1JDJA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with 2-fluoro-6-chloropurine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
349
structure length
346
Chain Sequence
b'KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 132
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2001-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1jdjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jdjA01
2OORA 2B83A 4YXFA 4LVCA 3V1TC 2X0NA 2YHIA 3WFJA 4TQGA 2J3JA 1GYPA 1ADGA 3EZLA 1TT7A 5EIOA 2I9PA 2YV1A 4R5MA 3F5SA 3ROPA 4XZ3A 4PLHA 4BNWA 4R1NA 1Q0QA 1U3TA 2X22A 4UVHA 4ALIA 3PRJA 2YQ5A 4NBWA 3ZI0A 3MJEA 4YDRA 3UW3A 4ONEA 4YJFB 1NQOA 1KEVA 2HAEA 3KYDA 5BSEA 2PKQP 3MTJA 2X0RA 4I08A 1UZLA 3LDHA 4R9SA 4AJJA 4ALLA 4L75A 5JSFA 1CYDA 1PJTA 4RVDA 4D43A 5HBRA 4BGUA 1VM6A 2FPPA 4INAA 4IDAA 5A5FA 1I3KA 5A03A 1GV0A 1PJLA 3LZ6A 1ZK2A 5COQA 1QYXA 3AY3A 3DR3A 4XYMA 1ZCJA 3F3SA 1ID1A 4LK3A 5F5LA 1NFFA 3INRA 3QIVA 2DPHA 4CLRB 3D0OA 1G0OA 4BNLA 4XB2A 3OA0A 4JP2A 1IY8A 1JQBA 4BMVA 1K5HA 2D8AA 3V2GA 2OMEA 3SEFA 1CF2O 4YCAA 3PJFA 3U3XA 2V6GA 4FS3A 5DULA 2RCYA 4GVLA 3OQBA 1SB9A 1NFRA 4EGFA 4JCOA 3ZNPA 2YDXA 3MEQA 4CMGA 3WJAA 4IIVA 3NV9A 3PLNA 3UN1A 2BGLA 1QORA 1DOHA 3T4EA 1GZ6A 4J7CA 1M75A 2DM6A 4XGIA 3ENKA 2GF2A 1HE4A 3I9OA 4IM7A 1O89A 5L4LA 5L53A 4O0LA 2HMSA 1FMCA 1X14A 4CM9A 1HSZA 1RYDA 1KVRA 5KVVA 1PTJA 1UH5A 2O3UA 4GGPA 1H6DA 5FWNA 4FFOA 4CM5A 1DHRA 3RBXA 3S1LA 1DIBA 3JQBC 3TL3A 3WJ7A 1YB5A 4ND2A 4D42A 2ZYDA 3HDHA 4DPKA 1N1EA 1S6YA 4CM1A 5DP1A 1ZXLA 3GPIA 3FF4A 5L7TA 3P19A 1D8AA 4QFDA 2EXXA 3VH1A 2YFQA 3AI1A 4OSOA 4DLBA 3GRKA 4BO7A 5ICSA 3DDNA 3FNEA 4R51A 4RV9A 4A2CA 5A3JA 1ZEJA 2J5RA 3GVIA 4YB8A 4ALJA 2PV7A 5TX7A 4BVAA 4KOAA 1JAYA 4EUEA 4J16A 4FFLA 4MVJH 3K92A 1BVRA 1QYWA 4IQ0A 4L4XA 4OXKA 4A10A 1I2BA 1LC0A 4QO8A 3E9QA 4MJLA 4MVJE 3QVXA 1DHTA 3DO5A 4Z3KA 4BHTA 1C0LA 3HWRA 2VUSA 4IMPA 1TT5B 4A27A 2X0IA 2VTDA 3PJEA 4CLOA 1OFGA 3UOGA 1E3IA 2Q4EA 2HQ1A 3N74A 3UH1A 5I9LA 1KIFA 3QVWA 5JYEA 1E3EA 2AG8A 3D5QA 3JTMA 1LC3A 4OKNA 4WK6A 4XR4A 3V2UA 4NK5A 4BKQA 4L74A 2EG9A 4E33A 2Q46A 3LT4A 2TMDA 4J6FA 2C29D 3LVFO 3MJVA 4IBOA 3TNLA 1Z45A 3A9WA 4XJSA 4IUYA 3WGGA 1EUCA 2FWMX 1WW8A 4D41A 2NUAA 3GEGA 2BGKA 3P2OA 5DBFA 4GAEA 1ISFA 1QLJA 1IYZA 3PJGA 1HSOA 2D1YA 3UCFA 3TZHA 3TZQA 5JAIA 1UJMA 2CDAA 4CMEC 2YHIB 1KY5A 2OXIA 4AJOA 1PZEA 1B14A 3GNQA 4P38A 3PDJA 1P33A 3B70A 4J90A 3DZFA 4O5OA 4Q39A 1U5CA 3AOEC 4PG8A 3TJRA 4GKBA 5EQFA 2O7QA 3DOCA 3EVTA 2VN8A 3IL2A 4RPGA 3IKTA 2JJYA 1Q7GA 3KYDB 2NVUA 3M1AA 4NI5A 4YAIA 1GCUA 3TL2A 1RM3A 4MKRA 1NBOA 1PS9A 2GN4A 4GWKA 4KUEA 1KYQA 4YRDA 4DIBA 2R00C 1PQUA 4WCDA 2J8ZA 3KETA 5T67A 4IMRA 3OJOA 3U0BA 4DQXA 2YW9A 1QYDA 5KJFA 2C7VA 5HTOA 4IJKA 1PWZA 3SLGA 1BWSA 2CZCA 3A06A 4BNKA 4CLHA 4L73A 1GFSA 3L4BA 1PJCA 1NYTA 4R68A 4OM8A 1JU9A 2NTJA 3DBLB 3HDYA 4EDFA 3PYMA 2PZJA 4D7AA 2DC1A 3QV1A 4D0RA 2EHDA 3E9NA 3RFTA 1I3NA 2NACA 3ROQA 3I52A 1LRKA 1P1RA 3I9NA 4C4OA 3D1LA 1KETA 5DZSA 3PJDA 5ADHA 1R37A 2I3AA 3E18A 2ZYGA 1KVQA 1O0SA 5DDIP 4PGFA 1JKJA 2EGHA 3H3FA 3RUAA 3GNTA 4EJ6A 1DSSG 1EFKA 1HYEA 1GD1O 2VOEA 3MOIA 4U0KA 5CDSA 4RQTA 3W8DA 3ZHBA 3VPGA 3WMXA 4A0SA 5L40A 4NDNE 3KYCB 2IXAA 4QSMA 3RC7A 3TFQA 4O59O 3ZHZA 1NR1A 1Q2XA 4TWRA 1ZJZA 2C2XA 4J3FA 2OHXA 3JD1A 5CEEA 2O3RA 3PHHA 4B4VA 3VH4A 5CDUA 2EP7A 2GR9A 3LU1A 4E5MA 5CFZA 3G49A 1E1NA 2CDCA 3IUPA 4ZVVA 4FOSA 4W82A 5THKA 1WDKA 4JBIA 3RI3A 4DA9A 2Y05A 2Y93A 3QWAA 1NAIA 5IZCA 4ZICA 2W2LA 1ONPA 3WS7A 5ILGA 1E92A 1AN9A 3OIFA 5EESA 2FSVA 4TZKA 2ZATA 1UXJA 1F0YA 3KRTA 1VKOA 3RBVA 4WKGA 1VL8A 5L9AA 2WYWA 1CIVA 1JWBB 1NTOA 4TRJA 5G0TA 1MXFA 3NDIA 4KDEA 4OOFA 4CMIA 4DVJA 1NQTA 3L6EA 1AXGA 1HRDA 2GPTA 4RF4A 5DBIA 4UUPA 1I8TA 4RLSA 2P4QA 5A06A 2IXBA 3LK7A 4HUJA 2Q49A 4KTVE 1HE3A 4A26A 5I7VA 4PLPA 4IGEA 1XIVA 4L4SA 3HE3A 2VYNA 5ICMA 1VSVA 4RF5A 1TI7A 4AJKA 2X0JA 1Y7TA 1OC4A 3H5AA 3U9LA 1HTBA 4CLOB 2RHCA 3DMTA 4IY1A 3LT0A 2FR1A 1KC3A 1TA4A 5AXDA 2DQ4A 3FI9A 1YJ8A 5KJCA 2NM0A 2QRLA 2VRCD 4B4WA 4PVDA 2VZ9A 3UCEA 4KUGA 1Q7BA 3U09A 3JQEA 1C1XB 2GN8A 3IQDB 5DOZA 1I2ZA 4LRSB 1XQ1A 1LSUA 2X5JO 4FDAA 5H82A 4IQGA 2Y1CA 3OJ0A 4I5GA 5DF1A 5JC1A 2ZCUA 3W6UA 4J1QA 1ENYA 1BVUA 1JW9B 1V3TA 4GX2A 4EITA 2PWZA 5KNLA 3H5NA 3ZGYA 1PS8A 3KVOA 4XYEA 2I5PO 2OZPA 1YO6A 3U5TA 2V6MA 1LTHR 1AHHA 5CAEA 6ADHA 2H9IA 3HDQA 4D3SA 1V3UA 3C7AA 2DAPA 4OIMA 4BNVA 2UUPA 3UGKA 1F12A 5AVOA 2OL4A 1CDOA 5I7EA 3ANMA 4PG6A 4BL5A 5L7YA 2NVUB 2A94A 4WNIA 2E37A 1T25A 1F8FA 3IMFA 3TDKA 3ZWVA 3GK3A 1DFHA 4I5EA 2C0CA 4J4TA 3OF2A 2ZTUA 2O7SA 2Q50A 4LCJA 3VH2A 4YJHA 3N58A 4XCVA 2VHXA 3BTVA 2VZ8A 3QSGA 1B8PA 3C8MA 3ZWYA 4CM4A 3OA2A 1PJQA 1XCBA 3GVXA 3WFIA 2SCUA 3FTNA 4JGBA 3WLEA 5HRUA 1PQPA 4TVBA 3JD0A 4R1SA 2FOIA 1I3MA 1GQ2A 2CSUA 3QP9A 2O4CA 3AFMA 4BO9A 2P5YA 1CETA 5GZ6A 2DKNA 1Y8QA 3GA0A 3KSDO 1YONA 3WBFA 1SC6A 2PKQO 4W99A 1U5AA 2A9FA 3GN2A 1IULA 3Q11A 3OBBA 1E1MA 2PZKA 4H3VA 2NTVA 4FFRA 1OMOA 2O3JA 4MINA 1NWCA 1P1JA 2I67A 4XB1A 2ZTLA 3AWDA 3BHJA 3HB5X 1SEPA 3WIDA 1M6HA 3R0IA 5TJ9A 1LXCA 3CXRA 4CM6A 5IFLA 4FJ2A 1EK5A 2P68A 