1M75A

Crystal structure of the n208s mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVSRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N208S Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m75A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m75A01
3G79A 1SC6A 3KUXA 1YVEI 2CDCA 4CMIB 3WGGA 5B4UA 2D8AA 3WTBA 1OC2A 2DKNA 3BHMA 3VDRA 4CODB 3SVTA 2EKPA 4YBZA 2Q1WA 5KJ1A 4UVGA 2NTJA 2PZLA 2WYWA 3CH6A 5G0TA 3ROQA 4CMJA 1B2LA 3D1LA 2D59A 1WZEA 1HDGO 1PZGA 2PD4A 1DRVA 1DXYA 1VKOA 5C7LO 3Q2IA 1PGPA 2ET6A 2V7PA 1EK6A 3A06A 3HDYA 2CMDA 3UF0A 4L4XA 2AE1A 3KHUA 4R1SA 2WTBA 3GMDA 3GC6A 2QHXA 3WYEA 5I8ZA 2CVQA 1JA9A 1KYQA 1Y81A 3PQFA 4XYBA 1S7CA 2YY7A 1Q7GA 1IOLA 3QWBA 4HFNA 4J1NA 1JWBB 1GUYA 3S2EA 3QIVA 4RQUA 1XHLA 1MC5A 1UR5A 3NEPX 4YRDA 2DFVA 4O59O 4UUNA 4ZQFA 1KVQA 1EEHA 2OUIA 3PQEA 3RUCA 2VHYA 2NVUA 1Y5MA 2O3TA 3MJ4A 4ZJUA 1GUZA 3QJ5A 1ISGA 1Z75A 4FFPA 3MZ0A 4BQPA 4WNIA 2Q1TA 5KCZA 5F5NA 4Y6RA 1FDTA 1LLQA 2O4UX 3AW9A 4JJGA 1LUAA 4BKUA 4A5OA 1ISIA 4M86A 4C7KA 4CR8A 1ONPA 3U09A 1Y9AA 3Q1LA 3OEWA 3WMXA 3WJAA 5I7EA 1ULSA 4R9RA 4HNHA 3NT5A 3LYLA 2OZPA 3V2UA 1X1TA 1HDCA 2O3RA 3GEMA 2NM0A 1YBMA 4R1NA 3M1LA 4GX0A 4NQZA 2XPCA 3MTJA 2Y99A 4MO2A 3OETA 1J6UA 4IZHA 3JQ9C 2EV9A 4CUZA 5HS4A 5I7FA 3E03A 4DGSA 4M54A 1LLDA 3G17A 1M6HA 1MFZA 2AQHA 2I3AA 3BTUA 3NRCA 3RC2A 5G4KA 1F12A 4QO7A 4BB5A 5CFZA 4INAA 1S6YA 1A27A 1P1FA 3HUDA 2BRUA 4AJLA 1YOVB 4J4BA 3RJ5A 5A9TA 1W4ZA 5A04A 2GN9A 4IS3A 1IB6A 3DDNA 2YV3A 5BSHA 3V5NA 3RFTA 1LRLA 5TGDA 1E3SA 1NVTA 4BB6A 4P4NA 1K2WA 1U8XX 3I52A 1C1XB 1ZK4A 2EJWA 3HE3A 4E3ZA 5EMHA 2D0IA 5KVVA 1PQPA 3ENKA 1HDRA 1CETA 1P74A 3H6KA 1HL3A 1BGVA 3LU1A 1I5RA 3ZI0A 4M1QA 4WPGA 4CMKA 3ZZNA 4DPLA 1MGOA 2VWGA 2JHGA 5ADHA 2FZWA 1CDOA 4PG6A 3GA0A 4PLCA 4PRKA 4TZTA 4KP7A 5L9AA 4FOOA 1ZW1A 2ZB4A 4PGFA 4IDGA 2OOSA 3E1KA 2Y66A 3BXXA 3FI9A 4L9RA 4BO9A 4J91A 4F3YA 4YRAA 3ONEA 1GEEA 1P33A 4XEHA 5L7TA 3GMSA 4Q3DA 4LCJA 4FFOA 4CM6A 4IDFA 1R4MB 4TSKA 1YL7A 4KUHA 2RIRA 3D64A 1MUUA 3JD0A 2BLLA 1QRRA 4JNKA 4YJHB 5THKA 3RD5A 2FR0A 2CF6A 1W6UA 3DZIA 3Q0EA 4J43A 2BKAA 1OFGA 4BNYA 3EYWA 3GNSA 3GAFA 4HXYA 3TZHA 2LDXA 4CLOB 5G0WA 5LDGA 3P19A 2Y1DA 3OJ0A 4UAGA 2ZB7A 2JFHA 2R6JA 4YT2A 3OIDA 2ZK7A 2EWMA 3WOHA 1ARZA 5DNAA 1M76A 3HB4X 1ZVMA 3IP1A 4XB1A 3ZWNA 3OQ1A 4QECA 1LQTA 3ROKA 3UVEA 4XDZA 1K6XA 5B4TA 3NJ4A 4R1UA 3QWHA 1KBZA 2IRWA 1LDEA 1FMCA 1VM6A 2J3IA 1T25A 1CIVA 2PNFA 3ZWPA 4NMHA 5EQFA 1B8UA 1D4FA 2VHWA 3GUYA 1MXHA 4L4SA 4MIOA 3I3OA 4FGSA 1D1TA 3L6EA 3JYOA 2PKQP 4ZQGA 3L07A 4NNJA 1TA4A 1N9GB 1I32A 4GX2A 1EQ2A 3C24A 3TZ6A 4CLDA 5THQA 4A10A 4NI5A 4QFCA 1U3TA 3DO5A 4ZGWA 3MOGA 4J1TA 1E3JA 1DRWA 1H0KA 3KETA 2VHVA 1JQBA 4GQAA 2ZB8A 4LRTB 1XU7A 4I5FA 3AI2A 1QYCA 2ZQZA 3ASUA 4B79A 4ZRMA 4JLWA 4RLHA 3WWYA 4BKRA 1IUKA 5F21A 1UZMA 1KEWA 3OIFA 4FN4A 5DP2A 3AJRA 3ZV5A 3K30A 4FJ2A 1GPJA 3OMLA 1NQOA 2C7GA 3OP4A 5C5IA 2IE0A 2I3GA 4CPDA 1T2EA 4YXFA 3NT2A 4H15A 1P0FA 1SZJG 2CDBA 2X9NA 2D4AA 4GPD1 3VPFA 4W99A 3FD8A 4NJMA 1UZLA 3NV9A 4CV1A 4DMLA 4ALJA 1ZCJA 4PVCA 2P4HX 3COSA 3HDJA 2C7VA 1X15A 4JBHA 2RHRA 1PS0A 3Q3CA 2O7SA 5T57A 3VPHA 4AG3A 4JROA 5JCJD 4P8RA 1NR1A 3KVOA 4ZU3A 4EJ0A 1JAYA 3NDRA 2GZ2A 3DB2A 1HT0A 2O3SA 3TJRA 1GY8A 2GCGA 2WD7A 1T1SA 2VNAA 1XU9A 3EMKA 4BKPA 4EYEA 3S1LA 5T5QA 1IHXA 1HKUA 3RQSA 5A9RA 3WGOA 1KVTA 1YDEA 4HY3A 2QRJA 5F1PA 5TSDA 4IXWA 1ONOA 3JYNA 4XR9A 3WIEA 1H94A 1I3KA 4WE3A 4U8GA 2ZCUA 1M6WA 5L45A 2JJYA 5JPIA 1MX3A 3NTOA 1HETA 1PZFA 1PSDA 3WFIA 3ZWVA 3H9EO 2QRLA 3H5NA 4KTTE 4YAKA 1Y7TA 3ROMA 2Q1UA 3FTNA 3U4CA 5EJ2A 5A3JA 2DUUA 1WXDA 3Q6IA 5L40A 1F8FA 1BW9B 5FFFA 2PGJA 1V3VA 2GN8A 2BFAA 4MKZA 3TSCA 3ZU2A 4PVDA 4A7PA 3L6OO 2GO1A 1K3TA 4XWYA 3VKVA 3N7UA 4GVLA 1NQ5A 2VNSA 1Q0QA 3WXBA 5JY6A 2Y0DA 2YUTA 2HK8A 1PQUA 2HMTA 2RBEA 2O3JA 3GZNA 3INRA 3KYCB 1GDHA 4IJKA 3RFVA 4PRLA 2RH8A 1HSZA 3WWZA 5COBA 4UVIA 1DHRA 2WE7A 4DIBA 3GHYA 1LRKA 3DBVO 4YEDA 1EMDA 3PDJA 3LLSA 3RWBA 2V6MA 1NP3A 2AHRA 3GZ4A 1YQXA 4BNIA 3JQBA 3JQAA 1JKIA 5FF9A 3GFBA 5JAIA 4GLLA 4JCOA 2Y1EA 4BV9A 4KUGA 2HU2A 4JX8A 1ZXLA 4A27A 5DT9A 2AEMA 3NTRA 4PLPA 4TRRA 1P1IA 2Q2VA 4JBGA 4RF4A 3JQEA 1E7QA 1MB4A 1YDWA 1YKFA 3MJEA 1HLPA 2GNAA 3SLKA 3ZWMA 5IDXA 4YJHA 3ZWBA 1IPEA 5COQA 2VN8A 1NVMB 5CDSA 3F4LA 2UYYA 3LF2A 3TOXA 2QQ5A 3AUAA 5IJZA 2HK7A 3DBHB 4XGIA 3R0IA 4GGOA 4YJGB 4E31A 2O50A 4GL4A 4WLEA 1I2ZA 5CDTA 1IZ0A 2DLDA 2B4RO 3PWSA 4RJTA 3ANLA 1O95A 2ZJ1A 4R1TA 4BNNA 1JAXA 4B3JA 1BDMA 3DAFA 4CQLA 1A7AA 4WCFB 4MVJI 2UV8A 3PPIA 5TIIA 4CMIA 3WGQA 1CERA 3GOHA 1T1RA 1R0SA 2D5CA 1KVUA 1NWCA 1IY8A 2VWHA 5IXYA 4QTZA 4YJFA 1GUFA 2PR2A 3IJPA 2AE2A 4RQTA 2NU6A 3VPGA 4D44A 1PL7A 4FFMA 1ZK1A 3RC1A 1E6UA 1M66A 3GN2A 4AJEA 3ONFA 3PYXA 3RUFA 2VT2A 4K9DA 3TNLA 4BNTA 4J7CA 1XEAA 3KM0A 4IQ8A 2CD9A 1EVJA 4FW8A 4BV8A 3QLJA 3F3SA 1EBUA 1TLTA 4A73A 4PN3A 4XGKA 2BH9A 3QHAA 2A4KA 4E33A 2Q4BA 4HFJA 3O4RA 4B4UA 1QR6A 3PGXA 3GVXA 5JDIC 4FBGA 4TROA 4LK3A 4NK5A 4PG4A 4BO7A 1WDMA 3K31A 4ROSA 1ONNA 2O2YA 1IYZA 4EZBA 1E3WA 2P68A 2ZCVA 1ZK3A 1W8DA 2ZB3A 3GH3A 3ZV6A 4YRBA 