4PZEA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
b'SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
molecule tags Oxidoreductase
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzeA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzeA01
3WGQA 5T6BA 1DC5A 4DYVA 2VRCD 3WBFA 4XQCA 3DBHB 3MWEB 4MVJD 4WE3A 4BNKA 1ID1A 4RVSA 3RROA 4BL5A 4ROSA 1C0KA 2DFVA 2RHRA 1KOLA 1PGOA 1J4AA 4II3A 2BH9A 5G4KB 1H6DA 4B4OA 2O7SA 4Z9YA 2P5UA 4CR8A 2P9EA 1B3BA 3JQGB 2XAAA 3PK0A 4GL4A 1NVGA 1HF3A 2RH4A 1ENOA 4NFYA 3ZWVA 3RASA 3I9LA 3EAGA 5DN9A 1PJTA 3RU7A 4CM8B 3RC2A 1C1XA 2IE0A 3PHGA 1PZFA 2RAFA 2YQ4A 1JAXA 3KB6A 4BKQA 3INRA 3FPCA 3JQBA 4LVUA 3EMKA 1NASA 2YDXA 4PLGA 4JBHA 4PG8A 4OQZA 2O48X 4CV3A 1SNYA 3V5NA 2OO5A 1ISFA 1MV8A 1UR5A 4UUPA 1ONOA 3F46A 1EBUA 3DMTA 3AUSA 2NLOA 3O4RA 2I76A 3GVIA 4M89A 4TVBA 3VH2A 4AJKA 4YRBA 1YXMA 3JQ7A 4YB8A 1E3EA 3FR8A 1TT7A 3T4EA 2VHZA 2WSBA 5CDTA 4CR6A 1EVIA 3LT0A 1EBFA 4QEDA 3K8ZA 4OAQA 5THKA 3V8BA 1B2LA 2EKLA 2EP7A 1M75A 1KEPA 3GDFA 5JCJD 1Y5MA 1E3WA 3VH3A 5F1OA 3ITKA 4R9SA 3I9NA 2PZKA 4P22A 1F17A 2EG9A 5L7WA 5HM8A 1YVEI 2G5CA 2AMFA 2Y0CA 2Y68A 1MA0A 2POQX 1NP3A 3GZ4A 2OOSA 3ZWOA 3H5NA 1DIAA 2GSDA 4ALLA 4CLRA 5KOIA 5A9RA 5HA5A 5B12A 5HRUA 4OOFA 4ZD6A 3WOHA 4OXKA 1PQUA 1JKFA 2JL1A 5C7LO 1LSSA 4XYEA 2TMGA 2Z5LA 2PZLA 5B37A 4OO3A 3OSUA 4PG7A 3WQSB 2OGUA 3INGA 4GI2A 1E7RA 4WCDA 3AK4A 3MWDB 1J0XO 1UZNA 3VH1A 5FEUA 5HS6A 4AL4A 3AI2A 3H3JA 3QVSA 1L1FA 1NVMB 1E3SA 3PPIA 3JYPA 4UEJA 3ZHYA 4RF4A 3LU1A 4IDDA 5DCYA 4WECA 2FRDA 5TF4A 3E1KA 3L4SO 2VHWA 4PFJA 2WWRA 1D3AA 1PJ3A 4INAA 4OSOA 3ZCXA 1LLUA 4Y8VA 2ET6A 1YOVB 4LRTB 4XYBA 5JDCC 1E7WA 1I3NA 1Z73A 4BNLA 1J49A 3WQQA 2D0IA 4JGBA 3RC9A 3JQFA 1ZSYA 1QYXA 3UCXA 3KSZO 4II2A 3JCZA 3NTOA 4CMGA 1U7TA 3NDRA 1PTJA 3I4FA 1GAEO 1O9BA 2NU7A 4MVJG 3LT2A 4GX5A 1CETA 2HMWA 4I08A 3FBTA 3PYLA 3H3FA 5HWSA 4K26A 1Q7CA 4E2WA 1HXHA 4E5YA 1E6UA 4ZQGA 1PJBA 1NQOA 2X0IA 1ADCA 1FDTA 2ZYDA 1EK6A 2VZ0A 1UAYA 2HJSA 3AWDA 1NQAO 2CDBA 5EESA 1DBVO 1X0XA 1V8BA 1NWHA 3A28A 1TVEA 2VHXA 4U8GA 4XB1A 3RCBA 3CMCO 3EDMA 4GMGA 4OXYA 5DP2A 2GLXA 2BF7A 2ZQYA 4DQUA 2OUIA 3NTRA 1ZEJA 2DTDA 2E82A 3GZNA 4TSKA 2NSDA 2NVUB 2EF1A 1UJMA 2LDBA 5KKAA 2DQ4A 4E5NA 4C7KA 3MJEA 1A9YA 1U9JA 3OIDA 5DCWA 1ISGA 1HSZA 3E18A 3O03A 3C24A 4OIMA 3GUYA 4IIVA 4BO7A 3QLJA 1N7HA 4OQYA 3HDYA 3HB5X 2PGDA 1UXGA 1NR1A 3WJ7A 4BGVA 2EJWA 2JCXA 2X0RA 3QWFA 2AQ8A 1ZK0A 3KYDA 4HNHA 4PRLA 2VUUA 2IZ0A 3RBVA 4CM6A 3NT2A 4S3MA 5DBIA 3LQFA 3NJ4A 1E1NA 2G0TA 4WKGA 5CPBA 1B26A 4ZHSA 1X14A 4LGVA 4GQAA 4XX0A 4IDAA 4BQPA 1N9GA 4B79A 4DIBA 5JC8A 1PJSA 2Y66A 4CQMD 2YHIA 1ZCJA 2XXJA 2C29D 1HDRA 1TB4A 4Q3CA 4RF5A 1BVRA 3TZ6A 1JTVA 5A1TA 3H4VA 4I5GA 4R3WA 2FPIA 4IXWA 2ZTMA 3BAZA 2QRJA 2WYVA 3KYCB 3PQDA 2QX7A 1YBMA 4RVGA 1NNUA 3K92A 3GT0A 4J9VA 2HMTA 5T5QA 4FQ8A 5C37A 3JQCA 4NU6A 4R01A 1VRWA 4XR9A 1XLTA 3OETA 3AY6A 3FNFA 1BXGB 2HRBA 2Q1UA 2PZMA 4WNIA 3ZWPA 1YRLA 4BV9A 4PZDA 2AQHA 2WD7B 1E92A 2B36A 1WNTA 4RQTA 4WCFB 4RLHA 3PWSA 4CV0A 4YVFA 3PJGA 2HDHA 1SOWA 3AJRA 1DIHA 3UF0A 3JQAD 2PLAA 4TRNA 5A9SA 4BNGA 1MC5A 5JFOA 5LDHA 3PTZA 4CM9D 4RZHA 4E5MA 1VSVA 2J5KA 1DEHA 1O0SA 1QORA 2UUPA 1I3KA 3QVTA 4BGEA 3E5RA 5CEEA 2BLLA 4WLVA 4Z9XA 2VT2A 1U5CA 2Q2VA 1P1IA 3EY4A 2DUWA 1H6BA 4M1QA 1Y6JA 2JAPA 2HQ1A 4XWYA 4MIOA 4KZPA 2Z1MA 3RSHA 1KVUA 3S2GA 4G81A 5K6AC 4BNHA 2VYVA 4HWKA 4IXTA 3HG7A 4NK5A 1J6UA 3W8FA 5JMPA 1FDWA 3ON5A 3W4KA 5C3MA 1WXDA 2ZJ0A 4JNKA 3DONA 1XU7A 2CY0A 4J4BA 4W82A 1VJ0A 1V9LA 3H65A 5I8WA 1YJ8A 4HFRA 1YKFA 2NV6A 3QA9A 3FF4A 4NK4A 2AEMA 4K28A 3VZPA 4BB5A 2HK9A 4NR0A 2J5RA 1QKIA 4TZTA 3UCEA 3FHLA 1P3DA 3WTCA 1P33A 2GYYA 3F1LA 1D8AA 4UUOA 5AXCA 5KWEA 1NBOA 1SCUA 3WSVA 1VKNA 4IM7A 1LTHR 3F4LA 5L40A 5A03A 3JQ9C 3EVTA 4TKMA 3TQHA 1I5RA 3NDJA 1HZJA 5JLAA 4MVJP 4BS9A 2CUKA 2VWPA 3ONEA 4C7JA 2J3IA 3PJFA 3ZU5A 1YBAA 1L7EA 1NVTA 4JIGA 4YAKA 5B4VA 2DM6A 1NFRA 4J90A 3AM5A 4TZKA 4C4OA 3C8MA 2ZATA 4RGBA 2FPPA 4HNGA 2GZ1A 5JAMA 4DREA 1I0ZA 1HDGO 4UVIA 3TRIA 4EJ0A 1GV0A 1V6AA 2HUNA 4ALIA 2ZCVA 3NYWA 4J2OA 5CEFA 3Q6IA 2DLDA 1ADBA 1IPFA 5H82A 2AHRA 4XDYA 3W1VA 1GUYA 2EV9A 3DZHA 4BO0A 4XR4A 4F46A 3GN2A 4FIZA 1G1AA 3U3XA 2FR8A 3KM0A 1XIVA 4Z0PA 2O4CA 3ICPA 2WE8A 2BGLA 3OHSX 2J3JA 1LX6A 3RU9A 4YRAA 1CQJA 2HAEA 3NRCA 3PZBA 4WLOA 2GZ3A 1VC2A 2Q46A 3GVCA 9LDBA 2Q4EA 3RUFA 5C7IO 4ZQHA 2W2LA 3V1TC 3WX0A 4RZIA 4GKBA 4CPDA 5JDCA 2PH5A 3JQDA 4RJTA 4J3FA 4BUCA 2HK7A 5CP8A 1NPTO 3PHIA 1JN0A 1C3VA 3VPXA 1FDVA 1NM5A 4EITA 1DDOA 1HEUA 3WMXA 1TT5B 2VYNA 4DC0A 1TEHA 4NPCA 1DXYA 2IZ1A 3GK3A 1LJ8A 4W6ZA 3DDNA 4NNJA 2V65A 4GPD1 1X7GA 2FR0A 2BHLA 2PTGA 1R0LA 3AI3A 5JO0A 2UVDA 4KWIA 2YZ7A 4ONEA 1C1DB 5COQA 5I7VA 3G49A 5JAQA 1NXQA 5IXYA 4ZQFA 3PI7A 3K96A 2EW2A 2DBRA 1S6YA 2E48A 3JQEA 3RAJA 2HLPA 1TA4A 1XDWA 3R3SA 4IJWA 5A05A 3AOEC 3M1LA 3N7UA 2PD4A 3TOZA 5GZ1A 1U4SA 3EZLA 3HUDA 1E7QA 5TNXA 1R15A 1H5QA 3GQVA 1V35A 4GKVA 4JBIA 3S2FA 4BIIA 3K9QO 3ZWWA 2BGKA 4YAJA 3PVZA 3WGHA 3WGYA 3U4DA 1SZJG 3DHYA 1PZEA 3PWZA 3X2EA 4U6QA 1Z7BA 1KIFA 1I30A 3C1TA 