4GI2A 1E7SA 3AOEA 4AJLA 1LLDA 4L4RA 3PTZA 1LDNA 2CVQA 3B20A 3BAZA 1D3AA 4BQRA 1J4AA 5EQDA 1GQYA 5T8KC 1YB1A 2QQ5A 4BMNA 3X2EA 1UXGA 4IDDA 2WM3A 1Z74A 4MDHA 5FI3A 5FF9A 1WMBA 4YWJA 4CL8A 4DGSA 4F45A 2OUIA 3C1AA 4AJEA 1NM5A 4FIZA 4NMHA 3VVCA 3JQ9C 1FXSA 5IJZA 1CWUA 5LCXA 2VRBA 2X58A 3GF4A 1H9BA 4EW6A 4GX5A 1KVSA 3UICA 1DFGA 4TRMA 4BKOA 1FDTA 1PR9A 3H65A 3LT2A 2AQIA 4CMIB 2OBNA 4QUKA 1XU9A 4FCCA 1NQ5A 1UDBA 3HNPA 1K2WA 1QYCA 2QIOA 4PG7A 2WYVA 3H9QA 3UVEA 4CUJA 2Q2QA 3GR6A 5BT9A 1C0PA 2CF5A 3H9GA 2P2SA 3IIEA 1DBVO 1NAHA 5IAAA 4OH1A 1SMKA 3JQAD 4M87A 3H2ZA 4AFNA 3RC9A 1DJQA 1HLDA 1ZSVA 4IDBA 3G3EA 3PI7A 2H6EA 1NVMB 5F1PA 2F00A 3ZWWA 3FNHA 1AE1A 4IXTA 1U3UA 3BMNA 5L51A 1ADBA 3IJRA 4BO0A 4EBFA 1X7GA 3L07A 2W8ZA 3VZRA 4CQMB 3JQFC 1HDCA 1PQWA 3FNGA 5KJ6A 4KQXA 4EUHA 5GZ1A 1R16A 5CEFA 3JQ8A 3ZV5A 1AUPA 3Q2IA 1ZK0A 2DBVO 2D4AA 5L3ZA 4ZHSA 2Q1SA 4Y98A 3H9JA 3CZRA 3KV3O 3VC7A 4CM3A 3F47A 1B2LA 5JMWA 1OZAA 4J1SA 3RQSA 3ONFA 1HZZA 4PZEA 3M1LA 2C59A 5T57A 3PIDA 4NH4A 2DBRA 5U4QA 2DTEA 3FBGA 4PLZA 9LDTA 2Z1NA 3AM5A 3ICCA 3JYPA 3L0DA 2QRJA 4TZTA 1WPQA 1SB8A 3KLPX 1Y1PA 2BFMA 3F6YA 2E49A 5CP8A 4EJ0A 1LDMA 4II3A 3FPCA 2QG4A 1FDVA 3PWZA 3GOHA 4S3MA 2XXBA 4YRAA 4Z9YA 1IB6A 2ILTA 1MFPA 4YJHB 3VKUA 2PR2A 4GX1A 3JQCA 3S8MA 4HXYA 4D79A 4CLRA 4CM4B 2HCTA 1A4IA 4QO7A 3LYLA 3MJ4A 5BSFA 1UR5A 3S2GA 1NXQA 3H9EO 3O8QA 3QWIA 3VPXA 5A1TA 3WQSB 4I5FA 3GHYA 3ETGA 3O38A 4J4HA 1EVIA 2X7HA 4R1UA 3EHEA 3WIEA 3L6OO 4BO1A 1U2GA 1QV7A 2ZB8A 4NIMA 5IDYA 4E5PA 1Y8QB 2EP5A 1PGOA 1PJ2A 1J0XO 2YV2A 3GAZA 4ALNA 1IPEA 1QR6A 2VCYA 4RPLA 4P22A 2GZ3A 4MVJG 3VZQA 2DPGA 1LRJA 3X2FA 2HJRA 2OGUA 1NP3A 4PG4A 2AEFA 1NHWA 1SEVA 1WMAA 2CF6A 3EW7A 3GC6A 1AGNA 4WJZA 4TVOA 4CM7A 2WMDA 4E5YA 1XQ6A 1E77A 1NPTO 3W8FA 2Q2VA 1AXEA 2PGJA 1ISGA 1E3WB 3CEAA 5JXWA 4OYRA 4P4LA 3I6IA 3T4XA 4NJMB 2C5EA 3ZHYA 3E5MA 3P2YA 4W6ZA 1ZVMA 3WGZA 1DAOA 1F17A 1LDBA 1D1TA 4G5HA 1ZIDA 2FY8A 2Y0EA 3RASA 5ER9A 5JDIC 1H2HA 4FJ0A 4EEXA 5CDTA 3NGLA 2AQKA 4K26A 3ASUA 3GDGA 4PRKA 4QTZA 1BDMA 4LSWA 4FC6A 1YGYA 1PX0A 2RAFA 3K73O 4G65A 2YDYA 3SXPA 1ZW1A 3PIIA 2ZQZA 2B4TO 3VTFA 3Q1LA 3QHAA 5TQVA 2OP1A 4XYLA 1A7AA 4DMMA 3MJSA 3NGXA 1YL5A 3WMWA 2NNLD 1XELA 4OGWA 4MVJI 5FYDA 2B4RO 4R5HA 2NLOA 4E6PA 1A72A 4ZU3A 2EJVA 3IP1A 4TROA 1TT5A 5JPIA 2X9NA 4BO3A 5B4UA 4KWHA 4XQGA 1BGVA 4N5LA 2EEZA 4ALMA 3ZNQA 5C5IA 4RGBA 3ENNA 4BO4A 1HDRA 5I8ZA 4LISA 4WE3A 4DWVA 3RJ9A 4YAKA 1PGQA 1CERA 3WLFA 1DEHA 5TIIA 2JHGA 2JL1A 3PHJA 4YTEA 3ANNA 3PLRA 3BTUA 1R0SA 1HKUA 2G0TA 2PD4A 1T2AA 3BMNB 4FOOA 1UP4A 3SJ7A 3OETA 4LN1A 2YQ4A 1M6WA 1G6KA 1ORRA 3EYWA 3VZPA 5A04A 2HDHA 4RORA 2H1SA 2X23A 1GU7A 1BRMA 1YE3A 2WSBA 4WLEA 1O6ZA 1P31A 2IZ1A 3JQ8B 1E7YA 1U3WA 2AG5A 2ZQYA 3ROKA 4B7XA 3BMOA 4PZDA 4IQ8A 4IS3A 3FR7A 2D59A 2EGGA 2NU7A 1O5IA 4B3JA 2FMUA 3NTRA 1HT0A 1OC2A 2WYUA 4I9HA 1XYGA 5BNIA 5G0SA 3JD4A 3GFGA 5CEJA 1H94A 5G4KA 4BOYA 1MFZA 4GMFA 1X0XA 4MP8A 1PGNA 1YL6A 3PP8A 3MZ0A 3I6QA 5G0UA 3GQVA 4H7PA 3SJUA 5HS6A 4W9NC 1VSUA 5EMHA 3NT4A 3F9IA 1WVGA 2UVDA 3DBLA 1SNYA 1LA2A 4MIOA 2UYYA 3O8QB 1H2BA 1JVBA 3FCOA 3WTCA 2ZTMA 3ZWNA 3GUCA 1DPGA 4WEOA 5KKCA 1DIHA 2X4GA 3DTYA 2PH3A 3IS3A 3DBRB 2GYYA 1B3RA 3DXFA 1ZJYA 5IXSA 1M2WA 2Q45A 5I9MA 3OJFA 5AYVA 1ONOA 1MLDA 1T24A 2RBEA 1JKIA 3KYCA 1YKFA 3RUIA 5F21A 4CL3A 2BMAA 1OOEA 3ZWAA 5T5QA 4FGSA 4L76A 2HUNA 4DC0A 1Z82A 1JWAB 5G2OA 4XGKA 3AY6A 4IJUA 1P9LA 1ZZEA 4UVEA 3WG9A 1NVGA 4Y6RA 1P3DA 3VPFA 3TZKA 1NNUA 4IPTA 1Q1NA 1XEAA 2DUWA 4ND5A 3K30A 2BGMA 4ZQBA 4HWKA 5LDHA 1LNQA 4IJVA 1U4SA 1TB4A 4M8SA 3WGTA 2GO1A 3BYZA 4FC7A 4CLXA 3M2PA 4XQCA 1YH3A 5CDYA 4YAEA 2JHFA 3QJ5A 3D3WA 4K1LA 1U3VA 2VHZA 3CINA 4WLOA 1PJ3A 3DAGA 1VJ1A 1ZK4A 1P0FA 1SZJG 4R41A 4ALKA 1SO8A 2CFCA 3NEPX 3Q3CA 2RH8A 4DREA 1SCUA 3NKLA 2GN9A 2O3SA 4MIYA 4RO0A 4XQ9A 1U7HA 3RBZA 2C7GA 4ESOA 3W6ZA 4J2HA 3IOYA 2H63A 1NR7A 4BV8A 1T1SA 3ZZNA 4UUOA 4WECA 4CV2A 4CMBA 2GGSA 2OP0A 3KEQA 1ISMA 2X1HA 2PGLA 3ZV3A 5MDHA 3PPIA 2AA3A 1MA0A 1CEQA 4CMCA 1ZMTA 2AQHA 3CMMA 3ZNNA 2WE8A 3AUAA 3GZ4A 3I9MA 4LGVA 1C3VA 3JYLA 1KVTA 4ROSA 3HZZA 4HV4A 4OAQA 1C1XA 1PU2A 3U4CA 3DC2A 2B5WA 3OQ6A 1E3SA 3VAZA 3NX4A 4C7JA 1VC2A 1PL6A 3UAGA 1ZMOA 3JD2A 4MVJD 3BMQA 4J7XA 3QWHA 3SX2A 3TRIA 2EW2A 4XDZA 4ZQEA 5COAA 2VWPA 2QX7A 2VUTA 3ZWXA 3SC6A 2FR0A 4KQWA 3AW9A 3PZBA 4K9DA 4RPHA 2EERA 1R4MA 1LSJA 3WWZA 4JJIA 3AOGA 3BMOB 2WEKA 4YAGA 1DC6A 1GL3A 3B6ZA 3KSUA 1LUAA 3ZN2A 3HFGA 1MUUA 3NDRA 4HY3A 3ONEA 2PTGA 3H7AA 4ZA2A 3JCZA 1W73A 3AM4A 4YJGA 4CUZA 3A28A 2GZ1A 4IDFA 3RVDA 1KEUA 4UAGA 2X86A 1NWHA 1ADFA 1UZNA 3WICA 1DRUA 1WP4A 2Y1FA 4RDIA 5G4KB 4Y6SA 2YV3A 1W4ZA 2HK8A 5KIAA 4CQLB 3GHHA 1I3LA 4RJTA 5JDCA 2NADA 1PEDA 5COBA 2JFFA 2Z1MA 5CG1A 5C7LO 4R01A 3WR5A 1DC5A 5THQA 2NQTA 3PQFA 4PLCA 4NU5A 3EY4A 2X9GA 1NPYA 2I99A 2NTNA 3EK2A 4CUKA 3O03A 4DYVA 2IEBA 4WOKA 1TXGA 4J7UA 1UDCA 2FP4A 1MC5A 4KMSA 5TT0A 3TOZA 4XRGA 4HFRA 2A92A 5JS6A 4WCFC 2HRBA 2P4HX 3GGGA 3B1FA 5TSDA 1MXHA 4BNUA 5JCJA 3RU7A 3MWEB 4QECA 4DQUA 1PJBA 3HJAA 4PN3A 1WDMA 4K6FA 3DBHA 2HK9A 1J6UA 4DMLA 5JO9A 1H6BA 1VJ0A 4YQZA 1F14A 1V6AA 