1JDJA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase in complex with 2-fluoro-6-chloropurine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCEROL-3-PHOSPHATE DEHYDROGENASE
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 132
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2001-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1jdjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1jdjA01
1Q7BA 1LDMA 2X0RA 4JJFA 4P4NA 1OC4A 3P2OA 3WXBA 1GZ6A 1UXGA 2DTDA 4WECA 1K6XA 4DPLA 3B70A 4JJIA 1KVQA 4Q9NA 4L75A 1PL6A 1SCUA 4JN6B 3H3JA 4WNCA 4IGEA 4BQRA 1EFKA 2AA3A 4B7CA 4EEZA 1Y5MA 1YQXA 2IRWA 3NV9A 5EJ2A 3NX4A 3FPCA 4TROA 4BNGA 1CF2O 2QRJA 2LDXA 1QYXA 3WGYA 4CM1A 4CMEC 4CUKA 3G3EA 1M2WA 3BMQB 3MJCA 3AFMA 2VRBA 3INTA 1KOLA 3WMWA 5ER9A 1F17A 2Z1MA 3RJ5A 3S8MA 1PZFA 5FEUA 3C1AA 1LDEA 4DYDA 2YW9A 5G4KB 4YJGB 2W8ZA 3MJVA 2PKRA 5IZCC 1HYGA 3WOHA 3LF1A 1WAMA 1XSEA 4XGKA 5DF1A 1P1KA 4N5NA 4AJHA 2OZPA 2VOEA 3M1AA 4NU5A 1BHSA 2CSUA 4QECA 1JWAB 4E0BA 1HRDA 3T4XA 1KETA 2FMUA 2VT3A 5JDIA 3R3JA 3IKTA 5T6BA 1E1LA 3AK4A 5IJZA 4Z3KA 1NVMB 1T2EA 4OHUA 4WE3A 4OOEA 4HY3A 4RF3A 1RM0A 1V35A 3DBHB 4RF4A 2ZQZA 4FFOA 2GN6A 5EMHA 1SPXA 1MUUA 2HRZA 1DB3A 5F21A 2AW5A 3PVZA 1X7HA 4PLGA 3BZUA 2AXQA 2ZJ1A 2FRDA 4AJ1A 3ZHBA 1XKQA 3CUKA 3DZHA 4YJDA 2VHYA 1DFHA 3ONFA 4W9NA 3TJRA 2NVBA 5CEFA 4IQ8A 5A5FA 1JKIA 2CF6A 2VWPA 4YWJA 1YOVA 5CDGA 1NAIA 1PJBA 1BTOA 4G81A 1K5HA 3F46A 3ZV3A 4E30A 3FNEA 1SO8A 1R15A 2J5KA 3OJEA 2WYWA 1XDWA 4FN4A 1X1EA 2CVQA 4E2ZA 5DZSA 1Y9AA 2FPGA 5A5EA 1OZAA 4GX1A 1QV6A 1YWGO 1P74A 4WJZA 4XQ9A 4BO6A 2NVUA 3WTCA 3OIFA 2GD1O 3WWYA 1GZ3A 4JGBA 3RFTA 3VH3A 2O7SA 4N18A 1R16A 4ZD6A 3W4KA 1P0FA 1Y7TA 4UEJA 3DZGA 4QFCA 1PJ4A 2I3GA 1QYDA 4OSOA 1ENYA 1D1SA 2IZ0A 3SJ7A 2H5LA 3I6IA 3EW7A 3RUIA 3VPFA 1Y1PA 3LF2A 2UUPA 3W6UA 2JHFA 3KBOA 2CNBA 2X5JO 3E03A 4YYZA 3WQRA 4ZQGA 2Q99A 1V3TA 4BO8A 1PJSA 3H5NA 3GZNA 3OEWA 2ZYAA 1E7SA 2J3KA 4J9UE 4KOAA 5CPFA 1W4ZA 4FDAA 1BMDA 5AXCA 3T7CA 4I08A 3H9UA 3PFFA 4IDEA 3AY6A 1YDEA 3DAGA 4RVHA 1NNUA 4CMKA 4BGVA 4NU6A 2Q2VA 3QW2A 1ONPA 1SMKA 3DDNA 3QRWA 4ALNA 3K5PA 3DMTC 4DC1A 1PGOA 1DDOA 3V8BA 1DJQA 3SXPA 5L7WA 1RM5A 4NG5A 1C0IA 3AW9A 1DSSG 4CR8A 3GPIA 8LDHA 4PLFA 4ZRNA 1LEHA 2BFOA 3OECA 5CEJA 4DWVA 1E3SA 4ILKA 2B83A 4UREA 2DU8A 1VJ0A 1HZJA 3FTPA 3VDRA 4CQLA 4YRDA 1PL8A 5IDYA 2JHGA 1XHLA 4PZEA 2VRCD 4PLVA 1E7YA 3JYNA 4PG4A 3RVDA 2EIHA 3GN1A 2E6UX 1XU7A 1DIHA 1X15A 2YQ5A 4IDBA 1F06A 3ROMA 3SLGA 1ZEMA 4RVSA 4W6ZA 1MA0A 1JW9B 3HN2A 3DHNA 2AG5A 2W2LD 2B35A 3L4BA 3ICPA 1H9AA 1IZ9A 1YL7A 1H94A 1DBVO 3RJ9A 3K9QO 3C85A 4CMIB 1SC6A 3OQBA 1F14A 2B37A 2YYYA 4H15A 1DRVA 3TDKA 4MOWA 3H5RA 4CODB 2PZMA 4RZHA 3OBBA 4E5KA 4HFJA 5IF3A 5IXSA 4J7UA 4EDFA 4O6VA 1U3VA 3IOYA 4Q3EA 4GKBA 4BB5A 4NJMB 1C1DA 2HMSA 3ZWBA 5G4LA 1UZNA 3ZV5A 4LVCA 1GY8A 3U62A 1Z73A 3DFZA 4LK3A 4B3JA 1ZFNA 1QORA 3IKVA 4ZICA 3I5MA 1DRWA 2F1KA 5ER6A 2VHZA 4NQZA 1VLLA 1P44A 1R0SA 3NTOA 4NZ9A 3GZ4A 4WKGA 4MKXA 2Q2QA 3VAZA 3QWIA 4RQUA 1A72A 2G0TA 2ZJ0A 1ZEJA 1EEHA 3PPIA 2GDZA 5KJEA 4WEQA 2NU6A 4AJNA 2A92A 3OFSA 3AY3A 3AOEC 3LT2A 4XIJA 4GAEA 1N8KA 5CDTA 5A02A 1A9ZA 4Y6PA 1PR9A 1XYGA 3GDFA 4M55A 1PTJA 5EPOA 1NX6A 1HKUA 2LDBA 3RUCA 5KTKA 3E6AA 3GPDG 2JD0A 3PIIA 3AY7A 1I10A 1NP3A 5COBA 4WCDA 5AVOA 5B12A 4Z0HO 1ISMA 1T4BA 3BTVA 3WQSB 4U0JA 4YAIA 1WZEA 3BXXA 4LSMA 4GGPA 4OAQA 2PGDA 5I7VA 4BHTA 1SZJG 1T2FA 3GEDA 4LMPA 3GUCA 3CIFA 4XD2A 4W7HA 1FXSA 2PZJA 2VWQA 4DMMA 1DJNA 1BSVA 1JKJA 4BNZA 4BO5A 2VNSA 4OMUA 1GYRA 1M6WA 1MFPA 3BMNB 3NT5A 3VHRA 5ADHA 1LDBA 3F4LA 1U5CA 3UFXA 3E1KA 1OI7A 2Q1UA 3WYBA 4RGBA 1ENOA 5HM8A 3D0OA 1EQUA 3MOGA 2PGJA 4BL5A 1VKOA 3JQAA 3GNTA 2B69A 1PQWA 1WZIA 3HZZA 3WLEA 3U9LA 4R01A 1PZGA 4A03A 4MP8A 3UKOA 1O94A 4QEDA 4YRBA 3PJDA 4E5NA 3D7LA 1JDJA 2C82A 3OH8A 5JCJA 3ZWVA 3S1LA 1GR0A 1K2WA 4E33A 3FNGA 2P2SA 3WJAA 1JU9A 2JL1A 2TMGA 5AXAA 2X8LA 3DBLA 4IIVA 3KSUA 3R3SA 4IQGA 5BNTA 1EZ4A 1SOVA 4H16A 4YT2A 3JQ7A 1N92A 1I0ZA 2R6JA 4E31A 4BNXA 4J7XA 4UUOA 1WWKA 5HRUA 3NT2A 3UW3A 3COSA 1ML3A 1Z7BA 3CPSA 1GV0A 3EAGA 3CSDA 4CM9A 4QO7A 3IS3A 1IHXA 4YAJA 1LC3A 4CMJA 4OQYA 4Z9YA 2VN8A 1D7OA 2I67A 3NGXA 4FBGA 4Q3CA 3DQPA 5K9ZA 1FJHA 2QX7A 1PL7A 4HNGA 2VYVD 2AEFA 1U7TA 2OGUA 3GGGA 5B4TA 2Q46A 5DBIA 4NK4A 4BO2A 2Z95A 1NFFA 2YFQA 3AI1A 1HYHA 3WB9A 4BNFA 1G0OA 3WFJA 1Q7GA 3ST7A 2ZB4A 4HBGA 4ZN6A 4R1SA 4KUEA 1NPTO 3VZQA 2QZ9A 1KBZA 2P4HX 4KWIA 1AE1A 4ZQBA 2ZKLA 5FFFA 3W8FA 1DIRA 5G0VA 2RAFA 1Y9EA 3PYXA 1UJMA 3HN7A 3OJOA 1K6IA 4U0KA 1H6DA 1H5QA 3CKYA 2B4RO 5ES3A 3TOXA 4CMEA 3RQSA 3KEQA 3AOGA 3WMXA 1YE3A 5IDWA 1E7RA 4EJ6A 5ITWA 5K0ZA 2Y68A 2B4QA 3D64A 3JYLA 4JIGA 1UAGA 1TVEA 2P9GA 1ISFA 1EUCA 1B26A 4N5LA 3PK0A 3Q6IA 5IZCA 3RU7A 3DTYA 3TZHA 5J23A 2FP4A 1MV8A 4ALLA 4FOOA 1PU2A 4FFMA 3TN7A 3RUHA 2DTEA 3OJ0A 4K9DA 4LRSB 4PLHA 5JW6A 5LCXA 3ZWWA 4UVDA 3O9ZA 3VZSA 1TT5A 3Q9UA 4BNKA 1E3EA 2EGGA 2YUTA 4QTZA 2OUIA 2RHCA 2B0JA 4U6QA 4PLCA 2GR9A 4J9VA 1YB1A 4Z9XA 2JFGA 4U7WA 4AJKA 3JQEA 4W99A 3AI2A 2EJVA 4PLYA 9LDBA 1HF3A 1Q7CA 2HMVA 4R3WA 4BNTA 4PRLA 1UXHA 1KERA 