4PZEA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
molecule tags Oxidoreductase
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzeA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzeA01
3W4IA 4INAA 4GSKA 1ISFA 1E7QA 4AVYA 1P1HA 4OXYA 9LDBA 5JYDA 4WEOA 2VWPA 4P4LA 2W8ZA 2E6UX 4BQPA 4AJIA 3IJPA 5DN9A 4PLTA 3EVTA 1JTVA 3WQSB 4D44A 2EKQA 5B37A 4B4WA 4B7UA 4YAKA 3DWFA 4OMUA 5K6AC 3GRPA 3QQPA 4E2YA 1DFGA 1ZXBA 1EFLA 2YUTA 2NVUA 6LDHA 3CTVA 2IXAA 1JAXA 1BVUA 3OJFA 3DMTC 5JMWA 1T2EA 1H93A 1VC2A 2FSVA 2IYPA 2NV6A 4JJFA 3M6IA 4DXHA 3TRIA 1GEEA 7ADHA 1ORRA 4IBOA 1XGKA 2P9EA 2OZPA 1YJ8A 2NACA 4OOEA 2C7VA 3WS7A 3CE6A 4D79A 4QX6A 5DOZA 1Z45A 5BSHA 2Q1UA 4MKRA 4FJ2A 4YA6A 2NTJA 4WE3A 3IDSA 1QMGA 3VOSA 5B12A 3L4BC 4J3FA 4UUNA 3GMDA 3AWDA 4HP8A 1AXGA 2W90A 2EP7A 5CHEA 3NDIA 4YQYA 1M2WA 1TT5B 4IDDA 5CDYA 3WG9A 3KEOA 5DBGA 3NUGA 4IXWA 3HQ4O 1IYZA 2B4RO 3E6AA 2G82A 3I23A 1PGQA 4BKOA 2IE0A 2A92A 1I01A 2BI7A 3QVOA 2Z5LA 2UDPA 1EMDA 4NR0A 4LMRA 5JW6A 1EEHA 2CF6A 3C1AA 4L8VA 1LX6A 5TSDA 1QV7A 3MOGA 4RLSA 1SAYA 4BVAA 1D3AA 1IE3A 5CPBA 1UXHA 5ILOA 1BVRA 2OHXA 2VTEA 3AJRA 3MWEB 2JJYA 1GV0A 1Z7BA 1KEVA 4ZRMA 2CVOA 2HKIA 3TL3A 3TNLA 3WQRA 4S3MA 1ZSNA 4XR4A 2X9GA 4F3YA 1V6AA 4DLBA 2Q4BA 4KWIA 1E6EA 3GZNB 5DCYA 2VT2A 3GNTA 1DIGA 1M6HA 1GCOA 3QJ5A 2PKQP 4DQVA 2ZKLA 1K3TA 3ANLA 2O4UX 4YBZA 3GAZA 3QLJA 4GGOA 5L4SA 1O94A 3EK2A 1IZ9A 1PJTA 1ONNA 1R0LA 1ZK0A 4QQRA 3ICCA 1B3RA 3KEQA 2ZJ0A 1JWBB 3K31A 3S8MA 1GCUA 1NPYA 1UH5A 1C14A 2WD7B 4PG8A 3QSGA 1B8VA 1XU7A 3I9NA 1MA0A 4TVBA 3W8DA 1DHRA 4RV9A 5JO9A 3LC7O 4GH5A 2Y1GA 1FDUA 3BXXA 2BRUA 2PGDA 2YHIA 3AY3A 4FS3A 4XGIA 1NFRA 2RBEA 1S7CA 4E2ZA 1SOWA 2A4KA 3RUAA 4AG3A 1H0KA 2I65A 3B1KA 3SC4A 4B7XA 4J1QA 2O23A 1QP8A 3W4KA 5HRUA 3UOGA 3UH1A 2R00A 4ALJA 3EUWA 3I9LA 3PLNA 5JFOA 4WCFC 5IZCA 3ZCXA 1BXZA 1YO6A 2PLAA 3DFZA 1Y81A 3MTGA 2PD4A 4RF2A 4J4HA 2CVQA 2ZQYA 4PLHA 4Y67A 4RPHA 3UF0A 2E48A 1DLIA 1ISIA 3V8BA 3WWYA 1GEGA 1RPNA 4JXKA 3H2ZA 1ISJA 4J2OA 3VH3A 5T8KC 3SC6A 2J5KA 2IEDA 1YE3A 3NGLA 4BKPA 1EZ4A 1QYWA 5JDCA 2FRDA 1F8FA 1B15A 1JAYA 2PTGA 1XA0A 3ROMA 4FJ1A 4CL3A 3IUSA 4LVCA 4J1SA 2GCGA 4J9UE 3GF4A 4KTTE 3HDHA 1OAAA 2WSBA 3B1JA 4ZN6A 3K73O 4Q3AA 4W7IA 1M76A 4BO8A 2WDZA 3P5SA 2DTDA 3BMQA 1XDWA 3GRKA 1LSOA 1I0ZA 5CDGA 1JVSA 1YQDA 4Z9FA 3H3JA 1PZHA 4RVHA 4XA8A 5L7TA 4A73A 4KUGA 3D4PA 3HSKA 3U0BA 4II3A 5BNTA 1NXQA 1MC4A 2X6TA 5F1KA 4Z9YA 4J90A 3AUAA 4A26A 4DPLA 4JJIA 3JD1A 2Y1EA 4JJGA 3DQPA 4W4TA 3UAGA 4TKLA 2HJSA 4TZKA 1LTHR 1I3MA 1RM5A 4L0QA 4PLGA 4AJ4A 2DPHA 3EVNA 4PLCA 2CY0A 4U7WA 4BKRA 4YJGA 5FWNA 2X0NA 3EHEA 4CMBA 5L40A 3WIDA 4II2A 2H1SA 4BS9A 1N1EA 3H9UA 3JQ9C 4Q3NA 1PJ4A 4PIVA 1X14A 3D3EA 4YDRA 3WSVA 3HDJA 3DOJA 4MP6A 4KUHA 4J1TA 1V9LA 3FTNA 4J16A 4S1VA 4WK6A 2X58A 4BO1A 4BNUA 1P1KA 2D59A 4UREA 2Q99A 2FMUA 4IY1A 3V2GA 3E48A 1OBFO 1SNYA 1NQ5A 2ZB4A 1LLUA 3ONDA 4WOJA 4GBJA 8LDHA 4CLRB 1YOVA 4GPD1 3RASA 1WPQA 1C0PA 3DTYA 4B4OA 1DLJA 1YVEI 3PZBA 1FMCA 1I2ZA 4EUFA 3AY7A 5B4VA 1MG5A 5L7WA 3K8ZA 4O6VA 5AQ1A 2DBZA 1JLLA 1LC3A 2ZYGA 2D4AA 2EXXA 2HRZA 2V65A 1Z7EA 2ZTLA 3L6EA 4IDBA 3HFGA 5DP2A 3G17A 1SEVA 1K6IA 4JCOA 4WLNA 3FD8A 3I83A 4ROSA 4JX8A 4RPGA 4MO2A 5ITWA 2HO5A 2BFOA 2PH5A 5JDIA 2VWQA 3ZNPA 5CDSA 3GDFA 2JAHA 3AI1A 1F17A 1NASA 2ZTMA 1P44A 4YJHB 2PWZA 3RBZA 2IODA 1BGVA 4LCEA 4BMVA 3I6IA 1YRLA 3KRTA 4I5GA 3QIVA 2PGJA 1D7OA 4LRTB 2J3IA 1ADBA 1EBFA 3PHIA 4WASA 4BL5A 2JCYA 1ZIDA 3GLQA 1NPTO 5JPIA 4FGSA 1C0IA 3X2FA 2FOIA 4CM1A 5G0VA 1CERA 3ROQA 2JD0A 1PS8A 2X0RA 3GH3A 3WXBA 2F1KA 1SOVA 2RAFA 4E13A 5HWSA 3H9JA 2NVWA 3KHUA 3GUYA 3LLSA 3PQFA 4XKJA 5AXCA 3K30A 1N1GA 3PHGA 1Q1NA 1OZAA 1PGJA 3GAFA 4GGPA 4MVJF 1GYRA 1DRVA 1XELA 3NJ8A 3ZV3A 2IDZA 2TMDA 1LLQA 1OI7A 5TRTA 3GFBA 4E21A 3PVZA 4GVXA 4P4NA 1ULUA 5HS6A 1XU9A 3FBGA 2R00C 2X23A 3RIHA 3B6ZA 3OIFA 5TJ9A 3T7EA 1JWAB 5IZCC 4L4XA 1R0SA 3KYCA 3ON5A 1Y8RA 4QXMA 1J0XO 4ONEA 3TZHA 1ENPA 4MVJH 3RD5A 2VWGA 3ZNOA 2VHZA 3VPGA 4GKVA 1HDZA 4FPXA 4ZRNA 1PJQA 3RUIA 4NNJA 3JQ8A 4WCDA 3JTMA 2Y93A 1ENZA 1YDWA 4WNIA 2LDXA 1WDMA 2I67A 3KLPX 2UVDA 3UUWA 1DC5A 3VPFA 4NK4A 4CUJA 4MVJE 4MVJG 1IHYA 1LI4A 3GGOA 3JQEA 1JW9B 4XGNA 3JQ7B 1I3NA 1GD1O 1R66A 5JDCC 1KC3A 2VYND 3BMCB 3RSHA 1X0VA 2JAPA 3NGXA 3GK3A 4D42A 3GHYA 1VJ0A 1QR6A 1PTJA 3VAZA 4Z9XA 1KVRA 2SCUA 1YJQA 3V1UA 4IZHA 1VKOA 3GPDG 4P4GA 2VOJA 3N74A 4BB5A 4R68A 3TF5A 4A7PA 2ZB7A 2C29D 3IMFA 4RVGA 4J7UA 3T4EA 1QYXA 1P1JA 1A72A 3AU9A 5GZ3A 1JVBA 3KBOA 5H83A 4BO5A 4FFRA 2WMDA 5IF3A 3W6ZA 4ZQFA 1O95A 4CV2A 3OETA 1HE4A 1KIFA 2NU7A 5CP8A 1I10A 4ND1A 1NVMB 2FR8A 2AE2A 2VHVA 1LDGA 2C5EA 4FOOA 3WLEA 2GN8A 3IUPA 2VRCD 3G1TA 3GEMA 1PJ3A 2RHCA 3U5TA 3P2YA 4CQMA 4IIUA 3SEFA 4O0LA 4DGSA 3EC7A 4R1UA 1Y5MA 4BO0A 4QFCA 3U9LA 5CG2A 3PDJA 3CTMA 3HJAA 4A10A 2VQ3A 2HRBA 1E7MA 4GX1A 1HLDA 4CLHA 3NT2A 4B3IA 4YT4A 1KOLA 4MP3A 4KUEA 1YBVA 3GN1A 4PGFA 5B4UA 3WBFA 1AN9A 3D3WA 4NJMB 1F06A 4RPKA 1IY8A 4G2NA 5F5NA 1XWFA 5THQA 3TN7A 2VZ8A 4B3JA 1E0DA 2NADA 3KV3O 2VWHA 5G4KB 5I7VA 4NI5A 1Q7BA 4YACA 4GLOA 3JYOA 1E7WA 