4J0EA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
296
structure length
296
Chain Sequence
MFTAKCAMQNIRNVAIVGSGQMGSGIAQVTASSGFNVMLADVNKKALDRAMKAISQSVTHLSKKQKGTDKEKSDFVTLTMSRIKTCNNVSTAVADADLIIEAAIENIDLKRGIFAQIEQSCKKDSILTTNTSSFLLEDVAKGLQDKTRFGGLHFFNPVPVMKLLEVIRSDDTSDETYATLIKFGTAVGKTTVACKDSPGFIVNRLLIPYFFEAARMYERGDASMTDIDEAMKLGAGHPMGPFELADYIGLDTVKFVMDGWAAKYPEVQLFEASPLVDKLVAEGKLGRKTGDGFYSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1
publication title Purification, crystallization and preliminary crystallographic analysis of 3-hydroxyacyl-CoA dehydrogenase from Caenorhabditis elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 118
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4j0eA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j0eA01
1A4UA 4R51A 4FFMA 2YFQA 5F5NA 1XU7A 2FRDA 3EUWA 3VC7A 2VUUA 1C0PA 3AI3A 4A2CA 1MV8A 4CMIA 1DFIA 4GVXA 3MOGA 3JQBC 5L7WA 3VKUA 4KWHA 3C7CB 3ADOA 1JA9A 4M87A 4FPXA 1YB4A 4IY1A 3VZRA 4OMUA 3JD2A 3L4BC 4AL4A 2ZB7A 3DBRB 4NU5A 1BG6A 4C7JA 2NU6A 5CDGA 3N58A 4GL4A 1VLLA 1ADCA 5F21A 2EF1A 3FPLA 4J4HA 4OO3A 1WWKA 2Q1TA 2P68A 2CVQA 1HWYA 5KNLA 3DMYA 1I0ZA 3R1IA 3RUCA 1HZJA 1CERA 5LCXA 1B16A 5U4QA 5LDHA 3K8ZA 3FNGA 1XQ6A 1C0KA 1LEHA 4M49A 2E48A 2H9IA 1ZH8A 2DFVA 3U5TA 3C85A 4AJ4A 3QWHA 2LDBA 1RJWA 3C1TA 3HNPA 2YFHA 3JQ7A 2G17A 1YO6A 4D3FA 1LDNA 1QYCA 3OJOA 5G4KB 3CZMA 3BHJA 5K6AA 3GHYA 4D79A 2VZ0A 5BT9A 4CM7A 4RGBA 1B2LA 1LRLA 4J1NA 1MA0A 2YHIA 2JCXA 1IHXA 1KVTA 1YXMA 5KKAA 3CXRA 2P5YA 1X13A 3ZNPA 1KIFA 2NVBA 2Y05A 2UV8A 4IBOA 2CDCA 1TA4A 3UAGA 1V3UA 1GQQA 1SC6A 3E6AA 2WMDA 5KJ1A 1AUPA 2Y66A 3Q9UA 1KVUA 2EWMA 3PPIA 4EZBA 1NBOA 3AOEA 2OL4A 4IJUA 1K6IA 2FWMX 2HJSA 2D5CA 2RIRA 3GOHA 3ROPA 4DMMA 3KOUA 1S7CA 3DBLA 4IXWA 1M66A 2IYOA 2OZPA 1YH3A 2YDXA 1OI7A 2NVUA 3RASA 1YVEI 1Q0LA 1A9YA 1VSUA 2Q49A 3IKVA 5COAA 4U7WA 2PNFA 3E48A 3EW7A 2YJZA 1B15A 1Y81A 2YDYA 4NJMB 2XOXA 3BTOA 4J1SA 3S2IA 5ENVA 2O23A 1JKFA 3WNQA 4KOAA 1ZJZA 3KYCB 3HWRA 3M2TA 1DPGA 4I08A 2I9PA 4YCAA 2BKAA 1U2GA 1RWBA 1ZIDA 4CQLB 3Q9NA 1KOLA 3RBZA 3IUSA 4OXNA 4BNUA 2X9NA 2HJRA 4IZHA 3LT1A 3WMXA 5BQFA 3DQPA 2BMAA 9LDTA 4BL5A 4YJFA 2O3UA 2I76A 2X5OA 4GSLA 1VI2A 2P9EA 3DDNA 2GN4A 5IDWA 4DIFA 1KY5A 5B4VA 4PLVA 1UXJA 3GQVA 4XIYA 1B0AA 3L6OO 1E92A 3F46A 4JX8A 4BO1A 3KUXA 3ZHBA 3X2EA 2RH4A 3UICA 3ZU4A 4DC1A 1Y6JA 4BHTA 1CWUA 1YBMA 1ARZA 3KVOA 5JAIA 5EIOA 1GYQA 2DLDA 3E5RA 1JKIA 3Q3CA 4G65A 4O0LA 3WDSA 3I83A 1DB3A 1Z74A 2DQ4A 2X9VA 4DWVA 3QQPA 4UULA 4XJTA 5AQ1A 4R9SA 1GY8A 1EDOA 1EBFA 3NJ4A 4ROSA 4XB1A 1NAHA 5L40A 3RJ5A 1HDRA 4OHUA 5CEEA 2CMDA 3DMTC 3K30A 1OZAA 2NVWA 3CTVA 4G2NA 1MC4A 1R0SA 3GDFA 3VPSA 1VE9A 1WZEA 3VPXA 3JQGB 1H94A 3WYEA 1Z7EA 4BKRA 4K9DA 2P9CA 3RBVA 2E49A 2DTEA 1X0VA 5L95A 3ZHZA 4B4VA 3K9QO 1PGPA 2G0TA 5T57A 4I9HA 3E1KA 5IZCC 3JV7A 5DP2A 1PX0A 3SLKA 1IB6A 5FF9A 3QY9A 4GGOA 4YAEA 4CM6A 1Q7GA 2R00A 4R1NA 4WOJA 5ICMA 3FHLA 1T4DA 5DZSA 1LRKA 3T7EA 2AHRA 2FR8A 4BB6A 3P7MA 3JD0A 4WCFA 2HRZA 4N54A 4OGWA 5JAQA 2ZYDA 1R66A 4MKXA 5LC1A 3O4RA 5U9CA 4CV1A 2X5KO 4CM4A 8LDHA 2PZMA 3QJ5A 3ZWPA 4K6CA 5HTOA 4ZQHA 1EE9A 2PTGA 3KHUA 1EMDA 1ZNQO 1FF9A 3BMNA 5IDYA 2B4QA 4ZA2A 1Y1PA 2JAHA 4HUJA 4UUPA 4EYEA 4BO9A 2Q1WA 1R0LA 4XR4A 3S2EA 5JDIC 1GD1O 3CZRA 3WBFA 1GCUA 4IGFA 4B8WA 4FFLA 4RVHA 2B37A 4D7AA 4MVJA 5JYDA 1MG0A 4DLAA 4U8GA 1NVTA 3IL2A 3GN1A 2WTBA 3F4LA 4YJGB 5T8KA 1WMBA 4BUCA 4MKRA 3UN1A 5A1TA 2X0RA 1K5HA 1OMOA 1ISGA 4FSHA 4HX5A 4J7UA 4CJXA 4EI2A 1NNUA 5HRUA 1PIWA 1A4IA 1DC6A 2DM6A 3LQFA 4J49A 3JQ8B 4H3VA 5DDIP 4TRNA 4PRLA 1P1FA 3QVWA 4CMJA 3GZ4A 2FZEA 1ISJA 2DU8A 1ZCJA 1CDOA 2EEZA 4IDFA 1T25A 2DBQA 3F1KA 4PG7A 3ZZNA 4XQ9A 4B3IA 1MX3A 5L4LA 3BMCA 3Q2KA 4J2HA 1GL3A 2P2SA 2RHCA 2WD7A 3DTYA 3A14A 4J91A 2GZ2A 4II3A 1EVZA 4FC6A 3ZWCA 1K0UA 1ZO8A 1KC3A 3WGTA 1HSOA 2G5CA 3ZWMA 4MVJE 2DTDA 5L7YA 1VRWA 3OJEA 2VWGA 5KJEA 4XYLA 4A7PA 1BXKA 3CEAA 1I33A 3IKTA 1NQAO 1TEHA 4LISA 5L4NA 1EUZA 4OIMA 3LT4A 4IIUA 4S1VA 3KYDB 4LMRA 3AU8A 3HN2A 2EP7A 3I6IA 4JQCA 1TT7A 5KVQA 5ES3A 4M8SA 1QRRA 2E82A 5EJ2A 3W4KA 3WJ7A 2PH5A 2V6MA 3PQDA 4PLWA 3E5MA 3E8XA 4KUGA 4JJIA 1UZNA 4R4JA 3GEMA 3LF2A 2FPGA 1GU7A 3RU9A 3OBBA 1EQUA 1Z6ZA 1WW8A 3PDJA 4O59O 5HA5A 4IM7A 3NT2A 3TQHA 4RPJA 3TWOA 8ADHA 1FK8A 2PD3A 1E7SA 3M6IA 1HZZA 2Q46A 3GPDG 2JD2A 1HDCA 3K96A 5DOVA 4FBGA 2CDBA 4RLSA 5DBIA 1O9BA 1PZFA 4CL8A 1AGNA 2CD9A 3R6DA 3OICA 4GKVA 2QZ9A 3GR6A 2VN8A 1PJLA 4ITUA 4O63O 3RC9A 1GR0A 4ZJUA 3DR3A 1A9ZA 1Y8RA 4MVJD 1E0DA 2VT3A 4YACA 4CQMD 4NFSA 1Y5MA 2EG9A 1NPYA 4PZCA 3PHGA 4L8VA 4ALLA 3DC2A 2NV6A 1QYWA 3M1AA 4OJNA 1YKFA 3QVSA 3B70A 4AJJA 4IQGA 4KMSA 3ZV6A 2I66A 4FGWA 1VC2A 4D44A 1F14A 2O2SA 1YL5A 1VKOA 5JSFA 4CLEA 2FOIA 3AJRA 2VYNA 3OEYA 2B4TO 4PRKA 3DZGA 4RVDA 3F47A 4FJ1A 5U1PA 3GFBA 3KSDO 1IHYA 4RQTA 3WYCA 1GQ2A 2QRJA 2Y0DA 1T1RA 3AY6A 1DDOA 1GPJA 5TT1A 3HZZA 4L4RA 1CYDA 4XKJA 4CR7A 3ULKA 3JQAB 1XEAA 1PL7A 4XD2A 3RUEA 1NHWA 4GPD1 2HUNA 3LC1O 1SMKA 3UH1A 4G81A 1JW9B 2O4CA 4LVUA 4A73A 1DRVA 4KTVE 4IS2A 2IZ0A 2QIOA 2ZATA 1T2AA 3HE3A 3B1FA 2AW5A 3A4VA 4Z9FA 1BHSA 2ZTLA 4ILKA 2CFCA 4EUHA 1YGYA 3PFWO 