1JDJA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with 2-fluoro-6-chloropurine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
total genus 132
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2001-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1jdjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jdjA01
1ONNA 4RDIA 1ADFA 4PLFA 4GWGA 1UXKA 1C1DA 1VI2A 1G1AA 2IRWA 2OZPA 4RO0A 2YYYA 4TRMA 1Y81A 1F8GA 1HDOA 1ZXLA 2IDZA 4P8RA 4BKPA 5B4TA 5JC8A 2G76A 4XIJA 3DZFA 3JYQA 1NQ5A 4UVHA 2WD7B 1CF2O 4GMFA 4NU5A 5I8ZA 3ASVA 3BMOA 2O3QA 1NFFA 4BHTA 3GDOA 2XOXA 3L07A 5AXBA 5EJ2A 3H8VA 3RC2A 1JWBB 3ZW8A 1H9BA 2FSSA 4NI5A 3VZRA 5TT0A 1LRKA 3IJRA 5AXAA 2Q1TA 5C3MA 4RVDA 1E7WA 4DA9A 4DL9A 2WYWA 1ZJZA 3BTSA 1C0IA 3V2UA 1U9JA 3DL2A 3E5MA 1VKNA 4GVLA 4K6CA 5CPFA 5JPIA 2I5PO 3PGJA 2NWQA 4IZIA 3KSUA 2AW5A 3UFXA 5FFFA 2CMDA 4BUCA 1BMDA 5I7SA 1ZMOA 3GMSA 3GGOA 4BKUA 1XG5A 1N2SA 4FB5A 4Y8VA 3F3SA 2BLLA 4BMNA 1YQDA 3PFFA 4J4BA 5EPOA 3DZKA 4R01A 4FFPA 3WQSB 2RHCA 1X1TA 5AYVA 3A4VA 3GZNA 3OQBA 3QVOA 1LLQA 3PHLA 4GX1A 5TSDA 1PJBA 2Y68A 3Q11A 4O59O 3FHLA 3TOXA 4BNHA 5A9RA 1WDLA 3IOYA 1E1KA 1BXZA 4WOKA 5F1KA 2YUTA 2D0IA 3VOSA 3WNQA 4FCCA 4CLRA 3JYLA 1ML3A 4L9RA 5L4NA 4TKLA 3TF5A 1YQGA 2JAHA 2ZCVA 1EUZA 2BELA 3ZWBA 4Y6PA 3QVSA 4EJ6A 3RU9A 4I08A 5EL0A 3IKVA 2IODA 1E3WA 4OQZA 3WBBA 2EGHA 1I3KA 1U8XX 3WWYA 1DAOA 3HDHA 2W2KA 2Y67A 4Y98A 3AWDA 2X5JO 1T2CA 4IIUA 4JQCA 2EERA 4TZTA 2G17A 3OQ1A 2GERA 3VDRA 3WGTA 3NT5A 8LDHA 3WJ7A 4PZDA 5ENVA 1F17A 3ANMA 3LC1O 3BMQA 1TI7A 2I76A 4GSKA 4J2OA 1LC3A 2JHGA 2C54A 3E18A 4PVDA 3VH4A 2NVBA 4O0LA 1F14A 1T1SA 2PR2A 4ILKA 2HK9A 2HCTA 1GZ3A 2QQ5A 4AFNA 3I3OA 4OJNA 2EGGA 2ZCUA 1ZK0A 2RBEA 3JD3A 4ALNA 1Q0QA 3DONA 3L9XA 1U1IA 1NTOA 4YAKA 2RH4A 3NJ8A 4Z0PA 3I9LA 3IP3A 3L4BC 4MVJH 4GAEA 4LRTB 3U5TA 4R3NA 1BTOA 1WXDA 4LCEA 3GMDA 3DBRB 1ONOA 2PTGA 4J9VA 3JCZA 4JROA 1XQ1A 3LC2O 1CETA 4GI2A 3B6ZA 4W4TA 3L6OO 4OO3A 1IHYA 1SNYA 3C8MA 5IXYA 3RUCA 3ZV5A 3IIEA 4E2WA 1ZK3A 5U4QA 3U9LA 4U6QA 4AVYA 3KM0A 4J7XA 4A0SA 4CM4B 4GX0A 2H9IA 1B8VA 4P4GA 5A9SA 4B3HA 3UF0A 5G0UA 1E3JA 4I5FA 1U2DA 4L76A 2IXBA 3O03A 3JQFA 4DYDA 3QY9A 5TJ9A 5DP1A 3RD5A 2O3RA 3ZV6A 1R4NA 1MA0A 5CHEA 4OHUA 1EUDA 3R3JA 4R1UA 4CV1A 4MIOA 4QQRA 5KKCA 1EE2A 1LDMA 3DEYX 3S2FA 3QWBA 4I5GA 4D44A 1XSEA 2EW8A 4KUHA 1G6KA 3JYPA 1JDJA 2GUGA 3CMMA 1QYVA 1U3VA 3FR7A 3E9QA 5CDUA 1DLJA 4PIVA 1ADBA 4M55A 1YONA 2NV6A 4YCAA 2AXQA 2FR0A 4UEJA 4XB1A 3CSDA 3ZN2A 3DTYA 1GQ2A 1DHRA 2D1YA 1LU9A 1YDWA 4KWHA 2A9FA 2Y05A 4Y9DA 3TFOA 2BFAA 4AJOA 8ADHA 3C7DB 2E82A 1JN0A 4HADA 3VVBA 3BA1A 1OI7A 4J16A 4IMRA 1P31A 9LDTA 3JQ7A 1B3BA 4OH1A 4G65A 1PJ4A 1B7GO 2W2LA 4D45A 3I9NA 4XX0A 1NM5A 4CUJA 1E92A 5A03A 1VJTA 1XLTA 4PCVA 2X22A 4HNHA 4OXKA 5BT9A 5JNLA 3U4HA 5DT9A 4Z9YA 2ZKLA 3PIDA 3D4NA 1GZ6A 4J90A 3RASA 3GH3A 3LYLA 1HWYA 3KSZO 5KVSA 5CEFA 1LTHR 1NPTO 4KP7A 1K0UA 4TRRA 1YJ8A 3DAGA 5G0SA 1E0DA 3VH3A 4IDEA 2FPIA 3G79A 3RBVA 1CIVA 1UXGA 4XA8A 4CR6A 4DC0A 1T2FA 4Q3EA 4YYZA 5L51A 3OICA 2RCYA 1LLUA 3WGHA 1TEHA 3PVZA 3ZWYA 4DPKA 1DIBA 1WMBA 5KJ1A 4K1LA 3VC7A 2CD9A 4IJKA 2FHSA 2P2SA 3CUKA 3L4BA 3OEYA 1ENPA 4IJUA 1GCOA 2FN7A 2OBNA 2C2YA 3OIGA 3R0IA 4JIGA 4WCDA 4ZQGA 4YBZA 5MDHA 2Q49A 1FF9A 4WLNA 1T24A 2ZIZA 1VM6A 2UUPA 2YFHA 1QYDA 4CMIB 4NR0A 2P9GA 2ZB3A 4M1QA 4HP8A 4H15A 2EEZA 3FF4A 4YR9A 5DOVA 2QRLA 4CMHA 1LQUA 3MWEB 2GPTA 1Y9AA 1LDGA 5KCZA 3DZBA 3GRPA 5CFZA 4OMUA 4PLCA 3QVTA 4PLYA 5ICMA 2OOSA 2C0CA 2PWZA 5DBGA 3WYCA 2UVDA 5A5FA 4DRYA 2VUSA 2DPGA 4E32A 5HM8A 2D5AA 1PWZA 2ZK7A 5COBA 4C7KA 3QJ5A 3U4DA 3JD1A 4IBOA 4RF2A 2YZ7A 1QYCA 4I9HA 1P0FA 3I9MA 4IDFA 3V2HA 3MJVA 5TS3A 2AHRA 2PZLA 3QP9A 1W6UA 1SB9A 3SJ7A 1CWUA 1E77A 4W99A 3GVCA 1AUPA 2OP0A 3U3XA 4ALKA 1TT7A 1JLLA 3H4VA 4CUKA 1K5HA 1BXGA 2FOIA 3RKUA 4F45A 3OHSX 1X0VA 4E4YA 3A06A 2DBQA 3D4OA 4HFNA 1ENZA 2VNAA 3EUWA 3IP1A 4IGEA 3I23A 1F06A 1ZSVA 4BNUA 5B4UA 2FY8A 1LLCA 3SLGA 1SPXA 5TX7A 3Q9UA 3TZ6A 1NPYA 4NH4A 5B12A 3DO5A 4CMAA 4ZGWA 2IZZA 3D5QA 3MTJA 3ANNA 1HZJA 2NTVA 3VH1A 4UVDA 3TL3A 2EKQA 4Q9NA 4BOYA 4JJGA 1LDEA 2QRKA 4TZKA 3K2EA 6ADHA 4M54A 3LT0A 4B4UA 1UXIA 4IINA 3K92A 5JMPA 4G81A 3PZBA 1MUUA 2WDZA 2DAPA 4N5MA 4YQZA 1YDEA 3GA0A 3QV1A 1T2AA 2AQ8A 3OF2A 3IUSA 3OJFA 1HYEA 4Y6RA 3A28A 3RSHA 3PHHA 3E1KA 3WDSA 1YOVA 3UVEA 1LRLA 2VT3A 1O6ZA 1PR9A 3AM4A 2VUTA 4NFYA 1EVYA 3HN2A 1UP7A 3G1UA 3I4CA 2HU2A 2VYNA 3ZHXA 1CQJA 3AUTA 1KEPA 4MKXA 3ZU5A 5EERA 4BVAA 1I24A 3HFSA 2ZB7A 4Q3AA 2GN9A 3F46A 2C82A 3C1TA 3CH6A 4DPLA 2B83A 3ZU4A 3V1UA 1P74A 4D3SA 4DGSA 2D4AA 3DTTA 1P1JA 3G3EA 2HMTA 4ALLA 3NTRA 4R3WA 5BSHA 4CM9D 1MGOA 3QWAA 4EUFA 3WQRA 3OIDA 1YQXA 2Q4EA 1A9ZA 2FPGA 3PJEA 1J5PA 2FSVA 3DBHA 2HK8A 3NJ4A 4DQVA 1OMOA 1HDXA 5A04A 3VTZA 3KBOA 1JQBA 1GY8A 4E2XA 3RC7A 5J23A 3QWIA 3ADOA 4DIBA 3SVTA 3L9WA 1HZZA 1B8UA 3DZJA 2NLOA 1R0LA 3PJGA 4II3A 1LXCA 4P22A 1RWBA 1BW9B 4ZU3A 4IDAA 4R16A 3B20A 4BGVA 1LEHA 4GL4A 3H9QA 4TRJA 4BNLA 1Y8RB 3BIOA 2P5YA 3ITKA 4ND3A 4R9RA 4XYGA 2NVUB 1GTMA 2HMSA 4RVFA 4LVUA 4IS2A 2QZ9A 3P2OA 3PYXA 5C5IA 2O3UA 