA 3LVBA 2FEXA 3H9BA 1IPFA 2MTBA 3P2MA 4UUBA 4CUKA 3JATA 1E7WA 4RHUA 4AJJA 1X92A 2YHIA 4HK4A 3S7TA 2W2KB 4C14A 3I5YA 4DZTA 2BI4A 2W2XA 1MW9X 2QF7A 4HRAA 4CLOA 1A88A 4ESHA 1IBLB 1NQ5A 1AKQA 4C03A 4X90A 2BGTA 2R8YA 3GLHA 3H9CA 5C7LO 2VH1A 3DXYA 1NUUA 3PTLA 3PRJA 5E3IA 3WBFA 3ZXYA 4EYGA 5JH7F 5SZJA 1E8MA 2LCIA 1HE8B 2O07A 2XUIA 5BSEA 5HKBA 3PK0A 4MUBA 2NYAA 2Y4NA 3R9KA 4P35A 2ZBVA 1OUMA 2AN1A 3REFA 2ZLBA 1WXQA 1EM8B 3NHZA 1LI5A 3G9ZA 2IXTA 1H3FA 4RL4A 1K5GA 1NASA 1MQAA 1ZESA 2I6UA 2PZLA 1CJSA 4OHVA 4CJXA 1KZ4A 5BN4B 3SIXA 4DY4A 3CKKA 3U26A 1Q44A 2J3DA 1L7MA 3NP9A 4ZT2A 1U2DC 2XQFA 4RSRA 4B8YA 3N0WA 2GFHA 2G70A 2KX7A 2PFGA 3A4IA 1JLMA 4UDNA 3LMKA 3COJA 1EM6A 4I4TA 2WSBA 1VKNA 2E5WA 5TQJA 5BV1A 3JQCA 4NG4A 4ZOCA 2EQAA 1SD2A 2DOKA 2A5FA 1YDMA 4A2CA 4BNXA 1EWKA 2NZWA 3LPCA 2WU8A 2B35A 3D7RA 3ZD9A 2F17A 1KJJA 1KETA 1Y4ZA 2BTOA 4HDOB 4L76A 4XUCA 3I1JA 1A97A 3E15A 3SDBA 1F9AA 4BEWA 2IYQA 2IDJA 3GZJA 4CKCA 1Q0LA 1OD6A 4ZCLA 3GDOA 1ML4A 1IRXA 1G20B 1ZQ1A 3KE8A 3UFBA 3V8PA 5I8WA 4HAZA 2I4TA 1HEIA 4WNIA 5TS3A 3VZCA 2CNBA 2IEZA 4BKUA 3NBAA 4EAAA 1Z35A 3FYCA 4CMEC 3IAUA 2AWOA 1XCLA 4QHYA 1ZI6A 2Y1KA 3CXRA 3KSMA 4IDNA 4XEUA 4BATA 1N9ZA 4PZEA 2QUAA 3E27A 1O7JA 3OJLA 3ZQUA 5CG1A 4D43A 2ZBUA 3SBOA 3SVLA 4OJQA 1G3IA 3THSA 5A5GA 3DLHA 3I01M 3IL2A 1TPYA 1W4RA 2QRMA 4EHKA 1JGTA 1MRSA 4TLAA 4XPZA 3GLFE 2O2EA 4I6EA 3ZKWB 6AT1A 3GA0A 3R3SA 4P7KA 5HRAA 1QNFA 3CWQA 3IULA 1R00A 1GNTA 3VPDA 1NOIA 1KP2A 5DTIA 4ZFNA 1KSHA 1JHMA 4MP6A 2MCFA 5JR3A 4RTKA 1WE2A 3KJHA 5JWHA 1NW8A 4ZAWA 1YCFA 3GRCA 1ZEJA 4WXEA 2AD1A 4CM8A 4RTJA 3H5VA 1PEDA 5JVDA 1XRSB 5DM2A 3EFEA 2DKOA 3EXIA 1DNPA 3MK31 2H7VA 1N8KA 3LRPA 4H1TA 3W5VA 1SXQA 3A06A 4PSCA 4YMUA 1BCRB 1DAGA 3CEHA 3NORA 2QQFA 3O5AA 2ZJ5A 3EY4A 3E4CA 1X9IA 2WA1A 1GLNA 3KB2A 4ODIA 1R15A 3FMGA 4LFBB 2R25B 5AQ1A 3VMFA 1XRMA 3QX3A 1QQ6A 5BORA 1O95D 4GZMA 3EULA 3K0FA 3AP2A 5JXJA 3DDOA 4CKWB 4E07A 4QDTA 3ULKA 4G5XA 3MOSA 4FEGA 3C1AA 2GZSA 3KSUA 3RYCB 1CUSA 1N2CA 5KAPA 4B4KA 3N2GA 7MDHA 3LOQA 1RS0A 4OQ4A 1EWYA 1HYEA 2IHYA 4LOLA 2Y0PA 4BYGA 1QUEA 2ZRNA 1VSUA 2H2IA 3SEAA 8MHTA 3JYNA 4G0PA 4ALLA 1Q1BA 2PMDA 4I66A 4RAQA 1EK2A 5FOTA 3REQB 1WMAA 3TK1A 2I33A 2RD2A 3GT3A 4KFRA 2PGNA 4G5RA 5JS8A 1ODFA 3QMVA 2IEGA 2VHJA 5JCXA 2IBSA 1V1MB 4W1PA 4C4ZA 4MYUA 4ZD6A 1O94A 2JCVA 2LVBA 1AHHA 2HSGA 3B6IA 3WQSB 3WYFA 4KREA 1XDBA 1SVLA 2ISCA 2ON6A 4MWBA 2YUIA 2PMCA 3TSWA 4L6IA 1TK3A 