3I9KA 4XIJA 3F1KA 3PLNA 2EW8A 3X2FA 2LDXA 1PIWA 4O63O 4EUFA 1B7GO 1EDOA 4OL9A 3GNSA 5A3JA 1I8TA 2GCGA 4Z3KA 4Z6KA 4ZU3A 1A71A 3BMNA 2BI7A 4HADA 1ZMOA 3GLQA 3K5PA 2VOEA 4NG5A 4A2CA 4CMKA 2NTJA 1GZ4A 2O3QA 5BSEA 3ROPA 2P68A 4BNZA 4PLZA 4U5QA 3BA1A 2HK8A 2ZIZA 3EVNA 5L3ZA 3FRJA 2BMAA 4D43A 5IAAA 2RCYA 4R68A 3B1FA 4AJEA 4CL8A 1WPQA 1IZ0A 1DRUA 1QLJA 2PH3A 1D1SA 1OAAA 4E5KA 3ZWMA 2VNSA 3L0DA 4IUYA 3IP1A 2J8ZA 1DC6A 3S55A 5TC4A 1FDUA 3TWOA 4YDRA 3MEQA 4QQRA 1U3WA 4D3FA 3LT1A 4YJGB 5A3VA 3ZV3A 2Z95A 4BNIA 1V3UA 3HWRA 4Z0HO 3SXPA 2GO1A 5BQFA 1M2WA 3PZRA 3HN7A 4MKXA 2BRUA 3CIFA 2VYND 1EQUA 3H9EO 4IJUA 4J4TA 5B4UA 4FJ0A 4D44A 1E3IA 2PGJA 3TZQA 2VZ9A 4ZVVA 4KOAA 1M67A 1I33A 1GYPA 1P9LA 5DZSA 4IPTA 3KO8A 1DRVA 4J43A 3ICCA 4L4RA 3E5MA 1ZUD1 2OP1A 1ADFA 5CAEA 5K6AA 2DU8A 5BNTA 2UYYA 4MP8A 5GMOA 5TIIA 1Q0LA 3OQBA 5J23A 1AXGA 1YGYA 1P74A 2IXBA 5F3RA 5IDXA 3P7MA 3C3XA 2VRBA 3NV9A 3PP8A 2FY8A 3W6UA 1D7OA 1U4OA 1LDYA 1T25A 2OL4A 4PLYA 1U2GA 2VRCA 1KYQA 4OSPA 4MVJA 3VKUA 3F6YA 1TXGA 3MTJA 3BMCA 3GOHA 4EUEA 3ZW9A 2P9CA 2Y05A 3B6ZA 3ETDA 2B5WA 3MOGA 5JYDA 1E1MA 2IEBA 1T24A 1DJQA 1DLJA 1JLLA 3ASVA 4LSWA 1VL6A 4P4NA 2IYPA 4N54A 4UEOA 1B14A 3GAZA 3JQ9A 3A4VA 4KTTE 1U5AA 2OBYA 3N58A 2CVOA 3FNGA 1Q7GA 2DC1A 4CM4B 4CMIB 4Y6RA 3ZN2A 4Y6PA 1R12A 2X8LA 1HT0A 3UN1A 3U4IA 4JP2A 2Q45A 1Y1PA 4DPKA 3FTNA 1LNQA 2X7HA 4R1NA 4L4SA 3FD8A 4ND3A 4WK6A 1YJQA 5CDUA 1MFPA 3GG2A 3WSWA 3QIVA 1GDHA 1HE3A 1FF9A 1T2EA 4W9NC 5KVSA 3SJUA 2C7GA 1Y8RA 4QECA 1LXCA 5JY6A 5L4LA 3AW9A 1H94A 1P1RA 1RM0A 2NNLD 1W4ZA 4CMHA 1AHIA 3JQ6A 3SLKA 3TF5A 1IPEA 4NFSA 1OC4A 1T1SA 1ADGA 4CMAA 3HHPA 3RKUA 5C5IA 1U3VA 4O59O 1DOHA 4FGSA 3KEOA 2JFHA 3GUCA 3PIIA 2J5QA 5MDHA 2NVWA 1KS9A 4YPOA 1GPJA 4YR9A 1PJ4A 1N1GA 3U49A 3DZKA 1EZ4A 3I5MA 3WNVA 3KOUA 4DQXA 4RPJA 4BO5A 2ZYGA 2Q1WA 4IY1A 4XGKA 3BHJA 2EIHA 3S8MA 4GX2A 3MJVA 1PU2A 3UFXA 4J1SA 4YACA 3W8DA 4QXMA 3WLFA 2QW8A 4XJSA 3I9JA 4BB6A 1EEHA 4I5DA 3GMSA 2X5KO 1ZW1A 4HFJA 1O6ZA 1Y8QA 4OH1A 2C59A 3HSKA 1QR6A 1WDKA 2AQIA 3WS7A 3DBLB 2BFMA 5DP1A 3ROKA 3RIHA 1O95A 1PZGA 3IP3A 4UREA 4OHUA 5F1PA 3NX4A 8ADHA 1HE4A 4WOJA 3O8QA 2O4UX 4OXNA 3UW3A 1BTOA 4YXFA 4YT5A 1X0VA 1H6AA 1I10A 1O89A 4YCAA 3ENKA 5KJ6A 2Q2WA 3H5RA 4FJ2A 2PY6A 1AHHA 3QVWA 5LC1A 4ND2A 1YBVA 2XPCA 4BNVA 2W98A 1Q0QA 3JQ7B 3CEAA 4ZA2A 2OORA 7MDHA 5L4SA 2X0NA 1W8DA 2PR2A 4J7XA 3AM3A 4Y67A 4I1IA 5CG1A 4CM7A 1QYCA 3AOEA 2BI8A 2X9VA 1VLLA 2DBQA 4AJOA 2ZKLA 4PLPA 3GHYA 4MVJI 3WIDA 5DCUA 3HADA 5IDQA 1LBEA 4WUVA 3PHHA 1DHRA 4IDBA 3L9XA 1N2SA 4MVJH 1YONA 3H7AA 4XGIA 4IJKA 2PA3A 3U09A 2PD6A 3C7DB 2X22A 1K0UA 4I5FA 2W2KA 4D45A 4L73A 3BYZA 2CVQA 1RM3A 4TWRA 4CQLA 5BSFA 5BNFA 1NFFA 2YW9A 2JCYA 3QV1A 3VVBA 1NHGA 3F3SA 1PS9A 3GDOA 4PLFA 1LDMA 4CV2A 1SB8A 1K89A 1JQBA 4RORA 2OHXA 3K30A 4PLCA 4F6LA 5L7TA 3TL2A 3UKOA 4I8XA 4R5HA 4BGUA 4XA8A 5DDIP 3VH4A 4NFHA 5JYEA 5GZ3A 2FP4A 4MPDA 3SC4A 1R66A 3HQ4O 4ESOA 3OBBA 5G0VA 1LLDA 4NJMA 4J0EA 3GNQA 4R3NA 1U1IA 3I9MA 3UGKA 4WCFC 4RVFA 2O3RA 4CUJA 2NTVA 2I6TA 4IDCA 2NM0A 4JJGA 3D3WA 4YT2A 3AUAA 2AG8A 1P0FA 4Z9FA 3OEYA 3PJDA 1ENZA 4J1QA 4TKLA 3M2PA 1YB5A 3IIEA 4NBWA 5IN4A 2ZB7A 4J91A 2ZB4A 4NBTA 1I24A 4J7CA 1ZXBA 8LDHA 4GVXA 4CQMA 3H5AA 4RL6A 4DTIA 4JJIA 2FN7A 4ALJA 1OC2A 4YA6A 2IEDA 2YV3A 4PG5A 4ND1A 4R1TA 2X86A 1TLTA 3FN4A 5G4KA 1GFSA 3RUEA 4NH4A 1GADO 3OP4A 1F06A 1YWGO 5ENDA 1PS0A 3DHEA 4W7IA 3NGLA 4HBGA 1C0IA 4N5LA 4CM8A 2VCYA 3IMFA 3MJTA 1LRKA 3HDQA 1JWAB 4UVGA 2JAHA 3P2YA 4MP3A 4EEXA 4F3YA 4FN4A 2CDCA 2ZQZA 4FOSA 2NUAA 3GZNB 2YV2A 1ULSA 3D4OA 2CF5A 3IQDB 5U9CA 3LT4A 3BZUA 1DC4A 2O23A 4HY3A 3KYBA 1I36A 5ICMA 1HTBA 4ND5A 4E2XA 4BNXA 1LI4A 3JQAA 3Q9NA 4K6CA 4J1TA 5HS4A 3ETEA 3DFUA 1HRDA 3IOYA 4XYGA 3LC1O 1M66A 3SLGA 4CM9A 3CKYA 3L6OO 4YJHB 3DZFA 3HZZA 4Q39A 3WYCA 4E33A 3DHNA 3KYDB 3U9LA 3OJLA 3ZHZA 2E4AA 1UAGA 4JX8A 3H9JA 4MO2A 3JYOA 3MZ0A 4FFMA 5TJ9A 4R1UA 1JKJA 1N7GA 1T4BA 1N9GB 2Y1EA 5JO9A 5TS3A 2I9PA 3RUAA 3S2IA 1GUFA 2YHIB 3ZW8A 4N18A 3T4XA 1U8XX 1RM5A 4WJZA 1K6JA 4Q3DA 3ASUA 1NFQA 1I3LA 4IMPA 1K5HA 5TX7A 1JA9A 5F1KA 4CJXA 1E1KA 2VN8A 3DEYX 1BW9A 3WJAA 4G65A 3KTDA 1VSUA 2D1YA 5F5NA 4J49A 5ITVA 5FI3A 4B4WA 4DYDA 5COBA 4PZEA 1HE2A 3GN1A 3EW7A 1PSDA 5IF3A 1LSUA 3DO5A 3FBGA 1MP0A 1YE3A 1BHSA 5EINA 1BWSA 1MB4A 2B83A 4H16A 2JD0A 1UZMA 3CSDA 1N92A 2CSUA 4W9NA 1I2CA 4B7CA 5ER6A 4D0SA 3DBVO 1U2DA 4A73A 4BO1A 2P4QA 3WICA 3ZNNA 1W73A 2W90A 4O1MA 3KRTA 5CFZA 1XELA 3IJPA 2OP0A 3PXXA 5A9SB 2O2YA 3GH3A 1SMKA 1E77A 4Z3DA 2BELA 3DAPA 3QE3A 4JLWA 1DFIA 4LK3A 4E2YA 3VTZA 5H81A 4ALNA 3TZHA 2GGSA 4E3ZA 2VHVA 4ZN6A 3AOGA 4RCVA 5TT0A 3OQ6A 1ZZEA 4K9DA 4XQEA 3WTBA 3EZYA 5JAIA 4RDHA 2GPTA 3K6JA 1V3VA 1YB4A 5LCXA 4WASA 3TZCA 3VC7A 4BNTA 4CLEA 5I7SA 2X23A 2D2IA 4IDGA 2E6UX 1SAYA 2VUSA 2AA3A 3Q3CA 4G5HA 3ZH2A 1R0SA 3H9QA 1A9ZA 3EC7A 3DZIA 2ZYAA 3I9OA 3TDKA 3PGXA 5EMHA 4EZBA 1RJWA 3D1LA 4M54A 5ENVA 3FWZA 3DOJA 1HDZA 1T2CA 1PWZA 2CD9A 3GEMA 4DLBA 5K0ZA 3TFOA 2NQ8A 1KC1A 4Q3AA 3ZHXA 3EK2A 4CLOB 4M87A 2GERA 1QSGA 2NVUA 3GPIA 4IDFA 4CM1A 1X1EA 3CPSA 1PQWA 3NKLA 