4R1TA 4KDFA 3TNLA 3WJAA 1FDTA 2YUTA 1I36A 3JQFA 3OJFA 2Y99A 3JD4A 3ONEA 2Y67A 3H3FA 3AUTA 3FCOA 5DP1A 3TOXA 1Z45A 2W2LA 2ZKLA 1XA0A 5A9SB 4XR9A 4W9NA 4XDZA 3RQSA 2AEJA 3ZWNA 2WYVA 4FOSA 5DN9A 3B1KA 3JYNA 3DB2A 3ZNOA 1IY8A 4CMBA 4QFDA 1RPNA 3IUPA 4QFCA 3Q1LA 4E5NA 2Z1MA 4EJ6A 2AG5A 3PEFA 3SJ7A 4UVHA 1GCOA 1DEHA 1I3KA 3D0OA 1LA2A 4WGGA 3WTCA 4AJIA 5BSGA 5CEJA 3SX2A 5IDQA 1RM5A 4Q3AA 3DZHA 3IIEA 1NWCA 4N7RA 4F6CA 3IMFA 1C0LA 2WJPA 3WGQA 4J0EA 5A06A 3WGZA 2VYVD 1YE3A 4GX2A 4ID9A 5L45A 4B4WA 5TS3A 4Z6KA 2CY0A 1UH5A 1DBVO 3QP9A 5TLSA 3CINA 4E0BA 1V3TA 1VL0A 5A04A 1V35A 2VYND 3KYCA 4NG5A 1QV6A 1XWFA 3W8EA 1KVSA 3CMCO 3ETEA 4FFPA 4CQLA 2DT5A 5KVCA 2NU7A 2JCVA 4F6LA 5ICSA 1I5RA 2QYSA 1YONA 2VHXA 5COQA 3NTQA 4BNIA 4DMLA 1JU9A 4J1TA 5FFFA 1M76A 4PLFA 2EJWA 1DFGA 1YDWA 3MEQA 5TJHA 1TXGA 3CUKA 4RQUA 2PV7A 1I3NA 2IRWA 2GN9A 1V9LA 1VL8A 3FNEA 3X2FA 3HDHA 3BMQB 3PZBA 3TPCA 1BGVA 4Q3BA 4WLNA 4BQRA 3PJGA 4JCOA 4D3SA 4UVGA 2HRBA 5JXWA 5MGBA 2O4UX 1NYTA 2ZIZA 3GMDA 2Y0EA 2AQIA 2AQKA 3IDSA 4RPKA 4IJKA 4AJNA 1KY4A 3SXPA 4WLVA 3VDRA 3HFSA 4FFRA 5CDTA 4FN4A 3RUFA 2W2LD 1A7AA 3JQBA 5BNFA 3TL3A 4U5QA 3RKUA 4BO2A 1E1KA 3RC2A 1C1XB 3O8QB 3FNFA 2AEFA 3HADA 1EVYA 3L4BA 4KDEA 4E6PA 3W6ZA 3NJ8A 4J9VA 3A1NA 4YTEA 1NVMB 2NWQA 4Y8VA 3V1YA 2PD6A 1X14A 4CV2A 4JGBA 2GLXA 4DPLA 3RUHA 2BH9A 4UEKA 4CR6A 3C1AA 1GQYA 4AJ1A 4BGUA 1GEEA 3COSA 1ISHA 3BXXA 4FIZA 2P91A 3H2ZA 3JQ9C 5A02A 1O5IA 3ROQA 4PLYA 2Y93A 1LSOA 1KVRA 4IZIA 4YT2A 1O6ZA 2QHXA 1DSSG 5DOZA 3GH3A 3MCVA 5AXAA 5IN4A 4BO3A 5G2OA 3FWNA 3PP8A 1ZBQA 3GT0A 1IE3A 2HMUA 2PD4A 4DXHA 5DNAA 1O89A 2J5QA 3VDQA 1NHGA 5I9NA 3AUUA 1X7GA 2UDPA 4PZEA 1VM6A 3H8VA 4Y6PA 4ESOA 3PGJA 2OHXA 3I4FA 1NP3A 5JC1A 5CAEA 4EITA 5JAMA 4K28A 3D5TA 4PLTA 2IYPA 1QYXA 3FTNA 5CFZA 4DYVA 4KWIA 4RVUA 5T67A 4LCJA 2OO5A 2PKQO 1EK5A 1F8FA 3FD8A 1ZMTA 3JQ8A 4WJZA 1O8CA 2C82A 2BFPA 2D3TA 4IS3A 2J8ZA 1R4NB 4ZHSA 3WLFA 1JVBA 3QV1A 4PLHA 3ZU2A 2VRCD 3P2YA 3PHLA 1ZW1A 1T2EA 3FBTA 3I9MA 3GN2A 5T64A 3TJRA 3GNQA 1U8XX 1IUKA 3RUAA 2VRBA 2PGLA 2GZ1A 2X4GA 4B3JA 5B37A 2D4AA 5AXBA 2E4AA 1H6AA 3B1JA 4LSMA 1T4BA 3DZIA 3EDMA 1HLPA 1ML3A 4RV9A 2CF5A 1U1IA 1KETA 2X86A 3GG2A 3L4SO 3ZU5A 3NKLA 5KVSA 3CIFA 4L9RA 1J49A 5FYDA 1B3RA 1I2CA 1VKNA 3DONA 3KYDA 3MJ4A 4YQZA 3ST7A 1T2DA 4JBIA 3ZW8A 4GKBA 4ALIA 1M6HA 4GMFA 3L77A 4D45A 3U09A 1DJQA 1P1RA 1BVRA 1LU9A 1U3TA 3UF0A 1L7EA 1M75A 4CMEC 2BGKA 1CF2O 1JVSA 4JN6B 4CUKA 3EYWA 4DQUA 3DZBA 4TKMA 4JNKA 4PLGA 1C1DA 4W4TA 4CLOB 5CPFA 1I30A 5L51A 3TDKA 1HE5A 4DL9A 2ZJ0A 3D3WA 3LU1A 3MJSA 1F17A 4IMRA 4XYEA 3RD5A 4AG3A 2IZ1A 3V5NA 1HSZA 1UZLA 4Q3CA 4JJFA 4GX5A 3UGKA 1GZ6A 3L6EA 3N7UA 2ZB3A 4O6VA 3DMTA 4BMSA 3I52A 3HG7A 2B36A 2D0IA 1FXSA 2UUPA 1X1EA 3O9ZA 4F3YA 2EIHA 1N9GB 1LQUA 4FQ8A 4XYBA 5DF1A 5CP8A 2HMVA 4F45A 1BXGB 2HCTA 3PJEA 2NTVA 3WXBA 5T6BA 4FC7A 3OECA 3DZJA 4CM3A 1KEWA 4EJMA 2EGGA 4XGIA 3MJTA 5EQFA 2NQ8A 4NFYA 4B79A 5IZCA 2DAPA 3MJEA 1ONOA 5JPIA 3H2SA 1YS4A 3TRIA 4BNWA 1XELA 1PGOA 2WYUA 4RPHA 5JO0A 2HU2A 5IN5A 2SCUA 2W8ZA 1WP4A 2GF2A 2ZB4A 5DULA 1WDMA 1HE4A 5L9AA 1EBUA 1U3UA 3CSDA 1N2SA 4IIVA 1U3VA 1V8BA 1GV0A 3AU9A 2CVZA 1LDGA 3G0OA 3G49A 3HDQA 4ZQGA 1RYEA 1H5QA 4MDHA 1G0NA 3VTFA 3ZHXA 3NGLA 3VKVA 3DOCA 3QVTA 4QECA 2D8AA 3VH3A 1E7YA 2I3GA 1ADFA 5JDIA 1XR3A 4LGVA 2JJYA 3GFGA 3QVOA 1AE1A 3BZUA 3ZNNA 4HV4A 1CEQA 1WMAA 2CF6A 4MP3A 2NADA 2X0IA 3EAGA 1JQBA 4I5FA 3NTOA 1ORRA 4BGEA 2IE0A 3H9EO 2YV3A 3D3EA 3ITKA 2CVOA 3QE3A 2P4HX 1PR3A 3OP4A 4IDCA 2V65A 1X7HA 4RDHA 2NUAA 4EBFA 4NK5A 4MPDA 2EERA 1UXHA 1E3IA 2OMEA 3H5RA 3F5QA 1AN9A 4DVJA 2HMSA 3QSGA 1GUFA 3GVHA 5L7TA 3H5NA 4QTZA 2J5RA 3HJAA 3LT0A 2IDZA 3PHIA 3MZ0A 1M67A 4JROA 4TQGA 4LVCA 2A4KA 5ILGA 1SZJG 3W4IA 3GEDA 5FWNA 1ZK4A 3WFJA 3ZWOA 4GWKA 1LNQA 1Y8QB 4GI2A 3JCZA 3E82A 4PLZA 1EFLA 4RDIA 1E6WA 4OQYA 1ADGA 4DREA 2NNLD 2GCGA 1VSVA 4J3FA 1XIVA 3OSUA 4CLRB 1MB4A 5A5FA 1T26A 1MXHA 4XEHA 2X58A 2DFDA 2BI7A 3NUGA 3HB4X 4QSMA 1GYRA 5FI5A 3T7CA 4LMPA 3I23A 2YQ4A 1BRMA 3BYZA 2CUKA 4FDAA 4E12A 1OC2A 1YDEA 3VH1A 2WEKA 4TWRA 5TIIA 1E7RA 5KCZA 4IDBA 1Y9EA 3HDJA 2X1HA 1UJMA 3FWZA 4EW6A 3TF5A 1HETA 1YQDA 1R37A 2BGLA 2FR0A 2Q50A 5FEUA 1PGJA 5F3RA 2XF8A 4J1QA 5CDYA 2B35A 2VHYA 2W90A 2DVMA 3KRTA 3VPHA 1EZ4A 3WLEA 4W6ZA 2OGUA 1VJ1A 5IFLA 3JQAD 3ZWWA 1NVGA 5G0WA 3WG9A 4L0QA 3JQ6A 1KEVA 4N5LA 3C7AA 4XB2A 4YT4A 1GADO 4CLHA 2PGJA 3BMQA 4EDFA 1Z73A 1XQ1A 4LRTB 3PHJA 2BFAA 4R41A 4NH4A 5EL0A 3TZCA 5JCXA 3GDOA 2QQ5A 4NBRA 1WLYA 5DT9A 2VOJA 4WLEA 3FBGA 3OJ0A 4DTIA 1ONPA 3OIDA 4R1UA 1SBYA 3CE6A 2B69A 3ENNA 1P9LA 3GRKA 3WBBA 1D1TA 4PN3A 4DLBA 2DUUA 1H2BA 2H6EA 3CPSA 4W7HA 4Y6SA 4YAIA 5B4UA 1UZMA 2WYWA 3WYBA 1E1NA 4CR8A 3ZGYA 4E33A 1C1XA 2FY8A 4NNJA 3ZWVA 1P3DA 4YDRA 4I1IA 1R16A 1EUCA 3ZDFA 3P5SA 2Y1OA 1IPFA 5I8WA 4WPGA 3MTJA 5KTKA 1IL0A 5C5IA 4MVJF 1UR5A 3ASUA 2VWQA 2Z5LA 4L73A 3I9KA 3O26A 1DFHA 4BNXA 5DBFA 3C7DB 5ITWA 3I9NA 2W2KB 4B4UA 1HL3A 1JDJA 1MLDA 2WSBA 2X22A 2X0NA 3HUDA 1UUFA 4HXYA 5I8ZA 3S2GA 2VWHA 1H6DA 4IXTA 5C7OO 4GMGA 3ZWBA 4CQMA 3S8MA 3VOSA 1ZEMA 3MJCA 1ENPA 2PR2A 4UUMA 2O3TA 5KJ6A 3I9JA 1CRWG 2PZKA 1QMGA 4WKGA 1ISIA 