3P2YA 4DREA 1BDBA 5G2OA 1XELA 2FR8A 5KNLA 3U4CA 3C24A 3DBLB 3FBGA 3JQDA 5EINA 1CYDA 1BHSA 4YB8A 4DMLA 4ZN6A 3EVTA 5LCXA 4L4SA 5JCXA 1T1RA 1UZNA 4IDGA 3WGGA 3B1KA 3RFTA 3ZW9A 3UOGA 3ZI0A 1XU7A 2EHDA 4BO9A 5AXDA 2G82A 3ETDA 5I9LA 3EGOA 3I9OA 2JD2A 3LC7O 2J3HA 1I3NA 1PJQA 1J49A 5GZ6A 4OXYA 5T6BA 2OORA 3N58A 3K2BA 3AJRA 1A9YA 3DAPA 1NHWA 4YTEA 1MB4A 4E5KA 4AJHA 1QLHA 1C3VA 4FJ2A 3DZHA 1QR6A 4RVGA 4TKMA 1WWKA 1NVMB 1HDGO 1ZMTA 3AUAA 2PGLA 4ALJA 2PD6A 4TVOA 4OAQA 1DXYA 3SEFA 1SO8A 3OM9A 2FPPA 3H3FA 4YT8A 3OH8A 4XZ3A 2J5QA 4JJFA 2X0IA 2E49A 5B37A 3K30A 4IMPA 1LNQA 2Q1UA 3EZLA 4PRLA 5F5NA 2GO1A 2TMGA 4BQRA 3TQHA 1H6BA 1DPGA 4YEDA 5GMOA 5ILOA 4YVFA 3RI3A 4LW8A 2A92A 3HADA 4YA6A 1DB3A 4PLZA 5F21A 4BO6A 1X7GA 3EZYA 3ST7A 2Q45A 4K26A 4WLVA 4PG8A 5ILGA 2GLXA 1FDTA 3IQDB 3WG9A 3AW9A 2EJVA 4L4XA 1GUFA 1PR3A 4UVIA 4Q39A 4AJ1A 3PZRA 1R16A 3SC4A 3GFBA 4HFMA 1I2BA 3K6JA 3OFSA 5T8KC 5ES3A 3R1IA 1LUAA 1ISHA 1E7SA 3S2IA 2W4QA 1PZFA 2PKQO 4QT0A 3PLRA 1UH5A 1P1FA 5I9MA 1N7HA 3WB9A 2VCYA 3K73O 2G0TA 3HSKA 3T7CA 3GNSA 4XIYA 1YE3A 5CDGA 2J3KA 1LRJA 1BWSA 1FMCA 3GN2A 4FQ8A 5COQA 2A4KA 4PLPA 1B2LA 4QO7A 1Y9EA 3RUIA 4BO3A 9LDBA 1HXHA 5IZCC 1NBOA 1XA0A 3UW3A 1ZEJA 2PH3A 4UEKA 1H6AA 2O3SA 3GEDA 2HDHA 4TSKA 3KYDA 4FBGA 2E48A 1XGKA 1GADO 1SMKA 3BZUA 1XWFA 2PK3A 1NQOA 4D46A 1HSZA 3ROKA 3INTA 3T7EA 3ZCXA 4ALMA 4G5HA 4R1SA 1PGNA 4BNWA 4IGFA 3UXYA 3ZNPA 3DMTC 4NJMA 2Y0EA 1W4ZA 1W73A 2OL4A 2GN4A 1ZKMA 4PG7A 3SC6A 4UUNA 4B79A 3WSWA 4RJTA 4YPOA 1EQ2A 3DOOA 4OSPA 4YJGA 5JY1A 1YBVA 2Z1NA 4W9NC 4B4WA 1LJ8A 1O94A 4J1SA 4KQWA 1GYQA 1U2GA 1GR0A 1ZW1A 2GZ2A 3WGYA 4DPMA 2ZQZA 2Y66A 5CPBA 1T4DA 1BGVA 3NTOA 4JBGA 5ENDA 3VZQA 4OKNA 1GFSA 4WNIA 2EG9A 4YXFA 4TMFA 4WLOA 3WQQA 5C7IO 4F6CA 1FDSA 4FOSA 4IQGA 4U0KA 1EE9A 3VKVA 5ER9A 2O4UX 3B1JA 1U3TA 1E3LA 1BVUA 3D3WA 4CR7A 4BB6A 4Q3CA 4EJMA 2JFHA 1BSVA 3EC7A 1RM0A 4EUEA 3K9QO 5DCYA 5G4KA 2H6EA 4JP3A 4DVJA 5T64A 1KC3A 2UDPA 2X9VA 5IN5A 1VL6A 3JQ8A 1XKQA 4QSMA 3PQFA 3U09A 1UDBA 3OECA 1PL8A 1VSUA 3W4JA 4E13A 5JO0A 2Z95A 3ZWMA 1XIVA 4JBIA 2R00C 3NGXA 3EYWA 3MCVA 4CJXA 3K5PA 3CZRA 2RH8A 1ZJYA 1KYQA 1KETA 2PLAA 3GC6A 2RAFA 4FD3A 4MOWA 1P44A 4RVUA 5C7OO 1EQUA 4IQ0A 1XYGA 1V6AA 3TZCA 1IULA 1ZBQA 3H6KA 4U8GA 4CLOB 4F3YA 2EKLA 3X2FA 2QZZA 1GD1O 3E9NA 3PQEA 2CFCA 5JYDA 2D5CA 3LF1A 3GAZA 1C0LA 3WTBA 4O6VA 1HKUA 4F46A 5T67A 2PD4A 3ZWCA 1UP4A 1YVEI 4M8SA 3GFGA 4CMKA 2I67A 3PTZA 2DVMA 4FFRA 1HT0A 1QXSA 2Z1MA 1OC2A 4O63O 1RKXA 4XGKA 5HTOA 1Y8QA 5FI3A 2X9GA 3W8DA 4BIIA 4NHEA 1R0SA 4YAEA 4OOFA 1H5QA 3P19A 3CINA 4HX5A 4BO8A 3WGZA 3WS7A 3EMKA 3F1KA 1H0KA 4OIMA 1X15A 4LMPA 4CMGA 3INRA 1O8CA 5IZCA 1BRMA 1QKIA 2Y1OA 1I2ZA 4RF5A 2OO5A 4MPDA 4RVHA 5FI5A 1PGOA 4M87A 5G0WA 2BI7A 5L7YA 5JMWA 5B4VA 3ROQA 3HB5X 1P1KA 1YL7A 2OGUA 1UDCA 1DC5A 1YH3A 4MIEA 4CLDA 1NQTA 3TSCA 1EVIA 1PEDA 4IXTA 2CZCA 1E3SA 3LT2A 3GAFA 4BNNA 2O2SA 1KS9A 3H9UA 3M2TA 4E0BA 1E6EA 5G0VA 1IYZA 5T57A 1DSSG 3DMTA 2YDYA 4W7HA 4WCFC 5JLAA 4W7IA 5F1PA 2J3IA 3HWRA 4FGWA 1H6CA 1ZXBA 2DM6A 2VHVA 4NG5A 4RGBA 4BKQA 5L4SA 4MP6A 3BHMA 1IHXA 3QW2A 4E6PA 1DIRA 1H2BA 4XJSA 1WDKA 4TQGA 3I52A 4W9NA 4PVCA 3T4EA 1NPDA 1R15A 3RCBA 3JQAB 1UXHA 1M76A 4DC1A 1A4UA 2I9PA 2LDBA 4CM8B 5EQDA 1V3VA 2HJSA 3NTQA 4N7RA 1KERA 5L45A 4W6ZA 2HMWA 1D1TA 2IE0A 2O3JA 4D3DA 3HN7A 2VZ9A 2BGLA 2ZB8A 1Y6JA 3PLNA 4XDZA 2JD0A 5A02A 2D2IA 1J4AA 1Z82A 4YAJA 5ADHA 2Q99A 3NT4A 4CMJA 3WLFA 2UAGA 4AJ2A 4CQMA 2Y0DA 1U3WA 1K6IA 1LX6A 1V35A 4MKRA 4ESOA 3ULKA 5ER6A 2CDBA 3GY0A 2HLPA 4CL3A 1U7HA 3AM3A 3HG7A 1QMGA 5IDYA 1PL7A 3PEFA 4S3MA 2R00A 4D7AA 1I32A 2FP4A 4UUMA 1EZ4A 3BMNB 4EI2A 1R6DA 1KEUA 4K6FA 4KTVE 3KEOA 4BNMA 5IF3A 4R41A 1B14A 2Y1FA 4WPGA 2XPCA 1LSOA 1QRRA 4YJHB 2C2XA 4AICA 2OMEA 2C7VA 4NZ9A 4BNKA 1NYTA 3AY7A 1K6JA 3H5NA 3TL2A 1KVUA 3FTNA 3ADPA 2B0JA 3DOCA 3GN1A 4JXKA 4OSOA 1N5DA 1KVRA 3NEPX 1NWCA 3OJ0A 4HY3A 4A27A 2YHIB 1WZEA 2OFPA 3S2GA 3BMCA 4P4NA 4ONEA 3DXFA 1I8TA 4MINA 3AK4A 3KYCA 3WBFA 3DHEA 2NSDA 4L0QA 3C3XA 2V6MA 4B4VA 3KRTA 5JY6A 3ZWNA 4KUEA 1ZSYA 3ROPA 4A73A 1Z45A 4OL9A 4P38A 1B0AA 3AOGA 5AQ1A 4PGFA 4MP8A 4HBGA 3HDYA 3A14A 4FPXA 2UV8A 1JKIA 1P1HA 1YB1A 2DPHA 3OP4A 2NVWA 4U7WA 1RM4A 2PH5A 2ZTLA 3HB4X 4MP3A 2VT2A 3ENNA 4D42A 4RDHA 1TT5A 1D3AA 4J1NA 3DR3A 1B3RA 4NQZA 1CJCA 4RPGA 1H94A 3PIIA 5JAMA 4JGBA 3ASUA 1K2WA 4N18A 4YJFA 3OBBA 2YQ5A 3WIEA 5A5EA 2C7GA 4GPD1 3WWZA 3KYBA 3DOJA 4WCFA 4RVSA 5K6AC 3FD8A 4G2NA 1EDZA 3D7LA 1SC6A 3JQGA 3Q6IA 7MDHA 4HV4A 1N9GB 3P5SA 1LDNA 1DRUA 3STHA 5MGBA 3KB6A 3FNHA 1A4IA 2Y1GA 4CQLB 2CUKA 2CVQA 2PFGA 3D5TA 3NDRA 1KBZA 3VTFA 3EHEA 3ZHZA 1QYXA 5F5LA 3GVXA 4B7XA 5U1PA 2AEJA 5JBIA 4QTZA 4XEHA 7ADHA 5IXSA 1PQUA 1X7DA 3WLEA 3O8QA 3JV7A 4GKBA 1PU2A 4CMCA 1LBEA 3IMFA 1C1DB 1E3EA 2YW9A 3GR6A 2B4TO 2GZ3A 3KUXA 1BVRA 1T2EA 3HE3A 3I6QA 3D64A 1O95A 2AG5A 4BV9A 2DQ4A 2X7HA 5KTKA 3VH2A 5LDHA 3WGOA 1EMDA 2B5WA 4CLEA 2Y99A 3WNVA 1ULUA 1JU9A 5IFLA 5A3VA 2O3TA 4JN6B 2HO5A 3BMOB 3GVIA 3AFNA 5ITWA 3IUPA 3F4BA 3O4RA 4RQTA 5L7WA 2X5KO 1IB6A 2BHLA 4QO8A 1PGPA 1NQAO 3H5AA 3TFQA 1GYPA 3BTUA 5L3ZA 