4J0EA

Crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
296
structure length
296
Chain Sequence
MFTAKCAMQNIRNVAIVGSGQMGSGIAQVTASSGFNVMLADVNKKALDRAMKAISQSVTHLSKKQKGTDKEKSDFVTLTMSRIKTCNNVSTAVADADLIIEAAIENIDLKRGIFAQIEQSCKKDSILTTNTSSFLLEDVAKGLQDKTRFGGLHFFNPVPVMKLLEVIRSDDTSDETYATLIKFGTAVGKTTVACKDSPGFIVNRLLIPYFFEAARMYERGDASMTDIDEAMKLGAGHPMGPFELADYIGLDTVKFVMDGWAAKYPEVQLFEASPLVDKLVAEGKLGRKTGDGFYSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1
publication title Purification, crystallization and preliminary crystallographic analysis of 3-hydroxyacyl-CoA dehydrogenase from Caenorhabditis elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 118
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4j0eA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j0eA01
4LK3A 3TQHA 3OA0A 2CY0A 2F1KA 3DHEA 4AICA 1IY8A 3QA9A 1U2DA 4PLYA 3RSHA 4LVCA 3WB9A 3H5RA 3JYPA 2IEBA 3EK2A 3JQ7A 5COQA 2AE2A 5T57A 4EBFA 1XQ1A 4IS3A 3VPGA 3CTMA 3EZLA 4RPLA 4IJKA 3OIDA 1EFLA 1PWXA 1A72A 4MVJP 1R16A 5JCJA 1LA2A 1FDTA 2CDCA 4WLOA 1IZ9A 1AUPA 1LI4A 3IMFA 2EW8A 3ONEA 4YXFA 3IOYA 3GNSA 1ZXBA 3E9QA 4PGFA 1RM5A 4RVGA 3CTVA 1NNUA 4L8VA 3EW7A 2B4TO 1WXDA 3CIFA 3P7MA 2WJPA 4GX1A 5THQA 3KYDA 3OEYA 1C1DB 5KJEA 3O8QA 4OSOA 3UAGA 5K0ZA 3HDQA 3JQGB 3AM5A 4KTTE 1SO8A 3ZCXA 3Q11A 5B12A 4R3WA 4CLEA 2C5EA 3RCBA 1ZJYA 2YQ4A 4UEOA 1O9BA 3I6IA 3Q3CA 3GG9A 1E5QA 4OSPA 3D5TA 4J43A 4QXMA 3BZUA 4IPTA 1EEHA 1Q0QA 4Y67A 2BF7A 3A14A 5IDYA 4XA8A 4OM8A 2E37A 1NVTA 3NV9A 2DTXA 2GERA 2CMDA 5F1KA 3PP8A 3INRA 3WQQA 1N7HA 1E3SA 4BKUA 1K5HA 4CM4B 1DC5A 5JPIA 4A73A 5I8WA 2XOXA 3AUUA 3QW2A 2Y1CA 2NV6A 2D8AA 3NJ4A 2FY8A 3COSA 5IN5A 2A94A 1LNQA 3RUIA 3QWHA 1KC3A 1J0XO 5F5LA 1HXHA 2IDZA 2EKQA 3DBHB 4GPD1 2WSBA 4GKVA 5CDSA 2Q1SA 4TMFA 5C5IA 1Y6JA 3HFSA 2GSDA 3CZMA 3FBTA 1MV8A 3BXXA 3DQPA 3VOSA 1HKUA 4ND5A 1B2LA 3SC6A 1X14A 1ISMA 2OMEA 4P4NA 5DCYA 5ILGA 3VVBA 1GCUA 2BI8A 2HCTA 3WXBA 1NFQA 1CQIA 4ZRNA 2P5UA 4RPHA 1FDWA 3UN1A 1P44A 1YVEI 1C0LA 3TOZA 1B3BA 2Y0DA 4WE3A 3DMYA 5BSGA 4MVJF 3D3WA 1BDMA 4CMJA 3DZGA 1HLDA 2O3RA 1BWSA 1T4DA 3IP3A 5I7FA 4J49A 2IZ1A 2GN4A 1P1JA 1WWKA 2W98A 4ZN6A 3OP4A 4CR7A 4B3IA 5AOVA 4P38A 1QYXA 3W8FA 3KRTA 4CV3A 1QXSA 4BNXA 2VNAA 3GA0A 4RV9A 2VT3A 4R1UA 4CMEA 1UDCA 4R5HA 4WUVA 1Z7EA 1ONPA 4J7CA 4ZVVA 1K6IA 2ZB8A 3GEMA 3DR3A 2PD3A 3WOHA 5ITWA 5HBRA 3R1IA 2E6UX 4DQVA 2NQ8A 2VRBA 3QVTA 5AQ1A 4BV9A 2DFDA 1CETA 5HRUA 5GMOA 1DFHA 3KYDB 4O0LA 4XYLA 1Z82A 3GY0A 4MP3A 4UUOA 1MUUA 4XB2A 4UEJA 1SC6A 4RDIA 4HWKA 4TWRA 4DC0A 3H9QA 4BNTA 3B1FA 1H6BA 3TDKA 1T2AA 3CH6A 4RVHA 1B8VA 3C85A 4Y6SA 2B5WA 3T4XA 1LDEA 1U4OA 2PZLA 5JYEA 3DOJA 4IQGA 1XR3A 1PJTA 3PIDA 1X0XA 1L7DA 2X9NA 3DTYA 5TT1A 3BTUA 6LDHA 2YV2A 4KQWA 1LSSA 1WVGA 4QX6A 3BHMA 4J16A 3UCXA 5JFOA 2VTEA 4YJFB 1SMKA 3GC6A 4YA6A 3ST7A 1T25A 4FJ1A 4WK6A 4YAKA 4IZHA 1ADGA 3H9UA 1QMGA 4NBUA 4J91A 1E1LA 4NBTA 5EIOA 3UCFA 3NYWA 4CM5A 4CMIA 2HMTA 3ZWNA 1LRJA 2VWQA 4I9UA 3VZRA 5H81A 2B4QA 5JAZA 1PJQA 8ADHA 5KOIA 1U3TA 2HO5A 2QIOA 2OZPA 4K1LA 3JD3A 4B7XA 2FZWA 4CM1A 1ENOA 4LSWA 3RC2A 4GX0A 1OI7A 5IAAA 4E32A 1DC6A 1BVUA 4DA9A 3X2FA 1QYCA 1ZXLA 3TZ6A 1H6DA 2C59A 4D3DA 1R4MB 2BGMA 2VT2A 1Y81A 4JROA 4Q3EA 2JD1A 1RYDA 1QKIA 4RPKA 3DEYX 2I6TA 3K73O 2DUWA 5TQVA 1OBFO 1ZKMA 1E1MA 3VPFA 5JO0A 4YJDA 4AG3A 1KEWA 1K89A 1MG5A 3P5SA 4FGSA 3VDQA 3WGTA 4BKOA 3E6AA 3SJ7A 4CV2A 3DBLB 4KWHA 3JYLA 4NZ9A 3FPLA 2Y1EA 3ROKA 3IL2A 3W4KA 4E12A 3GNQA 1PJ2A 3OJLA 4DGSA 3GHHA 2Y1DA 2GUGA 3WFJA 1ONOA 3MCVA 4M89A 1FDVA 3GPIA 3U49A 3PHJA 2YZ7A 3HADA 5A9SB 4ZICA 5H83A 3UF0A 1NHWA 2PGJA 5A06A 4P8RA 4WEOA 4XB1A 3WBBA 4XYBA 1LC0A 2X58A 2Y67A 3GUCA 2PH5A 4JBGA 2C07A 4PZEA 3KLPX 3OICA 5A9RA 2JCYA 3PZBA 3H7AA 1UAYA 4EEZA 1LJ8A 3AOEC 1DRUA 3K31A 4KQXA 2PLAA 4D3FA 4PLWA 4ZQEA 5F1PA 5FEUA 4C7JA 2EV9A 5LDHA 3AM3A 1J5PA 5KJ6A 4GX2A 2NU8A 1P1IA 4AJIA 2C82A 3PYLA 3TFQA 2NVWA 2PNFA 5KCZA 2FPGA 4M86A 1XCBA 2OXIA 5G0WA 1ENYA 2BFMA 1HZZA 3I83A 2O2SA 1O89A 1KETA 1EQ2A 1VJ0A 4GAEA 3ZWYA 2GPTA 2PKQO 3WQSB 2F00A 1DFIA 2ZTMA 2HUNA 3DHYA 4JCOA 5B4TA 4PVCA 1VL0A 1LSJA 1P1FA 3PDJA 1T1RA 2A4KA 2NVUA 1XU7A 2OGUA 5A02A 1U9JA 2YDXA 1LC3A 1I8TA 4PN3A 5G4KB 4CMIB 4RQTA 3ZH2A 1DHRA 4UUNA 3O26A 3SXPA 5I7VA 3M6IA 3NT2A 4YR9A 5JDCC 4YVFA 5CEEA 2QYSA 5CP8A 2DQ4A 5CPFA 3BMOB 1MXFA 1RM4A 4IXTA 3UW3A 4FBGA 4RVSA 3L9WA 3ROPA 3RKUA 3ADOA 3WTCA 1UXIA 3H6KA 3UICA 1XDWA 3V2GA 3VH2A 3PWSA 2UAGA 5KVCA 4IM7A 5DBIA 3QVOA 4CLOA 1GR0A 3OF2A 3ZWPA 4XD2A 4CQMD 4IJVA 3WNQA 2ZB7A 3JSAA 3PJGA 4WCDA 4A26A 2I3GA 1SBYA 1ML3A 4TRRA 5U1PA 2P4QA 1E6UA 3WYBA 3ZWVA 3DXFA 3I4FA 3IDSA 2GZ3A 3RIHA 3VTFA 1E3JA 4ALIA 4DRYA 4QFDA 1M66A 4CM7A 1LLQA 1LEHA 4AJ1A 3ZZNA 4R68A 3AI3A 2D3TA 2J5QA 2UUPA 5DOZA 1NFFA 4Q3AA 1B26A 1Z75A 1PTJA 4K26A 1HTBA 1D4FA 3DAPA 3OEWA 1HE5A 1U5CA 4IMPA 3I1JA 5H82A 2WYWA 1NTOA 3VDRA 2EP7A 1NQAO 4YJHB 3PWKA 1Q7BA 1LTHR 4J0EA 1I36A 3V1YA 4C4OA 4BGIA 1JWBB 1JVSA 1H93A 1NASA 2HRZA 3A06A 3FSRA 1YWGO 2IEDA 3PPIA 4W4TA 2I76A 3RBXA 3LT1A 2VZ9A 1I3NA 1V6AA 1NHGA 4FDAA 2FZEA 3IAHA 4ZHSA 2NQTA 4MVJH 2PFGA 2OL4A 3SJUA 3QV1A 2JFFA 2TMDA 3GH3A 5I9MA 