1M75A

Crystal structure of the n208s mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
b'KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVSRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Crystal Structure of the N208S Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m75A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m75A01
4FN4A 2ZYAA 5FI3A 4D3FA 2HU2A 3ZHYA 3DQPA 5KTKA 2B0JA 2VOEA 1GAEO 2Y1FA 2OFPA 2BHLA 2CD9A 3HFSA 3I9MA 1LEHA 3EVNA 4OYRA 4E5PA 4CLRB 5FYDA 4UULA 2A4KA 3DZIA 1TT5B 3A14A 4CMEC 2VCYA 4TZTA 2NTVA 3WWZA 4ALKA 3VPHA 1Q1NA 3DMTA 1ENZA 2DUWA 2Y1EA 1HDXA 1IUKA 3UCFA 2DBVO 3ZWNA 4RL6A 4BNGA 1MX3A 1GPDG 2WYUA 4NU5A 2J5KA 4MVJF 1OAAA 4IIUA 4BO1A 3PI7A 3I52A 3T7EA 4MVJD 1MXHA 1CRWG 1E3LA 3IOYA 1GEGA 1U9JA 5JCJD 4LSWA 1LUAA 3WGHA 1NFRA 1GQQA 1J0XO 1MUUA 3M1LA 4B3IA 1ZFNA 2ZQYA 4LSMA 4XGNA 2QZZA 4J9VA 5CG1A 4RVGA 1X13A 1E1MA 4YJHA 4CMIB 2QRJA 5DCYA 3CMMA 3A9WA 3H3FA 1R4MB 3OICA 3ORFA 4I5DA 4ND1A 4PCVA 4Y6RA 3PK0A 5ITWA 4XD2A 2X1HA 4GWGA 3C3XA 2UUOA 4BKRA 1ZEJA 4MIOA 3VZRA 1I2CA 4W99A 3PEFA 2E6UX 1P33A 2FY8A 3KO8A 3WYBA 2JHGA 3GNQA 5TQVA 1ENYA 1Q2XA 1LLUA 2I5PO 2ZTVA 3HG7A 1M67A 1WDMA 5TC4A 2NQTA 3JQFA 2NVUA 3OF2A 1U5CA 3BMQB 3EHEA 3ADPA 1YBVA 1ZJZA 4BNIA 4JIGA 3TFOA 5G0UA 5HM8A 4W82A 4YJDA 3DB2A 4JBGA 4NFYA 1QYWA 3VZPA 2P5YA 4HY3A 5LDHA 1OI7A 2FN7A 3F5QA 2VWGA 4HBGA 3IUSA 1I3NA 3GMSA 3UCEA 3LC7O 2HMVA 1VE9A 1J4AA 4FFPA 3UXYA 3C1AA 4EBFA 3ZWWA 3WMWA 3UF0A 1C3VA 2CDAA 1ONNA 3OJLA 4L8VA 4CR8A 1E3EA 1C0IA 2H1SA 3TZ6A 2VHXA 1OC4A 3OBBA 1YKFA 2RHRA 1GZ3A 4MP6A 2DBRA 2O7QA 2VQ3A 3ETGA 1MV8A 4KTVE 3BHJA 2Q1WA 4HKTA 3I3OA 2GGSA 2P9EA 3LT1A 4XRGA 5F3RA 4YCAA 5ENVA 2W4QA 2JJYA 3R3SA 3I6QA 3TZQA 2ZYDA 2R00C 2ZB7A 3OQ6A 4YTEA 3W6ZA 3QVOA 5B1YA 3I6IA 2CVZA 1P44A 1C0PA 4GX2A 5I7FA 1P1HA 1EDZA 4FGSA 1JVSA 3O8QB 1D3AA 1R16A 4DL9A 1W0CA 2EWMA 1O8CA 3L4BA 2FZWA 3DBHB 2QZ9A 4F6CA 3EGOA 1YDWA 1QKIA 2NSDA 4GQAA 2VWHA 4NH4A 4PLYA 1EVZA 4RF4A 3E9MA 3SC6A 1TT7A 3OHSX 1PQWA 3GUYA 1B7GO 1LDMA 1PWZA 4PVDA 3GMDA 1MFPA 5G4KA 2DVMA 3N7UA 2C7GA 5IZCA 1DHTA 1WZEA 1VKOA 4DC0A 1PQPA 1UP7A 3K92A 4J4BA 3P2OA 4RDHA 3PGXA 1LSOA 1XA0A 1YH3A 1XHLA 4FJ1A 2Y93A 4KMSA 4F3YA 1LRJA 1ZKMA 5HRUA 3ZV4A 4KUGA 2B4TO 4IXTA 2IXBA 1T2DA 4BKOA 1E1NA 1E7WA 4KWIA 1Y8QB 3LT0A 1GDHA 5ES3A 4FFNA 3PRJA 1BHSA 1HF3A 3ROQA 2NWQA 3JQ7A 3Q6IA 3GEGA 1X0VA 1O89A 5KOIA 2X5OA 3ZW9A 3DXFA 2VHWA 3IJRA 1JWBB 1CDOA 5CDSA 4PLHA 1F8GA 5JCXA 1JWAB 3ASVA 2VZ9A 2J3HA 2W90A 3E9NA 4XR4A 5TX7A 2X22A 4MP3A 1AGNA 1YL7A 2AHRA 3N58A 3WOHA 2JAHA 2O50A 3WFJA 1WMBA 1JKFA 3QHAA 4HFMA 4RF2A 4WKGA 3H5AA 2BGLA 1OBFO 2D8AA 4TVBA 4LMRA 4E5MA 4HP8A 4M55A 5IN5A 4QQRA 2QW8A 1E7QA 2LDBA 3KSDO 4BNYA 1DJNA 3CEAA 1A5ZA 4GX1A 1MC4A 5JAQA 1Z45A 1HE5A 1SMKA 1ZNQO 2EEZA 4OO3A 4TMFA 2WEKA 1O94A 4XEHA 1GEEA 1U28A 5ILGA 4BNFA 1U3VA 1P1JA 5EIOA 2AE1A 2JFHA 3T7CA 3U3XA 5KIAA 5KJCA 3DZGA 4LMPA 1M2WA 3HADA 1P31A 2HRZA 4ONEA 5L4LA 2NTNA 1LLDA 3HJAA 4L4XA 1BMDA 1XQ1A 1TB4A 3O38A 1BGVA 3A28A 2J8ZA 2FZEA 3G1TA 2YZ7A 3GLQA 3H9JA 3OQBA 4J49A 5I9MA 5IDQA 1LJ8A 4LRTB 3E8XA 3NDRA 1WXDA 1E92A 2XXJA 4IJUA 4J91A 2B83A 4PN3A 1IPFA 2EERA 3E9QA 4HFNA 5IDWA 1DIGA 3FWNA 1HDGO 3MCVA 1IHYA 2C29D 4CM4A 1Q7GA 1U4SA 5IN4A 4NBWA 3O4RA 4CM9D 1DIRA 1YOVA 1AXEA 4NMHA 4URFA 3M2TA 3VZQA 3DFZA 2GRAA 4OHUA 1RKXA 2DUUA 2EKPA 3D4NA 2X4GA 4KUHA 