3HHPA 3QVSA 3JQAA 5A05A 4PLVA 1KBZA 1PGJA 3DAFA 2Y0DA 5DT9A 3DWFA 5HA5A 1E7RA 3BXXA 1ZNQO 1H6CA 4XEHA 2D5AA 1E3JA 2X9VA 4Z3DA 3RC2A 4QFCA 5C37A 3GEMA 3OP4A 3GDFA 1E5LA 4WLUA 3RJ5A 4UVDA 3CMCO 5G4LA 3U4HA 1EE9A 4NR0A 4PRLA 2J3IA 3NT5A 2PZLA 5IF3A 4N5NA 3HQ4O 3AM3A 2QHXA 1YQDA 3LC2O 4HKTA 4YJDA 5U9CA 4DRYA 4OMUA 4GPD1 4WLNA 3SVTA 3INGA 1HE5A 3D3WB 3G17A 4BB6A 4ZQHA 5ILOA 3HG7A 3WXBA 5BR7A 1X1TA 3ADOA 1GPJA 1LJ8A 4Y67A 1PL8A 1IZ9A 2HMUA 2ZCVA 4PLYA 3SLKA 4B3HA 2QZ9A 4OQZA 3GVCA 3OEYA 2P9GA 4EEZA 5H81A 1QMGA 5KWEA 1V3VA 5ENVA 1ZO8A 1ZBQA 5K6AC 4IZHA 3F1LA 3F5QA 1HXHA 1GQQA 3HDJA 3KOUA 3V2HA 4Z0PA 1QSGA 2J6IA 1N9GA 4W7IA 4ILKA 4E32A 3KXDA 3OFSA 5BQFA 4GSLA 5GZ3A 4XD2A 4WOJA 4DLAA 2DVMA 2GERA 3JQGB 1Q7CA 5F1OA 1B8UA 3D4NA 4RPJA 4FN4A 2RIRA 5JMPA 3I9KA 3PYLA 3TOXA 4CQMA 1OAAA 1E1KA 3BMQB 5DBGA 4Q3BA 3A1NA 3E8XA 3GEDA 3W8EA 5B1YA 3L9WA 5A4DA 5T6BA 2JCVA 3IJPA 4EZBA 2HJSA 4CM9D 2JD0A 1ZUD1 4IS2A 3I9JA 4FR5A 4OXNA 4DBVO 1LDEA 3JQBA 1Y9EA 4ID9A 3TF5A 1R4MB 5EERA 3JQ6A 3U4IA 5DCYA 1ZKMA 5TGDA 2EV9A 3ADPA 3L6DA 4GGOA 4JJGA 4ZQGA 4HX5A 2GCGA 3I23A 3S2IA 4BKUA 4YJGB 2P5UA 4YT2A 4FPXA 3B1KA 2C20A 1BXGA 1GYQA 1K3TA 3GFBA 4BNFA 5JLAA 5C7IO 3ANLA 2EWMA 2PD6A 4KUHA 3LLSA 4J49A 1E6EA 1Y8RA 4EI2A 3ASVA 2PA3A 4MIEA 3B1JA 4TRNA 4M1QA 5AOVA 5BNFA 1U28A 4CODB 3K96A 2DT5A 5A9RA 3BTOA 3ZH2A 3ZW8A 1YXMA 4B4UA 3DMYA 4WEQA 1XLTA 3BHIA 3D7LA 4GH5A 4EUFA 2IDZA 3WGOA 1O95A 1QLHA 2P9CA 4YAJA 1U9JA 2POQX 2FZWA 4BNXA 4A03A 3PFWO 4MO2A 3NTOA 3DZGA 5EINA 4C7KA 4CPDA 2A35A 4BGIA 4YA6A 1GR0A 3PDUA 4J0EA 1QV6A 3DHEA 3GG2A 4RDHA 5T64A 5A9TA 1ZK3A 4FJ1A 3PGJA 3MTGA 4R3WA 3DBHB 3L4SO 4JNKA 1GZ3A 2X6TA 4CMEA 3OEWA 3GN1A 2YUTA 1PZGA 3JQAB 4L9RA 4FD3A 3JV7A 4OHUA 1HF3A 2EKPA 4QQRA 2CNBA 3R3JA 5A5EA 1ENOA 4O63O 4LMPA 1EUZA 4DPLA 3CZMA 4LSMA 2OOSA 1P1KA 4XRRA 3GGPA 1E3WA 1H5QA 4NK4A 1Z73A 4NJMA 4NBTA 2ZJ1A 4TMFA 1EUDA 1HEUA 2EW8A 1I24A 3VOSA 3K8ZA 3LC1O 1LI4A 4ZQFA 1EBUA 2AMFA 2CD9A 3RWBA 1Q0HA 4DQVA 4BNTA 1SPXA 3E9MA 2R00A 3ZWCA 1T2DA 2VWGA 4BNYA 1NHGA 2Y66A 3RCBA 4N7RA 4N5MA 1PWXA 3JYNA 4MOWA 2LDBA 4XDYA 1E7MA 3WNQA 2VZ0A 4CJXA 4H15A 2DTDA 2YY7A 3KZVA 3VTZA 3EGOA 1QXSA 1R66A 3C24A 1T2CA 1HE2A 1U4OA 1N8KA 2WD8A 4KP7A 4UUNA 4YPOA 4YBZA 1I32A 2B69A 1IUKA 4JJFA 1K0UA 3ULKA 1YBVA 2O2YA 3KUXA 3WYBA 4RQUA 3DB2A 1BMDA 1N9GB 1XG5A 1ZH8A 2ZKLA 2A4KA 4M55A 4Q3EA 1I2CA 4F6CA 4NU6A 3IKVA 3WDSA 4PG5A 4DC1A 3LT1A 2O50A 3BIOA 4JX8A 4WPGA 1L7EA 4R1TA 3EVNA 1XKQA 1HDOA 2O4UX 3TSCA 1YBAA 2E82A 1QYVA 4G2NA 2CVOA 1HWYA 1KVUA 3OIDA 4FFMA 3ETEA 1A7KA 3R3SA 2YFHA 2B37A 1MB4A 5G0VA 3WTBA 3DZBA 1X7DA 1ZK1A 1XDWA 2Y1DA 1JA9A 1Q0LA 3I1JA 2DUUA 3HN7A 4S1VA 4PLGA 1LDGA 2EF1A 1YVEI 8LDHA 2VTEA 3FHLA 4F46A 3VZSA 2GNAA 4CR8A 3GAFA 4E30A 1XSEA 4AVYA 1JAXA 1GUYA 3WGIA 4ZRMA 2W2LD 3RUDA 4U6QA 1MX3A 3AU9A 9LDBA 4NBUA 1A27A 1BXGB 1UUFA 2GN6A 4DLLA 3S2FA 1DRVA 4XR9A 1M66A 1D1SA 2XF8A 3FBTA 3QRWA 3V1YA 4DIFA 4W4TA 3FWZA 3ZU2A 1Y8RB 4NFHA 1R0KA 1G0NA 1EE2A 1E1LA 3GVHA 3EDMA 5LDGA 3AY7A 3K6JA 5JBIA 2PFGA 5K6AA 1FDUA 2IODA 5F3RA 1MC4A 4RVGA 3QQPA 1A9YA 4J9VA 2Z5LA 2VYND 3PHGA 3WX0A 2GRAA 1CQIA 1YJQA 1GAEO 4FB5A 1ARZA 1R4NA 1ZEMA 4B7CA 2JFHA 4TKMA 3DAPA 1GDHA 1K89A 5KCZA 1OBFO 1N1GA 1Y9AA 3C7DB 2BRUA 3DBRA 3CE6A 3V1UA 1PJSA 1Y81A 1S7CA 3C1TA 3GZNA 4DBZA 2J3HA 3JYOA 3FD8A 3RROA 1Y5RA 4E31A 2FZEA 1P77A 2BKAA 5KJEA 3ZU3A 1K6JA 3NT2A 2UAGA 5EN4A 3QW2A 1W8DA 3OHSX 1LSOA 2VWHA 5H83A 5ITVA 2PD3A 2G1UA 2B36A 1IHYA 4HFMA 4P4GA 3RUHA 1N92A 4F6LA 1V8BA 1CQJA 1BTOA 4D3DA 1KOLA 5KVCA 3CSDA 4GX0A 3ZU5A 1LEHA 1Z75A 3PGXA 3DZHA 4DTIA 2PZMA 2DTXA 3AU8A 5GMOA 5IDXA 1I0ZA 4D0SA 4QX6A 1ZXBA 3VKVA 1P45A 1K6XA 4R9RA 1AHIA 1N7HA 1HDGO 3VPSA 3A4VA 3QWBA 4H16A 2HMTA 1WXDA 4CMJA 2VYVD 4P4NA 4A73A 3DBVO 2EKQA 1IOLA 1DB3A 3DTTA 4NJOA 3RFVA 1GZ4A 5JY1A 5LC1A 2VNAA 2ZB4A 2Y99A 3QWFA 1H6AA 5B12A 1A5ZA 2J5KA 4R54A 2G82A 1ZSYA 1KERA 1RWBA 2I66A 3JYQA 2O3TA 3NTQA 3OJLA 5EL0A 2HSDA 3NDJA 4E3ZA 1UXHA 4UVIA 1GUZA 4Z9FA 2I65A 5L45A 4XIYA 2O2SA 3UF0A 3PVZA 1NX6A 1RKXA 5GY7A 1R6DA 3ZCXA 3NAQA 3Q9NA 1EVZA 3TWOA 4XX0A 4YR9A 1LSSA 4R3NA 3C85A 5B4VA 4IXWA 4NHEA 5B37A 1T2EA 4BIIA 3L4BC 4XIJA 1PZHA 1JKFA 5HS4A 3W4IA 1JN0A 1T26A 4JBGA 4HNGA 3JSAA 4IIUA 4IDCA 5JYDA 1JTVA 5T8KA 1YBMA 2V65A 5CHEA 4OXYA 3AI3A 1HDXA 5TRTA 3RUEA 1DLJA 3LSYA 4BNJA 3RFXA 4ND4A 4QXMA 2NVBA 3OSUA 5HM8A 1YRLA 2BD0A 1LQTA 4KWIA 2TMGA 5EJ2A 3W4JA 1LX6A 1LLUA 2I76A 2FSSA 1RPNA 3PZRA 4MPDA 3JQ9A 4UEJA 3CUKA 1E5QA 3UCXA 5C3MA 4E4YA 5IDWA 4HADA 4WUVA 1M67A 4UEOA 3IUSA 2EIHA 3LLVA 1ISIA 4CQLA 1BSVA 1DO8A 3HSKA 1B0AA 2IEDA 1N2SA 2YJZA 3WBBA 1UAYA 3M6IA 2E4AA 4U0JA 3I83A 3RIHA 4FGWA 3GVPA 3OH8A 4PLWA 2WE7A 3DFUA 5TS3A 3PHIA 3FSRA 4OOEA 5DCUA 4DIOA 4DXHA 3GRPA 5L4NA 5MGBA 5IZCC 4BNHA 1C0KA 5AQ1A 3I3OA 3MJTA 2FHSA 1RM0A 3RU9A 3WOHA 4CLDA 4KDFA 4RZHA 2XOXA 4Y9DA 1PIWA 1R4NB 1TVEA 4M86A 2HK7A 4Z0HO 3ETDA 4R16A 2JAHA 4Z6KA 2FPGA 3OMLA 4AJ4A 1ULSA 7ADHA 4EJMA 2O23A 1E3LA 2AQ8A 4GKVA 1LQUA 3GZNB 5C7OO 5KTKA 3JQFA 2R6JA 3PWSA 5AXCA 3ZV4A 5DN9A 3FTPA 4MKXA 3LC7O 4Z0TA 2XPCA 5KKAA 1EDZA 