4XR9A 2FPPA 4YA6A 1GZ4A 4E3ZA 1CRWG 2PNFA 1E7MA 1LLQA 1H6AA 3Q2IA 4K6CA 5TJ9A 4Z0TA 3PGJA 1EUDA 2GSDA 3L6OO 5KVVA 3L0DA 2DKNA 4MPDA 4M1QA 1DLIA 4P22A 4J91A 1HL3A 4IXWA 1N7HA 3ZZNA 3E18A 4MIYA 2CMDA 3WDSA 2DLDA 4ND2A 2NV6A 5A03A 5JO0A 5FI3A 1SAYA 4I5GA 1Z82A 1AXGA 2A94A 4NK5A 1BXGA 3ZHXA 2PA3A 1GUZA 2FY8A 3PWSA 1P3DA 2JCVA 1ZSVA 3ZCXA 2JAHA 2RH8A 3DONA 1Y8QA 2PKQO 3CINA 5L4SA 3AU8A 3I4FA 1K0UA 3UXYA 2NVUB 4OXNA 3FWZA 4NFYA 2C2YA 1ZK1A 3IUPA 1B16A 4MKRA 5TQVA 4CM4A 5IN4A 4XQCA 1KY5A 3AJRA 3CXRA 3A9WA 3JQGA 2NQTA 1U3TA 1ISJA 3ZHZA 3ZNPA 1EVZA 2OFPA 4EUEA 1ZSNA 1Z75A 1A5ZA 2ZTVA 1TEHA 1HZZA 4A26A 4D46A 3L4SO 3DMTA 3DBRA 3GZNB 1DC5A 4WCFA 3S2IA 4OGWA 1M67A 3ZW8A 1T1SA 2CD9A 3PQFA 4DIBA 1FDUA 3X2FA 4MVJG 4IDAA 1D4FA 3A28A 1R0LA 3VZPA 4A0SA 1HLPA 1KVTA 2HMTA 4RZIA 5JXWA 3B20A 1E77A 2AQKA 2EV9A 1N1EA 4XJSA 4XYBA 4FQ8A 4R1NA 3STHA 4W7IA 2NACA 1VRWA 3GNSA 1IE3A 5HS6A 3K2EA 1ULSA 2EHDA 1P33A 1QXSA 3QV1A 4EJMA 2BGLA 1MC4A 1TB4A 3QLJA 1I5RA 4JQCA 5EQDA 1F12A 1KEWA 3ADPA 2D8AA 3VH4A 3OHSX 1PS9A 3AUTA 1I3LA 4HFRA 4PG5A 2VZ9A 4L8VA 4FIZA 3PJEA 2B4TO 3DZFA 2PD3A 3I23A 5MGBA 4ITUA 3ROKA 3D5QA 3RBZA 3R6DA 3Q2KA 1R4NA 3ZWPA 3DWFA 5FYDA 4I9UA 4J49A 2VT2A 1YQGA 1NWHA 3I9MA 3KETA 1PQPA 2GN8A 4XDZA 4GX5A 1FMCA 5COQA 4U6SA 4CUJA 1E5LA 1PR3A 5CDYA 5ILGA 4JXKA 4IJVA 3QP9A 3RD5A 3WYCA 4AL4A 1C1DB 4A10A 4QXMA 4XA8A 3N7UA 4BNWA 1GQQA 1E7QA 1C1XB 3I4CA 4I1IA 1CETA 1R4MB 3AOEA 2ZB7A 4TKMA 1IZ0A 3FN4A 3GMDA 1XELA 2VZ8A 4HKTA 5L7YA 4BB6A 5F1OA 4W4TA 4DQVA 3U0BA 3QQPA 4A5OA 1HDRA 5C7OO 2J5QA 2ZB3A 5TSDA 3K8ZA 4WEOA 5DDIP 1QYVA 3K73O 2IXBA 2QYTA 3MZ0A 4FW8A 4BV8A 2I65A 1ZUD1 3DEYX 1DFIA 2RHRA 4OO3A 3ICCA 2WSBA 3B6ZA 2WTBA 2WMDA 4IZIA 3AUSA 4MJLA 2C29D 4O59O 5A4DA 4CV3A 4J1QA 3NDJA 2BRUA 3MOIA 4R9RA 2WM3A 1YJ8A 1DC3A 3QWBA 1HWYA 1X0VA 4I5EA 1MGOA 2NSDA 1PEDA 5I7EA 4CR7A 3H2ZA 5DCWA 1ZXBA 4MO2A 3TNLA 1YVEI 5TNXA 4MIOA 4MIEA 4DPMA 2GERA 2R2GA 4HXYA 3I9OA 3JQAD 2WYVA 3MEQA 4PVDA 3HQ4O 4BGEA 1YL6A 2D0IA 4PLTA 1KY4A 3ANMA 4BMVA 1EQ2A 3ENNA 2Q1WA 1V3VA 3HDHA 3OA2A 1VSUA 2I9PA 4PZDA 1S6YA 4CLXA 1YJQA 5JCJD 1ULUA 3JQAB 3FBTA 1I2ZA 3EUWA 3KYCB 4ZQFA 5A1TA 5JLAA 2HMWA 4ZGWA 1KEVA 2HKIA 4MVJA 4AVYA 4C4OA 7ADHA 3GVXA 1RKXA 1KIFA 2QQ5A 1C0LA 5L45A 4BO9A 4D0SA 4FC6A 3H6KA 1Q0QA 3H4VA 4DPKA 2BGKA 3HDJA 5G0TA 3GAZA 4GBJA 1WW8A 4IIUA 3UGKA 1QYCA 4XDYA 5KJ1A 1RM4A 2FZEA 3DBLB 3Q11A 1YBMA 1GUFA 5DOVA 1DHRA 2D1YA 3RIHA 4CM9D 2Q45A 4ROSA 3UOGA 2DTXA 1G0NA 3WWZA 1QLHA 1X7GA 2V7PA 4ALKA 4ID9A 4OOFA 3RC7A 3I3OA 3ZGYA 4DLBA 4AJJA 2Y05A 5AXDA 4IDCA 4DC0A 3RFXA 1JA9A 1NXQA 5BNIA 4J0FA 1YS4A 2IODA 2P5YA 3CE6A 2YDXA 5T8KC 4JP2A 4R5HA 4KWHA 2HLPA 4BGIA 3IJPA 1ONOA 1AUPA 4UEKA 4DLLA 4TRNA 4B4WA 2D5AA 5CHEA 3OQ6A 3DXFA 2P9EA 2FWMX 2PH3A 3H9GA 3QY9A 2YFHA 2FOIA 5KVQA 4GSKA 3D3WA 2VHVA 4GLLA 2BGMA 3OMLA 2BD0A 3ETGA 2BFMA 3H9JA 1ARZA 1LXCA 3TZ6A 2OBYA 5A06A 3L07A 2HQ1A 5H82A 1EE2A 2AMFA 1HDGO 1ISIA 4INAA 1B7GO 3QVWA 4M86A 1CJCA 3CZMA 1BW9A 3GGPA 2P68A 2B5WA 1T26A 1VL0A 4BMNA 4OYRA 1B8UA 3KYBA 3U09A 3PYMA 1LQUA 2EKLA 3GH3A 3Q0EA 3G17A 5DCUA 3KM0A 4BMSA 2DPGA 2XF8A 2HDHA 3F1LA 4NBWA 4ND4A 3D4OA 3TL3A 4BKOA 2C7VA 4Z6KA 1CQJA 3TWOA 3OQ1A 3RSHA 2B5VA 3BA1A 4L4SA 3QIVA 1C0PA 1H2HA 2EF1A 3MWEB 4FB5A 4UAGA 3E5RA 4NI5A 4XRGA 4KDFA 4E5YA 5EL0A 3L9XA 1LSOA 1JN0A 1GL3A 3S2EA 2Q1SA 3I9KA 4YJHA 5IN5A 1OBFO 3GFBA 2Y0DA 2DC1A 4J3FA 2C5AA 4C7KA 2X7HA 3AWDA 3JQ6A 3PZRA 3D3EA 1G1AA 2PZLA 4YCAA 3FBGA 5CFZA 1MB4A 3LDHA 3ULKA 1RPNA 2UVDA 4Y6RA 3ON5A 3VTFA 1XQ6A 4CMCA 5HBRA 3HDQA 5TX7A 3UICA 2PD4A 3PTZA 3Q1LA 3ZWOA 3LYLA 4GMFA 3RASA 5I7SA 2VTDA 4PZCA 2NADA 2YHIA 4WLNA 3AI3A 4HP8A 5BNFA 4IPTA 2EG9A 1HXHA 1XQ1A 4LRTB 1GCOA 1LDGA 1CYDA 2EGHA 3NUGA 4RVFA 3GK3A 3H9EO 4ND1A 4NIMA 1OOEA 4NBRA 5IG2A 2UYYA 3MJSA 2DUUA 4GMGA 2ZCUA 5C37A 1NQOA 1BXGB 4CLRA 1EK5A 1T2CA 5LDHA 1UDBA 4RPJA 3M6IA 2W2KA 3BTSA 4BKPA 3HB5X 4DVJA 1PJ2A 2DT5A 3BIOA 1Y8QB 2O48X 3MTGA 1PS8A 3HE3A 4QFDA 3JYQA 5HA5A 4HV4A 1ZBQA 8ADHA 2A35A 2JD1A 3AFNA 1Z45A 3MJ4A 4WPGA 1CWUA 4P4LA 4CM5A 3KYDA 4CR6A 4CM4B 3PHGA 1C0KA 2W90A 4D45A 1MX3A 4F45A 4AJEA 1GDHA 3QE3A 2I66A 2Q50A 1BXKA 1FDVA 2CZCA 3DZBA 4UVGA 5T5QA 3V1UA 3IIEA 1LX6A 3PHIA 3TPCA 1IB6A 1VPDA 3OIDA 3DBRB 2BLLA 3G49A 4PFJA 4WCFB 5I8ZA 4BIIA 4OXKA 3PIDA 3KHUA 4XCVA 2TMDA 4CLEA 3PHLA 4IMPA 1H9BA 2HK8A 1EDOA 4GWKA 3UVEA 1GQYA 2QRKA 2OOSA 5A9RA 5DULA 2HO5A 2ZTUA 3S55A 3SEFA 3GDGA 4BV9A 3HNPA 4F3YA 3OF2A 5JMPA 5CG1A 2DBRA 4UULA 3UCFA 3KRTA 1DAOA 4XIYA 1HSZA 4XYMA 4ZJUA 3K30A 4DQXA 2D4AA 3O4RA 2E82A 1LSJA 2C54A 3RAJA 4GPD1 4D3SA 3KXDA 2J6IA 4DIOA 1N9GA 3L77A 3MJEA 3MCVA 3HB4X 1PQUA 5L40A 4GKVA 4EJ0A 4O63O 1P77A 1H6BA 4B7UA 4K26A 3C7DB 4IS3A 3VKVA 3FI9A 3QVTA 2RCYA 2DM6A 4EUHA 3IL2A 3GQVA 3UF0A 3I83A 3NDRA 4YQYA 1CQIA 1YQDA 3NRCA 4OJNA 2JAPA 3RC1A 4YJFA 1GFSA 1R4NB 2GN4A 1UXJA 2VUUA 3DHYA 3QWHA 4Y9DA 3EK2A 5GZ6A 4FR5A 4OIMA 4GWGA 3IP1A 2AE1A 4R3NA 1WVGA 3DZJA 4ALIA 3EMKA 5TS3A 3TF5A 4IQ0A 4YAEA 4EYEA 1N2SA 3HDYA 4W82A 2OP0A 5EINA 1R66A 3G0OA 1QV7A 5F5LA 3PI7A 2WD7B 3GRPA 1O8CA 4BNIA 5TGDA 4J1NA 