3I9LA 4GGPA 2WMDA 4XIJA 1H6DA 3GUCA 3DZJA 4YJHB 1YWGO 2Y1DA 3F5SA 4R9SA 5A3JA 1QV7A 1YXMA 1LLCA 3F4BA 3ZHXA 2OXIA 4DQXA 1VJ1A 2BLLA 4UVDA 3FBTA 4INAA 4HNGA 2DTXA 5AXCA 2YV3A 1FDVA 1I33A 3ZV3A 2IRWA 4PLVA 5L3ZA 3Q11A 4NHEA 3JCZA 3UHAA 3QJ5A 4TZKA 1NR1A 4O1MA 2Y0CA 1WZIA 1H93A 4XKJA 4WLOA 1NVTA 4R51A 2JHFA 3DZHA 2NVUB 4L9RA 1RYEA 3JQ8A 4JLWA 4Q9NA 4B4UA 2PKQP 4CM6A 3E48A 4NK4A 1YL6A 2AG5A 4TKLA 3V1YA 4I08A 1B8UA 3WB9A 1PR9A 1Z73A 3HN7A 1I8TA 1I2BA 3MJCA 4RPLA 2RH4A 4WEOA 2PGJA 3E5RA 3MTJA 4E21A 3I4FA 2JFFA 4NQZA 4DIFA 3NDIA 2EKQA 3X2EA 4YQYA 1BW9A 3GDOA 2NVWA 1EK5A 1X7HA 1ZBQA 2EJVA 3OIDA 5JDCA 2YW9A 3I5MA 2POQX 3KYCA 4DIBA 4A73A 3KEQA 1Q0LA 2G0TA 2HRBA 3FNFA 1ZXBA 2AE2A 2YHUA 3DHNA 3ETEA 4ND3A 4BMNA 1KEVA 3V1TC 1QP8A 1ZK0A 2CFCA 1GCOA 4FFMA 1EBUA 4GLLA 2PZMA 1E5QA 1HRDA 3PHLA 2Q4EA 4IMRA 4Y9DA 3K5PA 3LF2A 3N74A 4AJIA 1GQ2A 4EUEA 2Y0DA 3TZHA 3GF4A 5JAZA 5JY1A 3L0DA 3ZWMA 5JDIA 4KUEA 1UXGA 2HDHA 1FMCA 4K28A 1JW9B 1R4NA 1V3UA 2GNAA 1NTOA 1UZMA 2JCXA 5BSFA 4DPMA 2GUGA 3SJUA 3PYMA 5DF1A 4XB2A 5BNTA 4FIZA 3R6DA 1RYDA 2W2LA 3ETDA 2DBZA 4TVOA 1YJQA 4RVUA 2E82A 1D4FA 1CETA 4DA9A 3Q0EA 4R5MA 5L4SA 5CEJA 2BKAA 4OAQA 4JROA 1D8AA 3GY0A 3NTRA 4E2XA 1NAIA 1H6AA 4H3VA 1LQTA 2PD6A 2PTGA 2RBEA 3A1NA 3HZZA 3PFWO 1LNQA 3RVDA 2O23A 4ZRMA 1PQUA 1BDBA 5G4KB 4DQVA 2GCGA 4J4HA 1ZCJA 5A9TA 4FOSA 2IYOA 4E5YA 1UZLA 3T4XA 4CLOA 4E0BA 4G65A 3NUGA 5BT9A 2E49A 2NM0A 1MG5A 1RM0A 4GGOA 5K9ZA 5CP8A 3VH2A 1LC0A 2WE7A 3IKTA 3CXRA 3MOGA 1M6HA 2WD8A 1DLIA 2GZ1A 5TNXA 5TIIA 1CQIA 1YQGA 3JTMA 4KZPA 3Q2KA 1YL5A 2NV6A 2Q2QA 3BTVA 3QA9A 5A9SA 2Y1OA 3JQ7B 1BG6A 5FFFA 3OMLA 3FCOA 3ZWOA 4YT5A 4E31A 4IGFA 2PV7A 4BO4A 4J7UA 4N54A 1YQXA 2X58A 3VAZA 2IE0A 4CQMD 4NDNE 4BNLA 3FBGA 4YQZA 3VPXA 1U7TA 2YQ5A 1YRLA 4CM5A 1NYTA 1EVIA 4MVJA 1PZFA 2C07A 3TL3A 5A4DA 1CJCA 4XQGA 2BFAA 3VDRA 1VLLA 2X8LA 2PY6A 1CYDA 1KERA 4J7CA 4UREA 1EE9A 3OP4A 1QSGA 4NIMA 5A1TA 5AXAA 5KWEA 4J2HA 1EUZA 4W4TA 2PK3A 1M75A 4R3NA 2PD3A 3K2BA 4IDCA 1N2SA 3NTQA 3PHGA 4U7WA 1R0SA 4YA6A 1UZNA 5EJ2A 1VKNA 2B69A 2EP5A 3H9GA 1BVUA 4WNCA 1JAXA 1T25A 3MJVA 1WLYA 3ANNA 4IDAA 4CM4B 4CQLA 1NPDA 3RKUA 1ID1A 2Q99A 3TZKA 1YOVB 5BSHA 3BXXA 3FNEA 5JLAA 1PJTA 1MLDA 4BGVA 3IC5A 4Q3EA 2BD0A 2CY0A 5THQA 3NDJA 1W4ZA 1I3KA 2R2GA 3RAJA 4DUPA 4CPDA 4Z6KA 4C7JA 4LW8A 2FPGA 1EDOA 3DL2A 2WYWA 4J2OA 1XELA 5ER9A 3L9WA 4M87A 3WGZA 1G0OA 4EUFA 2AQ8A 4ALLA 5L7WA 4N5LA 5F1KA 4KQXA 1MFZA 3PWZA 1IOLA 2JD1A 3OJEA 3U4CA 3K2EA 3PYXA 4E5NA 3GQVA 3IL2A 1BXGA 4A10A 4CMAA 2PA3A 4J7XA 2NUAA 1W73A 1GV0A 1N5DA 3JQ8B 3PQEA 1Y9EA 4EW6A 4HUJA 1I5RA 4A27A 3RUDA 4BNJA 3V2UA 4YB8A 4R68A 2C59A 3VZSA 4BUCA 4KOAA 1HTBA 1XGKA 4BGIA 5AOVA 1GYPA 3D5QA 4ZJUA 5AYVA 1TVEA 3KEOA 3UICA 3PLRA 1GY8A 3VH3A 4UVHA 5EESA 5T8KA 1BW9B 1SC6A 1U2GA 3ROKA 1QYXA 1HLPA 2GSDA 1I32A 1UAGA 5CPFA 4ZA2A 3E6AA 3B1KA 3KYCB 5CDUA 3U09A 1TLTA 2PH3A 3CH6A 3KYBA 4CMGA 2RIRA 1E3JA 4MO2A 4AVYA 1S6YA 4YPOA 4AL4A 2H6EA 4YAJA 2C20A 2OP1A 2IZZA 1CQJA 4LRSB 3Q9NA 5BQFA 4D0SA 2VTDA 3HUDA 3ZWPA 4JN6B 1EQ2A 1EE2A 4IXWA 1X1EA 4Q3BA 4OXYA 7ADHA 4UUPA 3PQFA 3JD1A 3EDMA 1DIAA 2ZB4A 5JYEA 1P0CA 1KC3A 1R4NB 4WASA 1PGOA 4B8WA 4E12A 1KETA 5H83A 4JJIA 2VNAA 5T8KC 3AM3A 4FDAA 4WCFA 3UVEA 2P9CA 1NQAO 1UXKA 2G82A 3G0OA 4FC6A 3GVHA 2X5KO 3WSVA 2IYPA 3AW9A 3JQ6A 1IYZA 1YBAA 1J5PA 3AI1A 5DCUA 4O59O 4YJFA 4NR0A 1RPNA 3H2SA 1K3TA 