1F06A 1PL7A 3K9QO 4CM8A 4PLTA 4QEDA 2Z95A 3VHRA 2R2GA 3DMTC 1V0JA 2W2KA 2VRCA 1DFIA 2Y67A 2WTBA 1H9AA 4BNGA 1WDLA 3U49A 2JKVA 3V5NA 5CG2A 5I7SA 2VT3A 1LDYA 3BHMA 3EMKA 2NQ8A 4FQ8A 3F4BA 4OO3A 3MOGA 1Z6ZA 2F1KA 4I8XA 5IN4A 2XXJA 4O1MA 5U1PA 3E48A 1VLLA 5JAMA 3QY9A 5ENDA 4AJ1A 3PXXA 4JXKA 1J49A 1WAMA 2JD2A 3GDOA 4AICA 1PR3A 1SOVA 3BA1A 3PEFA 3D3EA 3ST7A 1QP8A 2BF7A 4MVJM 3RC1A 1LLCA 1HZJA 1PGPA 2Y68A 3DHYA 3PHLA 1U8FO 3BMCA 1G1AA 4Q3AA 4GWGA 1E6WA 2VUUA 3EZYA 1RJWA 2E48A 3JQ7A 3OIGA 2UV8A 2AE2A 1VKNA 4YT5A 5L95A 3D4OA 1YL7A 4NG5A 4YT4A 3RUCA 1MG5A 3OECA 1RM4A 4JK3A 4YACA 2B4QA 4AJNA 1SAYA 4HFJA 1P44A 4PFJA 3ICPA 3JQGA 3O4RA 4TKLA 1QRRA 2QYSA 4J2OA 1BW9A 2Q99A 2ZB7A 1MG0A 3PK0A 4BKRA 4M89A 1ML3A 1X0VA 4D3FA 1LLQA 3VDQA 2HU2A 3U62A 3M2TA 1YDEA 2NWQA 2I3GA 4YYZA 3DOJA 3K31A 2QYTA 2NV6A 2YHUA 5CPBA 1DC3A 1TEHA 2AW5A 3D64A 4IDGA 5G0WA 2Y0CA 4RCVA 3CTMA 1HDZA 5DP2A 2FRDA 5JDIA 1EMDA 1ENZA 3AUUA 1GY8A 4Q3NA 4N18A 1GCOA 1EVJA 1BXZA 1HYGA 1W6UA 2NU9A 4F3YA 1EZ4A 3IAHA 2NU8A 1ISJA 3TPCA 3G1UA 1J5PA 5JY6A 3ZHXA 2ZTVA 2PY6A 4XGNA 5IXYA 4E5NA 3EAGA 2FN7A 1EDOA 4BNNA 3G79A 2C5AA 4K6CA 2Y1EA 3TFOA 1Y5MA 2B5VA 3L9XA 1X15A 4UVGA 3WYEA 3ZWOA 3NJ4A 2BI8A 2QZZA 3F1KA 1LRLA 1EFLA 4WGGA 1FF9A 3GGOA 2LDXA 1ULUA 3E82A 4NQZA 1W0CA 4J1NA 1KEPA 3SBOA 5JO0A 2E6UX 2WWRA 1MV8A 2FR8A 3CPSA 4NNJA 3D4PA 1SBYA 4MKZA 4XWYA 3BZUA 6LDHA 1F8GA 1X7HA 1TLTA 3K2EA 5I8WA 2D0IA 1GUFA 1YOVA 4GVXA 5KVQA 4GSKA 3KSZO 4B79A 5AXBA 3WQQA 2J5QA 1MGOA 4J1TA 4RVHA 2EKLA 1RYEA 2ZK7A 3KHUA 2X8LA 4UEKA 3PWKA 2ZB3A 1OI7A 4OJNA 4RLHA 5TJHA 5JAQA 4O6VA 4LW8A 3RKRA 4DL9A 2G76A 1I5RA 4JIGA 3TN7A 3C7CB 1YB4A 2X5KO 3NJ8A 4E2WA 3WNVA 2FPIA 3QVOA 2J3KA 3WB9A 1UAGA 1FDWA 4CR6A 4CM8B 4I9NA 5ITWA 3HADA 4CMHA 4CR7A 2W2KB 3AFNA 2Q1WA 1X1EA 1IHXA 2CVZA 4FBGA 3F46A 3W4KA 4B3IA 4PLFA 3MCVA 1KY4A 5EPOA 1JDJA 3KM0A 2ZIZA 2Q4BA 3ZNOA 3GMSA 4JN6B 4J43A 4E13A 3JQDA 1P1HA 1GPDG 5JC8A 4B8WA 1O94A 4XYBA 5F1KA 3VVBA 4ZD6A 1PZFA 4GBJA 1D7OA 1XWFA 2BFAA 1R12A 4WNCA 4W9NA 3WWYA 1GEGA 5TF4A 5TLSA 1ENPA 4NFSA 3TQHA 1LU9A 3BMCB 5DNAA 4PCVA 2Q3EA 4UREA 1PS0A 1Y6JA 1A4UA 4D46A 5IZ4A 3HB4X 3IDSA 2AHRA 1VJTA 3GT0A 4GLOA 4U5QA 4YVFA 3VDRA 3JQ7B 3INTA 3QLJA 4HFNA 3E03A 4B8ZA 1GTMA 2HMWA 1M76A 3QE3A 4BO8A 4IDEA 3WSWA 4AG3A 1XR3A 1PJ4A 4OL9A 3QVTA 4MP6A 4CV0A 4BMSA 3GUYA 1WWKA 1BW9B 1P1IA 5DCWA 1O9BA 2JAPA 4YQYA 3ON5A 2VNSA 3GY0A 4BO6A 3KYBA 5TNXA 4JLWA 3DOOA 1KC1A 4JBHA 5TC4A 1I36A 4ZRNA 5JAZA 1BG6A 3DQPA 1HDYA 3DZKA 5BSHA 4QT0A 1DIRA 3HFSA 1XA0A 4ZGWA 4AJ2A 4PIVA 2G5CA 3DFZA 1C1DA 3VH3A 5KOIA 4J0FA 1E0DA 2Q1TA 2RHRA 4BGEA 1IPFA 2WDZA 3LF1A 1E6UA 4AJPA 1A9ZA 3PQDA 1C0IA 1YWGO 4I1IA 4FFNA 4EYEA 3AJRA 1QG6A 5B4TA 3GH3A 2DBZA 1UP6A 4BKPA 3Q9UA 4XA8A 4LCEA 1Z7EA 4LVUA 2VHYA 1IZ0A 4BV9A 4NBRA 3ZWMA 5K9ZA 3FWNA 5A02A 4E2XA 5F5NA 3TZ6A 4URFA 1LBEA 4BUCA 2QW8A 1EBFA 4WLFA 4D44A 1BDBA 2PLAA 3EUWA 3OJEA 3SC4A 4BNIA 3COSA 3BTSA 4MVJF 3A14A 1NASA 3Q0EA 3R6DA 4TRRA 5KJ1A 4OQYA 1L7DA 4MVJP 3UKOA 4RVFA 3E1KA 4YRBA 4FSHA 3U4DA 4BNZA 3WYCA 4U6SA 1I30A 1YDWA 1FK8A 4RVSA 4GL4A 1U1IA 2VYVA 3P5SA 2UUOA 3T7CA 3I9LA 3RD5A 2H5LA 2W4QA 3ZW9A 3JD3A 1YOVB 3Q2KA 5K0ZA 4I5DA 2PH5A 1K6IA 4L0QA 2Q2WA 3OM9A 1UP7A 2Q1UA 1B3BA 3AUTA 1VL0A 3KBOA 5AXAA 2HLPA 3ROMA 4B7UA 5KVSA 5BNTA 1L1FA 4D45A 1VPDA 3ZDFA 1I33A 4R4JA 2YYYA 1DAPA 3I4FA 2VHWA 3MJCA 4RZIA 2GSDA 1HYHA 2P9EA 4UUMA 2B0JA 5IG2A 2GZ2A 1JLLA 3Q6IA 1DIAA 2Y1OA 1C14A 2D3TA 4Y8VA 4WASA 2V7PA 4BO2A 3WQRA 2O3QA 4II2A 3HN2A 4AL4A 2BFOA 3GMDA 1JVSA 3I4CA 4JP3A 3IC5A 1X13A 2DFVA 5I9NA 1FDSA 2XAAA 2GDZA 3CIFA 1VI2A 2W90A 2GUGA 4ITUA 4ZJUA 1EVYA 5IN5A 1WZIA 3AUSA 5A3VA 3WGYA 8ADHA 3K2BA 2ZYAA 4IINA 1VL6A 3RAJA 3KLMX 3DHNA 4UULA 4RVUA 4J91A 4N54A 3ZV6A 4GLLA 5JW6A 1B8VA 2PKRA 4BB5A 1E7WA 1E7QA 3H9UA 3T7EA 3IP3A 4E2YA 1DLIA 1T4BA 4JQCA 4ZN6A 5CDGA 1ONNA 5JE8A 4HNHA 2CUKA 1HLPA 5L7WA 4RF2A 5ER6A 1U7TA 2CMDA 2VWQA 3AI2A 4Q3CA 1GADO 4WCFA 1A71A 4CMKA 2IYPA 1HETA 2OFPA 1GV1A 2CY0A 2PK3A 1DDOA 1B16A 3H6KA 1XHLA 1NFQA 4YT8A 1N7GA 5JCJD 3STHA 4RF3A 4CLEA 3MWDB 4E2ZA 5FEUA 4Y6PA 1RM5A 2HKIA 4XKJA 1D4FA 3C3XA 2NVWA 1V35A 4IZIA 2ZJ0A 1HL3A 2C82A 3UFXA 2VQ3A 3H4VA 4TSKA 3N7UA 1BHSA 4NPCA 5DOVA 5A9SA 5ES3A 3FN4A 3PQEA 3E6AA 1XU7A 1C1DB 2BELA 1DIGA 3GG9A 2AE1A 3PYXA 1VE9A 2EJWA 1EQUA 1NPDA 2WD7A 1I01A 4LMRA 4MP3A 4NZ9A 2JFGA 4CMAA 1KS9A 1WNTA 2BHLA 4KZPA 4A7PA 1GEEA 3O9ZA 2IYOA 3UXYA 3WGQA 2Y1GA 3ONDA 3V8BA 1P74A 3NUGA 4NBVA 7MDHA 3ZWPA 2DFDA 2GLXA 4BGVA 3G1TA 3ORFA 4GMGA 3AK4A 1I10A 4L8VA 1UXKA 1B26A 5JCXA 3GNSA 3S2EA 3K5PA 1DRWA 2C54A 1N5DA 1YQXA 4YJFA 2C07A 3S55A 1O8CA 3ITDA 2HO5A 5BSGA 4E5KA 1T1RA 2VOJA 5CPFA 4RPKA 1R15A 4BO5A 3GPDG 3RUFA 5HWSA 1FJHA 4Q9NA 1NVTA 1H93A 2V6FA 2DBQA 4CV1A 3O26A 1IL0A 3NYWA 1UZMA 4W7HA 3C1OA 3FPLA 2I6TA 3W1VA 2CDBA 5I7FA 1ADCA 2BH9A 2DLDA 2D5CA 1ZSNA 2ET6A 2YZ7A 3ZU4A 4DPMA 1XGKA 4KTTE 1QKIA 1EQ2A 2JCYA 1WLYA 3OQ1A 4ND1A 2GD1O 4YEDA 4X54A 1MP0A 5FI5A 2VHVA 4OSPA 4BQPA 4CQMD 1UDAA 5FFFA 3G0OA 5IDQA 3DONA 3D5TA 3H3JA 2AEJA 5JFOA 2RH4A 3NRCA 3LF2A 1P0CA 3WSVA 3ZWBA 4FW8A 