4E4YA 3F9IA 3WYBA 3ZDFA 3JYQA 3LC1O 5T8KA 5G4KB 3Q9UA 3KOUA 4LISA 3I4CA 2NTNA 3IDSA 4FC6A 2DPHA 5G2OA 1J4AA 5J23A 5I8WA 1G6KA 4CMEC 3D0OA 4IINA 2I99A 1H6CA 5KKAA 1YRLA 3GHHA 4IJUA 5TQVA 3X2EA 4NG5A 4DPMA 4NBVA 2PH5A 3WS7A 1D8AA 4II2A 4RORA 4XJSA 1DSSG 1ZSYA 1Z6ZA 2NU7A 4L75A 4LRSB 2BELA 3C1TA 1C1XA 1HLDA 2EP7A 1IL0A 1ENYA 3JV7A 5BNFA 2IYPA 1H5QA 1GADO 3TZQA 1A5ZA 3I6QA 4BO0A 3AOEA 4DUPA 1KEUA 2PKRA 5ITVA 4E13A 1PZHA 5HBRA 5EESA 3QWAA 3JQ8B 5IDYA 2OXIA 4BNMA 4QXMA 1KS9A 3MCVA 3DZHA 3GVPA 1JTVA 3GUCA 5DULA 2GZ1A 4JXKA 1WVGA 3LZ6A 3QVSA 5G4LA 3GGGA 3DZJA 5AYVA 2Q45A 3PHHA 2OP1A 1QSGA 1GCUA 4O63O 1V9LA 2V65A 1PS9A 1LBEA 4FOSA 3VH4A 3O38A 3OQBA 3L77A 1C14A 5A5EA 4CMGA 4O6VA 3PXXA 4KWIA 1N1EA 3ZNPA 4IIVA 5L4NA 3GG9A 4FCCA 3U9LA 1SBYA 1E3IA 4MVJF 2VUTA 1I3MA 1UP4A 2JD1A 1JVBA 3FR8A 2F1KA 5CEFA 3E18A 3QW2A 1LDYA 4TRMA 2WE8A 5U4QA 3AI1A 4RZHA 3JQCA 1DC6A 4A26A 3TRIA 1OC4A 4O0LA 4R5HA 4TQGA 3FTPA 3QQPA 3RUDA 1K6JA 4PIVA 3U5TA 2YQ4A 3Q11A 3STHA 5TS3A 3W8FA 5TJHA 4CUJA 4DLAA 5ICMA 4Z9FA 5HWSA 4EEZA 4EJMA 5KNLA 3K96A 3WBBA 3SJ7A 5BNTA 3HFGA 4ZQEA 2TMDA 3BTOA 3S2IA 1BMDA 3GRPA 4Q3BA 5T6BA 2CZCA 3L4BA 5I9MA 3CE6A 4U5QA 1HDXA 4ALMA 2NADA 1GU7A 5LDHA 4FFNA 1P3DA 1E3WB 1LC3A 3WQQA 1Q7CA 3AU9A 4PG8A 1NPDA 1JKJA 2YHUA 1QG6A 3P2OA 5IAAA 4XX0A 4R16A 4OGWA 3ZNQA 5G0VA 3CINA 5FYDA 3GPIA 3AFMA 1T26A 1HE4A 2G17A 5DN9A 1F06A 4NU6A 5BR7A 4E32A 1MG0A 2HJRA 5FI3A 2RAFA 3GDFA 3AUUA 1TB4A 2P2SA 1E7MA 1I24A 2Q3EA 2CSUA 3K8ZA 1NQTA 2HMVA 1HYHA 3VH2A 4GWGA 4JGBA 4UEKA 3VTZA 1DJNA 4WLUA 1DC3A 2GD1O 4DWVA 5C3MA 1MP0A 2QG4A 1A72A 5JMPA 4D3DA 1NXQA 1ZK2A 1KEVA 2HK9A 4EDFA 2HJSA 1ADCA 1EZ4A 3E6AA 4R9SA 2PZKA 1I36A 4MP6A 4WLNA 4WLOA 4YT5A 4QFDA 3RASA 3L0DA 5L95A 1DPGA 4BNFA 3GNTA 2ZTVA 4YQYA 4DA9A 3UW3A 4PG7A 5F1OA 2Z95A 2AG8A 4P38A 2UVDA 4BO6A 1HE5A 2FY8A 5JO0A 4J6FA 2H6EA 1WPQA 1W73A 3ZV3A 1Z74A 4J9VA 3FSRA 4BVAA 1X7DA 2FPPA 1LI4A 3WTCA 4GSLA 1O8CA 3GRKA 4TZKA 2ZTLA 2CF5A 1E0DA 4DL9A 1YXMA 5DCWA 2VHXA 2O7QA 3JQGA 4S3MA 3DBRA 3KBOA 1ISFA 1QLHA 1ML3A 3IJRA 1SEVA 5IZCC 1ZEMA 2GN4A 2V6FA 1ZIDA 1H9AA 4L4RA 3FPCA 3ROPA 2PK3A 1DIRA 4Q3NA 4RVUA 1UXGA 3FN4A 4GKVA 3BTSA 4RVDA 3OICA 1IHYA 3ADPA 5TRTA 3JQ9A 3GY0A 5DF1A 4ZRNA 1B16A 1D3AA 4B4WA 4MVJP 3UCEA 4MKRA 4JJFA 5CP8A 1QP8A 2AEJA 3VZSA 3ZNNA 4B8WA 1NAIA 1QMGA 4ALLA 4D45A 5IG2A 3INGA 3IC5A 3ZWAA 4NFHA 3NJ8A 3QVWA 4BNWA 2OO5A 1B14A 4FQ8A 4KOAA 3B1FA 1TT5A 3K5PA 4MINA 1IPFA 1P1KA 1R0KA 3W4KA 1U7HA 1DC4A 1FF9A 4Y8VA 1U9JA 4NIMA 1X0VA 2HCTA 1LDBA 2TMGA 1EK5A 2UUOA 3RJ9A 2W2KB 4WKGA 2HO5A 2GERA 1UXJA 3VPSA 4IDEA 2BFPA 1LA2A 1OZAA 4WECA 4AVYA 4YT4A 3RI3A 5AXCA 4E5MA 1H2BA 4KWHA 1BW9A 1GQ2A 3IP3A 1PEDA 5JC1A 3KSZO 4E12A 4Y6PA 1UDCA 3U3XA 5KOIA 1Z73A 5F5LA 3VHRA 3NTQA 3SJUA 4QSMA 3PZBA 3AUTA 2JFGA 1LDMA 3JD1A 3ABIA 4WCFC 3GN1A 1JN0A 1LSUA 1OMOA 4A0SA 3JQ7A 5GY7A 5K6AC 2Q4EA 3SEFA 2YV1A 5JW6A 4YWJA 1BVUA 3MWDB 4CM1A 3AK4A 2VZ8A 3RUEA 2YDXA 5IN5A 1WZIA 3ANMA 3CZRA 5ILGA 5KJFA 3ZHBA 5ER9A 4RVSA 1EBFA 3DXFA 1PJCA 3IUSA 5JAZA 2H63A 1H6DA 3SBOA 1UAYA 2FWMX 2FPIA 3ZH2A 4L74A 3F1LA 2P9GA 2Q49A 5A9SA 1B8VA 1RM5A 3I9MA 4KDFA 4YJFB 3O8QB 3RIHA 4RF5A 2I5PO 1P45A 3NGXA 1BVRA 4OSOA 1N92A 2X22A 3TF5A 3F5SA 5U9CA 5H81A 2RCYA 3KZVA 4E2ZA 2YZ7A 3RSHA 2EEZA 4KUEA 1VPDA 4FB5A 3GQVA 4W7HA 1PL8A 2P9CA 9LDTA 5T64A 4WLVA 2YFHA 4YJGA 4JIGA 5B12A 1KC3A 2W2KA 4G5HA 5JAMA 2DVMA 3PI7A 7ADHA 3I6IA 4MOWA 2X23A 1H6BA 1KY5A 3ZN2A 4EITA 5K0ZA 4IY1A 3WG9A 2XAAA 3BMCB 2EW8A 3IOYA 4UVHA 5MDHA 4E5PA 4RPJA 1VL6A 4BKOA 1D1SA 3GEGA 3PHLA 5L3ZA 4H7PA 3BMQB 3RBXA 3GZNB 3KYCA 3LC2O 1Y8QA 4D79A 5JC8A 1PL6A 2AA3A 3ZWXA 5A05A 4BO2A 1T2DA 3A14A 5A06A 1SB8A 1PZEA 2I65A 5I7VA 2X0JA 2W8ZA 1VSVA 4JP3A 4P4LA 4XQ9A 3W1VA 1LSOA 1N7GA 3MTGA 1DB3A 1E1KA 1O9BA 1XDWA 3PZRA 4DC0A 1XA0A 3V1YA 3SLGA 4J1SA 4UREA 4I5EA 4TVBA 4CQMB 3GLQA 2E48A 1WAMA 3G1TA 2DAPA 3FHLA 3OSUA 4U7WA 3GVIA 4YAGA 5BSGA 4CR6A 2EG9A 4E5KA 3WSVA 2IZ0A 3UOGA 3JD4A 1SOWA 2JCVA 2W90A 1ZNQO 3VVCA 3AY6A 5L7YA 2DBZA 4L73A 3I9NA 1X1EA 2C2YA 5KJEA 3DBHA 4WCDA 3WGYA 4DLBA 4YJDA 2NVUB 1MXFA 5T8KC 1A4IA 1FDUA 1HYGA 4CM8B 3C1AA 4CL8A 3ZU3A 3HDHA 5CDUA 2OGUA 4AJIA 1HDOA 4R69A 1OOEA 1U3WA 2JAPA 4CLRB 3DBRB 1R66A 1HWYA 1R4NB 4U0JA 1ZUD1 2C07A 1I2BA 2GUGA 2C54A 3KRTA 5B37A 3WX0A 3OM9A 2BGLA 3V2HA 1PJ2A 3CZMA 4DYVA 5GZ3A 4HFRA 1GCOA 1YO6A 3QVTA 4YDRA 3ST7A 4R41A 3ITDA 4HWKA 4UUMA 3GEDA 4YVFA 3ZNOA 2Y1GA 1KOLA 4R4JA 3MJSA 2FR8A 4BNKA 1A7KA 4OXNA 4NBUA 3NYWA 4MIYA 4NBWA 1JVSA 5I7SA 1I10A 1ULUA 5KKCA 1SMKA 1YB4A 1NVGA 1QXSA 2Y67A 4GBJA 1HE3A 5BQFA 4LN1A 1CQIA 4B7UA 1VJ0A 1FDWA 4W6ZA 4WOJA 1J49A 4D3FA 4MPDA 3EHEA 4XZ3A 4EI2A 4UUPA 4YPOA 3LK7A 1DO8A 1X7GA 2FSVA 3QVOA 4UVDA 4ZA2A 1ZEJA 4B4OA 1R16A 1T24A 4CMHA 5IFLA 1MG5A 2B35A 4RF3A 3OBBA 2VTEA 3ETEA 4DC1A 4Z9XA 2EKQA 3JSAA 4EGFA 3L9XA 3WQRA 3GGPA 2EKLA 3V1UA 4F45A 2FRDA 4ND2A 4E2WA 2D5AA 3TOZA 3EGOA 1H9BA 4PZDA 4OL9A 4XYGA 1E7YA 5JDCA 3HQ4O 3JQBC 3OJLA 3GAZA 4GX5A 3DMYA 4ZICA 4DQVA 3DZFA 4HV4A 2NU9A 3C7CB 3BA1A 1NASA 3E5MA 1TEHA 2DTDA 5EN4A 4I8XA 1YL6A 4BO8A 