4W4TA 3PEFA 3F4BA 3T7CA 3WLEA 4ALKA 5CDYA 2AE2A 2PK3A 1M6HA 4FR5A 1SC6A 2GN6A 1SEPA 1EE2A 3U5TA 3CMMA 5AXBA 3JYLA 5KVQA 7ADHA 2C54A 4O6VA 1MUUA 3VPHA 4Q3BA 3DAGA 1NAIA 4XQ9A 1ZEMA 5GY7A 3JQ8B 4A27A 1LC0A 4YBZA 1E6EA 5KJCA 5T67A 3EHEA 4UAGA 2VOJA 3I4CA 4BKOA 6ADHA 1ML3A 1D1TA 1ISIA 1GCUA 2PKRA 2BD0A 1KEUA 4OOEA 3VPSA 3HDJA 2DAPA 3CTVA 3STHA 3V1UA 4KDEA 1MG5A 2E49A 1YS4A 1PJ2A 4WEQA 5G0TA 1EMDA 1OZAA 4Q9NA 2C2YA 2VUTA 1DAPA 3I6IA 4BKUA 4FBGA 1H2HA 1GQQA 3LF1A 4TRRA 2GNAA 4CUZA 2RIRA 4R1SA 4D3DA 3LC7O 1QXSA 3GGPA 4GX1A 2C5EA 1Q1NA 4PVCA 3D7LA 3L6EA 3NT4A 2CDAA 2WD7A 4HKTA 2DTXA 1T2AA 3O9ZA 4D41A 1R4NA 4UVHA 1Z75A 2GN9A 3D5QA 5HTOA 1M6WA 4QSMA 1ONNA 1PR3A 3GRKA 3P2OA 5L51A 4OKIA 3SC6A 1EDZA 3GVPA 1G0NA 4XEHA 3NEPX 4NZ9A 5DBFA 4PZCA 3JSAA 4R51A 4RLSA 3K2EA 4OM8A 3WQRA 4K1LA 1P44A 1LDGA 3T7EA 1A27A 3AY7A 5T8KC 3QWIA 2FSVA 1T4DA 4A10A 4ILKA 1RKXA 5AXAA 3DB2A 3RUHA 1EVZA 3TPCA 4FPXA 4TQGA 1XEAA 5TGDA 1CDOA 5TT1A 5F21A 2JHFA 3QY9A 3ZNOA 1GEEA 5L45A 1ZK1A 4HV4A 4HP8A 2XOXA 1E3JA 1X7HA 4CMEC 3E8XA 1BXKA 3FTPA 5EPOA 4YQYA 4J16A 4J0FA 4ID9A 1AXEA 3EUWA 2HKIA 3G79A 5BSHA 4QO7A 2A9FA 4WPGA 3IDSA 2VTEA 4PLHA 4B7UA 4F6CA 3DAFA 5FYDA 4AJLA 1HE5A 3L4BC 5CPFA 3ST7A 4D79A 1VI2A 1YQGA 2Y1DA 3ANNA 4LMRA 4FW8A 3PRJA 2E37A 3H6KA 1CWUA 5HBRA 4ZGWA 3DTTA 3I52A 3DOOA 4L9RA 4R69A 3U4HA 4CLHA 1A7AA 5IJZA 1PEDA 2AEFA 4P4GA 4FC7A 3DBRB 1LUAA 5FI5A 5KCZA 4RO0A 3VVCA 4DRYA 1QLHA 1SOVA 5AYVA 3OMLA 5A4DA 1FK8A 1KERA 1GZ3A 4YJFB 2OZPA 1I3MA 3O38A 4PLTA 1XYGA 3AUTA 1XSEA 4RPLA 3ANLA 4IZIA 4JXKA 4FB5A 2H63A 2C2XA 4B8WA 5F5LA 3FCOA 1MGOA 4BNUA 2G17A 4XZ3A 1IUKA 3GEDA 3JD1A 4RQUA 4BMSA 3QVXA 5JSFA 4MJLA 5BR7A 2H1SA 4FCCA 4GSLA 3DL2A 3Q2IA 4MOWA 3SX2A 1DIGA 2GZ2A 3HFGA 4AJNA 1EFKA 4TRJA 2G76A 4QO8A 4A0SA 3U4CA 1ZXLA 2UAGA 2XXBA 3HB4X 3TFQA 5JPIA 3KLMX 1I01A 1N8KA 6LDHA 1KVRA 3FNEA 3ZHBA 1ARZA 4XJTA 3VZSA 4RF2A 3RVDA 4BVAA 2YY7A 3ZV4A 3ZWAA 2I99A 3JTMA 3NJ8A 2H9IA 1DPGA 4DBZA 1GR0A 1OFGA 5IZ4A 4HXYA 2AXQA 5JAZA 1IB6A 1PX0A 4TVOA 3TJRA 5I7FA 3RFTA 1E7MA 1WMBA 3E03A 2JHGA 1EQ2A 1UH5A 3INTA 4JROA 4S1VA 5JY1A 3JD0A 4OKNA 4AJHA 4ZJUA 2UV8A 2B4RO 3JQBC 4IBOA 4DQVA 1TT5A 2Q1SA 4GGOA 3I23A 2CNBA 4XB2A 1A7KA 1A72A 2F00A 3RFVA 3OQ1A 1E0DA 5JBIA 2NU6A 3BMQB 3BXXA 3MJCA 3IL2A 4TMFA 3DMTC 3V1YA 1HZZA 1MC4A 2UUOA 4B4VA 2O7QA 2X58A 1ZMTA 4AJ4A 4J9UE 2QYSA 5DULA 1VL0A 1YQXA 3F47A 4LW8A 3ZDFA 1F8FA 4E32A 5TRTA 1FDSA 4E12A 3LVFO 4XRGA 3IS3A 4Y9DA 2PV7A 2RH8A 4RPHA 2GRAA 4UVDA 4DMMA 3UHAA 4GSKA 1WMAA 3GNTA 1PR9A 5BSGA 3L6DA 4NDNE 5EN4A 4DIFA 4PGFA 3WWZA 4GWKA 1LEHA 1Y9EA 3MOIA 1K6XA 1P1KA 1FMCA 3W8EA 5JW6A 4URFA 1NYTA 1UDBA 3TNLA 3QWHA 4L75A 3NAQA 3OA0A 4BKRA 4EUHA 3OA2A 3QWAA 3RJ5A 4CLDA 1WW8A 2P4HX 3RUDA 2Q99A 2JFGA 1Z7EA 2B37A 4E5PA 3GPDG 2NU8A 2D8AA 4ZRMA 3WGOA 4WLFA 5I8ZA 4PLWA 5DOZA 4YQZA 4IGFA 1WZIA 1PL6A 2VNAA 3BIOA 4PG4A 3WYBA 4CR7A 3TOXA 1XKQA 1KEVA 3WXBA 4A5OA 2AQKA 2DFDA 1A4UA 1H0KA 1DSSG 2IRWA 4DUPA 2X5JO 1H9BA 1ORRA 4CM3A 1X7DA 2B4QA 4IQGA 3F5SA 3ONFA 4JK3A 4JN6B 4XQGA 3RC1A 4O0LA 3P19A 1XA0A 5A02A 5L4NA 2HCTA 1W0CA 2D5AA 4RV9A 3RJ9A 3PQEA 1WVGA 3WB9A 1NR7A 3EGOA 5THQA 2EGHA 5L9AA 1KEWA 3HDHA 4D3SA 1KY4A 1U3UA 4HFMA 5IXSA 4J1NA 1U3TA 4BMNA 2Z1NA 2EKPA 4DPMA 3ZWYA 4YJGA 4J7UA 3SEFA 3TSCA 3AUUA 2PD3A 1JVSA 2DBZA 3PFFA 4PVDA 5DT9A 4XYLA 1BDBA 3RI3A 3ETGA 4KQWA 5JDIC 4D42A 2P2SA 4RVDA 1HETA 1HSOA 3PIDA 3E6AA 4IZHA 5ICSA 4OJNA 1OBFO 3CTMA 2ZTLA 1QMGA 2CVZA 1NQTA 4KDFA 1ZNQO 3O8QB 4LCJA 4MKZA 5T8KA 5TSDA 4BQRA 2Q3EA 4YYZA 1Y7TA 2YFHA 5KJFA 3BMOA 1HYHA 2I67A 2P91A 4N5MA 1ZSVA 4BGIA 4DLLA 3BTUA 2CFCA 2C20A 3EYWA 4P38A 4BKPA 3S2EA 2X1HA 3OEWA 4AJIA 1ZK2A 3ANMA 1NQ5A 3KV3O 3DQPA 3H2SA 3RWBA 1P1FA 4DPLA 3S1LA 1HDOA 2EHDA 2X4GA 4CMEA 1BDMA 1SB9A 4MIYA 4BO2A 2J6IA 4YT4A 1G6KA 1B15A 2AG5A 1R0KA 5ITWA 5IN5A 3OF2A 3W4IA 5JE8A 5ES3A 3D0OA 4UULA 5T64A 3DFZA 3M6IA 1VM6A 2VTDA 4FFNA 2YJZA 1C1XB 4ZRNA 4YAEA 1IHYA 1D4FA 1CERA 4PG6A 4CQLB 3KEQA 2ILTA 2VWHA 5I7EA 3ABIA 4DBVO 5B4TA 4CM4A 3A1NA 3IC5A 1BMDA 3L07A 1R4MA 4CMBA 3GY0A 2X9GA 3Q1LA 4ZQEA 1RYEA 2H6EA 1N5DA 2GDZA 3BHIA 4B8ZA 5KVVA 2QRKA 3H9UA 2BGMA 1ENPA 2HRZA 4GH5A 3PFWO 1IYZA 4XKJA 4H3VA 4HFNA 3N74A 4I9UA 1PL8A 4MKRA 3WGIA 2HMVA 3WG9A 1IL0A 3L77A 1L7DA 2DT5A 4PLVA 2W4QA 1UDAA 1RWBA 4CMJA 3ZU4A 2V6BA 1E3WB 3GFBA 3K31A 1KY5A 1PZHA 4PIVA 2HMSA 3VTFA 3C1AA 3KSDO 4BO9A 3O26A 1E3LA 3KSUA 2CF6A 5DNAA 2GN4A 2VQ3A 3DMYA 3I3OA 2I65A 2NADA 5FF9A 2C82A 5KJ1A 1DB3A 4BNNA 4YAIA 4KUEA 4U0JA 2Y1GA 4CQMB 4L4XA 4DVJA 2B0JA 3HE3A 5A5EA 2Y0EA 4F45A 4CLRB 4YAGA 2GN8A 1A4IA 2FPGA 2ZCUA 4MP6A 3GC6A 2QQ5A 4E31A 2G1UA 3WBBA 1P45A 4KP7A 2WD8A 3GVHA 3WGTA 1GTMA 4JJFA 3VPFA 1X13A 3B20A 3DBLA 2CMDA 2TMDA 3IUPA 2O3SA 1UXHA 4FD3A 4E21A 4RDIA 3G1TA 3R1IA 1UP7A 5JCXA 1Y9AA 4GBJA 2JKVA 3QHAA 1QYDA 4K6FA 2G82A 3VAZA 3OJOA 4ZQBA 1SEVA 3RKRA 4DC1A 1KVQA 1XWFA 5G4LA 3ORFA 1IZ9A 4FSHA 4FDAA 3JQAB 2EERA 3UUWA 1ZVMA 1VJTA 3C1OA 3DBHA 4HX5A 1C14A 4EJMA 2R6JA 3SVTA 2X0JA 2AW5A 1UZLA 3NTQA 3ZI0A 3ZWCA 2DTEA 4BNJA 4BNWA 3E9MA 4O5OA 3WR5A 3MTGA 