1KC1A 3PJFA 5TC4A 3DFUA 1EK5A 1WVGA 4WLFA 3F5QA 2J3JA 4D3FA 2AQIA 2Q2QA 4R5MA 1E1MA 1YS4A 1DIAA 1MG5A 2IZ0A 3CMCO 1GQYA 3KHUA 4DBVO 1Y5RA 1HYHA 2W8ZA 2PA3A 1DC4A 4IIVA 4FSHA 3M1LA 4CM7A 4CM6A 3DBVO 3LU1A 3MJEA 4PRKA 4WEQA 2JCXA 2FZEA 2PNFA 3I6IA 1R4MA 1MG0A 1RM5A 2E37A 3ZWVA 1YB4A 3GZ4A 2WD8A 1PZHA 3MOGA 3QE3A 4NK4A 2VOEA 4J49A 1E7QA 4ZHSA 1HE5A 2ZQYA 1SEVA 1P77A 3ZV3A 4NFHA 4JX8A 4MVJM 4WUVA 1QP8A 2DUWA 2HK7A 3GZNB 1SEPA 5DN9A 3R6DA 4RPJA 2QRJA 4R5HA 3IKTA 1KEWA 2YDXA 2B35A 1E1NA 4NIMA 1SAYA 4JCOA 3H65A 4I9NA 2CF5A 2JCYA 4PZEA 4L74A 2E6UX 4CLRB 1WZIA 2H5LA 3W6UA 2AE2A 1D1SA 2D59A 4XDYA 4PG5A 4E2ZA 2WE8A 2AEMA 2YHUA 4IJWA 5AOVA 5TRTA 3ZWAA 3TZHA 3I9KA 3C1OA 4J6FA 3QIVA 3F6YA 1QG6A 1GEGA 2V6BA 3C85A 2DFDA 5COAA 4XR9A 5TT1A 1W8DA 1CRWG 4RZIA 4XB2A 5I9NA 1E3WB 2PKRA 4B4OA 3C1AA 4ZQHA 5K6AA 1NAHA 3WGIA 2W2KB 3PP8A 1GZ4A 4J2HA 2CF6A 2V6GA 3CZMA 3DB2A 5H81A 3U0BA 2IYPA 1GQQA 1SOWA 2JAPA 2WEKA 4XYEA 2GYYA 3BMQB 3WIDA 3L6EA 3OEWA 3WSVA 4QECA 3E82A 5A06A 2BGKA 3QVWA 1WDMA 3O26A 3HNPA 2BKAA 1SBYA 3ZHBA 1HDRA 3KSDO 3L0DA 4YAIA 5BSFA 1QV7A 2JD1A 4IS3A 1NFQA 1T25A 4TRNA 2VRBA 1CDOA 4L8VA 1GDHA 1NASA 1Q2XA 2PV7A 2R6JA 1E7RA 4TWRA 4R68A 3RJ5A 1R0KA 2VZ8A 1JTVA 4MVJD 1W0CA 4E5NA 4RF4A 3AU9A 1HLPA 1A5ZA 4I9UA 4H7PA 2WE7A 4IDCA 4S1VA 1PS8A 1DJNA 2DKNA 2GN6A 3PQDA 4LN1A 4YAGA 1Z73A 2A35A 1DEHA 5JW6A 1E6WA 4INAA 2WD7A 4BNGA 2HMVA 4Y6SA 1M6HA 3RVDA 1PGQA 5JCJD 3C7AA 2X0RA 3PK0A 1DAPA 3S2EA 4J7CA 4XQ9A 1P33A 2WYUA 4NPCA 3W4KA 5KOIA 4WOJA 4ZJUA 2OUIA 4DIOA 3RC9A 1DHTA 1XU9A 2OP1A 4XQEA 2HQ1A 4LVCA 3GDFA 1LDYA 1QSGA 3FCOA 2Q1WA 3MOIA 4GMGA 2NADA 2YQ4A 5A05A 5EN4A 3LT1A 1GAEO 1KVQA 4XKJA 5A9SB 3EAGA 3BAZA 4PG4A 3LK7A 1HDYA 3AM5A 4E5PA 1V3UA 5GZ1A 1NXQA 1GL3A 1LQTA 1XEAA 2Q2WA 3H3JA 3SJUA 2DBRA 5BNIA 1GEEA 2VHWA 4W82A 1R4NB 4HUJA 2AQHA 3OETA 3ONDA 3AY6A 3NKLA 3TN7A 1VC2A 4RLSA 2P4QA 1SOVA 1U7TA 5JXWA 3GOHA 2J6IA 1TT5B 4BNFA 3PHJA 2Q3EA 4TROA 4CPDA 3DQPA 3WJAA 3RBZA 5JFOA 2NNLD 2QX7A 2X6TA 2BFOA 1O9BA 3Q0EA 4Q3DA 1PJ2A 2V65A 3H9EO 4YJFB 3Q1LA 4ALIA 3JSAA 2NACA 4FOOA 2I3AA 3HZZA 4A7PA 1X1EA 1PIWA 5EESA 2YV2A 3PDJA 1PZGA 3L77A 4WE3A 1I10A 1H93A 4KQXA 3UUWA 4YJDA 2VYVD 1E3IA 2HSDA 4J3FA 3IC5A 4RF3A 2RHRA 2ZTUA 4BNVA 1E1LA 1Q7BA 2RIRA 3JQEA 3JQ7B 3ONEA 3F5SA 3KZVA 2XXBA 1KY4A 1FDUA 4QXMA 5KWEA 3VPSA 6LDHA 4RQUA 1MLDA 3DDNA 5BSGA 4PLWA 3FPCA 3KTDA 4B3IA 4BGUA 1EUCA 2FWMX 4N5NA 1YBAA 3ICCA 1H9AA 2POQX 3RIHA 2GGSA 3TPCA 3RUHA 3OJLA 4R1TA 3KLPX 2HKIA 1WP4A 3LF2A 4RV9A 3DFZA 1JKFA 3ENKA 4NK5A 2Q2VA 1K6XA 4WLEA 4MDHA 3UCEA 3L6DA 4KZPA 3GEGA 2YV1A 3Q3CA 3GNTA 1BG6A 1NAIA 1KEVA 1V9LA 4GH5A 4DUPA 5EMHA 4N5LA 4GGPA 3NT2A 3GHHA 2LDXA 3OA2A 4WK6A 3TJRA 1VRWA 2GF2A 1RYEA 1YL5A 3KVOA 5DNAA 2W98A 4WECA 2UYYA 1B16A 1D8AA 1WNTA 1TXGA 5TNXA 3ONFA 4J9UE 3IS3A 4LRSB 2AQKA 1IZ0A 1QV6A 3JD4A 2ILTA 3VVCA 1WAMA 2FRDA 4Q3BA 4MVJE 1JVSA 1ID1A 5DOZA 1EK6A 4J4TA 1JWAB 4UVEA 2CDAA 3H5RA 4D0RA 1J6UA 5KVCA 2JFGA 1P45A 5A1TA 1V0JA 1KVTA 1T26A 4ROSA 4Y67A 3DBRA 5TQVA 1I2CA 1I3LA 4BO0A 3FNGA 2CY0A 2NM0A 3GK3A 5CP8A 3OSUA 5JSFA 5KIAA 4DXHA 4E3ZA 2X1HA 4Z3KA 2AA3A 4LMRA 1LC0A 1DOHA 1FK8A 3RKRA 3GLQA 1Q7GA 4XQGA 5AXCA 1JA9A 4MVJA 4I5EA 1U5CA 3EW7A 4XWYA 2GSDA 5K0ZA 4GLLA 4CM4A 4CM9A 4RORA 1ORRA 1ZNQO 3DC2A 4AJPA 1FDVA 1AXGA 3E8XA 1ZEMA 3PHIA 4II2A 1VE9A 2C20A 4QUKA 1N92A 4AG3A 5HS6A 4NBVA 4PLHA 5JCJA 3QLJA 2Y93A 5L4LA 4NBWA 1FDWA 2GNAA 3RROA 4E31A 4HFJA 2PZMA 3CE6A 1KIFA 2J8ZA 3WYEA 5DP2A 1QORA 3FI9A 1VL0A 4XRGA 5DBFA 1KY5A 4GWKA 3GPDG 1C1XA 4YACA 4Z0TA 1YBMA 1IZ9A 2VHXA 1BXGB 4BO1A 4EZBA 1KOLA 2C07A 1XR3A 1NR7A 2DU8A 4QFDA 3IL2A 2VTDA 1XDWA 4GKVA 4NBUA 1BDMA 5DF1A 1JW9B 3IJPA 4M86A 2Q46A 3N7UA 3RWBA 1YJQA 4K9DA 4EITA 3CIFA 4EDFA 3V1TC 3UCXA 4RPLA 1VKOA 1SZJG 1OBFO 4Z3DA 4CODB 3AOEC 4BKRA 1B15A 4CLXA 5IG2A 5KJCA 4EBFA 1I01A 3OJOA 3E48A 3WOHA 4CV3A 1PJLA 1C0PA 3PRJA 4WGGA 4DLBA 3TZQA 2SCUA 3K31A 4XYLA 5KVQA 1HL3A 5JAZA 3FWNA 4PZCA 3WTCA 3MEQA 3FTPA 3LQFA 4UUOA 4DBZA 1M67A 1YOVB 5FEUA 2DLDA 3MJSA 1EFKA 5IDQA 3E9MA 3O38A 5JE8A 1E5LA 1RJWA 4P4LA 3LZ6A 1K89A 3KETA 3PWZA 3AUUA 1YGYA 2NU8A 3AUSA 3I1JA 1NVTA 4RLHA 2VYVA 5C7LO 4AJLA 3VZSA 2ZTVA 1L7DA 3PDUA 1MC5A 1J0XO 5HBRA 3DBHB 1OC4A 1XQ6A 5T8KA 4BNXA 4BQPA 3FNFA 3JQ9C 1E6UA 2WJPA 3OMLA 4IUYA 4ITUA 2VRCD 4YT2A 2XF8A 3RQSA 1TVEA 2HRZA 1PQWA 3F1LA 1NHGA 4OKIA 4LISA 5CEEA 1LI4A 5B1YA 3H7AA 1QLJA 4A26A 4EEZA 4J0EA 1Y5MA 3WFJA 4CMIA 2IXAA 3RBXA 1MFPA 4E12A 2AG8A 2NQTA 3PYMA 1L1FA 5JDIC 3M6IA 3WICA 5HA5A 4R1NA 5THQA 2H1SA 4RCVA 1YWGO 2B36A 5JDCC 1VSVA 1V8BA 1AN9A 1IL0A 2EXXA 1U8FO 3NX4A 1DJQA 5T5QA 2NU6A 2IYOA 3G17A 1HETA 2JHFA 1A27A 1LDBA 3M2PA 3W8FA 1ENYA 1LLDA 1T4BA 4TVBA 5I7VA 3JQFC 4E2YA 1AGNA 5GY7A 4MJLA 4XYBA 2PD3A 4NJOA 4IPTA 1Z7BA 1H6DA 4RPKA 3K8ZA 1ADCA 4NMHA 4CLHA 3HQ4O 3SXPA 4M89A 3UAGA 1HE2A 1LSJA 1ZO8A 3QQPA 4FR5A 4KTTE 1PS0A 4BGIA 2W2LD 4EEXA 2QW8A 1SCUA 4B8WA 5I8WA 1FJHA 1F8FA 4UAGA 2YFQA 4FJ1A 4AJKA 3F47A 3NYWA 1R12A 1DIGA 2WWRA 2P4HX 3QVXA 3U49A 4BNTA 2YY7A 3AI3A 5U9CA 2DFVA 4YQYA 3ITDA 2YJZA 4CR8A 3NAQA 1P3DA 