2BI8A 4RV9A 1BDBA 5LC1A 4C4OA 3IKTA 2H9IA 2PTGA 3BTVA 4F6CA 2CUKA 2G76A 5C7OO 2A9FA 2WD7B 4JP2A 3EAGA 3HN7A 3G1UA 1C0KA 1LTHR 2WMDA 4WEOA 3CPSA 2NSDA 5IZ4A 4BNUA 1NTOA 2HUNA 3TPCA 3PJDA 5TJ9A 2E37A 2PD3A 3D4PA 3P7MA 4BNGA 4DQXA 5TF4A 3WQSB 3VOSA 1AXGA 2VZ9A 1LU9A 4J16A 4AICA 1DIAA 1VL0A 1W0CA 1DOHA 3ZWWA 1DEHA 4JQCA 5IDWA 3HFSA 3UUWA 1M75A 4E21A 1R37A 4BO1A 5AQ1A 1V3TA 3MWEB 3UICA 3VH3A 5L4LA 5JE8A 4HUJA 4OO3A 3MOIA 2J8ZA 1EFKA 1R4NA 4NBRA 3VTFA 5CG1A 5IN4A 4W9NA 1QYWA 1RYEA 1C3VA 4IBOA 4IQGA 1LNQA 1F17A 2ILTA 1EDZA 2A35A 4FFRA 3DFUA 1QV6A 5DOZA 5LCXA 1ZJZA 2O3QA 3BMNA 1QYVA 3QSGA 5BSFA 1XKQA 1B3RA 1ZK0A 4GMFA 2NUAA 4WNCA 4OJNA 3U62A 4M49A 1EUDA 4BNVA 3ON5A 1NPYA 4XQEA 1PWZA 4U6QA 3PDUA 2OL4A 4OIMA 1UDBA 3G3EA 1KY4A 5KJ6A 2NV6A 4R68A 3NDIA 1NPTO 2B69A 1VI2A 2FPGA 3AM5A 1P1HA 3H8VA 1PJTA 2ZJ0A 1GTMA 1N8KA 2X4GA 4P4GA 3TFQA 1YH3A 1C0IA 3NDJA 4DBZA 4J0FA 3H7AA 4W9NC 1A9YA 5TT0A 1WDLA 5ER6A 2Y1CA 2C82A 2V6BA 2YJZA 3PHJA 1CWUA 5EL0A 1BG6A 5IF3A 3E9NA 4O1MA 4BHTA 5JSFA 1YL5A 3DC2A 1ZSVA 3I9KA 1PU2A 4Q9NA 1C0PA 3SX2A 1UDAA 3N58A 2AG5A 2WM3A 3FRJA 2PD6A 3VDQA 2GDZA 1I33A 1Q1NA 3JCZA 5EQDA 1U2DA 3ZHXA 1X13A 2DTXA 3RKUA 4CLHA 4YCAA 3ASVA 3GF4A 1DLJA 1OI7A 3V1TC 4R3NA 1N1GA 2GRAA 2NQ8A 2BF7A 4ZD6A 1FXSA 1U5CA 2A92A 4N5LA 4BO3A 1P77A 1XELA 3IMFA 5DDIP 1ENPA 3RAJA 4ZHSA 3EY4A 4FSHA 1U1IA 2WD8A 5T67A 4L76A 4CQMD 5TX7A 1VL8A 3E48A 5DZSA 4CM4A 2Z1NA 3W6UA 4BIIA 2VRCA 2W4QA 3C8MA 3FNFA 3PFWO 3PWZA 2R00A 4LW8A 3EC7A 4NH4A 2EF1A 4MVJG 2V6GA 4DRYA 1LJ8A 5AXDA 4TVOA 1DC5A 4RDHA 4Z0HO 5GZ6A 3WLFA 3EK2A 2VOJA 4K1LA 1UXIA 4GAEA 1LXCA 3AM4A 1XQ6A 2VCYA 4XIJA 1DIGA 1GQYA 3PJGA 3U49A 2OBNA 4R51A 2J3HA 3FWNA 3JQ6A 5CG2A 2W98A 2Z5LA 1SO8A 3OJEA 3RU7A 1Y5RA 1X7HA 2ZTUA 2J3JA 2B4QA 3DMTC 3OA0A 3R6DA 3PEFA 5ITWA 2EJVA 1B7GO 4GI2A 2HLPA 3IUPA 2JCYA 2C29D 2B0JA 4MVJD 3OQ6A 1CF2O 2Q1SA 2ZTMA 1P44A 4CV2A 4BGVA 4HADA 3PTZA 2HRBA 3RUHA 4WOKA 2NLOA 2B5WA 3QP9A 3TL2A 2GPTA 3L4SO 5TNXA 3LT2A 1ADFA 5KTKA 4EUEA 3GT0A 3ZGYA 1PJ4A 1VC2A 2J5KA 1VJTA 2AEFA 5EERA 4CMCA 5KVSA 4LGVA 1OBFO 2C5EA 3FNGA 5G0UA 3RROA 3ZWOA 4AJOA 1XQ1A 3TN7A 2Y68A 1C1DA 4N7RA 4F6LA 1BTOA 4PFJA 1VE9A 4D41A 4J3FA 3ZW9A 3OEYA 1YE3A 2JD0A 4XJTA 1T4BA 4CV3A 3HSKA 1NHWA 2H5LA 6LDHA 3M6IA 3UAGA 2X5KO 3LT1A 3K6JA 5ENDA 5KVQA 4CR7A 3M1AA 4FR5A 3B1KA 3KYBA 2I9PA 1AXEA 1E1NA 3WGIA 1HE2A 3HJAA 2I6TA 1EVYA 4FC7A 3EVTA 4E0BA 3PLNA 3A9WA 1ZJYA 4N18A 3ZV4A 5F3RA 1TT7A 2E49A 2A94A 2SCUA 1F14A 1BHSA 5KJCA 3G0OA 3E9QA 1PJBA 3I9LA 4QT0A 5A03A 3QRWA 3TQHA 4Y98A 5JFOA 3IL2A 3F1KA 3D3EA 3W4JA 1EUCA 3LT4A 1ENOA 1Y6JA 3QVXA 4Y9DA 4B8ZA 4ZQBA 1ZXBA 3I4FA 3N74A 4QEDA 2ZYGA 4F46A 3ULKA 3BAZA 3DTYA 1U7TA 4XYLA 3UFXA 1IE3A 4GX1A 2BHLA 4NFYA 1Y9EA 4E30A 4QX6A 1AGNA 3ONDA 4DYDA 2BGKA 5TLSA 3PHIA 1QLJA 1P1RA 1JU9A 1I30A 2ZKLA 3INTA 4DTIA 2PLAA 4QQRA 1Y8RA 5B4VA 2BFOA 4XKJA 4BQRA 4RVFA 4R5MA 4J2OA 3UCFA 3I5MA 3RU9A 1DDOA 1Z7EA 2AQ8A 2HRZA 3KSUA 1WWKA 5HM8A 3E82A 2CNBA 3H5RA 5A1TA 4TKLA 2JD2A 2DQ4A 1RPNA 2NWQA 1YS4A 2DU8A 4MVJE 4RVHA 2ZATA 5C37A 4WJZA 5ICSA 5A5FA 1V3UA 3JQFA 4PLHA 1RM4A 5CPBA 4BGIA 4MVJM 4N5NA 2UUPA 4XR4A 4RZIA 1O0SA 3UN1A 3KTDA 3BIOA 4ID9A 3K2EA 3ORFA 4FFLA 2QW8A 4GGPA 4ONEA 4JBIA 4CUKA 4MDHA 3RBZA 3X2FA 4EW6A 2D2IA 1M2WA 1MFPA 3WLEA 4I9HA 2B37A 1NWHA 1E7RA 1WNTA 1DBVO 1U3UA 2EGGA 2FZEA 4YT8A 1WLYA 4Z0TA 3SXPA 5A02A 2Q99A 3ZW8A 3V8BA 2AQKA 1N5DA 1B3BA 3IS3A 4CMAA 2Y93A 3FNHA 3PYMA 1SEPA 1HZZA 2EP5A 2AW5A 1RWBA 3JD2A 4FPXA 4XIYA 3RBVA 2FN7A 5FI5A 1ZBQA 4J7UA 3B1JA 4NR0A 5JDIA 1UAGA 2X5JO 4Z9YA 1XGKA 4AJHA 4ND3A 5CPFA 2CDAA 1AUPA 1MV8A 2DBRA 3NAQA 3H9UA 3EUWA 4RPGA 3LF1A 1ZMTA 4IZIA 1SAYA 3D5TA 1PJLA 4OXYA 5JAQA 4Y6SA 4BNHA 4IS2A 3WBFA 3JYPA 3RKRA 4PLYA 4XA8A 1QV7A 1LRJA 4GH5A 4CM7A 1XIVA 4HBGA 3RC7A 4EEXA 5CDYA 3NUGA 3HN2A 4HFMA 4J1QA 2JHFA 2Z1MA 3F4BA 4LSMA 3KSDO 2YDYA 1U28A 2OORA 3D3WB 3GGOA 2EXXA 4H3VA 5BSEA 1BXKA 1PIWA 4OKIA 1KC1A 3VC7A 3FNEA 4CV0A 2Y0EA 4ZQHA 4IGEA 1KIFA 4WGGA 2E82A 3WSWA 3FBTA 3I9JA 4WCFA 4OQZA 4CQMA 2B5VA 4LVCA 4J0EA 3FCOA 2OHXA 3BHJA 4J49A 3QWFA 3H65A 1PQWA 3WGHA 1ZFNA 1HF3A 5DOVA 4PZEA 2PA3A 2IXAA 3WICA 1KERA 2BI7A 2IEDA 3B70A 8LDHA 1C1DB 3EZLA 3JQDA 1YBVA 2VRBA 1BSVA 3HNPA 4PCVA 4G65A 1CJCA 4OH1A 1SB9A 1I3NA 1E5LA 4YA6A 3F47A 3ITKA 4RF2A 3P5SA 2C20A 1U2GA 3O9ZA 4IMRA 5JO9A 1H93A 5IXSA 1E3LA 1LQUA 1E6EA 3ZWCA 4MP3A 1E1MA 1TVEA 1R0LA 3DAGA 3K2BA 4R01A 5BNIA 1ISMA 4YACA 1VKNA 4I9UA 4W4TA 3JQGB 1K89A 1LX6A 4DMMA 1I2CA 3BZUA 1ZMOA 1K5HA 4D46A 1YB5A 5L4SA 2NTVA 3U4DA 3D4OA 3VPXA 3A4VA 1D7OA 3KB6A 4AFNA 2GLXA 2B4TO 2H1SA 5KVCA 3H2ZA 1LDNA 3TFOA 3S8MA 2DBQA 3RUIA 3LVFO 2VWPA 4ESOA 3DBLB 3ZU4A 1FK8A 2POQX 1BXGB 2B36A 2YYYA 4PZCA 1J5PA 1GZ6A 4GSKA 4IIUA 1OAAA 3CIFA 2DM6A 4EJ6A 4UULA 1G1AA 1GZ3A 1KVRA 1HTBA 3PJFA 3WGTA 4GWKA 3L4BC 3LDHA 3BMNB 1B15A 1CQJA 1P9LA 2P91A 4FS3A 2VTDA 4OMUA 4BMSA 1GYRA 2VOEA 3W8EA 1UUFA 3ZHYA 4U6SA 2D1YA 1EE2A 3ETGA 3T4EA 1DLIA 1PX0A 2G5CA 4UEJA 3PWKA 5L7WA 4NPCA 2AXQA 2YW9A 3LC7O 4S1VA 3EVNA 3T7EA 1V0JA 3MJCA 4XYEA 4P22A 4FJ1A 1O89A 