4L73A 1KS9A 2GASA 4XYGA 5K6AC 3ZCXA 2JL1A 1ONPA 3RI3A 1ARZA 3FTNA 1SPXA 1YONA 1K6JA 1ML3A 2JCVA 3LLVA 3WBBA 1BXZA 4RO0A 3RFVA 2EIHA 1A4UA 4CLOB 3GH3A 1JLLA 1H2HA 3QQPA 3FPLA 3IKVA 2Z1NA 3RU7A 2HUNA 5JO9A 1YDEA 3DZBA 3GVXA 3BZUA 1A27A 4CMKA 4CL3A 2GN8A 5HA5A 4D46A 3M2PA 1JTVA 1X7GA 2QQ5A 3NAQA 3AUSA 2DBQA 4BNWA 1PTJA 5B12A 2JKVA 3PWKA 4RLHA 4R1SA 5LC1A 4RVHA 5A9SB 2HK9A 1PGJA 3NT2A 2XOXA 3QWIA 4PG5A 1FXSA 2G5CA 1A9YA 4N5NA 3WJAA 3ZWYA 4DXHA 4DPKA 4FR5A 4DTIA 2C2XA 3ZN2A 1DIHA 3RROA 1EFKA 1GFSA 2D0IA 4MJLA 5HBRA 4K6FA 5T67A 3JQEA 1AN9A 3AU9A 2BGMA 3TQHA 2QYTA 2NU7A 4OM8A 4MINA 4BGEA 4PZCA 3QVXA 4QO7A 5ER6A 4Y6SA 3ZU5A 4CM9A 1PGPA 3WGOA 4XJSA 1PR3A 2DTDA 3DONA 5KJEA 2YV2A 4IDBA 4E6PA 1UDCA 4PIVA 3QWAA 2YDYA 4QFCA 1U1IA 4RJTA 4N7RA 4ITUA 4RPKA 1JVBA 1DRWA 1H6CA 3AU8A 4YT8A 2PZJA 3IP1A 3ZW8A 1ISHA 4BNKA 4AJ2A 2I6TA 1WP4A 3LC2O 1PL6A 3WNQA 4LCEA 3EVTA 3NYWA 3RASA 4MDHA 2CVQA 4CL8A 1FDUA 5F1PA 1QV6A 4EJ0A 3DMTC 3FNHA 1R0LA 2VRCD 4XIYA 1VJ0A 4J90A 2PH5A 4DWVA 4L0QA 2UYYA 4MIYA 2B5VA 4IQGA 4JJFA 4CQLB 1P45A 3E18A 4PG8A 5JPIA 1U2DA 1P1KA 3OJOA 2OP0A 1NVGA 1H6BA 2NU6A 4YRAA 4PLZA 1G0NA 4IJVA 3WGGA 1QMGA 4Y8VA 3NGLA 4CR7A 3O03A 3QVSA 3VH4A 1DC6A 1NNUA 4OOFA 1X1TA 5EN4A 2XXBA 3GK3A 3ITDA 3JYLA 3D3WA 3KOUA 1T4BA 1XSEA 8ADHA 3PHHA 5CEFA 2CDBA 4HADA 4M1QA 1DDOA 4EITA 5KVCA 1ZJYA 2B35A 4HX5A 2FR8A 3D1LA 4JNKA 1A71A 5FF9A 1F0YA 2B4RO 3EC7A 1QYCA 3TWOA 1HDRA 4A7PA 4BO7A 4DBZA 4HV4A 3O9ZA 1LRKA 5DDIP 2EW8A 4D3SA 3ZGYA 3DR3A 3NGXA 2X9NA 4B79A 1QXSA 4PVCA 3MOIA 3KLMX 1E77A 3QW2A 3B1FA 4YT2A 3F46A 3DHYA 2HMUA 1H9AA 1BXGB 3EZYA 3GAZA 3K30A 1MA0A 1IL0A 3DAGA 4MKZA 3JQFC 3P5SA 3S2FA 4RZIA 4ESOA 2G17A 2AG8A 5BR7A 5U4QA 2JAPA 1YVEI 4LK3A 1HSOA 4R1NA 1EMDA 5JNLA 3ENNA 4D44A 5CDTA 3ITKA 3LSYA 1M76A 1LSJA 3FR7A 4KP7A 4OGWA 1N7GA 3DZKA 5TS3A 3GGOA 1KOLA 5K0ZA 1OFGA 1GV1A 4CM8A 3WTBA 2QRKA 3LC1O 1CIVA 2PZKA 2QIOA 1LDGA 4BNNA 1E7MA 3S2EA 1NHWA 1W6UA 5A05A 2J3IA 1DRUA 1K2WA 1WAMA 3CMCO 3KVOA 2ZKLA 3K8ZA 4RORA 1V3TA 7MDHA 3VKVA 1E3IA 2P5UA 4GKVA 3HWRA 1X0XA 1ZSNA 3EMKA 3R0IA 2Y68A 2Q46A 3U5TA 3C85A 2RAFA 4CUKA 2WSBA 2HK7A 4Z9XA 2A9FA 2P91A 3GGPA 2P9GA 1EVYA 3ZHBA 2C5AA 4NNJA 1DOHA 1P1IA 4YBZA 5F1OA 2I99A 4ALIA 5ILOA 4WCFB 2Q45A 4TROA 4D45A 3DTTA 2ILTA 3EW7A 3RJ5A 1YBMA 3W8DA 3FHLA 3WQQA 3DTYA 3GEDA 3TF5A 4P22A 1LI4A 1PX0A 3C7CB 2C7VA 3GA0A 4IS3A 3K31A 4K9DA 4B7XA 3HE3A 4YJFB 3L4BC 3F1LA 1HKUA 3ZNQA 3U4IA 3W4JA 3OEWA 4FFRA 4L76A 3SC4A 1CEQA 3UN1A 4NBUA 2GF2A 1ZMOA 3WQRA 4PRKA 5ITVA 2AEFA 2FRDA 5FEUA 3C7AA 3PDUA 4CQMA 1EFLA 4KTTE 4U6QA 3HDHA 4CLEA 5IZCC 4RVFA 1YE3A 4XCVA 4AJKA 3QWHA 3WX0A 4B4OA 4RQTA 4IDEA 5DCWA 4R5HA 4WLFA 3TFQA 3BMNA 4AFNA 5L40A 2WE8A 3E82A 4QEDA 4B3JA 2I3GA 2DPHA 3ZDFA 5AQ1A 4Z0PA 1I30A 5ICMA 4FD3A 1N8KA 5A02A 1MXFA 2NADA 4NU6A 4XGKA 3HFGA 1H0KA 4YXFA 3QVTA 5JYDA 4YDRA 5JFOA 1BXKA 2PD4A 3GEMA 4A0SA 3TOZA 4BNUA 1DLJA 1K89A 3CKYA 2AMFA 5C7OO 2H63A 3C24A 4WJZA 2EG9A 4XYMA 1ISMA 3LDHA 1WNTA 3FD8A 1ULSA 4GPD1 5IF3A 4NI5A 1LSSA 3QLJA 5I9LA 2DU8A 1L7EA 2DPGA 3FSRA 4BVAA 3ZI0A 1AHIA 2EXXA 5COAA 5ENDA 4CM1A 4BO2A 1RM3A 3BMCA 2V6GA 3ABIA 4F45A 1YB4A 3SXPA 2VYVD 1JQBA 5EINA 2PFGA 1NX6A 4ROSA 4QSMA 2D2IA 5DP1A 5T5QA 3VC7A 2UVDA 4I5EA 2FHSA 1QRRA 1LLQA 3ZWXA 4IMPA 2GR9A 1V8BA 4BIIA 3JQAD 1BDMA 1JDJA 3GHYA 2A92A 4DREA 3AJRA 4EJMA 4GX5A 3ZNNA 2D5AA 1DFIA 4C7KA 5C7IO 4BMSA 