1BMDA 4CM8A 2ZIZA 1B3BA 1H2BA 3G49A 2GF2A 1MV8A 3FCOA 4GQAA 4OIMA 3C85A 4XIYA 1DXYA 1E1MA 3ENNA 1K89A 1KY5A 1WXDA 1ZK4A 4CLOA 1GYQA 5A9TA 4L9RA 3FN4A 4FFOA 2C07A 3LF1A 3O03A 3Q2IA 5JCJD 5JDIC 1EQ2A 1LRKA 4FFLA 4NFHA 1VI2A 1X7HA 3S55A 4J1NA 1K5HA 2Y0CA 3WIEA 4Q3DA 4MP8A 3DOOA 3CMMA 3DBLA 3OQBA 4KQXA 4XJTA 3H8VA 3NRCA 3RKRA 1K6JA 2ET6A 4UAGA 2AXQA 3EDMA 3WNVA 1CETA 2GSDA 3HHPA 1ENOA 1YL5A 2PD3A 2X86A 1LLCA 4AJJA 1D8AA 3ABIA 2X0IA 1L1FA 1CJCA 1SBYA 4D0RA 3RFVA 4PLFA 1CWUA 3AOGA 3ZWXA 3BTOA 3KO8A 3ULKA 1NM5A 5KVQA 1UJMA 4L74A 2EGGA 4AJNA 3A1NA 1ONOA 3GPIA 3E9QA 4BV9A 1DAOA 1SPXA 3OSUA 1HDYA 5AXDA 2O2SA 2OL4A 1Q7CA 3K6JA 5L45A 3WBBA 3C24A 3KB6A 2GN6A 3DZHA 3KVOA 4R1TA 4IMPA 2BGMA 4R54A 2FN7A 1PIWA 3QW2A 1I32A 1T2CA 4Y6RA 1GQYA 5COQA 5C5IA 4MVJP 3U4IA 4GLLA 4JIGA 5A3VA 1VM6A 5FEUA 4E4YA 4PCVA 1HDRA 1P31A 2QHXA 2BLLA 3DZFA 4ZVVA 1XKQA 5G0SA 5KNLA 1A7KA 4QECA 1YXMA 4K28A 2YV2A 1EVIA 4Q3BA 1KEUA 3DBRB 3I6QA 4IDGA 5DCUA 5TGDA 2GLXA 1E7YA 3WJAA 5JC1A 2NWQA 3W8FA 1PEDA 1H6AA 1N92A 3SX2A 3DMYA 4U6QA 1GU7A 1NFQA 2NQ8A 4RGBA 4B8WA 5A04A 2B36A 3RC9A 2D3TA 3AOEA 3W6UA 2Y1FA 2C54A 3SLGA 2GZ2A 4O63O 3D5TA 3VPXA 3ICPA 3GGPA 3E9MA 3VTFA 2RIRA 1PWZA 3ZU3A 4CODB 5FI3A 2O3RA 1O0SA 2PKRA 1X7DA 3OJLA 1W8DA 4HUJA 3H6KA 3FNGA 2IZZA 1DJNA 4R3WA 4WLOA 3AM4A 1TT7A 3KUXA 3GG9A 3KETA 3EYWA 4BNNA 1F12A 2OUIA 1EUDA 2HMTA 1KYQA 1U7HA 2WEKA 1UDBA 3AFMA 2YJZA 1ENYA 3VH1A 1KEWA 3CZRA 3HDQA 3QWIA 1UXKA 4LMPA 2OOSA 3P2OA 2GASA 3IAHA 3ITKA 1ZZEA 3E5MA 2Q1SA 2ZQZA 4BB6A 4AL4A 4F6LA 2AQIA 1VLLA 2HMWA 5AXBA 2J6IA 3L4SO 1LLDA 4Z0PA 1ISGA 1G1AA 4AJHA 2RH8A 3GEGA 2I5PO 1H6DA 1ZKMA 4BMSA 2BFAA 3PYXA 1QLJA 3UVEA 3ZWCA 1Y5RA 1PX0A 4TRRA 4NU6A 5I7SA 3HNPA 4DUPA 4NG5A 3WFIA 2Q2QA 1YS4A 3WGHA 2I3AA 2CZCA 2ZTVA 3NTQA 3OEWA 2H9IA 4QFDA 4NHEA 3DZJA 3ZWMA 1C1DA 3OF2A 3VVBA 3DBHA 5BSGA 1M6WA 3TOZA 1GAEO 2XXBA 1NAIA 2ZYDA 5IN4A 4ZHSA 2GN4A 3WDSA 1WDKA 4YQZA 3OQ6A 4Q3CA 5ES3A 4Z3KA 2B83A 2B0JA 4UEKA 3U62A 4UULA 1KBZA 3INRA 4UVIA 1TLTA 2FP4A 4BO9A 2VN8A 3VHRA 3IOYA 1VL6A 5F21A 4RF3A 1EUCA 3QP9A 3FR7A 1YKFA 4RDIA 2WYUA 1KEPA 4A2CA 1VSUA 1UAYA 3UCFA 5T6BA 1E3WA 3M1AA 2EIHA 3QY9A 3KYDB 2FPPA 3FPCA 4B4VA 2EEZA 4CMHA 3QVXA 2CDBA 3E82A 4FBGA 4D43A 2QW8A 2PGLA 4HX5A 1HE5A 4M87A 5A05A 3V2UA 3NDRA 1RM4A 3LT4A 3N7UA 4WCFB 3GQVA 2WD8A 3RC7A 1Z82A 1I36A 2QZ9A 3O8QB 1E5LA 4D3FA 4RVUA 3RJ5A 1JKFA 3KXDA 4FJ0A 4MIOA 4E33A 1UAGA 3RU9A 4MVJD 2FR0A 3HE3A 4R69A 4XX0A 1NP3A 3ZW8A 1V3VA 2V6GA 2AG8A 5CEFA 3R0IA 4YJFB 1HF3A 5ILGA 1WMAA 2NU9A 2OO5A 1J4AA 5TS3A 1I2CA 4MPDA 2JD2A 1VJ1A 2O50A 2RHRA 3A9WA 4U6SA 3OFSA 2Z95A 3RUHA 2VHYA 4N5NA 2EG9A 3JD0A 3K2BA 5I8WA 3LYLA 2OBNA 1CQJA 4I5DA 4L76A 2DU8A 2B69A 4Y6PA 3C7DB 2AQKA 1EVYA 4OHUA 3E1KA 1SB8A 3JQAD 1MXHA 1UXGA 2FSSA 1UUFA 1A4IA 1R0KA 1YWGO 3JQAB 4DC0A 4I08A 4KDFA 5JO0A 3FF4A 1Y8QA 3PFWO 4WOKA 4CLDA 4ZICA 3WMXA 2D0IA 4B3HA 2NVUB 3AOEC 2B5VA 4ND2A 3BMNB 5TX7A 3BTSA 5IXSA 4W9NA 2ZTUA 3QA9A 4CMIB 4YAIA 2BFMA 4DIFA 4Y98A 1B8PA 1V0JA 5TLSA 1XEAA 3RUDA 1EUZA 1DIBA 2OP1A 3JYLA 3GZNA 1PR9A 3L07A 2PK3A 2G0TA 4BMNA 2CMDA 1LDBA 4LSMA 2WYWA 1B14A 4E5YA 1T2AA 2VTDA 3OP4A 3ORFA 4FCCA 3WJ7A 1WVGA 5KVVA 4D3SA 3D7LA 3G3EA 1X0XA 3LQFA 1GV1A 4IGEA 1PWXA 5BQFA 1LRJA 3R1IA 3M1LA 1G0OA 4E6PA 5IZ4A 2QYSA 2A9FA 1XCBA 3JYQA 4CV3A 1NHGA 4H15A 4ZJUA 2WD7A 4TRNA 5EERA 3GNQA 1MX3A 2DKNA 1N8KA 2LDBA 1SB9A 1E3IA 4YR9A 3F9IA 3ZWAA 4LGVA 1O5IA 4C7KA 3NX4A 2VHXA 4R16A 4PZDA 2Q2VA 4NBVA 4BO4A 1T25A 1LQUA 1LDEA 2NTNA 1AHIA 3OA0A 3PZRA 1B7GO 3AUSA 3LT1A 1TI7A 2GO1A 4MKZA 4EZBA 3ZW9A 3P19A 3OJOA 1U7TA 3FI9A 4MKXA 1EQUA 3DEYX 1LJ8A 1E7RA 1HETA 5GMOA 4D41A 3PXXA 5H81A 1LUAA 4J7CA 4H16A 5ICSA 3TZQA 1RJWA 3KSDO 5T57A 1BW9A 1VL8A 2C7GA 4OKNA 1LXCA 3HN7A 3S2GA 2AEJA 3PWKA 3ZZNA 4E5PA 3LDHA 4XIJA 2DC1A 4N7RA 3OHSX 1HLPA 5IN5A 2NU8A 5BNIA 1NVTA 1B26A 5CFZA 1PR3A 4EJ0A 4FIZA 3U3XA 3H5RA 4XCVA 1D1TA 2CFCA 1ZMTA 2I76A 3WGOA 1GPDG 1ML3A 4RQUA 1GL3A 1I3KA 4YYZA 4YT5A 3BMOB 3ZU2A 2YDXA 4PLZA 5C3MA 1I24A 3IC5A 4IJUA 3ZU4A 3KM0A 4ZQHA 1ZJYA 1MGOA 1HZZA 4EW6A 4XYGA 1R4NB 3D64A 3MEQA 1C0KA 1J5PA 4BQRA 4YRBA 5MDHA 2FZEA 4NBRA 4YCAA 2P5YA 3O9ZA 4I8XA 5ER9A 5IDXA 3BHIA 1F8GA 4J49A 4P22A 5HA5A 3CINA 4BNVA 5CEJA 2O3SA 5HM8A 3AFNA 5L9AA 1BDMA 1DC3A 2EWMA 7MDHA 2PZMA 3F5SA 4JROA 4E2WA 5KJEA 1E3EA 5KJCA 3IS3A 3JD3A 1CRWG 3OMLA 3S2FA 1ZO8A 3ETGA 2FR1A 2GN9A 2NQTA 4QSMA 1ZSYA 2HJRA 1YONA 4CL8A 3NDJA 2EJWA 2X0JA 4IDAA 1QYVA 1TXGA 4MOWA 1O8CA 2DUWA 3U4DA 1PGNA 1IB6A 4KP7A 3NT5A 3I4CA 3FTPA 4XDYA 3D4OA 2BHLA 1A9ZA 5JMPA 2O3UA 2YQ5A 1FDSA 3AI2A 3ZV6A 4NFYA 2GERA 3GVCA 2VZ9A 2PFGA 4CM5A 2ZCVA 1Y9EA 3I9OA 4CMKA 1T1RA 3K5PA 4DREA 4CLRA 2HQ1A 1F14A 1DO8A 1P0CA 3LC2O 4CM7A 3JQGB 1I30A 2ZCUA 3GUCA 2O7SA 3I1JA 1B16A 1X13A 1L7EA 2A35A 1W6UA 2PNFA 3CMCO 5A9SB 1UP7A 1VRWA 5DZSA 1F0YA 2O4CA 5G4LA 4DMLA 3H2SA 3H9EO 4UUOA 4YT2A 3V5NA 2QZZA 4OXNA 2B35A 1T1SA 3ENKA 4ND5A 3E9NA 2CD9A 3DAGA 3PLRA 1DC6A 4RVSA 2HLPA 4UEJA 4W9NC 3ETEA 2O7QA 1XR3A 5B4TA 3QWFA 4EJMA 2PD6A 1DSSG 4NPCA 3RQSA 4Q39A 3HFSA 3DAPA 