2JCXA 1T2FA 4XQEA 2P91A 3DZIA 3E5RA 4G81A 3CTVA 2VT2A 3KO8A 2HMVA 4BS9A 4MVJA 3CH6A 4E21A 3TZCA 1ZFNA 1EK6A 2O48X 4XJTA 5JNLA 1B15A 3L77A 4E0BA 3H8VA 2GASA 1YQGA 4M54A 1U8XX 2IE0A 3KEOA 4B4OA 2G17A 1IE3A 2IZ0A 3KTDA 3P7MA 3DEYX 3H5RA 4U7WA 4BNMA 2HRZA 2BFPA 3FR8A 1NQAO 3CKYA 2V6BA 3DZJA 3FRJA 4M49A 4CV3A 1EEHA 3QA9A 4E12A 2WJPA 3RKUA 4P8RA 4JROA 2D2IA 4LRTB 3DL2A 4DYDA 3F4LA 3UUWA 3WGHA 1T4DA 1P1FA 4U8GA 1DXYA 1H0KA 2BLLA 5L4SA 2NSDA 3R1IA 4IJWA 4PVCA 1WZEA 4PZCA 2AEMA 1B7GO 2C2YA 3PFFA 4AJIA 1VRWA 1BXKA 1UXIA 1YS4A 4WCFB 2AXQA 2OBYA 4GQAA 2OO5A 2DU8A 4ND3A 2IRWA 3FNFA 4I9UA 1PSDA 1V9LA 2JD1A 5JDCC 2NU6A 4J4BA 3OICA 5TT1A 4DUPA 3RSHA 5J23A 3UHAA 4HBGA 1CRWG 1R0LA 1SOWA 2PNFA 4WLVA 3I5MA 2B35A 4OKIA 4HP8A 3ITKA 4Z9XA 1CJCA 2QRKA 4NFYA 4K28A 3HUDA 4Q3DA 2BI7A 4J9UE 4IGFA 1DC4A 3GLQA 2X5OA 3EC7A 4A5OA 1KEWA 2UDPA 3H2SA 1ISHA 3LQFA 2W98A 5A9SB 3VPHA 4R69A 2PGDA 2IZZA 1GYRA 4XYGA 1DJNA 1U2DA 3ABIA 4RL6A 2WD7B 4FFPA 4AJHA 1Z7BA 3KB6A
chains in the Genus database with same CATH superfamily
5JJ5A 3H75A 3WWPA 2FMIA 4BQOA 2JFWA 3E2IA 1I4OA 3CKMA 1KP3A 1BWQA 3GAAA 4R7TA 2FEXA 3IB3A 1VPEA 3HL4A 1QHYA 3AIKA 2QTTA 1ADGA 3EZLA 1NJ8A 1P9NA 5JARA 1ZCBA 3X1JA 1T5OA 5AK6A 1L4KA 4Y1GA 5E95A 1Q0QA 1Z47A 2O06A 2E5FA 3PCTA 4AF7A 4R05A 3H1PA 3HO6A 3ZI0A 3C5VA 5L3VA 4EYOA 4GOKA 3KYDA 1VGVA 3QHQA 5BSEA 2PKQP 1ZM9A 4Q7QA 1TIBA 2QZJA 3QI2A 4BC1A 3L7JA 4R2LA 5K3CA 2VT7A 4D3YA 1JIUA 1AGRA 2A0YA 3LDHA 1CSEE 4R9SA 3T9AA 5DXAA 3IPAA 2NOGA 3WSVA 4EABA 4QOSA 1UK7A 4HLUC 1R9JA 1ZUNB 2P6OA 3CB2A 4BGUA 3LCMA 4A6XA 3OCVA 4INAA 2WAAA 4Z99A 1BFKA 3WNBA 5D3MB 5T4EA 3W2IA 1YS7A 4H4EA 1LI5A 1GV0A 1PJLA 3ZDQA 2EFJA 2G09A 4PX2A 2PKYX 1ZCJA 3K09A 1ID1A 1Z56C 5HCIA 2GKOA 3INRA 4K05A 3LLUA 4EA9A 4MJ3A 1GGVA 1O9HA 4CLRB 4IO1A 4BNLA 1J9EA 4MW2A 4U8HA 3ZZ0A 5AW7A 2R85A 1RXCA 1JIQA 3KP1A 1S8FA 4X65B 3HCEA 3N9IA 1XJQA 3VPBA 2J0QA 2AFHA 4UPVA 4NZPA 2EKDA 2HA0A 3HGMA 3WLPA 4RTRA 5KOHB 2Z6AA 3EGIA 1MB0A 1D2AA 3LDGA 1SB9A 3HCPA 3OQBA 3QVUA 4JVOA 2VF2A 4CMGA 3WJAA 4IIVA 2PLFA 3JR7A 3UN1A 1UC4B 1ZGHA 5EG5A 1KI2A 1JRLA 2DUNA 1S02A 1F2VA 1YB6A 1K86A 1PYGA 1LBIA 1M75A 4URYR 2WWHA 1K66A 1QIGA 1SG9A 4U6NA 4XGIA 1XJCA 4JT2A 1HNWB 4K6GA 3DDWA 5L53A 4O0LA 2P2GA 4LIPD 4CM9A 3HWSA 3IUYA 4HQNA 2ZRCA 4LE0A 5B3KA 1Z0UA 3CR3C 3CZAA 3O3OB 1UH5A 5E3JA 5JZVA 3HDGA 3V4OA 3ZWDA 3CY6A 1H6DA 3MN1A 1K3FA 3AHIA 1KMMA 4URHA 3RBXA 4UW9A 3S1LA 4IICA 2AD5A 2YTZA 3P4UA 3W3AH 3JASA 3ELYA 4OHXA 4KNWA 4RWZA 5L7TA 3I76A 2WU1A 1PX2A 3E7DA 3ESXA 1K3UB 4EKDA 3VH1A 3QIAA 3DDHA 3HKDA 1A9XA 4A2CA 2AW3A 1J33A 2AC7A 4AG5A 5HRCA 4BVEA 4LJRA 1Y3IA 2ZYVX 5DHUA 3ODPA 2UYOA 2NPFA 4AN1A 3GRAA 5IUNC 4MPRA 2PV7A 3B7PA 5TX7A 2QM0A 2HX1A 4R9NA 4OHMA 1NF8A 2AG6A 5HF8A 3WKEA 2BEWB 1JAYA 2YR0A 4J16A 5AFSA 2NO9A 3WXMA 2GCPA 3QE4A 1EFVB 1U28C 2NU6B 4L4XA 3UJAA 2XQFA 3CRW1 3ROFA 4A10A 3VGPA 4WZAE 3WYFA 1XLTC 5LVAA 1BX1A 1CEXA 3EASA 5REQB 3MS4A 1E1RD 3C70A 4Z3KA 1WXWA 1X7YB 1CUCA 2UZ3A 2VUSA 2WFAA 4M1WA 4JFAA 1PQYA 2X0IA 4JSYA 3VYRB 4G5GA 3QLTA 5EMNA 1O95C 3UOGA 2XBUA 1E3IA 3DOEA 2Q5CA 2MSDB 3GEIA 3N74A 3UH1A 4A8JB 2QUIA 3I0ZA 3L3BA 3N2EA 1E3EA 2AN3A 3JTMA 1FLAA 1LC3A 2B8NA 4OKNA 5JYEA 4ZAGA 4UOZA 3ANSA 4NV0A 4P54A 1G3QA 1AA9A 5SV2A 3ETCA 2FUKA 4XUCA 3MJVA 3ZHRA 3I04A 4XJSA 4M0CA 4IUYA 4OJTA 2GMWA 1WW8A 1FXWA 3SR3A 3GEGA 3VC1A 4AF8A 3P2OA 4Y2UA 3B89A 3AF5A 4HAOA 1ISFA 1E20A 1UK8A 5TQ0A 4B3FX 2RAPA 3PJGA 2PMBA 1XL1A 2D1YA 4LMBA 1OTYA 1ZW6A 5IP5A 2E4WA 4Q4JB 1PHPA 3TZQA 5JAIA 3Q9SA 1CU1A 4TMTA 1FFYA 1FFBA 2YHIB 4DJEC 1MAHA 3RS5A 2F62A 3GNQA 4M4SA 4EH1A 1P33A 4TQAA 2R1UA 1SXPA 3ND9A 3SE0A 4O5OA 3AOEC 3MUFA 2PX8A 4QYMA 1FPMA 1GPBA 3MNFA 4F9TA 1KH3A 4Z7OB 2QN6A 3LPMA 4YLEA 1H22A 1CQPA 4G5XA 1JTFA 2KS6A 1XYVA 4GP6A 1RLMA 5K6RA 1KZHA 1Q7GA 1C30A 1K6EA 1AUVA 3FMPB 4HNAB 2ZTSA 4MKRA 4HQLA 1OLUA 2ZUCA 4EHBA 3D2BA 3KE9A 3KU4A 2YWBA 4GWKA 4LZAA 4MQEA 1J8QA 4C78A 2Y8EA 1PLKA 2FPPB 2ZRQA 2XYQA 3KETA 1TF5A 2OPHA 4X6YA 2Q3MA 2QR3A 5JANA 2Q4TA 4UM7A 4CF3A 4W1QA 1NV8A 1OH6A 4W5WA 3T95A 4OI1A 2ZBGA 4IJKA 5AKHA 1WUYA 5L6MB 4CNBA 4GZ6A 4F3RA 4BNKA 3ZY6A 5H8WA 4W9MC 1QHXA 3KOXA 4R2WA 3EEIA 4ES6A 3SHTA 2EQ5A 1JEDA 1NYTA 4US2R 3PNMA 3ZIUA 3GPBA 2AUTA 2ZUSA 3AB3A 3R75A 4MGYR 1K2VN 3R7NA 3ZE9A 2PZJA 1OROA 4D0RA 2MHCA 5FHQA 2EHDA 2H9AA 4I4LA 2NPIA 4MKGA 4G0WA 3ROQA 4AIIA 4YFVA 4LRUA 4F4IA 5IWCA 1LRKA 2JAXA 4C4OA 2OVFA 1QO0D 1TO1E 2Q5LA 5KUTA 1R37A 2ID9A 2ZYGA 1QNFA 5DU2A 4O1HA 3OD1A 1K8RA 1JKJA 2EGHA 3H3FA 4UHJA 5TPWA 1OW3B 1PNTA 1WCIA 5KYNA 2R1TA 2PXXA 3V7UA 1PJAA 1IU9A 1CB0A 4NCIA 4MHOA 3EVFA 3G59A 2BW0A 3L8YA 2DOKA 3KKEA 1J8MF 3RC7A 3BVPA 1NR1A 2FSUA 2HWYA 3RHTA 4C7OA 1DRKA 1UIMA 3FWKA 3CLUD 1QU2A 1Y6ZA 2ATCA 3AZOA 3T99A 3TTXA 2C2XA 4J3FA 3JD1A 3A6ZA 4MWTA 2O3RA 2UKDA 3F7TA 3PHHA 4UZFA 3E3AA 3MWLA 3VH4A 3K4QA 4HS4A 5JAUA 2JFYA 2EP7A 5CTJA 3IUPA 1E1NA 2H85A 3K2QA 5THKA 1IAQA 4W82A 3PEEA 3SF0A 4AS3A 3ZHOA 4JI0B 5FORA 4LWQA 2W2LA 1EBBA 1ONPA 5ILGA 3LX6A 1JR3D 1E92A 5EESA 4B73A 1ZM3A 2FSVA 3BCSA 2ZATA 3E3MA 1F0YA 2VRWA 3KRTA 1VKOA 3RBVA 5LNK1 4HR7A 1FRZA 