4AJLA 2NLOA 1VI2A 5JBIA 4BS9A 3UHAA 1LDNA 1W6UA 3ABIA 5KJ6A 5ICSA 4BGUA 1J0XO 2IYPA 4GQAA 3V2GA 1GEGA 3U4DA 1YBVA 4YAKA 4YB8A 4U5QA 5I7FA 5AOVA 1HE2A 3K31A 1PIWA 2RBEA 2NU9A 1D8AA 2VWHA 2Y67A 3C24A 5A3JA 5TT0A 3S2GA 1BVRA 1X0XA 3C8MA 3P5SA 4IBOA 4F6LA 4DREA 1VJ1A 4E13A 5L4LA 4IZHA 1ZK3A 2ET6A 1NR1A 1DC6A 3H2SA 4KMSA 3C7AA 5F1KA 3ZWNA 3V2HA 1AGNA 4UVHA 4HUJA 2VCYA 5U9CA 5IXYA 2ZYGA 2WE8A 4ND5A 3EVNA 2JFHA 2J8ZA 5BSFA 4JLWA 4AFNA 5BQFA 5LC1A 3U4CA 2DBVO 2Y1OA 3EDMA 1YH3A 2OMEA 3SC6A 1VKNA 4MDHA 1ZKMA 3IAHA 1F8GA 4IY1A 1LLUA 4RPKA 3MJTA 6ADHA 1RYEA 4MVJD 3PEFA 1UH5A 2CVOA 2EXXA 1SEPA 3PQEA 4CPDA 4EEXA 1XEAA 2DVMA 5G4KA 3EVTA 5TT1A 3W4IA 4NMHA 3RCBA 3A1NA 4YRAA 2YV3A 3LLVA 4IJUA 1HDZA 1KEPA 3NTQA 5DBGA 1U5AA 2AE2A 1HE4A 2DFDA 2PV7A 4Z0PA 1CDOA 1O6ZA 3RBXA 3JCZA 5JMWA 1EBUA 3LC7O 4PG8A 5KWEA 2Y0EA 1WMAA 4GVXA 2E48A 1YKFA 4N7RA 3LQFA 4X54A 2C59A 3SVTA 4R69A 4URFA 2HJSA 2Y1CA 3T4EA 3GVIA 2J3HA 5I9NA 1I8TA 1KVSA 1JAXA 5T8KA 2GCGA 5JYEA 2X9GA 3DBHA 1NASA 2I5PO 1I32A 5F3RA 3LZ6A 5THQA 3EGOA 1B3RA 3M1LA 3ASUA 5CG2A 1ADCA 4BNLA 3ADOA 3KUXA 3G1UA 3JYOA 5EESA 3TZQA 3ZWXA 2VHWA 3FPLA 1I24A 1KC3A 1MC5A 3BTUA 3GEMA 4AICA 1I33A 4XKJA 1LJ8A 1UDAA 3E5MA 1JLLA 1MFZA 2NTNA 3BYZA 5KVSA 3PHJA 1IUKA 5F1PA 1V0JA 1R6DA 1HE5A 3ZNNA 1DIGA 4IXTA 3DR3A 4CM6A 2Y99A 3ZU5A 4AJIA 4M87A 2R00C 1MXFA 2GZ1A 4E5PA 4M54A 2YV1A 3WJ7A 4EI2A 1E0DA 1NM5A 1BW9B 4YDRA 3F47A 4IGFA 3LLSA 1CERA 2Q1TA 2JKVA 3KSZO 1DAPA 4N5MA 5EN4A 1XLTA 3ZI0A 4XRRA 2XXJA 4OQZA 1YOVB 3JTMA 2D5CA 1TA4A 3AU9A 3DL2A 4BO4A 3WG9A 4D7AA 5ICMA 5FWNA 1UXIA 3CZRA 3F4BA 5JNLA 1HDOA 4A7PA 3HHPA 3ZWAA 2IYOA 2O4CA 5JC1A 3PDUA 2QW8A 2EW8A 2XPCA 4WASA 4YJHB 1YO6A 1AHIA 1E1KA 2BH9A 4LGVA 4L76A 4R1UA 3WNQA 3F6YA 4Y98A 4IJWA 1A4UA 2PWZA 1U7HA 1LRJA 2O3UA 3HFGA 4KTVE 4R41A 4CV2A 3KB6A 2AEJA 3GRKA 3FRJA 3JSAA 3SJUA 1BWSA 1BVUA 2OBNA 4B4UA 4RLSA 5H81A 2WD8A 1MG5A 3H7AA 3RUAA 1KYQA 3BMCA 4IS2A 4XJTA 3QJ5A 1LNQA 1K3TA 1PJQA 3BMOA 2VHXA 2P5UA 3NYWA 1U3WA 5B4VA 1U8FO 4BKUA 1JTVA 1P45A 2J3IA 2YHIB 5L51A 5C5IA 5G0WA 1AXEA 5L95A 1MG0A 3KTDA 3H5AA 3U49A 2PY6A 1ZSYA 2V6BA 2PKQP 3WGQA 1Y81A 4XYGA 3K6JA 3QWAA 4YPOA 4RF5A 2CF5A 2IZ1A 5FF9A 1EVIA 2X0JA 4B8WA 1ENPA 1UR5A 4CQLB 1LI4A 1ONNA 4YT5A 4OKNA 1LBEA 2P4QA 2YV2A 2W2KB 3U5TA 2YY7A 2F00A 1QP8A 2NNLD 1ZMTA 2POQX 2Y0CA 4P38A 3NTRA 3PJFA 1TXGA 2FN7A 3H65A 4I5DA 3ZDFA 5KJFA 4TVBA 1B14A 1VL6A 3OICA 4UVIA 4PG6A 3GHHA 1H93A 3RI3A 3KYDB 2BI7A 3R1IA 4NPCA 1IL0A 1A27A 3NEPX 1ZW1A 1EFLA 9LDTA 1I2BA 1LC0A 1NQAO 3ZN2A 5JY6A 3DOJA 5A05A 4BO3A 3GVCA 4RF2A 2VWGA 1LLCA 2O3TA 2VUTA 5G0UA 4J4TA 4JBHA 1YRLA 1K6JA 5JCXA 1U1IA 1X7DA 1EE9A 3EHEA 5JDCC 2P91A 4QO8A 4BNMA 4UVEA 3NKLA 1JAYA 3JD4A 4WLUA 1HSOA 1O0SA 2HK9A 4JP3A 4JNKA 4P4GA 4B3IA 2DQ4A 4RV9A 4TWRA 4BNVA 2ZATA 1BRMA 4ALMA 3JV7A 4CMHA 1L1FA 5LDGA 3GAFA 4FCCA 2Q4BA 2Y1FA 1C14A 4OKIA 1T24A 3LT4A 1Y5RA 4U8GA 2HRBA 2GUGA 2V65A 1I3KA 3KO8A 2DBZA 5JE8A 3H3FA 3JQBC 1CIVA 1JVSA 3OEYA 3JQ8A 2HUNA 5TIIA 1N9GB 1U2DA 3WTBA 4GX2A 1B3BA 2G82A 3HG7A 3KV3O 4BNYA 4EBFA 3ASVA 4M8SA 3C1TA 1I3NA 4LISA 3WGTA 1ORRA 4RORA 1NYTA 2CY0A 1L7EA 3FTNA 4RPLA 4K28A 2BFPA 3FR8A 1HDCA 2G1UA 2GRAA 1DC4A 3QVOA 4J4BA 1B2LA 3KOUA 1VM6A 1P1IA 3QVXA 3RU9A 2I6TA 4L4XA 2D2IA 1UUFA 4YJFB 4TKLA 4E2XA 2J5RA 1BDMA 5AXBA 1GQ2A 1I01A 4MVJI 5JAZA 4TZTA 3N58A 4ZA2A 1P1JA 3AM4A 3JD0A 3NAQA 4MP6A 4BKRA 2EW2A 4EUFA 1TLTA 1AHHA 3P19A 4EW6A 1OC2A 4CLHA 3E82A 1NQTA 3DHEA 3GG9A 3BHMA 4DRYA 1ZK4A 4Q3BA 3WQQA 2Q2WA 3WX0A 3ZV4A 3SLKA 3I9LA 1Q2XA 2G76A 4JROA 3LT1A 2Y1GA 4BUCA 4L73A 1ADGA 3F3SA 3UCEA 3TSCA 1V9LA 4XGIA 1NBOA 1XU9A 3ANLA 1A71A 5B1YA 1QLJA 1Y6JA 3ZW9A 4KDEA 2VYVA 2XAAA 4CV0A 4G2NA 1PJ3A 3IMFA 3RWBA 2Z1NA 1VE9A 2J3JA 4BNHA 1YB5A 3JQ7B 4GSLA 3HWRA 4ONEA 3I6QA 1J4AA 1G6KA 4MVJF 5KCZA 2B36A 3U4HA 2PK3A 1NVTA 4YT4A 3P2YA 1BGVA 4BNJA 4CJXA 1Y8RA 5IDQA 4DMLA 2HJRA 3LC1O 3VVBA 3INRA 1OAAA 4BNUA 2H9IA 3E9QA 4KP7A 3NGLA 5ILOA 4WLEA 4FFRA 5JY1A 5BR7A 5JO9A 3ROQA 1NFQA 1O89A 3ONDA 4IMRA 3IJRA 1DFGA 4LMRA 2GLXA 1PGQA 1ZIDA 5K6AC 3PLNA 5L4NA 1XGKA 2EKPA 1NVGA 5TC4A 2NM0A 1H6CA 3KVOA 4FD3A 4GI2A 2CVZA 2RIRA 1QMGA 1UXKA 3AM3A 3D4PA 5F5NA 1IOLA 2X0IA 2QZZA 4F46A 1YL5A 2Y1EA 4RPGA 2OL4A 4NFSA 4S1VA 1JVBA 2H63A 2OP1A 3JD1A 1R12A 1ZCJA 3ZV6A 4DYVA 3PJGA 4NH4A 5HTOA 3PXXA 4BO7A 1B8VA 4XWYA 2X5OA 1GAEO 2ZIZA 3EC7A 4R1TA 5COAA 3FNHA 3I52A 1U28A 2IEDA 1RJWA 3ZNQA 1T4DA 1A7AA 1E1MA 2GO1A 2FPIA 4LN1A 1SOWA 4J43A 3VPXA 3ZU3A 2JCYA 4YBZA 4NNJA 1D3AA 5DNAA 2V6GA 3DOOA 2HU2A 4ZRMA 2WE7A 1E5QA 2BKAA 3NJ8A 1I30A 3ORFA 1DLJA 2EERA 5C3MA 4YT8A 3VC7A 1F0YA 1T2DA 2X5KO 3JYPA 3F1KA 2YHUA 3EZLA 3O38A 4FGSA 3KLMX 3M2TA 1U4SA 4J1TA 4ZHSA 2ZTLA 2X23A 1TT5B 2Q3EA 1A4IA 3RBVA 1FDTA 2D59A 3SBOA 1E92A 1PJTA 4MINA 4YVFA 2PLAA 3GUYA 2R00A 4L4RA 3W4JA 3I9NA 3DOCA 3I1JA 4ZQHA 4ALJA 1E3WA 3B1KA 2PH5A 4MP3A 1Q1NA 5GZ1A 5I8WA 5JSFA 4HADA 4R5MA 4BVAA 4XX0A 4L0QA 4MVJP 2P9CA 5A3VA 1U8XX 3TRIA 3A06A 2HSDA 2E4AA 4RVGA 2W98A 3KEOA 4J0EA 4IDDA 1E6WA 4LW8A 1UP7A 1B8PA 3HADA 1DPGA 1O95A 1OMOA 1P9LA 1GD1O 4LCEA 4WGGA 4BO0A 4MVJH 