3C1OA 4X54A 1U2DA 4JBIA 5U4QA 3TFQA 1LSUA 3VZQA 4BNIA 4C4OA 2E4AA 3ZGYA 2JCXA 2I99A 1UDCA 2XXJA 4XD2A 4WLFA 1EBUA 3DR3A 3LU1A 2OORA 1OC4A 3OICA 4XB2A 4YB8A 5L7YA 5TNXA 4KDEA 2DBRA 3HDYA 4GAEA 6ADHA 4RZHA 4RF4A 2HDHA 5BT9A 2Y1OA 4ALKA 4EBFA 2WTBA 4XQEA 5G0TA 1YOVB 4YPOA 4ALMA 4WPGA 4OL9A 2E82A 3A4VA 3DL2A 5G0UA 3RUCA 3SJ7A 2XAAA 5IDQA 3ZH2A 4W82A 3GMSA 5EN4A 4BNFA 4CMCA 4HFRA 1P0FA 2Y99A 4W99A 4NMHA 1NR7A 2UUPA 2WM3A 3T4XA 1IPEA 4EUEA 1DHTA 1CYDA 4FD3A 3WLFA 4B79A 2NU6A 3NTOA 3INTA 3PGJA 2HU2A 5T64A 3WNQA 1BXGA 3ITDA 4IGFA 1T26A 1Y7TA 1WMBA 1ZK2A 5DOVA 4Z6KA 2OP0A 3RAJA 4E3ZA 1XYGA 2ZYAA 2PV7A 3E8XA 2WE8A 3EY4A 2Y68A 3ZNQA 4PG4A 1R4MB 5FYDA 2VNSA 2JKVA 4YAGA 3PDUA 4D45A 5KJ6A 5TIIA 4D7AA 3FWZA 2ZB8A 4K6CA 3PJGA 5JY1A 3FHLA 3H9GA 2G1UA 4YJDA 2VRBA 4A0SA 1JA9A 4PG6A 1YL7A 3HN2A 4EI2A 1RYEA 2GZ1A 4RORA 1P74A 5A5EA 2HSDA 3BMCA 5TT0A 4G5HA 3WX0A 4YTEA 2VYNA 3EW7A 3TPCA 1E1KA 3GHHA 4R5MA 2OGUA 4BKQA 2GNAA 4QEDA 4GVLA 3L77A 4M89A 4EJ6A 3SXPA 2DM6A 2P68A 3UW3A 4KMSA 4JK3A 2ZK7A 5JY6A 1P33A 3ST7A 4QUKA 5U9CA 3KYCB 4YVFA 5I7EA 4OGWA 2Q50A 4WLEA 2P4QA 5EINA 3SBOA 2W2LD 1I5RA 5ITVA 1HXHA 2BI8A 1U28A 4BNMA 2VUUA 3KLMX 1GUYA 1PSDA 4IDEA 1EK5A 4YXFA 3KSUA 1E5QA 2HK7A 4LISA 1KETA 4AJLA 4ZQGA 3PEFA 3LVFO 1U1IA 3BHJA 3F46A 5GZ6A 4DQXA 5KJ1A 1Q0HA 2PZKA 3TWOA 1Q7GA 4MIYA 3V1TC 1W4ZA 1LA2A 2BELA 5ENDA 5DBFA 2HMUA 4YAJA 3I9KA 4AICA 3TOXA 1X7GA 4Q3EA 1ZW1A 3JYNA 4EITA 3INGA 2V6MA 3VZPA 3GOHA 4PLYA 4R1NA 2W2KB 1QORA 4GL4A 2AEFA 4RVFA 4FC7A 1LSSA 4NJMA 1HKUA 1NWCA 5LDHA 4FW8A 2P91A 4NU5A 2NVBA 3W4JA 4E12A 4OM8A 1ZBQA 5G4KA 1EK6A 2JHGA 1LRLA 1DC4A 3A28A 5L95A 1YL6A 3ZHZA 1HEUA 3QWHA 4FB5A 2W98A 1GQ2A 3D1LA 3LLVA 1IUKA 3TZ6A 3DOCA 1R12A 4IS3A 3HB5X 1B0AA 4CMJA 1CQIA 4LCJA 4XJSA 1E77A 4BHTA 2QQ5A 3AM5A 1JKIA 1XSEA 4IUYA 4BGIA 4HY3A 1YH3A 3WGTA 5C7OO 4JNKA 1WNTA 5A02A 2F00A 3G79A 3VVCA 1TVEA 3KOUA 1GZ6A 3NAQA 4FOSA 1GDHA 2X7HA 3E03A 3WYEA 5JCJA 1HSOA 1GPJA 1RM0A 1NQAO 1AXEA 2E37A 2OFPA 2Y67A 1H5QA 4N5LA 3UKOA 5CAEA 5EJ2A 2X1HA 4DYVA 1NVGA 1SC6A 1DRWA 3WFJA 3IL2A 1HZJA 2D5CA 3AUTA 2CDCA 2JFGA 4XQGA 1T24A 2H63A 3UXYA 4LSWA 4ZA2A 1H9BA 4NJOA 4UVGA 2EP5A 4D46A 3V2HA 4OXKA 3TJRA 1PZFA 4DLLA 4KZPA 1WP4A 3VH2A 3NV9A 5BSEA 1CIVA 3DO5A 1SCUA 4HBGA 4WGGA 4BOYA 1UZLA 2X5JO 3D0OA 5DULA 3LC1O 1U3VA 1NQOA 1WLYA 2HCTA 4NIMA 4NBTA 2A94A 1LDNA 2C2XA 4DLAA 1B2LA 4YRDA 4I9NA 1KS9A 1QLHA 2CNBA 1YB1A 4CLOB 4KQWA 1N5DA 1DJQA 4AJEA 5ADHA 3OJ0A 4JN6B 4QTZA 3F6YA 3VH4A 4L73A 2YQ4A 4NK5A 4EGFA 1WWKA 3DBLB 5COAA 4YT8A 2DBVO 4FR5A 3H5NA 3U4HA 4XYLA 3EZLA 2C2YA 3D4NA 2D2IA 2VOEA 1ID1A 3DBRA 3VTZA 1LEHA 3NJ4A 5K6AA 1ARZA 4EEXA 2B37A 1YGYA 2C0CA 2Q3EA 1ZCJA 3ZWBA 4OJNA 4UEOA 2ZATA 1BSVA 4P8RA 1XIVA 4ALIA 1PQWA 3MJVA 4K26A 4HFJA 4E30A 3PJDA 3FNEA 1Z74A 4CM4B 1JU9A 3I3OA 1T2DA 1GADO 4BNHA 4N18A 4XRRA 3PYLA 1IULA 3DHEA 4I1IA 2CVZA 4PRKA 4CR8A 3QRWA 3WB9A 4A5OA 2DTXA 2FWMX 4ILKA 1N2SA 1YQGA 2PKQO 4IM7A 1ADGA 4IJKA 2EGHA 1C1XB 3PJEA 2Q4EA 1NWHA 1GQQA 1MG0A 2CF5A 3U49A 2G17A 3H5AA 4NDNE 5IXYA 1VJTA 5F1PA 4FGWA 1HYEA 3CXRA 2GGSA 2DPGA 5CDUA 1NPDA 2V7PA 1BRMA 2CUKA 2VYVA 4M54A 5I9LA 3HUDA 1V3UA 3PRJA 1Y9AA 5I7FA 4IDFA 3CH6A 3PYMA 5COBA 1VPDA 3G1UA 1ZNQO 4RF5A 3UCEA 3WYBA 2PY6A 5KKAA 3PIIA 4JQCA 2BD0A 2HAEA 1XHLA 1FDWA 1RKXA 4UVEA 3RFTA 1DOHA 1RWBA 3TL2A 1HE2A 2AW5A 4PFJA 1WDLA 1N9GB 2YY7A 3KSZO 5KKCA 4WJZA 1I33A 2TMGA 1OMOA 4J0FA 2O3QA 5HTOA 4PG7A 4BNGA 4ZD6A 3MJEA 1U4SA 1AUPA 2Y0EA 2BFPA 5DT9A 1GUZA 3WOHA 3ZWYA 3I9JA 1PL8A 1Q0LA 2DVMA 4A03A 1ZXLA 1EVJA 1MC5A 1K0UA 2UUOA 4IZIA 1XQ1A 3PHHA 1PU2A 3GFGA 3FRJA 4TWRA 4DMMA 4RLHA 4CUZA 4I5EA 1T4BA 2Y05A 3RBXA 3F47A 4J2HA 4XEHA 3B20A 4B4UA 4PVDA 3L0DA 4BNTA 1NQTA 3OJEA 2NTVA 4LW8A 4WKGA 3W1VA 5KIAA 3PJFA 4BNJA 3ETDA 3KYDA 1A5ZA 4D3DA 1Q0QA 4IXTA 1R15A 3LT2A 3O38A 1VL0A 1E92A 3IKTA 3QV1A 1VE9A 2X22A 1ADFA 3L9WA 3QWAA 4YRAA 4PZCA 2VCYA 3ONFA 4HKTA 1QRRA 4WNCA 3OA2A 4WCFA 4CQLB 3AM3A 4HV4A 4BGVA 3O8QA 2J3JA 4BO6A 3SJUA 3T7CA 2D8AA 2QRLA 4G65A 2AMFA 5CPFA 4JBGA 1VSVA 2BGKA 5DDIP 4XWYA 5JC8A 3ADPA 1DRUA 1U4OA 5JE8A 1YQXA 4GSLA 4MVJA 2ILTA 3DONA 5AYVA 2Z1NA 1PZGA 1W73A 1PL6A 3U09A 1N7HA 4XB1A 3DTTA 5FF9A 3GA0A 2BH9A 4F46A 3DC2A 4GKBA 3UICA 1ADCA 2OBYA 1U9JA 5BNFA 4BO3A 4CV0A 1CEQA 3VDRA 3GEDA 1O89A 1E3WB 1O6ZA 1EVZA 3QWBA 2PH3A 4HWKA 4R41A 3K2EA 1S6YA 1GFSA 4JP2A 4U5QA 3KTDA 3K9QO 2X9NA 2XOXA 1DFHA 5ICMA 1FJHA 2RH4A 1V35A 3QHAA 4CM9D 2AHRA 5H82A 2ZJ1A 1PJ2A 4NZ9A 3Q1LA 1PJCA 1DFIA 2J3KA 2JFFA 2QX7A 2Y1DA 3I9MA 3JQAA 4JBHA 5T67A 3ZV4A 4DPKA 3CZMA 1BTOA 1DIAA 4CLEA 3TDKA 3FNHA 1TT5A 4M1QA 3ANMA 4J0EA 5TQVA 3WTBA 1T4DA 2VUTA 2P4HX 5B1YA 5JAMA 5BR7A 1R6DA 4OQYA 1FK8A 3BMNA 4RO0A 4Z0HO 4N5MA 3LZ6A 4CMIA 4J7XA 1Z75A 2OXIA 3JD4A 4F45A 5L3ZA 1G0NA 1M75A 3JQ9A 5G2OA 1ONPA 3DB2A 3EZYA 3L6OO 4KWHA 3Q9NA 2Y1CA 4Y9DA 2Y0DA 3ASVA 3Q3CA 4FFPA 1AE1A 4FFNA 4DWVA 2VNAA 4NFSA 3HG7A 2YW9A 4W6ZA 5L4LA 5GY7A 1H9AA 4ZQEA 1YB4A 4IJWA 3A06A 3FBTA 2C5AA 3VKVA 3MTJA 4TVOA 1FF9A 2DQ4A 3VZRA 5J23A 1VKNA 4ESOA 1HSZA 3RFXA 2NSDA 5IDWA 