4MKZA 1KY5A 4E5PA 3AUTA 4CQLB 4E5KA 2ET6A 1Y1PA 2QRLA 4EDFA 4J0FA 2CZCA 5ADHA 2WDZA 5IXSA 3KEOA 1GQYA 1UAGA 3FWNA 2C0CA 2Q1UA 1KS9A 4U0KA 3IQDB 4DPMA 3BTVA 4J1QA 2LDBA 4BHTA 5FWNA 4AL4A 4CMBA 4ALMA 2X86A 3TN7A 4TRMA 1U3VA 1VPDA 3ANNA 4B8ZA 4WKGA 1GUFA 4M8SA 1Z45A 3SC4A 5CDUA 1E7WA 1YOVA 1E7RA 4ALKA 3ZV3A 2I9PA 3BHIA 3NKLA 4B7CA 4C7KA 3AK4A 1Q7CA 1GYRA 3RUCA 3JQFC 4NJMB 1C0PA 1KBZA 1P9LA 1IHYA 1TLTA 1WLYA 2C54A 5JSFA 3I9JA 4YCAA 4XIJA 3WSWA 2D5AA 4MKXA 4JJIA 3ZWWA 1TT5A 2GZ1A 1JU9A 1P0FA 3ABIA 4OQZA 3RASA 5AXAA 4K28A 1CDOA 2Y05A 4MIOA 2CDAA 4P22A 4OO3A 4CLOB 3W6ZA 3VVCA 3FTPA 4TKMA 1B16A 2OBYA 1H5QA 2VQ3A 4FD3A 4NFYA 4D0RA 4J9UE 4KOAA 1UH5A 4MDHA 2DKNA 1U7TA 1F06A 4BNGA 5KVVA 1D1TA 3HWRA 3A28A 1NPTO 2ZQYA 3TZQA 3ZW9A 3HB5X 4KUHA 1LDMA 1XG5A 1GUYA 3WSVA 4AFNA 4IIVA 3PZRA 1UJMA 4LRTB 4P4GA 4BO2A 4F3YA 2AMFA 1PQUA 1CEQA 3OFSA 2CD9A 4RPJA 4BUCA 1XA0A 1HDRA 2R6JA 2WTBA 4OGWA 3LLSA 3IUSA 3ZWMA 4QECA 2J8ZA 4CLRB 3KHUA 4CQMB 1JAXA 1R0SA 1V0JA 3D4NA 3HSKA 4D7AA 1NAIA 4EI2A 4AVYA 5EERA 5TT0A 4YAEA 3I9OA 2YJZA 3LU1A 3E9MA 4J6FA 2OHXA 4CUZA 1GEGA 4FIZA 4YDRA 1WP4A 1XYGA 1H2HA 3DBRA 1DAPA 4BL5A 5K6AC 1ZO8A 3MWEB 3ZNOA 2JD0A 1SEVA 1QORA 4FOSA 4CMHA 1Q1NA 2NTJA 3RUDA 3ZDFA 4WNIA 3A9WA 4PRLA 2EJVA 2IYOA 3O03A 3ASVA 1TB4A 3O4RA 4ILKA 1Z73A 4L4SA 3EVNA 3OH8A 2VNSA 3BMQB 4DUPA 1E3EA 5AXDA 3ZNNA 5A03A 1RWBA 1IPEA 3LT2A 3W4IA 3ZWCA 5TRTA 3ROQA 4OHUA 4BNIA 4EEXA 3L6EA 1JWAB 1EUCA 3KYCA 5COAA 4BO4A 4N5NA 2JFHA 2H63A 4DMLA 3ASUA 4XWYA 3UUWA 2D59A 2Q45A 1HT0A 1KVRA 3AM4A 5TJ9A 1LDNA 4GH5A 2O4CA 4BMNA 1LRKA 1SNYA 4J4BA 4NMHA 2JCVA 3ENNA 3RUHA 3V2HA 4RF4A 2EIHA 1B3RA 4KP7A 4LISA 3EGOA 1ONNA 3K9QO 3QVWA 3JQ6A 3PXXA 5L40A 4KDFA 4N54A 1HDGO 1TT5B 1U2GA 4DYDA 2JFGA 1Q7GA 1RKXA 3QSGA 4H15A 1QYWA 1I2BA 3BMCA 1V3VA 3HQ4O 4YRAA 4PVDA 2CVQA 4YJGA 3RFVA 3QWBA 4YTEA 5KVSA 5I9LA 2HSDA 3HUDA 2NVBA 2VUSA 1Y7TA 1P1RA 3WMXA 2AQ8A 1GTMA 1GFSA 2FR0A 3F6YA 2C2YA 2J6IA 4CM8B 1DJQA 1GPDG 5AXBA 4S3MA 2X1HA 3GK3A 4XCVA 2PKQP 3L4SO 1E3WA 3D7LA 5F21A 1QV7A 2IZZA 4CLDA 1B0AA 4N5LA 2Q3EA 3GFBA 5KJCA 2J3KA 3RUFA 3HG7A 4YQYA 1P0CA 5BNTA 5A3VA 2ZYAA 4YAIA 5DCWA 2UUOA 3JQ9C 4URFA 3SLKA 1BRMA 3ANLA 3N7UA 2QZZA 3DBRB 3DZKA 5EPOA 4JK3A 5KTKA 4FGWA 2XAAA 4BGEA 4J7XA 4L0QA 4E21A 3ZWAA 1NPYA 4KWIA 1H9AA 2YQ5A 3GVIA 1A9YA 3KM0A 4LMRA 5JCJD 2VYVD 3JQ8B 1EDOA 4E30A 4I9HA 5IXYA 3JCZA 1KEPA 1ZK1A 3AUAA 3GMDA 4W9NA 4DQUA 1NWHA 2O7QA 3B1KA 2GNAA 3WX0A 5L4SA 2GO1A 4CM9D 2RH4A 3LVFO 1YDEA 4B3HA 3JQBC 2CSUA 5CG2A 3PEFA 3UCEA 2JHFA 1GYQA 4W82A 2YV3A 3FWZA 4H7PA 4Y6PA 1U5AA 3TL3A 3MEQA 5L51A 2VRCD 3FHLA 1PS0A 2VYVA 4L74A 1NYTA 3Q2IA 3GDFA 4Q9NA 5JY6A 2VN8A 2O7SA 5DOVA 4X54A 5DP1A 4RLHA 2JD2A 4E4YA 2EHDA 3IS3A 3P2OA 4PZCA 4IGFA 2DBZA 2X5OA 1B8UA 1PL6A 1JN0A 1KVTA 4CM9A 3NX4A 4IBOA 2V6FA 1C1XA 2FR1A 3Q9NA 4WLNA 4LCJA 3GN2A 3AOGA 4FFPA 3PLNA 1VI2A 4E2WA 2VRCA 1X13A 4EUHA 4MVJE 3Q9UA 2X9GA 2RIRA 4Y9DA 2IYPA 1N9GB 3LF2A 4M55A 3M2PA 4RCVA 4E2ZA 1NX6A 5A4DA 3ZN2A 1UXHA 3DFUA 1ZIDA 4DIOA 3TPCA 1QYDA 1Y8QB 4D0SA 3K2BA 5FI3A 5I7EA 1LU9A 5TLSA 4Y8VA 1U8FO 1E3IA 3E82A 4B3JA 2VHWA 2WD8A 3R6DA 2O48X 3HE3A 3PIIA 3VZQA 3S2EA 2AXQA 2PZMA 5CEFA 2VZ8A 3PHLA 2Q2VA 5AVOA 2WE7A 4E5MA 2PGDA 1E3WB 3CKYA 1LLUA 1Y5MA 4BGVA 5ITVA 2W90A 1BTOA 2X0RA 1KY4A 2Q99A 4FC7A 4AJ4A 3BHJA 1NQOA 1U4SA 2Q4EA 3DHNA 3BMNA 3EHEA 4K6CA 3DTTA 1G1AA 1PR3A 3KYBA 1QLHA 4YPOA 1DLJA 5HWSA 5JDIC 4PCVA 2LDXA 1ZK3A 1HE3A 3QHAA 1BGVA 1LDGA 1J4AA 1XSEA 4CJXA 4HX5A 1Y8RB 1PZGA 3K92A 2Z5LA 3OQ1A 3F9IA 1LQTA 5T67A 1UZNA 3QWFA 1FDUA 2X6TA 3TNLA 3U62A 1YQGA 4DXHA 2VWGA 3GN1A 3H8VA 4A7PA 2FR8A 5F3RA 3MTJA 5G0SA 4L9RA 1RPNA 2BKAA 2D0IA 2VYND 2Q1TA 4I5EA 3WLFA 3MOGA 3B1JA 1MG0A 3F4BA 1L1FA 4RZIA 1YDWA 4ALJA 4GSKA 1DB3A 3INTA 3DC2A 4NIMA 3OJEA 1P31A 4RL6A 4ZQFA 3JQ7B 4EZBA 4J1NA 3ONDA 1E5LA 2EGHA 1I10A 2G1UA 4GWGA 3WGQA 3C8MA 1GU7A 3E5RA 3GT0A 3H9EO 4JP2A 1P1KA 2VYNA 4JBHA 3VPSA 4FS3A 3GEDA 1LX6A 2IXBA 3KBOA 1EE9A 3W4JA 1QG6A 3MJCA 3STHA 2ZIZA 2G5CA 2QX7A 2FWMX 2OUIA 1PJBA 3TZHA 4QEDA 1HSZA 3GGGA 3WTBA 5G0VA 3H5NA 4YT8A 2B0JA 4ID9A 1C1XB 4NU5A 2FMUA 3EYWA 3O8QB 1BSVA 1CWUA 2O4UX 2BMAA 1KEVA 4U8GA 3U3XA 4R9RA 1YJ8A 3RBZA 4CLXA 1UP4A 3LSYA 1JAYA 4GBJA 3AFNA 2R00A 1R66A 1PJ4A 3AW9A 3SVTA 1V8BA 2E49A 2Q2WA 3GVCA 5JE8A 3KSDO 4NU6A 4XQ9A 3ZU4A 4F6LA 3ETEA 2H1SA 1PL7A 3OJOA 5T6BA 4RORA 3RUEA 3PVZA 3SLGA 1C14A 3KXDA 3MWDB 1OZAA 3FD8A 3PFFA 1BXGA 1D8AA 1OAAA 5L7WA 4B8WA 1ADBA 1W73A 5MGBA 1ZFNA 3DONA 1O94A 4OYRA 4BB6A 2J3IA 5B1YA 3I52A 4PG6A 3RUAA 1GUZA 3S2FA 4AJNA 2C7VA 2G17A 1U3UA 2QW8A 4B4OA 2CDBA 3ITDA 2BHLA 3IC5A 4I08A 3E5MA 4G5HA 2Y99A 4U0JA 4J3FA 1JKIA 4R5MA 1XU9A 3NGXA 1EVZA 3AY6A 4JP3A 1ISHA 3V1UA 1TI7A 2EKPA 5T8KA 1SPXA 1ZSYA 2Q2QA 3WGOA 5LC1A 1DRVA 1JQBA 1Z74A 4L76A 1A71A 3OIGA 1IOLA 4OXNA 4UVIA 1WAMA 1ID1A 3DMTA 2GZ2A 3NUGA 4NPCA 4MINA 4N18A 1I2ZA 3U4IA 1E7MA 5DDIP 3I9NA 4DIBA 1PZEA 3FNGA 1O6ZA 2AQHA 2GCGA 4R1SA 5K9ZA 4B4VA 3CSDA 1I3MA 2RHRA 3LC2O 4E6PA 3KSZO 3D3WB 4IMRA 1GZ6A 4KDEA 2NLOA 4YRBA 3WNVA 4AJEA 5KJFA 3E8XA 4YWJA 1JA9A 4XIYA 4PLZA 3GQVA 4XRRA 4D79A 4WASA 3UKOA 5L45A 1E6WA 2IODA 