3E8XA 5FEUA 4IGFA 3OH8A 1DHTA 2VQ3A 4K26A 1T2FA 1KVSA 3JQFC 3KLMX 1PR9A 5JCXA 3PP8A 5I9NA 5U1PA 1PGQA 4BL5A 4M87A 4BUCA 3CMMA 2VZ0A 1GYQA 1UXKA 3OA2A 4BMNA 4ZVVA 3A1NA 5H83A 3IIEA 1LC0A 5HRUA 2G0TA 2VRCD 3FPLA 1GD1O 4CM9A 1LLCA 1XCBA 3IAHA 2O23A 3QE3A 1HSOA 2VUSA 1QYDA 3OF2A 3WJ7A 3H5AA 4GVXA 4CM9D 4OKNA 1SNYA 1U5AA 5FWNA 3B6ZA 3JQAD 5HA5A 3NX4A 4BO5A 3WR5A 4LMRA 1NFQA 3Q9NA 7MDHA 1ZZEA 5CHEA 2GR9A 3WB9A 1NHGA 1TT5B 4B4VA 5C7IO 1E3EA 2CFCA 2DT5A 4DIOA 1HEUA 2YHIB 1PJQA 1G0NA 1YOVA 1E77A 6ADHA 3GR6A 4RLSA 1AE1A 2O3UA 1GQQA 1U8FO 1VSUA 1EDOA 3GNQA 2D3TA 3CTMA 3RUAA 1YQDA 4PLWA 3H9JA 3DONA 3BMOB 2FP4A 2J5RA 2XOXA 3DTTA 4RVGA 4FDAA 1TXGA 1A9ZA 1EE9A 2HDHA 1UP6A 5L53A 1YWGO 3R3SA 1VJ1A 3BMCA 4DIFA 4LSWA 4R54A 3TL3A 1F0YA 3DMTA 1HDYA 2C0CA 2I67A 2X9GA 1F8GA 4PLFA 1PJ3A 3DR3A 4Z3DA 4CMEA 2BFMA 3BMQA 2VYVA 3DEYX 3M2TA 2UDPA 4O5OA 3LT0A 3OIGA 3JQ7B 3NKLA 4D0SA 2OP0A 3QV1A 4JK3A 4LCEA 4NJMB 3OHSX 5AXAA 3WNQA 1YB1A 3CUKA 1L7DA 5BT9A 4FGWA 4HNGA 2JKVA 2X9VA 4XQCA 4Q3EA 3AY3A 3BYZA 3HG7A 3UGKA 2WJPA 4J90A 2HAEA 1PTJA 3G49A 1XWFA 3U0BA 4TMFA 1N9GA 4WASA 1M67A 3V2GA 1R4MA 3PLRA 4II3A 4AJKA 1LSSA 3PIDA 3W6ZA 1H6AA 2UAGA 3AU8A 3GG2A 4ZN6A 1NYTA 2X8LA 5AXBA 3AOEC 3ANNA 1WP4A 4XGNA 4EUHA 3VAZA 1QKIA 4AJ2A 5GZ1A 2PY6A 1UXHA 2IYOA 3WGZA 3H3FA 1LDGA 1AHIA 3PK0A 1NQAO 4EBFA 4G81A 1GPDG 1Y8QB 4G2NA 5JYDA 3KLPX 3CXRA 3I1JA 3L9WA 4R3WA 3OECA 4KMSA 4WLFA 3C1OA 5JMWA 1AN9A 2QYTA 1PS8A 2PGLA 2WYUA 1HXHA 4OXKA 5AVOA 8ADHA 5DCUA 1V8BA 3GDOA 3U4HA 4BGUA 2XF8A 3FR7A 3H9QA 4XDYA 2Y0CA 1N7HA 1A71A 3DOCA 3DAPA 1GFSA 4RGBA 4Z6KA 1EVIA 2WWRA 1R6DA 3CEAA 4K6CA 3TDKA 5DBFA 2PV7A 4A2CA 4D0RA 2PZJA 5JBIA 1RM3A 1ZKMA 2FSSA 3QA9A 3S2GA 2P4QA 4DLLA 2FOIA 4L8VA 4YAEA 4IPTA 1GR0A 3JQAB 3H4VA 1DAOA 1HRDA 2PZMA 4XYMA 3JD3A 4BNJA 3C7DB 4E2YA 4E5NA 2BD0A 3DHNA 2QZ9A 3GK3A 2XXJA 4CLXA 4PLTA 2Q50A 4FIZA 1MA0A 5EIOA 3VH1A 5A4DA 1P1JA 1ID1A 4JJIA 3KEOA 2HKIA 4XRRA 1HDZA 4NK4A 5L51A 1I3LA 5AOVA 4I9NA 3IKVA 2VWQA 3L6DA 3FF4A 1B26A 2C2XA 2DUWA 5ENVA 5JLAA 3T7CA 3LLVA 2DPGA 1ENZA 3AY7A 2HQ1A 3MJVA 3FBGA 3PRJA 4MIEA 1BRMA 2PH3A 3WNVA 4RDIA 1NBOA 1O5IA 1DFIA 2QIOA 1GZ4A 4J4TA 4K28A 4E6PA 4E5YA 2X6TA 4C7JA 3C3XA 4IDAA 1XYGA 2DFDA 3TWOA 2FHSA 1JLLA 1ADBA 4BNXA 4W7IA 2IZZA 1U4SA 3QWIA 2GGSA 4TRNA 3O26A 3QY9A 4ALNA 1ZH8A 1K0UA 3JYLA 3OJFA 3AM3A 2VHZA 4RCVA 4LMPA 2AQIA 4NHEA 3KEQA 1RM0A 2YV2A 1A4UA 2FMUA 1KETA 2NVBA 3UHAA 2OFPA 2JFFA 4XCVA 2ZIZA 2IDZA 3DFZA 2QYSA 1I8TA 2Q46A 5G0SA 3PQDA 4NZ9A 4XD2A 4ALKA 1DFGA 1AHHA 1PR3A 3D4NA 4N54A 5GMOA 2IXBA 3H3JA 3DZKA 4GKBA 5ES3A 4D42A 2GASA 5COAA 1NNUA 3MEQA 3R3JA 3I23A 2G82A 3F5QA 1UP7A 2WSBA 3SC4A 5EINA 1V35A 3VVBA 3S2FA 5CAEA 1FDVA 3CMCO 3K9QO 2RHCA 4Z0PA 1ADGA 5IZCA 3RFXA 1U4OA 2VYNA 2GYYA 3BMOA 3KV3O 2CVOA 5K9ZA 4JN6B 4NJOA 1SPXA 4CQLB 1ISJA 2JL1A 3ENNA 1NFRA 3TZCA 5JXWA 1Y1PA 4OSPA 1T2AA 4J7XA 4MP8A 2HMUA 4KQXA 5JCJA 4YAJA 4B7XA 2YQ5A 5TC4A 5IDQA 3WYCA 1E1LA 3Q2KA 4AJJA 4K6FA 3PGJA 4I5GA 1E7WA 3W4IA 2NU8A 2IODA 3AUSA 3HB5X 4HKTA 4IMPA 3ZU5A 2WYVA 4IQ0A 1VRWA 4D3SA 3UCXA 2W2LA 4U0KA 2C59A 3ICPA 4HX5A 4CL3A 1RKXA 3HZZA 2EGHA 1Y8RB 1JW9B 1YJ8A 4M55A 2PGDA 1ZSNA 4BGEA 1O6ZA 3DWFA 4MJLA 1YQGA 1E6WA 5A9SB 2EIHA 3PVZA 3DZBA 2HSDA 3NT4A 4XRGA 5MGBA 4GMGA 2NQTA 1MC4A 1Z45A 3LSYA 4XB2A 3NGLA 2VUUA 4TRJA 1E92A 2DBVO 3HDQA 3PYLA 4UEOA 4ND4A 3M2PA 5B1YA 5JDCC 1X0XA 4MVJH 4M8SA 3I83A 1YJQA 1EVZA 2DC1A 2E4AA 4RPLA 3ZCXA 3PHGA 3WDSA 1PWXA 4I1IA 1EFLA 3DQPA 2LDBA 1NFFA 4ALIA 2Q2WA 5CDGA 3EDMA 4BOYA 2AMFA 1Z82A 3VKUA 4DREA 4BS9A 1T4DA 4OOFA 2G1UA 1H2HA 2QZZA 3C85A 3DOOA 5DBGA 4B7CA 4OQYA 3HADA 2EERA 2X0IA 1ZO8A 3DBLA 4CLRA 5KWEA 1K6IA 2EW2A 1DIHA 1FJHA 1BXZA 3AOGA 5H82A 3BHIA 2X1HA 3DZGA 3EZYA 4BMVA 2RH4A 4J9UE 1DJQA 3TZKA 3UH1A 1E7SA 1I0ZA 3SC6A 3WMWA 4Y67A 4B3IA 3JQ8A 3ETDA 4KDEA 4CM3A 2VT3A 4YQZA 3U4IA 1V6AA 1PGNA 3RC9A 1O94A 1JWAB 4PLZA 4CM4B 3FWZA 4FD3A 1RJWA 2P5UA 3GPDG 3KYDA 3PJEA 1HYEA 1VLLA 4AJ1A 1QORA 4CMBA 5TT1A 1XR3A 5HS6A 1IULA 3PFFA 4DVJA 2JCXA 1DRUA 4Q3AA 3VZQA 1XSEA 3A28A 4EUFA 1Z7BA 5EPOA 4IJVA 2VYND 4OOEA 1GEGA 2I76A 1UZNA 3MJTA 2DTEA 1PGOA 1C0LA 4AJNA 5DCYA 4IDDA 4IUYA 4RPHA 3D7LA 2F00A 1XLTA 4BNZA 4CLOA 4I08A 4E2XA 1LEHA 3K92A 1UH5A 4D7AA 4OHUA 2J5QA 1YGYA 4WUVA 1NR7A 3UKOA 3GDGA 2X0RA 4Q3CA 4DXHA 2ZYDA 2HMSA 4UVEA 3IQDB 1BXGA 2O4CA 3EW7A 1Q0LA 4RL6A 3KO8A 1LSJA 1E5QA 2C5AA 1ISHA 4Q39A 3O03A 2X0NA 3E5RA 2PWZA 4D43A 2JAHA 5DBIA 1SCUA 3DL2A 4NDNE 4RPKA 4W82A 4BNLA 1IZ9A 4URFA 2W2LD 2XXBA 4AJPA 4NU5A 3VZRA 4YR9A 4TKMA 1GL3A 3GFGA 5JS6A 2CVZA 1NX6A 1PGJA 1T2CA 3D5QA 3H2SA 3CSDA 3KYDB 2P5YA 3CTVA 2QRKA 2Y1FA 2GN6A 4ND1A 3ZHZA 2YHIA 3B20A 4YB8A 2IZ1A 2YFQA 2X5OA 3DHEA 9LDBA 4GLOA 4I5DA 3RVDA 5KIAA 1NM5A 1B0AA 5A3VA 1XG5A 4FJ0A 3F46A 4ILKA 1Q0HA 4J2HA 3I9OA 2J3KA 4H16A 4IDCA 1DFHA 2IEBA 1DIBA 3ADOA 1P31A 3KXDA 4DQUA 1Q2XA 1R12A 3E9MA 1U3VA 4OYRA 1KEPA 2B83A 4J4HA 3DHYA 1LLUA 4DBVO 1CYDA 1R15A 3W8DA 2NACA 2I66A 3GVCA 5I9LA 1JDJA 2X86A 1FDSA 2Y05A 1EQUA 3VZPA 2WEKA 1L7EA 1P0CA 4ITUA 4XQGA 5JY1A 1JKFA 3H9GA 4AJ4A 5K6AA 