3GVHA 4UUMA 3OM9A 2NWQA 3EYWA 5AYVA 3WGHA 3HJAA 4DLAA 1U4OA 2ZB8A 2NUAA 3VH2A 4D0RA 3TFOA 1UP6A 1WDKA 2UV8A 3GR6A 4AJOA 4NBUA 4KQWA 5FI5A 4FS3A 4Q39A 1PWZA 2HAEA 3ZU4A 2EKQA 5IAAA 4J16A 3WBFA 2I76A 5JAMA 3C7CB 1LRKA 2FR0A 4CMBA 3DC2A 1EVJA 1ISHA 5JAQA 4QX6A 1X14A 4WCFC 3UAGA 3UN1A 4NBTA 3K96A 3WLFA 4PG7A 1TI7A 2WJPA 3W8DA 4DTIA 1NQ5A 2ZQYA 5T67A 3TZCA 1P0CA 2GPTA 4HNHA 3WNVA 2CUKA 1UP4A 3ZWMA 4E4YA 5IFLA 2NTJA 1SB9A 3JQCA 3JQGB 1XR3A 1EBFA 4HX5A 4CL8A 5CDUA 1XIVA 4Y67A 5IDXA 3NT4A 1IPFA 2O3SA 2YDYA 3HUDA 3GOHA 2VYNA 1ZMOA 4D79A 1W0CA 3NDIA 4OXYA 3TOZA 4DGSA 4KTTE 4CMAA 3G1TA 1IY8A 5JPIA 4DIFA 4D43A 1K89A 2CDAA 4JBIA 3BMCB 4JX8A 2X9NA 3BMOB 1JQBA 5TRTA 4DUPA 4CQMA 1SEVA 1UAYA 4CM8A 4XQEA 1HDYA 4XYEA 5L3ZA 2AQ8A 3PFWO 3KLPX 3MTJA 2V6MA 2XOXA 3VDQA 5A9SA 4E21A 5DCYA 2O4UX 1DO8A 3GA0A 1ZXLA 2PTGA 1NR7A 5JC8A 3LK7A 3E9NA 5T64A 4II2A 3PWZA 3WIEA 1NHWA 2WWRA 3RKUA 2VZ0A 4Z3DA 3ZH2A 4B4OA 3BTOA 2Y93A 5TF4A 2IDZA 3RUEA 1ZK0A 3BHIA 1Z74A 2ZTMA 3HSKA 1RM3A 3OP4A 1GYPA 1N1GA 2EJWA 1KVUA 4ZQEA 4AJ4A 4E6PA 5A04A 4FFNA 3WSWA 4E5MA 3VPHA 1XCBA 2VQ3A 3E9MA 1GPDG 4TRRA 3W1VA 4NR0A 2GASA 1GTMA 3PZBA 4PRKA 1C1XA 1C3VA 4DL9A 2AQIA 3E8XA 3OIGA 4NFHA 3SX2A 3L9WA 6LDHA 1R4MA 1FDSA 2OHXA 2GZ3A 3JQ9C 3M2PA 2VNAA 1ENZA 4WOJA 1X1TA 4HFMA 3VTZA 3PDJA 7MDHA 4QUKA 3G79A 4AJ2A 4P8RA 4XB1A 4CMGA 3GF4A 5CEEA 5JDCA 2I99A 5DP2A 4Q3NA 1I2CA 3MWDB 2H1SA 4KUHA 3S2FA 1B15A 4RCVA 3V5NA 2ZYDA 1T1RA 2WDZA 4F6CA 4FJ2A 5L53A 3R0IA 1WMBA 3T7EA 4JBGA 1GADO 3DO5A 3O26A 2EP5A 1PJLA 3VKUA 3FR7A 4H3VA 3ITKA 2FR1A 3JQFC 4CV1A 2D3TA 2FSVA 4L74A 1V8BA 4G5HA 1S7CA 3OA0A 4R16A 1ID1A 3JQBA 4BQPA 1WP4A 2C5EA 3VPSA 3ZNOA 4QT0A 5CAEA 3O8QA 4MVJM 2IXAA 3EY4A 3TQHA 2YQ4A 1E3JA 5ENVA 4OH1A 1SBYA 3WGOA 3V2UA 2UDPA 1PWXA 1SB8A 1LUAA 4I5FA 3ANNA 3CTMA 1E3IA 2DBQA 3JQ8B 4J7CA 1HEUA 4CLOA 2C2XA 5DBFA 4D41A 3AUUA 5JFOA 3H9QA 4Z9FA 4IM7A 4JCOA 2QG4A 1DIAA 3IP3A 3IDSA 2FR8A 3LVFO 5MDHA 2O2SA 1R37A 4XGNA 3WGGA 1P1RA 3CEAA 2Y1DA 1DIBA 2C20A 4O0LA 1NWCA 4TSKA 5KJCA 3KYCA 4PCVA 1PZHA 3QVSA 1HDXA 4UEOA 1Q0LA 4YAGA 5JS6A 1WDMA 3WS7A 4TVOA 1X13A 2O23A 4K6FA 3B1FA 3K2BA 2OORA 3GHYA 3W6ZA 1EK6A 4MKZA 5BSGA 2BFAA 2CDCA 3GEGA 2QHXA 4WLOA 2HCTA 3TFQA 1XA0A 4IINA 1ZK2A 1BG6A 4EGFA 1QR6A 4OL9A 3OSUA 1PZEA 4HWKA 4E32A 4EZBA 2X0NA 1ZJZA 1E6UA 4GLOA 3JD3A 2X86A 5G0SA 4TQGA 1N7GA 1O5IA 3U4IA 5C7LO 2G5CA 3BMQA 3ZWYA 1Q0HA 4O5OA 2UUOA 1NTOA 1A9YA 2Q4EA 1YB4A 1CEQA 3L6EA 4PLPA 1BDBA 4QSMA 1EMDA 4FSHA 4GVLA 1ZZEA 2E49A 2GNAA 1PGJA 3N74A 4YJGA 5EERA 4E2YA 3C3XA 1RWBA 3LU1A 3JQDA 1HETA 3QHAA 1FDWA 4YTEA 4XYLA 1EVYA 4WLVA 3RC9A 5TLSA 2JJYA 5EQFA 2WYUA 2GGSA 1ZNQO 1DRUA 1MP0A 2EP7A 1LDYA 3NJ4A 5BSEA 1NPDA 4XQGA 3P7MA 4JJGA 2GZ2A 5KVCA 4RPHA 4J2OA 1W73A 2DUWA 3U3XA 4B3HA 1E1NA 3O03A 5DN9A 3WFIA 4WK6A 3GY0A 3AM5A 4NHEA 4RL6A 4TRJA 1U2GA 1P31A 3GLQA 4O1MA 5U1PA 4TMFA 1IULA 4EITA 4TZKA 3WYEA 4XZ3A 5JDIC 2C7GA 4NJOA 1UDCA 4BNNA 4H7PA 1WPQA 1GYQA 2GN9A 4Q3AA 3WIDA 3GVPA 3ENKA 2X1HA 3PHHA 4CLDA 3PYLA 1Y8RB 2FSSA 1PS0A 2PZKA 3BAZA 3CH6A 3KZVA 3PWKA 1XG5A 2IE0A 3LT0A 4PGFA 5CPBA 1N5DA 5K6AA 1P1HA 4II3A 2AHRA 1GEEA 1WLYA 4FC7A 1GPJA 1OFGA 4BO1A 4CM3A 1BXZA 3PRJA 1J5PA 3E48A 3Q9NA 5CDSA 1E3LA 4IUYA 3GDOA 4Y8VA 4GL4A 1WNTA 1VC2A 3IUSA 4M49A 4NBVA 3DAPA 4KQXA 1LQTA 4W9NC 1ZH8A 4XR4A 3PGXA 1KEUA 3ZHYA 3D3WB 4B79A 4XB2A 4RJTA 1R0KA 2BELA 3CTVA 2EWMA 2PR2A 2E37A 2OXIA 4N54A 4LVUA 4PVCA 3ZU2A 3GT0A 3FHLA 3WR5A 4Q3DA 2O3QA 2CFCA 5DT9A 3IC5A 1PGPA 1TT7A 3Q3CA 1J49A 1QG6A 2HMUA 3WICA 1FK8A 1KC1A 1M75A 5H83A 5GZ3A 5KOIA 1QRRA 1U3UA 4FJ1A 3QSGA 1ISGA 3ETEA 4ND3A 5KKAA 4I9HA 3GNQA 3RKRA 2X6TA 3DZIA 3LSYA 1ZO8A 1M76A 2AEMA 3UCXA 1XWFA 2A4KA 4FOSA 4ESOA 4PN3A 4E12A 5L9AA 1GCUA 2G17A 2X9VA 1NHGA 2X4GA 3IQDB 3UH1A 2VOJA 5KNLA 5ITVA 2A9FA 3GN2A 4I8XA 2Z5LA 2OO5A 1DOHA 3VPGA 3ITDA 1LSSA 3OJLA 5HS4A 3B1JA 3DB2A 4B8ZA 1WDLA 4LCJA 2FHSA 4K1LA 4BOYA 4Y6SA 3VVCA 3AUAA 3FSRA 1E7WA 4LSWA 4YEDA 1E6EA 3QA9A 2HK7A 4D3FA 3UUWA 1MLDA 1DXYA 2PD6A 4J6FA 2YJZA 2JD2A 1QYWA 4CM7A 1E3WB 5L7TA 2DAPA 1MXHA 4CUZA 1QSGA 4HFNA 1M66A 3GGOA 4IJKA 1B0AA 4JK3A 4RVDA 4KUGA 1HT0A 2X22A 4CL3A 3W8EA 1VJTA 2YZ7A 1M6HA 2BI8A 1LA2A 4L9RA 5DP1A 2VRCA 3RUFA 2O7QA 4A2CA 1AN9A 5TJHA 1IYZA 1I36A 1EDZA 3GFGA 4J4HA 5EIOA 1GUYA 3V1TC 3PQDA 2GF2A 4IDGA 1H0KA 2Y66A 4A73A 4J1SA 3VOSA 3FF4A 5U4QA 2ZCVA 1UZLA 4CMIA 1O9BA 4D44A 1H2BA 1L7DA 5B4UA 5A9TA 1P1FA 2NTVA 3DBVO 4TRMA 3TZKA 2W2LA 1GU7A 4S3MA 3L4BC 1QKIA 2JFFA 3K92A 4PLWA 3SC4A 5AQ1A 1V3UA 1ZVMA 4CLRB 1F8FA 3FD8A 4KZPA 3EZYA 4XEHA 3WGIA 3RUDA 1HLDA 4DBZA 1Z7EA 2V6FA 2AG8A 2WEKA 4NJMA 2X58A 4OSPA 2NU7A 3F5QA 1Z6ZA 4J2HA 3I9JA 5GMOA 2NU8A 4RDHA 2AQHA 2O3RA 4ZU3A 4FFPA 4YQZA 2VYND 1JWBB 3GC6A 3ROPA 4NDNE 4WLFA 2C07A 1PGNA 5KKCA 2VTEA 5KIAA 2H6EA 5G2OA 4PIVA 2SCUA 3FCOA 4CQMD 1D1TA 3FNFA 2BHLA 3ONEA 1IHYA 4YR9A 2CDBA 1IPEA 1W8DA 1UZMA 2GYYA 1PJCA 2C0CA 2DPHA 1RYDA 2I3AA 1YXMA 2QIOA 2PGLA 4ZVVA 3WBBA 4A27A 1DHTA 3D5TA 4RVUA 4DA9A 4CQMB 4DXHA 2ZK7A 4CM8B 2W4QA 1J6UA 5A9SB 1WXDA 1YGYA 2Q49A 3C1OA 3DAFA 5T57A 2XXBA 4DBVO 4FGWA 