3I9LA 1HZJA 5TSDA 2ZYGA 1HE4A 2IZ0A 4NK5A 3AY7A 1PWZA 1YJQA 3PTZA 4F45A 5G2OA 3ICPA 5C37A 4G2NA 4H3VA 1VJTA 1RYEA 5GY7A 3CMMA 2AW5A 3QVSA 3RC1A 1SOWA 1R4NA 4CMEC 3OHSX 4IUYA 3BA1A 3ITKA 5KNLA 1JVBA 3RU7A 1HDXA 4KZPA 4AJLA 4U6QA 3UGKA 1Q0HA 4Q3NA 3UOGA 4CL8A 2NNLD 1MGOA 3PQEA 5I9NA 4BNKA 2NU9A 2HMWA 2Y1GA 3EY4A 1NP3A 2GN6A 3R3SA 5FF9A 4XJTA 4EJ6A 1UZLA 2CFCA 2DUUA 1R0LA 1I2CA 2VWPA 2HJSA 2I3AA 3AI1A 2P91A 2JJYA 4ND2A 3NGLA 2Y93A 2FPIA 2VUUA 3ETGA 3F5SA 2IRWA 5HM8A 3CEAA 1PZHA 2GR9A 5CAEA 4DLLA 4EUFA 4GGOA 4WJZA 2A35A 4WCFA 3TF5A 3S2GA 4WLVA 3C7CB 4CLHA 1I32A 4E0BA 4TZKA 4D46A 3VH4A 4FR5A 5C7LO 3LLVA 5THKA 1DHTA 1TVEA 1O0SA 2BRUA 3K96A 4INAA 1GZ4A 1YKFA 3E9NA 3C7DB 3KLMX 1X7HA 5EJ2A 2I5PO 4MO2A 4WPGA 3FN4A 3AY3A 4FFLA 5L4NA 1SB9A 4M54A 1ORRA 3UVEA 1TA4A 3RQSA 4FC6A 4OOEA 4EITA 1F14A 1Z6ZA 1PGOA 1ZH8A 4GQAA 3IUPA 2WD7A 5A3JA 3K6JA 4OMUA 2BD0A 4YRDA 4IDCA 4Q3CA 3PGXA 5DNAA 5CEJA 4BNZA 1YONA 4XKJA 2P9GA 3ANMA 1D1SA 4YACA 2NU7A 4EW6A 4LCEA 4R1TA 2HJRA 1H0KA 2R2GA 3OSUA 3KSUA 2V6GA 3F1LA 4O1MA 3ZHYA 2WYUA 3GR6A 1T24A 1SZJG 1IULA 4IS2A 4PLGA 3T7CA 1AXEA 1NR1A 4JLWA 3BYZA 1AGNA 1VKOA 4JXKA 3OIFA 3VPXA 5JYDA 1U3WA 1P74A 1YQDA 2RBEA 3EUWA 2HK8A 3UXYA 4PLHA 4E2XA 1G0OA 3AJRA 3GZNA 4BNMA 1YB4A 2FP4A 2C5AA 3KO8A 2FOIA 4U5QA 2GD1O 1EK6A 5TNXA 2CVZA 1NQTA 4CM3A 3ZV6A 4E3ZA 4BOYA 4H16A 5A1TA 1QR6A 1ZK4A 4HADA 1H94A 2XPCA 4MJLA 4DBVO 1P77A 1N7GA 5K6AA 1DOHA 1O95A 3MJEA 1ARZA 3QJ5A 2O3UA 4BNHA 4NK4A 3RJ5A 2ZTLA 3AU8A 3DZHA 3B70A 1PS8A 5HS6A 5JC8A 1GYPA 4RF3A 4BKRA 5CDTA 3HZZA 4G65A 2YFHA 4TQGA 4NDNE 4PLCA 4XZ3A 4YT2A 4UEKA 3GRPA 4GLLA 4ZQBA 2YHIA 2UVDA 4Z0PA 3WIDA 4FFMA 1PS9A 2SCUA 5GZ1A 1O5IA 4MIEA 5DBGA 4XDZA 4R16A 3L4BA 1NVGA 2OO5A 4IIUA 4MVJG 2NVUB 4EJMA 4TRNA 1WNTA 3OBBA 4I9NA 3S1LA 1HEUA 3RD5A 1DC4A 3KETA 4O59O 4WOKA 1Z7BA 1WZEA 3ZHXA 3WICA 2C29D 4D41A 1CYDA 4TROA 4II2A 2DBVO 3OA2A 1GV0A 4UVGA 4CPDA 5KJ1A 3JQEA 1ZK0A 2X5JO 1IE3A 2ZJ0A 3HDJA 5CFZA 4KUEA 3P19A 3VPHA 1F0YA 2WYVA 5ENVA 5BT9A 5ES3A 1SEPA 3WIEA 3KVOA 4CUJA 1BG6A 2W8ZA 3VKUA 5A04A 4WECA 2P9CA 1KVSA 2W4QA 4GKBA 4BVAA 1X15A 3C24A 3S8MA 5KIAA 5MDHA 4NG5A 3GHYA 1IUKA 4L73A 1E77A 1GZ3A 4IQ0A 3QIVA 3ZU5A 1P3DA 3I5MA 2ZQZA 3QVXA 1PX0A 4ALNA 4LW8A 3OETA 1PGPA 3H9JA 1U8XX 5ENDA 1T2DA 4MIYA 2GYYA 1M75A 5DULA 2EWMA 3NDJA 5BNFA 1L7EA 3MJTA 4FFNA 1GV1A 1BMDA 3V1TC 1YB1A 2O3SA 4W99A 5IJZA 4QQRA 3PK0A 2BFOA 1E6EA 2CUKA 3NTOA 2X8LA 2C20A 3ONFA 3Q0EA 4HFRA 1M76A 5IZCA 1Y5RA 1EBFA 1KIFA 1P33A 3S2IA 2PR2A 1J49A 1LSOA 3ZU2A 1PJSA 3NTQA 4GVXA 2HQ1A 4AJHA 3T4EA 3MJ4A 2AQIA 3TZKA 4BO7A 4O5OA 3WLEA 4IINA 4O63O 1UXKA 3AFMA 5BR7A 4IDAA 5TC4A 3WGZA 3EZYA 1LDBA 2V6MA 3EMKA 2AG8A 3JV7A 3ZGYA 2DPHA 5JY1A 3L07A 1QV6A 2P4HX 1K2WA 5B4UA 3WYCA 2FSSA 4HFJA 2PH3A 4JQCA 4HY3A 4J2OA 5KVQA 2D2IA 3CE6A 4DLAA 1GCOA 1FK8A 1B14A 1HDOA 2ZCUA 3JQBA 4FFOA 4OAQA 2QHXA 3PRJA 4CODB 3C1TA 3JD4A 6ADHA 2PA3A 1Q0LA 1ZMOA 2PD4A 2VHZA 2V65A 2O2YA 5EQFA 2JAHA 4NI5A 1NVMB 3T7EA 2VZ0A 2HRBA 4FCCA 3PI7A 1YOVB 4ITUA 5T5QA 4DPLA 1LSUA 2QRJA 1E92A 1KYQA 2VTDA 4Q39A 1PGJA 2D1YA 4KTVE 1H6CA 3D3EA 2BGKA 1G6KA 4AJOA 4M1QA 4ONEA 2J3HA 2CF6A 3M1LA 3QWAA 5TS3A 1ADFA 4JJGA 1UDBA 4PG8A 1X7GA 1WDKA 4JX8A 4CR6A 4XR4A 5GZ3A 3GLQA 1LLDA 3GNTA 3PYXA 2Q4BA 3PFWO 1IHXA 3FNEA 4NBRA 1ENPA 1IPFA 3AI2A 1PJ3A 1MP0A 2X0IA 2YDYA 4B4WA 2PV7A 1C1DA 1PGQA 1F8FA 2G0TA 4I5DA 4OXYA 4YT4A 5ICSA 4OXKA 1T26A 3G3EA 5F5NA 3U09A 5J23A 3R3JA 3UH1A 3KOUA 2JKVA 3RFTA 4RJTA 3IP1A 2HMSA 3F5QA 4WGGA 4LSMA 3ZWBA 1DPGA 5LCXA 1DSSG 1MC4A 1VL6A 3GDGA 3PGJA 1VSUA 2OORA 2PZJA 1R0KA 1V3UA 3DL2A 5EQDA 2POQX 3GVPA 4F6CA 2WEKA 4XQEA 1UUFA 5BQFA 4R51A 1S6YA 3Q1LA 2I66A 4XEHA 4DBZA 3SX2A 4OH1A 3E1KA 2RH8A 5ER6A 1VLLA 4CV0A 4CM4A 3NEPX 4LMPA 2CNBA 4RVDA 1A27A 4ND3A 1SB8A 3G1TA 3K2EA 3SBOA 4BQPA 1UXJA 5JCXA 3O38A 1NXQA 1MC5A 3JYNA 4IXWA 4TSKA 2H5LA 3WBFA 3GGPA 4MP6A 3DBHA 2Z1MA 3TOXA 3LZ6A 1G0NA 1OC2A 3ZHZA 3JD2A 4BO9A 2PGLA 1IYZA 1SOVA 1YS4A 3N74A 3RFXA 1J6UA 2EXXA 4LGVA 4XYEA 2NWQA 1GPJA 4E31A 4FFRA 4RF2A 2ZATA 4GI2A 1VRWA 3DOOA 4CM6A 4ZD6A 2YHUA 2DVMA 3KYCB 3L9XA 4NBVA 1HYEA 3JQAD 4Q3BA 1AE1A 4TRJA 5I8ZA 1MX3A 2OP0A 1AXGA 3PQDA 2DAPA 4NJOA 4J1SA 4ZRMA 4PLTA 3RC7A 3W8EA 4HKTA 1E3LA 2NSDA 4J90A 4CMAA 4YBZA 4F46A 2ZTUA 4J1TA 4JGBA 5C7IO 4CV1A 3ICCA 1MFPA 4UAGA 3WJAA 4NQZA 5EL0A 1WMBA 4RGBA 1LBEA 3PJDA 3NDIA 3VHRA 3TRIA 2YUTA 2X0JA 4YQZA 3WGHA 4OOFA 4YAGA 2QG4A 4FOOA 3RAJA 1GADO 1VL8A 4HUJA 3DFZA 1K6JA 1T4BA 4A10A 5L53A 3QLJA 3JQAA 3TJRA 1TXGA 3GAFA 4BKQA 5TF4A 3KZVA 1HDZA 2EERA 3AWDA 4XYMA 4NFHA 3BMCB 3H9GA 4J7UA 1XHLA 1DLIA 2UDPA 3LK7A 2I99A 2VHYA 3K8ZA 1ISJA 5COBA 5DCUA 4YJGB 2DBRA 4ZGWA 3HFGA 4LRSB 2Y1OA 4RVFA 2QYTA 3F4LA 5DP2A 4FB5A 2FRDA 4MPDA 2OP1A 1QYVA 2O23A 1HYHA 2O3QA 5TJHA 1ISFA 4YAJA 3C3XA 4BO1A 4JN6B 4ALLA 3G0OA 1CRWG 1PSDA 2AEJA 1F17A 2A9FA 4NBWA 3WJ7A 3QQPA 2XXBA 2O3TA 2YW9A 3AU9A 1YBAA 5JC1A 1E7YA 4RDHA 1OFGA 2DC1A 5BNIA 2J5KA 3QP9A 3GG2A 2IXAA 1EQUA 4Z9YA 1BXKA 1U28A 4DTIA 2PTGA 4EGFA 4OL9A 1XKQA 3G49A 1LRLA 2B37A 4EUEA 3D1LA 4YJFA 5JW6A 3U4CA 3X2EA 3RROA 1EMDA 4GGPA 5EN4A 4B7UA 2VUTA 2DPGA 3GDOA 