4MVJF 4Z6KA 1DIHA 1NFRA 3QHAA 3HDJA 4XRRA 3VDQA 2AEFA 5BSEA 2NU7A 3AOEA 2Q4BA 4K28A 1N8KA 2ZYGA 2JL1A 2CSUA 1EDOA 2VWGA 1NR1A 1I5RA 3NRCA 5KKAA 4D0SA 2PKQP 5JS6A 3F9IA 3ICPA 1UP6A 2D3TA 3E6AA 5TF4A 4KMSA 3GPIA 3GVPA 3GT0A 2PY6A 3BTOA 1EVJA 4QEDA 4E5YA 1I0ZA 1DFGA 1Q7CA 3HUDA 4J4HA 3I5MA 1NX6A 1X0XA 3JD0A 3ZWXA 2X4GA 5CDYA 1IY8A 4KWIA 4JLWA 4NU6A 1DBVO 4BO2A 4RZHA 1VJ0A 2NTNA 4GBJA 3CXRA 2XXJA 3JQCA 4DYVA 1WW8A 4J1TA 3GG9A 4Z9XA 4FJ0A 2GDZA 1ISFA 1X7HA 4BNIA 5THKA 4CV0A 1UAGA 1N1GA 3PPIA 1EEHA 3RFVA 3CEAA 4RPHA 1PZEA 3ZNOA 4FFLA 4NBTA 3LVFO 4GSLA 3EY4A 3ORFA 5LDGA 3U4IA 5I7FA 3JQ9A 4XR4A 1NP3A 2GRAA 4NFSA 4A5OA 2EV9A 4H3VA 4FN4A 4QFCA 3MZ0A 4ZRMA 3L4SO 2QYTA 1UZMA 2NUAA 1I3MA 3TDKA 3ZDFA 1HLDA 3KO8A 4ID9A 3KYDB 3DHYA 3HJAA 1JAYA 1DRWA 1DDOA 2GZ1A 3PXXA 5JDIA 1PSDA 1MXFA 2GCGA 1O5IA 1A7AA 1BW9A 2ZYAA 1ZH8A 3TZKA 1VL8A 2GN8A 3ZZNA 4ND2A 5CG1A 3FWZA 5JDCA 1Y8RA 5FWNA 4NJMB 4HKTA 4EW6A 2NVUA 1Q0LA 1YL6A 2HRBA 4EGFA 1YXMA 1GCUA 3UKOA 3ZNQA 3JQ6A 4YJGB 2VZ0A 2VRCA 5KJEA 4AL4A 3OA0A 4ZVVA 3FR8A 2EP7A 4FGSA 1ZK2A 4BNJA 1C1XB 1V3TA 3DBLA 4CUZA 4HFRA 3AI2A 3P7MA 4MVJG 3I9JA 2ZJ0A 4YRBA 1TLTA 3GNQA 4CM1A 1X14A 3ZNNA 4XQCA 5BQFA 1GUYA 2VN8A 4ZQFA 3PI7A 3ZWPA 4FW8A 2B4RO 2B69A 5DBIA 3PWSA 4HNGA 3PJDA 4PG6A 4DMMA 2OHXA 4MVJP 3FBTA 3D4PA 2IEDA 5HWSA 3D3WB 4XYMA 4JJIA 3GDGA 3FPLA 4ZD6A 2Y0CA 3EK2A 3GEMA 5CEJA 2B37A 5G4KB 4BS9A 3W6ZA 5L53A 2X0NA 2X9NA 3RUDA 2VYND 1B8PA 3H9GA 4R54A 2ZB4A 2HMUA 2B4QA 1Y1PA 1AXEA 4MO2A 3JQ8B 4EUHA 3ANLA 3HHPA 4GQAA 3UCFA 3VPGA 3QSGA 1G0NA 3WXBA 1ISMA 4IQ8A 1B26A 4YT5A 1MP0A 4JK3A 4UUPA 5L9AA 2X58A 3Q2KA 1C0KA 1GPJA 2WTBA 4I5DA 1OOEA 2X5OA 4OGWA 1EBUA 3FSRA 1DFIA 2HJRA 3JYNA 4DTIA 2EF1A 3ZV4A 5A3JA 1ZCJA 2BFMA 4BO7A 2AE1A 3S55A 5JAQA 1O0SA 2VHZA 1ZK1A 3KLMX 3ZHYA 1HDZA 1RPNA 2W90A 1LA2A 2QYSA 4A2CA 2EJWA 5JYEA 2AMFA 1HTBA 3NV9A 2DT5A 1PS9A 2Q1SA 3QA9A 2I6TA 3ABIA 4GVXA 1N1EA 3TWOA 2YV3A 3CPSA 5G4LA 1OFGA 3Q9NA 2I65A 4BGEA 1A7KA 3AY3A 2DC1A 3HDQA 3PGXA 4KDFA 2P9EA 1WMAA 3RAJA 1Y7TA 4U6SA 2O23A 4IDDA 2XAAA 4R9SA 3KOUA 4DWVA 4OOEA 3WMXA 5KJ6A 5TLSA 1ZFNA 4L75A 2BF7A 2EP5A 2PGDA 1Y8QB 1P1IA 1KVSA 3A9WA 5TJHA 2OXIA 2ZYDA 3GVHA 3BHIA 5F1OA 2VWHA 3T4XA 2BI8A 4ZQEA 1ZUD1 2PGJA 1ZVMA 1HRDA 3ETEA 1PJSA 1IE3A 1NVGA 1DO8A 2VWQA 5DCUA 3RUEA 1DRVA 5F3RA 3E5RA 3UICA 1SB8A 4PN3A 3MJTA 1E7YA 3JYOA 5CG2A 1PGJA 3ZGYA 1S6YA 2Y1EA 3W4IA 3ZU3A 2I3GA 4GGOA 3JQAD 3DZIA 1XCBA 5EIOA 2A94A 1UR5A 3CTMA 2C5AA 2C29D 5G0TA 4E30A 2GASA 1RM3A 2VHYA 2VQ3A 4CV2A 2JCVA 5KVVA 4R51A 4A03A 4E5MA 2O48X 5IN4A 4DIFA 1M75A 5A9TA 1EVZA 3FNEA 5DDIP 3UH1A 1M6WA 3M1AA 1NWHA 2Y1DA 3DZGA 4XGNA 5BNFA 2EIHA 3V8BA 1X13A 2V7PA 3GQVA 4UEOA 2IZ1A 1Q0HA 2E4AA 5AVOA 3W1VA 1ULSA 5L7TA 4OXNA 2JFFA 1VPDA 1MX3A 3RUFA 3BHJA 2CVZA 1S7CA 4L4RA 4L73A 4X54A 2FZWA 3QRWA 4O1MA 2J5RA 3UHAA 1UXJA 5K9ZA 4HWKA 3G49A 3H2SA 4KDEA 4IY1A 4AJ4A 4CM3A 4ZA2A 4DQUA 4DLAA 1GPDG 3MJCA 4GLOA 3G0OA 3B1FA 3KXDA 2QG4A 3PYLA 2VTEA 4PFJA 3VKUA 2GR9A 1OZAA 3ETGA 4BO5A 4C4OA 5ITVA 5JC1A 3GRKA 4N54A 4OQYA 1UAYA 4BNZA 2BGMA 2VOJA 1DC6A 4BO4A 4CQMB 1HE3A 3OJEA 1HE4A 5TIIA 3KV3O 4GX5A 3TRIA 4FC6A 3COSA 1ADGA 4JNKA 2P68A 4EYEA 5H82A 1I30A 1Z7EA 2B5VA 3TNLA 4J1QA 3C7CB 2NTJA 4BB5A 1AE1A 3DMYA 5DULA 1LSSA 3R3SA 2Y1CA 3IDSA 4EJ0A 1ARZA 4ND5A 5IDXA 5JO9A 3LLSA 1ISJA 1WLYA 1M66A 3AFMA 1EFLA 3W8EA 5BR7A 3RC1A 5HS4A 1N7GA 4U5QA 2O50A 2ZATA 4XGIA 4HXYA 4IDBA 1DFHA 4AJEA 4CLOA 1M2WA 1MFZA 3LLVA 3NUGA 2I99A 3VPFA 4AJIA 1AHHA 4MVJI 4NNJA 1TA4A 2EWMA 4JBHA 4PLVA 5BNTA 3ZH2A 2CNBA 3SLKA 5TGDA 5L40A 4ND1A 2HUNA 4J0FA 2ET6A 3GGGA 3BMCB 2UUOA 3CKYA 1G0OA 4FIZA 4BMSA 3KYCB 4B3JA 4E21A 3PFWO 1XHLA 3MJ4A 1A71A 1ENOA 4R4JA 3DAFA 2X23A 4NDNE 2DBZA 4MIYA 2TMDA 2BMAA 3ZWOA 1DLIA 3GUYA 1GV1A 1VJ1A 4U0JA 4Z0HO 4IM7A 4WASA 5EQFA 4YWJA 2C59A 2F1KA 1Z6ZA 3A1NA 3FN4A 4R69A 3KEQA 4FFOA 2NQ8A 2CDCA 3GGPA 4BL5A 2QIOA 3UGKA 3VAZA 1VLLA 2ZTMA 1QYWA 3H9JA 3JTMA 1U4SA 3AI1A 3V2GA 4URFA 2BFPA 5IDWA 4BKOA 3WFIA 5FYDA 2O7QA 1IPEA 3VZPA 3ZU2A 4LK3A 1F0YA 5IJZA 2P91A 3WMWA 4LCJA 4MKZA 1HYGA 2P5UA 4CMEC 1PWXA 4WCFB 2CVOA 2VUUA 3D3EA 5DZSA 3I4FA 3JQBC 1UZLA 1D7OA 1E5QA 1O89A 4XJTA 3LT4A 4JP2A 4DQXA 3VHRA 2X8LA 4ZICA 3JQGB 1IOLA 4Q3NA 5GZ3A 1PJ3A 2O2YA 1BXKA 4XD2A 4OM8A 4F6LA 3H2ZA 3RJ9A 1OAAA 2F00A 1HSOA 1FXSA 1R37A 2DTDA 2WM3A 1P1RA 4BV8A 3IAHA 4QX6A 2IEBA 3MTGA 4WLUA 3JQAA 3D0OA 2V6FA 3DHNA 4FFNA 4FFMA 2ZJ1A 3LDHA 1GU7A 2BRUA 4CM8A 2FMUA 3WR5A 5CDSA 5IZ4A 3GG2A 3O8QB 3CTVA 4I1IA 3RU7A 4B7CA 3SX2A 1L7EA 5FF9A 1H2HA 4PLTA 2VWPA 2G1UA 4PLGA 2J5KA 3VPXA 2Z5LA 4J7UA 4LSMA 4YDRA 1E7MA 2P9CA 2C5EA 2O4CA 4M49A 1PQPA 4YRAA 1CEQA 4FDAA 1PL6A 1I33A 3G1TA 4UVGA 1ONPA 4AJJA 4J43A 1JAXA 2NU9A 2D8AA 3VPHA 2R2GA 1HDCA 3RUAA 1YRLA 5I7EA 2VNSA 4WJZA 1P9LA 1AHIA 2BD0A 3D1LA 2X86A 4YRDA 5CDTA 1LSUA 1GUZA 4FC7A 2WSBA 1Z74A 4FS3A 4C7JA 4WEOA 5CAEA 3U62A 4WKGA 4NBRA 1YO6A 3Q2IA 3NDIA 3QWFA 4IZHA 1ZSNA 3ROMA 1EBFA 4J91A 3NGLA 3BMNA 4E33A 3GF4A 1C14A 4B8ZA 4BMVA 2QHXA 3S8MA 1U5AA 5H83A 2O7SA 1K3TA 3SBOA 1UUFA 4RL6A 2HAEA 4YJHA 3ZWWA 2PZJA 