4DQUA 5BSHA 1HTBA 1U9JA 3VH1A 1T2AA 2EEZA 3A4VA 3CMMA 4R9SA 3RFVA 3HFSA 4E2WA 3TL2A 1T25A 4RDIA 5I9LA 2UAGA 5THKA 4YXFA 4D42A 1KS9A 1NFRA 3BMNA 3F9IA 4BKQA 1PX0A 2BMAA 1FF9A 2NQ8A 3QWFA 2PFGA 3PP8A 3JQ9A 5I9MA 1DEHA 1EUZA 1I3MA 2O3JA 4WOKA 4WUVA 4R68A 1PSDA 4GGOA 2QYSA 2RH4A 3INGA 4FPXA 2WD7A 3ZWCA 4PLZA 5DOZA 4MVJE 5JAIA 5C7IO 3LC2O 5GY7A 1LRLA 5JYDA 5B37A 4D3DA 1YONA 3H8VA 4I9NA 1YDWA 4AG3A 4OM8A 4WNIA 3PLRA 2QRLA 1KVRA 1V6AA 3WGZA 2VUSA 2DFVA 4R4JA 3JQFA 5IZ4A 1A7KA 3FWNA 5ENDA 4FFLA 3RROA 3OETA 4GX0A 5CP8A 1NPYA 1VSVA 2IEBA 3X2EA 3GMSA 1JKFA 5BT9A 2BF7A 3V1YA 4YACA 1VL8A 4G65A 3WSVA 3KSDO 1LSUA 4J90A 2O50A 1ADFA 1HYEA 1SNYA 4AJPA 4FJ0A 4UUPA 1NAHA 1HE3A 3DZKA 4UUNA 3VZRA 3D1LA 3O8QB 4B7XA 1LU9A 2O2YA 4RLHA 3D4NA 3BHJA 4R51A 2ILTA 3DFUA 4IDFA 4CLOB 2JCXA 1ADBA 3CMCO 3GG2A 3DTTA 4B4VA 3L6DA 1GV1A 3DMYA 1ZJYA 3F5SA 4GH5A 3ETDA 4RQTA 5HWSA 3A14A 1LTHR 1YBAA 2IZZA 4M89A 3RC2A 4RO0A 2FZWA 4R54A 2NVWA 1LLDA 4C7JA 3JD2A 3OJFA 4QQRA
chains in the Genus database with same CATH superfamily
2X0RA 2UUBB 2FLVA 1OC4A 3DOUA 3FCUB 3HZOA 1FPMA 2JI4A 3UMJA 4EOGA 1W4CA 3LPCA 1G19A 3B70A 2F9LA 1EHYA 5CCDA 3TQOA 1SVNA 2W2MA 3KKMA 1O6FA 3LUFA 3PEYA 1RHKA 1T36B 2GJKA 1QBKC 2PKYX 4L27A 2DPYA 3FCSB 4Q9NA 5ERYA 1D5CA 1SUWA 1JFVA 1RLIA 2OYSA 4H7FA 4ZDKA 1Z5PA 4KN8A 4R7ZA 3FYUB 4TMKA 2AA3A 2XYHA 4F2DA 1AY0A 4EYGA 2PXAA 3E05A 2IRWA 4EGQA 1RWPA 5AWFC 5C8YA 4BNGA 1KJYA 1VBKA 1YA4A 3BHNA 4R81A 4BVKA 2QRJA 2GJSA 2LDXA 3Q85A 4ZT4A 5IH3A 3UMVA 1JX6A 4CM1A 3PEWA 4FM9A 4EG0A 2R6AA 1VLJA 3IVXA 3T5DA 2A5DA 2OVBA 5JZOA 3OTIA 4WBNA 2VRBA 3INTA 2G88A 1Q11A 3OLVA 1KOLA 3U7QA 4ZIRB 4I50F 1Y4UA 2DQKA 1WXWA 2A88A 3Q12A 4YAOA 5AKYA 4DGQA 1RZVA 5AVVA 4OJTA 2XQJA 1P7PA 3WLJA 3CE9A 2XH8A 3FWYA 4YDSA 5G4KB 1NOIA 2W8ZA 3DEAA 3H19A 2JFYA 3HRIA 4I0WB 3U1TA 1RMTA 1XSEA 2D1TA 4N3NA 2IYVA 4WX2B 3K6KA 2KW5A 4F8EA 3I2GA 1G3IA 5K01A 1ZJWA 5J43A 5CCXA 4HC4A 2BM9A 2ZRLA 2MSNA 4P36A 4UQPA 4BMZA 2I1QA 4KVFA 5BNIA 2CSUA 4QECA 2B94A 2JLVA 4MIKA 5ULLA 2PUGA 4L0DA 1KETA 3T4XA 3Q98A 2WIJA 3R3JA 2HWWA 4E94A 3HJGA 3WDMA 4HB4A 4JBLA 4OLHA 3AK4A 1I1NA 3WHIA 4Q18A 2QI9F 2ZYWX 5IJZA 2HCJB 1T2EA 3RH0A 3EZGA 5KQGA 4R6WA 1H2WA 1C4XA 4N6GA 5DBHX 3EPPA 4JQZA 4BP8A 1XF9A 4DCTA 4EUNA 1SKMA 1E94E 5KNBA 3HUTA 1JEQA 1V35A 1XK6A 5M2QA 3RVMA 3TECE 1YU9A 1KSFX 3SYMA 5EMHA 2W11A 2VQEB 5CD9A 4JWTA 1X42A 1NI4A 4MI1A 4C2AA 2OFWA 2AW5A 2ZCJA 4PLGA 3P2IA 2VSNA 2FRDA 4ER7A 4Q5IA 3HA2A 4YJDA 3RK4A 2VHYA 1DFHA 4UEQA 3L43A 3V2IA 4HO1X 5A5FA 4KBGA 1JKIA 5DHAA 3T3OA 1YNOA 4H6PA 2VWPA 3H1GA 1YOVA 3DGEC 1X7YA 1AZWA 3KR9A 3NAZA 4YWJA 1PJBA 3ZZ1A 1Y6GA 1K5HA 3UA3A 4PC3A 4NCKA 4E30A 1QO7A 3TXYA 2OQIA 4JI1B 4GW3A 1SO8A 5LFAA 3OJEA 3R24A 4N0QA 1B6SA 3RHFA 5IS2A 4ATNA 2WP8J 4MV5A 3VYRB 1ZY2A 5LM3A 3RYCA 1JFRA 4FT2A 4H1HA 1Z3IX 3GDHA 4AS2A 2FPGA 1QGOA 2HRCA 5AW2A 2XJ4A 4D8XA 4UU8A 4E7PA 2R84A 3BD8A 4XE5A 5JFGA 3CKMA 4HDMB 4GLFA 4C3OB 4JSTA 3OM1A 1T9BA 2CUZA 1OTYA 3DZGA 2W2QA 4ETWA 2B8WA 2BCGY 2Y0PA 1TC2A 4CCYA 3EARA 4K6MA 1JALA 2CDNA 1IN5A 5FV7A 4UTZA 1GQFA 2AZMA 3ORHA 3EW7A 4HH3C 3VPFA 4Z49A 4HR7A 4RJKA 3PPYA 5C81A 1CBUA 2CNBA 4TT3A 3LHSA 2BHNA 4M88A 4JYZA 1SHKA 1V3TA 2NZ8A 3K72B 4EHJA 5M29A 1OB2A 3H5NA 4LJ4A 3QMPA 2J3KA 4J9UE 2P2LA 5CPFA 4JB2A 3NQ41 3EIHA 2NV0A 3ZJYA 1P6QA 4X90A 4I08A 4P4TA 2CNDA 2F7SA 3AY6A 4RVHA 4CMKA 3BBLA 2Q8NA 1K7YA 1ONPA 3QRWA 4OI1A 3CGWA 2G9VA 3D6TB 5A4IS 1DJQA 1RM5A 1L7OA 4OLJA 1RNLA 1C0IA 3PCRB 2I7TA 3L6BA 2PCJA 3U19A 2J0SA 1GGHA 4PX2A 4YFVA 2JAWA 4QE3A 4ZYTA 4MUJA 5FX2A 4EAAA 2QRVB 3IRUA 2BP7B 3QEOA 2O14A 2NSYA 4HS4A 3QBVA 4E14A 2ST1A 4MH0R 2J0UA 3OWHA 2AC4A 3DAOA 3VDRA 4B3BA 1Y3BE 4CQLA 2IPLA 4AQYB 2ZSBA 3VNQA 2V55B 2EJTA 3H86A 3CEMA 2JHGA 1XHLA 2B34A 2BWJA 1E7YA 3VR3D 1QAOA 1EYZA 5T4FA 2ADMA 2YQ5A 3EIEA 4JLJA 4DMCA 4HAIA 3LBFA 4GKAA 2FWAA 4Z8XA 5KX5B 2Q3FA 5JJLA 1OAOA 1ZMXA 1WCV1 3K3PA 3I04A 5FCDA 3SC3A 3SLGA 1DJOA 1LFAA 4LXUA 4MCJA 2HLHA 1M1YA 1QK3A 3EIWA 3QOXA 4XSGA 2Q3HA 1FUUA 3L4BA 2B35A 4JX9A 1FP6A 1P17A 1STOA 1XLUA 2O0LA 1BEZA 1OBOA 2PXCA 1WG8A 4K2AA 3PLAE 1IZ9A 9ATCA 1TYCA 4G0QA 3ZQ6A 3STYA 4KIWA 1GVHA 4PYIA 1SC6A 1P80A 3TIGA 5FUVA 1DQPA 1CS0B 1J25A 3U13A 1IONA 3A9UA 3JRXA 3MB8A 4FE7A 4UASA 4PGGA 4MRRA 3R9IA 4FGZA 4E5KA 3BE4A 3SR0A 3N2KB 2WSMA 3AR6A 2HHHB 3RSOA 4ER3A 5IF3A 4Z54A 1H2AS 5ALRA 3AQ4A 3F3MA 3IOYA 4Q3EA 3C3AA 1C1DA 2HMSA 2NU7B 1NW8A 3ROFA 3V7YA 4CIBA 4KQHA 5JRJA 4RHCA 1GLGA 3T3IA 4BWFB 2OHOA 3GLTA 4LVCA 5IKXA 2XDQA 3KPWA 4XIFA 1Z73A 3DFZA 1P4GA 4MA4A 1N32B 3BGWA 1QORA 4ZICA 1OLXB 1UQTA 3L0ZA 1F1JA 3ZR4B 1FBTA 1Z4IA 2F1KA 3TN7A 1P44A 3AF3A 1KPIA 3VAZA 3EY9A 1XVUA 3HR8A 3ZYZA 4F91B 1O97D 3AM1A 2RCNA 1YOBA 3K0FA 4PTZA 4B43A 1EEHA 1J2YA 2GDZA 3MAJA 4I1PA 4NSNA 2NU6A 2EZ8A 3OFSA 3VU3A 2KE5A 3B38A 1ESDA 3LT2A 4XIJA 5HK8A 2RGWA 4RGQA 2A1TS 1G1MA 3EZXA 4Z0NA 4M55A 2R44A 2I9KA 3EG9A 1UWCA 4MRMB 1U81A 2P9HA 3GP5A 4PYQA 4WZAE 4PPYA 3W5CA 1ZU5A 1CF9A 3PC6A 4Z9BA 5KTKA 1X3LA 3RSGA 2RG7A 1N5MA 1P2BA 4OP2A 1Z17A 4L28A 2R6ZA 2HA6A 4TWAA 4A82A 3NJRA 1YQEA 1NP3A 1SUEA 4OHBA 3ORRA 