1XR3A 3H9QA 4CLXA 4NK5A 2V65A 3WS7A 5CAEA 3C1OA 1DFGA 3F6YA 1AXGA 4Z9FA 4EUHA 3RQSA 2DKNA 3STHA 1OC2A 1D1SA 4R54A 2NU9A 4MVJG 1I24A 1IZ9A 3ROPA 3AOGA 1ADFA 4CV2A 1ORRA 1PIWA 1UAYA 3D3WB 4GAEA 2BH9A 4E2WA 1DO8A 3EZLA 1GZ6A 2TMGA 4YAEA 1V9LA 3SLKA 2B37A 2X6TA 4FJ0A 3P7MA 3RKRA 3I9KA 3ZZNA 3ANLA 1UP6A 2O4UX 4IM7A 4UUMA 3NX4A 4RVSA 2TMDA 3VHRA 4OSPA 1HETA 4XYBA 2VUSA 5IFLA 2FSVA 4ALMA 2DLDA 4U0KA 1ISIA 2AEMA 4LVCA 4RLSA 1WVGA 2PR2A 1EZ4A 2ZCUA 5KKCA 3RWBA 4RPHA 4RCVA 3ZU3A 3IMFA 1NR7A 1LRLA 3W4IA 4FW8A 1R37A 5CDGA 1KEPA 1B26A 2X23A 3X2FA 2DFDA 3WFIA 2GN4A 3QWFA 1P3DA 4FJ2A 1S7CA 4CLDA 4ZHSA 1N7HA 3E5MA 1KVSA 3CUKA 4CM8B 5A03A 1H5QA 3OH8A 4GVXA 5JDCC 3V2GA 1ZZEA 3ZWBA 4JX8A 5DT9A 4FC7A 4M8SA 3GNTA 1ZK1A 5F21A 1Q7BA 4WCDA 3GRPA 3WNVA 2VHVA 4YAGA 1C0KA 3LVFO 4IJWA 1ISJA 4PLTA 1TXGA 1HDYA 3IUPA 1T2EA 2AQHA 4ND4A 4DBVO 1PJBA 3EK2A 5KJ6A 4YYZA 1GQYA 1ENPA 1QORA 4OKNA 1Y9AA 5DOZA 4XGIA 3U0BA 1UDBA 4D43A 4GL4A 4GSKA 5AVOA 1B8VA 3KSUA 4E2ZA 1A72A 4P8RA 1VPDA 5JDIC 3U9LA 4N5MA 4MVJH 2E37A 2DC1A 4CMHA 3PIDA 1B0AA 4F46A 3DWFA 2EW2A 4GMGA 1RWBA 1Y5MA 2NLOA 2OZPA 1HE3A 1IULA 5I8WA 3HHPA 2OL4A 2I3AA 5G4LA 1FF9A 1EQUA 2E48A 5L51A 5MDHA 1DJQA 5COQA 2ZB3A 2D5CA 4ALNA 4Z3DA 4PRLA 4OOEA 1P77A 4IINA 1PZGA 2Q2VA 4L74A 3O26A 4YRBA 2XF8A 2HCTA 3KV3O 1GZ4A 4R01A 3WR5A 5B4VA 1XG5A 2JD2A 1PEDA 4CQMB 4YT4A 1XU7A 3GT0A 1DB3A 3FI9A 2E4AA 3H7AA 2YJZA 2PKRA 4B4VA 2PKQO 3BMNB 3HQ4O 3RBZA 1ADBA 2NACA 3EUWA 1PZHA 4ZU3A 4OKIA 3ON5A 2WM3A 1QYVA 1DBVO 2OO5A 2J5RA 2ET6A 5A06A 2B4QA 4R3WA 1ZEMA 3OM9A 4FBGA 1F14A 5A9RA 2I67A 3T4EA 5JCJA 3WSWA 4C4OA 1I3MA 5BSGA 3DBVO 4BKUA 3HNPA 2JD0A 2W2KA 3RC9A 2AXQA 4BO8A 4X54A 1OMOA 2BGKA 1DC5A 4IPTA 1W8DA 1VSVA 3COSA 1CF2O 2P4HX 4BNMA 1PGNA 4FSHA 2YQ4A 2VRCA 3RBXA 3DAFA 4CODB 2C2YA 1KEUA 2IZ0A 1N9GA 1ZW1A 1ZSVA 4UEOA 2QX7A 2GPTA 4AJOA 1GD1O 3RUFA 3GNSA 3ZWAA 2IZ1A 4G81A 2OOSA 1A7AA 3SLGA 3BMCB 2RCYA 3ONDA 3EY4A 4J1TA 1T1RA 4UVEA 2VYND 1FDWA 2NU8A 3INGA 3WTCA 4BKQA 4P4LA 2VT2A 1OZAA 1TI7A 1XEAA 3IIEA 2DTEA 4XA8A 1X15A 1SAYA 5G0VA 1NP3A 1Y8RA 2ZTUA 4I1IA 4OXKA 5JMPA 1PS0A 3PHIA 2ZTMA 3JD2A 2DT5A 4RV9A 3U62A 4BL5A 5C5IA 4GBJA 4GKBA 3D4OA 4AG3A 3QE3A 5DBGA 3W8FA 1DC3A 1RJWA 3JQGA 1Z7EA 3GDGA 4I9NA 2ZQZA 2YY7A 4W9NA 3ST7A 5DBFA 3I23A 4ZN6A 3AM5A 3W8EA 3WQSB 1R0KA 3R1IA 3KYDA 3PJFA 1DAOA 1UJMA 3WMXA 4W7IA 5B4TA 3GGGA 4IJKA 5AXDA 1PJSA 2J3KA 3DBRB 4XZ3A 3DHEA 3FPCA 3TSCA 1J6UA 1PSDA 2HSDA 2Q50A 3LK7A 4FPXA 2GDZA 2SCUA 4M86A 3OFSA 1P1FA 1RM5A 3AI2A 2X0IA 5IG2A 3JQBA 3ONFA 4BMVA 3OJ0A 5JAIA 4R16A 2BI7A 2DFVA 1VJTA 2H5LA 4HXYA 4E3ZA 1LDNA 2Y66A 3ENKA 4I5GA 1E6WA 5JBIA 2IDZA 1TEHA 3LQFA 2CVOA 4IGEA 3UW3A 3KETA 3PXXA 1B2LA 4DMLA 3CZMA 1PS9A 2FPIA 3F9IA 4Z9YA 2O4CA 4BOYA 3GZ4A 1BSVA 1E6UA 1KEWA 2HJRA 2WWRA 4YR9A 1GL3A 1ZO8A 2BI8A 1YS4A 1PJQA 2VHYA 2YFQA 5L4NA 1UXIA 2A94A 4GI2A 2EP7A 5BNIA 1CWUA 4ZGWA 3NJ8A 3ZU2A 4I9UA 3H5RA 4PLGA 5TGDA 2Q4BA 1FK8A 2NNLD 3HDYA 3DDNA 3RIHA 3JD4A 4DPLA 9LDBA 3JYPA 2O48X 3OA2A 4I9HA 4DIOA 3UGKA 5HWSA 3L4SO 4B4WA 1ULUA 4J1SA 2FWMX 1ZXLA 3DOOA 4WNIA 3BMOA 5DP2A 1GUZA 1D7OA 2ZCVA 4AJPA 3LU1A 2CZCA 5FWNA 3BHMA 1EUCA 3AFNA 2HK8A 4EJ6A 1XKQA 3LZ6A 4MVJI 3DFUA 4Z3KA 2VNSA 3KLPX 4PLPA 4AJLA 3H3JA 4DRYA 2X0NA 4TRNA 4WK6A 1K6XA 3I83A 2CMDA 3KB6A 2DM6A 2YFHA 3AOEA 2IEDA 5AXBA 5CPBA 4Y98A 4QX6A 4OL9A 3D7LA 4XB1A 3RJ9A 3WDSA 1WDLA 3UH1A 