4CM5A 5CEEA 4A03A 4IXTA 2O48X 3ZWYA 3HHPA 1UJMA 4Z3KA 1RYDA 2Y1OA 4KTVE 1WMBA 1GV0A 3RCBA 4CLEA 2GF2A 3ICCA 1MLDA 2ZQYA 1Q7BA 3JTMA 1J0XO 1QYXA 1DAPA 4IDBA 2EHDA 2WDZA 4CM8A 3R1IA 1WDKA 4QO8A 2OMEA 1TI7A 2OBYA 2X7HA 3HWRA 2NNLD 4PLGA 3S55A 1X14A 4RO0A 4MKXA 2BGMA 4L0QA 1EUZA 2J6IA 1N2SA 4OAQA 4IJWA 4KZPA 2GSDA 3C7AA 2VYVD 2Q2QA 4LVUA 4NBTA 1YONA 1ORRA 2GZ3A 2NVWA 3F6YA 4N5MA 2X58A 4B3HA 2R2GA 4HP8A 3T4XA 5HTOA 4YYZA 2PKQO 3AWDA 4MVJA 4NFSA 5DP1A 1CRWG 2O2SA 2HMWA 1NAHA 3P2YA 3D3WA 4X54A 4CJXA 4UUOA 2BMAA 4M89A 4QUKA 3LQFA 1GYPA 2QX7A 4PLVA 1BWSA 3OFSA 4YAIA 3AFNA 4AL4A 5F1KA 1SOVA 3WFJA 4YTEA 4DPKA 5ILOA 2ZYAA 5JNLA 1GAEO 1YBAA 3O8QA 5CEJA 3AI3A 4BKQA 1B8PA 2P9EA 2CY0A 4OM8A 1GV1A 4KQWA 3GVHA 3OJOA 1PJSA 3WIDA 4PG5A 5JYEA 2PFGA 1WW8A 1CEQA 4WK6A 2E6UX 1WMAA 4TWRA 4BO4A 1HZJA 4IM7A 4WEQA 1G0OA 1I01A 3K73O 1L1FA 3DOJA 3UXYA 2FR1A 3PIIA 3CKYA 2R00C 4ND5A
chains in the Genus database with same CATH superfamily
3G79A 1GAQA 2X2EA 3KUXA 5IP5A 3TAUA 3NVKI 1I2MA 2QM7A 2ASVA 3L7YA 4BC1A 1DUVG 3FBWA 1PV1A 4CODB 4OAOA 1M5TA 2D1FA 1SBTA 3SVTA 4DHWA 1MBZA 4YBZA 3ROQA 2PZLA 4CMJA 3CH6A 4OI2A 3MAJA 2B3TA 2FF7A 4R3UC 1UAAA 3D1LA 1IOVA 3HUEA 4FGZA 5TEVA 4HAWA 5AKZA 4TKUA 2ZE6A 4BV3A 4AMUA 3L6CA 2ECOA 2ODNA 1VL2A 4BXOA 1OJLA 2BGGA 3L6RA 1GAJA 5GTDA 3EZ6A 4PNPA 5HCNA 2PD4A 5D01A 1XRRA 4RTKA 1YV9A 2ET6A 1CX9B 1XTQA 2H9AA 4CG2A 3A06A 5REQA 4P0QB 2Z58A 4L5IA 4KYIB 1ZGZA 3HDYA 1TVMA 4GS5A 4LZZA 3H75A 2F4NA 1B00A 1YACA 1SKUA 2UUBB 5DIFA 4OATA 3JQRA 4R1SA 2C95A 5J1SB 4UMVA 3LX8A 2WTBA 4WY8A 5CW2A 4G86A 3GMDA 4HN9A 4EGSA 4GXRA 1TQ2A 5KOJA 4PQYA 4FZJA 5I8ZA 2LPMA 1HKHA 2W11A 3ZS8A 1JA9A 3TGWA 1Y81A 4A6PA 1YZKA 5CA0B 2C2BA 3QWBA 1OLUB 2XSZD 1O2DA 3BH6A 4HFNA 4IX9A 4UC0A 2IYYA 2B6HA 1XHLA 1TQ8A 2OK8A 5K0GA 1MC5A 1GPBA 3C8ZA 3D6HA 2DFVA 1BD4A 2IA5A 1MVOA 1IIRA 1W2GA 3ESAA 4O59O 4UUNA 4YH1A 2R6ZA 3OQIA 3OX4A 3X44A 1RCUA 2O3TA 4ZJUA 1XNJA 1GUZA 5AHRA 4XJXA 4MWEA 3N5CA 3IERA 4MDFA 2Q1TA 3HVKA 1JL3A 4NG4A 3ML1A 3VSCA 2O4UX 3TMKA 1FFBA 2HPHA 1FA9A 1RRPA 2O2EA 3CGWA 3H13A 4XVHA 1L4MA 2ZRBA 4CR8A 1EWVA 1XAJA 3WDLA 3TAXA 4ESHA 1X3LA 1QJ4A 2E89A 4KO2S 1JQAA 3WJAA 5I7EA 5AI5A 4Q4CA 3UKDA 1NIPA 1TGYA 1V26A 2AZTA 1XK7A 1XP8A 4Z4IA 2G77B 5HDBB 1JLRA 2A9QA 2D0DA 3ZD9A 1GGNA 2OZPA 3V2UA 1X1TA 2RMKA 1N2XA 3EGDA 3K1JA 1YBMA 3M1LA 1OLXB 4GX0A 3EWNA 2Y99A 3QI2A 2I33A 1J6UA 2G71A 2X8JB 3FFTA 4JEMA 4O2AF 4R9SA 5BN4A 3SKVA 1KXJA 2EV9A 2YJTD 4CUZA 1PR0A 2IBTA 3V8QA 4V03A 3RS8A 2IGBA 3R0QA 5CLIA 5BSKA 4DGSA 3ZWQA 3HVHA 2O7RA 1SY7A 3QX7A 3I1IA 3RC2A 4K1XA 5G4KA 1JFVA 4QO7A 5CFZA 5KYGA 3QEAZ 4Q02A 4B2YA 3BCSA 2XKKA 2UVPB 3W5AA 1YZGA 3MCAA 3BGDA 2G83A 4ND8B 1EK0A 1P1FA 1U1CA 2BRUA 1YOVB 5KYXB 4J4BA 3RJ5A 5A9TA 5A04A 1SQ5A 4FZVA 1JQ5A 4ZANA 4H3SA 5BSHA 1PVVA 1D8TA 3ZQKA 3RFTA 4WZBE 2V4MA 5F73A 2J7PA 5MFZA 3ZJYA 2R84A 5T4EA 3AEZA 3BFXA 2YN0A 3IHKA 4ZZ0A 3SYNA 4P4NA 3OKCA 4RE5A 5LYJA 2EJWA 3VPBA 9GPBA 1SWVA 5HGXA 3EPLA 4CIWA 5C1OA 5KVVA 3G8AA 1ESNA 3ENKA 1M2JA 2VH2A 3H6KA 1TUGA 5CVDA 1KJYA 1VKHA 4KNYA 4MQFB 1RI1A 2BCJQ 1G5HA 1QH9A 3FCEA 3HBFA 2PSEA 3ZE1B 5EZ5A 3ZZNA 4MQEB 2LIPA 3L46A 3B2QA 1DJPA 1Y7IA 4O2AB 2PMWB 1ULBA 3UMRA 3BL8A 2VYFA 3O4HA 1HT1E 4PLCA 1Z2EA 7AT1A 4PCAA 3QELB 4FOOA 3NFRA 4PGFA 1MOZA 1TF7A 3RO7A 4IDGA 1N3YA 1O97D 3H42B 3KOZA 3T8YA 2HUPA 3FI9A 1JHVA 4KLCA 3PA6A 1DKQA 1ITZA 2CXOA 3Q85A 1H5UA 4U2CA 3SX4A 1VIAA 4C0QC 1TRHA 3BXZA 3C4QA 3VHQA 2PZ8A 1KJNA 2G9QA 4XFDA 4BEBA 2XGJA 1YL7A 4NOMA 4J03A 3CCCA 1MUUA 1G98A 1L1EA 2MDTA 2H1OA 2BLLA 5E9QA 1ZA2A 1CD5A 5EZYB 5K05A 2YIJA 1CR0A 4RANA 4DW8A 3QYAA 5ALVA 5F9HA 4TZ6A 2FR0A 1NG1A 2CF6A 4MYRA 1YS2X 1W6UA 2R6R1 3DZIA 3H97A 4B32A 5EWLA 3THYA 2JFNA 2BKAA 1OFGA 3PC8A 3QK7A 3H04A 4BNYA 4DANA 3L1IA 3V33A 3TCNA 4IIXA 4DNXA 2O5RA 2EJUA 2ZXFA 1T36A 5DGCA 5AD1A 1JDNA 4F3CA 5HNKA 3LYAA 2V98A 3JZIA 5LDGA 5DCLA 1PD1A 1S7GA 2I22A 2Y1DA 1OB2A 2QLFA 3OJ0A 5JSZA 2BHTA 3QSYA 521PA 3VO2A 3OIDA 2ZK7A 1OXTA 2EWMA 3TDNA 2P9QA 3WOHA 4JQOA 4NQRA 1ARZA 1E3TA 1KWGA 1FFEA 1P60A 1TZKA 3CRRA 1QH1B 4LYHA 4RW0A 1ZVMA 3E7PA 4MI6A 3RK1A 1V5IA 3C97A 5E8JA 2HMYB 4BJ1A 4XB1A 3ZU6A 2YN4A 3CRVA 3IOBA 3QA3E 4JLPA 3ROKA 4BMOB 2OG1A 2G09A 4ZZ3A 4GBGA 3EFEA 1PR2A 2QUBA 5EKTA 1QKKA 4R31A 4EKNB 3MD9A 1U9IC 1LDEA 2X40A 4N49A 4ENPA 2J3IA 3SQMA 1VHDA 2PNFA 3ZWPA 1YNOA 4NMHA 2F1OA 5CFRA 1MXHA 2XUGA 4XGQA 4GR5A 4KXWA 3AUKA 1J09A 1V4BA 2VPYA 2XYQA 4G0NA 1RHMA 1A76A 1S3IA 2GK7A 3GP5A 3PXUA 4DCPA 1RYBA 2NSJA 4HWGA 1PR1A 3L07A 5FBVB 4MCHA 3MILA 2QU8A 2GKSA 4BECA 4AKIA 4AY2A 1TA4A 3QLVA 4Z51A 3K9GA 4E5VA 2BEJA 2ZIXA 4A10A 4QFCA 1U3TA 3DO5A 1AGXA 2HFKA 2RHLA 1H0KA 1AKVA 3H1BA 1JQBA 3NH9A 2H3EA 4GQAA 3SX0A 4CE6A 1XU7A 1NW4A 3AI2A 3GUZA 5JBNA 1E1DA 2ZQZA 1O4WA 3SAJA 3WYGA 4ARVA 2OHOA 4UW9A 4F8JA 4ZRMA 4BKRA 1QBKC 1U31A 4L9SA 5F21A 2RC5A 1UZMA 2B78A 1Y82A 4FOTA 3C3KA 4RD6A 5DP2A 3K6SB 1V96A 4Q4JA 1ZD5A 2UU9B 4ND7A 3KELA 1GPJA 5ALRA 1XQXA 2HA3A 3OP4A 2QAJA 1FLNA 1RJFA 4IDNA 2I3GA 5CVCA 3B8EA 1T2EA 4YXFA 1UK6A 5F2KA 1P19A 5FHRA 4CF3A 2HRDA 1G5RA 1SZJG 