1Q2XA 1IL0A 3B20A 3RBVA 3V8BA 1H9BA 1HDCA 3LC1O 3RC9A 4RLSA 3FTNA 3HB4X 3JYOA 4B4UA 4CL3A 5JMWA 1KVQA 4BMVA 5JAIA 2RAFA 3FBGA 2DU8A 5LDGA 1EBUA 3P2YA 3WQRA 5B4VA 3TSCA 2EGGA 2Q50A 4R4JA 2FHSA 3GEGA 3WFIA 4UVHA 3N58A 4J4HA 4BB5A 5ILOA 3HDYA 2Y1FA 2B69A 1SAYA 3WG9A 1R4MA 3RWBA 1BXZA 4Z0TA 4BMSA 3H2ZA 4WEQA 5A9TA 1VJ1A 3JTMA 1E1NA 4W9NC 3KEQA 3ZWXA 4B79A 2NM0A 1V9LA 3ULKA 4FJ2A 4Q3DA 3VZPA 3GOHA 1VE9A 4UUMA 3W6UA 2UYYA 3H4VA 3GZ4A 1F8GA 1FDSA 4GWKA 2X5KO 3DBLA 3FI9A 4IDGA 1WDMA 1DO8A 2AG5A 4I5FA 2V6BA 4J9VA 3HDHA 4FW8A 1YE3A 1MFZA 3NT5A 4BIIA 4A0SA 3MOIA 3AOEA 4BO0A 2HMUA 5A9SA 3JQAB 3JD0A 1GDHA 1YXMA 1NFRA 3PJEA 4WLFA 1XWFA 1KEUA 2AEMA 3LC7O 4HNGA 2I65A 5JLAA 3U5TA 3QRWA 4MKRA 4BNLA 5DZSA 1NAHA 3IIEA 4RF5A 4GMGA 4XGNA 3ZV5A 3UFXA 2FSVA 3R0IA 3GMSA 2AQKA 3I4CA 2Q46A 3ZI0A 3DO5A 4QTZA 1X0VA 2NACA 3HNPA 2TMGA 2ZB4A 1PU2A 3G17A 4K6FA 4BO5A 2ZKLA 4A03A 1DIGA 5DF1A 1ZNQO 3Q6IA 1BVRA 3K30A 1DBVO 2EKLA 1XIVA 3DOCA 1XQ6A 5KKAA 1EFKA 4GL4A 1M6WA 1R37A 1R6DA 3DZJA 1C0IA 4DLBA 2PWZA 1YRLA 3FRJA 3PWZA 4HFNA 4BKPA 3G1UA 1S7CA 1CJCA 3FNFA 1KOLA 3SEFA 3U9LA 2VOEA 3BMNB 1LQUA 4K9DA 3BTOA 1EVIA 2DTDA 5F1OA 3W8DA 2V7PA 3CZRA 4GX5A 1AHHA 5CDYA 3E18A 3RVDA 5JDCA 3E48A 3I9MA 4ND1A 4Z9FA 4DMMA 1IZ0A 4BO8A 4R3NA 3VH3A 3MZ0A 4D43A 4NHEA 4IZIA 1OMOA 3HHPA 4FN4A 1HETA 3M1AA 2PK3A 2J5RA 1QRRA 1XELA 3F47A 3GUYA 1V3TA 4PLFA 5L95A 5G4KA 1MB4A 4I5GA 2Y0EA 4Z6KA 3GAZA 5CDGA 3GPDG 4YEDA 3VKVA 3CXRA 1UP7A 1DJNA 4MP8A 2Y68A 1PR9A 2GRAA 3FCOA 3FPCA 3GF4A 1WDLA 4CMKA 3BMOA 5JMPA 3ZHBA 4ZA2A 3NAQA 2W2KA 4OKIA 2HDHA 4QO7A 2NTVA 3C1AA 2O50A 4AJ2A 5TIIA 2JAPA 1N1EA 4WLEA 5BSFA 1YL5A 2BELA 4AJJA 4U6SA 2O3JA 5G0TA 1BW9A 4E33A 5EESA 3C1OA 3ORFA 3OQBA 3O9ZA 1JTVA 2HLPA 4XQCA 1I33A 3JQDA 4L4RA 2EF1A 4JJFA 4CR8A 4BS9A 4E2YA 4JIGA 3LT4A 2X0NA 4DYVA 2HK9A 4HV4A 1SCUA 3I9KA 3IJPA 3CUKA 1W8DA 1QLJA 2EEZA 2NU6A 4PRKA 4AJKA 4J2HA 2B35A 3F46A 1ISIA 5CHEA 1GD1O 1I30A 4MVJI 3DWFA 4GVLA 4DC1A 2NUAA 2ZK7A 2DLDA 4UUPA 4W6ZA 4GMFA 1K3TA 2P68A 3L0DA 3DAFA 3I23A 1FF9A 4YJHA 1C0KA 1P1HA 4OJNA 4ZQHA 3W1VA 3PDUA 3U4HA 4ZQGA 3I3OA 1BXGB 2BI7A 3NRCA 3H3JA 3ZNQA 1ZVMA 1I3KA 1Y9AA 2R00C 1M6HA 3WWZA 4BNNA 3HN2A 1HSOA 4GSLA 2Q1WA 3QY9A 2G82A 2I67A 2VWHA 3DZIA 3DDNA 1NQ5A 1DIAA 2RHCA 3WDSA 1A9ZA 1FXSA 4CQLA 2Y0CA 3ADPA 1JLLA 1ZUD1 4DVJA 2E4AA 3UHAA 2HKIA 3MJVA 5IG2A 2BFAA 3DZBA 2ZB3A 3QE3A 1T2FA 3DBVO 3LF1A 1DFGA 2G76A 3BIOA 3JQFA 1Y9EA 1N2SA 3RKRA 5L4LA 1RM3A 4A2CA 5FYDA 4L4XA 1EK5A 4BQRA 4UULA 1ZMTA 4RQUA 3WGYA 3KB6A 1W6UA 4CUKA 1EZ4A 2X22A 3PYMA 1WW8A 3JQCA 1YL6A 1EVJA 5JBIA 4HBGA 4WOJA 1MXHA 1UZMA 2XF8A 3GRKA 4TKLA 5G0UA 2D4AA 5T8KC 1PIWA 1H6AA 4IDDA 4NJMA 2YYYA 1EUDA 3CINA 4QO8A 5L9AA 3KUXA 4L75A 2W2KB 2VCYA 4JNKA 3DMTC 2B4RO 1K6XA 4DPKA 1ADCA 5EMHA 2Z95A 1JDJA 4N7RA 2ILTA 4FPXA 3WGIA 3WMWA 1MLDA 1DAOA 1EUZA 4PFJA 2GN8A 1PZFA 1A7KA 1BW9B 1JW9B 2EG9A 4BO3A 4PZDA 1B8PA 3OJ0A 1JKJA 1GY8A 4R9SA 1TT7A 4NFSA 2EJWA 5TGDA 3F3SA 1VKNA 2UV8A 2C7GA 1YL7A 3LT0A 4Z3KA 5HS4A 1B7GO 1JKFA 3LQFA 3Q2KA 5U9CA 1R4NB 2VHVA 3OMLA 1H2BA 4HFMA 4PIVA 1CQJA 4OQYA 2HAEA 1M2WA 1EVYA 2X23A 2CVOA 2GDZA 4CQMA 2OOSA 4CLRA 3D4OA 3ZNPA 1DEHA 1R12A 1YBMA 8LDHA 2NADA 1PQWA 2HK7A 3DZFA 4II3A 3IJRA 4YT5A 3RJ9A 4DWVA 4CMGA 5JAMA 2DFVA 3EC7A 4J4TA 4Y6RA 3EVTA 2WM3A 3D4PA 3OJFA 3VH1A 4Z3DA 2Q49A 4QFCA 1N92A 1MA0A 2GN9A 4TVOA 4YB8A 3EAGA 4LN1A 1ZBQA 1UDAA 2H6EA 3HJAA 5IDQA 2BGLA 5KWEA 1YQXA 1GQ2A 4PG4A 4IDEA 1DIHA 3NT4A 4U7WA 4DIFA 1DRWA 3H2SA 4WCFB 3DAGA 1LDYA 3H5AA 3L6OO 3BMQA 4O6VA 1V35A 5C7OO 5L3ZA 1ZW1A 1F12A 1YH3A 2AHRA 1W4ZA 4XJSA 5JO9A 3S55A 2P5YA 1EE2A 4RVUA 1VM6A 1HDYA 1WMAA 1W0CA 1AN9A 1N5DA 1ZJZA 1GEEA 4IGEA 3D0OA 5CPBA 1WZIA 2Y66A 1I0ZA 2DM6A 1I24A 2BFPA 5A5EA 4W7HA 4WCFC 3FR8A 4BV8A 3KV3O 4KUGA 3AUSA 3LYLA 4PLVA 4R01A 1YBVA 2C2XA 2A92A 4BNFA 1E0DA 2NTNA 3PHHA 1LLCA 2WD7B 1A7AA 3F1KA 4N5MA 5C3MA 1PJLA 3E03A 3TWOA 4A5OA 1CIVA 3PHGA 1HLPA 3INGA 1HF3A 2PY6A 4QSMA 1OOEA 1QSGA 3FF4A 5IN4A 1N8KA 3TFOA 1ISGA 4GLOA 1N1GA 4XGKA 5U4QA 4I8XA 3U0BA 1KVUA 5DN9A 2X9VA 2QRKA 1OC4A 1XEAA 1ZEJA 4JBIA 4BNWA 4XDYA 1HE2A 2ZYDA 5DBFA 4XRGA 3ENKA 4FQ8A 4EYEA 1XGKA 1PQPA 3PLRA 1UP6A 4I1IA 3M2TA 5JAQA 3ZU3A 3VC7A 3GGOA 2P9EA 2E48A 4ESOA 4ZU3A 1FMCA 4HP8A 4D3SA 4Z0HO 1PL8A 5JXWA 5JS6A 3GZNB 5IFLA 3VAZA 4BNJA 4M87A 4E5NA 2J3JA 3B6ZA 5IDWA 1ENZA 1C3VA 4OIMA 1BDBA 2VOJA 4D44A 3JQ9A 4HXYA 5DT9A 3BTSA 4BNVA 3G79A 4CM8A 4W7IA 4ZJUA 3A1NA 4TVBA 1FJHA 1T2EA 1CERA 4EJ0A 3DB2A 4P4LA 1D7OA 1NPDA 1VC2A 3OQ6A 3RI3A 1E7QA 1RM0A 1RJWA 2D5CA 2AEFA 3C7AA 1B15A 1X1TA 4NR0A 1ZZEA 5CG1A 2P2SA 4CMCA 1I5RA 4KMSA 1AHIA 3NDRA 4IJUA 4WNCA 5AYVA 3I6QA 3WYEA 1E7SA 4R1NA 4MVJM 2ZTVA 2DBQA 1YB5A 4PLPA 2GLXA 1YO6A 4XR9A 2XXJA 1LUAA 3V2UA 1UR5A 1GQQA 2JHGA 4R41A 4QUKA 2GASA 2OBNA 2FPPA 2QZ9A 5I7SA 4PG7A 3PHIA 3IKVA 3VTZA 2YHIB 3A4VA 5FFFA 7MDHA 1U7HA 1XLTA 5IZ4A 5TX7A 1I3LA 2Z1NA 3JQ8A 4NNJA 4DREA 3PQFA 1K0UA 1DDOA 2JL1A 4MVJD 4DL9A 1UXGA 1O8CA 1ZEMA 2HMVA 4UVDA 3ETDA 4XGIA 3ZWOA 3MJSA 3ZW8A 2QQ5A 2DT5A 2AA3A 5AXCA 1DIRA 3HN7A 3PJFA 4IJWA 2HU2A 4Z9XA 1DC3A 3GVXA 5HA5A 7ADHA 3D64A 4IQ8A 4UVEA 5EINA 1KERA 