4XCVA 3WS7A 1E3LA 4NU6A 4XWYA 4Y6RA 5KJFA 4BNGA 4J9UE 3SVTA 1HDYA 5AVOA 4FD3A 4UUOA 1LLQA 4RO0A 4YBZA 4BOYA 2Y1DA 5IAAA 1BW9B 2C5AA 3K92A 4YRDA 3UXYA 3IP3A 2YV2A 4LRSB 3GVPA 2PWZA 1EE2A 4JBGA 3UKOA 4HFJA 2OP0A 1RKXA 3H9GA 3QWIA 2BF7A 2O3SA 2O7QA 4HNHA 3WGOA 1H9BA 2G76A 4O5OA 4RPGA 3RBXA 3GUYA 2JFFA 2Y0CA 4GQAA 3VAZA 3SLGA 1Q0QA 5L3ZA 3EZYA 2YZ7A 2ZK7A 3K2BA 3SEFA 1V3VA 5IG2A 2CDAA 2VZ9A 4WK6A 2IODA 3PVZA 2V6FA 1I10A 5CPBA 3W8DA 1UXKA 4E2WA 4QUKA 3L0DA 4DC0A 1NPTO 3DO5A 1R15A 2X9GA 3W1VA 3ANLA 2VTDA 1YQXA 3DBVO 5TC4A 4DBZA 3VZSA 2PLAA 1SEVA 1HTBA 4GWGA 5EINA 2VTEA 2NSDA 2X7HA 3KEQA 2XPCA 4DRYA 2NU8A 2FZWA 1W8DA 4D0RA 1H2HA 2VUTA 2W4QA 3BA1A 4BGVA 1SNYA 2J3KA 2OP1A 3GGOA 4C7KA 1P0CA 1ZJYA 4BKQA 3AW9A 1GEGA 5JDCC 3LK7A 2B5VA 4BNZA 2QW8A 1GZ4A 4R1SA 1ID1A 3JQDA 1Q2XA 1DAPA 4CLOA 3ICCA 1UP7A 4WASA 1O94A 3V8BA 5IXYA 1CQIA 3OQ1A 4CV3A 1LBEA 2GO1A 2YW9A 3ZCXA 4UREA 2VYVA 3PHHA 3ADPA 3LZ6A 1BVUA 1K2WA 1PGNA 2E6UX 4CMIB 4D46A 5KJCA 3GMSA 4Q3EA 2C2XA 2C07A 1YL6A 2VHVA 3RCBA 4BO6A 1YJQA 4X54A 1PZGA 2C5EA 4P4NA 5A5EA 1N9GA 3UW3A 2HQ1A 3VVCA 2P5UA 2DPHA 1W6UA 3O03A 3DBRA 2VZ8A 1IOLA 4M54A 3WGHA 3K2EA 1BXGA 3IOYA 4W7IA 1K89A 4W99A 3PQFA 4BMNA 4AICA 4BNTA 1WAMA 1IYZA 3DFUA 3ZN2A 4AJKA 4IDGA 1P1IA 2Q2WA 1P74A 1NFRA 2Q45A 5A3VA 3FR8A 5JCJA 4IMPA 3JQ9A 2C7GA 4F46A 3ZV4A 4CUZA 2X8LA 3CMMA 2AQHA 3UOGA 4GX1A 2O50A 3L9XA 5IJZA 4TRJA 3WIEA 2W98A 3KTDA 1WXDA 1HE3A 1RYDA 5CEFA 5MDHA 1EVIA 3HHPA 5K9ZA 2WE8A 3GEGA 3RAJA 1GYPA 5G4KA 4E30A 4KTTE 1GV1A 1TLTA 4MIEA 3TSCA 5G0SA 4NPCA 2Y1FA 1ZVMA 3DEYX 1EDZA 5COBA 1PTJA 4R54A 1DLJA 4I9NA 1E6EA 4NJOA 4L75A 4B7UA 1HDGO 5TF4A 5JBIA 3RFXA 4MKZA 1DIAA 1UXIA 1DIBA 2GSDA 4AJEA 1HYGA 1W0CA 2Q1SA 2OORA 2WM3A 4UUNA 4XZ3A 1L1FA 3WMWA 4HP8A 4DIOA 4YR9A 3GNSA 4BKPA 4CMCA 1WDKA 1K6XA 4BNJA 2GDZA 5T8KC 1EQ2A 1B8UA 4E4YA 4EGFA 3ASVA 4P4LA 3S2FA 1NX6A 1NASA 1PEDA 5G0TA 3EZLA 2R2GA 1XLTA 5DCWA 1SB9A 3H7AA 6LDHA 1R12A 3D4PA 4JK3A 3H9UA 4ZRNA 3U4IA 4PIVA 2A92A 1T24A 4HFMA 4L4XA 9LDBA 1MP0A 4J16A 1FMCA 2X5JO 4QEDA 4RF4A 4XA8A 3Q6IA 4NJMA 2B83A 3KO8A 2ZYGA 2J6IA 1A71A 3AY7A 3RKRA 1YQGA 1U7HA 2RAFA 4BQPA 1N1EA 4HNGA 7ADHA 5JMPA 4OXYA 1ENZA 4MIYA 2FN7A 3ONFA 2Q4EA 3ROKA 1XGKA 3STHA 3RJ9A 3WFIA 1ZSYA 3UHAA 2WWRA 1NFQA 1N5DA 1XDWA 3BHMA 3WB9A 3E9NA 1J4AA 2GR9A 2V6GA 3JD1A 3JYOA 4R69A 5HBRA 2HDHA 1HDOA 3GAZA 3IS3A 3F9IA 2VHZA 4J2OA 4TROA 3L6DA 3QA9A 1ENOA 3LYLA 4BV9A 5JCJD 5H82A 1D8AA 1PWZA 1PJ2A 2HK8A 2O2YA 3C1OA 5C7IO 5AYVA 3IP1A 2XXJA 4TRRA 1CIVA 4RVGA 4BIIA 1TB4A 2FMUA 1H6CA 4Q39A 4YB8A 4KUHA 4EUFA 3AOGA 5JY6A 5A05A 3WIDA 1RM3A 3GAFA 4K6FA 3TL2A 4PGFA 1MFPA 4XJSA 1P0FA 5J23A 2GNAA 5A03A 3G3EA 2NTJA 3A9WA 4GLLA 3WOHA 2DPGA 4NI5A 4IQ8A 3FF4A 1P44A 2PK3A 5TT0A 4DLLA 5C37A 3KV3O 5I7FA 2VRCA 4TKLA 2GYYA 2FR1A 1SEPA 1DC5A 1WVGA 1DHRA 3G79A 1BTOA 3GA0A 2TMGA 2X0JA 1F06A 1JN0A 1PGQA 4FJ2A 2A9FA 4AJPA 3OEWA 4NBTA 1Y9AA 1YOVB 3FTPA 3JQGA 4IINA 3K5PA 4A26A 5ER6A 2AE2A 2POQX 1DIHA 1LSJA 3HN7A 2F1KA 4NR0A 5EMHA 3WQQA 4RF3A 4D41A 2YHUA 4WCDA 2GUGA 2FHSA 4BKOA 5JY1A 1SOWA 4NIMA 1VPDA 2DBRA 4J43A 5BSEA 2J3JA 4I8XA 4URFA 4BNNA 1V0JA 3HDYA 4E5MA 4NK4A 4NHEA 4P38A 2I3AA 4TMFA 2OXIA 4IQ0A 3I5MA 1LC3A 4IUYA 1RM4A 4MP6A 4E32A 4UVEA 1PWXA 4I5GA 1XG5A 4GX0A 4CV0A 2W2KA 4WEQA 1W73A 1PR9A 2D59A 2NU9A 2QX7A 3AI1A 4XYGA 2JL1A 3WTBA 1WZIA 5AOVA 2XXBA 2V6BA 4R5HA 4IDEA 3DL2A 2AMFA 3ITDA 5I9MA 4RLHA 1MG5A 4IDAA 4GH5A 5G4LA 4A0SA 1GDHA 3N74A 3AI2A 4YJGA 4U6SA 2CZCA 3NT4A 1SOVA 1KEPA 4K1LA 4Z9YA 3JQFC 2RBEA 1QYDA 4ZD6A 1DOHA 5TJ9A 3VPGA 3W4JA 4E5YA 1T2FA 2HO5A 4UVDA 4ZQBA 2ZTMA 1I01A 5ITVA 1Z82A 2HKIA 5KOIA 3QIVA 4A10A 4L74A 3NDJA 5FI3A 3DFZA 4YYZA 1BW9A 1D3AA 4B8ZA 4W9NC 2ZTVA 4DQVA 4PFJA 3EMKA 3ETGA 4CODB 1JTVA 3PIDA 3WGGA 3DTTA 4RVSA 4NFHA 4MVJH 4CMHA 4B4OA 4GBJA 4E3ZA 3EY4A 1XHLA 3U49A 4FCCA 1UDCA 2EW8A 2ZYAA 1HDZA 2WD7B 3GDGA 1PJCA 3H6KA 4AJHA 4XX0A 3FR7A 3LC2O 3QHAA 3JYQA 3NEPX 3PYMA 2OFPA 1U2DA 2O48X 3C24A 2O3JA 1CJCA 4Q3NA 1UAGA 5F1KA 1P1KA 4DYDA 4PG5A 3QWFA 4OQZA 1BXZA 1ISFA 1B26A 1XYGA 2VNAA 2C7VA 3WQSB 1MFZA 3WR5A 4R68A 3M1LA 3QWBA 1DJNA 1JAXA 3ICPA 3PQEA 3C8MA 3WGIA 5GY7A 4J6FA 5JO9A 1Q7BA 3IJPA 2HK9A 4MVJG 2HMTA 5JFOA 3S1LA 3FI9A 5H83A 1FDVA 1P33A 1U4SA 1Y5RA 4RZIA 4J4BA 4WNCA 4D42A 4PG4A 4B7CA 3FN4A 2VCYA 4RF5A 4FGSA 4NBWA 1HYHA 3OM9A 3V2HA 3OETA 1RM0A 1DRWA 4U0KA 3VTZA 1G1AA 2Y1CA 4LK3A 5I7EA 3ZWAA 3NDRA 1Y8RB 4II2A 4BO5A 3H9JA 3DAPA 3IJRA 3PTZA 2D5AA 3SC4A 1NFFA 2I65A 2GN6A 2VNSA 3GNTA 3FSRA 3ZNQA 4XGKA 1PJ3A 4N18A 1GFSA 4RZHA 3JQCA 3OA0A 1BSVA 1HXHA 1QLJA 5JE8A 1OBFO 1PS9A 1R4MB 1E3WB 5A9RA 4R3NA 4UEJA 1Q0HA 1BMDA 3U4DA 3ZU3A 2VQ3A 3E03A 5THKA 5HS6A 3INTA 3PIIA 1ZKMA 2DKNA 3ANMA 4H7PA 1NTOA 4YJDA 2IZZA 5JC8A 1GUYA 1JLLA 6ADHA 3WQRA 1HEUA 1K6JA 3TZHA 1GPDG 2QYTA 1PZHA 3NT5A 4FJ0A 1TVEA 3ZHYA 4YRAA 3BMOB 5CG2A 2BRUA 3H9QA 1GAEO 2P9GA 3DBHB 1PJQA 4PCVA 1I8TA 1ULSA 3BTVA 3EK2A 4BS9A 1L7DA 3JQAA 1PL8A 1H93A 2AE1A 1N7GA 1OAAA 4EEZA 1GZ3A 2BHLA 1U9JA 2I67A 1D1SA 2FSSA 3H5AA 4NQZA 5BR7A 1DIGA 3ZV3A 4AJLA 1DLIA 4S3MA 2PKQP 5AXCA 1PJBA 2H1SA 4AFNA 4ZVVA 2EJVA 2HLPA 4I9UA 4MVJP 1U7TA 