1TCUA 1U0OC 2A5LA 3KALA 1D2NA 4OP2A 3TPFA 4GPD1 3FF1A 4D98A 4UXHA 4EQ6B 4XDHA 1LPOA 2BWJA 3A10A 3K2IA 2VCEA 4DAOA 2AG1A 1IY2A 4PVCA 4RSRA 4NBSA 4ZARA 2Q5JA 4OY3A 2X2FA 2ACVA 4W7SA 2C7VA 1O96A 2VFAA 3D31A 1XQ9A 4Y2RA 5KAPA 4LJRA 1J8VA 1OWNA 3G2MA 2O7SA 5CFNA 1UODA 3P9QA 1ESEA 4P8RA 4EJ0A 3ZGOA 3RG2A 4IJMA 2JGAA 3O1HB 3VNBA 3TJRA 4F04A 1T1SA 2VNAA 2IEZA 1LWNA 4BKPA 5A4FS 1LFAA 1QF6A 3C6YA 2XD4A 1NQWA 4HY3A 1ODSA 5F1PA 3U4QA 4EPWA 1RE1A 1DWOA 1GXSA 1RHRA 1YB7A 2NO6A 4N0DA 3PUKA 1DT3A 4MWDA 4PFKA 4WE3A 3WIEA 2ANCA 2OENG 5CCEA 5TVKA 1QWOA 4CTJA 5I7OA 4GEKA 4PSDA 4CIVA 4JASB 3KQWA 5JPIA 5L45A 3ZVKA 3FCAA 1D09A 2VDVE 4QDKA 2AOVA 4ZT3A 1PSDA 1WMFA 2I6UA 3R3WA 4HDMA 3SFVA 2QRLA 3WK5A 4YAKA 1Y7TA 3CLUD 2Q1UA 4AK9A 3KPVA 4ODIA 4DLWA 5LLTA 3P2KA 2RSLA 4TN5A 1RWOA 3K4PA 1YZUA 3CVXA 2XOKA 2P0EA 1AHPA 2PGJA 4BU0A 5ABPA 2BFAA 2GZDA 2E4YA 4I4TB 5FADA 3KQUA 4A7PA 3L6OO 3LA6A 4E88A 3R5XA 4K86A 4I4NA 1K3TA 3WL4A 3QY0A 4D4LA 1GPYA 3ILYA 3KVNA 5GGYA 5SZHB 3BDVA 4GVLA 4ETNA 3KB2A 1NT2A 4PYMA 2RBEA 5JV5A 3KYCB 4IIJB 3FNRA 1E98A 4LGYA 4WQMA 1HSZA 3RVQA 3STWA 4E6EA 1P9OA 3V1MA 5F3WB 3QG5A 2W22A 5COBA 2QA5A 2KBEA 3FI0A 1PYOA 2WIJA 2BHRA 4JT4A 3LLSA 2IS1A 5EUCA 4LFAB 3U81A 2V6MA 1H4SA 1NP3A 2Z5VA 4V1CA 1YQXA 2QN8A 2YWDA 4BNIA 2ZR7A 3JQBA 4MYDA 1K75A 1JKIA 2OBFA 3GFBA 1CUFA 4BV9A 3MERA 2HU2A 3EDCA 4QTXA 2HA0A 1U5BB 1V1JA 4WA7A 3Q7RA 5JDIA 4M0FA 3DVQX 1R9GA 4TRRA 1CRPA 2Q2VA 5K51A 3UNXA 2XMDA 1HLPA 3LM8A 1R1DA 4O4IB 4MQ6A 5IDXA 2ZRGA 4YJHA 2LV8A 2QAGB 1NMSA 4IOMA 2UYYA 2RGWA 2RAVA 4YASA 4LDPA 1A9SA 2H2DA 1UDXA 4GRIA 2QQ5A 2WPNA 4MAMA 2FQWA 4PHGA 4V3CA 5IJZA 4GGOA 1S2OA 1ZH4A 4N0PA 2O50A 4YJGB 4B3BA 5H68A 4D4JA 1D6NA 5DXJA 3CF6R 1TZ2A 4YREA 1X1CA 2BE9A 3ANLA 3O3OB 1A9XB 1JAXA 1X19A 2JJ2A 4PSCA 3P4XA 5CT4A 1R0CA 3EEQA 4WCFB 1FP4A 1UINA 4CMIA 1CERA 2D5CA 4YAFA 4JYZA 1NXSA 3CF2A 4QTZA 3IJPA 2PR2A 5C4GB 4ARIA 2NU6A 3DLIA 5JEEA 1PL7A 3HB0A 2XUPA 3KQYA 4RD3A 5C8XA 4BX9A 3TEJA 3RC1A 1M66A 3BL5A 3GN2A 4AJEA 4D9HA 2VT2A 2FN8A 4PPNA 4KQGA 3PGA1 4LWOA 4IQ8A 4P32A 1BMQA 4FW8A 3K3PA 4BV8A 1FYXA 1IXRC 2JAUA 4YRJA 2XNCA 4RA9A 4F21A 3FKQA 4XGKA 3KVYA 3QHAA 5FP0A 3PJRA 1DBRA 2Q4BA 4C20A 4B4UA 3WGKA 1QR6A 4Q9AA 3GVXA 1D1QA 4OBEA 4NK5A 5ESRA 1OU4A 2P41A 4UZSA 1WDMA 3K31A 1A82A 3OLXA 3ZK9A 3DT6A 3RVMA 5ESWA 2M32A 4P54A 2K2WA 3H2JA 5BWLA 2ZSAA 5FHQA 3UFXB 4AU1A 2QXUA 2RG7A 1HGXA 1ZK3A 1W8DA 2JI8A 2ZCVA 4L2IB 3GH3A 4QFMA 1SKYB 3ZV6A 1FE8A 3OT1B 4E4YA 3VR4A 4CYMA 2IH5A 2H1RA 3F9IA 4MLPA 3KKQA 4M9CA 4KSBA 5AW9A 3VYWA 2ZWAA 3ZDFA 1FQKA 4FSDA 3A9TA 1KTIA 1GFWA 4RCZA 4ZJZA 2JASA 1T10A 3HA2A 5D3MB 4BCCA 3I58A 1ZITA 4GXNA 3L5KA 4B09A 1AB6A 3K6SA 1DBWA 1NE2A 1G6KA 2FW9A 4URVR 2PVSA 1BE8A 1XP5A 3D0OA 3U3KA 3C4JA 3F8TA 4O08A 4EKDA 2I99A 2JJMA 2ZANA 2CK3A 3H16A 2QTCA 1J7KA 3X2EA 3FPEA 4RL4A 2O57A 4MCIA 2VYQA 4NBVA 2O2ZA 4RORA 4II2A 5JCPA 1VYHA 4P6VF 2GPSA 4IW3B 2I91A 2C96A 1R0WA 1ZXXA 4L8GA 4MS1B 3RIGA 1HLDA 2YN2A 3ER6A 5E6SA 1IL0A 2W2MA 3TLGA 4AF8A 1SXJE 3EIQA 4HD8A 3R9KA 4G8JA 4HEA6 3EWIA 4MW9A 2C4UA 3K8OE 4M0CA 1CQJB 4BFYA 2VSYA 4ZOAA 4HMOA 1UANA 1NJ8A 4ZQCB 4HC4A 4DUPA 4RGQA 3DO6A 5ITVA 5EE5B 2NIPA 4HQOA 4HQKA 3SJCA 1PZHA 1U0NA 2CNLA 2G36A 5HBRA 2JFPA 4Q7EA 2CMKA 3JQ8B 4EY5A 3COJA 5CLFA 4ZVRA 3GVPA 1JTVA 3GEEA 3GUCA 2R5NA 5DULA 2V7QA 5KTNA 3SVLA 3NP7A 2NXWA 1G42A 1SXIA 2SICE 4PNZA 4Y2PA 3TLEA 1GPUA 2Q45A 4ITVA 1Q1BA 4LECA 4B9AA 1WD5A 4ZCTA 2YOHA 2OP1A 3PHHA 3NIWA 1J2YA 3CZ9A 1YRQA 4EG3A 4QUIA 5FPKA 1FSPA 4DWJA 4FOSA 3VH4A 4Z4EA 3MPUA 1M1ZA 3HB1A 1Y6QA 1DKRA 1C14A 3ZDRA 1K5GA 4CIXA 2NO4A 4B4KA 4IIJA 4KWIA 3ZNPA 1DTEA 1KNQA 2ADOA 2AG6A 1KMQA 1WVIA 2DUMA 4N6OA 1JTFA 3ILSA 4MVJF 1TU3A 2X15A 3DDWA 5E4TA 2JD1A 2F1KA 5CEFA 4V0SA 5FBHA 3K9WA 2WNHA 3QW2A 2Z2ZA 3BB3A 2H1IA 2QVBA 2P7IA 4YUVA 2WE8A 1U0RA 1NNLA 4MW7A 5U4QA 4IX1A 1C29B 1YI0A 2FSPA 2YIVX 3KZKA 2D74A 1DC6A 2QRVA 1GCGA 3JQCA 3LECA 4ZU6X 4NZYA 1C9NA 3BDIA 1IBSA 3A6FA 1FFXA 2IPNA 2X7JA 2G04A 4PIVA 2GK4A 2YOFA 1I6KA 3U5TA 2A78A 2YQ4A 1KOGA 1RZRD 3JWHA 2WT9A 2FDCA 1AG9A 4MKHA 1GUDA 4MGKR 5ICMA 5HWSA 2RHGB 2PLFA 1A9TA 2Z43A 2ZR0A 3TTSA 1SOUA 2IY9A 3NNNA 4ZQEA 4IIYA 2QT9A 2PS1A 3S2IA 1BMDA 1F9AA 4QOEA 3WB0A 1I6WA 2GXUA 5DYWA 1AB5A 4TGLA 2FMKA 4MUMA 2BMEA 4NZNA 5T6BA 3S70A 3DE3X 4L6AA 3TZLA 2OAQ1 4D0LB 1IC6A 4C4XA 4MR9A 1Z4KA 4X24A 4S1OA 3T52A 5E7MA 2NADA 3VXKA 4ES6A 2VCHA 2E4WA 2GCOA 3FVTA 3IPYA 4OXQA 2AUTA 3PFGA 2L42A 2OA0A 4J0QA 1AHNA 5BYBA 3MINA 4DJAA 2GM4A 1E3WB 2LIVA 3WQHA 1FQJA 4EG6A 3PTLA 2BGUA 1SCNE 4UU7A 4DNFA 5B5SA 4RS3A 1NPDA 3L1VA 2XVMA 1QG6A 3DEIA 4LF7B 2IVZA 1NRWA 3HKDB 3Q6MA 5DNYB 1IBCA 4WD3A 5IAAA 2V58A 5BRAA 3HCAA 1M8GA 4CN8A 3R6WA 3ZNQA 3KXLA 2Q0HA 5G0VA 1CQWA 3PNPA 5BSUA 2XWSA 5TEWA 3RU2A 1T26A 2X1LA 4HPWA 3IODA 5DN9A 3S5UA 1XBTA 5KWSA 4MV6A 5IVHA 1ND6A 1IBMB 1U98A 3AIIA 3R9IA 1Y7HA 3R4CA 1I24A 4JFRA 1N5RA 1WSWA 5CFMA 3K8ZA 3ND7A 4NAVA 1BDHA 2YXBA 3I6ZA 5K0NA 3VH2A 4GWGA 4LAFA 1FYWA 1OLXA 1PR4A 2Q3FA 5DEOA 4MV1A 2E6KA 3KWFA 3AINA 4K0KB 3B3GA 1DC3A 1CBUA 4LRUA 4RX1A 2ZJ3A 3HZOA 1THMA 