1ZK2A 2BH9A 3IKTA 3JD1A 3L4BC 3ON5A 1DIBA 4XX0A 2WE8A 2W2LD 3U4DA 3OM9A 1A4UA 1HRDA 3QWIA 5JNLA 3ROMA 3V5NA 3ZV4A 5IDXA 4D42A 2YY7A 2IE0A 4IDFA 4MVJA 3OECA 2YFQA 1E1KA 2E82A 3EDMA 2B36A 4RZHA 4Y98A 3NJ8A 4E13A 2GGSA 4TZTA 4BNUA 1A4IA 3WR5A 4HNHA 4IY1A 1PEDA 3JQGA 4XQGA 4XYGA 1LXCA 2VHXA 5L7TA 2W2LA 1NR7A 5IF3A 3LDHA 1ULUA 2H9IA 1N9GA 9LDTA 1M67A 3NTRA 5FI5A 4DQXA 4YYZA 2RCYA 4ROSA 4WLUA 4RPGA 1P45A 4OKNA 1U1IA 1X1EA 3CPSA 1HWYA 1PJCA 2AE1A 2JCXA 4FSHA 4MOWA 4ND4A 2WWRA 1X7DA 5T64A 2PD6A 3BAZA 3CMCO 3JYQA 5G4LA 1Y8QA 3TZCA 1T1SA 2EW2A 1ZSVA 3H3FA 4E5YA 2BLLA 3TL2A 3D5QA 1ULSA 1YGYA 5ER9A 3WS7A 4BNYA 1TEHA 5GZ6A 2OFPA 2ZCVA 1DXYA 5JDIA 1QP8A 1NBOA 3FNHA 2EP5A 4S1VA 4BGUA 2X4GA 5BSEA 5KKCA 4BO6A 4AJPA 4LVUA 2YV1A 1KC1A 1T2CA 2DTEA 1HL3A 4G81A 4NH4A 4D45A 5IZCC 5HTOA 5A5FA 1IB6A 1A5ZA 4A27A 4IDBA 1GAEO 1ZSNA 9LDBA 1CF2O 4R54A 1VSVA 5ICMA 1HYGA 3KTDA 1PGNA 2WMDA 1BHSA 4QT0A 3FR7A 4UREA 2B5VA 3L6DA 3H65A 5L7YA 1NM5A 4PG5A 4RO0A 2X7HA 3WGGA 4R69A 1EDZA 2GF2A 5B37A 2CF5A 3GFGA 1Y8RA 2ZJ1A 1ZCJA 2PZKA 3RU9A 3WWYA 2B83A 1D3AA 4FJ0A 5A05A 3MTGA 5BSHA 3GVHA 3L77A 1I01A 1WPQA 4M49A 1NWCA 3K5PA 1R15A 2FN7A 1GL3A 2PKRA 3VZSA
chains in the Genus database with same CATH superfamily
3KFLA 3TQHA 4C6TB 3D8BA 4DLZA 2P3LA 1PVOA 1ZHFA 1IY8A 2BMFA 1RTTA 2H5EA 5DNYB 4QICA 2H7YA 3RSHA 2Q9AA 3QFFA 5CVEA 1G8SA 2QSYA 2XEDA 3C6KA 4URXR 4FEYA 1K92A 1SVKA 3K4PA 1M74A 2PYIA 1KZ1A 3H9CA 3A6PC 2NP6A 2QQ0A 3CX8A 3EZLA 1XBTA 4LYDA 4M1TA 1OXMA 1EFLA 1NI4B 2B98A 5JSHA 1A72A 2ZRGA 4MVJP 3B3GA 1LA2A 1FDTA 1TEZA 4L5AA 4LNUA 3HNRA 1LI4A 5AW2A 4NOKA 1LPSA 2A33A 2PN1A 3C6ZA 5GJWC 4ZHQF 4NCKA 3E9QA 3GJQA 4IKEA 3FTCA 4R2IA 2YMMA 1NNUA 2VJMA 3N9IA 4GEGA 1T1GA 2AVNA 1S01A 1WXDA 3CIFA 4L8VA 4PO1A 2WJPA 5EVCA 5TB5A 3WQBA 4YMLA 1VA4A 3GJ0A 2QTVB 3AY0A 5C51B 3U31A 3O8QA 3UAGA 4TTPA 3HDQA 5EMLA 3AM5A 3WZMA 1VECA 1U2GC 3Q11A 1XVTA 3WMRA 4RLFA 4PZ9A 3N8HA 4L95C 2Q9UA 5IULC 4UEOA 1N32B 1E5QA 5EQJB 2R6CA 3T1VA 1IBKB 1UL1X 4YECA 5IUNC 2O07A 4J43A 2HLDA 3T9AA 3I32A 2HLNA 3LM8A 2J4FA 4R6WA 2XUGA 1JIIA 3A1UA 4RD0A 4H0NA 1Z18A 821PA 5JJ5A 2E37A 2H8GA 3H42B 4G23A 1ANKA 2DTXA 2D13A 1UPCA 2GERA 1AGRA 3O4IA 4Q9HA 1E3SA 1V1RB 2QV0A 4BKUA 3C7TA 3T1NA 2B20A 4D2IA 2A88A 3OSZA 3N0RA 4A73A 3IAXA 2QRZA 2YR0A 3I9V1 4RM2A 2QVLA 5CU7A 2BHRA 1RZ3A 2I8LA 2ODTX 4P53A 1V7PC 2UUBB 2PT9A 1Z56C 3NJ4A 3TTSA 1CS0A 4NV0A 2FY8A 3COSA 4A0HA 2A94A 1LNQA 2X76A 3VU0A 1AKUA 2WIAA 3QWHA 4FCVA 3C0KA 4PX3A 3R3UA 1KC3A 2HF7A 1J0XO 5F5LA 4EMTA 2GCNA 1ODLA 2EKQA 2XMCA 2ZS7A 4KE6A 2P9JA 2ZBUA 5CDSA 4U9UA 4TMFA 5C5IA 4HWRA 4TSRA 3JVVA 4I9GA 3HFSA 2L0XA 3VPBA 2C78A 2GSDA 3OCVA 3WZ2A 2R65A 4MLDA 4RFSB 2Q29A 3IALA 4ZVQA 6PFKA 3BOSA 2FEMA 3DLCA 1L6RA 2R5NA 3D4BA 3I2HA 1HKUA 3QVUA 4ND8B 1XTVA 3VO9A 2XB2A 2XEXA 3SC6A 1NRXA 1ISMA 2WAOA 3WXBA 1CY4A 1GCUA 2BI8A 4GYKA 2BKVA 1NFQA 2ICAA 3ZKWA 4ZRNA 2P5UA 2P90A 4B6GA 4PGAA 2CHFA 2J31A 2JB9A 2MCFA 3QX8A 4B3TB 1N5KA 1UIMA 1S7GA 3CBGA 4P7FA 1M83A 3TRHA 4A1FA 1B3BA 3C14C 1OFIA 3A4TA 4NDAA 4BEVA 2WWXA 2P9ZA 3DMYA 1QHFA 4DR5B 3KQNA 4O8ZA 1FUEA 3ZQ4A 3JTEA 3MERA 4RHEA 4CMJA 5I8WA 1I7DA 1A76A 2HRCA 1T4DA 1Z2EA 1P1JA 3HI6A 4UDXX 3U7JA 4CV3A 5AOVA 5YASA 3W8FA 4KV9A 4EZIA 5MFZA 5LU9A 5DX0A 3QPWA 4RV9A 5FOVA 4IX9A 4R1UA 3RNLA 3UNXA 3WBKA 1FB5A 4D9BA 5M5BA 4W1SA 4R5HA 1PT8A 4DIKA 1DAIA 4ME6A 1KWGA 4MR9A 2VH2A 4ZVVA 3CR3C 3NOQA 1K6MA 4QBTA 1K6IA 2CCKA 1U90A 2ZB8A 3EMDA 1GQOA 4K0RA 2XHEA 3K1TA 3B78A 1SZCA 1CB7A 1AT1A 3DDOA 3E7XA 3G82C 3IAM6 3KUUA 4G63A 4JVMA 4M83A 4RGQA 4X24A 5KWIA 1WXEA 2VRBA 3VX3A 4NZZA 4HEA6 5AQ1A 1MAWA 4CGZA 4RTOA 2DFDA 4U3JA 1CETA 3K8OE 1HY3A 1DFHA 4EPRA 1XJ5A 1W1IA 4Y3UA 5L4SA 4H7IA 5BSWA 4S1PA 4C4SA 2C2WA 3M83A 4L5IA 4LDAA 3AHDA 4RDIA 4HWKA 5CLLA 4DC0A 3HVRA 3GLIA 1Q77A 2H52A 2ZE7A 3B1FA 5BW5A 1P7PA 2H0QA 2IEIA 4BTLA 1XUOA 2R6AA 4KE7A 4NYIR 2IDMA 2HIAA 3LQ1A 4Y6SA 2B5WA 4XUEA 1SCDA 3OURA 1SULA 2HDWA 1PNTA 5HKKD 1Q3KA 2IHJA 4BUJA 1LDEA 2GTPA 4UOQA 2PSJA 4ODIA 5SYAA 1YZFA 3E1GA 4IQGA 4YMIA 1JECA 4XPZA 3V8PA 1L7DA 2X9NA 1YJ5A 2YASA 2C4TA 1BO6A 1R5BA 3BTUA 5JASA 1PKXA 3CHYA 4WFKA 4C3UA 5EAIA 2P41A 3T61A 5IWAB 1KE2A 4J16A 4EIWA 1W0JD 5JFOA 4ETIA 1ULZA 4ZEOA 1JT9A 1T25A 4FJ1A 5C53B 2R8XA 4Q3LA 5DU2A 1OFHA 5EOVA 4E94A 4EDHA 4H7KA 3FWKA 2GZSA 3CW2A 1ZBDA 4TM7A 2I71A 1M1YB 3I62A 2YJTD 1GPAA 1CZUA 4CMIA 2HBRA 3FI0A 2A9QA 1UBFA 2JA2A 3B5JA 2XQFA 4I9UA 2B4QA 2V96A 1E9SA 1K7YA 5CFMA 5LQKA 3HJFA 1T2UA 1DC7A 3P0JA 3I5YA 2VHUA 4OBWA 4UAJA 4Y6LA 3THWA 4COKA 4PNHA 5JXJA 1JI3A 1V5EA 2FZWA 4ARZA 2C7QA 4I50A 3RC2A 2G4VA 4GX0A 4CDRA 3CRRA 2CHGA 2XMZA 4DV5B 2FEKA 1W4BA 2PCJA 1B1CA 1KFEB 3QIAA 1GU0A 4TKUB 4UU1A 3VU1A 4CKCB 3Q7EA 4GKAA 3TZ6A 2XXAB 1BS9A 5HJEA 3CH7A 4D3DA 1Z6PA 3DXXA 3MWYW 2BGMA 3N3AC 3FUTA 1TEVA 2PM8A 2JD1A 2QTLA 3DDZX 5AR1A 2V7GA 5K3EA 2G63A 3DEYX 4WY8A 1Z5UA 2I6TA 1ORWA 2V6IA 2X1VA 2FSFA 5FRDA 3RYIA 4AP9A 1CQWA 2WJIA 2X3YA 3RSOA 1XTQA 3MUEA 1WVIA 2BKUA 3WISA 3BJRA 3Q0IA 4I81A 4NYMR 4YJDA 3JPWA 3P5SA 3VDQA 1QFXA 3E6AA 3SJ7A 3VNQA 4CV2A 4KR3A 2AJLI 3K0CA 5EJEA 3FPLA 3UV6A 3LTNC 3G23A 2IP4A 3VUFA 2KQUA 1KNQA 