3I9JA 3PJGA 4DMMA 3JQ9A 4M49A 2FSSA 4WLNA 1SEPA 5B4UA 1ZUD1 1VC2A 2BRUA 1DRVA 3JQCA 1C1DA 4CM7A 1BWSA 2B5WA 5BNFA 4DLBA 3MWEB 3RSHA 3UUWA 4R9RA 2I65A 1HZZA 4PLFA 5KJFA 1XDWA 2EV9A 4JGBA 3WICA 4CMJA 1SNYA 2H9IA 1T2AA 3DC2A 3OIGA 5KVVA 1GUYA 3WJ7A 1V3VA 1B8PA 2Q2WA 1Y6JA 4H15A 5L7YA 4BGUA 4BNXA 1HEUA 3U4DA 3ZV6A 1UUFA 3SX2A 4IY1A 1C14A 4JCOA 2WTBA 4PGFA 1BRMA 1K5HA 3V5NA 1FDTA 5JY6A 5JSFA 3IQDB 4WCFC 3WGIA 1N92A 3PJDA 4A26A 2YHIA 3GRKA 3L77A 5T6BA 4DGSA 4NJMA 5IXSA 3RC2A 4O63O 4MVJP 4MIEA 4HFRA 1MG0A 4RPGA 4ZQHA 4JK3A 1C1XA 1ZH8A 5EMHA 1O5IA 2BFPA 2Z1MA 3JYQA 4N18A 4CV3A 3K96A 4ZQBA 3HB4X 2PGLA 4CMEA 1K0UA 1SEVA 4IBOA 4OSOA 5FI5A 1F8FA 5F5NA 1PU2A 3HSKA 5DULA 3P2YA 2D3TA 1U5AA 4R41A 4XYEA 3H9EO 1NASA 3AY3A 3F1KA 3GFGA 3Q1LA 4D0RA 1E3WA 2JCYA 2O2YA 4IDGA 5JAMA 5JS6A 3FNGA 3ZV5A 2VYVA 1I2ZA 1GCUA 3BYZA 4O5OA 4Q3NA 4TRRA 3WLEA 2X0JA 5GZ3A 3R3JA 3AFMA 4DVJA 4XWYA 1ADCA 4E13A 4E33A 3FWZA 3VKUA 1X14A 3S2GA 3E03A 4NBTA 1E7YA 3JQAA 2W2KB 3AUTA 3GOHA 4L4RA 5DBIA 3OJFA 3OA0A 3ADOA 2GYYA 2X86A 3PPIA 3AUUA 1HWYA 2IODA 1Z82A 4RPJA 4H7PA 3ANMA 3D64A 4CJXA 1FDSA 4P4GA 1N9GB 2GZ3A 3B6ZA 1NBOA 5C7LO 4QTZA 3TJRA 4KWHA 1R66A 3KHUA 1I3LA 4WOJA 1PJCA 3LT2A 4II2A 4CLHA 5TF4A 3KRTA 3PGJA 1WPQA 2YYYA 1LXCA 3F4LA 4D41A 1UXHA 1E1KA 5A3VA 4BNTA 1ZVMA 3TL2A 4PZDA 1EEHA 5GZ6A 1ZK2A 3PLNA 3K6JA 1MP0A 1Y8RB 4DQUA 2EJWA 5LCXA 3RFTA 1B14A 1NQTA 1V0JA 4H16A 4J16A 3AWDA 3OETA 1DIBA 1MC5A 3JQGB 3PDJA 4GLOA 2W8ZA 2FOIA 4UVIA 2QRLA 4WLVA 5CFZA 4O6VA 2RHCA 1RM4A 4E5KA 4EEZA 3KTDA 5EQDA 4ILKA 3KYDB 4EYEA 3CSDA 4Z0HO 2O7SA 3PYLA 2V7PA 2VZ8A 3KSZO 3U49A 5G0TA 3PHJA 2F00A 4MKXA 2I66A 3NV9A 1K6IA 4BNVA 3C1TA 2AQKA 3EYWA 3SBOA 2JFGA 5A04A 3RUEA 4J3FA 4I8XA 4OJNA 3L6OO 1HDCA 2ZATA 4XDZA 1WWKA 1PL8A 4BO0A 2ZK7A 2PGDA 4J0EA 3CE6A 1IB6A 1VRWA 4ID9A 2R00A 4Q39A 2AQIA 4RF3A 3WG9A 6ADHA 2J6IA 3CPSA 4IIVA 5DOVA 4IZHA 1MGOA 4IUYA 4Z0TA 2O3UA 5EERA 3L6DA 1YQDA 1KYQA 1J49A 1A7KA 2CNBA 3SVTA 4MPDA 1P1RA 5U1PA 2C5EA 4TRJA 2BMAA 4YWJA 1DXYA 4A03A 1Z7BA 3GPDG 4J43A 4OMUA 1WW8A 4D42A 3IAHA 3QSGA 1T2CA 4NZ9A 5G2OA 3JYOA 1HYGA 4PFJA 3NEPX 4RQUA 1DPGA 4WOKA 4NJOA 3BMOB 2WYVA 2Q1UA 3PIIA 1VL8A 4IQ8A 3TDKA 4PG7A 3OQ1A 2Z5LA 4LN1A 4Q3CA 2YDXA 1ADGA 1NQOA 4YRDA 3S8MA 3TNLA 1P74A 1KVRA 3H4VA 2X5JO 1HE2A 3K9QO 4EZBA 3H9UA 1I01A 3ICPA 3BTUA 4FB5A 3BA1A 3IDSA 2C82A 4OXNA 3TZCA 2HKIA 2O2SA 4E4YA 5IAAA 4TQGA 1YO6A 1XCBA 2GO1A 4UAGA 3F3SA 5CHEA 2AA3A 4EEXA 3UAGA 3WGQA 1C1DB 2V6FA 3ICCA 2HQ1A 3MZ0A 1YB5A 1U3WA 4EGFA 1NHGA 4JBHA 3Q3CA 1ZK3A 2X9VA 3ONEA 1B15A 1NFQA 4RGBA 1JKJA 1NAHA 4XX0A 4NPCA 5KCZA 2VHZA 4CMBA 3H2ZA 4CM3A 2O3QA 9LDTA 3QY9A 3D3EA 4UUNA 1VI2A 1JU9A 5I7SA 5ICSA 3WLFA 2PWZA 4MKRA 1LDBA 1ISFA 3OEYA 1SB8A 3INRA 1LC3A 4ND5A 4ZQEA 2YHIB 2QG4A 2PZLA 2ZJ0A 4NJMB 4CV0A 1XLTA 1F17A 4MP8A 1D1TA 5COBA 4GH5A 1R15A 1C1XB 1G1AA 4BV9A 1HDZA 1U3UA 3QVWA 1G6KA 2X9GA 1HZJA 5JW6A 2Q49A 1L1FA 5TT1A 3G49A 6LDHA 4F6LA 4J1QA 4E30A 1JN0A 3DEYX 4QUKA 4J4TA 4W7HA 1VM6A 1ZSYA 4NBVA 2EGGA 1LBEA 1LQUA 1Z75A 2ZTLA 4U0JA 5HS4A 2O3JA 3WYEA 1E0DA 4XJTA 2Y1GA 3JYNA 1O95A 2Q3EA 5G0SA 2VZ0A 2X0RA 2HMWA 4BS9A 1E3WB 4Q3AA 3RCBA 5TRTA 2VYNA 4L75A 5JC1A 3H8VA 1PJ4A 3NTOA 3CZRA 4J9UE 3TPCA 3QP9A 1Y5RA 4FGWA 2Y1CA 1U3TA 3PFFA 3ZNPA 2OBYA 3DBLA 1HE4A 3CINA 2F1KA 2GN9A 3QV1A 4CMCA 3JQAB 4NBRA 2NVBA 4OQZA 1EUDA 1NFFA 3MWDB 5TJ9A 3MJ4A 3HB5X 