2OCAA 4JUIA 3SR0A 3WLHA 3GFFA 4ZXFA 2BR5A 4UTXA 4YRNA 3FPHA 1FUKA 3TE7A 4D3DA 1E1CA 3ND9A 3RSGA 1MZVA 2HK9A 2BP7A 1KPHA 2NV0A 3C3EA 1ADCA 1JA1A 2AC7A 1UBTS 2WD9A 3COZA 3HH8A 3LP8A 3IR5A 4FI3C 1I36A 1AKYA 3RAPR 1ZI9A 4MP6A 4WLNA 1Q19A 3SM3A 4V0KA 1LK5A 4LJ5A 1QPGA 4UM9D 4AZ3A 5K8UA 3RTBA 4ZVPA 3L0DA 3NIBA 2NN3C 2ZTVA 4B3MB 3DMRA 3VJRA 4DA9A 2UXDB 3PRKE 2B8NA 4PG7A 1TM3E 2Q5CA 1CHDA 2UVDA 2VSOA 1M0EA 1SVMA 1JI3A 2YFYA 3IELA 4CGZA 2H6EA 2Z4RA 1A7UA 1W73A 1Z74A 2BFWA 2X0FA 4F38A 5H9VA 2FPPA 1OV4A 2QTNA 4X7MA 4CTKA 4DCUA 2B1JA 3EDQA 3K4QA 4R9NA 3U1BA 5DNCA 2OCPA 4TZKA 2BGRA 4G0UA 2JGMA 3TG8A 2ON6A 2O7QA 3DXYA 4YJ3A 5LA6F 3N05A 1FUIA 3L5OA 1ML3A 1CTQA 3IJRA 4KZKA 1C9KA 2XA1A 4MA4A 5DI9A 4DMCA 2GN4A 4DDTA 3UBTA 2ACKA 2V6FA 2Y77A 6NULA 2E87A 4D80A 3FPCA 3KQTA 3AVQA 3CEJA 1Q16A 4YRMA 1DIRA 4A3SA 1KY3A 4QE3A 4OK6A 1TADA 2FMIA 5KREA 4GKVA 4HNRA 3BTSA 4KQHA 3DLBA 1S8NA 4ZVMA 4RVDA 1NMZA 2IOFA 3GX1A 4KVAA 3ADPA 5DF1A 3FKJA 4BVKA 3IR7A 4B4WA 3K70B 4IH1A 4JJFA 2OLJA 2XUDA 4BZXA 4YMWA 1V8OA 1UBUS 1NAIA 3GEHA 4D45A 3JTEA 3VOAA 2OD9A 2R8XA 5IJ0B 4XVRA 5JS7A 1FU8A 2PU7A 1PFGA 1Z29A 2X4DA 2Y0BA 4KOAA 1TUBB 1TT5A 1FB5A 1U8UA 3K5PA 1I0IA 4MINA 1TK9A 2CXQA 1R0KA 2FGKA 2Q4OA 4GOJA 1MOQA 2QG6A 3CBQA 3P4UA 4X0EA 4Y2QA 5LQNA 2FEWB 4HG2A 3T4UA 3T1OA 1X0VA 3NYRA 4C07A 2HCTA 2V5UA 4H9GA 1NG9A 2OO5C 1R7RA 1QDLB 4ENVA 1CR1A 2W2KB 3VPSA 3DMPA 4C4RA 5AVUA 3N0TA 3QU9A 1FW6A 1OZAA 2MU1A 3GGJA 4WECA 4LRXA 4N0QA 2GT1A 2NUPA 3DP7A 4UBNA 3A05A 5AXCA 1KAOA 1KK2A 1PD0A 4IQFA 3RI3A 1BW9A 3CRZA 1U7OA 2OB1A 3IP3A 4FYHA 3KSZO 1LZLA 4BIMA 4NYMQ 2XXAA 5LKAA 4C4YA 3NTQA 2F8SA 3QKRB 4BB9A 4EG1A 3AUTA 4LJYA 3M5DA 2JFGA 3JD1A 2J32A 4LC0A 2HSWA 2R47A 3AUYA 4HXGA 1J7JA 3KLBA 4G5RA 2JFQA 4HAOA 4X20A 1OMOA 2UYGA 3JQ7A 4JP5A 1G20A 1V16A 1IOZA 4OIFA 5K4AA 3HY3A 5IW8A 5AK4A 3VSEA 4E1BA 4YWJA 1RW4A 5AVJA 3E35A 3WLIA 5F5XA 3K35A 1IN4A 3ANMA 4OQFA 2VS1A 2HGZA 5ILGA 1J8MF 2OQVA 3ZZ0A 3IMGA 1F3OA 2PJZA 3HUTA 2JEOA 5K01A 3IUSA 3L4EA 2BR4A 2H52A 2JW5A 1X6VA 2FWMX 2ZWIA 3BBLA 3ZH2A 4KACA 4L74A 1WZNA 4D96A 4RTQA 3F1LA 2CV2A 3K71B 1YR1A 1USIA 3O8QB 5IAOA 2PE5A 3AFGA 1Z6GA 4ARZB 3VYVA 4BQOA 4FXOA 4O4IA 3B7PA 3A7DA 2I7CA 3OCVA 3F5SA 2X77A 5U9CA 1NUSA 4I6EA 1R8YA 4E2ZA 1KORA 4R6WA 4PYIA 4PX5A 1VPDA 2JGKA 2B4KA 1WY5A 4ZOBA 5HRAA 4WLVA 5EIHA 2H59A 3ELUA 3RS4A 4G5HA 1CUJA 1JAHA 2FWAA 1T9ZA 3PI7A 5AVTA 1E6KA 2PBFA 5AVKA 3UMVA 3LVRE 3R3UA 1EQAA 1I9CA 1H6BA 3OM1A 1E4OA 5K0ZA 4IY1A 5M29A 2XOKD 4DXAA 5JJCA 4RS4A 2VT7A 3BMCB 2EW8A 4DXDA 1CUCA 3TNYA 1ESMA 4AM8A 3OTIA 4TWZA 4IAOA 5E1OA 2IUTA 4RPJA 1Q22A 4E5PA 4BKOA 3GEGA 5AW2A 3TSYA 1ABFA 3U60B 2FX5A 1QQAA 4H7PA 4QASA 3RBXA 3GZNB 2CHGA 1HMYA 3IDFA 3LC2O 5FUVA 5JC8A 3V4OA 5DTMA 4IKOA 2C9BA 5CNKA 5A05A 2F1JA 1O54A 4BO2A 4K9KA 1T2DA 4NOJA 1WZUA 1SB8A 3HLTA 3OQVA 2J6HA 5FOXA 5HZKA 5I7VA 5EWMA 3GNLA 3I92A 5JECA 2PL3A 3AXSA 4ZJYA 4G01B 5ALFA 3RTGA 3W4IA 2HSGA 4ZP1A 5EIEA 1DB3A 4DC0A 4LJ7A 2FOLA 4N3CA 2AFHA 3JZFA 4N5IX 4LYEA 1EP9A 3F73A 5IH7A 4MQUA 2YWGA 5THXA 3GLQA 3LX4A 4KQ6A 4WI1A 3ZOKA 3P2EA 3SYKA 2QZPA 3FHLA 5KOJB 2O52A 1ODCA 3GVIA 2R1UA 4L2IA 4P58A 4CR6A 4E5KA 3UJ8A 1Q5PA 1UM9A 3EMVA 3NIDB 2IZ0A 3JPWA 1J0BA 1F6DA 2ONYA 3HPRA 5BR4A 2OBMA 5TDHA 5DB4A 4BRUA 1XO1A 4FE7A 2JCVA 1NVXQ 3GXBA 4B2IA 1YRHA 4AYTA 4IH4A 5LIPA 2VKQA 2C2YA 3WISA 4QJ5A 2HJ9A 4DLBA 2JS7A 4QGSA 5D3KA 2WJ3A 1MXFA 3GH1A 5IWCA 1QHIA 1I1OA 1YQUA 3HJNA 4KAJA 3C1AA 4YI5A 1Y3BE 2JI4A 1R0RE 4BLUA 4EVSA 5INTA 4Q18A 4AJIA 1INLA 2H00A 3DGEC 4R69A 2WILA 3PHCA 3TIIA 1U3WA 3VZDA 2R0QC 5ALDA 1MJGM 5C2JB 5BY2A 1WSDA 3WVNA 2AOTA 1M2VB 2PX3A 5KO2A 3K53A 4U0JA 2WJ6A 4Z2AA 1I2BA 4FZ5A 4GZMA 3HJFA 1CVRA 1EFVB 2C54A 2XUQA 1XRNA 1M73E 3V2HA 2VBIA 2QTVB 3RV3A 2HF8A 2IYTA 3NCTA 3MRTA 1J07A 1P3Y1 2DG2A 3F5FA 2HR1A 1ZW6A 3GLGA 1GCOA 3GLFA 1YO6A 1R5NA 4WX2B 4DLNA 3ST7A 1FMTA 2A9VA 2O1SA 3FVRA 2VSFA 2YJ4A 3GEDA 4TUYB 1PKXA 3JRXA 4UUMA 3Q9SA 2Y1GA 3HBMA 3HU2A 5EWMB 1KOLA 2WWVD 3RR2A 4KNWA 2FR8A 1G7RA 1MRZA 3F6CA 3P27A 5KYUA 1P2BA 5DHQA 5F4BA 3NYWA 3RM3A 4EMTA 5C35A 2XCRB 4KQJA 1I10A 5BQOA 3JXEA 1JVNA 1TCBA 1HE3A 2R7MA 4BQEA 1G18A 2FKNA 5KTPA 1EXVA 3OF5A 2WHYA 2ZIGA 3EHEA 4TM8A 4N9QA 3DBOB 3CEPB 4X84A 3W2TA 2PMDA 2FF5A 3LK7A 4JLAA 3TD6A 1DO8A 2FSVA 4UVDA 3EWAA 2XQGA 1N6KA 3AF5A 1Q0SA 2ZYWX 3GRZA 5GJBA 2GF0A 2Q3LA 4AW9A 1T24A 3HP4A 4L7QA 4CMHA 3Q8LA 4QDOA 3KKNA 2JFWA 3CSSA 4URYR 5D7BA 5F1YA 5LLSA 3OC0A 5HSGA 3THYB 1ZCFA 2OQRA 4HQLA 5C4IA 5AM2A 4C2AA 2JKZA 4OHBA 2FAXA 2YVKA 4BC0A 3I37X 4B3CA 3GLIB 4MUJA 3V6LA 1II9A 3L9XA 3MLBA 3G7SA 4PQRA 4F45A 2GEFA 5IJ9B 5EY5B 2H31A 3D4IA 2GK6A 2JIMA 3HBAA 1ILEA 4Q3LA 5KOHB 3JU3A 2WNIA 1OX6A 3BK7A 3NWBA 4PZDA 3I8OA 1MAVA 1DXQA 4XYGA 4AWXA 2QLTA 4GPZA 4XXHA 4TUYF 1NOJA 1NV8A 1VE3A 3AW8A 4X9XA 3W77A 2NP7A 2JFUA 3GAZA 4D26A 1VOTA 3FIUA 4DQVA 4OFBA 2CFOA 3I3SR 4HV4A 1H65A 2CBZA 3KLOA 4RTLA 1NF2A 2GQ0A 1TEHA 2HADA 3E5MA 3UK2A 1K7YA 4I8XA 4BO8A 1JP7A 1QCDA 3NWEA 1UJ2A 1XMIA 2QENA 1BDBA 4UKDA 5LC1A 4C4OA 2H9IA 1U7ZA 3VYUB 1ZH2A 4Y2XA 5AKYA 4D9CA 4DV6B 2CUKA 