3B70A 4UULA 4IJVA 3V5NA 3GHYA 3HFGA 4D79A 3BXXA 4YT4A 1CERA 1T2DA 1R4MB 1Q1NA 4LSWA 1ISGA 1UJMA 4IXWA 1HEUA 5A4DA 3BYZA 4D41A 1P0CA 4KUGA 3DWFA 1I36A 1PJCA 4XCVA 3N74A 5ICSA 2YHIA 4OYRA 3O9ZA 4O5OA 1RYDA 2WMDA 4H16A 3WX0A 3BTVA 1Z75A 3E03A 4ZQBA 4A10A 1ZIDA 2I66A 1MC4A 3NDJA 3X2EA 1GYRA 1F12A 2OBYA 1NNUA 3FRJA 3OIFA 5KJFA 4DLLA 2JKVA 4AJNA 1CQIA 2EKPA 1GV0A 3WYBA 4CL8A 1DC3A 2DTEA 1A72A 2DUUA 3UN1A 4LGVA 1HF3A 4CM5A 5JAIA 1R66A 3TOZA 2G5CA 3JD2A 5HRUA 3MWDB 1PTJA 2EW2A 1TB4A 1U3UA 4GX2A 3QWHA 1U4OA 4I8XA 1D4FA 1ISIA 2H63A 1ZZEA 5L95A 4ND4A 2X0JA 4CMEA 4UREA 4CQMD 5IAAA 2FR1A 3ON5A 5C37A 3JQBA 2WYVA 3WGQA 3RFXA 4WNCA 1JKJA 1PJTA 2GD1O 1IPFA 3GUCA 3PHGA 4B7UA 1PX0A 1MV8A 3S1LA 4ZRNA 3K96A 3INGA 1IUKA 2BH9A 5DCWA 1U28A 3EVNA 1N9GA 4Z9FA 5LC1A 2DTXA 1YB5A 2PZKA 4D43A 1MXHA 3LSYA 4KOAA 3V1YA 2JJYA 4BNYA 3F4LA 4CMBA 4CQLA 1UDAA 1ZK4A 3EDMA 3AU8A 3I83A 3OQ6A 2DBVO 1JVBA 2Q50A 1YKFA 3PWKA 1WPQA
chains in the Genus database with same CATH superfamily
2IYRA 2ZR0A 2HB6A 4KXMA 2ECKA 4DV7B 1V6SA 1DQSA 1SR8A 1UWLA 1HFKA 2YYYA 2M6SA 4HX2A 4M83A 4TRMA 1Y81A 2AT1A 4X0EA 5AVOA 1MMFB 4LI3X 1TRHA 4NG4A 4NZMA 2JGNA 5B4TA 2G76A 4XIJA 2HA0A 1R27A 3NCTA 3O47A 4LE0A 3LGXA 1NQ5A 3BXZA 5CYPA 1HI9A 1NLMA 2WD7B 5EXDA 2FN4A 1CF2O 1Z34A 1A9XA 3ASVA 4BC0A 5BUCA 5C8DA 2BTOA 1YR9A 3BMOA 4BHTA 3LBHA 5AXBA 5EJ2A 3H8VA 1EVKA 4HYQA 1Z0AA 4A15A 3O4IA 3H86A 3RSZA 1YKGA 2AMLA 2Y0BA 2FSSA 1LFDB 4TLLB 5B7PA 3VZRA 2PZ8A 3R3HA 1A5BB 4UBNA 3EGXA 4YIHA 3R7NA 3CKMA 4JDPA 1E6CA 3WY9A 1Y4ZA 2XZLA 1KMHB 4F4JA 4F4HA 5HK9A 2CV2A 4RVDA 4Y2PA 4HXEB 5DLPA 1X1CA 3ZXYA 3BTSA 1AGRA 1CHNA 1DX4A 1V2GA 3VGPA 2MIIA 4G5OA 1U9JA 2H11A 3HFJA 3RAFC 2ZLBA 5JPIA 5A4FS 2I5PO 1M8KA 1Q6YA 1OXMA 1TQHA 4RMIA 4YUVA 5EMKA 3KSUA 4U2CA 3DVSX 4YJ3A 3TPFA 3UFXA 5FFFA 2ILVA 4DZZA 4YRSA 1BMDA 1ZMOA 4A2PA 2CLOB 2WM8A 1THGA 4L15A 1ZW6A 3GW8A 5E4FA 2FW0A 4BKUA 3MMPA 4FB5A 3TZLA 3F3SA 4BMNA 3TQSA 4MHOA 2F59A 4AY3A 3M6LA 3NBKA 4DILA 1ZS9A 4HK4A 1JDTA 1E9RA 4G0UA 4FGZA 3H2JA 4WINA 3DV0A 1MO4A 4GX1A 5LQDA 2Y68A 4X45A 5FRDA 4I4TF 3FHLA 3TOXA 5EJEA 1UJ2A 2GRUA 4KGVA 4OYHA 3KUUA 5F2EA 4C5AA 5LNK1 1TM3E 1QHEA 1JQ5A 1U9CA 2CJWB 3IOYA 3RSCA 1KXZA 3O75A 4CLRA 1BDIA 4Q9AA 1N8SA 1UC4B 2GCNA 5IRCD 5L4NA 2E5LB 3JR7A 2QTRA 2Q8PA 3DCNA 4I99A 3OUUA 1BDJA 4MUGA 4F21A 3VVLA 4WXYB 4GQIA 1FQKA 3TQOA 2LW7A 4KODA 4BTVA 4HTFA 4FQ7A 2I2BA 3IKVA 2YS6A 3PCTA 5A7HA 4AC9A 4B44A 1HYBA 1WS6A 2HA7A 3EXEA 4PCAA 4UTXA 3R8CA 2J4FA 3WBBA 1XD2B 1ZNXA 3LPNA 4LJ5A 4OHCA 3WWYA 2AVNA 2E4YA 1OT5A 2ON6A 2W2KA 2Y67A 3OQVA 4FDTA 1JG1A 3AWDA 1T2CA 4YQFA 2I4NA 3MUNA 2OC4A 2AZDA 3MCWA 2GERA 3VDRA 2X4LA 1SRRA 5FPKA 3ASYA 1JBKA 3I9FA 5I7HA 4PZZA 1F17A 3IQXA 4HVTA 3V34A 5I4BA 4JYPA 4XVHA 4KR3A 2HQRA 4N49A 2W58A 1I9GA 5CYOA 3EQ6A 1LWNA 1E9VA 1AS3A 2P9ZA 3GPBA 1GPYA 1JA0A 1XRRA 1UOEA 2QGZA 3EPPA 1IY9A 1T5OA 3IEUA 2VJOA 2ERYA 1LI7A 5AOAA 1FQOA 3VH4A 4QNMA 1T1SA 2D5BA 2OO7A 1OXTA 2HK9A 1SHLA 3CJQA 3T4PA 1UBHS 3E2PA 4EELA 4U7DA 2W6JA 3PNOA 3DCJA 4OJNA 2LBPA 4P6VF 2JI4A 4YMHA 3F71A 1JHMA 2WJZB 4N01A 5GADl 1FP4B 3UKJA 2RH4A 2R1VA 1ZRHA 2P3QA 2XDAA 3OZRA 4EB8A 2JRLA 2XUAA 5D01A 4B6PA 3CXUA 2MSKA 2YMMA 2DETA 3L4BC 1REQB 2C4UA 3FUCA 3RS7A 3GLVA 1TEVA 1G5IA 2IOYA 3GMTA 4MUFA 1FNSA 4D8UA 4W5OA 4G0YA 2V0GA 3DBRB 4RTQA 1Z4LA 2GXSA 2HM7A 1CY8A 2R4QA 4JROA 3LD9A 4MZXA 4JR0A 3G68A 4YMTA 5HZHA 4DUGA 4GI2A 1O58A 3E2IA 3QE2A 1FTGA 2XMRA 1UBSB 2ZUWA 1WPXA 4OO3A 3VTKA 2C42A 1V5EA 1SNYA 3S0JA 4EKIA 3ZV5A 3DT9A 4HVLA 2E4ZA 4QODA 2JVJA 1KJZA 1ZK3A 1NN5A 3ZDCA 4I3GA 4QPJC 4CM4B 4R8MA 2REQA 4TL8A 5A9SA 2DMRA 2VJMA 4BC1A 4NJEA 1P0MA 4B3HA 4IUCS 2WJWA 5G0UA 2GKSA 1E3JA 3EBOA 5JAOA 3DAHA 4N6GA 4R8SA 1N5MA 2CLKB 2REBA 1ZVKA 4L76A 3JQFA 3NHPA 5TJ9A 3RD5A 2O3RA 1XJ5A 2E4VA 4AO6A 3BOSA 2G1PA 5LB4A 1V5IA 2GVDC 2K4MA 1NVDA 1B1AA 1H0HA 3OZAA 3FOCA 3ZBQA 5K0GA 5AKLA 4DHWA 5LPNA 2AUMA 1P1CA 3TJZA 4N39A 3ELDA 4HMQA 1EE2A 4XLTA 1FU8A 4C5CA 2Q3HA 4I5GA 3FJOA 1RVDA 3A04A 2HCFA 2ZYSA 2PX4A 2H4ZA 1JDJA 1EP1B 2GUGA 2XYQA 3EZFA 3JASB 3TSAA 2RI0A 2QN1A 3HC7A 5E2IA 1GU0A 3NB0A 4IVPA 1DLJA 2VK2A 2WJJA 1GPNA 4O8ZA 1UWVA 1PVDA 4GZ6A 2ZSFA 3RSQA 3WZLA 4K86A 1ND5A 5HF6A 5BRNA 4XB1A 3SVLA 5E0OA 2N1MA 1AO0A 4B3RB 3PD7A 3PXBA 4PFKA 1VMEA 2OCYC 5ENZA 1N6LA 4RGYA 5CJPA 1LU9A 1YDWA 3KJGA 4Y9DA 5A71A 3UOWA 4AECA 1HC7A 3TFOA 4YJ3F 4EO9A 2DPLA 4LYJA 1KRHA 3WLIA 4AJOA 2QX9A 1Z5OA 3DNMA 3TYXA 1OFUX 2E82A 1JN0A 3I72A 3IO5A 3V8PA 4TZ0A 1FL9A 3U3MA 4B43A 1DKUA 4CTKA 4BEBA 3JQ7A 4MW0A 2DQSA 3AJEA 4HG2A 1NL3A 2PR7A 1KZYC 2IBSA 4KR7A 1YR8A 4ETMA 5DMXA 1I0LA 4CUJA 2CLDX 1QC5A 1SUFA 1L4FA 2HZ7A 2QLTA 2XQGA 2AYZA 5BT9A 4RMHA 1QYIA 4PPGA 5K3BA 3D2LA 4MRNA 3PIDA 3VV2A 2BGUA 2DR2A 1ZUNA 3D6VA 3GH3A 2DWPA 4C4AA 5KVSA 2ZW9A 5CEFA 4Q1BA 1GTSA 2V45A 4D9MA 4F6RA 2CYCA 4U2KA 4EJ2A 1CUWA 3QFCA 1LTHR 4PGAA 2VJYA 3GJZA 4KP7A 4Z1MA 1YJ8A 1S8NA 2PRJA 5E1DA 4I1YA 2C3MA 4JR2A 3G5TA 3P5BA 2KB0A 1OKKD 3K1AB 4ZC8A 1VPLA 1H22A 2IYVA 3MN1A 3RYHA 4IYJA 4JU9A 5TB5A 3QHQA 1Z16A 1T2FA 1V4NA 4FUQA 4OHWA 4IHJA 5F35A 4YYZA 4HDAA 4EIWA 