1E6EA 1IY8A 2ZYGA 2J5QA 4YJGA 3IS3A 3WIDA 2ZB8A 5IDXA 5DN9A 3GR6A 2VRBA 4QECA 4HFJA 3G1UA 5F5LA 4DLAA 3BHIA 3PJEA 2BF7A 2R6JA 1E7RA 5HS6A 3ASUA 3BAZA 3C8MA 3DOJA 2P2SA 4TKMA 2IEBA 4JP2A 3DBRA 4NG5A 4R4JA 3S2IA 3BTSA 2G76A 2O3RA 1Q7CA 2WDZA 4J6FA 4BV8A 1IE3A 3L07A 1GADO 3L6EA 5I7EA 1U7HA 2GERA 3VPSA 4KDFA 4TRMA 1SO8A 4BO3A 3PP8A 1GYRA 1F12A 2GN6A 3GPIA 4B7UA 5JXWA 1P0FA 4M89A 4MVJE 5EL0A 1WDKA 1KY5A 1Q0QA 2Q1SA 1HXHA 1GTMA 1LA2A 2XAAA 5CDYA 5L95A 3TOXA 4JBIA 1NPYA 4NFHA 5I9NA 2Y05A 5JE8A 1CERA 4A5OA 3L9XA 1VL6A 1IHXA 3RC7A 3KM0A 4GX0A 1Q0HA 3ZWVA 2HMTA 3BIOA 1DAPA 1BVRA 2Y99A 4WLEA 5IZ4A 5GY7A 3S1LA 1XIVA 3RC1A 2BFMA 2VT3A 4RVDA 5CG2A 3GVCA 1HSZA 1A9ZA 4S3MA 2WD7A 5TJHA 2Z95A 4J1NA 2RH8A 4D7AA 4K6CA 1NXQA 2AEJA 3QWBA 2VUUA 1V6AA 4BB5A 4DYDA 1M6WA 1VSUA 3LLSA 1NVMB 2I9PA 2QYSA 3GZNA 1NM5A 1KBZA 3I1JA 1E7SA 2CF5A 2VTEA 5KNLA 3PZRA 4EDFA 1WMAA 1AUPA 3NT4A 4II3A 1O6ZA 4GVLA 5IXYA 3AUAA 1UH5A 4PLWA 4XQ9A 5EPOA 2HAEA 8LDHA 1YJ8A 3PVZA 3UOGA 2NQ8A 3SEFA 2VWQA 3W1VA 3AM4A 3GHHA 1SBYA 3UFXA 1DC4A 4RF5A 3HDQA 4BHTA 1SCUA 2QHXA 4NFSA 4U8GA 3TN7A 5ADHA 4WLUA 4RZHA 3INTA 4BKPA 4DYVA 3FR8A 4OH1A 5L45A 3OECA 1XQ6A 4E32A 1XWFA 1PZEA 3GFBA 3JV7A 1Z74A 1KVUA 3M6IA 3LF1A 1KIFA 3ROMA 2BFOA 4PG6A 4G5HA 3B1JA 5IJZA 1V35A 3A06A 2NTJA 1VL0A 3D5TA 4UVGA 3VVBA 4CV1A 2PLAA 4UEKA 4CUJA 1QLHA 3C7DB 4DLLA 4U6SA 4JQCA 2EF1A 4XQEA 3Q2IA 4B7CA 1ZMTA 4FCCA 4QFDA 1Y81A 1X7DA 5JO0A 4ALJA 4O0LA 3HN2A 5U9CA 5KVQA 4B3HA 3GG9A 4HNHA 4IDDA 4A2CA 5I7VA 1JKIA 4XQCA 1HL3A 4ZQFA 4YVFA 5IDYA 3ZH2A 3JSAA 3NJ4A 4FFOA 2WJPA 4I5FA 1EBFA 5TLSA 1BTOA 1HYHA 3MJEA 2GLXA 3CTMA 4ZQGA 3GC6A 4ZD6A 4CR6A 1O9BA 1UP4A 1L7DA 1SB9A 2EHDA 3FTPA 4MVJM 3BTOA 4G2NA 2ZIZA 3RFXA 1GR0A 2Q1TA 2C54A 5MGBA 4BO9A 1OOEA 1KVTA 1LSUA 5JMWA 2AW5A 5DZSA 1TA4A 4XR9A 3LT4A 1GPJA 2V6BA 4WUVA 3JD0A 5H81A 4AJNA 4BB6A 2UV8A 4AJEA 2P68A 1T26A 2Y67A 3PQDA 3H65A 4KDEA 3Q9UA 1H9BA 2CSUA 3GVPA 3HDJA 4WE3A 3RUHA 4ZVVA 3I9OA 4CLRA 4YAKA 2I76A 1HDOA 1TT5A 1IPEA 5A5EA 3RUCA 5C37A 1B16A 3B20A 3I4CA 4XYLA 1LX6A 3OIFA 4WECA 4YAIA 3QIVA 4Q3DA 1IZ0A 2HLPA 1A4IA 3GN2A 4LISA 3VTZA 3MJTA 2HMSA 3GDFA 4OIMA 1YGYA 4K26A 4GWKA 4PLCA 2LDXA 1QLJA 3DBLB 2IXAA 3V2HA 3VDQA 3B70A 3ZU4A 4EI2A 4GMFA 4Y6PA 3WIEA 3ZNOA 1I10A 4IDFA 1C0LA 1ZIDA 2C0CA 3WYCA 1LDEA 1ZK4A 3RU9A 3CIFA 3DOCA 4IS2A 4YJGB 2OGUA 4YEDA 5L53A 3FN4A 4CMIA 4GSLA 2D4AA 3JQDA 1R4MA 1MB4A 2O3TA 1HT0A 1Z6ZA 2CF6A 2OMEA 5TT0A 4WGGA 3AI3A 1UDAA 3UCXA 1P9LA 1GUFA 3H6KA 2FR0A 4AJJA 3V1UA 1XU9A 1QG6A 3I9NA 3IP3A 3TRIA 1I36A 5HTOA 2OHXA 1E1LA 3AY7A 4W6ZA 4XDYA 2OORA 3NRCA 3P19A 4QT0A 1EVJA 1GYQA 1SOWA 3DO5A 4BQPA 3VPGA 3A4VA 2OBNA 2CUKA 3E1KA 3MTGA 4AJHA 5L9AA 2FR1A 3RBVA 3BMQA 4BO5A 3VTFA 4K1LA 2W98A 3JD3A 3KUXA 2FMUA 3IJPA 1N1EA 5GMOA 4KQWA 3RD5A 4OQYA 4QXMA 3DAPA 3VOSA 4XRRA 2EKLA 5THKA 1KVQA 1R6DA 1Y1PA 2FP4A 3KZVA 4JXKA 4D3DA 3PZBA 4W9NC 1KY4A 3G79A 1HYEA 3S55A 4FQ8A 3WWYA 1LDYA 1U8XX 4PG4A 4J0FA 4R69A 2B36A 2YV1A 1EK6A 3FRJA 5BSEA 3GN1A 2DAPA 1T24A 3GAFA 3CTVA 1T2FA 4R1TA 2VN8A 5L7TA 4S1VA 3MEQA 4IQ0A 1LU9A 4PZEA 4U5QA 3D4PA 1PGQA 1F06A 2WD7B 5C3MA 4B8ZA 3QRWA 3ULKA 1DHRA 3DZFA 3EAGA 3JQBC 3M1AA 3OSUA 3WXBA 4QO8A 3VVCA 1FJHA 4BNHA 2VWPA 3U4HA 4D79A 2UDPA 3KBOA 4FFLA 1B3RA 2A35A 3W6UA 1JAYA 1PL7A 2J3JA 3GZNB 1UXJA 2V6MA 1PS8A 2XPCA 2PNFA 3MJSA 2HJSA 4E2YA 1UR5A 3O8QA 4JJGA 4JP3A 4R1UA 