2P9GA 3UGKA 3ZWOA 4CLXA 5A5FA 4UVDA 3NYWA 1RM3A 2FPGA 1E6UA 4DQUA 2HK8A 5KOIA 4RJTA 1Y8QB 5EIOA 4Z0TA 2CSUA 3DDNA 3CUKA 3PQEA 3O4RA 3FR8A 3ROKA 3WGZA 3V1YA 2AE1A 3H7AA 4E0BA 5IDYA 2BMAA 1JQBA 4ZQBA 3M2PA 2RCYA 1NTOA 1AGNA 1V3TA 3DFUA 4XZ3A 2FZWA 4IDCA 5I9NA 1NBOA 2AEMA 4RDHA 1KC1A 2UV8A 4FDAA 1DBVO 3NT4A 2DAPA 2QG4A 3CIFA 1TEHA 3PGXA 3F3SA 2FPIA 3GNSA 4RPLA 3WYCA 1NHWA 4IS2A 2ZB3A 2X9VA 2WE7A 1MLDA 3M2TA 4EUHA 3IJRA 2DBQA 4CR7A 3S2EA 4DTIA 2YV3A 4Y8VA 3S1LA 5TF4A 4U8GA 1I8TA 1DIHA 1UZMA 4DIOA 1LBEA 4J91A 5DF1A 1U3WA 1P1RA 4AJ2A 4OSPA 5AOVA 5DP1A 3PTZA 2PA3A 2Y66A 3RKUA 4DYDA 1W0CA 3EGOA 1ZEJA 2EF1A 5ENVA 3RVDA 1BWSA 4TRJA 1A7AA 3ZHBA 3VDQA 1WW8A 5L51A 1JN0A 1P9LA 1CDOA 3VZSA 3BMOA 4IQ0A 3I52A 4H3VA 4ID9A 3KZVA 4EEZA 3NKLA 5CDTA 1G6KA 3PWSA 5GZ1A 1MB4A 2YHIB 1NFFA 1R4NA 3ZHYA 2C59A 3H4VA 4LRSB 2B5WA 3VC7A 4TQGA 1GZ3A 1ISMA 5A1TA 4PLWA 3ZWPA 5KWEA 4D0SA 5TC4A 4TMFA 1K2WA 1R37A 3FNFA 4FSHA 5JSFA 3R6DA 5JCXA 1BHSA 5KCZA 5MGBA 3MJCA 5JAQA 4C7JA 1NYTA 1GYPA 1BW9B 3MCVA 3ZWVA 4BUCA 5A06A 5IJZA 5A4DA 3AY6A 4WEQA 4JLWA 4DRYA 3OBBA 4G81A 3GVPA 3PPIA 1E1LA 2P9CA 1PQUA 1EE9A 4PG5A 1P45A 1BG6A 3OECA 4IPTA 1QSGA 1A71A 1U3TA 1UP4A 1X15A 4XYEA 4TRMA 1KVSA 3K96A 3BZUA 4K9DA 1N7GA 4OH1A 3PIDA 1QYCA 3DBVO 4UUPA 4LN1A 3OIDA 4URFA 4CMEA 3BYZA 3R3JA 3AU8A 1PGPA 4PLPA 2NUAA 1FDTA 1RYDA 5G0WA 5C7LO 2Z1MA 3JQGA 3BTUA 4HNHA 3ADOA 4OO3A 4J43A 1L7DA 2IEBA 2POQX 5THKA 5A9SA 3RUFA 4NQZA 3ZHXA 4KTVE 2VUSA 3BMQB 1UDAA 3GVHA 4MJLA 4DBZA 4WUVA 1H94A 3P7MA 3WR5A 4AJOA 3GDOA 4ALLA 2P5UA 2Q49A 4B7CA 3HB4X 2J8ZA 1ZUD1 2EKPA 3UCXA 3JQFA 4RVDA 4R4JA 1DIRA 3HWRA 2FY8A 4YJGB 4J4TA 1HE3A 4GWKA 1KY4A 3Q2KA 1GR0A 1P77A 3AK4A 2WJPA 1U2GA 4I9HA 5KJFA 5C7IO 3A14A 1OOEA 2BGLA 3UHAA 4GX5A 2X5KO 4IIVA 1LSJA 1H6CA 1IZ0A 3UFXA 3WGGA 3WGQA 1TB4A 1BDBA 3N58A 4YJHA 2O3JA 3GN2A 2PZJA 3DAFA 4RQTA 3QVWA 1XLTA 4OKIA 1EE2A 1OC2A 3C8MA 4W7HA 1BXKA 4YAEA 1PZEA 4E31A 1IHXA 5FI5A 4PLVA 3F1KA 3NTRA 3GGGA 4MINA 1TA4A 1GTMA 5BSFA 1H6BA 4NBWA 1HYGA 3IKVA 5HBRA 4BIIA 4DC1A 2AG5A 2J3HA 1AHHA 3JQDA 1NX6A 4IMRA 2AQHA 2X8LA 3JV7A 3LF2A 4IQGA 1V8BA 1R4MA 1MFPA 3OEYA 1J6UA 1YB5A 2GRAA 3WGIA 1H2HA 3STHA 4RCVA 2J5QA 2DT5A 4OAQA 4CJXA 1X1EA 2IXBA 5U1PA 1PJLA 2HK9A 1EFKA 1PQPA 1E1NA 3CPSA 5JXWA 3ZV5A 3D5QA 4OQZA 8ADHA 4PRLA 2G5CA 2UAGA 3BTVA 3H9QA 3RI3A 2X5OA 4ND3A 4O5OA 1KVQA 3TZKA 1LDYA 2I66A 1JDJA 1ULSA 1Q2XA 2EV9A 3F4BA 3AUUA 4RL6A 3NEPX 2HMSA 4BNKA 4K1LA 2EERA 3DXFA 1E3JA 1Y6JA 4DVJA 3RC1A 3FSRA 1HDOA 3JQ7A 4XGKA 4BNYA 3PI7A 4M86A 1NNUA 4UUMA 1BXGB 2NLOA 2XF8A 1MUUA 3DHNA 1DB3A 4Q9NA 4CMAA 3E18A 1Y1PA 3OM9A 2QRJA 2I9PA 1ZSVA 1I2BA 3WICA 1ZK3A 3ZWNA 1R16A 3ZDFA 5K0ZA 1HT0A 3TQHA 2IRWA 5HS4A 1LU9A 4HXYA 2W2LA 5A3JA 1ZFNA 2VT3A 1ZEMA 1Y8RB 1GY8A 1FDVA 4FC6A 5CEEA 4CM3A 5JNLA 1NAHA 4ZU3A 2IZ1A 4I5FA 2QYTA 1QKIA 2BF7A 3SLKA 5JAZA 2X4GA 2JCVA 2DUUA 3JQ8B 4BNZA 4DIBA 5L4NA 1ZH8A 1YBAA 4JGBA 3U4CA 3WSWA 3IIEA 5JS6A 1ZVMA 4ITUA 2GUGA 2H5LA 1PS0A 4DBVO 3C7AA 1HL3A 3CKYA 3CEAA 4NBUA 4CMEC 2VHWA 1I3LA 2VRCA 3MJSA 1PJBA 3O26A 2W2KA 3PK0A 5I8ZA 4PN3A 3E5RA 4GX0A 3R3SA 4O1MA 5A9RA 3ZI0A 4DL9A 2NM0A 3MOIA 3FWNA 3RWBA 4CR6A 4AJPA 2YYYA 5EESA 4RZIA 2DLDA 2C82A 3WTCA 1XG5A 1JKJA 3DHYA 4EDFA 3GR6A 3BAZA 4B8ZA 4AJ1A 3JQBA 4MVJI 1ZK1A 2Q46A 3Q0EA 3WWZA 9LDTA 4R5HA 4E32A 5FFFA 1MXFA 3AW9A 2D1YA 1U8FO 3PHLA 2V6FA 5LC1A 2WYVA 1E3LA 2Q2WA 3W8EA 1IPFA 4GI2A 3JQFC 4I9UA 4P38A 2DFVA 1XQ6A 4YEDA 5A03A 1UR5A 3H65A 4DA9A 5F3RA 2YDYA 1C3VA 2GZ3A 2CDAA 3DZBA 4F6CA 5CG1A 2O48X 4CQMD 2B4TO 2QRKA 1KVTA 4A27A 3QVSA 4CQMB 3JSAA 2QIOA 1CF2O 2EKLA 3GG2A 4WLVA 4CUKA 4ND4A 1LQTA 1A9YA 5I9MA 4HNGA 1LNQA 5T5QA 1IL0A 2GYYA 3GT0A 3TZCA 3TFOA 4R9SA 4UVHA 4QO7A 4M8SA 4YWJA 4HFNA 3D3WB 1PJSA 3ZWWA 2C20A 3WGYA 4AFNA 2Q45A 1ISHA 1P1IA 4FFMA 4L4SA 3HADA 4TSKA 2IZ0A 1HRDA 4TKMA 4CM8B 3GVIA 2EW2A 1UP6A 5TJHA 5IAAA 1QV6A 1U8XX 4GMGA 1WZEA 3X2EA 2GDZA 4WECA 3PQDA 4WLUA 3AI3A 5DBIA 3DZGA 5DNAA 1D4FA 1QXSA 5IFLA 1LDMA 5AXAA 4BKUA 2Q1WA 2GR9A 1O9BA 1SEPA 4DPMA 3IP3A 3WQQA 2J5RA 3EMKA 5EL0A 3ANNA 4NH4A 5JAIA 3I4FA 3QVTA 1X1TA 4E5NA 3COSA 5JLAA 3MJTA 5EQFA 5L53A 2EHDA 2NNLD 4XYMA 1MP0A 5EQDA 3GC6A 2EJVA 2R2GA 2DFDA 4BO7A 4IJVA 3HZZA 2P2SA 3L9XA 3F1LA 4L75A 1HDXA 1PS9A 3QE3A 3BIOA 2D5AA 5JBIA 2PR2A 3KYBA 4CM4A 1EDZA 4BO2A 1WZIA 1C0LA 1WAMA 1NR1A 4J4BA 3DMTA 1M66A 3IP1A 4PVCA 4CM6A 2PZLA 3JCZA 4H7PA 3LT0A 1C1XA 2FHSA 4R01A 3BA1A 2O3TA 3OIGA 1SO8A 4Z3DA 4RPJA 4FQ8A 4IQ8A 5LDGA 3C1TA 3RROA 4BGEA 4ZGWA 4BNLA 4CPDA 5EMHA 2JL1A 1DEHA 3I5MA 1DAPA 3TSCA 3ASUA 2XPCA 4AJKA 4EYEA 3L4BA 1KERA 2HUNA 3S2IA 1U5AA 2G76A 1IOLA 3EAGA 4MVJM 4N54A 3RU7A 2B4QA 3PHJA 3GVXA 4CMGA 5F1OA 2AQ8A 3ZN2A 3UN1A 1E6WA 3MJ4A 4O59O 5F5LA 4U0JA 2E49A 1E3SA 4M55A 4ALNA 4GMFA 3RCBA 1EDOA 3JD2A 4OSOA 1FXSA 4LK3A 1PGOA 2JHFA 4E5MA 2VZ0A 5IG2A 2JD1A 1N9GA 3GY0A 4E2XA 1P3DA 2EW8A 5KVCA 1D1SA 3SVTA 4OOFA 1ZMOA 4XYBA 3VPSA 2JFHA 2IYOA 2Q1TA 1M67A 1KVUA 2YFHA 2I3GA 3F4LA 3PWZA 1UXJA 3IQDB 1OFGA 3WMWA 4GWGA 4XRGA 3MZ0A 2YFQA 4MDHA 1DPGA 1HDCA 3GDGA 3JQBC 3RUEA 