4S35A 1NNSA 1KYVA 2V55B 4Q3KA 5C7OO 2WD7B 3SI7A 1QB8A 1XAHA 2V7TA 3HN7A 4JA2A 5FBWB 1C0KA 3WAKA 3H17A 5ESDA 4KREA 1OWMA 2WMDA 5E0KB 4WEOA 5LU9A 4B71A 1XVLA 2QPAA 3RF7A 1GVNB 3NOVA 1NTOA 3TBKA 1JIJA 3LFUA 2I3DA 3P7MA 4GP6A 4R8VA 5EHNA 4A36A 1ZHFA 3ZY4A 4KVFA 2ZVQX 4OJMX 3VOSA 1WO8A 4AICA 1IPHA 1DIAA 5HRCA 1W0CA 1DOHA 1Z26A 3D0KA 4JQCA 5DNEA 5IDWA 5AQ1A 5A4MS 1UKCA 1RWNA 2ZUBA 4N7MA 4UMEA 4WKNA 1UKZA 5F7JA 4HYTA 1KP2A 2RGDA 3W8RA 4C08A 5IT9A 3BWDD 3OEED 4RK4A 1MTOA 2ST1A 4N01A 4MRAA 4W1QA 5CTAA 2X1VA 3MOIA 1Z0DA 1M8FA 3CYFA 4ZREA 3UOAB 4BATA 1Q15A 1M33A 3M4YA 3ESYA 4OXRA 1XNGA 5K3AA 4RKFA 3UWKA 2WSMA 1UEXC 3MGBA 2HPVA 3NHAA 4W9NA 5I8PA 1G63A 3ENQA 4IBOA 4ZOLF 4MA5A 1GITA 5CX1A 3HCBA 2C1EA 3I5AA 1LNQA 4LDAA 2A35A 2JJ8A 4FFRA 5HJEA 2YXLA 3AF4A 1ILWA 3QNMA 5LCXA 3V1LA 4G0WA 3C3PA 1VLQA 2YCLA 3BMNA 4HS9A 1X1RA 3GQBA 4ZWNA 5DI3B 3KZ1E 2RGYA 1KP9A 2JCGA 3V4VB 1L6IA 1SXJB 3FW1A 4Y2GA 3WGVA 4FSXA 2BDEA 4QHSA 5KQGA 4BNVA 4YV1A 4DWWA 4Q9LA 4EO7A 4XQEA 1XZAA 1CIPA 4U6QA 1QVZA 2QE7D 1RPZA 4ESEA 5KJ6A 3JAMA 3TUJC 2JLAA 3OZXA 1VI2A 2X3FA 3L05A 1N0VC 2CDRA 3NB0A 1SUCA 1ZU5A 1PJTA 3AV3A 2D13A 4P4GA 3TFQA 1KRHA 1YH3A 3IHLA 3AVPA 5BUCA 2D7DA 4H7FA 2XWBF 1RT9A 2C82A 1NF3A 2V6BA 2YJZA 2AXNA 3N2IA 4DR2B 3A6GA 5K03A 1ZM3A 1E4EA 1RFGE 2W0MA 4G63A 1EXNA 1ZSVA 2CLEB 3I9KA 4LZWA 3AETA 3TEMA 3DLHA 1EJ0A 2BZ0A 4Q9NA 4HZIA 3SX2A 2WF7A 3O4VA 2AG5A 4DSOA 5JAUA 2C5HA 2WM3A 3FRJA 3G5LA 1M7HA 4J0JA 5D84A 5TPZD 1BGXT 1YVPA 1Q1NA 1TM5E 3G2HA 4IHJF 2QG9A 3ZE2B 2IEIA 3PGVA 4UFPA 2NZXA 4YMTA 4MV9A 3U44A 3GF4A 1DLJA 4L95C 2GXSA 1T6NA 4QXOA 4TN1A 3V1TC 1EH5A 3RYTC 3EDYA 5JVDF 4C4PA 4HATA 4OBWA 5B30A 1SZDA 1K8QA 4YRRA 2NQ8A 3Q8WA 1VPVA 1FXSA 2ZJ8A 4N5LA 1BRTA 5H3CA 3HU1A 2B94A 4KXFB 4QYSA 4RYDA 1ENPA 2VJPA 4P4SB 5EIWA 3RAJA 4HVLA 2YL2A 2HF2A 5KDLA 1AMUA 1OAKA 3BXPA 1E5XA 4L76A 1SHKA 1O94D 2BC9A 3B78A 4R0NA 5IBCA 1JFFB 4ZHQA 1G8PA 3AC0A 3SBEA 1BHO1 4U2FA 2Z1NA 2Q5EA 2W4QA 3C8MA 3FNFA 3PFWO 2FN9A 1IN1A 1LVHA 5C1BA 2O1WA 3MXTA 2QJFA 1FYFA 2HBYA 2IP4A 4NH4A 2EQBA 1LJ8A 2OPBA 4TVOA 1PT7A 3T7CA 1WQ1R 1UC5B 4BVLA 3E05A 2CJYA 3HBLA 3SHWA 4P0TA 3EK2A 1G2OA 1GXSB 1ULAA 4K1LA 1Z08A 5ICFA 1LXCA 5KQSA 2F1IA 2VCYA 1DIGA 1GQYA 3PJGA 3EGWA 1BN6A 2AMVA 2C2WA 2J3HA 4L5CA 4LQ4A 3JQ6A 3R7NA 1WS6A 3DF7A 4AWBA 2Z5LA 4D8WA 4QJ3A 1ETHA 2WUWE 3OJEA 4Q4DA 5JZMA 3M6UA 4LHZA 4WKOA 4DDWA 1KDPA 1T13A 2J3JA 2Z0MA 2CKDA 3ET5A 3QXXA 2CLMB 3MELA 5JADA 4Z5XA 3GLHE 3R6DA 1VGRA 1TTTA 2ZRIA 2EJVA 3C87A 3DAYA 4FHEA 4RIEA 3W2FA 5JWRA 5DISB 1K66A 5BWNA 2MSCB 3IUPA 3LWBA 2AF3C 2C29D 4AY4A 1DWQA 3OQ6A 3DM5A 4KMRA 3WMFA 3V3KA 3H4TA 4D9IA 4ZU1X 4Q7MB 5LBUA 3NH6A 3HYRA 4CV2A 1BS1A 2R751 1J5XA 2NLOA 2Y8EA 3QP9A 4QBGB 3ZBTA 1U1DA 2QY9A 1EYZA 3BM5A 3CU5A 3TL2A 5LXTB 4OQPA 1ADFA 4PX9A 4Y6QA 3I0MA 2V59A 1EKXA 2RHJA 4XASA 3W05A 3ZGYA 3FUCA 4OQDA 1JA0A 2H2IA 5DX0A 2VLIA 2Z8XA 3NNDA 1LBQA 1T8RA 4H7IA 1OX4A 4KSYA 5EERA 5KAMA 4MGIR 4ARZA 4CMCA 1XPRA 3O4JA 4AJOA 2HIAA 3W9YA 5HIAA 1SVOA 4I1OA 5DGIA 1GG8A 3NOQA 5LYJF 2DUNA 2FLVA 2ZBGA 3ABZA 1BTOA 3EGXA 4N7RA 2EL7A 1O1YA 4PZ9A 3M4NA 1KFCB 1E0KA 1USVA 3CBGA 1YE3A 3CNNA 3KZXA 3QUSA 4Y0NA 4BWYA 3MAAC 3S1AA 4Y2UA 2QS9A 2QTFA 1ULZA 3EXHA 1NUAA 2H5LA 2YX1A 3OJXA 4ENTA 1E2DA 2X5KO 3UAGA 4D1YA 2V8OA 2QEQA 3DUFA 3K6JA 4YCBA 4Z54A 4CEHB 2HV9A 1R8JA 1L8XA 4FINA 4WAUA 3KKLA 4DY4A 3TNDA 5CVTA 9ATCA 4MPRA 3KYBA 3O3MB 1E1NA 2PUGA 2QAGA 3SXJA 2CB9A 2C8VA 5LM3A 1FQOA 2XH8A 4FC7A 1L4GA 5LP6B 2AZXA 4B34A 3PLNA 4QKQA 2YJ3A 1M2OA 3GRFA 3I39X 5F3RA 3TM5A 4EB0A 4OQXA 1TW2A 3H2KA 3HCRA 4I2VA 5F9MA 2GTHA 1SJ9A 2PVCA 1F14A 4PU0A 2QAGC 3FNQA 4PO1A 1T1JA 3Q0TA 4C7OB 2UYHA 5J40A 1LH0A 1JNYA 1ZD9A 5FFMA 1HNWB 3C3BA 5A03A 4JP1A 4PXYA 3QRWA 3ZE9A 3E3MA 3AEUA 2QLJA 2V96A 4PZYA 5JFOA 4H6VA 2P9BA 3SICE 3F1KA 3IQIX 3OG9A 1EUCA 3C7TA 2H5EA 2QM3A 3LS2A 4D9BA 2QRVB 2ZI5A 4G1EB 4ZQBA 4Z7NB 1P9RA 1MKYA 5KBYA 4EJFA 1XCGB 4W1SA 3DTYA 3HLKA 5FUBA 4OHZA 1MB0A 1U7TA 4G9GA 3HACA 3UM9A 3RODA 4G1BA 2JGNA 4CRWB 4LZJA 4KRFA 3EA4A 1HZZC 3HCCA 1R0YA 1Y9EA 3LO8A 2ZDGA 1H9CA 1GDTA 3HSSA 4DGQA 2Z9CA 3BORA 2QMYA 3FYUC 4Y7DA 4PBSA 3RS3A 3I6BA 4PBTA 4F7DA 1I30A 1DTWB 3TRDA 1KQNA 2W83A 2GPWA 2BFOA 2EG5A 4RVFA 1PYGA 5K6RA 3QH4A 1CSEE 2BLNA 5E9WA 1Z7EA 1ZQ9A 2HRZA 3S1AB 3TW8A 1WWKA 2CJXA 4OMCA 2BUBA 3DG9A 4ACAA 2CNBA 2XWQA 4Q1VA 3AVVA 3GJ3A 3H5RA 2XNDD 2GHQA 4TKLA 3N8DA 2AC2A 1O0BA 3NHJA 2NWQA 3IVRA 1PHRA 1YS4A 5A2GA 2ZQ5A 4LYGA 1FDIA 4OG2A 3D8NA 1Q1AA 3C48A 1TU0A 4JR2A 2D2EA 5DWQA 2AN9A 3SZUA 3EH2A 2F64A 2F6RA 3IHWA 2UUPA 3IT1A 1N2CE 3L41A 3I5XA 3GJZA 2G40A 4NTZA 1U11A 3TUIC 3BIOA 1U9YA 3ACDA 2X9QA 3KHTA 3ORFA 2QW8A 3T1NA 2GHRA 2X41A 3CEHA 3DE7X 1E3QA 1UBJS 5B3KA 1M2WA 1MFPA 4I9HA 1RRCA 1BVHA 4L6CA 4DIEA 4C4AA 1NWHA 1M2NA 5CA1B 4IF6A 1U99A 1F20A 1ZVVA 3F74A 4Y2SA 1QZUA 4HRYA 4YT8A 3SXPA 3KSBC 4AP5A 3OMWA 4JDPA 3HO6A 3V8BA 3MQ4A 1U81A 1YU9A 3IS3A 4HDNA 4OPMA 5FBRB 1QBGA 4WBSA 3T7RA 2FH5B 5AESA 3UIEA 1OF1A 3PYMA 5AVVA 1SEPA 1CEEA 1ZI8A 4BWGA 3AR6A 1RWBA 4AZ0A 2POCA 3C3JA 3DV2A 4RZXA 1IVSA 1BYIA 2VJMA 1YJXA