3EGOA 4Z3DA 4E5PA 2OOSA 1DXYA 3RVDA 1CQJA 3WSVA 3DHEA 4E2XA 4ND3A 4CLDA 4TRMA 3ABIA 3E9MA 2QRLA 2PZLA 2EP5A 3GUCA 4E5KA 3GG9A 3C3XA 2AA3A 5JYEA 5A9SA 2O7SA 4Z0TA 4I5DA 4MIOA 3UUWA 1FDUA 1X7DA 4A5OA 2I6TA 4BGIA 3DWFA 1NQ5A 3RROA 5GZ1A 5EN4A 3NRCA 4L4SA 4Y67A 3IAHA 1LDYA 3V2UA 3OIFA 3KLMX 3GVXA 4RJTA 4ND5A 3SBOA 2PGDA 3KYBA 3R0IA 3JYLA 3M2PA 5ADHA 2NLOA 2EV9A 4Z0HO 1M2WA 2IEBA 3DHYA 3MWDB 4Z3KA 4XIJA 3UVEA 1A7KA 4OAQA 3RSHA 1LX6A 1VL6A 4QX6A 4PG8A 1P31A 2HSDA 3EC7A 2O3RA 3OQ6A 2JCYA 4Y98A 1SB8A 1KC1A 2XAAA 1EVJA 3D5QA 4E13A 4D3DA 1E7QA 3JTMA 4XQGA 4DGSA 2R6JA 2UAGA 1LXCA 4CPDA 4YXFA 3PJDA 3TOZA 3NV9A 3GC6A 3KLPX 4R16A 4A03A 1X0XA 4CM8B 4QO7A 3TN7A 3GLQA 3PXXA 3V1TC 2ZJ1A 3H3JA 2Q4BA 2GZ3A 2D2IA 4QT0A 4B3HA 1SCUA 1E5LA 3DAGA 3FPCA 4E2YA 3U3XA 2JFGA 1QSGA 3AFNA 3RIHA 3KSUA 4ZICA 4CM5A 2JKVA 2GRAA 3QWAA 4HADA 1EUDA 4BNFA 5IZ4A 2VT2A 1M6WA 3ZWXA 4HY3A 2J5KA 1U28A 3AFMA 3B6ZA 3GVIA 4CM1A 2B4RO 5JDCA 1PQWA 4WLOA 5I9LA 1E5QA 3PYLA 4JXKA 5EERA 5GZ6A 5BNTA 3SJUA 1N8KA 3ZI0A 1LC0A 2TMDA 2AXQA 4U6QA 1P1JA 3LC7O 1J0XO 4ZGWA 1H0KA 1NXQA 2ZTUA 3T4XA 1I3MA 3TZ6A 1KVQA 3F1LA 1J6UA 3PYXA 3F6YA 7MDHA 3WGYA 4YJHB 1JAYA 1Q1NA 1X1TA 4YRBA 4OOFA 4XYMA 3GF4A 4YQYA 5THQA 1ZSNA 1Y7TA 4BNVA 2WE7A 5CDUA 4J4TA 2J3HA 3O8QA 1CETA 4DPKA 1ENYA 2C2YA 2WDZA 2ET6A 4OXKA 1YB5A 1E77A 2I99A 5HWSA 1YOVA 3AUAA 2AEMA 4XQCA 4OOEA 1LLDA 3PDUA 1Q7CA 4ZN6A 4E31A 5AXDA 1MC5A 3WWYA 3GZNB 4WLFA 2Q2QA 1QORA 4AJOA 3Q0EA 1LDEA 3E18A 2PKRA 3D4NA 5DBGA 4DA9A 1QP8A 4YA6A 3ZW9A 2JD1A 4MJLA 3OMLA 1HLDA 2EHDA 1NQOA 2HAEA 4WLUA 3R3SA 2UYYA 3GK3A 4ALKA 2C0CA 4R01A 5CDSA 3O38A 4GLOA 2IEDA 1YBVA 1PZEA 1VJTA 1HRDA 3OIGA 1HF3A 4RF2A 5BSFA 4YVFA 2FPIA 5K6AC 3INRA 3INGA 1PQPA 4TSKA 3I9OA 2PY6A 4JP2A 3E9QA 1QR6A 3GGGA 1HKUA 4FFNA 2B5WA 1O95A 4IJVA 3LLSA 3G1UA 3OJLA 3TFOA 1U4OA 1MUUA 2YY7A 4YWJA 4BNHA 3ROMA 5HS4A 4HFNA 5DCYA 5I7SA 5KWEA 1WNTA 1E3EA 2OUIA 1QKIA 2Q99A 3F5SA 1AHHA 4OSOA 3RFVA 1B8VA 5IDXA 3EVNA 2CSUA 2Y68A 1ZK2A 4DIBA 4RVFA 2ZCVA 3AOEC 4XRRA 3TZKA 1SPXA 4HFRA 2Q3EA 1QV7A 3KEOA 1EEHA 3ONDA 5L53A 4PVCA 3KBOA 1YB1A 1DIRA 1VJ0A 1U8FO 3A06A 2PA3A 1H9AA 4JBHA 3KXDA 4M86A 3D4OA 4LW8A 4L76A 1SO8A 1B3BA 3IQDB 3LDHA 1R4NA 2VOEA 1BWSA 4R3WA 4MOWA 1NR7A 3PWSA 4GVLA 4UAGA 3OHSX 4Q3DA 4HBGA 1QXSA 1B7GO 4J7CA 4AJ2A 3ON5A 1SAYA 4JLWA 3AM5A 3JYPA 3ZV5A 1TT5B 1PJTA 5B12A 2BFMA 4P8RA 2H63A 3B20A 1KYQA 5DCUA 3L07A 4YPOA 1BDMA 3A28A 2GERA 2NM0A 3EHEA 4DQXA 3RUDA 4UEOA 5TNXA 2JFHA 5F5LA 1PS8A 1ZK0A 5IXSA 1I2ZA 2OBYA 3JSAA 4R5MA 5GMOA 3DOOA 3UFXA 3ORFA 3PJFA 2RH8A 4IGEA 1FJHA 3Q11A 4TVBA 3I4CA 1JWBB 4BO7A 2I5PO 2G1UA 3QW2A 4KQWA 5KKCA 2J3IA 4MVJM 3AUSA 5A4DA 4FB5A 5TSDA 1ZK1A 3K6JA 1C1DB 1WPQA 1DC4A 5BSHA 1N92A 1YWGO 3D3WB 3DAFA 1UDBA 4ZU3A 3ZH2A 4HKTA 1I32A 2PH3A 5G0VA 4PLCA 1DAOA 3HB5X 4ZQEA 5F1OA 5A9TA 3GHHA 3F3SA 4NBUA 3WX0A 3KB6A 3VHRA 4EEXA 3PLNA 5B4TA 3U4CA 1KBZA 1HT0A 2NTNA 3SC6A 1JWAB 1U3WA 5A3JA 3CH6A 3RUIA 3VVBA 3AWDA 2C29D 1P1HA 3MTGA 1E7WA 2Y1EA 1GUZA 2X23A 4FS3A 5I7VA 2GPTA 5EQDA 2GN8A 2EXXA 5GZ3A 2FP4A 4WECA 1R4MA 1E3WA 3Q2IA 1LRJA 1E6UA 4INAA 1LDBA 4U0JA 2RHRA 5IF3A 4H16A 3AM4A 4LN1A 4XRGA 3G17A 2R00C 1YJ8A 5G0UA 3OFSA 1NQTA 3T4EA 3V1UA 1D4FA 2YV1A 1LLCA 5TRTA 2C54A 2QZZA 1OC4A 1B14A 3JQ7B 3BMOA 4WCFC 4M55A 3WNVA 2FPPA 3GVCA 3KM0A 3KZVA 3V2GA 3DBHA 3U4HA 5ER9A 1G0OA 5EPOA 3GRPA 1IULA 4J0FA 4QXMA 1HYEA 4RL6A 2GASA 2E37A 4D0SA 3D64A 2DBVO 5TX7A 5B1YA 2YHIB 4MINA 5ENDA 4NZ9A 2BGMA 2HMWA 3PGXA 4Q9NA 5BNIA 4Z9XA 2RCYA 1MXFA 1I3LA 4KP7A 3WSWA 3BTUA 1E3JA 3W6UA 2HK7A 4BO0A 2JAPA 1A5ZA 4C4OA 3PRJA 1UXGA 3TZQA 2Z1NA 4OM8A 2LDXA 3LVFO 1KERA 2EKLA 4ZRMA 4BNYA 1R6DA 3JD3A 4GAEA 3HSKA 3AK4A 1E3SA 4P22A 3RC1A 2EKPA 3DBLB 2JD0A 4CUJA 3PK0A 4K26A 5KVVA 3GY0A 4CMGA 1ULUA 2NVUB 3U62A 3RFTA 1LI4A 2Y1GA 4A27A 1UDAA 1AXEA 2O3QA 1PJ4A 1LSSA 3U0BA 1YL7A 1KEUA 3I9LA 1PSDA 2FSVA 3ANNA 3LLVA 2BD0A 4AVYA 1A72A 1G6KA 2IXAA 1V6AA 4Y9DA 3OQBA 2UVDA 4NDNE 1C3VA 1ZUD1 3DHNA 5H81A 1Y8QA 4ND1A 1DRUA 3DOJA 2YYYA 1YBAA 1FDSA 4QQRA 4FOOA 2EKQA 4KUEA 4J7XA 1T1SA 1TI7A 1OFGA 1PU2A 5C7LO 4CLRA 3IC5A 4OYRA 3WWZA 3CTMA 1KS9A 1U5CA 3I6QA 2DTXA 1EK6A 4YJFB 3KSZO 1ZK3A 5JMWA 4WUVA 3KETA 2CNBA 1JKJA 4YAJA 4BB5A 4DPMA 1U5AA 3NDIA 4NBVA 1K3TA 4ZQFA 3VZQA 2BI8A 4CM9A 1ADBA 2DBZA 1T2CA 4Z0PA 1XCBA 2PZJA 3HFGA 3OF2A 3VH4A 4CLXA 4CMEA 1D7OA 5KIAA 1EFKA 1PQUA 2F00A 3K73O 2ILTA 4CM8A 2DC1A 5CG1A 4MO2A 3H4VA 1I2BA 1A27A 4BNMA 3P2OA 2NACA 2ZQZA 2VUSA 4JIGA 4ONEA 2PFGA 3NX4A 3H65A 3TFQA 4N5MA 1W4ZA 1NWHA 5C3MA 3NYWA 3QRWA 2EW2A 2AQ8A 2Q2VA 3PFFA 4FR5A 5TQVA 4UVIA 1IPEA 5JAZA 1LDMA 2YQ5A 3BHIA 4IPTA 1ZSVA 5L4SA 1FDWA 3G1TA 4XQEA 3VZPA 3DZKA 4TZKA 3D7LA 4ALNA 3HQ4O 1LUAA 4OKIA 4E2ZA 1X15A 1ZMOA 3LSYA 3CKYA 1I24A 1QG6A 1LJ8A 3BIOA 1WDLA 5T5QA 4WE3A 1IZ9A 4WNIA 2Q1UA 2VHWA 3JQEA 1AXGA 1DO8A 4E21A 1HE2A 2C59A 1Z7BA 5JW6A 4YT8A 1LQTA 5HM8A 4YT5A 4YAGA 3U9LA 2UUOA 4YJHA 1ZXLA 1E1LA 1P45A 3RWBA 3WICA 1C14A 2C20A 1B8PA 4CL3A 4M89A 4P4GA 4OL9A 4RORA 1P77A 1LTHR 4BKUA 4WCFB 4J90A 4BO4A 2WD8A 2G82A 2JHGA 3LT2A 3DXFA 1IZ0A 4YEDA 4ALJA 1XKQA 3MOIA 4CMKA 4CM4B 3GZNA 4KZPA 4CMAA 