4N0EA 2RBGA 2W8BB 4LYYA 4WCDA 3R3UA 1V3QE 1ESMA 1Z6PA 5B12A 4XPIA 1ISMA 1T0PA 2PQMA 3BCRA 2DHCA 1M73E 4U0JA 4D80A 1WZEA 3RRNA 3GLIE 5K8UA 3P97A 4EY3A 4EQ6A 1E2GA 4BHTA 1T2FA 2WBLC 1RAAA 3HUFA 1DG1G 5EHGA 4A8HA 5REQA 5CH8A 2ZANA 3W78A 1JKJA 2BRUC 5IM5A 1V9SA 1R7RA 3VHRA 1BN6A 1M6WA 1I13A 2V97A 3Q8WA 5HW0A 2XY4A 1KEKA 1TZBA 3F4LA 4X6UA 1REQA 1BD4A 2YQZA 2Q1UA 3WYBA 4CKBA 4B3SB 3ZVRA 2RHDA 4O08A 4G1UC 1LV8A 3PUWA 4I4CA 3LGAA 3D0OA 3MGBA 2PGJA 4LK2A 1JJ7A 1ZM7A 3VHXB 5I7HA 1YSCA 1P7WA 2F6RA 1D07A 2FX5A 3KJIA 4J0CA 3R7SA 2YMLA 1HURA 2XUPA 3BVPA 2O0HA 1JLHA 3K8OE 4R01A 4RIIA 1ZZGA 4BNDB 4MP8A 2H1CA 3OIUA 1O94A 2P8SA 4N0PA 4RIFA 3RG2A 3P32A 4YCSA 4YRBA 3QE9Y 4Q24A 1UM9A 2ACVA 2C82A 2HGZA 1KI8A 3F49S 4TLAA 3I73A 2RAVA 4TWBA 2X0FA 3S1LA 3X44A 2G7ZA 4OXQA 4E33A 1KKLA 4F4UA 1YMVA 2P2SA 5C8VA 3WJAA 1C7JA 1KMHB 3MOSA 1NP6A 4CIAA 2X8LA 3DBLA 4IIVA 3ONWA 2GPWA 5AUOB 4XLZA 1D1PA 1GPYA 3R3SA 1EZ4A 5TMPA 1LW6E 2K2WA 1KQPA 5LJIA 3N2YA 1JI3A 1KEZA 4MHOA 4BJ5A 2ASEA 2ID7A 4M7RA 1UK8A 2VHQA 4QG3A 3EVGA 4GR9A 4OU4A 3NHPA 1SKYB 1DKQA 3LVQE 4J7XA 4NYIR 5JS7A 5HRUA 1NXPA 1Y5NA 1DUSA 1XRMA 3COSA 1ML3A 1USGA 2GLTA 2F43A 2C9CA 3CSDA 3EAGA 3O2JA 1CUDA 3W5SA 3ZIUA 5BOSA 4OU5A 3EQ8A 4CMJA 5K0GA 1OFHA 4HAZA 3L6CA 2XUHA 1D7OA 3OQIB 1XRQA 1SUSA 1H0HA 3DQPA 1U1EA 4QQ8A 1I7PA 3SIXA 3X2SA 2WJIA 4GKJB 5FNZA 4KDCA 3TX6A 4YBRA 2VYVD 3VSCA 1C30B 1P2SA 1II0A 4BVJA 1QVWA 4JH0A 2H0AA 3CR8A 3ANTA 3LBIA 3N2EA 4GGMX 3LX4A 5FLKA 4B74A 3TTYA 2GTIA 5K3OA 1WXIA 3BRWA 2QQGA 2Z95A 3NIDB 2YFKA 4NKRA 4M1EA 4QYIB 2MYTA 1QM5A 4YCDA 3S4YA 1JFTA 4JAVC 3QW4B 2AOUB 5TQ2B 1FXUA 3R5SA 2XT9A 2VPZA 2HJVA 4JUDX 4A6PA 3KE9A 4BNFA 2E4WA 2QMZA 2JFNA 2ZB4A 3G5UA 3TLJA 2LXNA 2YXNA 5AOAA 4ZN6A 5K20A 1ZRMA 2FPRA 4KUEA 2PLRA 2SKCA 2HH9A 1GPNA 3TEFA 4BRWA 1Q50A 3A25A 4CKZA 1O4WA 1T4CB 3PICA 5EYPB 4O8ZA 3KE8A 4RAQA 1V1RB 3B6EA 3EZ6A 2AH5A 4WZBE 1DIRA 4NAUA 1D9XA 2RAFA 5G0VA 3WLMA 1U9ZA 3AX6A 1O0CA 3B5EA 3GWZA 4G4SO 2HLDD 1FTWA 4GLBA 1USIA 5AK0A 3TOXA 4OLAA 3OCUA 1U63A 3RQSA 3IT1A 3D7KA 5NULA 5D5HA 3LY5A 5IDWA 1E7RA 4LZLA 2NZVG 4N9WA 4OXIA 1CX9B 2Y68A 4KR2A 1Z5UA 3PF9A 3JYLA 1G18A 3LP6A 1UAGA 1I0LA 1ULZA 1TVEA 1IXYA 2Z6QA 1AK9A 2REQA 1U8UA 5AM4A 5EPUA 5JMTA 1B26A 1XD2B 4LF4B 2OWEA 3MWEA 2QPTA 2YJNA 3LWBA 1SHJA 2ARKA 1NVVQ 4CF7A 2Q6VA 3PITA 4LDNA 3A1VA 4B6OA 2FP4A 5AQEA 5FPPA 1YR7A 4MWSA 3CLUC 3MCAA 4HGPA 5J2TB 3T8YA 3UMYA 3ZXUB 4AUNA 2FSFA 5BVHA 3MD0A 3IEKA 3AILA 2G3YA 3E1GA 4F8JA 1H3NA 3UQZA 1X1AA 2C42A 4HB3A 1GWNA 1IQPA 3AVWA 4URZR 4UVDA 5BPHA 5LLTA 1QCDA 1TT5A 3JAWA 4DR4B 3KLNA 3MXTA 4P53A 2RH5A 3NKFA 1GRQA 4Q7MB 4MWTA 2QDXA 2B0JA 3E7WA 4GOOD 3C6YA 3L7NA 4MYDA 2VDWB 4JNCA 4LDAA 2H1IA 3BGVA 1ZVKA 3G6WA 1PO7A 2J3DA 4IV8A 3UHJA 3ZGXA 4AJKA 4D4HA 4GXNA 2GESA 3AI2A 5D86A 9LDBA 2HMVA 2GM9A 4R3WA 2LGJA 1UXHA 1KERA 4NV1A 2ACKA 2JGLA 4EB0A 1DQSA 1CRWG 2PNFA 4D4JA 3GCDA 1LLQA 1GG9A 2LZ0A 2V96A 3H2IA 3MERA 1RVV1 3PSAA 1KMQA 4HF7A 4K6CA 3SD7A 4BQEA 3AFIA 4TPKA 3PGJA 1EUDA 3KKEA 4S1PA 3V8EA 3L0DA 3DE5X 2DKNA 2OV8A 3VUEA 3HVHA 4BB9A 2O2JA 3BH7A 4J91A 4P22A 5DI9A 3WY9A 3DEIA 1HL3A 3ND5A 1FMLA 1NZDA 5AJVB 3H0KA 5E1MA 5A03A 4B31A 1IJFA 1M6VA 1YZQA 1SFRA 3G5AA 1CUZA 3ONNA 5CDFE 4LF5B 3THYA 4O4JF 4GBED 2OK7A 3AGPA 5DRTA 4DM3A 2CB0A 1UFVA 1XQYA 5CUQA 3FPEA 3ZHXA 1NE7A 3M81A 3OBIA 3R3VA 1P3DA 4G23A 4M1TA 4N7JA 1AJEA 4G1MB 2Y9YA 1LTKA 4GE3A 3AHFA 4HDSA 3ZCXA 4RANA 2VDRB 3CRMA 3OKFA 2PKQO 3JWHA 3AU8A 5FIUA 2OPHA 4MAAA 1K0UA 3UXYA 2QIPA 3EDRA 2FGKA 4OXNA 3FWZA 3OQHA 1U7UA 4NFYA 1RI5A 2A1UA 2FFJA 3FFWA 4L8WB 2XZPA 2G36A 3FMOB 4MKRA 3QBTA 4XQCA 1KY5A 3SFTA 4BASA 3A9WA 1RTKA 2RHGB 1G7RA 2EX1A 3BERA 3D6HA 2YWBA 3QX9A 3QX8A 4LZZA 4B87A 1ISJA 1X1CA 4QARA 5KHAA 1QHGA 3EASA 2AFIA 3COWA 1F5SA 3SGLA 1ADYA 1TEHA 2OFFA 1HZZA 4A26A 2O1SA 4AQ7A 2AJCA 2E3JA 4HPJB 1GTL1 2HOQA 5C0OE 1EXMA 2QTCA 4D46A 1DC5A 2ZITA 1QGYA 5ALOA 3URMA 3WGKA 4DC9A 4R9VA 2X4LA 1JE0A 4YXWA 3GCXA 3NI2A 2MHCA 4CN9A 2P2NA 2LPMA 3HKBB 4IDAA 1D4FA 2QORA 1ZNXA 1R0LA 1ZQ1A 2X3UA 3UJDA 2QX6A 4R1LA 3KHTA 1JU4A 2HWKA 5EWMA 3JS5A 4HI0E 4KNVA 3TQCA 4D25A 1RZ3A 3PWTA 1GAWA 2F9MA 4PQYA 3RVRA 1FLNA 4ZPXA 3TQFA 3V46A 3R20A 2XTZA 5J59A 4PBTA 2FTKE 2QZPA 5NLLA 2R97A 5KMGA 1N75A 5ARCA 3ZU6A 1C7ZA 3OKAA 3U37A 5JYCA 2R7AA 5HS6A 1KQFA 3PVSA 2C4NA 5HF6A 2H4FA 4P86A 4MUIA 1XAJA 2YFYA 2WKPA 3IQFA 1MB0A 1HOTA 3OT1A 2OV6A 4OXXA 1TB4A 4MS1A 1J2TA 3OX3A 4IICA 3TS1A 1C9YA 3VH4A 4HZIA 3KQQA 4V2IA 3AUTA 4G01B 4PINA 4JEUA 4PG5A 2CLKB 3FOZA 1VJDA 2VZ9A 3HFRA 3Q2OA 4KH1A 1YJCA 3PJEA 3HA3A 1RU3A 1PDVA 4HN2A 1K7CA 4JA2A 1QQ5A 3F7TA 4QXOA 3ZZ0A 2PD3A 3U4QA 5MGBA 4YI3A 1YR2A 4ITUA 3ROKA 3GYBA 2GK3A 3MUFA 3RBZA 4DA6A 3Q2KA 1R4NA 1W5FA 1G59A 5BT8A 3TRFA 4HLQB 5ALSA 3DDCA 1NWHA 4RIHA 1F0NA 1UJNA 4TUYF 1C9MA 2FVXA 1OLOA 1Z07A 3HVIA 2GN8A 5KYNA 3P0EA 4XDZA 1PF7E 1DWUA 2CLMB 3AHHA 2WWTA 2DUMA 4LX0A 4MV7A 5LBIA 4CUJA 5HOQA 3ECSA 3HKCA 5CDYA 3M82A 4JL6A 4WBXC 2HNBA 4QU0A 1WUJS 1W4LA 5AVUA 4U6NA 1TAQA 1R50A 4QXMA 2JHPA 5A6SB 5IEBA 1P18A 1BFDA 1E7QA 1UJ5A 4LYEA 1NJ1A 2CMGA 4RPIA 5HG0A 1YDGA 1CETA 