2D1YA 5T57A 1LTHR 3NKLA 1HLDA 3V8BA 3G17A 3DBHA 5H82A 4ZICA 3F47A 3GVIA 3SJ7A 2UAGA 1QR6A 2D59A 3PTZA 1ISGA 3GG2A 5A5FA 5K6AA 1DEHA 4AICA 3VPFA 3W4KA 2OUIA 3PWSA 2FPPA 4ND2A 1SZJG 1O0SA 5B37A 3ZHZA 1E3SA 1N1GA 2GD1O 2Y0EA 4FS3A 4HWKA 4M54A 3WBFA 4MOWA 5EQFA 1XYGA 3DMYA 3H5NA 3WGTA 4ZRNA 1AE1A 1U4OA 4LGVA 5LDGA 3UKOA 4LCJA 1M66A 1PJ3A 5KVSA 5GZ1A 1SOVA 4BO6A 2VUTA 4TSKA 5CEEA 3AOEC 1DFHA 1NQ5A 1PWXA 2UUPA 3WGYA 3G3EA 2ZJ1A 3K73O 4WEQA 1ONOA 4Y67A 1JA9A 4P38A 3RUIA 2O3SA 1U8FO 3JQ9C 1T4DA 3AY6A 1T1SA 1Y8QA 4TWRA 2W2LD 5G0WA 4P4NA 1I0ZA 4YACA 5KJ1A 1H94A 2YUTA 5J23A 3AK4A 4UEJA 2VOJA 1B3BA 1NWHA 4LVUA 2G1UA 4DC1A 1NWCA 4BQRA 2BELA 5I8ZA 2CDCA 2GZ2A 3ZWCA 3FF4A 4CUZA 4RDIA 5TSDA 2P4QA 2EGHA 1AHHA 4UUOA 1PJ2A 3KXDA 5DNAA 2X7HA 3VH1A 4IZIA 5KKAA 1E5LA 3NT5A 1PJLA 2DQ4A 4BNZA 1H2BA 1YB1A 1ENOA 3LYLA 4AJ1A 1GU7A 5JC8A 1R12A 4FOOA 1DSSG 1QYDA 2HO5A 3D0OA 3RUAA 1Y7TA 1NPTO 4AJ4A 1KC1A 5T64A 4L4SA 4WPGA
chains in the Genus database with same CATH superfamily
1G4AE 2YYSA 3ZHYA 2ASVA 1UK7A 2PH1A 5J5VA 1JXAA 1R6BX 3MJRA 3FZEA 2WSSD 4GXNA 1YOBA 2VOEA 3SKXA 1GAEO 1GNLA 2OFPA 2BHLA 3GRFA 4KE7A 2ZYTX 3A1EA 3NH6A 4ODIA 1LEHA 1PFGA 4DNFA 3EVNA 4ZHQA 5KX5F 1PKEA 4E5PA 1SCKA 3OJXA 2HIHA 2PQ2A 4HTAA 4ZVMA 2NYVA 3A14A 3AGQA 1FZTA 3V8EA 2OZLA 2VCYA 4YXWD 1CQWA 3F0TA 3BH7A 4ZOLF 2NTVA 4LQDA 4TMXA 1M2JA 3IVRA 4IWXA 3SEZA 2NSLA 4KFCA 1HDXA 5ALKA 1T9HA 5EFOA 5F76A 3HEMA 3OURA 2C3YA 4HB2A 2A9JA 4FYWA 4JIMA 4EAAA 4NU5A 1HQCA 4IUCS 3HV2A 1YQEA 2F9MA 1VECA 3G2LA 4LJ7A 4IIUA 5CJ2A 5P21A 3VUFA 4BO1A 1MABA 2DJIA 3I52A 4JC5A 1GQSA 1JZQA 2WKWA 4LYFA 1CRWG 4MVJD 3C5VA 4RESA 4ZPXA 5CB4B 5AOCA 4AIRA 3N76A 3VX3A 4NE7A 1T0IA 4QNMA 5JCJD 4G85A 4C6SA 1B42A 4B74A 1VZ2A 1T5TA 1NFRA 1G60A 1GQQA 1M7GA 1KFJB 2RHOA 3DP9A 4HLCA 2QZZA 3QVUA 1W4AA 1W4CA 4HEA6 4DLPA 5CG1A 4OQXA 3I4LA 1X13A 4RVGA 1E1MA 1M2VA 2ZWOA 4WL0A 1VJ5A 3IDZA 5B3JA 1OFVA 3W2GA 5IKOA 4Y6RA 4CMIB 1R4MB 3OICA 4I5DA 4WKNA 5CLFA 5DTRA 1LVHA 2JLYA 3P71T 4EBBA 4F9FA 1EGMB 3N5CA 5A4FS 1C41A 3W7VA 4BQIA 3K0BA 5ITWA 1N6OA 3C3XA 3K15A 3TNDA 4RGVA 1A9XA 3QYFA 3A1UA 3V7YA 1RPTA 5DNEA 3WK7A 3VZRA 1A5TA 1NSTA 2OVBA 1IM5A 4W99A 5ED0A 4D0GA 2E6UX 2AJ8A 3VZBA 3R6GA 3R9XB 3BF7A 1I94B 1TE2A 1ENYA 2B4YA 1PYOA 1LLUA 2I5PO 3DLBA 3DNMA 3HG7A 3LG2A 1D0IA 2WF8A 3EXEB 3SXUA 1CJSA 1YCDA 3U0VA 5IK2A 1WDMA 3T34A 5TC4A 4DY6A 2C4KA 4AG5A 3OF2A 4KVGA 5A6SB 1U5CA 5JJIA 5IHXA 3S7TA 3OU7A 1ZJZA 1YBVA 3E9RA 3ND9A 1SUBA 1BDIA 4BNIA 4D4LA 5CB6A 3HMQA 4JIGA 3TFOA 2F6RA 3I1IA 3O31A 1XYYA 2Y3IA 3WP1B 3YASA 1QE3A 3F3YA 5HM8A 5JMOA 1JPJA 1VXRA 1V7ZA 1R6TA 2PS9A 4HQOA 4W82A 4HH1A 4U2BA 2XCTB 4Z2YA 5A71A 4TZ0A 1IB0A 1M2OB 2FFAA 5FNZA 1PLKA 5JCZA 1QYWA 1DTSA 3OHPA 3VQTA 1P9WA 1OI7A 1IOVA 1OVMA 4HSEA 2VWGA 4KR0A 3UC5A 3HO6A 3UCEA 4FKZA 2J0UA 3FIUA 5JNUA 3CUEF 2XMCA 3UF0A 1VTKA 2BJHA 3TW8A 4Q24A 3B9BA 1C0IA 1G3QA 2QW0X 3AERA 3GXOA 3L05A 3PNLA 5CK4A 5H0IA 4EABA 2A1TR 4C2BA 1GZ7A 1P2SA 4JZYA 3TBFA 3MG9A 1MO3A 2IITA 5SZHB 5IS2A 5CXSA 2XYHA 3RS3A 2RGBA 2IS6A 2P9EA 4KGVA 2A0WA 2QYOA 1C3EA 3JAKA 1L9XA 2ZYUX 3KZOA 1EDEA 1PO7A 4KFUA 4YCAA 4L8GA 3HC7A 4OJQA 1Q0TA 5FPYA 3W5UA 3R3SA 2B94A 3A4YA 4ZC8A 3EC2A 3OQ6A 4RGYA 4JX9A 3W6ZA 3QVOA 4HSGA 3IAM1 4LHYA 1YA4A 3ZZ1A 4RD0A 3I6IA 2HA0A 4Y1GA 1C0PA 4YIKA 4WOBA 5DTEA 3G68A 5EFZA 4PPYA 4B3FX 1QK4A 1UCFA 3P97A 5DHFA 4FGSA 2XCQA 