4RPKA 4WNCA 4R9RA 5DBGA 3JQGA 1B3RA 5A06A 1O5IA 3AFMA 3QSGA 3Q0EA 1UDCA 1LDBA 3JYNA 1R37A 3M2TA 1DRWA 2I3AA 3CXRA 4IS3A 3UXYA 1UP6A 1BW9B 3I6QA 4WLNA 1I32A 4FOOA 4OMUA 1IHXA 2IZZA 4D7AA 3H2ZA 2DUUA 1DLIA 3GF4A 5KNLA 3E48A 4LSMA 3G1UA 2JCVA 5CG2A 3NT5A 5H83A 3V2GA 3LYLA 2YUTA 2UDPA 3ZNQA 4NMHA 4A26A 4HUJA 4ND4A 1LSOA 3GRPA 1OI7A 4E30A 4JCOA 4I9NA 2FOIA 2J3HA 1AE1A 3PYXA 3OECA 4AJ2A 2RBEA 4DMLA 3RUIA 1H6CA 3OJFA 1VL8A 5IZCC 2RHCA 2ZTVA 4BO8A 3ENNA 3W6ZA 1HDCA 4QFCA 3PLRA 1AUPA 2HJRA 5EJ2A 1PS8A 3ONDA 1P77A 1M76A 1GZ6A 3VZQA 4L76A 4MVJM 1P0CA 1Q2XA 2D59A 4QTZA 3M1AA 1ZO8A 3UAGA 3COSA 1ISJA 3JD4A 1Z74A 2AEJA 3RBZA 3SBOA 4RVHA 1IOLA 5A9TA 4KTVE 4CL3A 1DHTA 1KETA 2Q1TA 3FSRA 4GLOA 4DXHA 4OYRA 1AGNA 1HLDA 4IQ8A 4ALMA 2QZ9A 1MLDA 1P1HA 2YFQA 1QYWA 3Q9UA 5DOVA 5I9MA 1XU9A 1DFGA 4FFPA 4QX6A 1NHWA 5BT9A 4WOKA 4LCEA 1I2BA 1U7HA 2DPGA 3GAFA 2Y67A 3W4JA 3ZWXA 1O8CA 3K73O 3ADPA 1EUDA 2A92A 5JDIA 3L9WA 1XCBA 2Y1CA 2B69A 4EEZA 2EKQA 1X15A 3VZRA 3UOGA 1BVUA 3F9IA 5JXWA 3DZGA 5MGBA 3CH6A 1N1EA 1PGPA 4Q3EA 4ZICA 1E7YA 1XHLA 4BV8A 5EL0A 3MJSA 1RYDA 1BG6A 5ILOA 2X9NA 2NTNA 4MVJF 1SBYA 2QHXA 3RFXA 4GAEA 4JQCA 5KKCA 2GF2A 3KLPX 3ZWNA 4XDZA 1HDYA 3JD3A 4N5NA 1YOVA 1BXZA 1LLCA 2WYWA 1K2WA 4YJHA 2YV1A 5TLSA 4BHTA 3WIEA 3AU8A 2WMDA 2GASA 2OMEA 1SO8A 1CIVA 1ZKMA 2AE1A 1WAMA 2DKNA 3BTSA 4EW6A 4YWJA 3CZMA 3IUSA 2WYUA 1T1RA 3PQFA 1Z82A 1ZBQA 2R2GA 1HDXA 4U0KA 4U6SA 1WP4A 1KVSA 4EDFA 3OM9A 5L7YA 4H7PA 1R16A 3AU9A 2EWMA 1BGVA 1EE9A 2OXIA 4UUMA 5IDWA 5G0SA 2JD1A 4B7XA 2WE7A 3RUCA 3QVOA 1OOEA 1C0LA 4NJOA 1WLYA 3E9NA 3PHLA 4TROA 4AJJA 2VHYA 3PGJA 5GZ6A 1NAHA 3OJ0A 3VKVA 4EYEA 9LDTA 5L53A 1E7SA 4M55A 5EIOA 1WWKA 2GD1O 3WMWA 2CZCA 1MXFA 4YEDA 2I3GA 3OFSA 4EJ6A 4IMRA 2EXXA 2HMUA 5FFFA 5DF1A 1PJLA 1RPNA 1GD1O 1GCOA 4QT0A 3MCVA 3U62A 1B8VA 2YHUA 1MX3A 1R4NB 2Y1OA 1H2BA 1HWYA 1E6WA 3IKVA 5IG2A 4YJDA 4Y6SA 1A5ZA 3H8VA 1F14A 2ZB8A 1Z6ZA 2F1KA 3A06A 2DPHA 3ZU3A 3ROMA 3KHUA 1EUCA 3LC2O 3ZV5A 3VPGA 1AN9A 1YB1A 5IDYA 4XGNA 4BMVA 5COAA 1GQ2A 4L74A 1YDWA 1YL5A 3AY3A 4IQ0A 4AJ1A 1K3TA 4D0RA 5FWNA 1GYQA 2R00C 3WFIA 2GR9A 4DA9A 3KYCA 3MJ4A 4J6FA 1NTOA 4AG3A 3KBOA 4FFRA 5AQ1A 5KIAA 1HYEA 3ZU2A 2JJYA 3WFJA 4B4UA 1Y5RA 2B5VA 4CV1A 1JVBA 2Y93A 4EBFA 2ZK7A 4AICA 4DIOA 5A5FA 4AFNA 1H93A 3H9GA 1BXGA 3GGGA 3RD5A 3UCFA 3QP9A 1BRMA 3PDJA 1LA2A 5EQFA 1MG0A 1OMOA 1PWXA 4W99A 1XQ1A 2BKAA 1U28A 4WCFA 2O50A 2X5OA 3RC7A 3BHMA 2C7VA 3B70A 1DFHA 4L8VA 4CLOA 4NI5A 4WLEA 3WWYA 4M49A 2FZWA 3CINA 2Y0DA 4WEOA 4CMCA 1KVTA 3TL3A 4DWVA 2Y1FA 3F5QA 4L0QA 4EI2A 1YL6A 2PKQO 3LF2A 2IXAA 1E5QA 3PWKA 1GPDG 2QZZA 1XQ6A 4DLAA 3AI1A 4FFOA 1UXKA 1T26A 4R16A 4KWHA 4LN1A 3R6DA 1XR3A 4RVUA 1NWCA 2VWQA 1TI7A 5JC1A 2EEZA 3JQ8A 3NUGA 2SCUA 2NVBA 3NGXA 1PJQA 5A04A 1HLPA 4LVCA 1WDLA 1ZH8A 1SPXA 1PGNA 1IULA 1F8GA 3OICA 4CM5A 3ITDA 1QV6A 3PJEA 2JD2A 3LK7A 1JDJA 3E82A 1GYRA 3RQSA 2D5CA 1B0AA 3FNHA 3D3EA 3DR3A 3AM4A 2IODA 1DAOA 3JYQA 4B3JA 3TN7A 3GFGA 1BSVA 3FWNA 2I66A 4A7PA 1DIRA 1R6DA 3GEGA 3GMDA 4IJVA 2HU2A 4R5MA 4E4YA 4IINA 1WDMA 3GHHA 4TRMA 5IZCA 3ULKA 5G0UA 1CEQA 1PJCA 1UUFA 2HO5A 4MDHA 2WEKA 2WTBA 3IJRA 4NHEA 4NU5A 1E5LA 1LSJA 1LU9A 2PZJA 1G0OA 4XCVA 3BTOA 1EFLA 3K2BA 3C85A 5AOVA 2PWZA 3AFNA 2OBNA 5AVOA 1GV1A 3BMNB 1XG5A 3R0IA 4GLLA 2NWQA 4CLXA 4Y98A 3WNQA 3ZV6A 2Q50A 1WZEA 1IY8A 3GDGA 3R3JA 3P5SA 1QV7A 3CUKA 4KMSA 1IE3A 2Q49A 2V6MA 3LDHA 1MXHA 1ZK4A 2VYVD 4R54A 1GQYA 2ZTUA 4IDEA 2A35A 3WDSA 3ZWBA 1ZJZA 2FR1A 4Z0TA 1ISMA 2IDZA 2Y99A 2I5PO 1VE9A 2D4AA 2C07A 2FHSA 2O3UA 5IFLA 4R41A 2BFAA 1GL3A 3D5TA 1ISHA 5K9ZA 1U8FO 3C7CB 1P1JA 2QIOA 5G2OA 2B4TO 2V6FA 4GMFA 1DC3A 1FJHA 1V0JA 3CE6A 2W8ZA 4CODB 4J4HA 2J3KA 2O3JA 3OIFA 1ZFNA 4FS3A 4PCVA 3OH8A 3ROQA 3TZKA 2XF8A 5CHEA 5T57A 1T2DA 4NBRA 2PFGA 1JWBB 4NIMA 3GVXA 1QG6A 4RF3A 4GGPA 4FJ1A 4E13A 4FC6A 4BO4A 4FGWA 5L95A 3BTVA 4GWGA 3OIGA 2EJVA 3KUXA 5ILGA 4P4LA 3WGGA 2WJPA 1E1LA 4M86A 1I2ZA 3PYMA 5U1PA 3V2UA 4WGGA 4BO6A 3LZ6A 3DBRA 1YH3A 3RBXA 2EGGA 2C0CA 2JFFA 2PNFA 1GY8A 1LRLA 4YJFA 1EK5A 1UXIA 1ZIDA 4J2HA 1C1DA 3LLSA 4A03A 2O3TA 3HFSA 3NDIA 3VDQA 1YQDA 1F0YA 3D4NA 3WGZA 2NU9A 1RM4A 2ZB3A 2H5LA 3DXFA 3BMCB 2D3TA 3SJ7A 4UVEA 2QG4A 1LRJA 1EVJA 2FSSA 1HKUA 1F12A 3B1KA 4JP3A 2PGLA 4KUHA 3GR6A 3DZJA 3KVOA 2EP5A 1JAYA 3LSYA 4LMPA 4BNMA 3HN2A 1XGKA 4E0BA 4G2NA 3QW2A 1ULUA 4I5EA 4N7RA 5ADHA 1DIBA 3FR7A 1LLQA 1T2FA 1YL7A 2W2LD 2FWMX 1CYDA 2FZEA 2VT3A 3HNPA 1UXJA 3VHRA 1ONPA 2P5YA 3D4PA 2WDZA 4KQXA 3KXDA 4GX0A 4XIYA 1NPYA 2A94A 3I1JA 3DTYA 4IIUA 3G17A 1PL7A 3GA0A 4YRDA 1UP4A 3PDUA 5CDSA 1B8PA 1Y8RB 3DC2A 2YQ5A 5U4QA 3ZZNA 5KVCA 2R00A 1JKIA 1W6UA 1FXSA 1EUZA 3E9QA 4BNYA 4WLUA 4QUKA 3LLVA 4BO3A 1VKOA 2FMUA 3BMOB 3VOSA 1CJCA 2QYTA 3BMQA 4XRRA 5C7OO 1HL3A 1HYGA 1J5PA 3DWFA 3GG9A 4U7WA 3DOCA 1CF2O 3G0OA 3A14A 1ZSNA 2NACA 3UH1A 4DGSA 2Q2QA 2V7PA 4PN3A 1GEGA 3GGOA 3JQFC 5CEJA 1EVYA 1B8UA 3DZBA 3UVEA 5B1YA 1P31A 2YYYA 4MINA 2ZJ1A 5LDGA 3JV7A 4KUGA 4BOYA 2DVMA 2VWGA 3VDRA 5JS6A 2IYOA 1Y8QB 1KC3A 2C5AA 4ITUA 4E2ZA 1LQTA 3QWBA 4AJPA 5KTKA 1JU9A 1CQIA 4R4JA 4JBGA 