3Q6IA 4XQ9A 4J6FA 5K9ZA 2VYVD 1DDOA 4R1SA 2I6TA 4BNWA 1Z6ZA 4BV8A 3Q9UA 1K6XA 2UYYA 4KOAA 1HDGO 4FN4A 4BNXA 3ZNNA 1LC0A 4L4RA 2YHUA 5JYEA 3Q11A 4R9RA 2BKAA 4R51A 3B1FA 5LCXA 2OMEA 3JYPA 1Z73A 3ROPA 1T2FA 4IINA 5DCWA 3DZIA 3K92A 4GX2A 3ZU5A 3PFFA 4R3NA 4OYRA 3GZ4A 4LVUA 5ER6A 1YBMA 1QYDA 1GZ4A 3MWDB 2V6BA 2GD1O 3CSDA 4BGUA 1SMKA 4K6FA 1UZNA 4U0KA 1HTBA 3RBVA 1HWYA 4XR9A 1SZJG 5TT1A 4CQLA 4TZTA 3DZKA 1A4UA 4JP3A 2H6EA 3C7CB 3ONEA 2R6JA 3H3FA 1J49A 3LK7A 3OH8A 3FPLA 1MFZA 3RC2A 4HFMA 1C1DB 3LSYA 4PZEA 3DBHB 4QO8A 3F5QA 3JQCA 1ZJZA 2DTEA 3L6DA 2GPTA 2YZ7A 4XDZA 1HYHA 5AVOA 3RJ9A 1QG6A 3JQ6A 3OQ1A 3BHMA 2HMVA 3PP8A 4YJFA 4CV1A 4QT0A 4XQCA 2O2YA 5EPOA 5T8KA 1E7SA 5KVSA 2WWRA 4E5KA 4MIEA 1A27A 1P1FA 4TROA 1GUFA 3C3XA 3VKUA 2W4QA 1U3UA 1B8UA 2AA3A 3G0OA 5C37A 4Y6SA 4HADA 5KTKA 3B70A 4M49A 4J9VA 3VPHA 4CM9A 1UXIA 1PL7A 1U5CA 2YV1A 1YDEA
chains in the Genus database with same CATH superfamily
3LY5A 1USWA 4MUIA 1S4QA 3IBCA 1ZD9A 4INAA 3MPOA 5KNDA 1KR5A 1P1HA 4YMVA 4MVWA 9LDBA 4JA2A 1S9HA 2V3VA 3IQHX 1CVLA 3ZDDA 2W8ZA 3T7RA 1JJBA 2QLBA 4ZREA 1L4GA 5ILQA 4BQPA 2I7DA 5EWJA 3D3JA 3KTAB 2RHWA 1DUSA 3R09A 1UIRA 5B37A 5K0LA 2EKBA 2OCPA 2V58A 5K6AC 3GRPA 4AD8A 1P5RA 2B94A 4ZDKA 4N3AA 1EFLA 2YUTA 4RD0A 3HYLA 2G28A 1IN7A 1ZGJA 2ROQA 4XX0B 1E6MA 3DV0A 5FULA 2QJWA 2ZU0C 1GQSA 1T2EA 3L0IB 2XB4A 3GA7A 3C6BA 4JJFA 2OSBA 3GO4A 4Q0MA 3L8FA 4ETIA 3BHNA 3L6UA 4CKWB 4MUMA 4DJTA 3PL1A 1D9XA 3M5PA 2P9EA 2WJWA 4NYJQ 2NU9B 3TECE 1IHPA 1ZESA 2VNJA 3CE6A 1WKCA 4EABA 2CL7X 2H48A 3PQ5A 5EP3A 2AIRA 4QX6A 5LWHA 3WAJA 16PKA 1HTWA 2PMBA 1FFXB 2ZXEA 4MKRA 3KJQA 2V7QD 4UZFA 1C8KA 1R50A 2JFVA 3OLCX 4L7VA 5LP6C 2VAVA 2N1MA 1FFBA 1W5FA 3IDSA 5HQ3B 1M72A 3R0QA 3ONVA 3QJGA 4UUNA 1ADJA 1NVVR 2AJBA 3KWLA 2XYVA 4LI3X 1DAIA 3L8CA 4MICA 1AXGA 3DMDA 1NR5A 5T41A 1NXOA 1K1EA 1M2WA 1SK8A 3GI1A 3H19A 4P4TA 3UWPA 3Q7SA 3C4JA 3NUGA 4HQFA 4IXWA 5CX4A 2J4FA 4BKOA 3I23A 2IE0A 5KYNA 2D1RA 1I01A 3FJYA 5MN5A 2WKQA 4HDCA 1F0PA 1P7CA 1UPCA 1QGUA 1X9IA 1EEHA 1CQZA 1XZGA 2CF6A 3ASYA 3A11A 3C1AA 5AKZA 3MOGA 2CLKB 3CISA 3V4PB 1D3AA 4R8VA 5CPBA 2PNJA 4GW3A 5ILOA 5J40A 5J4LA 1YGPA 2XRFA 1D4AA 4QUGA 5DPMA 1HEIA 3HVRA 4TL8A 2ZVPX 4Y6LA 1GZHB 3KDPA 3QNMA 3TNLA 5LXTB 3WQRA 3OAAD 3HGTA 3G89A 3K15A 2IJGX 2APJA 4XR4A 1IONA 4F3YA 1Z6AA 4OI4A 3FUVA 4BVKA 2Q4BA 4G24A 4KWIA 1E6EA 1K7CA 3GZNB 3GNTA 3WWPA 1DV2A 1H4QA 1DIGA 2G1KA 2ZJ3A 4MB0A 3QJ5A 3EPPA 2VG8A 2PKQP 2GXUA 2QZJA 2IYLD 2Y6VA 1EZZA 5IBQA 2HEIA 2Y76A 1XRLA 2ZWAA 1J1IA 1K3TA 4YDQA 4Y1FA 2X15A 4YBZA 1OVMA 3UK0A 4GGOA 3VYWA 5L4SA 2YWFA 3DZDA 4IHKA 3K20A 3KLOA 1PJTA 1VECA 3FKSA 1WP9A 4EPYA 4HVAA 1ZK0A 2R97A 4S12A 3UMVA 4L85A 4ZEMA 4UPDA 3IPRA 4PN7A 1JWBB 2EATA 3K31A 3S8MA 4FNGA 5DM2A 3QE2A 4ZJPA 3KSBC 3QSGA 1B8VA 5DHQA 2C9BA 1MA0A 3PUXA 3O4HA 3W8DA 4GOND 1DHRA 4XB6B 5DYWA 3SC2A 4GH5A 5IKOA 4C0KA 4JP1A 1RPTA 4A2WA 2XLCA 2YHIA 4FS3A 2FP3A 3OZCA 4BVGA 1KF0A 2QTAA 5AKGA 2MHCA 2E5WA 2I4NA 3CM0A 1TO6A 3LDUA 4MRMA 2TECE 4B7XA 2Q4OA 4J1QA 4O4LA 1QP8A 3CW8X 1VMAA 3FPBA 3V46A 4JYMA 3UH1A 1PR5A 3PF8A 1D04A 2O2CA 1XZBA 4ALJA 4V1CB 2I6QA 2QRHA 5JFOA 5KWIA 4ZEOA 4B75A 3PNVA 1K7SN 3CEJA 1W6RA 2RGEA 2XJ4A 4NCBA 4X6UA 1Z5UA 1BO6A 1SXJC 2WT9A 3QU7A 2D2EA 4MMYB 4WXPA 3G13A 2CE2X 3GP8A 5CDFE 5CH5A 5JU6A 4QASA 4RHFA 4C4TA 1ISIA 1GARA 3R7LA 2GM5A 4Y2HA 5FNVF 1P0PA 1Z2OX 3O92A 2WUDA 3QY0A 3VGPA 3OZAA 1M34E 3QZUA 2CL6X 2HWUA 1KZ9A 2WR8A 4R2LA 4Y2SA 1ISJA 4LOHA 4RC9A 1G64A 3VH3A 5FOSA 4KNYA 1JXQA 5T8KC 1W35A 2B4YA 2IEDA 1YE3A 2ZRAA 3NM5A 4C4YA 3NGLA 3WMFA 2M32A 5B2FA 1I4LD 3EB9A 4PBRA 3UANA 3DDSA 1F8FA 4DQDA 1ZA1A 1GM5A 4OF4A 4BVFA 2Z6UA 1BS1A 1VP9A 2VHEA 4OHPA 4QBTA 3ROMA 1KOJA 1SM4A 3IUSA 4B44A 2BHTA 4AMVA 4KTTE 4B6OA 4D92A 3O31A 1OAAA 2WSBA 3JWJA 4HPJB 4DJDC 2GWHA 4H35A 5KTYA 1L4MA 2JGLA 1MMFB 4Q3AA 2QLFA 3GEEA 4GWLA 1NJ6A 1KEZA 5CGZA 5C3UA 1QF9A 1AK1A 4DARA 4B74A 2VATA 1R6AA 2NNWB 3KUDA 3R2JA 3ESYA 2LGJA 3O8CA 1VL5A 4II3A 2X6TA 2Y92A 3AUAA 2BCGY 3QLEA 4A26A 2J41A 4ARSA 2N0SA 4FNMA 3IODA 5AM0A 1JG6A 5DNCA 5LLTA 1OPRA 2AX3A 2QLLA 1TYDE 1M1YE 4BKRA 2G6BA 3T0GA 1ESDA 1CS0A 5FWNA 2C4NA 3W2EA 2G1AA 3SQMA 4ZTZB 5CXXA 2Q3BA 4M60A 3B1WA 3H9UA 2ECQA 4Q3NA 1PJ4A 3SQWA 2P0EA 1X14A 3KJZA 5IAGA 5BORA 3PPWA 2O7NA 2Z2JA 1EGVB 5K8JB 4MP6A 3EQ8A 1PVDA 4KUHA 3MMNA 3DLTA 5CH8A 5AW2A 2J67A 2MSNA 1ZM7A 4WK6A 4BNUA 1NLZA 1P39A 1KNQA 4R1QA 3KR2A 3WZ2A 2D59A 2PAAA 2X1MA 3KTFA 3NHWA 1DRJA 5JSYA 4C5AA 3BDIA 5BN4B 1HT2E 3P9KA 4QUIA 5G02A 4PBSA 4X7PA 5JVDA 1QFMA 1QQBA 1LLUA 5AIAA 4WOJA 8LDHA 4FE4A 1P17A 5LOVB 2ZSIA 3ZY3A 4LDAA 3V4VB 4D9IA 4E5UA 3WYNA 1ODJA 2ZI6A 1GPUA 4LC1A 3B1XA 3R3YA 4REOA 3F3YA 3GGJA 1XMPA 4CCYB 3AY7A 1CUJA 1BU8A 3AO0B 1V2HE 3HP7A 4QYMA 4YQEA 5B58T 5L7WA 4I2NA 3E0XA 2Z98A 3I12A 3PL5A 3PXGA 1LC3A 1W0KA 5KQMA 2EXXA 2HRZA 2XGSA 4WBNB 5CJ2A 1SU8A 1E8MA 2JDID 3D8RA 3BQMB 1SEVA 2C1EA 1J0AA 1K6IA 2VQDA 2VF2A 2W4MA 3MRTA 2DWUA 3NS7A 5KYWB 1SC3A 5B57C 1UDWA 2R8RA 2KE5A 3THSA 3Q8MA 4JX8A 3TAUA 4Q3KA 2GPBA 1JHXA 2HO5A 3PD0A 1YA8A 2GHTA 4RL4A 1RD4A 