4D56A 1ZVVA 1VL8A 5DN6A 2G1AA 5L9AA 4C0JA 1CIVA 1ABBA 1GIAA 5G0TA 3IHWA 3UH0A 5A4IS 1B1AA 1JT2A 2C5FA 3EVEA 3OOYA 4LBWA 5EZ5A 5CFNA 1DKPA 2CVFA 3LQYA 1O08A 4OOFA 4EPVA 1NQTA 1X1BA 4UTVA 2J1LA 2PMCA 5KNDH 4L22A 4JUFA 3ZJTA 3C4VA 2P4QA 3U1VA 2X4LA 1YJXA 1C5KA 1NYQA 2IEZA 1HE3A 3DULA 2IL1A 4ZT3A 3VR2A 4XVUA 4F8JA 4TZ0A 1DDGA 3T35A 2Q3DA 1FSPA 2IHVA 4IGEA 5I45A 3RU3A 2VYNA 3TTSA 5A4KA 1GZHB 3F6CA 3NTLA 2A5LA 2G08A 4MEAA 2RGGA 1VSVA 4TUYF 1TI7A 4ZT6A 3Q0TA 5HMMA 4AJKA 4HDKA 1OC4A 2JIBA 2UYQA 3K0HA 3V4ZA 1E0AA 2ISSD 4OQPA 2GAOA 4H7JA 3G9TA 5C18A 2CW5A 1K4MA 1KC3A 3AZPA 1TA4A 1WHSB 4K2AA 4NS4A 1WKBA 1VJ5A 4HGRA 4UJ5A 2VRCD 5FOSA 4PVDA 5DISB 2VZ9A 4KUGA 3I9V6 3KT6A 3U09A 2Q5QA 1EUCB 3BGSA 2VRNA 3L7LA 3PUWA 1N0WA 3E22B 1AT1A 1I2ZA 4ICIA 2JIDA 3T7TA 4JZKA 1JDBB 5H82A 3Q1KA 2Y1CA 4TVKA 1JFTA 4EJ2A 5CBPB 4ZYTA 3I2GA 3LOPA 5JC1A 2ZCUA 3W6UA 4IHAA 4EITA 5AR1A 1JW9B 3ZU5A 2PWZA 1P4GA 2O7NA 4ESHA 3F73A 3IVRA 1SVOA 2X41A 3ZGYA 4REMA 3HP4A 5H68A 3SZLA 2I5PO 5K0JA 1HT3A 1MVOA 1LTHR 1HQCA 1PUJA 4KVZA 2XOKD 4UDXX 3NPMA 3REGA 2R7NA 3CRQA 3EG9A 3QHPA 3VV3A 6ADHA 1V3UA 1XCPA 4I2NA 1XV5A 3L01A 4MYUA 3CRZA 2DAPA 2IYAA 2C77A 4Q48A 4B6JA 4E51A 3Q7QA 3F49S 2PGXA 3DL7A 1G18A 4IO0A 5I7EA 4X8LA 3SBEA 2XCIA 1BD3A 5B1DA 1EHYA 3JW8A 1D8TA 3BXZA 3MJRA 4URUR 2NVUB 1TJ4A 4YRLA 3LPLA 1FFCA 2R8YA 3FLEA 3FH0A 2WP0A 2E37A 1EM8A 4AO7A 5KC9A 5JQGF 3IMFA 3ICEA 1FRFS 1ZBDA 4R40A 2ECQA 3TDKA 1D6SA 3GK3A 4L3WA 5BQOA 2JH9A 4I5EA 2C0CA 4J4TA 4NENA 3UBMA 4L6CA 3A1VA 3I28A 4EA7A 2BDEA 3BH7A 4DV4B 2V7UA 4YJHA 1GXSB 2WB4A 3OT4A 2Z2ZA 5AICA 3TIGA 4B34A 1NJFA 3HA5A 3VJRA 1Y1KE 3BTVA 3QVMA 1B8PA 1TPZA 3ZWYA 4DRXB 3OA2A 1PJQA 3U3ZA 5HRUA 4DV5B 1DNPA 1U0LA 1EGHA 1PQPA 2OKGA 4UTPA 1XK7A 3HKBA 2WJ6A 1NF3A 1XZIA 2CSUA 4V2UA 3ETLA 4A2PA 4AUEA 2CLSA 3JY6A 4XLTA 1CETA 2FHPA 3QFRA 1GO2A 2HV9A 4WUTA 2FP4B 3B6EA 1YONA 2J9FB 3R0QA 4HGYA 2WQ7A 1NDUA 1J20A 3WLQA 2W48A 1Y1LA 3I9FA 4P92A 1U5AA 2XUPA 2BYTA 4O2BB 3GN2A 2H16A 4CL0A 1E1MA 1KSFX 2H17A 2FX5A 2PZKA 4LZWA 4Z1OA 3ILHA 2L2QA 1FFSA 4EB8A 3G68A 2O3JA 2EOAA 4MINA 4X20A 1ZMBA 4JI7B 2FPLA 5ILQA 3BHJA 1FNDA 2WYOA 3T0IA 5BR4A 1M1YE 1C3XA 3EN0A 5HQJA 2UYCA 4ZZ2A 1XRSB 5ADVA 1TNDA 5IBCA 4CM6A 3WLJA 4IYRA 1OGJA 4JQZA 4FJ2A 4PPGA 3UJNA 1LX7A 4KR6A 2XA9A 2O5RA 2V8OA 3E9EA 4AJLA 1YZYA 1LDNA 3MBOA 5DEIA 1XHFA 2DLNA 4ECAA 1U5BA 2QN8A 3S2YA 1RLIA 1GQYA 5T8KC 4Y3UA 3E05A 4K6OA 3G0BA 2VPXA 3MC1A 2VG8A 3BQNB 4L0CA 3UB2A 4HNVA 3N8HA 3IPYA 4LJKA 1L5FA 5FL3A 5FF9A 3S27A 4KH0A 3TI9A 3NHRA 2OUIA 1QWOA 4MV7A 4UUAA 2XGJA 1O58A 2YS6A 3AEXA 3VU3A 4AJEA 4BQSA 8AT1A 2C9CA 4PNPA 2C2MA 3WWEA 4FIZA 3JQ9C 5CW2A 1DQSA 4EW2A 1NVEA 2VRBA 1C3JA 3CLUC 4LA4A 1QZXA 2JFNA 4EW6A 1KVSA 4QGGA 4EYSA 4TRMA 4TXJA 2FAXA 4NEHB 4U7JA 5LJLA 3FHOA 5CB4A 1UK6A 4WDQA 4DV3B 1KORA 3HJNA 1MABA 4RS3A 1V11B 3EBPA 5HM6A 2JZOA 1SBZA 4FCCA 2I4TA 2XQKA 1NQ5A 3DT8A 2ZUVA 4PG7A 2QIOA 1C3EA 2WYVA 3HV0A 4CDMA 5KREA 1UFOA 3OLZA 5K6TA 3GNLA 3HRIA 1QCYA 3GR6A 1TM5E 3K9GA 4RL4A 4EGQA 2XADA 5FTJA 2P2SA 2H0RA 4M22A 3TTWA 1AUXA 4YAGA 1UJCA 1M34E 1TEXA 1JLRA 2HLHA 3FKSA 3RC9A 2J4CA 1KZYC 2WZDA 1G4UR 4JJ8A 3G3EA 4QBGB 4A23A 3AESB 3PI7A 2H6EA 1GAQA 1T1GA 2LIVA 1MH9A 1NI4A 1TMYA 3OIUA 5KSYA 1K9VF 1E9SA 1U3UA 2FK7A 5L51A 1ESDA 3DWGA 1HLGA 2I7TA 3I6MA 3EFOA 4N76A 4Y30A 2RI6A 3L07A 4UTRA 1WOMA 4AUMA 3KQNA 3VZRA 1VE5A 2CC2A 2ORYA 1L7AA 5GIPE 4KJXA 3DW1X 1ITZA 1R16A 4N6GA 4HXFB 4OAPA 2C8KA 4P0PB 5LD2C 4LJ5A 5E4YA 1DXHA 4LSGA 3NZEA 5BR1A 1RKQA 3GLKA 4QU5A 1XT6A 2VDWA 1NUQA 2A59A 1JXOA 3HVJA 3OCJA 4DA8A 3S8EA 3CZRA 3M5WA 4G1UC 3VC7A 2QWXA 3HP1A 1NUPA 5LQJA 4OQMA 2JLSA 3ND7A 5AM5A 1DG9A 1GKLA 1GL6A 1JUDA 1ZD2P 1J2UA 4W1RA 1I94B 3L1KA 3RQSA 4QUDA 3TW4A 2WHXA 3M1LA 4XX1A 3EX7C 2AUMA 2ECFA 2F3QA 5T57A 4NH4A 5U4QA 1NW8A 1SWVA 3FBGA 4RGVA 1EPUA 1WD7A 1TKAA 5KNBA 2SKCA 1BS1A 1ZINA 2ES4A 1QOPB 3WDKA 4TZTA 3FJYA 4QLOA 5DWDA 3BIJA 3LP5A 3QPDA 2I2DA 2BFMA 5KYUB 3DUWA 2QNRA 4WZBB 3L1HA 1CRLA 1TKRA 1FDVA 2E2WA 3PWZA 1Z6PA 5BXQC 4YRAA 5BV0A 1IB6A 1OV4A 1RZVA 1T0IA 4JI2B 3VKUA 2H7CA 2A86A 3MMZA 3S44A 2H59A 2EP8A 3CZPA 4OHCA 1OTXA 2QA5A 2ZZMA 4CM4B 4AN4A 2JJ8A 4FMDF 1WO8A 1QC5A 1CZOA 1V7PC 3DVSX 4G09A 1BS2A 3NANA 1UR5A 3S2GA 3UEOA 4DADA 2GM4A 1CP3A 3AFOA 2WICA 3B9QA 3MA0A 3GHYA 4I5FA 4LQCA 4PV7A 3RT9A 4MWEA 3VZBA 3L6OO 1NJGA 3I8SA 2R8OA 1Y8QB 1PGOA 1BCRB 1GCIA 1PJ2A 1PVVA 2OV6A 3W2EA 3IULA 2ZJ7A 4BLOA 1JJ7A 4HZUA 3W3ZB 1LRJA 2YC4C 3DV0A 1XL0A 2OGUA 1CVRA 3IODA 4Y9SA 1RKVA 5SZKB 5JZOA 2HRDA 1DDIA 1U0EA 1MO6A 1SEVA 2CF6A 1H3EA 3KJHA 3MTBA 4LJAA 3OT5A 4YI3A 5K4AA 3RB8A 4E5YA 3HBLA 4GPTA 3FUWA 4JT8A 3K7EA 1KZ7B 3H97A 5KTNA 1XCMA 2YBEA 2QPAA 4HDSA 4M3NA 2XWBF 1PR0A 2WUEA 1H2RS 3I34X 3N2ZB 4TS1A 4CDRA 2PUEA 2PGJA 4U2EA 4B32A 5K20A 3CW9A 5CVJA 3WZMA 4NJMB 4GUDA 2WM8A 3ZHYA 4BQNA 3I53A 4Y0VA 3W9YA 4RPIA 1FXWF 2IUYA 1ZRSA 4UZSA 5GOZA 3QLVC 1HTWA 4X90A 5EIBD 3ZX4A 4MMZB 1RQ7A 3W04A 4EY5A 1YASA 1A2KC 2Y0EA 1UC8A 3R5JA 5ER9A 3RASA 5CLFA 1AQYA 1H2HA 1QFYA 4P08A 1D9ZA 2HSEA 3GJZA 2PFKA 3U7RA 2AQKA 1A4RA 3FFXA 4UUQA 3SQOA 1JV2B 3G7NA 