3AM3A 3BMNB 5F1PA 4PLPA 4GSKA 1LSUA 3VH2A 4LCEA 3FNHA 1GTMA 4OH1A 4LSWA 1N7HA 1Z75A 4HWKA 2GGSA 4WEOA 1NM5A 2V7PA 1ISMA 1BDBA 3UCEA 5K0ZA 4CQMB 2B0JA 4CM9D 2ZB8A 4MP8A 3VPFA 4EJ0A 5JS6A 1DC3A 2VWPA 2X6TA 4IDDA 3ENKA 5EESA 4H15A 4ND4A 5LDGA 1ZXBA 3UCXA 3OA2A 1E7MA 2IXBA 1PL6A 1ZZEA 1QYVA 2JHFA 1S6YA 3L9WA 4W82A 4M1QA 1E1MA 4FW8A 2BELA 4GGPA 1AHIA 4QO8A 3MJVA 4BV8A 4BVAA 4YAKA 4FFOA 3K31A 3NTRA 4JJGA 1F8GA 3S55A 5ILOA 4KQXA 4D43A 4RPLA 2BFOA 3BMCB 4G5HA 4NMHA 4XGNA 1F12A 4MVJI 2QG4A 1OOEA 4PG6A 2BLLA 4BMVA 3F4BA 4WOKA 4DBVO 3W8FA 1ZFNA 4EUEA 4ND2A 3OH8A 4O1MA 3RC7A 2QRKA 2ZCUA 2NQTA 1LLUA 2EGHA 3PZRA 2ZQYA 1UAYA 4OSPA 1F0YA 1QLHA 3LF1A 3R3JA 4OKNA 3NAQA 4BNKA 3AY3A 1TT5A 2A94A 1YRLA 3D1LA 1MGOA 4N5NA 2P4QA 5JNLA 3GPIA 2Z95A 4PZDA 1UP4A 4PVDA 3DZFA 3QVXA 1DHTA 1NPDA 1ONNA 3I3OA 3BTSA 1PS0A 1N1GA 4BO8A 4BNLA 1PJSA 4IJWA 3QLJA 3RU7A 2A35A 1UP6A 3I1JA 1C0IA 3UCFA 1XU9A 3FRJA 4ALMA 3GGPA 2DUWA 1O0SA 3PWZA 3P19A 3PWKA 3PLRA 2D1YA 3NGXA 4TVOA 4RCVA 1XSEA 4TZTA 1NAIA 1ZEJA 3RI3A 2OBNA 4R9RA 1NR1A 5TGDA 5JLAA 4JP3A 1R0KA 3EVTA 3ZWYA 4DUPA 1J5PA 2GD1O 2H5LA 4B7XA 3MWEB 3PI7A 4I5EA 3ETDA 3BAZA 1HDXA 2AG8A 4XDYA 5CHEA 1H6BA
chains in the Genus database with same CATH superfamily
5ALUA 4QSHA 5DXFA 1JB1A 1A4UA 2QL6A 4H9GA 4BBPA 4ZYTA 4A2CA 1XU7A 2FRDA 1SVKA 3VMMA 4CMIA 1M5RA 1B76A 1LPNA 2XWJI 1DFIA 5KSYA 1OPRA 3JTEA 3O9MA 3ADOA 4MR9A 4LC9A 3I62A 3N87A 1MAWA 3PL1A 1L4EA 4IL5A 4EB6A 1L5ZA 2X8BA 4IY1A 1FTWA 3BB4A 2C3MA 2VDLB 3L4BC 2ZT6A 1D0SA 3NB0A 5EJ4A 3DBRB 1N77A 1LK5A 4C7JA 1MO5A 4CKXA 2OPBA 3LQ4A 3AR4A 3M33A 1VLLA 1ADCA 1Z17A 1T2NA 1UFRA 1EK1A 3FPLA 4IXNA 4Q4HA 4X97A 1L5OA 5F64A 4OO3A 3MUFA 4CKYA 4MWCA 5DXJA 1YR8A 2YOGA 2CVQA 4MQUA 3K70D 1JGTA 2ZI7A 3NBMA 8GPBA 3ADDA 2AYYA 1M74A 2SNIE 1B16A 4B2YA 3SU8A 3GLFA 2GEVA 5F76A 5LDHA 5B53A 3D0QA 4E3WA 1XQ6A 4XDGA 1JIUA 2Z04A 3ACBA 4Q4AA 5I5GA 4D0NA 1CUXA 1WXEA 2E48A 3NVAA 1XZAA 3BJIC 2H4FA 3C85A 3QWHA 4LDQA 2XD4A 1XTRA 5LD2C 2VP4A 3PJRA 1BXRB 1YVDA 2Z2JA 1AMNA 1C8BA 5CX1B 2PNJA 3DCNA 3EOAI 3V8QA 3VQTA 1QYCA 3UMRA 1GG2A 3CZMA 3BHJA 3RS4A 1H3EA 1EXNA 4JT2A 2O2IA 3ED1A 1J21A 3SS7X 3THYB 3L8HA 2P3LA 4Z4CA 2PE5A 1JQ5A 4QOSA 5FUYA 4X1KB 4RGBA 2ZAYA 2O8NA 1B2LA 2ZRGA 1MH9A 4HAOA 1J99A 1O7JA 5KNCH 4HXFB 4QL3A 4A5SA 1VB5A 2Q5HA 4L02A 1KIFA 2P90A 2WJ3A 1TA4A 3AILA 1P80A 2I0FA 2XE8A 3GZTB 1GQQA 4U7GA 5L3QB 5KJ1A 2ZRNA 1AUPA 4MKFA 4ZV7A 3Q9UA 4BLTA 2PT6A 3AOEA 2I3BA 2OL4A 4F84A 2UKDA 4MWOA 2XWQA 5KOJB 2QQFA 2I6SA 2NW6A 4G1CA 3WIVA 4KXXA 3GLFE 2RIRA 1LZKA 4HC4A 4NE2A 4AMUA 4DMMA 1XFDA 5FR2A 5ARDA 1UIRA 3A6JA 1PYGA 1NQWA 4D02A 4WV3A 1M66A 4ODIA 3CVWA 2AMLA 1SZCA 3UEOA 5LBIA 4DB2A 5F52A 4LK2A 1QG2A 3SMVA 2YWDA 1GTRA 3GJYA 3O2SB 5EE0A 2W8BA 5EPEA 3V6LA 3E48A 3H87A 1YHZA 3ZQ6A 4JJ6A 4NJMB 3OWHA 4J1SA 3S2IA 1VCMA 1JFTA 1E2QA 4D9CA 4KPUA 2IYFA 3WNQA 3N0RA 3WK8A 4RNDB 1KNQA 3T7RA 3PL5A 1DPGA 1JIXA 1T8TA 2PKWA 4N40A 3FOAA 2CXSA 2BKAA 1RWBA 4FHEA 4CQLB 2J6CA 2R1TA 5I7WA 5FV7A 1LTQA 3ABZA 3Q9NA 1NG1A 2DETA 3P4YA 3IUSA 5FBZA 3QOFA 5EJFA 2PGAA 1G5PA 2HJRA 4M0DA 2HCJB 3LT1A 3WMXA 4AIIA 1F0KA 2P4UA 1BVHA 9LDTA 3W9UA 4BL5A 1Z7WA 5DGDA 4YJFA 1DPFA 4XQ0A 1MABB 2P77A 1U8UA 3T7CA 2I76A 2ZIUB 3ESQA 1ZGGA 4GSLA 1VI2A 3B5IA 4MGIR 4MV8A 3NBZC 1NZFA 3ZD6A 1GCGA 5IM5A 2XY4A 2YV5A 1D03A 1UXJA 3GQVA 2AN3A 1AHPA 3SFVA 3DMRA 5IAEA 3RSSA 3TD2A 2A5GA 4EPRA 1B0AA 1E92A 1O1YA 1Q84A 1T9GR 5HKLA 3ZU4A 4DC1A 5NULA 2WIGA 3EMDA 1U3FA 5E4YA 1RJ9B 3TAHA 5E2BA 4EATA 2M6RA 5LJLA 1AY0A 2FPLA 1FP2A 4R83A 5CCBA 3CVUA 2WUVA 4XW2A 1SRRA 3I5XA 4LXXA 4X84A 4UNSA 2Y2UA 1EUQA 5DW0A 4XJTA 4C2TA 3IQZA 3NXSA 5AI4A 4O2AA 1EDOA 2XHZA 3EPPA 2FEXA 3DR5A 5CJPA 3CB2A 4XB1A 1CBUA 1GAQA 1UWLA 3BC1A 3HR8A 1HDRA 1G7RA 3PWTA 4WDQA 5CEEA 3UK0A 2DHEA 4EUNA 4HEQA 2NVWA 2Q0XA 3CTVA 4EPXA 4QBFA 3HA2A 1F6WA 1M2VB 1MC4A 3AVOA 3ZE2B 3IXMA 3NIDB 1U3DA 4QT4A 3AF2A 1H94A 4ER7A 1KSFX 2ADMA 1XXHE 4BKRA 4JSTA 5JQGF 3RYCA 3A2MA 4F2DA 1A9SA 3LY9A 2H2FA 3ZHZA 1ISSA 1QGDA 1YB7A 3GP3A 3L5OA 3PXAA 4AF8A 5ARBA 1Y1LA 1N2EA 3VYTB 4DMFA 5IZCC 1NYRA 1WQ3A 3H0CA 5D8DA 5DP2A 2RGBA 1VPLA 3IQIX 1IB6A 3QY9A 1K75A 3C6BA 1YK0A 4FEAA 4OK3A 4AN4A 5CB6A 3NHWA 4BV2A 5C52B 4KVZA 2H5JA 2IELA 2A67A 1JIQA 4I2VA 3GRZA 4O1IA 5J40A 3T7EA 3TI9A 3TLYA 2FR8A 5LD2B 2AMVA 1I7QB 4TOIA 3A9RA 2BVNA 4WCFA 2ZYIA 1N5OX 4ESEA 5JZSA 4GEKA 2IS4A 3DF7A 1XZPA 5LC1A 1TKBA 3H97A 3A4TA 3OC0A 3PE4A 1SU6A 4XJXA 4HLDA 1KRHA 4IXDA 2PZMA 3VUEA 3D7KA 4EF6A 5HTOA 3QEAZ 2OZLA 3ZGVA 1SJ9A 1FF9A 2HBYA 2ZBRA 3I6MA 4ZA2A 3NHPA 1IIBA 4M36A 5CFPA 2C7RA 4KYTA 2Q1WA 2OV2A 5JDIC 2LIPA 4FT2A 4NBLA 1W44A 3WBFA 1FLNA 1GCUA 2VSXA 1KZ4A 3TFWA 3IULA 4RVHA 1M8GA 1S4MA 1K6EA 3NONA 1MG0A 1B0UA 1PF7E 2Z09A 1NVTA 2Z6VA 1L0BA 3BSWA 4U8GA 3MGGA 2WTBA 1XDUA 1GQSA 3F4LA 3U4AA 5AFSA 3L4JA 1CEYA 3AL3A 5C4IA 4MKRA 4MICA 1QB7A 1TJ5A 1NQVA 1K5HA 4TKZA 5DYWA 3GNLA 1I4DD 1N2JA 3OOSA 4YASA 5GPBA 5AVXA 1SURA 2V03A 3OQIA 4C22A 4EMTA 5KNBD 3KDPA 1KBOA 4BX2A 3U80A 3NWBA 4TKUB 4OGLA 5E1MA 2V98A 3JQ8B 3KR0A 1DTWB 4TRNA 3OZXA 1ZGAA 1ZM3A 3E7WA 1WY7A 3ZG6A 1Z0SA 1W34A 2OWDA 3FCSB 5AKEA 3RVRA 4K9SA 3WE7A 