1GPKA 1QMPA 1TEHA 3LH5A 4RNCA 3EPHA 3MLAA 3PVZA 4DPKA 5LJIA 5KJ1A 2E5WA 3BXEA 4KXNA 2QRQA 2CD9A 1MRZA 4IJKA 3CUKA 3S28A 5CBPA 4WWHA 2JLZA 3L4BA 4IJUA 4ZDKA 2XT9A 2C2YA 3KZ1E 4JIGA 4ZQGA 1RE0A 1U0RA 4XW2A 1T24A 1HBJA 1VM6A 4IQ4A 5IAEA 5BN4B 3IPXA 4BZQA 1AMNA 3IEVA 2P9GA 2PKYX 4M1QA 1E4OA 3FTCA 3HKDB 3PQ8A 4RDCA 4DY4A 3D7RA 5B7GA 1NN1A 3DCYA 4YUWA 1RABA 5BN3B 4F56A 1Y9AA 1Y7LA 3TH5A 3LNTA 4GYJA 3DZBA 1LQ2A 1IVSA 4JUAA 2XY4A 2NU6B 1GPUA 2FF5A 3C8ZA 3VZCA 5TQ2B 5DBGA 3PUVA 3UUEA 2R4UA 5DHRA 4PYQA 2XCTB 4QQ8A 1OY1A 1JIIA 5A5FA 4TKUB 2CXTA 4FKZA 3TE6A 3EIEA 3UMVA 1PWZA 3AVPA 4D6YA 1R1DA 3SYLA 4GPBA 2I6QA 4C7KA 3IUNA 3DTNA 3OCZA 4ZJZA 3QJ5A 2UZ0A 3U4DA 2ZJ5A 4IBOA 4JI8B 3DTVA 3RRZA 3PG5A 4WL0A 4CCYB 1NMYA 3C3EA 4IIFA 4N6NA 2NAFA 4MCJA 4I9HA 2AD1A 4QATA 2JLXA 3EXIB 3V2HA 1AUVA 1A96A 5L6MB 2W6MA 1T2UA 5TS3A 5CB8A 2IVFA 2PZLA 1GPBA 1LF5A 1VSQA 1W6UA 2C3PA 4FYXA 1NOJA 1E77A 4HLNA 1BEEA 1AUPA 2WIGA 1TT7A 1WA5A 1JLLA 3H4VA 3ZIAA 1XZPA 1QTRA 4CUKA 3L0IB 3ZQ4A 4D81A 1DAFA 1WULS 5AICA 3B36A 1UMDB 4KIWA 3OHSX 4LJLA 4BZWA 1O57A 2DBQA 3A06A 2YINC 4BQSA 1CUCA 3IP1A 5JEEA 3EA0A 3N5CA 5FPHA 4B2PA 1UKBA 4TTIA 1B6GA 4JOQA 5DTRA 5B4UA 3AZQA 5DHSA 1W88B 2FY8A 5KOHA 4W1PA 4JC4A 4GC5A 1U2TA 3AJDA 1SPXA 4Q7QA 5TX7A 2GPSA 3ZDYB 2FFBA 2JIZD 5M7EA 4PSDA 1BEUB 2JLYA 3DO8A 4CMAA 5CNJA 3PEUA 4QTXA 3MTJA 2NSLA 1W29A 2QGFA 1SIUA 1ISSA 2QYOA 2VCEA 2DWUA 3SFVA 4PCUA 4AWBA 2BKXA 4UVDA 4NU8X 2H4YA 2FI1A 2XB6A 2H2FA 4BEVA 2PH1A 2IELA 5LZ5A 2WOJA 5HHTA 1LDEA 5JI2E 2QBYB 4Y1RB 4TZKA 3K2EA 3NBQA 2DLCX 2IS4A 1NZDA 5CT4A 4DMKA 1PFVA 4LOLA 3WLRA 1ZC3A 3LT0A 4B4UA 1UXIA 4IINA 1IIRA 4OLAA 2DF8A 3PZBA 4NMWA 4PBRA 2FPKA 1X39A 1YNOA 4TVSA 3T3PB 4D4HA 1T2AA 3OCUA 2AQ8A 1US8A 3OF2A 4RNDB 3N5KA 3T34A 3QQ5A 2ETXA 3DXZA 2HOQA 3E5NA 4LQDA 2FQXA 3PUXA 3N3AC 4GM0A 1JP7A 3RSHA 1OX4A 3WDSA 4P7GA 2PXHA 3AM4A 1O6ZA 1V6CA 4DDHA 4W5NA 2A0YA 3ACBA 3HN2A 3DAOA 2G80A 1UP7A 1EXMA 3CCCA 1AUOA 5T4HA 3I4CA 1ZOOA 4D4LA 2HU2A 4YX9A 4DA4A 3AUTA 3ZU5A 1LH0A 3OY2A 1ZD9A 1I24A 1MBZA 1LJUA 1UBFA 1UWKA 2JFZA 2POCA 2YC4C 2ZB7A 3HFSA 4GMHA 3F6BX 4MRPA 4RD2A 5J1TB 5K2MA 3U3RA 3ZU4A 4DPLA 1HMYA 1BYIA 4JIMA 5EFOA 2C88A 5E6UA 3FH0A 1D5CA 1Z8NA 5EVJA 1GDDA 1N5RA 2VPZA 2BN4A 5SICE 3WGLA 4ALLA 4Z54A 5AVTA 5DNWA 2XNSA 3A1SA 3R0VA 4EUFA 4G89A 3WQRA 1HV8A 4CHGA 3OIDA 2HLDA 3AUXA 1YI8A 4X92A 1A9ZA 2FPGA 5C3UA 4AKTA 5ALKA 4OHPA 1QGED 2WC1A 3NJ4A 4GRAA 3VXKA 4DQVA 2O5RA 4IJ6A 1OLUB 5J2UB 4F7DA 1XC7A 5A04A 1ADJA 3PDIB 1YE5A 1F4LA 2ST1A 4M98A 3TFQA 4L6AA 1GY8A 3NTUA 1XKTA 3MWFA 1RXWA 3C5CA 3QX8A 1NJGA 2HH9A 1YB7A 2YV5A 3AEUA 3W78A 4DIBA 1T6BY 3L9WA 4ABTA 4MCIA 1EWVA 3H97A 3G2JA 3VU8A 4I46A 1AD2A 5EIBD 3RBAA 2J67A 2FNAA 3QEOA 2A5JA 4XSGA 2A9OA 3ETCA 1DWOA 3TUIC 1RT9A 5D87A 3TCNA 1BN7A 4R16A 3RSFA 3L7MA 3B20A 4OM7A 4PGMA 3ROEA 1LEHA 1SHUX 2R66A 1DINA 2P5YA 3BIOA 4PU0A 1HORA 3UG6A 3ANYB 3A37A 4IS2A 2IU3A 2EOAA 2OHVA 1CVIA 1L5OA 4ZT7A 3IXQA 1RYHA 4GM1A 3P2OA 2GPAA 4IHJF 4S1PA 2FFAA 4UHHA 3T7IA 2WKQA 5IC4A 4GRIA 2ZETA 1X87A 1T91A 2LKDA 3PUWA 2L2QA 4GOXA 2WU1A 2MDTA 3I28A 1N33B 1QF6A 4HQKA 4TXNA 3VO1A 1RI2A 3C24A 2GZMA 1BE1A 3B8HA 1BHSA 2Z5VA 3PT9A 3EVTA 3II6X 4L4SA 4A0RA 1T1RA 1UINA 1Z0ZA 1UZNA 2IHYA 2M98A 1BHJA 1K7FB 2QVGA 1K4KA 2CN1A 2J85A 3B1KA 3ZW9A 3KT0A 4KDRA 4LXYA 3EQ2A 5FR1A 3UK2A 3ZI0A 4POOA 3TIVA 3EPRA 3P96A 4Y6QA 1A8IA 2VL7A 4J7AA 4EY3A 2ZAIA 5LA6A 4EG4A 2Z2IA 4W5JA 5F12A 3UAYA 2G1AA 4QD3A 1FUEA 1O9GA 1NDUA 5T6BA 5EMJA 5BYAA 2VJQA 3AJRA 1NHWA 3PE4A 5I9IA 3CWQA 3SDSA 1JFTA 5BVHB 1W47A 3ZY2A 1C3VA 5KU7A 1YBFA 3RFFA 4J29A 3DZHA 5B1HA 1NZFA 4RVGA 4TKMA 5DGHA 1VE5A 4UHFA 4ALJA 2PGLA 1EKXA 1GTL1 4O0MA 3SOPA 1U0TA 2Y27A 4OUDB 2QJTA 2WMYA 4PO1A 2VPPA 4FGUA 2X0DA 4AYTA 5K0JA 4YT8A 3GJ0A 5ALOA 2BUCA 4MV5A 1ESEA 1LTKA 2GBFA 3U61B 3VYSB 2ZI9A 5KWSA 1Z4QA 3VSEA 3QG1A 1KOJA 1H2RS 1VP3A 4PRLA 3SY8A 2QQ0A 2QD1A 1MRNA 2AI2A 4QOFA 3D2AA 5EIAA 1GM5A 1L4UA 4HEHA 5EJ7A 4D56A 2WKPA 3TW4A 3LY9A 4ZEOA 1XCJA 2C5FA 3ROZA 4DDKA 1T3HA 3BCUA 3NAZA 4PLZA 4AZVA 3FTFA 2FXVA 3KKOA 1PFUA 4LYGA 3ST7A 2WTXA 3DE3X 1EJ6A 3HBAA 3F67A 2FUKA 4MUNA 1DAMA 3CEMA 1UPFA 1XLUA 2NUTA 1QIIA 1T0PA 4LXXA 3JX9A 4IDHA 5ILGA 3T7DA 4ZCTA 2ZVPX 1SGWA 3NWJA 2HJWA 1XMVA 2AI1A 1GUFA 2FN9A 4RFVA 1SCNE 1IUPA 1PR3A 4C21A 4Q39A 4KHPB 6YASA 2G9RA 3D31A 4YUZA 3NVAA 3CW9A 4L0CA 2C8JA 3DYIA 1P0PA 5HIIA 3K9GA 3ZVLA 1B76A 2GZSA 3OPYA 3DPSA 2C2GA 3DMRA 2EBFX 1RAHA 4WDRA 1EXWA 3F2VA 1WKCA 3R4VA 3PLRA 3RFCA 1L5LA 3NVMB 2ZIFA 1N2CE 2QY9A 2XODA 2VCYA 3NCHA 4HWOA 5F7ZA 3HSKA 4NICA 2XUOA 3W1EA 2J3KA 4LC9A 1BWSA 3GN2A 2A4KA 2PRYA 1BU8A 3ABOB 3KKKA 4QO7A 2PL3A 3IX7A 1F4PA 1NUUA 2CNNA 3O94A 1E1CA 1IBLB 1XEWY 1VMKA 1ZEJA 2QRMA 3RO7A 2O8FB 2QUBA 3PJRA 1J8MF 2FZGA 2O3SA 4EUSA 3OF5A 3SNKA 2D3WA 3FZQA 4QTYA 3G02A 1CSEE 3H11B 2UZ1B 3R44A 3EF1A 1EU1A 1T6YA 2ECFA 2Q2NA 2VT7A 4C14A 3KKPA 3P32A 3D0RA 3ROKA 1N2CA 3G88A 2OZKA 4FEGA 5JXIA 5FTLA 3RYCA 2H0QA 4UU1A 1Z6PA 1Z4IA 4PSVA 3UMGA 1K7EB 1M6VA 4X93A 4Y2RA 3UXYA 4B2LA 1ZLXA 2C84A 1RHJA 4ZQCB 2A6PA 1A0OA 1CDDA 1I7NA 3O4VA 