3NP7A 4EX6A 1ONOA 3WIUA 1QGOA 2H2GA 1I1HA 3U49A 2GSWA 1U5BB 3PHJA 3TB4A 2OD7A 5KIAA 3IV9A 2R751 1UM9B 4HQLA 4NH0A 4ZO9A 3HZHA 4ZREA 4BRSA 4J0DA 4ZICA 3MG9A 1FP7A 1R9MA 5J5VA 4CTOA 4TTSA 1TECE 3ZUGA 1Q5PA 4XYBA 2XNDA 2IELA 1I94B 1V48A 1A4XA 1EGVB 2X58A 5DIZA 1NXSA 1SXHA 3RHSA 3JR7A 3V7YA 2D2EA 2IHKA 2Q5EA 3PZBA 4ZVRA 4U7DA 3IPCA 1XXHA 4EEZA 5K3DA 2I9KA 1DRUA 4PLWA 2PLAA 1R6BX 1EA7A 1OI2A 5FEUA 4M76B 3N2EA 2BT4A 5IUKC 3IR6A 2HHHB 3CZAA 4WTOA 4OTZA 3AM3A 4XASA 1J5PA 3V00A 2GWHA 1LPMA 5CGZA 1R3DA 1P1IA 5IAJA 5AKJA 2C82A 2NVWA 2PNFA 1MABA 2ZBGA 2WHXA 4D8TA 3FCYA 3SQDA 1RLTA 5IEJA 5KCZA 2I0FA 2WMYA 4JL8A 1QFYA 1XCBA 4W9RA 4E1VA 2RGEA 3UENA 2OXIA 4IIYA 1J97A 3SZRA 5JRZA 1N6PA 3EIXA 3JZAA 5E7QA 2E4ZA 2AH5A 4K9NA 1BWRA 5EFZA 3F0TA 3X1DA 1GZ5A 4CEIB 2VNJA 3CEPB 3W1EA 2RGAA 4WKBA 4GAEA 3ZWYA 3E3AA 5KNDH 1VZ2A 4M6WA 3MYYA 4JCOA 3J7TA 5K01A 2G80A 1M3SA 1VL0A 1P1FA 2WM2A 2UYQA 2WT9A 3FZQA 4RFVA 1ECLA 2AJ8A 2A4KA 4ENWA 1VGVA 2UKDA 1XU7A 2AN1A 5F7JA 1WULS 1J33A 3QZUA 4MQBA 3HR7A 4ZVMA 3HY6A 2YDXA 4G1FA 4CDNA 1NG9A 2RI1A 4W6QA 1QRAA 4P36A 3CRW1 1KJIA 3EEOA 3FNQA 3BF8A 3M6IA 5JDCC 4FZVA 2J9RA 4YVFA 2H1HA 2DQ4A 1CDEA 2VXYA 3AGPA 3TCXB 4QUBA 3OQJA 3BWVA 2I4IA 2ZWMA 4KN8A 3ADOA 1XCMA 2Q6OA 4KN6A 1G3MA 1EJ6A 3CKKA 2HF2A 3H6KA 2BKLA 4P4SA 2IOFA 5CM8B 3DHWC 4Y1EA 3AFHA 2ZYVX 1K98A 5DN6A 3AHIA 3VH2A 5KVCA 3QVOA 4X5OA 1VG8A 4QASA 1JSCA 2WTAA 2IS1A 3CCCA 1LX7A 2BEWB 3H84A 3T3GA 1DPFA 3P9ZA 4IJVA 4CQMD 1ECCA 3JSAA 1HNNA 1KMNA 4LOHA 3STXA 3D8HA 4UHEA 4URHA 4E7PA 2RIPA 3QU7A 2OBMA 3EB9A 3PEEA 2QN7A 1ZG3A 1ML3A 4XDHA 5EZQA 3WYBA 3HXTA 4K9MA 1M10A 1CZHA 2VVTA 2XB9A 1L7VC 4Q02A 1SUBA 3VTFA 3GFSA 2XGJA 1IM2A 3MN1A 3BAFA 5F33A 5AJZA 2R79A 4CM7A 1LLQA 1QBKC 4AJ1A 3B1YA 3ZZNA 2QM8A 2RAVA 5CR9A 4R68A 2YOFA 2HSJA 2V8OA 1NMZA 2JJ1D 4WBSA 5TARA 5DOZA 1TO2E 5I3ZA 4EPXA 1KFJB 1J07A 1NFFA 5DK6A 5LA6F 1PFGA 3NWPA 1B26A 4H1HA 4K26A 5B1IA 2YRWA 3W0LB 1D4FA 3MAAC 2QX8A 3W2TA 1XFAA 1U5CA 4IMPA 3I1JA 4E15A 3ZY2A 3CNQS 1NJ5A 3LMKA 4LA4A 5G53C 3REQA 3WL3A 3G88A 5K0JA 3MB8A 4Z4EA 2NZXA 3VDRA 1ST3A 1ZIPA 2BMVA 2B6NA 1KAQA 1LTHR 1I36A 3K9CA 5CLHA 4BGIA 4DRXB 3IXMA 1NASA 2E1RA 4DYHA 3VDNB 4BTEA 2KSQA 1ND6A 4X95A 1QO7A 1QK5A 4EF4A 2OGSA 2QY9A 4BX9A 2MDTA 3SXUA 1MQ8B 1RDFA 4DXAA 2QTCA 3IAHA 3CWQA 3C3BA 4MVJH 1D2MA 4WZZA 1GGFA 1QF7A 3T35A 3IT0A 3OZWA 1YOBA 2H59A 2JFFA 3GH3A 1C9EA 4HEJA 1G63A 4PC1A 4RW0A 4ZI3A 1WNFA 4WZAB 3B9PA 3NBQA 3S40A 2BBTA 3NB0A 4L7QA 4E5SA 4YK7A 2VDQB 4E5KA 5JBNA 1XZFA 2WU1A 2QUBA 5K05A 2QEQA 4HLNA 4MUMA 1M6EX 1DAGA 4YP0A 1NJSA 1FMLA 3MUNA 3ZE6A 2HWWA 3O2SB 1V8PA 1P0PA 4H1TA 1GN9A 1OWOA 1KNXA 3IQDB 5DTEA 5EA2A 4BQNA 7ABPA 2H4YA 4DPMA 4DEYA 5JRJA 2LPMA 2JLYA 1ZXXA 2QQGA 1P17A 3V1NA 2RJ3A 5FWNA 2C2OA 4CMBA 4E1AA 3NMUF 4DANA 1VQ1A 4TRMA 1KQGA 2CLDX 2RFLA 1Q21A 1KKUA 4B2YA 5KOJB 2ZXUA 4B8ZA 3ER6A 4WKGA 1GUFA 3SQXA 1T10A 2FWRA 3ZXSA 4NYIQ 1NKTA 1U81A 3GZTB 1E7RA 3CF0A 4ALKA 1FE8A 5CJPA 4LDNA 2I9PA 2AFIB 2CFRA 4B7CA 2VQ6A 1QAOA 5EXEA 1R8JA 1U65A 4NJMB 1KBZA 1SHLA 2QLNA 3LDFA 3NR2A 4D0NA 4UFPA 4RK0A 1AQNA 2C54A 1TLTA 2J6CA 4C0HA 5JSFA 4QG7A 2VR1A 3WSWA 5JT1A 4RQBA 4K6OA 1JYFA 2IOYA 2JGNA 2XUKA 3A1CA 3ABIA 2X5XA 3RASA 5A4KA 4Z4FA 1Q92A 5AXAA 3E2MA 3IBYA 5CNMA 4MIOA 4L27A 1VJCA 3EF0A 2QTBA 3BQ9A 4Z2AA 2IS2A 1J0CA 4U02A 4P3XA 3VVCA 1T36A 4FD3A 2VQ3A 4W1RA 1TL7C 2RKWA 1EZ1A 5CX4A 5BVHB 3I39X 4MDHA 5FJIA 4L4YA 2YWFA 1BXRA 3SM9A 4ZC8A 3EIEA 5KVVA 1D1TA 2J3QA 3A28A 3ZW9A 3L0CA 1WB4A 1CJBA 4I6EA 3LC0A 4B8YA 2V7QA 4BFSA 1ZQ1A 5EP2A 2FWAA 2PLFA 1WEKA 2V7BA 3ZY4A 4BO2A 1SOUA 3PDIB 3T1YB 3STWA 3VOTA 3DAYA 2GZDA 3OBIA 1PQUA 4AXBA 1CEQA 4F3YA 1TTTA 4G9BA 4WAUA 4EBBA 2CD9A 1XA0A 2R6JA 4HOYA 4B3CA 4F3KA 4AKTA 1XMPA 4CQMB 3EDRA 1MRSA 3WAKA 4BBZA 4BCCA 4CLRB 5H68A 5LLDA 4V03A 1X7XB 5TE9A 1F6WA 4N47A 2H3EA 4JUDX 4OQXA 2ZWOA 3TTTA 4EI2A 2R9VA 3B9BA 3I9OA 5LFAA 4WXMA 1YBHA 4MGKR 1OPXA 2CZQA 4CUZA 2ZLBA 4GLFA 1DBPA 1GEGA 1LBSA 4FIZA 1RRVA 3CVJA 3JQGB 5CLFA 4A8HA 2K4MA 3DBRA 4NYMQ 2M6LA 3P9PA 1D5CA 1HA3A 1X39A 1ZO8A 3ZNOA 4BECA 3PB3A 5TR9A 3ROXA 2HGZA 4RZSA 4CMHA 1Q1NA 3CNOA 3RUDA 16PKA 3L6UA 3ZDFA 3PKIA 1N2CA 1ZNZA 3LAWA 1ZAYA 1PZNA 4WNIA 1E4OA 2TMKA 3KQSA 4IVNA 1ZRHA 4G0ZA 4JASB 5KHOC 4CF6A 4HAYA 2V8BA 1REQB 2PX3A 4O08A 4DCNA 1M6VA 3OEEA 4ILKA 4L4SA 2ATEA 2HSWA 1EAYA 2VNSA 4KK4A 2ACWA 1JIUA 5BY2A 3R3ZA 4DUPA 2MMGA 1ZL0A 2BWJA 5AXDA 5A03A 2O2IA 4BC0A 4ZVNA 1RWBA 1JU4A 4YPVA 1GPUA 3FPJA 5TRTA 4XUCA 1YCHA 1FC0A 1KJ8A 2CLLB 2CEKA 3L6EA 4E4TA 1JWAB 4LYJA 1CPYA 1M7GA 3GJ8A 1EUCA 3KYCA 3PX2A 4P33A 3HA7A 5COAA 4FR2A 1RXSA 1W5FA 1IN1A 4ICIA 4Z8XA 5IKMA 3O90A 5FULA 4HDSB 2H63A 3ASUA 4L2IA 3BL6A 4A91A 1OW3B 2H4HA 5AO9A 4H08A 3FKSA 3SBDA 3ZIAD 3HEBA 4KK3A 1HT0A 5IK2A 3L7OA 3QOFA 2XMPA 4F1KA 2PKWA 1KMHA 1QHIA 1T1EA 3ANSA 1LDNA 3MT7A 1MENA 5TJ9A 3SQLA 4ZGGA 4J4BA 4ZODA 3MTBA 4IG4A 3T3MB 4Z4IA 1E2QA 5AJHA 3VR2A 4RD6A 2M2IA 2BHTA 2Y9MB 1F1BA 3I9FA 1LF0A 3KXPA 4K40A 2EIHA 3RUHA 3VV2A 1E6KA 5A3RA 4LISA 3EGOA 3VKHA 2WI8A 3B82A 3ZW7A 5LMNB 3K9QO 1XZCA 4JJ7A 2GCOB 2IEGA 2VF5X 3JQ6A 3FVVA 2QVYX 2HDNB 2IU6A 5L40A 1ZONA 4KDFA 4DSNA 5LJIA 