2VWQA 4G1BA 3A8TA 1TW2A 1MABA 3CLHA 3HCCA 4S1OA 3ZNPA 2QDKA 4YQFA 2JAHA 3AI1A 1LZKA 3BFJA 2D1FA 4C5BA 1G5HA 3KE8A 2X3UA 2PWZA 4BECA 4IX9A 2AVNA 1U3GA 3CLUD 3IB3A 4YV2A 4M0PA 5HKKA 3EQ2A 4I81A 4I5GA 2CMHA 2F8LA 4M21A 1L1QA 4IDOA 4J29A 4LRTB 4UZSA 4FB4A 1M5RA 2CCKA 3DGEC 4EO7A 1WX1A 3GFPA 2JCYA 1ZIDA 2WJYA 3HJFA 1UPAA 1NPTO 3M81A 3QPCA 3N2YA 3W2FA 1O77A 2FOIA 2ZUVA 4KITB 4NOKA 1VBKA 5G0VA 2H07A 4UHHA 3F2VA 1Z4OA 3CSSA 2IWHA 3CO0S 5HWSA 3KHUA 1ODCA 1O58A 4PICA 5AWFC 3GRFA 4F6RA 1W4CA 1PGJA 2GOYA 3OF5A 3VDMA 2IDZA 3NH6A 2TMDA 1LLQA 1Q0TA 4PYQA 2V55B 3USCS 2F4VB 3PVZA 1CVRA 2B6NA 2WNHA 4GVXA 5HS6A 3KZNA 1XU9A 3CH5A 2JI6A 4LZNA 4K3UA 4CT0A 3ZCSA 1T1IA 2ABWA 4PTZA 2HA3A 4JVSB 3ON5A 3JPWA 4N39A 1Y8RA 5A0FA 4YRGA 4JLMA 3RVPA 1J0XO 3P20A 4H4EA 4X3CA 4UHBA 4HXFB 3GWGA 3ZNOA 1W34A 1I94B 2R6HA 2IDMA 3OZXA 1XRRA 2PT6A 4ZRNA 3BH6A 3NIDB 3NALA 2Z83A 5C35A 4MKHA 1OFIA 5EIFA 3JQ8A 4QAJA 2XMSA 1PV2A 2Z4RA 4WCDA 3AVOA 1YDWA 2AOUB 1R0XA 3LUFA 3MF4A 4GRAA 1WDMA 1IOWA 3F9RA 1RLJA 3KLPX 2Q28A 3OD1A 1DC5A 4FQ7A 4QGBA 1RPZA 4N47A 1NU8A 2ZIGA 3AFOA 5DNUA 3ER9A 4YMSA 3WKBA 4Z2YA 2E0IA 3X1DA 3GGOA 2Q3FA 1TLFA 3R7AA 3QBEA 5C80A 2VYND 2X0KA 4EMBA 4LYJA 2JAXA 4O2RA 2GVNA 2J7KA 1Q44A 3INNA 4QAQA 3WYFA 1ZY2A 3K3PA 4A0QA 1T3ZA 3HA3A 3VAZA 3BKWA 2AI1A 2Z8ZA 4ZDIA 2C4MA 4E4RA 2XNHA 2SCUA 5F33A 3M33A 1FLVA 3H5WA 4F5YA 1VPEA 1VKOA 3GPDG 4TTAA 3WL5A 4C7BA 5BQOA 4BB5A 1H2EA 2CLDX 3MMSA 4A7PA 1IJBA 1RAEA 4XUCA 2RAUA 2C29D 4RVGA 3IPCA 1Z7GA 2VF7A 4B2LA 1XB2A 2AD1A 2YIMA 3EG9B 2QL7A 2WF7A 5EMNA 3E58A 3ORRA 3KBOA 2PUCA 5AH0A 2OM2A 3LFUA 4R40A 2QD2A 5KWSA 1XWWA 5IF3A 4DKXA 1VMIA 1CJMA 2FWRA 3D0QA 3DDZX 2R8OA 2YIVX 4IYRA 3LL4A 3OETA 4ZQFA 1KIFA 1QZZA 2NU7A 3OLZA 5GGXA 2H5EA 3THWA 1CS4C 1X86B 4DMCA 3QMWA 4BB0A 4MPTA 2XVXA 1JHZA 1TK9A 4ND1A 4B9AA 3CQ9A 1IY0A 3M5WA 2AUNA 2PIAA 2VHVA 1VFPA 4GLFA 2BEUB 2WWHA 4FOOA 2WI8A 3WLEA 2GCOB 5DW0A 3B2NA 1PEKE 2QG6A 3AWIA 5J3JA 3P2YA 5LSAA 1KMMA 2PZBA 4DGSA 1M7HA 1SXPA 1T43A 1T1GA 1G60A 1E9CA 1D2MA 3D6VA 4GZ5A 3U9LA 3FDXA 1U1EA 1AB6A 1ZMXA 4LY6A 3U3ZA 4A10A 2VQ3A 2XDAA 2F3UA 1E7MA 2R6GA 3NT2A 2HB6A 4KUEA 1P9RA 1RRMA 3L7AA 2GTHA 5KINB 4B48A 3CNHA 1U0RA 2H2AA 1ZWKA 2C3OA 2GDJA 2J3QA 3A32A 3GAMA 3M9LA 4ZVUA 4RELA 2PUBA 3NHKA 4G2NA 1IQUA 5AK3A 4CIXA 4B3JA 4B47A 1EFVB 4RJLA 2V7XA 3DOFA 4C08A 1PX2A 1RBZA 3IKJA 3CF2A 1X94A 5E9AA 4YACA 4MQ6A 3NBXX 4GLOA 5K0CA 1KQPA 2AXNA 1E2EA 4A6DA 2GJSA 3JYOA 1E2MA 3LD9A 2ZIZA 1DL5A 3CZPA 3SR4A 1H2BA 2P6NA 2GF2A 3U5ZB 1RQRA 1Y4DE 3ZZTA 3EUAA 3M6VA 1T0HB 2H54A 3WB1A 4CT4B 1T36A 1GZSA 3FYDA 4UEWA 4Q21A 4KG7A 2YW2A 1K89A 2IGBA 1Q3HA 5CITA 3CVXA 1GYQA 3VFDA 3SXJA 4L9RA 4FFOA 3TX6A 3Q2IA 2C5BA 1LK0A 2YWEA 2JVIA 1EQ2A 4LHWA 4NFHA 3ZGXA 4BP3A 1X7HA 2VLIA 2WJIA 3S55A 4DBLC 1DWPA 3AR9A 5CDFA 4IVNA 3DOOA 4KQXA 3EYAA 3U31A 3L1JA 2A7QA 4MV5A 1LPMA 5FB3A 3UAYA 3WNDA 5K45A 3SCZA 4I1VA 1CPYA 1CZLA 1QK5A 1AHNA 1GCAA 4UD2A 4ZZ2A 3LYAA 4HNTA 4LF4B 3HCBA 2EDCA 1H05A 2JIZD 2KBFA 3VR5H 4JT4A 4D6YA 1Y7PA 3EWSA 2HOQA 2XYRA 3NWOA 5LQRA 4CFYA 4MS4B 3SE0A 3GNLA 4LYAA 1JS1X 1UMBA 4UCQA 3GPIA 1OAOA 1C3OB 1V8DA 3E9QA 4BV9A 1FMFA 1MOPA 1HDYA 5AXDA 1ZGAA 4V38A 4LX0A 4FYMA 2H57A 5CNJA 5L45A 4DA8A 1P7PA 3SEAA 1V4VA 3KB6A 4Y0AA 4LECA 3NEJA 2PWAA 3KVOA 5FNVA 2RI1A 4IMPA 2BGMA 4TKVB 4RK5A 4B81A 3WO0A 1A9SA 3FAZA 2F1OA 4MYTA 1RRGA 1U8CB 5KU1A 2PJRA 3FA2A 4JS0A 4GRIA 2JIRA 4NYMR 5A3VA 1IM5A 1VM6A 3OPQA 4QBGB 1NV8A 5C31A 5FEUA 2WYOA 1N2JA 1P31A 3ANSA 4UMDA 3V1KA 1Z25A 2WKSA 1XKQA 1Y34E 1Y8AA 3ZS9A 5LQNA 2ZAIA 1OBCA 3AJEA 5KNBA 2DH5A 2BFFB 3FOWA 4DEYA 4DV3B 5B1IA 4Q3BA 5DCUA 2Z9BA 4W1SA 5FFMA 5FV7A 1XLUA 2IHVA 1CYEA 4Q4CA 5KREA 3W8FA 1H6AA 2P9QA 3ICOA 1CIJA 3DMYA 4U6QA 3E7XA 5J5AA 4ETNA 5IULC 4X44A 3C74A 4B8WA 3EEIA 5KOHA 4C78A 3AOEA 5FWAA 3M49A 1UMCA 3DO8A 3D5TA 4XGQA 3VPXA 3H8WA 2B5OA 2C3YA 1SUDA 1JAIA 5DXJA 5H70A 4F2WA 2ZYVX 2QTVA 1I2AA 2RIRA 2W22A 4TTPA 1PJZA 3VTFA 5FPTA 3ZUPA 2QD4A 4YV7A 5HQTA 1JIXA 2O3RA 5L7TA 3OJLA 2HN9A 3BB3A 3X44A 4BMDA 3GZTB 1DO2A 2SICE 2IZZA 4ZVMA 1DJNA 1M73E 3SIPA 4R3WA 4G01B 3B9PA 5HZGA 2D2XA 3DE6X 3BH0A 4OU4A 5AQEA 4JKYA 3ZDZB 1P80A 1TT7A 6Q21A 2X9LA 3KETA 4B71A 5H4HA 1LLFA 4UD6A 4UKDA 4COOA 1G55A 3G8CA 2XE7A 4UHJA 2CNKA 1SG9A 2CLMB 2YS7A 3ADKA 1EDEA 4C5CA 1ENYA 2IHBA 3CZRA 3F0TA 4JJ4A 4O8ZA 1LF0A 1DWUA 2DJ5A 3QELA 1DC8A 1OUMA 2RKWA 1OKKD 4L8GA 4MGIR 1VIVA 3IAHA 1T8RA 3E5MA 2R96A 1YJAA 2IXFA 2MU1A 4WUTA 1L9KA 3ET4A 4I4CA 4YP1A 4BB6A 2GFIA 4A36A 2I34A 5JNSA 3I09A 5D2CA 4QPJC 2IH2A 3RFCA 4ZT7A 1XAIA 2VYQA 2HMWA 2RKOA 2J6IA 3L4SO 2QV7A 1US8A 4GC9A 4C4XA 1QZUA 2H9AA 4IILA 2IIVA 4WAUA 3GEGA 1S02A 2I5PO 4LWPA 5AHXA 3SEQA 2BFAA 2J9YB 4EHBA 3PYXA 1HPLA 2WFAA 2XKJE 1Y5RA 4PZ9A 1PX0A 3UVEA 3V7NA 2VO1A 1SH7A 2WHQA 5AOBA 3HNPA 4F3KA 1EFCA 4NG5A 2D06A 3DHWC 2JGDA 1Y3DE 4D9MA 4GU5A 4LNUA 3WGHA 3OEWA 2M6RA 4HO1X 4NHEA 4IJMA 1B76A 3VVBA 4PYRA 3X1KA 2OCAA 5AW9A 5FOQA 1TQDA 2AZMA 2BJWA 5AW0A 3PXDA 3TOZA 4HDOB 1GAEO 1LTQA 2YJTD 4RLFA 2ZBDA 3UTDA 3VRHA 4RA9A 2O2XA 3D6TB 4RZ3A 3DNPA 3DPSA 3QPDA 