3RIGA 1W5AA 2BTEA 4IV0A 3SC6A 2PAFA 4UUNA 4B79A 4YPOA 3FMFA 3HYNA 4GLJA 3T9CA 2Z1NA 3IESA 1KAQA 3AEQB 1LJ8A 2IIPA 4B3SB 4JVOA 2E87A 3RTBA 4DKXA 3SF8A 2NSYA 3G2OA 4YP9A 1ZW1A 3WGYA 2Y66A 1Q1AA 4E4RA 2G0NA 1BGVA 3VR2D 3NANA 5ALHA 1TUIA 3LHSA 4OKNA 3TD9A 3TR5A 4N5IX 4TMFA 1VCOA 3UUGA 2PG3A 3WQQA 1FDSA 4D9HA 5C7IO 5I5EA 7GPBA 3VKVA 4BATA 4AXBA 3L8FA 2Y6VA 3QE0A 1G4HA 1K7CA 3I09A 4MCAA 4JYAB 4I55A 1JH9A 1Q0ZA 3O3OB 1W0JA 3OLVA 3QYFA 3GDWA 2H59A 4MW5A 1QAMA 4HDMB 2OZEA 1EYZA 1XF9A 5DCYA 4JP3A 1G9XA 5HF9A 4ZU6X 3N76A 4LOAA 3RSGA 3M3PA 4UXHA 2X9VA 4G56A 5HJ7A 2W5UA 1VL6A 3MJHA 1XKQA 4LZPA 2PNJA 2NPFA 3A6DA 1UPCA 3AONB 1SBQA 4C7XA 2B94A 1EXVA 1UDBA 4P34A 3K70D 1A5AB 3IQIX 4WACA 3FHTA 4XCQA 4E13A 3TI9A 2VPWA 5K8UA 4ZAYA 1TUBA 3TLBA 3ZWMA 4D82A 2ODWA 3ELBA 5CB4A 2GHQA 4ENRA 2J31A 3NGXA 2P75A 1PV4A 1N3YA 1QVRA 1JR4A 2R84A 2GZHA 2HRDA 3CZRA 4QBGB 2AYXA 2C99A 4LJSA 1RJ9A 2RH8A 2QDKA 5H9VA 3NQ41 5BYBA 5LA6F 1KETA 2PLAA 1OGJA 1QE0A 3GC6A 3PITA 1P44A 4N3BA 2P6OA 3A9CA 2WFZA 1NJ2A 4W8OA 1V6AA 4QYWA 3CONA 5E2AA 1AURA 1L7MA 3H6KA 5JSZB 1VJ5A 4YV7A 2FG7C 5KNDD 1BJTA 3PFHA 3X2FA 1AKEA 2YZKA 2PBRA 1AX9A 4CT0A 1D8TA 5E95A 1OQAA 1XRMA 3HEBA 2WM2A 3SJAA 5K3AA 5ECDA 4DDTA 2AOWA 1HKUA 2VJCA 3U7RA 1Y1RA 4BCBA 4EMTA 3A3OA 2A67A 3DC7A 2PD4A 4MUBA 4C03A 2B8EA 4CF6A 1QRSA 5C37A 5LJLA 4IIXA 2EJUA 1XQ9A 4OHMA 3RTDA 3UMMA 2RBKA 4FS8A 3PTZA 4ZAWA 4COKA 1YVPA 3P0FA 1TVMA 3C15C 2IEIA 2YHBA 5HM6A 1J9ZA 2DCUA 4P86A 4I4IA 2R87A 1VE3A 3QMWA 1Y8QA 3C3YA 2X9GA 1ECGA 1R0SA 1NI3A 4P3PA 1H5QA 2IY7A 4DF3A 3P19A 4TYPA 3DLHA 1E8MA 3EIUA 2VQSA 5TQ0A 2W70A 1L8OA 2OR3A 4GHWA 1H0KA 4ML3A 4OIMA 3TLGB 4MQMA 4B6EA 3BWXA 1AC5A 1B74A 1QKJA 4Q01A 1QOQB 2NAPA 4CMGA 1WD5A 1BRMA 1FFBA 3ZYZA 2XHEA 4E07A 2DWOA 2OO5A 4M7PA 5IYZF 4TTPA 2JFBA 1ZYUA 2QV0A 2WZDA 3GUHA 4M87A 2ABWA 5G0WA 2NVOA 2WFAA 1G20E 3GQBA 4IRUB 5EJIA 3I5XA 3G5LA 1VPTA 5JWHA 3IRVA 4OMCA 3LVBA 1EP9A 3WRYC 3WLSA 3HDTA 3H6GA 3IB3A 4K5QA 1UDCA 3KB1A 4QGGA 2V6IA 1YH3A 2XDYA 1PEDA 4IXTA 2H2GA 2HBZA 2ZBQA 1CUDA 4BNNA 1TKAA 3K9NA 1FVHA 3M2TA 4EVQA 4BRWA 1E6EA 4MAFA 2BGJA 1DSSG 1M34E 2YDYA 1J25A 1WE2A 4W7HA 4WCFC 1GP2A 4W7IA 4WY2A 5EYPB 1B4DA 3RIXA 3SHTA 5L4SA 4MP6A 3RRJA 1N5KA 2BMVA 1IHXA 2I3ZA 3BHMA 4E6PA 4JT2A 1F51E 1KOFA 5TARA 4BNDB 5CXUA 1EBBA 5K8CA 3OT1B 3FF1A 3R5FA 4TQGA 4URVR 1VYHA 3I52A 1G20A 3ETNA 1IZ7A 1TK3A 3G2QA 5IYZA 1NPDA 4I4LA 3NEAA 2I54A 3RCBA 5HRCA 3JQAB 1A2QA 4QUHA 1TM4E 1KTVA 2FMIA 1FSPA 1R0RE 1E4EB 3GBPA 1A82A 1P7YA 4JELA 1LBHA 3HA2A 2I9PA 4JS0A 5DI9A 4E7PA 2AR9A 3E7FA 4DSAA 4YY3B 4N7RA 2HBQA 1J8DA 1KERA 2H7YA 2ZVDA 2F1OA 4GQBA 2JHCA 2OBFA 2YJTD 3CUEF 2PVSA 4ECEA 1D1TA 2DULA 3IVGA 2FW8A 4M7OA 4NYMR 4HVCA 5M29A 1M34A 3GRAA 3HN7A 4Q21A 4UHDA 2OYRA 3N2LA 2H48A 1W76A 3F5MA 4FD2A 3MRSA 1RACA 2ZULA 3EC2A 2D2IA 1J4AA 4D97A 4YAJA 5ADHA 3ETJA 4KSBA 2HV9A 5IVPA 1LK0A 1R8YA 5F98A 5LWQA 5KSWB 4DJJA 4WJKB 1VJCA 2JFQA 2NU9B 1HPLA 2UAGA 2QTFA 4PX5A 3QNWA 4X6UA 3W05A 4ZMBA 3HYSA 3GGCA 1V35A 5DISB 3TLAA 3ULKA 3WLOA 1WSDA 2ZS7A 1KZ4A 3GY0A 3HY4A 2XA1A 3HG7A 4FINA 4H0CA 4RGVA 1RXVA 1QMGA 4JXZA 3QVMA 1UDXA 5C32A 3PEFA 3NBAA 4MLZA 1Q1EA 1IIBA 1YA8A 3QEMA 3WAGA 1KQ3A 3BFXA 1I32A 3DDWA 3F3YA 2DOKA 2FP4A 4G5YA 5AVZA 3IDAA 3CNQS 3D8BA 4HB2A 3FSGA 3U1TA 4EJSC 3L2OB 1KEUA 1RTKA 4K6FA 3E8MA 4BNMA 1XTTA 4PPYA 2KLBA 5CVCA 2HA3A 1J70A 5DCLA 4OXRA 3I64A 1E9DA 3ISVA 2WILA 4FSDA 2A5LA 1I6WA 1S4QA 3BGOS 2BBTA 1H8HA 3GV0A 3UIEA 2SBTA 1IQUA 1UK8A 4I4TB 4CGYA 2PUWA 4E6EA 1JEYB 2B8NA 4AICA 1NYTA 1C29B 3C45A 1JH8A 1KH2A 3H04A 3FTNA 1OZ0A 3IODA 3QX3A 3HA3A 3RDPA 3CLRD 4FSXA 1QO0A 2C7PA 2CUNA 2Z08A 3DSRA 3MYYA 1WRBA 2J9XB 4OHZA 1AH2A 1N5DA 2G08A 3EMDA 3OJ0A 5HZMA 4NS1A 3PRHA 3DLIA 2OFPA 4ER0A 4OFZA 4IHKA 4EAQA 1OXBB 5CB4F 4PHTA 5DLYA 3S2GA 4CL2A 4CKWB 5ISMA 1DJOA 2OSVA 5AM2A 4ONEA 1ZVQA 3DXFA 1GUBA 1R0BA 5DHAA 5JFGA 1E61A 3S8EA 3WBFA 3GFSA 1RWXA 2NSDA 4KQHA 721PA 4DLUA 2R8PA 5KO2A 1S4MA 3PEVA 5JY6A 4KUEA 4H7DA 4F5WA 1Z45A 3L49A 1YR1A 4OLHA 4P38A 1B0AA 3HZOA 4CIXA 5AQ1A 3D7NA 4MP8A 1TJ5A 2HT1A 3JAMA 3LDUA 4YWHA 1KQOA 2DPHA 4G4JA 3JAKA 1PN3A 1RWPA 3MCTA 3OP4A 1RM4A 4QYSA 4MP3A 1P17A 3ZLBA 4D42A 4B3TB 1S1CA 3TEFA 2LXNA 1L6IA 1OSNA 2PS9A 3C3AA 1TRKA 4TPKA 3RS4A 2ZUFA 3WRYA 1I9CA 2X8BA 2BDTA 4RPGA 5JQGA 5ALUA 1HQDA 2OAGA 4Z3OA 4DV1B 3BVPA 4W5WA 1RRFA 4B6SA 1J2EA 3VMMA 3WIEA 4F4DA 2YYSA 1G5PA 2GPYA 2PJDA 4GPD1 3K53A 3CT4A 5EZSA 2H3HA 2B4KA 4WCFA 1UK9A 4NP6A 1AHPA 1COWA 3K94A 1FFXA 5K6AC 4I1VA 2FLKA 4G2NA 2EW1A 3C5WP 4N65A 2ZWMA 3JQGA 3QVVA 3TSZA 4HV4A 2BDEA 3P5SA 4JVNA 3FFAA 1TTPB 3FDXA 1O96A 3M5WA 3F7OA 3KB6A 4IIJA 2O7RA 1A4IA 3EVGA 2CUKA 1UCFA 3VTFA 3FZGA 3CVVA 3I2KA 3GVXA 1AKQA 2MSEB 2ZR7A 1R4ZA 4NPHA 4XEHA 1N4AA 1CS0A 1V4BA 1AKNA 3SHOA 7ADHA 2H1OA 3AZOA 3T7RA 3R7WA 1CY6A 1SUPA 3TI7A 3J81A 4I9GA 3OT5A 1PU2A 4YRNA 2QP4A 3OQMA 1LNZA 1TLFA 2YW9A 4JLVA 4WK4B 3EH1A 2AJDA 3Q7IA 5LQUA 1CG6A 5B6JA 3ED5A 2QMQA 1T2EA 4ZZ3A 4N47A 1YZFA 3ND6A 2WJGA 4KQEA 1O95A 3A1DA 1NY6A 4DBLC 2W2OA 1JYEA 2X7HA 2GFQA 3VH2A 4DV0B 4MITA 1EMDA 2H4FA 3OE4A 1JALA 