2X6TA 5I9NA 1LC3A 2A4KA 3IKTA 2HSDA 2DBVO 4H15A 4W7HA 1ZJYA 3IAHA 3C7AA 3KETA 1VPDA 4NBUA 3U0BA 3UICA 5BNIA 3JD2A 1V3TA 1Q7BA 1R4MB 2BFPA 3V2HA 4XD2A 3Q11A 5JMWA 4MIEA 5TJHA 5JNLA 1JW9B 4IGEA 1QRRA 4LISA 5G0WA 1ENYA 1YO6A 2NQTA 4YTEA 3Q2KA 2B35A 4IS2A 2VZ8A 1B16A 2P9GA 4PRKA 4D46A 2V6GA 1GUZA 3I83A 3FI9A 3B1JA 1VJ1A 5KJEA 4AVYA 1X1TA 3HJAA 1QYVA 5AXDA 1S7CA 3ADOA 1GU7A 4M8SA 1PQPA 1Z45A 4B3IA 4LRSB 4XYMA 3ZNPA 4MVJE 2BFOA 4RPGA 4BNFA 5JCJA 4GVLA 3L4BA 1Y81A 4P8RA 5CDGA 1YDEA 2W2KB 1DO8A 1K6IA 1Q0HA 4CUKA 1CRWG 4E6PA 1H9AA 4I9HA 1NX6A 1ZK3A 3QQPA 3WYEA 4YT8A 4NQZA 4CMIA 1LDEA 4UUNA 3D64A 4X54A 5I9LA 1PGJA 1PGQA 2WM3A 4NBVA 4FFLA 4OGWA 5TQVA 5EQDA 1C0PA 4Q3NA 5ER9A 2OFPA 3QRWA 4EGFA 3PHJA 3QJ5A 2PKQP 3FPLA 4NJMB 4B3HA 3G3EA 1QP8A 2GUGA 1LQUA 5EERA 1MFZA 1DJNA 3ZGYA 2O2SA 1NPDA 3A9WA 1KBZA 4QFDA 4UEKA 2YDYA 3CZRA 3D3WB 3KZVA 3OJEA 4DL9A 2QRLA 1LDNA 1O94A 2Q4BA
chains in the Genus database with same CATH superfamily
4LYAA 3WGQA 5T6BA 2VDWA 3WBFA 4E22A 4B1FA 5LA6F 4LDJA 3QMWA 4WE3A 4F8YA 3HS3A 4BNKA 4EY8A 1K0FA 1CNEA 3HO6A 2RI0A 4Y9TA 2E6KA 3W3AA 3MTIA 2IBSA 2MR6A 4CDMA 4QBKA 1KYYA 4DUGA 3B85A 4DB2A 2DFVA 2OQRA 1PGOA 2QP3A 3W2FA 2AKYA 1XXLA 3DH0A 4M6WB 4DAOA 3CVUA 5JD6A 2EFEB 5GINE 3EUFA 3SS7X 5FR2A 1PRYA 2P9EA 4A82A 1BFKA 2XAAA 4L8YA 4I9FA 4F72A 1NQVA 1ENOA 3E1SA 3ZWVA 3AIMA 4X1KB 4DQKA 3UXMA 3W5SA 1EFPB 1FBNA 2P3OA 3RC2A 1C1XA 4G09A 4PR3A 2OGSA 1DZIA 2RAFA 5K2OA 3WGLA 1JAXA 3ZOKA 3S2SA 1Z6YA 2MINB 2ZYHA 3INRA 5AI0A 4BEWA 3HLYA 3W5UA 3CM0A 1TEXA 4INPA 4BLPA 4KRFA 2QVBA 3PXCX 1YFLA 2O48X 4CV3A 2JGDB 2C1XA 1N77A 3EPHA 1MV8A 4RK0A 1RWPA 3BGSA 3HKDB 4M8KA 1ONOA 3F46A 3DMTA 4HYQA 5EYPA 2PRYA 4AJKA 2R6R1 4TVBA 4XLTA 3X2SA 1XNGA 1YXMA 1WSDA 3STXA 4C76A 4HEJA 1V3QE 1TO6A 5BWMA 4YCLA 3JQ7A 1Z5PA 4D9HA 2FEXA 1FVFA 4CL3A 4KNYA 4DA0A 5KTYA 5A4MS 3SJCA 2VHZA 2BP7B 2WLSA 1BYUA 4JL8A 1TZBA 3ZXYA 4WGFA 2NT4A 2ZIXA 4D8YA 4URXR 3NEAA 3ZD7A 1EBFA 3ISJA 2BMWA 3K8ZA 4OAQA 4QEDA 5E2IA 3RJMA 4H7KA 1B2LA 1R8JA 1M75A 1XZFA 3DLTA 4EATA 2FXVA 4IDOA 4HPJB 4AO7A 5C1PA 2LKCA 5FBVB 3ITKA 2F48A 4FBMA 5AI9A 4D2IA 5IHPA 4DZTA 1RCUA 3LLCA 3AVXA 1D1QA 1WPGA 5HM8A 3KQUA 3IEVA 3V1LA 1Z0JA 4C1BA 2P3SA 3AETA 2G5CA 2AMFA 2Y68A 2GJ8A 2ZIAA 1MA0A 2POQX 3IO3A 4M1ZA 5TPWB 1NP3A 2WJIA 2XT9A 2LCFA 3NB0A 5IRCD 2DWQA 1KY2A 3QBTA 1TYCA 2BCGY 3GZ4A 4TVKA 4W8OA 4LXQA 3F90A 1SWVA 3ZQUA 1M2JA 4ALLA 2G8LA 2V7TA 5KOIA 2E4YA 4GXTA 4K46A 5HA5A 4MV0A 2B2XA 4V0QA 1TKRA 1UODA 3RARA 4DHEA 3H75A 5A4KA 4OOFA 1JKFA 1M54A 4IEFB 1I7LA 1QHGA 2TMGA 2ZVJA 4M8NE 3C3CA 3JVEA 1PKXA 4XYEA 4EA7A 3GFFA 1RSZA 1JZSA 4PG7A 1EUDB 1K3FA 4GOND 2OGUA 4TYQA 3INGA 3SZLA 1E6CA 1E7RA 4HQ6A 3RSFA 1GSOA 3SX0A 3MWDB 1J0XO 4IDPA 4EL0A 3DUWA 1UZNA 3DVAB 1YZTA 3OX4A 2RKBA 2Y71A 5HS6A 2W2VA 5JANA 4IX1A 3MWKA 3MNFA 3UB4A 5H1YA 3JYPA 3ZHYA 4RF4A 3NVDA 4R2HA 4BRZA 4IDDA 2PXCA 3GL9A 1L4MA 1E6LA 3OSZA 1G4AE 2FRDA 2H5EA 1WUHS 2XKKA 2DSTA 4NJEA 3TRHA 2X2OA 2HLNA 1PBTA 1RWQA 2WWRA 3O8LA 3PXEA 3GLVA 3KJXA 1W2GA 1XD2B 5BYJA 2R8ZA 3TEJA 1OLUB 1U98A 3NORA 1DKLA 1K08A 3OWOA 4L7QA 1ZRSA 3THYA 3EVZA 1Z73A 4ID3A 4ZU6X 1KEZA 5KWJA 2PE5A 4FR0A 2X13A 2HTEA 2A9RA 2FXIA 1YU9A 4ZT5A 5KQPA 2YMPA 2PXHA 3NTOA 2FMHA 1U7TA 2XYPA 4WY5A 3I4FA 4QAQA 1O9BA 4MVJG 3U61B 1ULZA 4GX5A 1A9RA 4I08A 2BGUA 3FBTA 3VUEA 4DY6A 1XHFA 4RIEA 4MYTA 1AQYA 1B00A 1PJBA 4A8TA 3LUGA 4OQFA 1C80A 3O90A 3ZVMA 4LF6B 2P9QA 1GZVA 5DHFA 1D03A 1NQAO 2RH9B 2C4UA 1M9NA 1X0XA 1MJNA 1NWHA 1XZHA 3CLRC 2VHXA 3DE2X 3DTVD 3DVSX 3LXUX 3H0CA 5CM2Z 3CMCO 3FPFA 4JFAA 3AUJB 4YUVA 2H4XA 5JZMA 5IHXA 4YIKA 5C53B 2YZGA 3NTRA 3HCRA 1ZEJA 4IZOA 1PV2A 4IF4A 5BWCA 4YRJA 2NVUB 4HVLA 3WAGA 4CEIB 1UJMA 1L4KA 2XMPA 2I2DA 4IHKA 3MJEA 2OA0A 3B3JA 5AT1A 5ALVA 1U9JA 1AURA 3OIDA 3TZLA 1ISGA 1ISPA 1HSZA 4YRGA 4HTFB 5HF9A 2RJOA 3BKXA 3O03A 4OMFG 1AS0A 1T4CB 3ZGXA 1ODJA 1I14A 2G36A 1XJCA 4OQYA 2BT4A 1YVUA 2QP4A 2XCOA 4NCHA 1NR1A 1UWKA 4BGVA 2JCXA 2JNWA 1N2CB 3SC3A 4EQ6A 4LS3A 3LWDA 4AG6A 4PRLA 5LYYA 4EFNA 1VXRA 4CM6A 5ERGB 4MW1A 1BKSB 3NTXA 3FMPB 7YASA 3K16A 3NJ4A 1DJMA 1E1NA 1OBOA 1TC1A 1Z08A 4MR7A 3SKXA 1JU4A 2FSFA 3M82A 3ZDYB 4GQAA 2R79A 1AK1A 3O3NB 1N9GA 1EHCA 2BDUA 3FW1A 4X0EA 5JC8A 1JSZA 3QEJA 2ZW9A 1Z47A 2XXJA 1HDRA 1ZKDA 4RF5A 2ENUA 3NBZC 4INOA 2YBDA 2TSYB 4LWQA 4LYYA 3FF1A 2L82A 4ON9A 1FNDA 4ZK2A 2YS6A 3W04A 1ETUA 1RLOA 3ZYZA 3IP5A 4F2WA 4ACAA 1XMVA 2ZRFA 1WCIA 1ACJA 2QX7A 2NV2B 4M7WA 3O74A 3M0EA 4HQLA 4TWBA 1OHHD 3WRYA 5T5QA 3JQCA 5E95A 4R01A 1VRWA 3FH0A 4ZDIA 3KPYA 3OJCA 3C98A 1K4YA 3QITA 2QQ0A 4MCJA 1IMOA 2LIPA 2Q1UA 2QSZA 4I7EA 4K1XA 4WNIA 3RVKA 3ZWPA 1OZGA 2HHLA 2O6LA 1ZIXA 2AQHA 1B0PA 2AWNA 2B36A 2ZE5A 3S2UA 4WCFB 3PWSA 4CV0A 3DPSA 1N25A 2FGKA 3AP3A 1GDTA 1DIHA 1BN6A 2Y4OA 3OT1B 4CDGA 3QXXA 4JLSA 3OPYA 5A9SA 1XQWA 3EVAA 1JSXA 2QT1A 4X8HA 3WLSA 4IO0A 1IG0A 2J5KA 1DEHA 3HFJA 1O0SA 1M6VA 2UUPA 3X1XA 1BOOA 5JJ5A 2UZ4A 1O6BA 3QVTA 3TMYA 1QQAA 1GNVA 2PX6A 5FBZA 2ZRQA 5CEEA 3BERA 4KJZA 3G02A 4WLVA 5DI9A 1P4RA 1BXRA 1U5CA 4RWZA 1P1IA 3C3AA 4PU0A 4B35A 1H6BA 4JYZA 