3QVWA 3MCAA 1NJGA 8OHMA 2FG7C 2QKYA 3I12A 2FZEA 4N3CA 3AB8A 1K7XB 4IDFA 5IXJA 1ZI6A 4WESA 3F1KA 3NO4A 5IM4F 4EJSA 4B3IA 1F8XA 4B31A 5A2GA 1RSZA 3G59A 4XX0B 5CT9A 2GZ2A 1O9GA 2IEZA 3FTFA 3DMGA 1ZO8A 3V8NA 1KC3A 4RQBA 3WGTA 2Y9PB 4ON9A 3QBJA 2XODA 5JPCA 2QX8A 2QRZA 5L7YA 4CHTA 4WNYA 4A7PA 3L6BA 1EM8B 2Z3VA 3FSEA 3T7TA 2FV8A 4X90A 1N2ZA 3HN6A 4I6GA 5FP0A 3ZS8A 2ZDQA 4FFVA 3RTGA 4ZO7A 3RWOA 4CG0A 1PK7A 3I0NA 2K2QB 3R3ZA 4TV9A 5KVQA 3KC2A 2E82A 3WJ7A 3PDWA 3P9YA 1RADA 2ONYA 2WIFA 3PQ6A 5JSZA 3CN9A 4KUGA 1CQZA 1XNHA 1J8QA 2PH7A 3QLVA 3DTVB 1V1RA 4R4JA 1QYRA 3RLFA 4BQEA 5EJ5A 2CJXA 2FPGA 1GU7A 1TGYA 3N53A 1KEEA 1XN1A 1Z6ZA 2VNIA 1KQFA 3S27A 5HA5A 5CK5A 3M4NA 4G0OA 4F1JA 4ZOLF 3HXKA 3QEMB 1E7SA 3HCEA 1OLOA 3USES 4EI9A 1J2JA 1AQUA 3BB1A 2Q46A 3GPDG 3I01A 1HDCA 5F12A 4N0EA 4OQDA 2EWVA 4KXLA 5KCMA 4B6FA 5K3OA 4LDAA 3NCTA 1M1NA 1R10A 1U28C 4RS4A 1R27A 4PZPA 2QX4A 4H17A 5DLYA 4O4IF 1XZCA 4WXPA 2VPYA 1PJLA 2JFQA 1SHJA 1MOSA 3O92A 4QGHA 1GR0A 2WP8J 4RTQA 1Y8RA 1JHPA 3ROXA 1E0DA 2VT3A 3V7FA 3DWEX 4CQMD 1AZTA 1Y5MA 2QQGA 3EIOA 1CJKC 1NPYA 3OD5A 4XLLA 4F3KA 4PZCA 3PHGA 2HCFA 2QAIA 1II8B 3M1AA 3E81A 4OJNA 1E5VA 2VSFA 3GMTA 3NYIA 5AO9A 3RTDA 3TTTA 4K03A 2BSXA 3LUDA 2FE1A 3QNUA 4N65A 5IC6A 3T9DA 4BN0A 3B70A 3O84A 1G5RA 4IQGA 4MQLA 1XJ5A 4QNNA 1E2BA 5DSXA 2RJOA 4F8EA 4D44A 4TS3A 1D4OA 3T3EA 2IHNA 2IPOA 1V5IA 3E7FA 4KE8A 1VGQA 2G5GX 3HYLA 1VKOA 4U2CA 5TQJA 3A1UA 3OEYA 2B4TO 4ZHQB 1GOTA 2XA2A 3IKMB 4H6VA 4GSYA 1A5BB 4U9HS 3IEKA 2QRJA 4HZUB 2XB2A 3LECA 1T1RA 4C0KA 3FPGA 4AP9A 5P8WA 2X1LA 2OD7A 1CR2A 3C3JA 1Z5PA 1KGDA 4ZOCA 5IVDA 4LDJA 1M6NA 1Y4UA 2I7DA 3HJFA 4FWTA 3ULKA 2GJAA 3F74A 2NPFA 1YS2X 2BZGA 2X0DA 1PL7A 5F7OA 2XCUA 2H00A 3B6EA 3DT9A 4D9KA 1KHHA 4RV5A 5CA1F 1KNXA 2XNSA 5BQXA 4B2IA 4RK4A 1DS6A 1NF3A 4P93A 1SU7A 2GPJA 2OGZA 4MUEA 3UH1A 4TT8A 1KYZA 1JW9B 2IZ6A 1THZA 3FROA 4A73A 1NOKA 1DRVA 4DJFC 1CYEA 4FE3A 2IZ0A 4HNRA 2ZATA 4IX1A 3HE3A 2AW5A 3A4VA 2EBWA 4Z9FA 1BXRA 1SHLA 2NSHA 2J9ZB 1YGYA 3G13A 4KDFA 4M9UA 1CQJB 4MRMB 3L0YA 1FDTA 2PAAA 1XMJA 4PNHA 2Q3LA 3OJFA 1QF7A 3THYA 1Z0UA 3JYHA 1TU3A 4Y2UA 5LXTB 2QOEA 5K3BA 1RWVA 4X1KA 2PWYA 2OV6A 4GDFA 3AUTA 3FH0A 5A6VA 3BCUA 1QYIA 3LY7A 3IXQA 2W2LA 2ZKLA 1H8EA 3SM3A 6Q21A 3E22B 1M1YA 3QJYA 1AUOA 3MT0A 1ULTA 3S6JA 1U0TA 2JGKA 1Q2UA 3A0UA 1ZD2P 1HDEA 4QYIB 1QNLA 3JXEA 2WYVA 4FOSA 5EPUA 3V1LA 1XF9A 5EJAA 1Q22A 1W4CA 3B1KA 3JYNA 2PRZA 3AUYA 3GX1A 1SU4A 4MVCA 4QFDA 3Q1LA 5AW8A 3LVQE 1I80A 1ITZA 3PRKE 1GP2A 5ALEA 3UXHA 1AX9A 2Q3CA 2JCGA 3CHYA 4B44A 1P7YA 4XWKA 1JL3A 5KOJA 3T1QA 1GNLA 2BJWA 3AXTA 4RE5A 4UJ5A 4X64B 1I3KA 1KJ8A 1NZDA 1XA4A 1YA4A 4MWZA 2DB3A 3SX2A 5M5BA 1SC9A 4BLRA 1OLXB 3T5MA 3U7QB 1O94D 2OXCA 3NC0C 1KKUA 1EYZA 1NWCA 4HOYA 2WDPA 2N75A 2PLRA 3KWLA 3R2JA 5MN4A 1EM6A 4GNRA 2VHEA 3WP1B 4LEIA 1KEZA 1W2HA 4LWOA 4P7FA 4D56A 1J90A 3NNDA 5L45A 4MYDA 1EFUA 1RC1A 4P92A 3KJNA 1DBVO 3KJXA 3P9ZA 3QP9A 2XGGA 5TEWA 4COKA 3CINA 4E0BA 2WA2A 3K35A 1VL0A 2V97A 3Q3HA 1TKRA 1IEXA 2C2KA 1H8HA 2GEJA 3A3NA 2VYND 4H7HA 3IKJA 1CSEE 1QV6A 1XWFA 1KVSA 2BZ1A 2HJWA 4FU0A 4WFQA 5B3LA 3CMCO 4FFPA 2VJNA 2Y92A 1M1YE 2WSMA 4CQLA 5KVCA 1RC0A 3S2YA 4PTZA 4F6LA 3IOBA 5ICSA 3LUHA 4I46A 2VHXA 5C0OE 4EQ6B 1H5NA 3DUWA 4DLRA 1SPBS 2PKEA 3RU3A 3ZDQA 4DLZA 4EW3A 4J1TA 2QPLA 4G26A 3BJRA 1DFGA 3ZXYA 2MU1A 3MEQA 1AB5A 3UPTA 3K94A 3WB1A 4LGMA 3NJRA 1MABA 1DNPA 1JI0A 4J7AA 4CN8A 3HJUA 4RQUA 4EPWA 3RVMA 4JFRA 3MUNA 3L0OA 4X7PA 5BQOA 4DR4B 1ETUA 1OWMA 1J2TA 1UMBB 3HDHA 3DDUA 3R74A 4CEIB 1MNAA 1XDBA 1RQPA 3P9KA 5A0VA 4BQRA 4IH1A 3PJGA 4KR9A 4ER6A 4D3SA 4OJTA 5FAXA 2HNBA 1QIEA 1L7RA 1RJ9A 3VU3A 2XTMA 1F4LA 1FFXB 4J0HA 4JOQA 1DXQA 2JEYA 4EECA 4M38A 5DJ5A 3W8RA 3DZ8A 3ZBTA 2R66A 2AR0A 2YJTD 4OKSA 4IYRA 4ZVMA 1H4VB 1KAGA 3IT0A 4OHVA 1KY4A 3VNRA 4WLVA 2G9NA 2H31A 3HMQA 2VJYA 1QH9A 3BIWA 3KD3A 3RUFA 1Q11A 1A7AA 2MHCA 3KQUA 3KALA 4OMCA 4EYOA 2IU4A 2W0SA 2XUAA 3EFBA 4PSVA 4U9UA 4Y0AA 1E1KA 3KJQA 4BO2A 1C1XB 3O8QB 3SJBA 1XL1A 3GL9A 3RVBA 2DR2A 1H3FA 3E2IA 3PXEA 2IVZA 4YP5A 1T0HB 2Q5FA 3L4BA 1WXQA 3A1NA 4YTEA 2I1VB 4G8BA 4BBAA 2P2LA 1MJGA 2E85A 1PUJA 4KQFA 1JALA 4JUFA 1O97C 4CV2A 5IBPA 3P4XA 3VYVA 2BM8A 3RC3A 3PBKA 4DM3A 4EB0A 2ZGVA 4AAYA 3WXMA 2BH9A 3SWWA 4CR6A 1GQYA 1F8UA 7REQB 1DI0A 1Y80A 3B9PA 3G6KA 4I4NA 1GEEA 4JLKA 4BGUA 3W05A 4E46A 4E5DA 3H2ZA 5LP6C 2VSQA 3JQ9C 5ITZB 1BQ4A 4RY2A 4JZYA 1O5IA 1QVAA 3D43A 3J7AC 3VRHA 1Z4PX 2CFSA 3P2EA 4TLLB 2RAVA 2Q5QA 1KVRA 2R8BA 1L5MA 2QF7A 1O6ZA 2FUKA 4GP9A 4HEA6 2QHXA 3A1CA 1YDGA 2IEIA 1ZLXA 3GH3A 5AXAA 1YZHA 3LWDA 3R3VA 2PJZA 4I9FA 4IJMA 5JSQA 3VR4A 4BJHB 1W0JD 1ZQ9A 4PGAA 2DERA 2VP2A 1ZGCA 2CLCX 3ZXUB 1IE3A 4DXHA 1UC4B 5DNAA 1O89A 2J5QA 1E9SA 2R4TA 1NHGA 5I9NA 1DKMA 5AI9A 3BXGA 5JC1A 1ULHA 1GU1A 1X1SA 4H59A 3UPUA 3ISTA 4OFXA 3Q8LA 5EP3A 4EITA 5BSUA 5L3SA 3D8SA 1QYXA 2RIPA 3L7MA 4FBLA 4H6WA 5CFZA 2PM8A 2YN0A 3EEYA 1NN0A 3PKIA 3G8DA 2GK4A 4LCJA 3KSAC 2PKQO 1VLHA 3N86A 3PPYA 1EK5A 4PSCA 4AURA 4KSYA 1SRQA 1R0WA 1TYEB 3FD8A 3QPVA 3L7NA 2BFWA 3RDPA 4TKUA 2GOYA 3TIGA 4EF5A 4URVR 1AHNA 3JQ8A 4WZBA 1DTWA 2QN9A 4RGYA 4LCBA 1SK8A 4IS3A 5GOTA 3ZIAD 1S0UA 