1V5IA 1TCCA 4IFBA 3ZIAA 3CA8A 3H1EA 4MKZA 2J7KA 3QYJA 2NNLD 4WDQA 3A7DA 2FKAA 3DBOB 1SXGA 4PAWA 2YNMD 3RUIA 2VHTA 4MUGA 2ZYWX 1SKYE 1H8HA 2R7MA 3HKCB 2GEFA 3QE2A 4QOIA 1P7WA 3UT6A 1TAGA 3W8RA 2NVUB 4BNVA 3DE5X 3OH8A 5BUQA 4ZWNA 4Y9DA 1SD1A 2B69A 2ZUUA 2M6RA 3AEXA 4HEA6 2QUBA 2VYVD 4I8IA 4IJKA 4QYSA 2PLAA 1PR2A 2BM9A 4NS4A 3PDIB 3TH5A 4URVR 3ABRB 3HVIA 1LBHA 2PQMA 1HA3A 2G28A 4ZVTA 4IUCS 2OCAA 4KH0A 3WGUA 2IV3A 4Z9YA 3TNDA 4KWTA 1U3FA 1GAWA 2XJ4A 4AT1A 1RWNA 2CNLA 3C3PA 3O8CA 1MDBA 1OFGA 4AKHA 2OXTA 3PFIA 1SUPA 3K71B 2IUSA 2TMDA 1X1DA 1VSBA 3PQCA 4DKJA 2C94A 1YRLA 2DE0X 2IF0A 4H1VA 5CNKA 4MGZR 4QDUA 5I3ZA 3CSSA 3ZBTA 2K4MA 3PPYA 1PL7A 3GFQA 2GNPA 2NADA 3PWKA 3QVXA 2IZ1A 5HPYB 2HLDD 3VNQA 4JT4A 4U5XA 3TJZA 3ZHBA 4XWTA 4OPMA 5DX8A 3VNAA 2ANCA 3DBRB 2GM9A 5SV2A 1MMFB 4RHFA 3SX0A 3IHKA 3ZLTA 1BD3A 4ITVA 5IZCC 2QLFA 3AH8A 3ZWVA 3UIEA 1K98A 2IH2A 1WKBA 2J09A 4DLXA 2W5UA 2RIRA 2HZ7A 1I2DA 1H1TA 1B23P 1W4CA 3B1YA 2PUVA 3PUIA 5E6SB 5C5DA 1NJFA 1U94A 4AUEA 3IJPA 4F06A 1VC2A 1CQXA 2JFOA 3ONFA 5B5SA 4FJ0A 5CEJA 2XECA 4MW6A 5AKIA 1M8FA 3NAZA 1V16B 5ANRB 3G2IA 1XPOA 1LTQA 3MZ0A 4ZEVA 1V45E 1RKBA 4OXRA 1ZIPA 3D8UA 3DZJA 4NK5A 2ZWOA 4MUKA 3DQZA 4OKNA 5DT2A 1P9NA 5FTKA 4G1EB 2QN3A 2WDPA 4EB8A 2P2NA 2B94A 1XEFA 1Y7LA 2ZPTX 1JA1A 3PLNA 4PCLA 3VR1A 2R4QA 2CMGA 2BVNA 3QVGB 5EP4A 5ICFA 1E1RA 1GRNA 3HFJA 4BJ1A 1Z6QA 2J9RA 4OI0A 1ID1A 4JYPA 5A3QA 5HP4A 4YHBA 3U44B 3GJ6A 2PNFA 3IEMA 1AMNA 4AIRA 3VQTA 4JV5B 5AVVA 1JEYB 1IN1A 4IVQA 1U7HA 4YRNA 1NY6A 1ENZA 3LT4A 3Q5DA 4DYDA 2L2QA 1H2YA 1FNCA 2BONA 1KIFA 3WGTA 2BZ0A 3EXAA 3VR4H 4R1TA 4TV8F 4UDXX 4MCJA 3O3OB 4UOEA 2EV9A 3ZIUA 4D9JA 3HABA 4ZTBA 1U7UA 3RUDA 4I1YA 4N0MA 4TZ6A 4Q4AB 4IEFB 2QBYB 4YLGA 3H17A 5F7XA 2J0UB 4YNBA 2EFEB 4XW2A 2J3LA 2G72A 3ZU2A 2AFRA 4QGAA 4RA9A 4CODB 3E81A 4R8MA 3WDSA 1NATA 5AM4A 4EBFA 1K4MA 4WOBA 2FPSA 1EHYA 4OL9A 3E9EA 1S9DA 3DDWA 3HLKA 1JDBB 2WM8A 3C8HA 4M1QA 4OXQA 4UHCA 3EGOA 4XLLA 5HF8A 4EHIA 3V4RA 4D4GA 2ZRBA 4XX1A 1NDUA 4RXTA 3WMFA 4RD0A 4FI3C 2O20A 5KUTA 1NNI1 3A9TA 1O96B 3S7ZA 3HGQA 1DKMA 1FDWA 1MVOA 1VL0A 3BS4A 3KWLA 4URHA 2WLSA 4JJEA 3PUVA 4MS1B 1VIMA 2XQVA 3U9SA 1YHZA 2O8DB 2I2XB 2QVYX 3C0KA 3LFUA 2ILVA 2R5NA 4A8JA 4HQRA 2PJUA 1KSJA 3EY9A 1BZYA 1Q20A 4MOWA 3JRXA 4IYJA 5GTDA 1IULA 2X23A 3E9YA 3QOFA 4Q05A 3T61A 3K6KA 4Q3AA 4HPWA 4F21A 2ZKIA 4MGHA 1XNHA 2WB2A 1V47A 3EDMA 4LX0A 4BWYA 1A72A 1VBFA 4GVLA 1ZU4A