4BX3A 4DMRA 2CJFA 4HDMB 4XD7A 4XWYA 1JF8A 1PT5A 5JUWA 3CF0A 4ZVOA 3B51X 4KZPA 4Z9BA 5EWMA 4HUTA 4KPYA 1Y5IA 421PA 2PRSA 5ARCA 4G81A 4CT5A 3PQ8A 5K6AC 3F5DA 3FA2A 4G56A 3ZHTA 4EW2A 2AEEA 3SKYA 3H2BA 2WWYA 1CIJA 3IMEA 3RTBA 3EZXA 3P0FA 5E6RA 5BWBA 1I94B 1FDWA 1AQNA 2XLCA 1TF2A 2W6OA 1AMUA 2O2JA 2HRCA 1DEXA 1ORTA 1MNAA 3C6BA 1XU7A 5FWYB 1FC0A 3NIFB 3V97A 1KQPA 3WLTA 1XOIA 2VQ6A 2ZT7A 5FEMA 1V9LA 1UQUA 3H65A 2NV6A 4LY6A 1LPBB 4L5BA 4YJ3A 4LZJA 1N1DA 3L0SA 1CLUA 4NK4A 3AVYA 4POAA 5AK0A 1NC3A 1NBHA 1TF7A 4BB5A 4AY5A 2HK9A 2C3YA 3OY2A 3FVVA 5JVDB 3EPKA 2GYYA 4IXMA 1W52X 4FDUA 1L5HB 4LYJA 5FPTA 5AXCA 3U13A 3WJ2A 3GP3A 4BFSA 4BJ3A 1UJBA 2OUKA 3I28A 3PNVA 4ZCTA 4OHBA 4MQUA 4RGVA 4EG0A 4EUSA 5L40A 3TIXB 3EVTA 3HVKA 3KSAC 3LK6A 1U0SY 1SRRA 3RF7A 5IABA 3DCYA 3TQHA 3NDJA 1HZJA 2WWWA 5JLAA 2ZZKA 1C3LA 2YH2A 3BIWA 2AYYA 1CUWA 4RQAA 2ZSHA 1LBSA 2QN2A 3ZE0B 3AZOA 2CUKA 2VWPA 4JBLA 3B8EA 3ONEA 4G37A 1XMIA 2J3IA 2GEDA 3HA3A 4KWEA 1FEZA 3OE7A 4L4YA 1L7EA 1NVTA 4BE9A 4DKXA 4GR5A 3C45A 4JBWA 1J9GA 4EARA 1PI3A 4U9HS 4C4OA 1NFRA 1POWA 3ED1A 4KO3S 1V26A 2M98A 2QTFA 2F9MA 1HTTA 3FUTA 1L5QA 3PNKA 4RGBA 3HNOA 3ZY2A 3IUQA 3FMOB 4OQQA 1OLXB 1I0ZA 4DREA 4ZMBA 1HDGO 1OWPA 4QA9A 3ZGOA 2M6RA 2ZCVA 5LQMA 1VRCA 1ZLYA 1LW6E 2AMYA 2QORA 1RZ3A 3GLKA 3MC1A 3Q6IA 3TB4A 2G9RA 2YMQA 4MPJA 3T12A 3UWKA 3QGMA 4EHJA 5K6RA 4Z4EA 1NYQA 3W1VA 1GUYA 1IPHA 1R6UA 3TCKA 1OB2A 1QZTA 5GJVC 4NULA 1H8ED 3C4QA 1H2YA 1TUEA 5DEIA 5LOVA 1XIVA 2C88A 1MVLA 2M32A 1FMTA 1N36B 1TM4E 5AUOB 1B42A 1TTTA 4YRAA 4HEHA 2B6HA 1CQJA 4M76B 3NRCA 5JH7B 4WLOA 4BBAA 2GZ3A 2EZ4A 4J0IA 3N3AC 9LDBA 2NNWB 2X15A 2W2LA 2C4MA 3L18A 1F6BA 3V1TC 1Y1TA 3CZPA 3OPYI 2B7CA 1IY2A 4GKBA 2GILA 3P9CA 3CUYA 5LWQA 3GLFB 3LECA 4CPDA 2L18A 5JDCA 3QVVA 2AH5A 4BBZA 4RJTA 1A9XB 3KOWA 3NC1C 1EP9A 1US8B 3PHIA 2AG6A 1C3VA 3VPXA 2MYNA 1AK9A 5H16A 4EITA 1DDOA 1HEUA 2AJCA 2H85A 3FSGD 3WMXA 2VYNA 4DC0A 2WNHA 4NPCA 1D2NA 1I80A 3R23A 3QU5A 4DM3A 1I0LA 3GK3A 4X97A 1GPWB 1TMGE 4X90A 5BRNA 4IIEA 2HK6A 4A9AA 3B6MA 1UEIA 1SY7A 2DPLA 4GPD1 4QDUA 1NUQA 4W5JA 5I5GA 3IUYA 2PTGA 1AQUA 3A27A 3PPXA 4R81A 2EL7A 2QBYA 2QZ4A 3V8RA 2YZ7A 2BONA 3Q1KA 1KO4A 5DLPA 1C1DB 3CNHA 4G1UC 2NZ8A 5COQA 5TMBA 5JCOC 3K5WA 3E9CA 4HDNA 2GVDC 2OORC 2GJ4A 5KYUA 3HWWA 4Y30A 1U94A 4B33A 2RG1A 5BW5A 5IXYA 2Z5GA 3K96A 2EW2A 1S6YA 4B8YA 2B4KA 3F71A 1MABA 4ZVQA 1O87A 4XPIB 3VNBA 4F4IA 3AOEC 4R1PA 4K88A 2PD4A 4FCWA 4PAQA 1P1BA 3QPAA 4O4IA 4PQYA 5B1IA 3TOZA 4QG7A 4KFTA 2FUCA 3HUDA 1E7QA 3KKMA 1RAGA 4PX2A 4DDVA 3GQVA 4GYKA 4GKVA 3S2FA 4CZ2A 2R97A 1ZRNA 2LV8A 3OZSA 1M73E 1NYRA 2YJTD 3ZJ4A 4DUYB 3ZWWA 1LS6A 2BGKA 4RX1A 4YAJA 5E7IA 3WGYA 4DR1B 2J46A 4KQKA 1Q2UA 1R5NA 2PZFA 1Z7BA 2WWHA 3JWIA 3X2EA 4CG1A 3UMGA 1I30A 2VS1A 3F1KA 1S2MA 1YZQA 3PLNA 1NE2A 1M2OA 1CY8A 4FOTA 3VKWA 1K7CA 2FEKA 2G71A 4I4NA 3RK0A 3UW1A 4P5DA 4R2KA 1PIWA 1ZNXA 4H6VA 1EDOA 2Q8NA 5A3JA 4I19A 4G1CA 1MENA 2IY7A 4QLBA 4HNVA 3WK9A 1STOA 4DW8A 5KTTA 2BI7A 2J30A 2IL1A 4HADA 2F7SA 3D7KA 2QUKA 2PU5A 4DAEA 2F6RA 4LE0A 3K5HA 1JHOA 3JAKB 5TMPA 2DKOA 4RM2A 4A2CA 1O2DA 2AXNA 4CMKA 5G1OA 3NI2A 3ROPA 2P68A 4XIFA 1KO5A 2IE8A 2XX3A 4PLZA 4U5QA 5KI6A 1VFNA 1EX1A 1OFIA 3BA1A 3A10A 4DLPA 2NG1A 4F5DA 4DCCA 3IUMA 2FK7A 2YN4A 4AJEA 4Q4LA 1A7JA 2JFXA 3JZMA 3LUCA 2PH3A 1FQJA 2OO3A 1D1SA 2ODEA 2W93A 1T9GR 1WD5A 1XZLA 1RHMA 2NSYA 4YH1A 1IZ8A 2WHPA 4IUYA 1RE0A 4RFVA 1P91A 3MJFA 3WK4A 2J8ZA 3JALA 2KBEA 5IYZF 4U2KA 2PIDA 5DFAA 3QTBA 1X19A 2C83A 2D5LA 2CVHA 4H1VA 7GPBA 3FB1A 4PCUA 4D3FA 2LKDA 3LT1A 2PPVA 4KO8A 2QE7D 4N8EA 3RVRA 1XZEA 4BNIA 3L0OA 5T4EA 4Q00A 1Q15A 5LB2A 1FY2A 4N1AA 4FHEA 3SXPA 5BQFA 4DCPA 3CX7A 3PZRA 3WLHA 2CN1A 3ABSB 2XCRB 3UAVA 1KZ9A 4B83A 1EQUA 2I4TA 1BX0A 3F5FA 3BK1A 4K6OA 3RYHB 3RRZA 4FJ0A 5KNCD 5TMEA 4D44A 1KY3A 2QE6A 4MS1A 3BJEA 2IGBA 1FBTA 2PMKA 1I33A 3WI7A 4IPTA 3KO8A 3ROTA 1DRVA 3RAGA 5EHNA 3ICCA 4PBTA 4X7MA 1Z0AA 5CIWA 1UAAA 3DPUA 3E5MA 1PR1A 2PFKA 1MHPA 5CAEA 5IT5A 1HFKA 2AS0A 3A3NA 3BN3A 2OLKA 3N59A 4MP8A 1SKMA 4BC0A 5EA2A 3DL0A 5GOTA 2P67A 5F3RA 1J23A 1AM4D 2WR8A 3C3XA 4C7MA 1NJ8A 3DD1A 2BGRA 1H3NA 3F49S 4B3GA 3PP8A 3O8OA 1D7OA 1U4OA 4NYIQ 1LDYA 2VQSA 1T25A 2OL4A 1DDIA 3V33A 2V74B 3S81A 1O08A 4HSEA 3EQ7A 4OSPA 1FYXA 1TEVA 1CPYA 3TJZA 3VKUA 1H4QA 1XMJA 2B78A 3OOJA 3P9IA 4NYIR 3TPZA 2J3QA 3F6YA 1FS5A 2QI9C 3HKBB 4QGAA 2H2DA 2OCDA 3B82A 2P9CA 2QR2A 2GPBA 2MSCB 1YCFA 2JLRA 2Y05A 4QHSA 4QPZA 4A2WA 3IAAA 3GFVA 1LQ2A 2JIMA 2Q7XA 3Q8KA 4KR7A 4YP1A 1T24A 1DJQA 5IT4A 1J9ZA 4HX9A 1G38A 3S4YA 4UEOA 6ABPA 4F85A 3R9XB 1H1DA 1KPIA 3GAZA 3JQ9A 3ORRA 4KTTE 4E15A 4WT7A 1U5AA 1WVIA 3N8DA 1FLAA 1IJKA 3TB6A 3AR5A 3A9UA 3CW8X 2G3YA 3FNGA 1ZQ9A 1IBCA 3PC7A 4U2GA 3ZN2A 4JI4B 3UTCA 2KSQA 2X8LA 4KG7A 2PYZA 4LRYA 1RZUA 4LOIA 2FRVA 4WKOA 5KOJB 4G0VA 221PA 2Q45A 4GP7A 1OGIA 4H77A 4JP2A 1LNQA 5CGZA 2LVBA 4DMUB 4DJDC 3Q4GA 3ZGLA 3Q2OA 2VPWA 1E1CA 4ND3A 4WK6A 5JJBA 5CDUA 2WTEA 1KKUA 1JHVA 3KEMA 1HE3A 2GNOA 4HS9A 1QHXA 1XL0A 4IMIB 2ZPTX 2NN3C 4YDSA 2DHCA 2XVYA 1LXCA 4QECA 2CMFA 1IWPB 1HNZB 5B1HA 3KZMA 4L4UA 