3LBAA 4ZVSA 1BQEA 4TSFD 3WLFA 3QV1A 1J56A 4RTKA 3WJ1A 4DWOA 2EJCA 2VRCD 3P2YA 5PNTA 3SAJA 1J00A 2WTXA 3GNQA 4L5JA 4MYSA 3T3IA 4DSUA 1R6TA 1OKKA 2BGJA 2TS1A 2VRBA 2DFTA 3FDJA 1EXMA 1V41E 2PGLA 4HXEB 3RUAA 5JAUA 1N3IA 2X4GA 3KTFA 5AXBA 3ID6C 3SJZA 2E4AA 2TSYB 2OBBA 1X74A 1H6AA 2A2ZA 1IBCA 3CBQA 3ZK8A 3SNHA 3HKDB 3EDMA 2V96A 5JS8A 1KETA 2X86A 3GG2A 2FPRA 3L4SO 1QP7A 2X41A 3IV6A 4DJ5X 4WJLA 5KYKA 2N1BA 3NAZA 4C14A 1CIJA 3H8SA 4IZ6A 4ZQIA 4EZIA 4ZCPA 4YQZA 3K8OE 1T2DA 2FMTA 3KQYA 2ZUBA 1U2EA 2WJGA 4ALIA 5LA6F 3L77A 1WOYA 4D45A 4F12A 1GAXA 1OU0A 3FKSD 4QE3A 2IC5A 4JJAA 4WZBE 3ZHUA 1L7EA 3I0ZA 1M75A 3BE8A 3CF2A 3TBKA 1EXVA 4YRCA 1JVSA 1TYDE 3DAYA 1U63A 1FP4A 1TYAE 2J46A 3ZZMA 2R87A 3N8IA 1XTUA 2W93A 2F3QA 3C87A 1C1DA 1ICEA 1D2MA 4MWTA 1XMOB 1KAQA 3EGWA 4H1HA 5L51A 3DQZA 3O0TA 1HE5A 5CNJA 4PNZA 2BWJA 4DDKA 2XBUA 2AN4A 2ZJ0A 3LU1A 3MJSA 4YALA 5JEEA 4C78A 1HDIA 2I2FA 2G3YA 3C8DA 1DO2A 4FHCA 3TR6A 3AF6A 2Y3IA 3PXCX 4CIWA 3CG4A 1T3ZA 3UGKA 1LBHA 1GZ6A 2A84A 1JG7A 2RGCA 3L6EA 3MCUA 3ML1A 4UXHA 5JNLA 4KPYA 3I61A 4BMSA 1GZUA 4DJAA 3HG7A 2ST1A 3A1SA 4BE7B 2CCGA 5JS1A 4IKOA 1SVNA 5EXTA 5CM9C 4O2BF 2P9ZA 2WKQA 2IZOA 4DA0A 4YUYA 5B6JA 1N9GB 2QUAA 2XVMA 4PHTA 1NKTA 4HDSA 4MV3A 1KMCA 2R6DA 1V5FA 5CW2A 5DF1A 1ZAYA 3F9RA 1II8A 5CH8A 2LUOA 4FC7A 3OECA 1RHQA 3H2IA 1KEWA 4BO7A 3D2LA 5EKUA 2FP4B 2ONKA 2AW3A 3BK7A 3M6VA 4WQMA 4ID3A 1GLGA 2NQ8A 4JOBA 5IZCA 4DM4A 1XTTA 1RRVA 3H2BA 4P2GA 2XMBA 5SYAA 4WXYB 2VAMA 5J5CA 3H2SA 1YS4A 3TRIA 5LP6B 3NMUF 5LB2A 2NSJA 1Q57A 3OFNA 4FOTA 4OXXA 4BMZA 1HFKA 2FEWB 3AIMA 1Y89A 2DWCA 2PGOA 1WP4A 1TQ8A 3HA5A 4AXBA 4BVGA 4ZHQA 2NMVA 1WDMA 5EUBA 2P9YA 2YWBA 3ESXA 2JARA 2O20A 1JLKA 2SKEA 1UPUA 1Y0BA 1V8BA 2A88A 1W2GA 2DWQA 4HZUA 1GV0A 2ROQA 4KFSA 4V3CA 1JBKA 1XQXA 2ZR7A 1GPAA 3OLZA 4KN5A 1LDGA 3G0OA 3F3KA 3MGAA 4LZOA 4OL0A 4ZQGA 1H5QA 1QO0A 2XTAA 2G08A 4PPNA 3ZHXA 3R4VA 5EHZA 3L05A 2DRIA 3LX5A 3PNMA 3P32A 5CLGA 5DGXA 4DNXA 1C4XA 4I1VA 2NO5A 5HHTA 1E7YA 5I7AA 4CCAA 4F38A 5JDIA 2JVIA 4LX8A 1VP9A 1P5JA 2ZUWA 4IJQA 4YRKA 1FZTA 2CF6A 3Q9LA 4QPZA 4Y0VA 4NS4A 4Y9UA 4MP3A 4YUXA 1OF1A 4P3XA 4F4JA 4QUGA 4NSNA 2H16A 2W6IA 1DKRA 2DQSA 3NTOA 3QBDA 1A7UA 3JVUA 3D3EA 1CVIA 3QNWA 1MKYA 1QZXA 1YRHA 2VQEB 2XXAB 5BSTA 2P4HX 4DV4B 1YCGA 2EKDA 1WOMA 4L5YA 2D6FA 1DJLA 2IOQA 1KH3A 1G20A 4IMJB 4EBFA 1PVVA 1UXHA 3H5RA 5LXTA 1Z6GA 4UW9A 4M9SA 3QNMA 2HMSA 3H1AA 2XB6A 1JIVA 1XCPA 2R60A 3E22A 2WWGA 4TX1A 4QYIA 1X9IA 2O0HA 3GRAA 1AGPA 3PHIA 5EY5B 1FFDA 5ALMA 4MRNA 2W2MA 4Y2YA 5ESDA 2GLUA 2IOYA 5ILGA 5B7QA 2YJNA 4FZRA 1UJBA 4UZFA 1MQ9A 5GGYA 5K4HA 4WZ6A 5EMNA 3FDIA 1LNQA 2GAFA 2IP1A 4GI2A 4PLZA 4Z1MD 1EFLA 2GD2A 1ZOLA 4OQYA 1ADGA 3GJ7A 1NJ6A 4TL6A 1MO4A 1VSVA 2BE9A 4J3FA 5IDWA 2IUYA 1XIVA 3U7QA 2YJ3A 2EX4A 4YNBA 1MXHA 2X2EA 4XEHA 1K4YA 1RKQA 4LSZA 2WZCA 3TQOA 1XMPA 1GYRA 3BRQA 3R41A 4XVHA 3TMKA 2AOWA 3PUZA 4YDHB 1NXSA 2YQ4A 2WB2A 1BRMA 3BYZA 2ZQ5A 1G20E 1ORWA 1YDEA 2HRQA 4FX2A 2WEKA 5JASA 2G04A 3BFVA 1FP7A 2RI1A 4GYKA 1UFQA 4P34A 4IDBA 1ECPA 3QOXA 2X1HA 3EIUA 3HB1A 4LTDA 2QTTA 3TF5A 1Z3IX 2NSYA 3C7TA 4GBED 3EG5A 2YL2A 4MK4A 1YZFA 3IP9A 2XF8A 4B5LA 2VHYA 4BFWA 3VPHA 4EQ6A 2YMQA 1EZ4A 5DGCA 4IEEA 1SG6A 2V74B 2MSCB 5BWOA 1RE0A 1V95A 2BKXA 4RCYA 5DHFA 4HN9A 2J4FA 5AW4A 3KEGA 1XE3A 3FTCA 4V1CA 1ZRMA 2HSJA 3E9RA 3QMPA 4OY3A 4B45A 1NVGA 4CDGA 4EF4A 5B7PA 3PEYA 3DVRX 4EM6A 2PUDA 3W5DA 4XH9B 1CVRA 1DAIA 1GADO 13PKA 1UMBA 2JIPA 2PGJA 4LOLA 3U3OA 4CLHA 3ICEA 2NO4A 3PHJA 3QKUA 1GPUA 3AESB 4Q6BA 4NV1A 4UAUA 2C84A 2NP6A 1TVKB 2ZJFA 4B6GA 1ZCBA 5DNDA 1ODCA 5ALGA 1UXOA 3FBGA 5FBKA 1FFXA 3OJ0A 4DTIA 3UMBA 3EWSA 1W49A 1DG1G 3LHFA 2Q5CA 3RYFA 3WNDA 2CZGA 2VBCA 4RMIA 4W1SA 1IB0A 3G85A 1INLA 2C9MA 4S0ZA 2AV6A 5LQAA 1H2BA 4Y6SA 4Q3LA 4EG4A 2WYWA 1TCUA 4L7VA 5CTJA 4ZOAA 1E1NA 1NLMA 1JTFA 1Y33E 3WYBA 4BQIA 3KD2A 4EEKA 1T1JA 1S7GA 2D74A 1Z39A 4D9MA 1X80B 1C1XA 1T5BA 1VL2A 2C0PA 2YS7A 3O93A 5KYYB 1G38A 2JLAA 4I1IA 1S8OA 3LLUA 3P5SA 4Q3OA 4GOND 1IPFA 2ACKA 2NUBA 4WPGA 2H8GA 1HFWA 2GH1A 1UR5A 2BRUC 2GCNA 4L73A 2I2CA 4N6NA 1US8B 2DY0A 3EVGA 2UYCA 1DFHA 5DBFA 1ICIA 3C7DB 1OPXA 2ZJYA 2Y6UA 3COVA 4M37A 4AIRA 4DXAA 2V5VA 5ITWA 5TMEA 7REQA 2VBFA 3IAEA 1RRGA 1M5TA 3QPAA 4ZVRA 3L7LA 4GUDA 1L7AA 2NU9B 1UJ6A 3CRW1 4ENTA 2X22A 2D13A 3WWOA 3KV1A 1BX0A 5ITZA 1XROA 4O3FA 4NCKA 3S2GA 4JODA 3URMA 4DN6A 4IXTA 1SQ0A 1PW7A 2E4VA 3CZ9A 1JHOA 3KSRA 3OCCA 2XCSB 4LOIA 1JE1A 1T5SA 2MSDB 1N36B 1NUSA 1XYVA 2WA1A 3E5NA 4JUBA 4H18A 5DSZA 1ZEMA 3S8MA 1VRVA 5I48A 3MJCA 1ENPA 2FW7A 4BX0A 1N6RA 2O3TA 3P0FA 1IVYA 2E4YA 2Q0SA 3LGSA 4PQFA 1CRWG 5D1NA 4GM1A 4X20B 3RIEA 1ISIA 2XYQA 4TQAA 4WK0B 2OBMA 4IGKA 4NU6A 4X8HA 2HZBA 4Y6RA 5BSRA 3NHJA 3U7JA 4ZJZA 2BF4A 3ECSA 4J9UE 1A50B 3AZQA 1CY1A 2QVXX 4NWIA 4BP9A 5KSOA 3SVTA 4NMXB 5CM8B 4XSVA 1UBJS 1FXWF 1GITA 4L9WA 1LK7A 4RO0A 1RP1A 3ORYA 5IAAA 3O94A 1BW9B 1FQOA 4HJRA 2BHTA 1OA0A 2VAPA 5LLTA 3K92A 3CLRD 2B25A 3S81A 3IP3A 1M2OB 1Z12A 3OLYA 3E9EA 3U81A 1BVYF 1TRHA 2G67A 3BERA 3N2KA 2VK1A 5IKOA 3ZHTA 1EE2A 1W35A 4P32A 3UT6A 3QVLA 4L50A 2O3SA 4P82A 1NNI1 2C4TA 1AKMA 1H9BA 3HVRA 2XVAA 4KX3A 2C7OA 4OQQA 