3ILXA 1C7IA 4U4AA 1A9XB 1TGVA 1C41A 2O3TA 3BMOB 3EFEA 4FILA 1XT6A 3AFNA 2XVMA 4N3CA 3V55A 4BX2A 5FX2A 3O4RA 2Y0PA 2X5KO 1IB6A 5BUZA 1QFSA 2F3PA 4R40A 3H5AA 5D5PA 3W2GA 3I6ZA 4EJSA 3B9RA 5B5SA 4DGQA 1XVAA 4RVNA 4BBAA 4YMGA 1C5KA 1KC1A 4RENA 1W48A 2R97A 1MJFA 3PJFA 3RK4A 4BFVA 4QZVA 3CG0A 5CW1A 3EGXB 3DQQA 3ZIDA 2GRJA 1EB9A 1U0OC 5MFPA 3T54A 4PS1A 3VAAA 3CS3A 4TKVA 3T5TA 3DB1A 3EH2A 4U9HS 2G6TA 5GM2A 2E5FA 2OC9A 2JG3A 1DIAA 1MG5A 2IZ0A 1V2HE 3KHUA 1OU0A 4DBVO 2C4MA 5JTUA 4N03A 4R6XA 1DC4A 4IIVA 1D4AA 1UBTS 2E89A 3D4LA 4CM6A 2B7BA 4JUFA 4WQMA 1G1MA 2PSJA 2FEAA 4QLBA 2JANA 3IILA 3KZOA 4DQDA 2HEGA 4RHEA 4YJ3B 3UFXB 4IGKA 1IN1A 3I6IA 1R4MA 5WRFA 5JRZA 1YB4A 4Q0MA 4XGRA 2IHZA 4FWTA 1U6KA 1PZHA 3MOGA 3QE3A 1YZTA 1NJ5A 3VHXA 5EY5B 1YT5A 2VOEA 1RMQA 4BKMA 4W8GA 3DKRA 2F2TA 2AFHE 2UZ3A 2ZQYA 4NHOA 1KA9H 1MQ8B 3O2SB 3WWEA 1Y37A 2ZBPA 4DNFA 4MXDA 4D8VA 4IOLA 1A9RA 4D92A 4R2HA 3U16A 1OI4A 1SEPA 2AN1A 2P8SA 4B4KA 2XUQA 3SZUA 2DT8A 4X00A 3D6TB 3NHLA 2BEWA 2RHGB 4NIMA 3BFPA 1LX7A 2IYQA 4Q12A 4Q34A 5K09A 4TYYA 3GB9A 2DH5A 2JCYA 1ESNA 4FONA 3W7VA 5JAPA 2QPTA 4LJ9A 4CLRB 2ES4A 2H5LA 2FOXA 2PO7A 2XT0A 4HNQA 3V8VA 2IEZA 3I6BA 4E2ZA 1NVFA 4PG5A 5AUPB 2AEMA 1E5DA 2AFHA 3UOAB 2GAAA 2YHUA 1FYVA 5B55A 2VJDA 4E22A 5JT1A 2PWYA 2JVKA 5G41A 2Z8YA 4B31A 4YALA 3WLTA 1TVKA 1XMOB 3W3AH 2DFDA 3KR0A 4LY0A 5COAA 4HWTA 1QH1A 4RZIA 3EXEB 4CGZA 3HCAA 4P0PB 5K6AA 1L4GA 1PFKA 2HSEA 4EA9A 2W2KB 3WQHA 5FBRB 3FKQA 4PX3A 3IV7A 4C7OA 4TMTA 2V6GA 3TXXA 3K9BA 4RYDA 4DBLE 2GD2A 5HJEA 3QPBA 1AK9A 3RNOA 1YSCA 4KPUA 5FADA 1JJ7A 4XYEA 3O95A 3WIDA 3E9ZA 2ZAGA 3JWGA 2H65A 3OEWA 3WSVA 2WK1A 5TMBA 5A06A 3LRXA 3TGLA 3S1SA 1WDMA 1CRLA 2IW3A 3LS2A 4LTNA 4JT4A 1JG7A 3EY9A 3LIPA 2YVQA 1SU4A 2JLRA 3O26A 1GZ5A 4TV8A 1WB6A 4W5RA 3GRVA 5JQGF 1IY2A 3FDZB 5EFZA 1HDRA 3WRWA 4V24A 1F9EA 1EUQA 5LUBA 1USIA 2EKBA 1XMPA 3KKZA 4B83A 4ZTZB 1WR8A 4U9IS 4WN3A 1WPGA 2R1VB 5JXHA 2G28A 3CFYA 4FYYA 4TTVA 4R68A 2QRZA 3U13A 1JS1X 1N32B 4E5NA 1HLPA 4G8CA 4I9UA 2FRDC 3SSAA 8MHTA 4S1VA 4ILEA 4MI1A 2R6GA 3QVUA 1XZHA 3F5DA 2DKNA 3PQDA 4QAQA 3SZOA 4RK6A 1ZKDA 3D8NA 1Q16A 4INAA 4BNGA 1T9CA 2HMVA 1IM8A 3RVDA 3SYTA 4F06A 3NP9A 3IOEA 1QK4A 4YCJA 1Z38A 4EPRA 1OWOA 1CEXA 3L1JA 4QLAA 4BDTA 4NPCA 1T3ZA 3K0KA 1XCOA 4ENUA 3O2QB 1AGYA 1DPFA 2O52A 4UASA 2IYLD 4DIOA 5DLEA 4OQLA 1YVDA 1JEDA 3CJRA 2B9VA 4DA6A 2VH5R 3GDFA 2J0SA 4ES6A 1WUJS 2NOGA 2H1IA 1I3OA 3PDHA 2REQB 1KXJA 4QGSA 2I1VB 2VEOA 4NV0A 3BM5A 4XKJA 3V97A 3QGMA 2CV1A 5A9SB 2VJMB 1X86B 821PA 4NJEB 3J81k 4KO2S 4KU4A 4K9RA 4AMGA 5BR8B 1P7CA 3KJQA 4KLAA 4NEQA 5D3KA 1E79A 1GL3A 4KKVA 2G5PA 1J42A 2WJYA 3N2ZB 2X40A 1TO1E 2H2HA 1Z56C 4G86A 3W6OA 2WU0A 2OESA 1GOTA 3E35A 1E2DA 3FVRA 5DMHA 5F77A 3OETA 4B74A 3AY6A 1U98A 2O8EA 1VC2A 2JAQA 3VYUB 5EP4A 4YAUA 1N9KA 1JRLA 5JJIA 2QLJA 4TTQA 1SOVA 1YZ3A 4V3BA 1RP7A 2MINA 1YD7A 2EEPA 3FGOA 2J6IA 2JA1A 4F93B 2RAUA 1SBNE 2JARA 2IHTA 2SECE 1PSWA 1S8FA 1V48A 2O20A 4MQBA 3WJAA 4CPDA 3WDMA 1GGHA 4TMKA 2X6TA 3TB6A 3F9CA 2WWFA 2BFOA 1O9BA 2NO1A 4DUYB 3THWB 4RTLA 2ETVA 2IHBA 4F4FA 4FYIA 1M2HA 3KVNA 2JK0A 3WYAA 3K05A 3OP1A 3TS1A 1RLIA 1CDEA 1DCKA 1BX1A 4HAIA 1VG0B 3I73A 2QN3A 1FNMA 3AYZB 1PZGA 4I8IA 3L77A 3UJ3X 2AC7A 4DA0A 4C3VA 5LLTA 4N0MA 3OAAD 4LV5B 4PC7A 5AVSA 1PKEA 2R47A 4ZYTA 3MRTA 4YV0A 4YRJA 2VYVD 5CXSA 2HSDA 4J3FA 4ZPJA 4RF3A 3C4QA 5BSUA 3W2FA 2RHRA 2ISSD 2GBCA 2IP1A 3HCDA 3SDZA 1E1LA 4BFCA 3JQ7B 3ONEA 4D9EA 2OD2A 3EGWA 3Q7EA 3HS3A 1QONA 3BB4A 4MEAA 4CL0A 1X1AA 4QE3A 3ORRA 1QC5B 4G0PA 4MDEA 2WWGA 3TZBA 2HDWA 4TLDA 1RXCA 1GNQA 1ZGHA 4BGUA 2FWMX 2OCBA 4N5NA 3IAXA 1H9AA 1GGKA 1ZUNB 1ICEA 2GGSA 2POQX 5BV8A 3OJLA 2XMBA 3CSUA 3FCEA 3P9XA 1EAYA 3K5IA 4GPIB 5CXXA 4H4EA 3TVTA 2R6FA 4MA4A 4F6RB 5LL6P 3LF2A 5F73A 4PIPA 2D7DA 3ONVA 4L85A 3E84A 4F60A 4H1WA 4R8VA 4WLEA 1KDZA 3UCEA 3UA4A 5HOQA 1M2FA 3NASA 3K15A 2YV1A 3RYHB 2M6LA 2YICA 5EWJA 2ADMA 2XAUA 3CVWA 5KUTA 4IHJB 3P9YA 1OXUA 3OY7A 4WK6A 3HCRA 2PMDA 1J7JA 2OV1A 4WECA 3IVRA 1KMIY 1Y7IA 1FXUA 1OR8A 1WNTA 2P90A 3LKVA 3LPLA 4Q9LA 1VCIA 3N1UA 4R2IA 5TNXA 2XDQA 2AQKA 1YA4A 2BHRA 5CBPB 3DM5A 1TU4A 1V11A 3B6IA 4N8EA 4REMA 4Q3BA 2FRDA 1YFKA 2EQAA 3FCUB 3EGIA 4MVJE 4EKEA 1PUIA 1CY4A 2XZPA 4YJKA 5AI4A 5GJCA 4JYZA 5C34B 3BH7A 4HR7A 3ZBUA 2EDCA 1E9EA 4J4TA 4US2R 4LNAA 4E11A 4HEA6 4D0RA 1P4RA 5AJYA 2VPYA 4NCKA 4DWOA 3P0EA 4AU1A 4B80A 4FKBA 2JS7A 4Y67A 1E20A 3E15A 3QUQA 1D0VA 1Z6QA 3AQ4A 1IY1A 1I2CA 3H84A 1M7GA 3NU1A 3OJCA 4HDQB 1Y5LA 5A6SA 3CB2A 1OHHA 2QE6A 5KIAA 4E3ZA 4LHSA 4BMXA 4G4IA 2DX7A 4Z3KA 5J4VA 2HTEA 1PNTA 2I33A 3G0BA 5F51A 3AB3A 4WHMA 4XWGA 3JWJA 1AV6A 3FWKA 4ENTA 3BD7A 3SE7A 1XTZA 1S7GA 2MYTA 4MVJA 1I4EB 4UBJA 3K32A 1JBQA 3Q7RA 4MYRA 4PW0A 3TKAA 4D3ZA 1DKQA 4GLLA 1ZN8A 5K0ZA 4CM9A 1N0IA 2V8BA 2XVZA 4PPFA 1Z5VA 1R88A 3DTVB 3H1BA 4HN2A 2P2DA 3N3BC 1S2GA 3N2YA 2GD0A 1ZEMA 4I14A 2HWYA 2FWBA 1SC9A 4CIAA 4MGKR 3WK9A 2C20A 4QUKA 4AG3A 1O87A 3P9QA 2Y93A 3BX1A 1BFKA 1Y5NA 1FDWA 2GNAA 4GZLA 3BQNB 4HFJA 3RROA 2PZMA 3D3JA 4OEHA 3ROFA 3I9V6 5DP2A 2WVAA 1D2AA 1VL0A 3EXG2 5FWXA 1JLLB 3PR3A