3U7QB 5KYYB 4TL8A 1T1EA 3UGJA 2H9YA 2RAFA 3K73O 2YDYA 4FYIA 5FA8A 4BV2A 4E7PA 4OK5A 4N0PA 2VXBA 5EIWA 4ZGBA 2B4KA 4RD0A 2OP1A 4XYLA 1L4LA 3GLHA 2Z9BA 1VFNA 2V0CA 1YL5A 1HNXB 1V1JA 1XZKA 1Z2OX 5FUBA 2PLWA 1X8XA 2YWCA 2CHGA 4H0CA 2RHMA 1UODA 1T3HA 1QGAA 5FYDA 2B4RO 4R5HA 4N6NA 2R96A 2NTEA 2X8BA 1A72A 4RSMA 2EJVA 3ISTA 4WESA 8ABPA 5EHIA 3IP1A 4TROA 1TT5A 4BP1A 3LHFA 4C3VA 5B4UA 4MS3B 1X86B 4N5LA 3SSNA 3WLAA 3ZNQA 1MO2A 1VJDA 3ENNA 1HDRA 2FPKA 4LISA 4WE3A 1THMA 1WF6A 5AJWA 2X42A 3H1TA 4G4SP 3RJ9A 3UAOA 5JD5A 4C0KA 1BMFD 4P2GA 3A2NA 3PHJA 1TEVA 2VDKB 3PLRA 2C57A 2BGIA 2PD4A 2BFFA 3F96A 1TM7E 2BMDA 5ALVA 4BLUA 1DKUA 2RGCA 4RCYA 5CJPA 1OT5A 1RFGE 1UP4A 4GOJA 3TD6A 3OETA 1E1CA 2WKQA 1A98A 5L6LB 3KAKA 4PO1A 2B20A 1NDQA 2XMRA 1E2KA 2J3DA 1G6KA 3NM4A 4JGGA 5JFTA 3VYUB 1EX7A 2AX4A 2W2XA 4RORA 3DPSA 3MLAA 4RKQA 3C6ZA 3RNOA 4HGZA 2AOUB 2H1FA 4WLEA 4MUYA 3U81A 1O6ZA 3FDIA 4LSZA 3UMCA 3JQ8B 5K8LA 3FGOA 1E7YA 3N05A 1U3WA 2R6AA 1MVLA 2ZQYA 4LRQA 3V8PA 3AEZA 1KR2A 4IS3A 4MGEA 1CT9A 1T2VA 2PSEA 5C7YA 2Y9YA 1ZIOA 2QZPA 4Q24A 2HUPA 2MINB 4IIJB 1P4AA 5HDBB 3LTNC 2HU8A 1QLWA 3I64A 1CHDA 2WYUA 1M2HA 3QF7A 1XYGA 3KB2A 5AKLA 1KAOA 4IOKA 4UDOA 1NKTA 5EGSA 5C1PA 4DVGA 1Q7EA 2O5EA 5CEJA 1OTHA 1H94A 4NKRA 3TUJC 4ZI7B 1X80B 4OV6B 3NYIA 3TJZA 1GPYA 2R84A 1AKNA 5E4TA 4HD8A 4R1MA 5ESDA 3TQRA 4ZDJA 1X0XA 4LXGA 4QJ4A 4RK0A 3PP8A 4PZAA 3MZ0A 4ZHQB 3JRXA 3RHSA 3SC2A 3ORYA 4PSKA 5KNBD 1Z5OA 4F7WA 4W9NC 3OIVA 4W5OA 3ZCRA 4HNQA 4IIDA 5A3QA 5IS2A 3IMKA 5DX0A 1VSUA 1XNRB 4M0LA 3F9IA 4MWOA 1G4HA 3VI4B 2O0MA 2PGOA 3DBLA 4EUSA 1IEWA 3D8SA 2KSQA 3KAPA 2CHQA 3O8QB 3TMKA 3U44B 2F55A 1JVBA 4YK7A 1UK9A 4YIKA 3NWOA 3FCOA 4XJXA 3ZWNA 1CQIB 1F0PA 4MA0A 1DPGA 4ZC8A 3TEFA 1KMHA 5KKCA 1JPJA 2KBEA 4ETIA 1DIHA 1KK3A 1PZMA 1SBNE 1SWWA 3DTYA 3LUHA 2JDIA 1JIJA 4IIEA 3LQKA 1VI6A 2GYYA 1BC5A 3AR8A 3EEQA 1CIPA 2WTUA 3QE2A 1U0SY 4O2LA 4I1UA 5BN4A 2WQ6A 1JG7A 2O8BA 3VV2A 1VGRA 1U8YA 5FOUA 1P5FA 2XWQA 3KD2A 4JBNA 4JU8A 4IG9A 4KXWA 4D57A 5CAEA 4N40A 1JXMA 4CEJB 2Q3HA 3OJFA 3BIXA 1ONOA 4NY1A 1G3RA 1MLDA 3OQOA 1UKCA 1SKBA 2IYLD 1K97A 1U02A 4GOLD 5JNSA 4BXOB 2RC6A 2V7BA 5IUJC 1Y5NA 1U1CA 2J4DA 2FEAA 4L76A 5B30A 4OHYA 1JEAA 4XVHA 1Z82A 4IUCS 1PD0A 4XGKA 4IJUA 1P9LA 1YR9A 1VE7A 4R83A 2W8BA 3WG9A 5HJ5A 3CVWA 5CR9A 4XIFA 5IJAA 1N2CA 3MELA 3PX7A 3QKWA 2E4XA 4X91A 3KUKA 3IR5A 4F0JA 3KQWA 4KLRA 1V2HE 3PTAA 3K30A 2WB2A 1EDDA 1YOBA 2ZJYA 3DYIA 3GLFA 2HCRA 1MV5A 4IJVA 1U4SA 4MWSA 1SD2A 3QKRA 4CLXA 1E9BA 4YAEA 1T5LA 2IV2X 3MWFA 1SCBA 3R3VA 1RACA 2GF0A 4MYTA 4V38A 3TAXA 2UUBB 1FOEB 3DKRA 1VKRA 1MOPA 1E64A 3LCVB 3ZE6A 4ZCMA 1JFSA 1CUDA 1VJ1A 1RQGA 4BZZA 4WOBA 3X1XA 5EIBC 2Z6VA 1SCUA 5DTEA 4DREA 4RTJA 1PNQA 3D6UA 3GP5A 2C7GA 3EMVA 4HYTA 2XUDA 1NR7A 3EHDA 4BCBA 3QU7A 4WECA 3D4LA 1YS1X 2OP0A 3B3GA 3KEQA 3MCTA 1Z8FA 4M21A 1IVSA 1FU7A 3OZVA 3RAGA 2JI9A 2X1HA 2PGLA 4OQLA 4BE9A 1MA0A 3GUVA 2YH2A 1TOAA 1PBTA 4AMYA 3B1WA 3ZNNA 2ZIAA 3D4IA 1Y4ZA 3ZX5A 4NECA 4LGVA 2B9VA 3JYLA 1KVTA 4ROSA 3NXKA 1X2BA 5KSWB 2CEAA 2P8SA 4AD8A 2IHYA 1PU2A 4YRSA 3TUZC 2JS7A 1E3SA 1JIXA 4Y1EA 3UENA 3LL4A 2DETA 4DJDC 5DM0A 3JD2A 4MVJD 3BMQA 4J7XA 4P35A 3QWHA 4PZ0A 3M6FA 3TRIA 2GBCA 4NDAA 1V6SA 1XNJA 4L72A 4QUIA 4ZQEA 4BATA 1UMKA 2IU6A 3IDOA 3R7FA 4ZMSA 4OLBA 1UANA 2B2NA 5CX1B 2FR0A 4ZI5A 4JYZA 2HCFA 4KQWA 1WU7A 4M37A 2XA2A 3TB4A 1M6VB 2ZBUA 3AW9A 5IKXA 3EPLA 1UKYA 2JEYA 3RJZA 3WWZA 2VDMB 3AOGA 4JJIA 5EMMA 3UG6A 4F1KA 1J06A 1Z2AA 2GCIA 1FYDA 1DWPA 4J6EA 1LUAA 2FVXA 2C4HA 3HFGA 4R1QA 5D01A 5KDOA 2J31A 3KQYA 3H6GA 1ODSA 4BMXA 1IRXA 1KI3A 1SK9A 2IW1A 2FG7C 4ZA2A 2PMWB 3EAQA 1ZKDA 2A57A 5ITZA 2BSQA 4B40A 4YJGA 4CUZA 2IPAB 2GZ1A 2Q0QA 2GF9A 3RVDA 3AP2A 3VR4H 2AX3A 1IBCA 1KEUA 4CKEA 2GHTA 3RH0A 2PL1A 2B34A 5IAOA 5F52A 1JYEA 2VQDA 3THXB 5AJUA 1ADFA 2FJ0A 3ZJYA 4HUTA 1DRUA 3NJRA 4EPYA 5BOSA 4RO0A 3KR0A 4CE6A 5FFNA 1NW9B 1CV2A 1HMPA 4CQLB 2COEA 3KQSA 1XZ8A 1Y42X 2B0CA 1Q1ZA 1KYYA 2JFFA 7YASA 3WL4A 5C7LO 1UFQA 2JLAA 2I78A 4E09A 2HPVA 2NZVG 4EELA 3PQ7A 5IARA 2P2YA 1UFKA 3DFFA 3FVVA 2IOQA 1YZ3A 4NU5A 3FCCA 3N5KA 2R4QA 3D8RA 1Q0TA 4POAA 1NMZA 3EK2A 1G1MA 2H52A 4CUKA 3FDJA 2NZUG 1ZAKA 1JLMA 4WOKA 3DWIA 2ZXFA 3ISJA 1AS0A 4M0DA 1GM5A 4V0MA 2G9QA 5JWOA 3R0ZA 1RZRA 3WISA 4Q7JB 3SM9A 2P4HX 1LS6A 1CS0B 1GSHA 2RB4A 4MEBA 5AO9A 4KPUB 5DLDA 3ABRB 4JB3A 1GDDA 2GEUA 4RIFA 2CNWA 2YWJA 2CGEA 1PJBA 3MWEB 3OSZA 1BMTA 1QF7A 4HL6A 1XROA 1J6UA 4BMPB 4Q21A 1G21E 3Q3JB 1V6AA 1Z3CA 2AN1A 4W5RA 1E2DA 1RADA 1SKAA 2C61A 4TKLA 3RKSA 4QJ3A 2L0XA 2X8JA 2YMPA 3NATA 4WJLA 1PGJA 3N7TA 4X3CA 1QDEA 3DAFA 4O4HA 4Y0NA 3BD6A 3W5VA 3C5HA 1YZTA 4FUQA 1M8PA 4JYMA 1H6CA 4JP1A 2BR3A 1N8SA 4EY4A 1F48A 2X9VA 5BW5A 4QFCA 5B58C 3L41A 4TQ9A 2ZJ8A 3OP4A 4X9XA 4YRRA 5B53A 4TV8A 1E5LA 4X45A 4R8LA 1H0RA 2DPYA 4B71A 3CMCO 3V9PA 4L5IA 4PHCA 1XTKA 1J0AA 1EB9A 2PZLA 4OUDB 2AOWA 4DZZA 2XUJA 3CPEA 2AN5A 1EFCA 3K5HA 3ZJ5A 3AM3A 2QHXA 4HKTA 3GCWA 4DQDA 2QVGA 5U9CA 2RGNA 4RA6A 3SVTA 2WT8A 5JI2E 4CGZA 1EM6A 1I6MA 3ROEA 1VZ2A 3WXBA 3G8CA 2FH5B 4AKGA 4MI3A 2FW9A 3I01M 1YMVA 2DFNA 4R9UC 1BJRE 4GQIA 