4QNRA 2XQIA 3TW4A 1SCIA 4UAJA 1P1RA 3GJ3A 3W34A 1EG7A 3RBAA 3B2NA 4CMHA 4EJSA 1X9GA 3LPLA 2CUZA 4Q1VA 1RAIA 4CMAA 1QIEA 4P7FA 4P3NA 2R85A 5C5IA 4LMAA 4MJXA 2FX2A 1DOHA 4UW9A 2K2QB 3BXFA 2W48A 4FGSA 4LF7B 2MHCA 3USES 3V6LA 2D2FA 2VBIA 3RT7A 4GLFA 2NYRA 4BBPA 1GPJA 2XBMA 1E3MA 1JDSA 4CG2A 1N1GA 1C9YA 1EZ4A 1BS9A 1D5WA 3I5MA 5HF8A 5DASA 1H1LB 2AB0A 1J8DA 1XROA 4G0MA 3UPUA 1PJAA 2RCNA 3S8MA 1W5SA 1PU2A 3RLIA 4TLCA 4YACA 2DQZA 3WDMA 1FNCA 3W8DA 4ZHQB 4QXMA 4MH0R 3SI7A 3F73A 1WXFA 2QW0X 4Y2HA 4QC2A 3GMSA 2I33A 5LQSA 4HFJA 3MINB 3IIMA 1M1ZA 2ZRPA 4L50A 4W6QA 4AN1A 2VA8A 3ML1A 2IV3A 2BFMA 4GOKA 1J25A 5DP1A 3HJFA 1UK8A 2HIAA 5A7GA 4EYGA 3GPCA 5C7YA 1CB7A 3T3NA 4OHUA 2DPYA 3NYRA 4DJTA 2J3DA 3P9RA 2DHEA 1HE4A 4ZCLA 4QEZA 4UNPA 5C1DA 4OXNA 4Q3OA 3U80A 4YXFA 2C4WA 5FH9A 2Z2IA 1T10A 3ENKA 4JJAA 2PVPA 4B09A 2Q2WA 4DEYA 3H5RA 4RZUA 1EWTA 2A9QA 4MRNA 1KXZA 4DIDA 4YUXA 3WQHA 3UJPA 4NAUA 2CVPA 4BNVA 2MOKA 3BB1A 1UBNA 2ZB2A 2PO7A 4HRVA 3V3KA 1L1RA 5FBRB 2WM9B 3PCTA 5L4SA 1W8DA 4J3JA 5EWLB 3RT9A 6AT1A 4C21A 5EGNA 4DMGA 3QX7A 1WQ3A 2QZPA 4CM7A 1QYCA 4WZZA 5H7XA 3THOA 3B5JA 4PXSA 5DSTA 4LXTA 1KGSA 3RR2A 4GMKA 2ZKLA 4TTSA 4PLPA 3CCBA 3P2KA 4S12A 3WIDA 3WP1B 1VYHA 3S6JA 1LBEA 1YA8A 1YOBA 2XCQA 2YZMA 3Q3JB 4D8XA 1FPQA 1DHRA 4MYCA 3DQQA 4XX1A 4UUQA 3L9XA 4D3YA 2WP8J 2OVFA 4XGIA 5ALMA 2VF4X 2PD6A 4JT9A 1NN0A 1IG3A 1WXHA 4ZYUA 1K0UA 1NXPA 4I5FA 3PDCA 3RRMA 1ZS9A 4AMVA 4AS2A 4D45A 5CD1A 3FOCA 4W5HA 1Q0RA 5CB4B 2JATA 3KCNA 5BNFA 1YVRA 3EXHA 4QJIA 1NHGA 3DZCA 1PS9A 1T5BA 4I1SA 1P3Y1 4TGLA 2J6BA 1G55A 5EG5A 1Z0KA 1FLVA 1JQBA 1A2BA 5JSZB 3GWZA 1JL3A 3GGCA 3L0BA 1L5NA 3UJCA 1RRMA 4PLCA 3V4SA 2KMLA 4WOCA 1DWOA 2H11A 5IEBA 1Y1QA 3AG5A 3UKOA 3HVRA 3G8CA 4I8XA 5JW6A 3K9GA 4XA8A 2WHEA 1CJBA 4NFHA 1L7OA 1SD5A 4K03A 3ZIAD 3M1IA 3HQ4O 2WAXA 3R0ZA 4L3OA 3ZTYA 3W2EA 2ZI7A 2Q3DA 3A4TA 4IDNA 4D1YA 4E6EA 2I1WA 4HMOA 5EHGA 2GS9A 1JEAA 4F2DA 3VSDA 1KPHA 3R41A 1HUQA 4R3NA 3UGKA 1E98A 4HB0A 2H08A 2O3RA 5AI5A 2CXPA 4RXMA 3I39X 4TT3A 4JJGA 1J70A 2PZBA 3NHZA 1E62A 2AN5A 2RGCA 4RE6A 5BWNA 4C2BA 3OEED 3S29A 3VXKA 3NPAA 1YSCA 2H51A 2JGEA 2BGTA 4J1QA 2CBXA 1RAEA 3IIEA 2ERCA 2ZB4A 1YJCA 3BVPA 2QTHA 3ZY3A 1ZXBA 8LDHA 4IIDA 1XCMA 1OFUA 2Q4DA 4ZCRA 1ZN2A 4FS8A 4DTIA 5EZ6B 4JJIA 4HR7A 1I4EB 1RU3A 2G5PA 3V9PA 5LLDA 4KN8A 3BIJA 2BFWA 4YA6A 3WE7A 4PG5A 3S8YA 5CX4A 1M7BA 1DL5A 1QK4A 2EU8A 1CP3A 3HYLA 4BMDA 1TLTA 5G4KA 5KU1A 1OYOA 2PJDA 4Z1MD 2WJYA 3KX2A 1H5NA 4NH4A 5ETJA 2G70A 5K2MA 3RIGA 2VQDA 3O2NA 3TLGB 3OOHA 3DHEA 5IM5A 1ZI6A 3QMVA 5LZ7A 2B2NA 3RS0A 4MW4A 3SIPA 1C0IA 1PSWA 4N5LA 4N6OA 4CM8A 2VCYA 3IMFA 2NO5A 4HWPA 1R1DA 1JWAB 4RTPA 2JAHA 3H2KA 4JY7A 4K9OA 3IE0A 1A88A 4FN4A 2CDCA 2Y9ZA 1CSEE 2ZQZA 4FOSA 3EWSA 2A1TS 2NUAA 1SQ5A 4LE1A 3SBXA 4BB9A 4D4IA 1ULSA 3TXYA 5GVSA 3D4OA 3LIPA 2ADOA 5U9CA 3LT4A 4HY3A 1U8YA 2REBA 3GNLA 1JQEA 4GSKA 1HTBA 1QE5A 3GLHA 2PNJA 1G9XA 4LKOA 1NDHA 4TUYA 2ADMA 3ESCA 4IRUB 1EM6A 3LKZA 1XN4A 1A1SA 4O2BB 5FBLB 3Q9NA 1I7NA 4K9PA 3DFUA 2Z08A 1HRDA 3WWPA 3ZHRA 3MFQA 3P20A 3ZKWA 3L6OO 4DCOA 4Q39A 2WPNA 2ADFA 3B5IA 4CCYA 4YCCA 3KYDB 3LP8A 3U9LA 3OJLA 2E4AA 1SVOA 1UAGA 3GRYA 2AFHE 1XKXA 3H9JA 5ESRA 2O8VA 4QXOA 2I2WA 2Y1XA 3HHEA 3K7EA 2HHJA 3MZ0A 2B3DA 3WHPA 4FFVA 2IU4A 4Y0NA 5TJ9A 1JKJA 3D5EA 4R1LA 1JR3E 2QLMA 2L0XA 4FONA 2LD4A 1HBJA 3AFGA 4WJZA 1K6JA 1R10A 3N7AA 2AR7A 1NFQA 3CURA 4LZZA 4AQYB 2AOTA 2H2FA 4II7A 1LPNA 1UDXA 2CE7A 2ZIWB 3OE1A 4RIHA 4HGQA 5AW2A 1EJBA 5AW3A 4HZUB 1UJ5A 2VN8A 4HWOA 5BOSB 1K9SA 2PBRA 4JGIA 4ER0A 4G65A 1JIVA 3V34A 4GL2A 2WVJA 3L7KA 3V8EA 2WINI 3NH9A 1HE2A 5KNBH 3PCXA 4EG1A 2RKOA 4DR3B 3TUZC 1LSUA 2WIKA 1NU6A 3DO5A 1CNFA 2QZJA 4I50A 4JUAA 1BHSA 5FNVA 3VNVA 4H16A 1W6RA 3PFGA 5KB3A 4E46A 2X40A 2HRQA 2PYDA 8AT1A 4B6OA 1JBEA 2IYSA 1ZAYA 1TNDA 3ZY4A 5JBQA 4IQFA 2HD4A 5GP1A 3NBAA 1Z12A 3DVQX 3KJEA 1SIUA 3WICA 4EFLA 4O1MA 4ZOCA 2AIRA 1OXXK 4WFJA 2ZIVB 2ZSIA 3REQA 2F8TA 1E2KA 1SMKA 4BATA 4WZ6A 3DAPA 4EG8A 3FDFA 2VIIA 3F7NA 4DM7A 1EUCB 3R0QA 5DM1A 3WB1A 2YV5A 4YXWD 2PUDA 2AC2A 3C74A 5BMVA 2V3CC 2GGSA 3FVWA 2VHVA 4DRXB 2EP8A 1ADYA 4I1UA 3AX6A 3CO0S 1DBIA 2P6UA 1KFCB 4XQEA 4OAOA 5IARA 2R0QC 4LDPA 2GPTA 3KKKA 1V3VA 5D01A 4CFSA 4WASA 3FDZA 1GOTA 1Y3HA 1MJGM 2GRUA 1HGXA 4H17A 3A05A 4WY2A 1BZYA 3QLUA 2RFLA 4Q7QA 1ZGCA 3A1DA 2D2IA 3A7EA 4LJ6A 2E6UX 2V7UA 4JDUA 1KNXA 1KZ4A 1OAOA 1BA3A 2AA3A 3VSEA 4EENA 3AF2A 2JJ2A 3ZH2A 1LBIA 3H9QA 2C7QA 1A9ZA 3VHXB 1K1EA 2BLNA 2XZPA 3I9OA 5DGCA 3PGXA 3TDKA 3PDIA 4EZBA 4TTAA 1SD1A 3GEMA 3WRXC 3E3LA 5FPPA 4DLBA 5K0ZA 5ALHA 1F3LA 1E2GA 4Q3AA 1KOFA 4Q1DA 2NXJA 2QRPA 3ZHXA 1CQWA 2NVOA 3AF5A 4CLOB 4HJRA 4M87A 1OYWA 4NE7A 1QO7A 4IGIA 1IY0A 1C4OA 2AF4C 5CNJA 4ZT4A 3X1WA 5ITSA 3A9RA 3CONA 2I7TA 1RQGA 3AF4A 2GCNA 1X8KA 2HA6A 3F4BA 4K0RA 2WZQA 5H3HA 3SZ3A 4EFMA 4Z54A 2C2GA 1MTZA 3D6MA 2QTNA 4DLVA 4IV8A 2PK3A 2O2IA 1ZY2A 3PKZA 4P5EA 1M6HA 1UMDA 1EGQA 5DEOA 4PEVA 3IPAA 5KVQA 5T7BA 4ZWNA 3CG0A 4D25A 1AMOA 1MUUA 1NTRA 4Q3BA 2AD5A 3DAGA 1SUCA 1WABA 1ZEMA 2RGEA 4XQ9A 4ZEXA 3P9PA 1E32A 5F98A 2W7TA 1FW6A 2GKGA 