4IHQA 1QHFA 3HY4A 1RQGA 3MYYA 4KO3S 3T06B 1QHHA 1WOMA 1BCSB 4TKMA 5L7YA 3FN4A 1OREA 2VZ8A 4BCCA 2C04A 5JSKA 4EGJA 4HRVA 2VP0A 1J9EA 3WWPA 2EKBA 3U0BA 3HSYA 2ZWOA 4TLBA 4CKCA 2ZB3A 2YWXA 5TSDA 4P7JA 2XZDA 3K8ZA 4OYLA 4JSYA 1EUYA 4W5JA 3V3KA 4F5WA 4PY2A 2YVLA 4H7IA 2A0FA 2PUFA 1G5FA 4REQA 1U7DA 1DFIA 3HCBA 2F8SA 2HYIC 2IX9A 1A2OA 3ICCA 1BJKA 1CUHA 4C6RA 1TJPB 4QA9A 1AUVA 5F76A 1AMUA 5J5CA 5E0KB 3SBDA 4O59O 5A4DA 3UMRA 3TNLA 4CV3A 3IUJA 3MT7A 4Q7LA 3N2ZB 3R7LA 2NO0A 3MOIA 4R9RA 4F5YA 3HC7A 2GEKA 4C03A 1LV7A 1O03A 3AF5A 1HWYA 1X0VA 1ZH4A 2QW0X 4AWAA 3AMVA 4XFKA 3H2ZA 5DCWA 4BECA 4JCCA 3VO1A 1CNMA 2PQ0A 3JYHA 4G0OA 5SV2A 1ESCA 4OP1A 4P34A 4WXPA 5CK4A 4MLZA 4YHBA 2V9ZA 2FEMA 3IB6A 2ISSD 3JQAD 4I66A 3MEQA 4NECA 4PVDA 3EG5A 3HQ4O 4GZ5A 3W5VA 4IOMA 2VKTA 4MB0A 3UAVA 3EC2A 2D0IA 3T5TA 5KDDA 3O4JA 4YFYA 4XGRA 2AOTA 3ENNA 3A2NA 3EJWA 4KO2S 3HDHA 2P77A 1VSUA 3MB5A 4PZDA 2JBAA 3GFTA 2R7NA 3KKKA 3QKIA 3JAMA 3QNUA 2AI2A 3GGSA 3EUWA 3TOSA 3VRHA 3KYCB 4ZQFA 2C94A 2D7DA 2FXIA 4ZGWA 1G8MA 1KEVA 2HKIA 4MVJA 2DH6A 2HO4A 5B3AA 4AVYA 3WISA 1KIFA 3W3AA 4EG8A 3A6PC 5L45A 4QPZA 4D0SA 3PQ5A 5HEKA 4FW9A 1Q0QA 4DPKA 3NAGA 2BGKA 2ZRJA 2RMKA 1C1YA 5I9BA 2O9JA 1SC4A 1SD2A 3NGMA 4X1YA 1Z83A 2BC9A 5GPBA 4YAWA 5CX1A 1A8QA 4XDYA 5D5QA 1RM4A 2BFBA 3R7AA 4XVUA 1GUFA 2I4TA 3NYQA 3WWZA 2DECA 1BZYA 3L1UA 2ZJ2A 3RRZA 2V7PA 1CZUA 4ALKA 3R8XA 4ID9A 4OOFA 1Z25A 4KJXA 1NONA 7GPBA 2XUDA 1CE8B 2C9MA 3U7IA 3ONVA 5T4EA 2R6R1 2IBMA 1QAMA 2GDJA 1CP3A 3QPAA 3RTAA 1CUBA 2ODNA 2IW1A 4B09A 1MDBA 2DWUA 2MDTA 2NPIA 3O84A 4U7GA 4M83A 1LPNA 3X1WA 3PUKA 4KO4S 3TUJC 4BEVA 2IODA 1ZGJA 3AF1A 4R7GA 2XLCA 4FR2A 3EJ6A 1EFHA 1V39A 4JP2A 4KWHA 1PYDA 5DYTA 1W9MA 2VAMA 1NZFA 1ONOA 1AUPA 1YDMA 1KIAA 2IQ5A 5JTTA 2WWHA 1WUIS 4IDQA 4A4DA 5JXJA 3HBMA 3K1YA 5C8YF 4AZ3B 2IYXA 3OZWA 1VG0B 4RDCA 1AOXA 2P27A 3NHAA 4YRMA 2Z6UA 1CUXA 1QF7A 2FWMX 3QY9A 4MYTA 4WBNF 1M2OB 3BD7A 3L7OA 3ROZA 1UJBA 4GLLA 5HMLA 1AK1A 1KAEA 3OMLA 4KRYA 2ZJ6A 5BN4A 2QAGC 5A62A 4F04A 2UYQA 3PEVA 1WULS 4DJDC 1ZR2A 2O5EA 2OD7A 4PX5A 3O4IA 4DWWA 2ZUDA 5H82A 3D6AA 3NOQA 4EP1A 3IOEA 1DUIA 4INAA 2C78A 1CJCA 4V1CA 3CF6R 5BN3A 1MJ5A 3CH5A 3JSXA 1JLKA 1VL0A 4INPA 4FEAA 1VPTA 2QTWB 2R6FA 1YS1X 5FV4A 1E0SA 5K8VA 1G3QA 3KYBA 3K5HA 2FVYA 3EQ2A 3ZDQA 1EA5A 3MWJA 1LQUA 2EKLA 3L06A 1ZLXA 4GUAA 3KM0A 3OY7A 5KTOA 2HBRA 2XF8A 1W47A 5K4GA 5C52B 4ND4A 2G8NA 5BQOA 5T6MA 5IJ9A 2C7VA 4EHHA 4G56A 1APBA 4Z6KA 4HWTA 1CQJA 1FNSA 4QPNA 1XLVA 4L4SA 1OROA 4UOZA 4TTQA 1MIOA 1R9GA 3F97A 3IP8A 3SYNA 1UM8A 4KRXA 2IXFA 4YV7A 1KR2A 4OP3A 1QBGA 1JDPA 4RLQA 4UAGA 3T9EA 4XRGA 5BR8B 4KDFA 1M72A 1IB0A 1JYEA 1WV1A 3L7JA 4OGKA 2C7RA 3AF4A 5EL0A 1YHYA 1GL3A 1Q5PA 2JCBA 3ZDBA 1A9OA 2Q1SA 4YJHA 1VYUA 4U2EA 3C7TA 4BE4A 5LSAA 2XKJE 3SR4A 2Y0DA 1XAHA 1TGYA 3B7WA 3WP0A 1MHTA 4JB8A 2H3HA 5DBOA 2J4CA 3PDWA 2DC1A 3RRBA 1AA6A 4AO8A 4FEYA 2EC5A 1NLMA 1SBQA 1U02A 2YUIA 3AWDA 3P0JA 3PZRA 2IU3A 5EJEA 4NY1A 1EXDA 2PZLA 3FBGA 4JR0A 5AW9A 2Q7OE 4C7VA 1TIKA 3TGLA 3KJQA 3AP1A 4N82A 3SKXA 5GWXA 1W88B 3T5BA 4MRNA 1Z08A 4ER5A 4X8OA 2UZ4A 4JL8A 2ZIGA 1CKEA 2ZSJA 2DQSA 3HDQA 1IEQA 3ETNA 3UICA 2LD4A 1MEOA 1T91A 1NBAA 2GS9A 5BNZA 1ZGCA 4K5QA 5LB2A 1SUIA 2NUBA 1DWQA 1PG5A 4JZYA 1KI6B 5KNDA 2OPBA 2YXBA 5I4IA 3SFVA 1VQ1A 1JFLA 2NADA 2YHIA 3ICWA 5AKZA 3IH5A 4HP8A 4MQEA 2XITA 3A32A 2FN3A 4PO3X 1DC8A 1EH5A 3ECCA 3RVKA 1H8HA 3VGPA 5LMCA 2WWXA 2XXAA 1NC3A 3U3DA 1H5NA 1ZM3A 4G5YA 1CYDA 1VMIA 2EGHA 3B89A 3ZE1B 3WAJA 4JU8A 4K1XA 4W9RA 1P9RA 4TV8B 1CUAA 4EYSA 3E3OA 4NIMA 5HUJA 2FI1A 3COJA 4JFRA 4NYIQ 2O6HA 1KU6A 2H4HA 3CS3A 1EGVB 4ZVPA 2GHQA 2UYYA 1DIOB 1CUWA 1PT8A 2ZBDA 3LBNA 3MJSA 4PBRA 5EE1A 3SS7X 4DDHA 2DH5A 3IDOA 1DTSA 4FK8A 4FLFA 1UFQA 2G9RA 1NVXQ 2WPDD 4CLRA 5LKAA 2NP6A 1Y37A 1E8MA 4XWOA 5LDHA 1KF0A 2Q5QA 3U7RA 2W2KA 5A4MS 4G85A 2I3ZA 1QC5A 4DVJA 2DT5A 4FDVA 3MTGA 1PS8A 4GG1A 2WF8A 3SF8B 3RE1A 5KSPA 1JECA 5EP3A 4RTMA 4L22A 2XYVA 2A4MA 1Z45A 4LOAA 4HNTA 1E1CB 3LA6A 4CM5A 5F7XA 4G1CA 1SHTX 1JV2B 1QVZA 5BWNA 1H4SA 1CRPA 3K0AA 1E98A 4H9GA 3DQZA 1MX3A 1NOJA 3QE3A 4A0GA 3DZBA 4MR7A 2IK8A 3CJQA 2G5PA 3DMPA 4F8YA 3FUTA 5JXGA 2OC9A 2PS9A 2Z8ZA 3GQBA 4JV5B 3TPCA 1VPDA 4I55B 5JU6A 3ZWDA 1U8ZA 3M6XA 4PFJA 1EFVA 4BQOA 1E61A 2ISCA 3CNHA 4NMXB 3KSMA 2JZOA 3G89A 4OHYA 3EWNA 4DXDA 4CLEA 3A6LA 1P2VA 3ILYA 1UKZA 2PQ6A 2BMDA 4JWKA 5DM1A 5F77A 2ZSKA 5A5DA 2EAUA 5KNBH 1EGQA 2GJ9A 1YS9A 5A9RA 3IVGA 2HO5A 4BV9A 4NF2A 4RY8A 4EJSB 3IVMA 2HK6A 3PQCA 3CC8A 4RYLA 1BQ4A 4UULA 4LDRA 1XEFA 1PV4A 2V3VA 2BI4A 3FNIA 2D4AA 2ZR8A 1RAFA 2DP4E 3RHTA 3TIXB 2C54A 4MV8A 4QKQA 4Z4EA 2ECFA 1C0EA 1INLA 3NKVA 2A0UA 4KAAA 1QH8B 4NICA 5ARDA 3MTAA 5DM2A 3RAJA 1XNJA 3RT9A 5BQ3A 4KR6A 4ODIA 1HO3A 4EG3A 2QZJA 3AUJB 3HB4X 3HWSA 2XNKA 3SFZA 5HX7A 1CG6A 4FOTA 4X6YA 3KB8A 4WFQA 1WSDA 2JGMA 4QYTA 1XEXA 4B7UA 4K26A 4BB0A 4DQLA 3T4UA 4IDHA 3UG6A 4YV2A 1JL3A 1ZESA 1Z6YA 2R7LA 2YJGA 1O1YA 2RB4A 1NP7A 4GFDA 4LKRA 1CQIA 1H1DA 1RRVA 3NRCA 4P2GA 2AC7A 4IHAA 4AW9A 4F4IA 4ZVOA 1PKEA 1VYTA 1I6LA 2JAPA 5E9WA 5K05A 4BX3A 1KQ3A 1ZC3A 4KMRA 1XA3A 2JEYA 1GKYA 