4N54A 3QEBZ 3ZJ4A 1K6EA 3IUJA 3P2MA 2X3FA 1PT6A 4PQEA 5DGXA 3PGA1 4MV7A 4MYCA 2QMUA 3I61A 1ZGGA 1ICEA 3CF4G 3ZBTA 4EECA 1OCEA 2H92A 3UHPA 1E2MA 1AHPA 4YTEA 2HSDA 2VUSA 1OIXA 1Y7TA 1TKBA 2JEZA 3NHMA 5TV2A 3T3PB 2QN2A 3LOPA 2DSTA 1LPNA 2AMLA 1I9GA 3E9DA 4OHCA 1GFSA 1V71A 2P7HA 1XTUA 1J0BA 2C2YA 2NN3C 3ED5A 3QEJA 1GPDG 5LLSA 1P2VA 1IHDA 4S3MA 3AB3A 3K9NA 1YJXA 3P9IA 4ARAA 1ORTA 2KMLA 3CZ5A 1IEQA 3LUCA 5DNDA 3LL4A 4UPDA 5KJCA 2G88A 2QRQA 4YQYA 1G8GA 2OFOA 3EIUA 5CRIA 4ZAGA 3TK1A 5A5DA 1L1QA 3CJTA 3NHZA 5AW4A 1E1CB 1UKBA 4URFA 3CZCA 3LRPA 5ALVA 2JLXA 3WMEA 3SKXA 1E0AA 2CHQA 2QE6A 2IC5A 3BVPA 1N8TA 3SLKA 2PJUA 3N7UA 3R23A 4QDTA 2QZZA 1NW3A 4ZZ2A 3E9CA 2FOLA 4ZV7A 3AL3A 4RHXA 1CHDA 4IOMA 2FPPB 1YZGA 3P9QA 4BGEA 3ZE0B 4J7XA 5DYTA 3HLYA 1TMGE 1NPYA 2Y4NA 4JSTA 1CIJA 2ZRCA 2WJ6A 3FWYA 3WL8A 1KH1A 1A9YA 2J33A 3KM0A 4LMRA 3TLMA 3LBFA 3WGNA 2Z9BA 2Z30A 3PQ3A 2IIBA 3I2IA 3ZZ1A 3FB1A 1SN7A 3JCZA 1YUBA 2OG1A 2WTXA 3GMDA 5BQOA 3RPEA 3VC3A 1BHQ1 2D4HA 2VDKB 4L8FA 1RYBA 4MUJA 2O6HA 2Q7DA 4R2LA 3DT8A 3VPDA 1GT6A 2CXOA 5BSMA 3WL6A 721PA 5HRAA 2IE8A 2VYCA 1Z0JA 4B4DA 1O9GA 4CM9D 4OYHA 3GFPA 2J48A 1CDDA 4AIIA 1SWVA 4RSHA 4L3OA 3FWZA 3QXGA 1UFRA 1UPUA 3DZ8A 1MCZA 1FUUA 3C5HA 5JI2E 3ANTA 1PTKA 1I51A 2VRCD 2ZUVA 3FHLA 4YRJA 4JCCA 3TRFA 3B5IA 3C3JA 1IQUA 5K1ZA 4LOJA 3WLKX 3GDFA 3KWMA 4P5PA 4IOJA 4WH0A 1PBNA 5JY6A 4X54A 3G0DA 4KOEC 4OHFA 1L4BA 1PSZA 2CHVA 3DVRX 3EIFA 5B7PA 4JLDA 3RYCA 2Z58A 4IGFA 5A0TA 3ZTWA 1SELA 3G6WA 4L6CA 4L8LA 1B8UA 2XUAA 1JN0A 4FMDB 1KVTA 3UXMA 3LKVA 3NX4A 4H7DA 5AP9A 3W05A 4C05A 4D9KA 2FR1A 2WP0A 2H29A 3EWSA 4WLNA 2ENUA 3AVYA 1U0OC 1UMBA 3EFOB 5B1DA 5HXAA 4CF5A 5JSUA 1IUOA 4FFPA 2HD4A 1KIMA 5JG7A 1UMDB 4G8CA 3I1FA 5AQEA 1E0KA 3Q9UA 4DR4B 2RIRA 1NVBA 1VYUA 1VA5A 2IYQA 4A6XA 1N9GB 4BNDA 2A1TS 3PC4A 2W5UA 2C42A 4ZJZA 3LF2A 4M55A 3ZHRA 4LJRA 1NX6A 3E7DA 3U0VA 2A0YA 4R98A 1RWWA 1GPNA 1ZH0A 5CYOA 3L7CA 1HORA 4PN7A 1K3FA 1JEDA 3LY5A 2DX7A 4KE9A 5ALOA 3K9GA 2MYTA 1Q6YA 4G1BA 2UZ0A 1IY9A 4OPMA 4ZU1X 5L3VA 2XYPA 1T6YA 2RGDA 2H1VA 2ZGVA 3FGOA 1RCFA 3TPCA 4MP8A 1YHNA 5AI6A 4AZ0B 5HIIA 1KI1A 3T06B 3E82A 2XVMA 1W87A 1N2EA 2OBBA 3R6DA 4JQYA 5A0FA 4DZRA 2WOJA 5KTMA 3D7MA 4ZCQA 3S2EA 1GRCA 3BH0A 2O5VA 3G2PA 1KZYC 4J0JA 3CEHA 1XAHA 2QUZA 3GO4A 3CUEF 2WE7A 3WLAA 2AFHA 1Y5MA 1E3WB 3M5WA 2PEYA 2XZTA 3PCXA 3FPEA 3U7GA 1TIKA 5CUQA 1KQPA 1BTOA 2HX1A 4M9XA 3UJ9A 5LWQA 2X0RA 2GM9A 1KF0A 3OZBA 2Q99A 1DQNA 3IBFA 1SKMA 4ZXPA 2AT1A 4D4LA 2YCBA 1NQOA 1U4SA 4TUYF 4XQ0A 2FMTA 4CF7A 1ADJA 1QZUA 2OAP1 4DILA 3DTTA 3FTEA 5L3SA 1QLHA 3GWGA 4BAGA 4R71A 5F98A 5HWSA 1BS1A 5JDIC 1CLUA 2LDXA 3K3PA 3Q9LA 1VXRA 1YFLA 1LDGA 2ORYA 2JGDB 1XSEA 2WQ7A 4J8PA 3E27A 3DV0B 2ZT7A 5L3QA 1LQTA 5TPWB 4WBNF 5CA0F 2X6TA 3TNLA 4AF6A 2OSVA 3UXEA 1VGRA 2H2HA 4C07A 2OENG 5EWLB 4V3BA 3GN1A 1JMKC 1NM5C 2FR8A 2GBLC 2GPYA 4S1TA 4L9RA 4PPYA 1RPNA 2RHTA 2VYND 1QK4A 2VPXA 1HV8A 1T5LA 2O1WA 4JYMA 4AY6A 2UXDB 1Z5VA 3F4BA 2ZT6A 1ZNXA 4RZIA 3T0FA 3QBVA 4ALJA 4GSKA 5ALWA 2RCNA 4C1NA 4DDTA 3INTA 1X8KA 4M7RA 521PA 2NO9A 4ZQFA 3JQ7B 2WP8J 3VR3A 1IRXA 3I0NA 2XA2A 4KMMA 4BRZA 1AVTA 1OSNA 1KR5A 1T5TA 4GP6A 1OD6A 1SD2A 2BY4A 3ANYB 4RA9A 1TKRA 1JTFA 1Y48E 1E5LA 2W48A 3HJCA 4LC9A 3OLXA 4GWGA 2EQ5A 5HDBB 4AP5A 3C8MA 1TKAA 5A3QA 5JADA 4JP2A 4RM3A 3UEOA 4D74A 5K6RA 3TINA 1GR1A 5C80A 3KWFA 1YCDA 4JBHA 1QQ5A 4PCLA 3V7FA 3VPSA 4WQMA 5D5PA 2QP9X 1E69A 3JATB 3STHA 3QBJA 3R7DA 2G5CA 1O1YA 2QUIA 4PNZA 2QX7A 3ESDA 1SQGA 2UVQA 2ZRLA 3H5NA 1T4MA 1Y5LA 4ID9A 4NU5A 3PHCA 1BSVA 3L82B 1KEVA 4G5FA 4U8GA 4JS0A 2WIDA 1I13A 4REQA 2DUJA 1RC1A 5FA8A 2QDXA 2Q3HA 1W581 1JAYA 1CR1A 4Z8YA 1UFOA 2IPOA 2I6GA 1Q44A 1PJ4A 2IEZA 3UK1A 2C7OA 2XT0A 3CLKA 4L78A 4RIFA 1KK0A 1T2NA 3G9ZA 1BU8A 1X6VA 4F6LA 1PL7A 3OJOA 4RORA 1DE0A 3NBYC 3SLGA 4LS3A 2DF8A 1NE2A 1Y63A 2JI4A 2QJFA 5DHFA 5HKBA 1ZVVA 1EFVB 1JQ5A 4HEQA 4NBNA 1A7JA 1BXGA 1U31A 4TTQA 3V8QA 9ABPA 3OWXA 1UOOA 3F8SA 4HX9A 3AXTA 3PICA 3F4KA 2J3IA 1CJTC 5T3YA 5A4IS 3I52A 4JR2A 4PG6A 3S2FA 4MI3A 4F9TA 3U3MA 2G17A 2IHYA 4MV8A 4IJ6A 4B4OA 2AR0A 2PS9A 3O8NA 3Q7IA 4QG3A 4G37A 2CDBA 2W8BA 4EFMA 2X0FA 4YQEA 4I08A 1UKAA 3E5MA 3EZ9A 3A3YA 3LE8A 2W6PA 1JKIA 2FSIA 4AN0A 1OWPA 1YSCA 5EKSA 3C5WP 5L3SB 1XU9A 2WMNB 3NGXA 2QYOA 1JKXA 1RYNA 4AMGA 4ISCA 3OZTA 1GXSA 3V1UA 3R3VA 3QOYA 4BX3A 4H7HA 3R74A 2D0PB 4R2XA 4C7OA 2Q2QA 4F12A 1UJ2A 4XLZA 1NBME 2RHLA 5LC1A 5AK6A 4P3PA 2PU5A 3EXIA 1Z74A 1JQ3A 4GIBA 2PV0A 4L76A 3ZKAA 5E3HA 1IOLA 4OXNA 1KTIA 3QNWA 2FE1A 3DMTA 2R1UA 4CVNA 1JA1A 4MINA 3CJQA 4HTFB 3KXLA 5FWXB 4AS2A 4F3NA 3I9NA 3INNA 4YRFA 1PZEA 3FNGA 4GOKA 4BVHA 1C9KA 1L8QA 3FNRA 1QF9A 4EYKA 1U63A 1DXQA 1N8NA 2AQHA 3ODPA 4GI5A 4F4IA 3CSDA 1IN7A 1I3MA 4QRHA 1W36D 4E6PA 5HCUA 3U3OA 4CG1A 1RBYA 3MUFA 3WLQA 1GZ6A 4PS0A 4PZUA 4BZQA 2XTMA 2HRQA 2JIRA 3M0EA 4YRBA 2XMRA 1JHXA 1VKZA 2C2MA 2F67A 2J9YB 5K8LA 1C4OA 3E8XA 5IS2A 5D6NA 4M38A 1JS1X 4WZBE 4C9BA 2DH6A 4MRNA 1XC7A 3GQVA 4PLZA 3R76A 3GNLA 4WASA 1K06A 3H4MA 1MH9A 5INTA 5JBQA 5L45A 2IODA 3Q7PA 1GTJ1 1YNSA 3O95A 4B3FX 4YLGA 2ZYGA 3IQWA 5DXAA 4WVFA 4CI0B 1R10A 1NMSA 3I04M 3M89A 4H4DA 1W2WB 4EPTA 