4JC4A 1RZRA 3QOWA 1ECFA 2J5XA 3G8YA 2B83A 1PFKA 4IUBS 4KO3S 4BX0A 2QNIA 2D62A 1J5XA 2XWJI 4DC0A 4FYHA 5BSUA 2VN8A 5IT0A 4L22A 1VL6A 2GPAA 3IURA 4BJHB 2X7XA 1CUSA 3NW9A 3QP9A 3T1YB 4BPBA 1YKFA 5JEDA 1HQYE 1BDJA 5DJ5A 2I03A 4BEVA 1KEPA 1AU9A 1E0JA 1VSUA 2VSXA 5D1NA 4C0BA 5T6BA 1UIMA 1L7BA 4OEHA 2PSHA 5F35A 1QS0A 1ISSA 5ALDA 2EIHA 4D4IA 3KYDB 4JXJA 4ZFNA 1X1BA 2CLOB 1Z6XA 3FPCA 1M5TA 2M6SA 3VSEA 1TOAA 3HCRA 3M3DA 3FPEA 2W70A 4YV1A 4D43A 4MQBA 5LA6A 1PYGA 2UUAB 1MOSA 2E4ZA 2I7XA 1NN1A 3ECSA 3UHPA 1WTAA 2NO0A 4CRWB 1RM4A 4KYIB 2PR7A 1KYZA 3D54D 4ER6A 4MS3B 4PBTA 4WCFB 1IB0A 3AT1A 4EYSA 1YIOA 4JR1A 4OHFA 2WD8A 3RC7A 1Z82A 2I62A 3ZE2B 4BCCA 4KX3A 2P3QA 2REBA 1UEIA 4PAQA 1HC7A 4E33A 1T6YA 1K5GA 1UAGA 1XWIA 3FZYA 1QZTA 1DARA 1JEAA 4LE0A 1E4EB 4MVJD 4XX0A 4AROA 4EYGA 3ZW8A 3AEXA 1IAVA 2V6GA 1LKZA 3NHBA 2AYZA 5CEFA 1BROA 2R25B 3UENA 4ER3A 1IBLB 1FVHA 1S4MA 2E6KA 1WXFA 2WK1A 2VLBA 1HF3A 4WY5A 1OAOC 4UPEA 2NU9A 1JDUA 2J30A 5TS3A 5I4CA 1I2CA 6ABPA 3NWBA 2JD2A 1NC3A 4JY7A 2XXAB 1CCWA 2GHIA 3FYTA 4AQ7A 1FFXA 4Q4HB 4U6SA 4YHBA 1A9PA 4D9EA 2V74B 3K53A 4W1PA 4YONB 2EG9A 3SF8B 5AI8A 2V7QA 1W1WA 3FAKA 2OBNA 1CQJA 4EB8A 1JU3A 1Q11A 3JRNA 5DBOA 2Z6AA 3CCBA 1D0VA 3LX6A 3HO1A 4OFWA 1RQXA 3SS7X 3E1KA 3UGTA 4DV4B 2JH8A 4EO9A 1T5OA 4ZTBA 5I7AA 4RSGA 5AVSA 1VIYA 3HFRA 4QDJA 1YWGO 1HNZB 4I08A 4NG4A 1D6SA 3MGAA 3AR7A 4D6PA 1WB5A 4L08A 2IPMA 4GQBA 4U7JA 1NP7A 1E4YA 4WOKA 4BLWA 4CLDA 4NMXB 1A0OA 3WMXA 2D0IA 2H29A 4U6NA 1FFHA 3AOEC 1YRYE 3HABA 4JT9A 4UCXA 2OGWA 2DY1A 1PAUA 3E7FA 4EECA 2OK8A 2HF9A 3TLZA 2PZFA 1NP6A 4Y98A 4BVLA 1CJSA 1B8PA 3K6KA 5LXTA 4U8HA 3CX8A 2NZ8A 4OI2A 3TLEA 3GLKA 1XEAA 3WK6A 1RCUA 3FCSB 3TG2A 1DIBA 1UZUA 4OQFA 1E2PA 2CZQA 3OAAA 1MJNA 4F2PA 4WJLA 6REQA 3BK7A 1XVTA 1ZU5A 2ZPUA 3GZNA 4JC5A 4KPYA 3S5JA 2E1RA 2G0TA 3DFKA 3W5HA 2N46A 4QSHA 3TM4A 1YZTA 1LDBA 1VIDA 3PG5A 3RVKA 4WOBA 4FCCA 5JS2A 4DQ0A 5CCBA 2FWBA 1ICEA 1NBIA 1X0XA 1K6EA 4QGHA 3LQFA 1GU0A 3N8GA 1SUIA 1PWXA 1JXAA 1SUCA 4D5GA 2HTFA 1LRJA 1X8LA 1IEWA 3M1LA 4ZZ0A 3R0VA 2MYNA 2QYSA 3COVA 1XCBA 4CV3A 1U0LA 1CZUA 2PUVA 3AHFA 4H15A 3U7HB 3LZCA 2FPGB 3EIUA 3E1SA 4XH9B 2IV3A 1I4DD 1MX3A 1Y6ZA 3ANYB 1CY1A 1EH5A 1U1GA 2OGZA 1N8KA 4N49A 3HBJA 1XT6A 2LDBA 1SB9A 2DHEA 2ENWA 2VDNB 2H4HA 5DYGA 4C7KA 1NRXA 2GXQA 2P27A 1UC8A 4PZDA 5CH3A 3KJXA 2DETA 1QC5B 4PZPA 1T25A 5IT5A 3HU5A 3VM6A 3IIMA 1UBSB 3EGXB 3ZWDA 1Z4KA 3OJWA 3WGMA 3HRHA 3TPZA 3AP2A 4TX1A 1MNAA 1QQAA 3RAEC 4FKMA 4MKZA 1Q6ZA 3H16A 5DHRA 1PDOA 1USUA 3OJOA 4JX9A 4ZCLA 4M4SA 3BWXA 5K6RA 4JB3A 3C5VA 3BCSA 1LJ8A 1Q83A 5CMLA 4Z8YA 2R47A 1N34B 2PX8A 3GXBA 2G5PA 3E22B 3FVWA 4EZEA 3CU5A 5K4HA 4AP5A 2NO1A 4YDHB 1RKBA 3JZDA 3TZQA 2COKA 3VNRA 5AVUA 3LJKA 1SIOA 2NSLA 2EJTA 5T57A 2VHTA 3IRVA 4AKGA 4RMIA 4YO7A 4ASUA 2C7GA 2W7TA 1AGYA 4OKNA 1RQ2A 4PGGA 5ESXA 1JTFA 1IG3A 2F90A 4QYIB 5FTNA 5SY6A 2HBZA 5TEVA 3ZZNA 4E5PA 2DC1A 4P7BA 3OHSX 5D7BA 5ALLA 1HLPA 1L5MA 2AK3A 3MPUA 1BMFD 5E4YA 1USGA 2DUNA 3EFHA 3G2NA 4BFVA 4DEXA 2BIFA 4Q7QA 3KQUA 4KR7A 1YK0A 2NAPA 1W7AA 1U31A 3U3XA 3G85A 5KWJA 1FRZA 2FWJA 4KXMA 1ZMTA 2MIIA 5LU8A 2PX5A 2QX9A 3W5BA 2PA0A 3S28A 4K9KA 1GL3A 2FFHA 4YYZA 1TK2A 3TB6A 3BMOB 3F5MA 4GPZA 4NE9A 5LQKA 1TMKA 5FLEX 3NTVA 1NSYA 4ZQHA 4M9CA 4JJEA 5D00A 3U13A 2HDOA 4A8HA 1FJXA 4J76A 4W5HA 1UM9A 2HO4A 4M36A 4E6EA 2O8DB 2JPDA 1XTJA 4UDYX 2HPZA 1D2NA 4MV6A 5MDHA 1SD1A 1X1RA 4PC1A 1YZGA 3ZZ0A 5KSYA 2WJ6A 1M1UA 3O9ZA 1E2GA 1AGXA 5HOQA 5ECWA 2Q0QA 4PNEA 1WQ3A 1DADA 2IYUA 4G5SA 4P22A 1AQJA 2H7XA 3D59A 4IWYA 5HM8A 3AFNA 3ND9A 2EWMA 4EF5A 2C96A 3ABSB 1DIOB 1FBTA 1KMNA 2QSYA 4JROA 5J59A 1YZUA 2XGMA 3E3AA 3R7BA 4M1MA 1CJVC 2F6RA 3OMLA 4NS4A 5F2EA 2Q6OA 1FP6A 1GZUA 2FR1A 2GEJA 2GN9A 4DLKA 2HJRA 2RCNA 1YONA 3MAAC 1I5OA 1L9XA 1K9SA 1WXQA 1R0CA 4IDAA 4MOWA 3KB8A 3KQVA 4DILA 1BA3A 2IOFK 4N40A 4NBLA 1ZQ9A 4M38A 1QAMA 1UFOA 3EA4A 2CB9A 3PA6A 1LI7A 4IMJB 3NT5A 3G7NA 4P5PA 4AP9A 3I4CA 4M0CA 2HBRA 621PA 4HAXA 1TRKA 1J33A 1KI6B 4Q7LA 4S24A 1XZDA 2C57A 1A8IA 1RYMA 3EIEA 5BN4A 3BKXA 1HMYA 2V54A 3DKPA 3R0XA 2AJ8A 4NFYA 1OB2A 2ZCVA 3BJMA 1YULA 3DT8A 1VLHA 3SFVA 1P7YA 1N4AA 1NF9A 3BE4A 3HJNA 1R5BA 4RU1A 1EXNA 2P62A 1R0YA 1TF2A 4ITRC 1AQNA 4HD8A 3L04A 2NAFA 1Z6PA 4MLCA 4ARZA 1ND6A 3G8DA 4XJVA 4NQRA 3K2IA 1N36B 2EHJA 3CMCO 1PQYA 3RNLA 1UP7A 5UKDA 2O4CA 4CCYA 4UE2A 4H08A 5DASA 1MTOA 2WJJA 1SU7A 3AFIA 3H2SA 3H9EO 1DKLA 3B3JA 3TSWA 4EPWA 4G4SP 3X1YA 1T1SA 4JHLA 3ENKA 4ZGBA 1TVKB 1ZRNA 2JJ2D 2O2IA 3Q9LA 4WBNA 5EY5B 4EVSA 2HLPA 2WIFA 3HS3A 2G9NA 2DECA 1FNDA 2QYOA 4W6QA 4EHHA 2G7ZA 3ETEA 1ORTA 5F98A 3AUFA 1I4WA 1QB7A 4LMBA 5KYWA 2WFLA 3QWFA 3WIVA 2REQB 1TUIA 3MLEA 5KC9A 2JDIA 2FKAA 2QA5A 1RJFA 3HFSA 1UKYA 1S3SA 2O6LA 1JQ5A 3AB8A 4TXMA 2A84A 4F86A 4BEBA 3ZD6A 2PSFA 3ZGYA 2JCXA 5IKMA 3RTCA 3OUTA 3OQIB 3QVMA 1EBUA 3DR3A 2G5GX 2H7VA 3FCXA 3LU1A 3QLTA 4YB8A 3UGQA 3KEMA 5TNXA 4H0CA 1YUMA 1IUNA 4HI0E 4J8PA 4AECA 4F1JA 3KPWA 4FDVA 1WB6A 2HU7A 2ONCA 3C8ZA 3OLVA 3RADC 4RF4A 3RO7A 1M6YA 3R5XA 2C2WA 2Y1OA 3FJOA 5EJ8A 3VR1A 2XB8A 2XMPA 4NDAA 1JYFA 5EJMA 