4RPGA 5TXGA 1GM5A 3GUYA 5A5VA 4MRSA 2JFFA 2DF8A 3JPWA 2M6SA 4FWBA 4XASA 1E2UA 3I2IA 1G4UR 3HDTA 3LYAA 3E7PA 1DUSA 1RBMA 3MLBA 4HDNA 2VTKA 1V3VA 5IG2A 3C4VA 3KVRA 4RE6A 3IUNA 3PVZA 2V6FA 2WIBA 4MW7A 5JOQA 3WAKA 1UEJA 3QXCA 5BUQA 2D06A 4DC0A 4FNOA 2YNMC 1XD9A 2J9XB 3F6RA 2X9GA 1YB6A 1OBVA 5T4EA 3WGVA 1ZM9A 3MWJA 3DKIA 4BXOA 4IOMA 4NEGA 4B0PA 1YQXA 3NWEA 3W5SA 5ITSA 2Y1XA 2XTZA 3O2QB 5AMXA 3ENVA 1SEVA 3FMGA 3W3ZB 5F2NA 2LGJA 5EINA 2ACWA 1WY5A 4O4LB 3HKDA 4ARCA 2R8PA 3RS5A 4DRYA 4C6TA 5TVGA 2NU8A 5M29A 1NQXA 2C9OA 1YACA 2VUTA 5DYTA 3BA1A 4KWEA 4BGVA 5JXJA 1JE0A 1YDMA 4QHYA 2PKXA 3QHPA 3T8YA 1JMYA 2J3KA 4ZEMA 5AJUA 1FNCA 1F7UA 3GGOA 1XMSA 4RHCA 3OWXA 4RZ2A 3OT5A 1NJSA 3HL0A 1Z4QA 2FZ5A 1S96A 4ROTA 3ODGA 1NUQA 2QTLA 3P9QA 5E2AA 4BNZA 3KAPA 4OHFA 4R1SA 1T2UA 3IUQA 4NABA 2CE2X 3K1AB 4ETMA 1GFIA 1VIVA 4FKZA 3RAEC 3U6KA 5EJ7A 1WTAA 2APJA 5HKKA 4AJ9A 4MR8B 1A8IA 2WVHA 1D1QA 3NI2A 1YS7A 1C3XA 3PHHA 1S2OA 4JT8A 4JJ8A 4MW6A 4DZTA 1KP2A 4IHAA 1LH0A 1U2ZA 1T6BY 1Z35A 2BKLA 1O95D 1OBHA 3AQ4A 2R6AA 5AVTA 5JZMA 5LDDC 2V3WA 1U1CA 2HSZA 3OZCA 4Q3EA 5BMVF 2C07A 3PUIA 1AC5A 2WU4A 5AKZA 5KOHB 4H0NA 4PHHA 5AJHA 3A3PA 5JAOA 1RYBA 5A5EA 1N9GA 3UW3A 2GKGA 4FBMA 4EKNB 5LOVA 2CSXA 3UJAA 1KGSA 1W6UA 3O03A 3D6MA 5K03A 1AQNA 4B6JA 3UKJA 2VZ8A 4M54A 3WGHA 3ER9A 1QZTA 2LV8A 3IOYA 3KE8A 4JIMA 3PQFA 4GYYA 4B81A 2BIFA 4BMNA 4Z86A 1IYZA 1Q14A 2YW2A 4ZAWA 4FZVA 4XXHA 1ABEA 2IYYA 5LP1A 1NNLA 3BGWA 1P74A 3OZVA 1NFRA 2PGNA 1IN5A 2ZIGA 3FR8A 3O4VA 3O8OB 3JQ9A 3OUZA 3EZ2A 3BX1A 4IMPA 5DTMA 5JCJA 3ZV4A 4F71A 2X8LA 1X39A 2QMUA 1T35A 3LQKA 1IMJA 3MJDA 3NKVA 3IE1A 1TLLA 2BR5A 2QTVB 4ZREA 4QOJA 5MDHA 2PUVA 1NIJA 3KB2A 2DH6A 1GQFA 3HHPA 2ZIAA 3USCS 5CEFA 2GFQA 3RAJA 3ZEAA 5IUJC 1YA6A 5G4KA 3GWGA 1OILA 3L46A 4ZYYA 1GV1A 1PJ8A 1H2XA 1TLTA 3DM5A 4ZAYA 5G0SA 3TSCA 4NPCA 4X91A 3OF3A 3ZJTA 4QBKA 1G6HA 2ZRHA 3DEYX 3NRBA 1TW2A 5COBA 3ZQKA 1BMQA 1SBZA 5EZYA 2W43A 3HEBA 3JWEA 1L7XA 4P36A 1W75A 4R8KA 4DC9A 1T4GA 2VJCA 4MKZA 4F6RA 2G36A 1OYWA 3MIZA 2GSDA 1YIDA 3IOCA 2Q1SA 3VHQA 1RI4A 3WMWA 4B3SB 2PQ6A 4HP8A 3ZBQA 1FUEA 1VLJA 1VZ3A 5JAHA 1JYEA 2P6UA 3RS9A 5FKJA 4BX8A 4RZUA 3P97A 1ECBA 2Q3JA 1T8SA 3P71T 5DTRA 3TIVA 2EZUA 4CN9A 4BGDA 3ZGZA 1D4AA 2BCEA 4KVGA 4OBBA 3DC7A 3GRFA 4Q16A 1CS0A 1UDWA 1ZAKA 4P4LA 4LG1A 2OCLA 2P0AA 4P7JA 4KO3S 1Z0FA 4KQEA 3LYUA 4O02B 5D5HA 5G0TA 3EZLA 2AKEA 5LU9A 3KT8A 1T0IA 3STTA 3ICQB 3H7AA 3OY2A 3FZEA 1W5FA 1O5OA 5IAGA 2QMOA 3C6MA 2NUPB 3ZDCA 3T9AA 5K9ZA 2Z58A 1TJ3A 3N0WA 1V9CA 3HJBA 5I51A 5JEDA 1DTEA 1U9CA 2OV1A 3WBKA 2H07A 3QQ5A 1NJFA 3IR7A 4PHCA 3JR3A 3Q6IA 2B83A 2ZYGA 3IIIA 2J6IA 3CPHA 4XARA 3IDAA 1GN9A 4CFSA 2JAWA 4TS1A 4BQPA 1E2PA 3KR2A 1PG2A 2IHYA 3VZDA 4DZRA 2ZXUA 7ADHA 1XVAA 4MIYA 2FN7A 4JITA 2Q4EA 3AF0A 1XGKA 4OMFG 1L9KA 2PPVA 4FLEA 3RJ9A 4LI0A 5ELLA 3UHAA 2WWRA 1NFQA 4ZYZA 1QP4A 1WDWB 3CE9A 4PRYA 3WB9A 3E9NA 5KKNB 1J4AA 2V6GA 4R69A 2NAPA 1NW4A 2VYCA 4V0MA 1FXUA 1CZUA 2HDHA 3GAZA 4U7HA 2YKGA 2EYQA 3FSJX 4MGZR 2QMQA 4EZEA 4JU9A 3N0XA 4ZKDA 5IVKA 4OXQA 5FOVA 3RVLA 4LF9B 5KQLA 2WHEA 3HV2A 2KM1A 3SXJA 4BV9A 4L78A 3D59A 4P84A 1K8QA 3IAXA 2O2YA 2BEUA 2H1WA 2RONA 4QPPA 5C7IO 4TRRA 1CIVA 5LQSA 5D86A 4O4HF 1L5NA 1FRQA 1WEHA 2YN2A 2XMSA 1H6CA 3SQMA 4FNAA 4Y2GA 3KR9A 3E9ZA 1Y48E 4BZQA 3IXLA 1EJ0A 3ANSA 4M1KA 3GAFA 4PGFA 4Q7EA 3BILA 3K6RA 3WRYC 5A3RA 5A03A 4IGIA 2NTJA 1D2AA 3KK0A 3SNKA 3G2IA 4QXPA 2XQGA 3QELA 3OCJA 1VHQA 1VE7A 3RR2A 4C9BA 4E07A 4KDCA 5IPFA 1BEEA 1E4EB 3LA6A 4DF3A 4JP5A 3GW8A 3VNAA 4YK7A 3RRZA 4TKLA 1CZKA 4C0JA 2GYYA 2FR1A 1OGIA 1N6LA 3L01A 1SEPA 5CJJA 3BRCA 2ZWIA 1S3IA 4BYMA 4ER3A 4V0ME 1DJPA 2H2IA 2QD4A 2R8RA 3GA0A 5E7QA 3ESYA 1KP3A 1HQCA 2CYCA 4EELA 1XMIA 4V0KA 3OFKA 1BZYA 2OC4A 1IFXA 4OA8A 1ZH2A 1SVWA 3E35A 2HMYB 2EBUA 3FTPA 2ZSAA 5KNBH 5C4GB 4IINA 3SE7A 3OE5A 2ZM6B 2LKCA 4WBXC 4ZGBA 4RMGA 4F8YA 3JAWB 2PMWB 2XLCA 1DIHA 5HG0A 3OY7A 4EYQA 5JCZA 2PRIA 4RWZA 5EMHA 2XGOA 2R1UA 2PSEA 3WQQA 3LUGA 5D3MA 2YHUA 4D41A 4BKOA 2X9LA 1DBPA 4JI1B 3KL4A 2WKWA 1XLVA 3EBLA 4FDVA 2NYAA 3OZ7A 3IDOA 3HB9A 4D82A 1A8SA 2ORYA 5A7FA 5JQGB 2CXQA 1CW2B 2FFAA 4C3UA 5KYYA 5AW2A 3QXJA 4B6EA 4UOQA 1V6SA 3MMPA 1Q77A 2FVXA 4Q1AA 4D4IA 2OXIA 3JAKA 1WW3A 3F6CA 1A7JA 1RRMA 1ZD5A 1HGXA 1N2OA 1ZI8A 2HWKA 4WNAB 5AVVA 2BBWA 2QW1A 4IUYA 4NY1A 5H80A 2QSJA 1CUHA 2A0XA 3F7MA 4E32A 1US8A 3DGFC 4UOZA 3ANXA 3QI7A 2SICE 1P2GA 3PNPA 4WEQA 4YUVA 2D59A 2NU9A 4ZDWA 5BR8B 1WBDA 3S68A 1XALA 2JL1A 3E3NA 4LJ6A 2XXBA 1HQKA 4CG3A 5AUNB 5JWOA 5CIYA 2A0YA 3M4ZA 4ECAA 3QXGA 3VO1A 3OM0A 2AMFA 3CO0S 3FYDA 5JZ9A 3KQNA 3IBCA 4GH5A 3FKQA 1GDHA 5G4LA 4A0SA 3BQMB 4OHOA 3CXUA 1JV2B 1WHTB 5B30A 1DBIA 2XZDA 3IV9A 3RYHB 4F11A 3PQ8A 3JASB 4WACA 5TJ9A 4E5YA 2FSUA 1DOHA 2QTAA 2O0LA 4UVDA 2ATEA 4DEYA 3THOA 1GKKA 4JI3B 5ITVA 3NIFB 4QIHA 3OOEA 5TLSA 2BSQA 2A9JA 3NDJA 3LWZA 4AUNA 4PONA 3GT7A 1BW9A 1HY3A 1I1OA 3NHMA 2BM9A 4DQVA 1WABA 3DOHA 4B4DA 5ADVA 1TK2A 1YE5A 4BFTA 3GGCA 3PIDA 1N7JA 2YVLA 3WGGA 2P6PA 4F4FA 6ABPA 4S05A 3QYJA 2XF2A 1ECCA 2XUOA 1DG9A 4I4IA 3VZQA 1CRZA 1EHCA 1K3FA 1SCJA 2H2DA 3AVQA 4E3ZA 1Y7PA 5ELXA 2V7VA 3I53A 3L8GA 2P2DA 4FCCA 2ZYAA