1LJUA 4Y2UA 5AJUA 1G9SA 1HM5A 2VRWA 2WUDA 4HZUB 1PWZA 1UDWA 3AZQA 4X8HA 5LZ2A 1O0BA 2XKAA 4ARVA 4NEHB 4TS1A 3PXGA 5FKJA 4LPKA 2H2AA 3FPGA 3P52A 4IHJF 4XAQA 3RWOA 3CB2A 1R6UA 1V16A 2ZBFA 3QG5A 4H3VA 1IC6A 2YIVX 4C06A 2WF8A 1DELA 4M1KA 1W85A 2JC3A 3EXG1 4WKCA 1P7YA 1JZSA 2AGVA 3QVSA 4YJ2F 1SOWA 1R4NA 1SQSA 4YFVA 3HXOA 2Z56A 4IJQA 3MLAA 4GM0A 3AR3A 1W5BA 1VYVA 1BEEA 2FWPA 3MGKA 5KNLA 4N6OA 5LA6B 5JAUA 3PQCA 5EIWA 1X1DA 3FOAA 1D4ZA 3ELBA 3UAVA 1YA4A 3AFOA 3IGFA 5HQJA 4B81A 4Q3NA 1G18A 4PANA 5I5EA 2XLBA 1MGOA 1R4AA 2JF0A 3UJDA 2DKFA 3K8QA 1SR8A 4BE7B 3COZA 3A37A 4RK7A 1NP3A 2GN6A 1OX4B 2ZIVB 4EJ6A 4C87A 3AR4A 4C0LA 2LWIA 2CDRA 5BVGB 2QR5A 2G9ZA 3SS7X 1S1CA 4PWYA 3OFNA 1FQOA 1K4KA 1OYWA 1L5QA 2QV7A 2UZ3A 2WKWA 2XDWA 3AI1A 3B3AA 3I01A 3I04A 3LWBA 2JJYA 3ME5A 4DMGA 3NGLA 4US1R 5CDFA 1A2OA 2C3PA 2VUUA 2C5GA 1DIOB 3HJNA 3FW1A 3PA8A 1WMEA 3PFIA 4IF4A 1T1JA 2CLCX 4LXIA 3W78A 4ZCMA 2IRWA 3ZQUA 4MUAA 5K7SA 4GGOA 1CP2A 3S28A 4WCFA 4E2FA 3S2GA 4PCUA 3RS3A 4WLVA 3RVQA 3TF5A 4UU8A 2P77A 1CP3A 5BSUA 3TIXB 4M9UA 2ZOSA 1Z0FA 3H99A 3D8TA 3ICWA 3MWKA 4FR5A 5ECGC 3NVKI 5CVDA 1BCSA 4X8OA 2JLZA 1Y7PA 3NBKA 3QUAA 3VNSA 1O0SA 3K96A 4M1OA 3EFBA 1GZ4A 3PNBA 2GOYA 1D2RA 1EFRD 3E9NA 1N2OA 3KLMX 3H0CA 4HGNA 3VHLB 5EJ2A 4QYIA 2I5PO 4JLNA 5CX1B 2QVBA 4MO2A 4OX9B 1LJLA 3OTGA 4D1YA 3AY3A 5L4NA 1SB9A 1ORRA 4KR7A 1TQDA 4OOEA 5C32A 1XK7A 1RC0A 1PGOA 1E59A 5E2AA 4P86A 3AJAA 4DE5A 5EKXA 2R8RA 3TW6A 3VJKA 5CB8A 1X3SA 4G07A 5KYYB 4YRDA 2Q5QA 2CXQA 5CEJA 4ZQIA 2A67A 3IVAA 2NUPA 4QVGA 3KKKA 3MJDA 4YRPA 5ALYA 5BN3B 1DEXA 2Q62A 3BCRA 1BIFA 1D1SA 1JU3A 1GNQA 1GL7A 3EDYA 3R7LA 2C4VA 3ESBA 4LCEA 3VAAA 2I55A 3I37X 2HJRA 4CT0A 4AW9A 3F1LA 4O1MA 4W5JA 2WYUA 3OT4A 4TXJA 1WZCA 1T24A 1M34A 1G5FA 3CPJB 2XI4A 3JQQA 4PLGA 3L4JA 1BQ4A 4Z7JA 3R9XA 4N49A 1AGNA 3SIXA 5KQSA 1NXWA 1VKOA 2QGZA 3A3NA 3X43A 1C7RA 1XMOB 4LJAA 2ANBA 1SXIA 2IYZA 2BJHA 1VP9A 1XZPA 2J7PD 2ZJAA 4UBOA 3V9PA 3UXYA 5TF0A 3WKAA 1O2DA 5JCPA 4GYYA 3QUSA 4ZPJA 3AJRA 4MAFA 4KLCA 3C6BA 2Q8QA 4EHKA 1RYFA 2XB4A 1YVUA 2DWPA 4UNPA 4ZAFA 3MGBA 5DVZA 4FNGA 4YALA 3LUPA 4EYGA 1NQTA 5ELXA 2YJGA 3OU2A 1ZK4A 4HADA 1FBNA 1WXHA 2FW1A 3FVTA 3T3HA 5ULLA 5HK8A 4PFKA 3TS1A 1KI6B 2E55A 1N7GA 2QJOA 1O95A 3MJRA 5I3CA 2JHCA 1YACA 3N5KA 1NBAA 3EY9A 1FPMA 2H1RA 2O3UA 3QJ5A 4XE5A 5JZMA 5HP4A 4KGDA 4NK4A 3RJ5A 2WWWA 1ILEA 3B70A 1FTSA 3N1UA 4WK2B 1H22A 1NVUQ 1QK3A 1V45E 2NU9B 3EZXA 2FPGB 5JC8A 3OEHD 2BZ1A 2XWQA 4TQGA 4RH3A 4UEKA 4L3WA 3H1GA 5D6OA 4YT4A 2PUDA 1M2OA 5DX1A 1BN6A 3O94A 1USUA 4M0LA 4ZQBA 1H2XA 5IH7A 3WIDA 4ZEVA 2VEDA 1O57A 3DMRA 4D3YA 4Y9SA 4EPVA 4UXJA 2PXXA 3WHKA 5KNCA 4PQFA 3REFA 4MXDA 2O8CA 5DBGA 3GCXA 4P4UA 3LWZA 1W76A 4IIUA 5FUBA 1TADA 4MA4A 5CAEB 2LIPA 4EJMA 4TLEA 2AI2A 1EDBA 4TRNA 3KSRA 2Q9CA 3E9YA 2QKYA 3S1LA 2I1LA 4BIMA 1O6GA 1HEUA 4G0PA 3V8VA 3BD6A 1DC4A 4DMKA 3FKQA 1URPA 1ZCBA 5DISB 1XZ8A 3EF3A 3V1KA 3ESYA 1SZPA 1VSTA 1WZEA 1R8YA 2FJ0A 2IYXA 3D0QA 3M9XA 1CY0A 4FQ7A 3FWHA 4LK2A 3WICA 4BX0A 3TR0A 4JQZA 1T29A 4OUDA 1F9EA 2RHOA 2WWIA 5K3FB 1JPUA 2X19A 3BULA 3I58A 4O2AF 4V38A 3VBEA 1UBCA 2IYSA 1MO5A 1IE3A 1JSLA 1VTKA 3L8FA 4HQ6A 5CJJA 3P20A 4O2LA 4EUNA 3ND9A 3REOA 2QY6A 1F0YA 3VPHA 4TYQA 4EKEA 3MT8A 1UJ5A 3QPUA 4FGLA 3M5DA 4L3VA 4KO4S 1NVDA 4O4LA 3WIEA 4YIKA 5EIBC 5FTKA 3KPWA 5F7XA 1H23A 2BM8A 2NUTB 3OTHA 2WWHA 1EFPA 4EGAA 3L6BA 1W52X 2AV6A 3GPCA 2GZAA 1WU7A 1Z0KA 3KJNA 4NULA 4W5HA 4L73A 5J2UF 1IXSB 2QF7A 4X6XA 4HLCA 3WWPA 4F6RB 1ZJWA 3ACCA 4NEGA 3T5DA 4QPNA 4JI6B 4CU5A 3ZJ5A 1A8HA 4FFDA 3QUTA 3QVXA 1MRNA 3JAWB 5LB2A 1IAVA 2CJWA 3OETA 4HMQA 4LW8A 3I92A 2R44A 1IJEA 3H9JA 3HR8A 3G0GA 1U8XX 5DV9A 1NW9B 2OHJA 2WF6A 1PHPA 5IVHA 1M75A 3FVWA 5DULA 5DLQC 1JLSA 1YZHA 5BNFA 4BQSA 5C4IA 1AH2A 1L7EA 4PQGA 3MJTA 4FFNA 4GW3A 4DBLE 1B1AA 3O9VA 1BMDA 4FVTA 1RRCA 1NE7A 4W99A 3ZTTA 4KRFA 4AKGA 2QSZA 1FYFA 4HLDA 4YO8A 3NTOA 4HFRA 3ONFA 4OGFA 3SX4A 5IZCA 3KLBA 3C4QA 1U7ZA 4ID3A 4EUKA 1I1NA 1RLJA 2FMKA 2VK2A 1YS2X 2PR2A 4X1KB 3FRIA 3CNBA 2HA3A 1IQPA 2X77A 3IE2A 2C99A 4CHGA 3KT6A 1J49A 4Y0VA 1LSOA 3WVNA 4ZANA 5BSKA 4EFKA 1PEAA 2GEBA 1JKMA 1RAFA 2BAGA 4UQOA 2L17A 3ZE9A 4A8PA 3HFJA 2VCEA 2YMQA 2NZ8A 5DW0A 1JX6A 4O63O 1IZ8A 1D2NA 3ZD6A 3AFMA 2QD5A 4HAVA 5TC4A 3P4XA 1XV5A 1VXOA 5CXSA 3U7RA 1BHO1 3J81k 3I6BA 1LDBA 5MN5A 1H2RS 1NY5A 4EY3A 1XLVA 4JSYA 3PVSA 4DY4A 2AG8A 2FFJA 3JV7A 2IBTA 3ZGYA 1RQRA 1WZNA 2DPHA 2FWJA 4GQIA 1SBHA 5JY1A 1LTKA 2Q0QA 1Y0BA 3B2QA 3WLSA 5AVSA 2EOAA 1XRLA 3F6RA 3W5VA 4ACBA 2V6JA 2IH5A 2VSYA 2XDYA 2JLSA 1UBJS 1QIKA 2AZMA 5KVQA 4B35A 1HYBA 2QTMA 4OLAA 3AR5A 4M2LA 1B14A 1A3CA 2FZVA 3IP9A 3JQBA 3KEGA 3TUIC 4D81A 4WN9B 4CODB 2IZ5A 1QIJA 2G9NA 1SBCA 3D7RA 2O06A 3JD4A 4UZSA 5EUCA 1QZZA 2YINC 2PD4A 3E7WA 5A5VA 3OFJA 2YWXA 3IO5A 4MS1A 2O2YA 1AD2A 2QXYA 1G8FA 2HRRA 4NI5A 5JRDS 1W35A 3T7EA 1RYHA 4C6TA 1Z6XA 3MJFA 2HRBA 4FCCA 1TIBA 1YOVB 3A05A 4Q1DA 1RIIA 1VL2A 2QRJA 4KYTA 1Q1GA 1E92A 2HTEA 5D3QA 4R8LA 1T4CB 4YUZA 3GLKA 2DHRA 3GCZA 2P79A 2Q5OA 3RSGA 1PGJA 3FHJA 3PNQA 4AUNA 5B2FA 2XITA 4M1EA 5EZYF 1G6KA 3IXQA 2J3HA 3CGGA 1TJ3A 1NI4A 1CJSA 3L79A 3PXCX 3HS3A 3E8SA 2IYEA 5JROA