2SCUB 3MFYA 5C5CA 4YBZA 4N7JA 2OD7A 2PIAA 1X77A 3F6RA 2QTAA 3EH2A 2VDNB 5NULA 5CFRA 2VOJA 3OPQA 6ADHA 4HAVA 3T15A 5TY0A 3KZXA 4JIMA 4UXIA 1XJ5A 5EPUA 1D1TA 1GCUA 3E0QA 2V6IA 4G4SO 4OHCA 5U4XA 5ALWA 3C6QA 1KEUA 3WYGA 3ZE9A 2VHTA 3HDJA 2DAPA 1BE0A 1FFGA 1H65A 4EPXA 1FFHA 2X41A 1ZCZA 3WYFA 1TK3A 2V7GA 3OFKA 4KDEA 5HFNA 4W5NA 1XU4A 4GMHA 4N47A 1GG8A 2RARA 5ECGC 4WEQA 3UKDA 1KAOA 5AJWA 4JHXA 2VZLA 1G1MA 2BUCA 2VUTA 4ZAXA 4BMOB 5A3RA 2YMLA 1GQQA 4TRRA 3F7TA 4CUZA 4D4HA 4ESEA 3BWDD 4MZDA 4R1SA 5BVHA 5K8IA 3O2SB 1S2NA 3KDPA 3LO8A 3ZCVA 3PNPA 2C5EA 1ZRMA 3MM4A 1SCJA 3PC4A 1G8JA 4R8KA 3MOSA 3L6EA 1WV0A 3LCVB 2CDAA 3NT4A 5D84A 5C35A 2WD7A 4P4SB 2DTXA 1M8JA 1T2AA 1RJEA 5I01A 1R4NA 2Z43A 4OA8A 4ER3A 2NO4A 3D5QA 5HTOA 4P2GA 4RQBA 1M6WA 4QSMA 1ONNA 3CW9A 2QIPA 1PR3A 4Z2YA 2VAMA 5FI0B 2JGIA 2GHIA 2VYFA 4ZOLA 3GVPA 1YHNA 4EHKA 4XEHA 2W2PA 4PX9A 3ABQB 4FYHA 3A3YA 5FORA 4PZCA 1R0CA 3JSAA 3SF0A 1Q74A 2QM8A 3BD6A 4JQZA 4QELA 4H59A 3MCTA 1NW8A 4B9AA 1H4VB 4Q9KA 3E2PA 5JATA 4A8JA 2EFCB 3FAZA 1P44A 1QHIA 1TRKA 3QI2A 3N0TA 1EM8B 5FOUA 3T7EA 1FZQA 1QFSA 3AY7A 2NZXA 2Z5FA 4YRIA 2FFQA 4JI6B 1G9TA 3WA7A 3T7SA 121PA 1OV6A 1T4DA 3QUAA 2BEVA 1L8LA 4A10A 1UOQA 3ZCUA 3DZDA 2FWAA 1TU4A 3ZYCA 5BURA 4PF1A 1ZLXA 1KOJA 2BFEA 4ZVUA 1EVZA 1MC1A 1KJ8A 3MTAA 1T34A 4QIHA 3LUJA 3RUHA 5FOVA 2WF8A 1EXVA 1CDOA 1MQ8B 1AKQA 4ROTA 1G42A 1QCZA 3ANSA 2IWRA 4K6GA 3W9YA 1GEEA 3GT7A 5CFOA 3PG5A 4CKYA 4OYYA 1Q77A 1SUEA 3U4QB 2PDAA 1N34B 2REQA 4C3VA 2XOXA 4UNSA 4BC1A 4CM5A 1TVKB 3BX1A 1PBNA 2JJ8A 3EEQA 5B1EA 3FTPA 2SECE 5EPOA 1G21A 1ZXXA 4E11A 4KO4S 4X92A 3WLNA 4ZAYA 1AXEA 1ZHHA 3SPXA 2IELA 3SJAA 3KQPA 1T9KA 4HVCA 1V43A 5F78A 5BSHA 1P62B 4YMSA 5HKBA 1NJ1A 1YRYE 2ORED 2YJGA 2VTEA 2H52A 1Z7WA 1KDRA 2A0UA 4WPGA 4B7UA 4EF5A 1KMHA 4AJLA 1HE5A 3ROXA 4MEBA 3QPWA 1UJ6A 4URYR 2ZAGA 3ST7A 4AD8A 3PTAA 4EHFA 1V6CA 2WU1A 3GEIA 3AR6A 2DWOA 3BSYA 3PRJA 4FW8A 3O2QB 4N3GA 4NY1A 3KTAA 5DHSA 1DUIA 1DXQA 4L9RA 3C3KA 4Q18A 5BT8A 4FC7A 3DBRB 5KCZA 4B3XA 3LX6A 3TLBA 2A88A 3EAQA 4BBJA 1K5DA 2YASA 5JZSA 1ZG3A 5CX1A 2WSSA 1CZKA 1KERA 1GZ3A 2R8OA 1EP1B 4N4AA 4AUMA 3O38A 2C7PA 3LTEA 4RY2A 3FRHA 1XYGA 3VGJA 3C6XA 3I0ZA 1I2MA 1EX7A 1ICIA 2QVGA 4KE9A 3QE4A 4QUHA 1ZD3A 4RPLA 3UAWA 4BV3A 2C2XA 4ISBA 1BKDR 1AGYA 1K6EA 2NU9B 5EMJA 4F5WA 3OQIB 1MGOA 3TLXA 4MVCA 4YHHB 4F86A 3HCBA 1BROA 4JR1A 4RQUA 5JSFA 3NS7A 4FCCA 3PE6A 4KPUA 2FOLA 3COZA 4C9BA 1IHPA 3DL2A 1TQ2A 3I9V1 3Q2IA 4MOWA 2VBFA 1DIGA 1JG1A 3ITNA 3UYKA 1NT4A 1V16B 3E1GA 3WL8A 1ZH2A 4TRJA 4F4CA 3T5MA 1P18A 4JUDX 4X6LA 4A0SA 3U4CA 5JQGB 2UAGA 3MMZA 2XXBA 3Q3GE 4MNTA 4O3FA 1HFWA 2M1XA 3E81A 5DSZA 3KLMX 3TFQA 3R6GA 1P3JA 1HDEA 3FNEA 3H0KA 3M6AA 4A0HA 5KYWB 2XRFA 1HL7A 2OHJA 1CUXA 3MWYW 3SM9A 3VZSA 3GDWA 3O47A 4UNIA 5FB3A 4TV8F 5JFGA 4MPRA 3JTMA 1CY2A 2IIQA 4IVNA 2XDQA 4LXXA 4D9EA 4BZXA 1R8QA 3OZWA 1M7HA 1GR0A 3KDAA 2GKOA 2VPQA 2UXBB 1NY6A 1PFGA 1VDMA 1RKVA 4CDRA 1QH1B 2IF0A 2V9PA 4KLAA 5LZ9A 1EXNA 1JR4A 3VDXA 1E7MA 4UM8B 1FJ2A 1UH5A 4MUJA 4S1VA 1CJTC 1G7RA 3FFBA 3OPNA 1A8HA 1H23A 3IAS6 2FUNB 4IBOA 1FFYA 4DQVA 1TT5A 4GGOA 1QHHB 2DT8A 3LY7A 4B3DA 2FFJA 5F51A 4DNOA 3V80A 2A14A 4RH1A 1P39A 4ZXFA 5LBUA 2HHHB 3AH8A 4TM7A 1U0OC 1FU8A 3CE9A 3BXXA 4NP6A 3MJCA 4Y1RB 3T3GA 2QTTA 3DMTC 2WFLB 3ICEA 4B4VA 3GFOA 3EZ9A 3MK31 4UTXA 2O7QA 4RTSA 3VDMA 2QX8A 1Z2EA 4I50F 1DRKA 1VL0A 3UPTA 1YQXA 4MAFA 3UAOA 3VYTB 4F91B 1K97A 4HVAA 3U31A 1D4AA 1VA5A 2PJUA 1WCXA 2VP0A 3QZUA 1FU7A 2P3QA 4ZCMA 2CWDA 4Z4QA 1GR1A 3LDFA 5IKEA 3HXTA 5CLQA 1EESA 1MGPA 4Y9DA 3AEKB 4DMMA 3TUJC 3BFPA 3GJ0A 5BSGA 3ZBQA 3QV2A 1MQSA 4C3ZA 5B7QA 1FTQA 3GROA 4ZEMA 3M70A 4PGFA 3WWZA 4GWKA 1LEHA 3I1FA 2YOGA 3R76A 1FMCA 3K09C 3EEBA 4URFA 1NU8A 5AJYA 3FYTA 5E6UB 5BMVF 4GOOD 5GIOE 1JMVA 1H2XA 4L75A 3NAQA 1AHPA 4RAOA 5CA1B 3QWAA 4CLDA 3RUDA 4D8WA 4DSTA 1QIMA 2QRZA 3G9ZA 5ALZA 4V1CB 1W1UA 4J0KA 5IW8A 1SULA 3KYJB 2XNKA 5DXFA 5ALYA 4M21A 2WM8A 4YQZA 1DAKA 2XV1A 5D6OA 2BSAA 2PFSA 2O8FB 3IEPA 3FHOA 3FMIA 1PL6A 3R77A 4KQFA 4RKEA 5EI5A 3BIOA 5BN5B 2BBWA 4GYJA 3G0DA 3TK1A 1DBWA 1JAIA 4EVSA 1I9CA 3B1YA 1KEVA 4HRYA 2AQKA 3C8HA 3JVIA 3NWPA 4A2PA 1A4UA 2G4LA 1DSSG 2F59A 3H6GA 5CM8B 1UBGA 2C1ZA 2IRWA 3U48A 2X5JO 4QDJA 1AUQA 4CM3A 2UYHA 2B4QA 2EKDA 1ORVA 2CHUA 1WTCA 4A6PA 3K0SA 4IRXA 1Z8NA 5IC6A 2FRDC 3NATA 4KXNA 2PT7A 3BCUA 1QTRA 1W4CA 1Z18A 3NJRA 1W0CA 4D9BA 1SK8A 2F64A 2VK4A 5F5XA 4AMUA 4XARA 2D5AA 3L06A 5DYYA 3RJ9A 1FNNA 3PQEA 4BCDA 3BILA 2JZNA 2EGHA 3AHIA 1E8NA 4YCSA 1U3UA 3GFPA 1EHIA 3H86A 4H18A 3AIKA 2I6SA 3NWBA 4DY4A 1DWPA 3KHSA 3Q72A 2OECA 3HSYA 2WZCA 3UFXB 1H05A 3P2IA 521PA 1VHDA 4HXEB 4PSDA 5AW1A 3ES9A 2CJWB 4YJKA 5EKSA 3AUUA 4HNSA 1O0BA 1JVSA 1UJ4A 3RUPA 1TYDE 3X1KA 3OHMA 3BD8A 4Q1AA 4HQNA 4XYLA 5DT9A 1T6YA 4MUBA 2WY2D 1KZ7B 4KQWA 2RJ3A 2ZVDA 3AEUB 4D42A 1G2OA 5DK6A 4PZUA 3OQMA 1K8YB 3RNLA 5DN6D 2ZP1A 1D2EA 5U1PA 5ICSA 3CTMA 2ZTLA 1V6SA 3ID6C 3VAYA 2HB6A 3CSUA 4WAUA 3IYLW 4FHZA 5TSDA 1KJZA 4QAJA 4BQRA 1Y7TA 3CZ4A 3GYGA 3TYXA 3HI4A 5A4JA 1UPAA 2DEUA 2XXAB 2PGNA 5BV0A 1IBKB 3KAJA 3BMOA 1FFBA