5NULA 2CFIA 2OZEA 1WF3A 2LPMA 3GJ3A 4DQKA 5GGYA 1T6NA 3SQOA 1SQGA 1Y4SA 2JBHA 3N9IA 5F76A 5I45A 4MJXA 5IDQA 1V9CA 1JNYA 4W82A 1G5RA 3R9IA 3PLAE 4HGYA 3O74A 1P0FA 1V9SA 3GRVA 2CHUA 3CF0A 2JI7A 4NMHA 1YF3A 4GM1A 4P0QB 1Z68A 3LRXA 1EE1A 4DJEC 4S04A 5IAEA 1Z6YA 4R6XA 3OE1A 5IABA 4LRQA 4Y0VA 4WNYA 3PGJA 2OO3A 3MILA 4FYVA 1BEUB 5T64A 3ITDA 1KQFA 1Y7TA 1ZK2A 1WMBA 4OQ4A 3P4UA 4RENA 1U8ZA 1SURA 4HRVA 1NE2A 2HV9A 3LUKA 1CUIA 2Q27A 2WE8A 3BSYA 1HRKA 2VP3A 1SKUA 3UMCA 3ZNQA 1T6XA 3ZCUA 2ZJ8A 1ZS9A 1NMXA 4KZKA 5FYDA 3L8EA 4TSRA 2VNSA 1CQPA 2FZ4A 3PKJA 1CEXA 1BN6A 4OQQA 3PT9A 1SPBS 3RS0A 4RY2A 4YAGA 3GD5A 3PDUA 1FFEA 5EIBD 2AFIB 4IV0A 4A0FA 5KDLA 1BJKA 1NKSA 2ZB8A 3DE7X 4K6CA 2F55A 3PJGA 3R7FA 5JY1A 2AOUA 3L40A 3MC1A 2XUQA 3QFSA 2HLDA 2VRWA 1M7BA 2G1UA 1DKMA 1L4NA 1JA9A 2XE8A 3HN2A 4N01A 5J2UA 3QENA 5JUWA 1EJ2A 4AUEA 1H5UA 1P74A 2GKGA 2RIPA 1AA9A 5JT1A 1OYOA 4L6AA 2YXNA 4Q12A 2WICA 3U4MA 5TT0A 2B2CA 4EHAA 5KYUB 3ZGZA 1CRQA 2VYNA 2QZSA 3EW7A 2BDTA 2WU4A 1IBMB 2OGUA 2OLJA 3IXMA 2G8LA 1K3UB 3L1VA 3RVNA 4A8JB 4G8JA 1WMDA 2GO7A 2JRCA 3GRYA 3L77A 1UBTS 4FCTA 4EJ6A 1U5BB 5D3MB 1W85A 3FRHA 3FZQA 1BJRE 2ZKIA 2GA8A 4ME6A 4TWJA 5C1PA 1E9AA 3KFVA 3OOEA 1JEYB 2YWXA 1OQAA 2G9ZA 2HU8A 2XUGA 5D7NA 5HEKA 4YVFA 4LHVA 4KXYA 2OGTA 1KZYC 1X8KA 2P4QA 2CXQA 2DB3A 3V80A 2CXNA 5ITVA 3OKAA 1HXHA 3SFTA 4BNMA 1YZHA 1KJNA 2XVYA 5H7XA 4RETA 2D1SA 2VUUA 1PYDA 2WHEA 4PNZA 3VJLA 4JJ6A 2W6MA 2I8CA 2I1VB 4FGJA 1YQ9A 4G25A 4GG1A 3ZCVA 1CSEE 3S7TA 1Q7RA 3I45A 5B1EA 4LISA 2BEUA 3AR2A 3MK31 1KETA 4AJLA 4TQ9A 4YJ3B 3SM3A 3PEFA 3SX0A 5FOVA 2XLBA 1HY3A 2H8KA 4U63A 4WSOA 2RG7A 3M4ZA 5EE0A 3DLAA 1Q7GA 13PKA 2IFTA 3GGSA 4G67A 3I9KA 3O94A 1ONBA 1X7GA 3KVNA 4Q3EA 1I3CA 3T5BA 3MINB 4EITA 4B3MB 4KWEA 2V6MA 2CBZA 1ZD5A 4G9EA 1N1MA 4IJ6A 4LJLA 4C7MA 2BM0A 1N9ZA 2ZBVA 1CD5A 5ALUA 2IYTA 1NWCA 3NWPA 2WWIA 1QIMA 3STVA 4E12A 1P3Y1 7MHTA 4MK4A 1LRLA 4N6OA 4DA6A 2OG1A 1YL6A 2NXEA 1JZQA 3QWHA 3BVPA 1RHUA 1RYZA 2WPNA 1QKJA 3STTA 1ONSA 4EB6B 3DW1X 4JSRA 4FB5A 1GQ2A 3D1LA 3LLVA 1IUKA 4JCCA 4KQIA 3TZ6A 3ZHCA 4KPEC 4Z4EA 2M9MA 4IS3A 1DEXA 4RYLA 4EWLA 1XCOA 2IC5A 1H2WA 3ABRB 3WLLA 2Z5GA 2CZGA 4RESA 1E77A 3CUTA 4EA6A 1JKIA 1XSEA 4GNKA 1T5LA 3RABA 3AX6A 3RWOA 4JNKA 3E9DA 3P9YA 3G79A 5CURA 3EVEA 4UHEA 2XA9A 4JB2A 3PEVA 1YE8A 4FOSA 2XCUA 1A50B 4MRPA 5DXAA 3SMVA 1EGQA 5IK2D 1EP1B 2E9SA 2XUIA 3CYFA 1YFZA 2JB9A 4KVAA 5E6UB 4EELA 4HLNA 3QKSB 4KN6A 1G17A 4MRSA 2VSYA 5EJ2A 2XUHA 5K0NA 4DYVA 1ABFA 4UPVA 3W2HA 2ECKA 4B3TB 2FQYA 2P3SA 1HZJA 1UK7A 3OCJA 2JFGA 4XQGA 2JFZA 4O3FA 4BCDA 4LSWA 1CY0A 1T3GA 2OILA 4DIMA 2IXEA 2XA1A 3BA6A 3EXAA 4D46A 2Q6TA 4OXKA 4XUDA 4ARVA 2JIZA 4IOMA 3U3JA 4A6EA 2O8EB 1ECPA 3H5LA 3VH2A 1HK7A 4OQPA 1CIVA 2ZSAA 1CF9A 4B2YA 3IXQA 4WGGA 1ZCZA 1E8NA 1JSCA 3OCWA 5HNKA 1GGVA 3FFAA 3RGWS 4YRTA 2QQ0A 1AQLA 1NQOA 2HCTA 4O4IB 5J9FA 2XCRB 3MHPA 2P8SA 4NBTA 1ODLA 1LDNA 1NZFA 2C2XA 1X3LA 1AKRA 4OB7A 3PVSA 3CLRC 3UJPA 3D4BA 4GKJB 2QL9A 3RYFA 3IT2A 3LIPA 2XNJA 3R3HA 4CLOB 4TKVA 1DJQA 4AJEA 1ODIA 1I6KA 1WSDA 5E2AA 3T5TA 4JN6B 1U1FA 4D9NA 1ZI8A 5KSWB 3LVQE 4BRZA 2QR2A 2LKCA 3AGPA 4PR3A 2IU4A 2YQ4A 4NK5A 3EEQA 2I71A 2B20A 1QPGA 1H2ZA 2ORYA 3HUEA 3DBLB 3V42A 1HLFA 2HDNB 3EVDA 1YDMA 4HAVA 1YR3A 3CEHA 2BFFA 3NETA 4E1AA 3MMXA 1KAEA 2NG1A 5LDDC 2C2YA 3D4NA 2D2IA 4PWZA 1ID1A 3OPMA 5SICE 2J45A 3VTZA 3NJ4A 5I7WA 3KZMA 3TTSA 5CW1A 3DTVA 1ARZA 1C7JA 3A2NA 2KM1A 3ZDQA 4RGVA 3R7WB 1NY6A 2Z1DA 4OBXA 1R9JA 4RXTA 1P7WA 2H17A 2B7BA 4P8RA 1DKRA 2O2ZA 2C97A 4X9XA 1PQWA 4G97A 4K26A 4E30A 2J9GA 4L4UA 4MVYA 3VPDA 3FNEA 4H7FA 2A0YA 2FGKA 1T2DA 1CY6A 2EC5A 2FPXA 1JSRA 3BZBA 3FKJA 3EJ6A 4OGLA 4HGQA 2N42A 4CR8A 1RP7A 3T1NA 9GPBA 2DTXA 1ZUIA 2FWMX 3B6JA 4AZ3B 4BU1A 3G9TA 1N2SA 1IC6A 2I4RA 4WXHA 1HNWB 4AY4A 1EVQA 1YS2X 3PI6A 3AH8A 4MCJA 2P2ZA 3SHFA 2WP8J 1MG0A 1IHUA 3KQTA 4JBYA 3U49A 2ZJYA 4HT3B 3TYXA 1P2VA 1V41E 3FGZA 4Q1FA 5DYIA 3UUGA 5IXYA 2UVPB 3WGNA 4FGWA 4LXXA 4F56A 2VSFA 1HG1A 3EGWA 4JVMA 4L8LA 4WK2B 4X41A 1QM5A 4Q4AB 3NIFB 4NESA 2IY8A 1ZHHA 4B6EA 4YIKA 3FOZA 4DMRA 3T9FA 2R6ZA 2H1IA 1Q0UA 1ZUWA 5KCMA 2CXPA 3NEAA 4U4AA 2F1RA 5COBA 1JJIA 1VPDA 4JVLA 1Y9JA 1MU0A 3G1UA 1XQWA 1ID8A 3P0HA 4AS2A 2PS1A 2KB0A 2H00A 2QN3A 3L5KA 4G63A 1VL2A 5EEGA 5F52A 1O6CA 2PY6A 2G1PA 4HGRA 1T0UA 3MWDA 2BN4A 3OZ7A 4FEAA 1G6OA 5J5CA 3RFTA 3UZUA 1UDXA 2NZJA 3V4LA 1RWBA 3MB8A 2AW5A 1RVV1 2ZS9A 4PFJA 1N9GB 5PGMA 3DE0X 3BWBA 3ESQA 4PTLA 4P32A 4KPFC 4ZYZA 1I33A 3QYPA 3VJKA 1U6IA 2XAUA 3JAKB 2J6HA 2QRUA 1WU8A 1OH8A 5HTOA 5BMVB 2ZJZA 2CXOA 1XKLA 4PG7A 5DT9A 1DBIA 1AUPA 1GUZA 1CHDA 1K98A 2HADA 3I9JA 3C48A 4Z99A 2WIKA 2YINC 3K0CA 1ZXLA 4X8LA 4EG7A 3D7MA 3HBMA 2ACVA 2GHQA 1YSCA 3KB1A 4NPHA 2P11A 2EBFX 2UUOA 4IZIA 4QULA 4RZSA 3PHHA 2IYEA 1PU2A 4TLMB 3C6KA 3FRJA 3QEBZ 1O54A 3BXFA 2HA5A 1BD3A 2ZPAA 2A0FA 4BFYA 1E2QA 3FPFA 3N8IA 1A8QA 1THGA 4X60A 5AOCA 2G7MC 1MENA 1IOVA 4PPNA 3RG8A 1Q7TA 1N3YA 1W75A 2BAGA 3ZVRA 1JQEA 4X7BA 1ODKA 1W1IA 3QLVA 3DV9A 3A0UA 5AFSA 1Z34A 2Q9CA 4M1TA 4YWHA 3TAXA 1NQTA 4LW8A 1RQNA 3EEFA 2GAJA 2ZIE