1F9EA 1DADA 2QZ9A 3UJ9A 3GVCA 3OEYA 3G8YA 5JU6A 1V3VA 2B8TA 4KDRA 3HC7A 2JGNA 2RIPA 1TADA 3AT1A 3F1LA 4MWCA 3BSSA 1XWWA 4KO8A 4WZZA 5BQ5A 1D6MA 2R6GA 1E5DA 4QUEA 1KO4A 1FRQA 3O84A 4LC1A 1VYVA 2DGDA 4E32A 2CDNA 4NEGA 3W5AA 4CEHA 5IT4A 4GSLA 5GZ3A 4GR5A 1E5TA 1O1YA 1WZNA 5H9VA 2DVMA 2HA3A 3BWDD 4U2GA 4O2RA 1TJPB 2V3WA 2D13A 4WT7A 1YVPA 2PSJA 5DI9A 1EXMA 1JQ3A 3VNSA 2R62A 4MRRA 2C4TA 2RIRA 4FGKA 1QUFA 2CLHB 4EG6A 3LXXA 4ZGGA 2ZJFA 4S1NA 4B76A 1OAAA 2ODTX 5LA6B 1COZA 5HGJA 4Q3BA 4BQFA 1XAHA 3DJYA 3IUEA 3SF8A 4BCCA 4EZBA 4CM9D 2C4VA 2CXNA 2OENG 1ZUD1 2WWXA 4I55A 2ZSIA 5EZQA 1RE1A 4AAYA 2BV3A 1JEYA 4CEIA 4M60A 1Y9EA 4ID9A 3TF5A 2VYQA 3WMFA 3U4IA 4Z2AA 5AUOB 3KKZA 3NHKA 3PX2A 3IL2A 2Q4DA 1ZKMA 1AZWA 1LPOA 1RJDA 3L6DA 2GJSA 2XI4A 1VXRA 4X6UA 3NVAA 3WB0A 1NXWA 1ZS9A 4RY9A 5G40A 2NUTA 5CCEA 4RPCA 4YT2A 3PNKA 3UMFA 2BCJQ 3S40A 3A6EA 1MGPA 5DYYA 3L1VA 3OWXA 2YXBA 5C34B 2K4MA 2QR5A 3QUQA 5A4JA 1ZGAA 5KTYA 3NNSA 1DXOA 4KUHA 1QGDA 2I3DA 2FQXA 2PD6A 1P2FA 3STVA 3CT4A 4FKZA 2W6ZA 1G8SA 1SZCA 3K96A 2DT5A 2JAWA 4YWHA 1A77A 2ONZA 3H8JA 3SG0A 3ZW8A 2QP4A 5HJEA 2PXAA 1TU4A 1Y4SA 5BSWA 1QCZA 4FWTA 3CUEF 3D7LA 4BX9A 4M2LA 2BHSA 4Q00A 2C4MA 1XF1A 3DWEX 3WGOA 2WVJA 3WHIA 4DARA 1QO7A 4U7DA 4EENA 1QLHA 3DZCA 4P5PA 2QDKA 5UKDA 5JCPA 1UQRA 2EFCB 3ZKWB 3JAKA 1V5EA 3NTOA 1VKZA 3T34A 5FWYB 4CPDA 3R7WA 4OYLA 2C99A 2HEGA 1KYZA 3REFA 3GB9A 4BGIA 2Z9CA 4YA6A 1GR0A 2IPLA 4J0EA 5T64A 4RDHA 1NBMA 1SA0A 5KTPA 1Z17A 5D2CA 3N8IA 3WL7A 1C9DB 1Z4MA 5A9TA 1RPJA 1ZK3A 4FJ1A 3RF6A 3TR6A 1UL1X 4ARAA 4JNKA 3M4ZA 1KO5A 5HIJA 5I4KA 1AV6A 2X6TA 3AHGA 3HPQA 3RIEA 1HT2E 1SU4A 1E9CA 1WHTB 4EX7A 5EHXA 4S35A 5DXJA 1OI3A 2WF9A 1ODJA 4MDYA 1W2GA 3R3JA 2ID7A 3K1AB 1SCAA 3AKYA 2POCA 2QPTA 3T5BA 3ZEAA 1YR8A 2OOSA 1E5VA 1AJEA 3JVIA 1E3WA 2ZT5A 3P9PA 3CBGA 3EH1A 3LC1O 1GPH1 3O2JA 3N7AA 4K3UA 4I50F 4MJXA 1TTPB 5CDFA 3VMFA 1YKSA 3I2FA 4M6WA 3ZCPA 1IFXA 2AMFA 4NBNA 3K0FB 5LKRA 2XGMA 2VSQA 3MINA 3TRKA 1UBTS 1FE8A 4DQVA 3BC1A 3LLMA 4D4LA 3RRYA 1AKVA 1X1DA 3E9MA 2R00A 4GOXA 1VSBA 4AZ3A 1QYRA 1G55A 2YJNA 4HEQA 1NHGA 4BNYA 3PVCA 5MFZA 5KDLA 4DJ5X 4HSEA 1F3OA 3AVXA 3JYNA 4Z49A 4MOWA 5JMOA 1WBBA 3QEAZ 3WNQA 4DANA 5E3HA 2YJ5A 2YICA 4CJXA 1S9HA 1QP7A 2BTEA 1GTL1 3KZVA 3C24A 1J21A 3QGMA 4AIRA 2C03A 2QSYA 1YQUA 3KVNA 5EC8A 2JLUA 2JW5A 1U4OA 4TS4A 3NDBB 3KDSE 4ZMBA 4Q37A 1JG4A 5EYPA 4W8HA 4FR2A 1L4NA 4URZR 2WTXA 2CNNA 4ZZ1A 2H7XA 1JVNA 3QTTA 1XAIA 3ULKA 3JVDA 3LHKA 4BNDB 4DDVA 2AFIE 4EB3A 2FGKA 1HRKA 5FUWA 4UFPA 5BV2P 3DM9B 1J90A 2NV0A 4YMLA 3NCHA 2A4KA 4GKAA 3NKFA 1Z33A 2JGLA 3C3CA 3G8DA 1JDNA 4ZZ0A 1I2CA 5B3AA 1BH6A 3WIVA 1W0KA 4F6CA 1NBEA 2BUAA 3RGGA 3J80A 2JEZA 2WJGA 3LT1A 4GRIA 5CGZA 3AF1A 1VHDA 1JFRA 5CNIA 1Y0BA 1L7EA 1TZMA 4R1TA 1XKQA 2P9YA 3IHTA 4PE5B 5F7OA 1HDOA 1QP0A 3KJZA 3WK5A 2O4UX 4YYEA 4ISCA 1YBAA 3T3PB 1QYVA 1D2MA 1V48A 1W5BA 2CVOA 4G2NA 3OIDA 4L5CA 2WTMA 2ZRAA 3VM6A 5CFMA 1EKXA 3C8DA 3B13B 2YFHA 2ORIA 3S0JA 4AO6A 2B37A 1MB4A 2EARA 2ZKIA 5HHTA 4EK9A 4S05A 1YTUA 2XUQA 5FPSA 1S3FA 3I1JA 1PAUA 1WY7A 2IOFA 2YWRA 3CPHA 4QFBA 4TMZA 1H1TA 2SKDA 1H2YA 2PZEA 4PLGA 3X1DA 3O8OB 4DLXA 3DGEC 1N2OA 4MB2A 1LK5A 4TL7A 1T5BA 4BFZA 8LDHA 3FHLA 3RSFA 2IXTA 5BVHB 3N59A 4ETMA 3VZSA 1JA0A 4ZC1A 4ZAWA 4KKXB 3ICQB 4CR8A 1QE3A 2P75A 3E5NA 4AVYA 1CFZA 1JAXA 3WAKA 2W2LD 1L7OA 4JB0A 3RUDA 1R64A 2YIJA 2BSXA 3PGVA 3AU9A 3TQSA 3Q5DA 2LXNA 5E9JA 5BN5B 3F7MA 4DLLA 1B0PA 2VH5R 2ZEJA 4QTTB 5LUBA 4GL2A 3SXJA 5DN6D 3FBTA 1JF8A 3EDQA 3IJ5A 2ZVJA 1NG1A 1SGWA 2C3YA 2ZRDA 4HWPA 1R0KA 3D81A 4Q7EA 3A3KA 4Y18A 4B9AA 1X1SA 3EDMA 5LDGA 1E9EA 3H86A 2VPQA 4HUQA 2Y27A 3K6JA 5D5QA 3KDPA 3U37A 4BLPA 1REQA 1ZUWA 3VR2D 4F38A 3R5SA 4KIFA 3TW8A 3W9BA 2NXEA 1KWKA 3UTDA 2VYND 4OQQA 2W2TA 1PNOA 1T6ZA 4YUXA 1Z15A 3I0NA 3OX1A 1SVMA 4D9KA 1TM4E 2X5XA 1EWKA 3O95A 3DAPA 4UUBA 3RIGA 3M4XA 4KYUA 2BRUA 3S7TA 5BUQA 3CE6A 4YP5A 1QHFA 2J7PA 4IHJB 4C3ZA 1FP4B 1L4GA 3CH7A 4J16C 1CRPA 1OSNA 1BX3A 3AYZB 3DMRA 4XUDA 2FZEA 4FYVA 2HRQA 2QXUA 3ESCA 3PNLA 4WKNA 3O5AA 1HGXA 1LD3A 4LDNA 4IGKA 2PZFA 2FUCA 4G2TA 2Z2IA 3FFBA 4FFPA 4YJ3B 3QW2A 3FKJA 1OLXB 4N5IX 3OHSX 4QODA 2BY4A 3PDHA 2FN9A 3PRYA 3NBUA 2PD3A 4LOIA 5BYAA 2HEIA 1N92A 4AMGA 4TS3A 3PRHA 5I47A 1EUDB 1ZN2A 1V8BA 1ULZA 3KS9A 4HLNA 3TR0A 3KALA 2DLCX 4EEKA 4D3DA 1U6IA 1UOEA 2QY9A 3LHDA 1KOLA 2VUIB 3OZAA 4QPCA 1LH0A 3CX7A 1LEHA 1U0TA 3BDVA 4RMJA 5E2BA 1H5NA 5AJXA 1UPBA 4IILA 3TQFA 5AUPB 4URXR 3RAFC 3DZHA 4DTIA 3AU8A 4P3OA 2FXIA 1I0ZA 1NLFA 1QVRA 5A2QA 1NVBA 5KHLB 1FFXB 2FX3A 2IOHA 3VKVA 3RR2A 1D4OA 3BE5A 1N5JA 1FLVA 4JVLA 2WWIA 4MRSA 5DXFA 4LVOA 2ZI7A 3A4VA 4CN8A 4KE9A 4YN3A 2VYVD 4TTSA 5EUQB 4KR9A 3I1IA 2YHSA 1G17A 3WGKA 4Q19A 4EHHA 1DB3A 1Z4PX 2OCBA 3O4HA 1BE1A 4Q9HA 5J40A 1N1DA 2QTBA 2I7XA 5JY1A 2RJOA 2ZB4A 1YHNA 1H6AA 5B12A 1A5ZA 2DFLA 2DFPA 2GPBA 3R77A 5CB8A 1T8SA 3KSMA 1ZSYA 1KERA 2FF7A 5EL0A 3OMWA 2HSDA 4MUNA 1T15A 4JENA 5CYFA 2EWVA 3OEEA 2W0SA 1GUZA 1IJEA 3IQXA 4WXRA 4P53A 4IVRA 1RKXA 3C39A 1E6MA 3E0XA 3Q3GE 5ICMA 4MAMA 5KU7A 1FBNA 2J9GA 4QYIB 3OZTA 3RVQA 4PXYA 1A5AB 3TWOA 3AEKB 3W6PA 1BDIA