1XALA 1E2QA 3SNKA 4FFWA 1KXJA 1MW9X 3B8HA 3OE1A 5DN6A 2VUUA 1K8QA 4WINA 4BTLA 4CYMA 3SF0A 4OIMA 3WQBA 4RZ3A 1UWVA 3A10A 1KEEB 1F4LA 3FM9A 1VJCA 2YW2A 4BIMA 2LCQA 4OYHA 3M33A 2IWHA 5B64A 5JD3A 1KGDA 4JUAA 4Y3UA 4RU1A 4ALIA 2WHRA 3H17A 5KQMA 3TF5A 1JR3E 1JT2A 2C9DA 4EYEA 4KAFA 4JJ4A 2D6FA 1S3IA 4UE6A 2DCMA 1IBKB 1EZ1A 1XHEA 1L7QA 1H42A 3ML1A 3DLIA 1HTWA 5LMUB 3K70C 3FRHA 5A6VA 5ELXA 2IEIA 1RJGA 4AJLA 4FYIA 4ZJZA 3V3TA 5BSKA 3BL6A 1DKUA 1Z4KA 4PF1A 4BS9A 3ABIA 5J63A 2BONA 3R6TA 1F1BA 3C8UA 1RBMA 3DOFA 3D8UA 5EY5B 2NX2A 2WLTA 1G8YA 1TZ2A 1XTZA 3K9CA 4MA5A 1KTIA 5K0SA 3I2FA 2J9FA 4FNGA 1EK0A 4RD2A 4BRSA 1AV7A 5I7FA 1Y3HA 1JEAA 2N9UA 2ZR9A 4R40A 4XGQA 5I7AA 3K31A 4LRXA 3EIOA 4URYR 1RJ9B 4R98A 4ZVUA 1QB7A 3B48A 3GEHA 2HF7A 1FDRA 2C4MA 2RGUA 4FYKA 3N3AC 3S3TA 5LQRA 3S2GA 4NX2A 4IWYA 1TAUA 5JFTA 5JNVA 1EG7A 1K5DA 3ZTTA 2G4VA 1YZFA 3P5SA 1M2FA 1KSGA 4F6LA 5EG5A 2G1PA 1KI9A 1N0UA 4U2DA 5ILQA 3L79A 1J0CA 4IZHA 1EHIA 2ET6A 3ZCSA 3RIXA 3HPQA 5F1KA 2XUZA 3ZWNA 5IVDA 1AGNA 1WXFA 4UVHA 4JP8A 1L5HB 1TMOA 5SZJA 3WB0A 5U9CA 1O3YA 2R4TA 1DXOA 4DV4B 1GPMA 2JFHA 5EP1A 1XYYA 4JLWA 2YIMA 1W581 1ODCA 3AEYA 3FUWA 3ORYA 3PC8A 2DBVO 2PLFA 4FFDA 2HY7A 4EZEA 2WF9A 4MZXA 1YH3A 1XZCA 2IUYA 4MDHA 3M6VA 2HIAA 5IYZF 2YWFA 2DKOA 5MN5A 2EYUA 3GOQA 4PO1A 2A5LA 3IAFA 3MJTA 6ADHA 3SSMA 3PEFA 1IQRA 3T7DA 3D4IA 3C8DA 2Y1LA 4KRGA 1DELA 2I3BA 3L2OB 4JEHA 4CPDA 3H11B 3PQEA 2JGKA 1WMSA 4HB0A 5HQJA 2WA2A 5THXA 2KMLA 3MRSA 1W5EA 3EVTA 2AXPA 1DC7A 2WTXA 4QDKA 5HDQA 3RCBA 4QJIA 5DNYB 1TRHA 2VHEA 4IJUA 4C76A 1HDZA 2H16A 5AI9A 5LCXA 2AE2A 4KV7A 3Q0TA 1TLFA 1FEZA 2PV7A 4Z0PA 3RBXA 3UK2A 3JCZA 1M5TA 2HA3A 1EBUA 5KWEA 1J2JA 1N5OX 4U7PB 2C61A 2Y76A 4ZVNA 5FI1B 3DEJA 3V6LA 4TLEA 3TLCA 2HI0A 1FRNA 1SR8A 2IYWA 2OMKA 2CL5A 4X54A 2JKYA 1Z35A 2C59A 3SVTA 4GF5A 4QATA 4W1QA 3C4QA 3ISVA 1GU1A 3M8KA 2CEKA 3OUTA 1VYHA 1I4OA 4DRZA 1VLZA 3UB4A 1VA5A 3F67A 4UUBA 5C8YB 5I9NA 1U9IC 5T8KA 1PJZA 3SIPA 1QFZA 5EZYA 3STTA 2ZAGA 4NPHA 1DAGA 1S7GA 2JATA 1CR1A 4DR2B 1CIJA 2I5PO 3FPFA 4YMSA 4W5NA 5F35A 5THQA 2IHVA 3UWDA 3W5HA 5EWLA 5C8DA 3D2CA 4ED9A 3G1UA 3TZQA 8AT1A 3ENVA 4DY6A 2VHWA 3FPLA 2A9KA 2VR1A 3IILA 4MUAA 1NSTA 3NBQA 5EIBC 2C2BA 3ZE7A 3O6VA 2FUEA 3GEMA 3NWEA 1I33A 4QRHA 1KARA 1TZKA 2PBLA 1W19A 4H4DA 5LA6B 1YE5A 3EBLA 3PNPA 3KELA 1V16B 2VNKA 1NLZA 4NYJR 3QYFA 1C7IA 2XEXA 5F1PA 2C4KA 2QZ4A 1PEAA 4C43A 1LBHA 4Q16A 1N2JA 2QA5A 3U6KA 2NV2B 1DIGA 3K1TA 5FOWA 2R25B 3IEMA 3ZIDA 3E9ZA 4OBEA 4ASUD 1RP7A 1Z36A 3ZU5A 5FBVB 4C4YA 3HXKA 3B51X 1K7EB 5C32A 1MXFA 1JEQB 4OB8A 3R0XA 1KSJA 1MPTA 5DXFA 3WJ7A 5JAUA 2XMBA 4JXZA 2ZS8A 3QV2A 2FFAA 1ILWA 4MGYR 1NI4B 3GLKA 3ZEAA 2OGSA 1W96A 5B1HA 2V9PA 1CERA 2YS6A 3I72A 2JKVA 1YUBA 1ZVQA 4M2LA 1JBEA 1V8PA 2PUJA 5EN4A 4Y7DA 3NCHA 3N2GB 5ALGA 2C3UA 4HWRA 1W34A 2IU4A 2GF0A 3TLZA 1HC7A 4GPIB 5C1OA 2ZYTX 1PBTA 1YOVB 3JTMA 1SH7A 1KDTA 3VR0A 4CEJA 4KIGA 4Q1BA 4XLTA 4TS3A 2VRWA 3E7DA 1MRNA 4NU0A 3A9VA 4HGZA 2ES4A 1OXMA 2VF5X 3CZRA 5ALJA 3ZKWA 1HDOA 1JXOA 1YBFA 1ZL2A 2W2OA 2Y2UA 3NBZC 1TADA 5T3YA 3BWYA 2O4CA 2BR4A 2QW8A 1XYVA 2EW8A 3GP8A 2A1IA 2F4VB 1ACJA 1AHIA 1M7BA 2BH9A 2QXUA 3PUXA 4L76A 1RACA 4LGVA 1PSZA 3F6YA 3PD7A 4UM9D 3W04A 1BOOA 1CRQA 3B1ZA 1TYEB 1TKBA 4GM0A 3V4FA 2G9UA 4B34A 3AHCA 1ZYUA 3H99A 4IJWA 1Z2EA 1OU0A 1A4UA 2MR5A 1N7JA 2QXYA 3EPJA 4F7WA 4OJMX 1SG9A 4Q4AA 3OU6A 4LI3X 3NW9A 2P9TA 1Q92A 4H7DA 4UM8B 1N4AA 4RFSB 2WFMA 2ZI3A 2WOJA 4B4UA 3D2AA 5EJFA 2JEZA 1MG5A 1OIWA 1U5BA 4MUNA 5DIZA 2BIFA 1P19A 1ZNYA 3PDIA 3AFHA 3UT0A 2OUKA 4Z4GA 1YRQA 2VHXA 3NYWA 5JVDA 3I2IA 3V1MA 4BKUA 4YP6A 2Y0BA 3HS3A 4BVBA 4B3TB 5UKDA 3EHDA 5BMOA 2OBLA 4I6GA 5G41A 4Q4HB 1F3OA 1T6XA 5C9ZA 3H5AA 5M5BA 1VPVA 3C3PA 2C57A 1XOIA 2PY6A 5TY0A 3BWDD 2PKQP 3WGQA 5KTSA 1KY2A 1Y81A 3I9FA 1P60A 1EWTA 1S4QA 2UZIR 4TTRA 4CF4A 2CF5A 3M6UA 3SC2A 1MRZA 2NAFA 2ZSIA 1AGPA 3IAXA 4YRPA 4V24A 2J0UB 4CQLB 2WB4A 2Q8QA 1PK7A 1LH0A 1X80A 4EA8A 4ND6A 1LBEA 2P4QA 4JJ6A 3MCTA 4PFSA 4QFBA 1QP8A 1HH4A 1ZMTA 2HA7A 2POQX 4PN7A 4DRXA 3PJFA 1USWA 3I6ZA 3BJMA 3H65A 1QFSA 3EUAA 2EFCB 2J7PD 5EEHA 4EHIA 3RV3A 4D4GA 5KJFA 1UC5B 4X85A 2GETA 2BMFA 3OPMA 3ZC3A 4UAVA 2V8BA 2X77A 3RI3A 5K8TA 1XMSA 4LYFA 5TGTA 1DV2A 1K5PA 3R1IA 3KXIA 4PGMA 4A0RA 1Z0UA 3WJ1A 4NPCA 1EM8A 1A27A 1CQPA 1WSAA 3NEPX 3X1DA 3I39X 1LC0A 3P2KA 1F9EA 3MGKA 4IOKA 1TM7E 3M3HA 3AXSA 4GHWA 3MWDA 1PLJA 3VAAA 4BO3A 1JQKA 4JXXA 2VWGA 3IKJA 1ZGAA 3TLGA 1L5WA 4OQDA 1NYQA 1CJKC 2O3TA 1K86A 5G0UA 1UIMA 3QOYA 4JBHA 1H66A 1NRWA 1YRLA 1K6JA 2R8RA 1U1IA 1X7DA 1EE9A 3BCUA 3DMFA 5EZQA 5JDCC 3ZOKA 2CVFA 1IIRA 2YN0A 1NE2A 1RRMA 1S2LA 3NKLA 4LJLA 3J81A 4KL8S 3IAM6 2FPXA 2ABWA 1JFFB 3FIJA 4B3IA 2DQ4A 3Q6NA 4JNKA 5TE9A 3FOEC 4Z4FA 1Q6ZA 1BRMA 4ALMA 3GLGB 4RXTA 1YB6A 4ITRC 3JV7A 1UQUA 5EXXA 4CMHA 2X8BA 5IXJA 3WL7A 1F3LA 3UWKA 3N0TA 5D8DA 5CB0A 4OKIA 5BWBA 2O06A 1WZ2A 1KYTA 2OHHA 5CW1A 1ZH2A 5JD6A 1XDSA 2BMJA 1E4VA 1UBGA 5FP0A 9ABPA 2VDPB 1X1SA 4MV1A 3OEYA 3PB3A 3D81A 3K0FB 4Q34A 3V9AA 5TIIA 2QTZA 3WTBA 4GX2A 4UPEA 1B3BA 1C50A 1TTHA 2NU6B 2VXCA 3E81A 4EBFA 2XYPA 4H6WA 4MNTA 2R1ZA