5KI6A 3FOFC 4ZOAA 4OQ4A 2R6FA 4L08A 4ZU1X 2D2XA 4XUGB 2D13A 3ILYA 3DBHB 5KQSA 3N2EA 3RAGA 3FDZB 3DBIA 3LGAA 2ZJZA 1EFCA 2NSDA 3KFVA 4GQAA 1KBQA 1DT3A 3OPQA 2V9CA 3AI7A 1EVZA 1P8JA 5AW2A 1MAUA 1R27A 4ZAVA 2QUAA 5HF5A 4DCTA 2PO5A 3C87A 5DHQA 3WNCA 1QIHA 3AJDA 4ZVKA 1B7GO 1LDMA 4BZQA 3SX4A 1BC5A 3GMDA 4EUNA 4REQB 2Q8QA 5G4KA 4FI3F 2JIPA 4Y9RA 4AM8A 2ZDHA 2FDXA 5IZCA 1USGA 2OILA 1VKOA 3GDWA 4J4BA 3LDGA 5FBZA 3FFTA 3L7LA 4G0UA 3PGXA 5EP2A 3AIIA 1C9MA 3L2OB 4G1BA 5HJ7A 4GPAA 1OFUA 4F3YA 1OLXA 2A8YA 3SDZA 4PX3A 5HRUA 1CUIA 2JBAB 4WBNA 3E9ZA 1ZRNA 4EFLA 3ZE7A 4W5RA 1FMJA 2OGTA 2ARKA 2H2IA 2R44A 4AN1A 3UANA 2YWHA 4RY0A 2WP8J 1I4OA 1ORTA 3RWOA 1RWKA 2HPZA 3H1AA 3ZTWA 3F74A 5PGMA 1EAMA 1SA0A 1NMSA 3MK31 1HF3A 3TUIC 3L0YA 3MYYA 1X0VA 1SD5A 1KAMA 1VKZA 1YC5A 5KOIA 3ZW9A 2XLBA 2VHWA 3CO0S 1BZYA 1SXHA 2Q3DA 3DXFA 3NHUA 3V9PA 4Q3KA 3JYHA 5JCXA 3HU2A 3QX7A 4M22A 3UT5A 5KOJB 2X22A 4UUAA 3VSCA 1BVYF 4TM7A 3UJ6A 4WV3A 2O50A 1WMBA 2D06A 1JKFA 1O97D 2I6FA 2QUHA 3FYSA 4Y9UA 3WYDA 1M3SA 4IGIA 2CNDA 5DNUA 5K0BA 4A36A 2HT1A 2VR1A 4KL8S 4LMRA 1BXRA 1ML4A 3FZNA 4M55A 4TS1A 5FUMA 3CW9A 5JJ5A 1E7QA 1ZL2A 3NBZC 3GYGA 4H9GA 1F2VA 3CY6A 3EW9A 4MDYA 4C2AA 1XLTC 4PAOA 2NZ2A 4HVCA 1HE5A 1ZNQO 5I7RA 2J0VA 1ES9A 1V7CA 3GJXC 1R5JA 3ANYB 4TMFA 1O94A 1GEEA 1U28A 2CLIB 3PPXA 3TXXA 2LR0A 4OHOA 1SUAA 3X1KA 4EG4A 1I9CA 2JFHA 1X70A 3U3XA 3IO3A 1DC7A 4LMPA 2IV3A 4ZHQB 1M2WA 2QL6A 3K05A 7REQA 5L3QB 3K9HA 1J00A 4ONEA 2ODTX 4L5IA 1R0XA 3AVPA 2RHHA 3RGGA 1BQ4A 3CG4A 3HJAA 4EG0A 5TPWA 3JVEA 2OZLB 3L92A 4IH1A 1K8QA 4JVLA 3CTPA 1WSAA 3CEMA 3WLIA 3CRNA 3HP7A 2J8ZA 1KKMA 3G1TA 3H9JA 2A78A 3HXTA 1L4HA 1LJ8A 1O95C 1V6CA 2VJOA 4LRTB 4U2CA 3Q85A 1E3DA 1EX7A 4AS1A 5AK6A 3ENWA 3FM9A 5I9TA 2B83A 1KH3A 2IFTA 4WFJA 5IDWA 1FFEA 2QJOA 2NOAA 3R5JA 3TR5A 1HDGO 1IHYA 2C29D 4CM4A 5JISA 2IF2A 1XPUA 2LVBA 1MABB 1H1LA 1MQ8B 3NPAA 3TM5A 1AS3A 1HO3A 5IN4A 4NBWA 4WERA 1OBHA 1WW2A 2QRPA 1AXEA 3AFIA 2R6DA 2VJLA 2PO7A 5E4YA 3VZQA 1PL0A 4OHUA 2EKPA 2JGDA 5AVRA 4QT4A 2ZRQA 3T3MB 3T52A 1H6DA 1RDFA 1RYFA 2J31A 1TYDE 3LSTA 1FFBA 3DZJA 3LZDA 4X44A 3O73A 4DV6B 1M2VB 3VR6A 4WOPA 1GP2A 3BVPA 1XMQB 4CT4B 3E4CA 1QV7A 1TYAE 1YXMA 3F4BA 3GT7A 2OM6A 1TKCA 3K4QA 4FOTA 1AH2A 4ZTUB 3E7XA 2JLUA 1RAEA 4UVDA 5DSXA 4DCUA 1YR7A 3LXRA 2OGZA 1F60A 1GSAA 1TMGE 4LHZA 5AXCA 1PBNA 3ZYCA 3ZV3A 1AZTA 1LPPA 4MS4A 3OPYA 3UXHA 1JQ3A 4EA6A 3FMIA 3IUBA 2IUFA 2RGEA 1K8RA 3JCZA 4KQ1A 1NBAA 1OI2A 5GJWC 3ZGOA 4CRWB 1SKQA 4QOSA 4EG8A 1G5FA 1GGEA 1NY6A 4XKJA 3GXBA 3SXUB 3WIBA 4ZI2A 3VNBA 3QOFA 1J24A 1XTTA 3CZPA 3ZU6A 4D1YA 5B6PA 5E6UA 3OQHA 3SYRA 4F1WA 3RW9A 2JHPA 4AMYA 5KMGA 2WJJA 1EQAA 1WKCA 1SHKA 5IFKA 4HDNA 4TKLA 3UIEA 3V1YA 1LBHA 2GYUA 3IXQA 4B40A 1WOYA 2XEXA 4D81A 1I8TA 1OGIA 3ADCA 1EGVB 2RH4A 3I42A 4ZMSA 2WHYA 3PX7A 3E5RA 4NYMR 3AIMA 5HZHA 3T7KA 1KL7A 3VKWA 3VU3A 3EIWA 2EKQA 3H5VA 2JIQA 2LKDA 1BW9A 2WU1A 4YQYA 1EK5A 2J0UB 4CF5A 3HA2A 1URPA 4LXIA 3I5MA 1IN7A 2WA1A 4KPYA 2K5UA 3H05A 3KEQA 4Y2TA 4U7FA 1Q0LA 3TW8B 3WMFA 4COKA 3AERB 1M1UA 3VJKA 3IMCA 5CD9A 1KEVA 3KE8A 1FFXA 4X7BA 1QV9A 3J80A 3BRWD 1GCOA 4B33A 3NYIA 1LW6E 4GLLA 2PZMA 2I03A 2Q4EA 4IMRA 5T6MA 4V1CA 1SCDA 3LF2A 1J07A 3FOBA 4AJIA 5KWSA 1G6OA 1RYYA 3JAKB 3DVRX 1P5JA 4FYMA 2NG1A 2HF9A 4OJMX 4EG3A 3ZWMA 4F93B 5JAZA 1S3FA 3B6MA 2WRZA 5EHZA 2P3LA 3ZY6A 4PGHA 2I34A 4P7FA 1V3UA 2XAUA 1NTOA 2IU6A 1W0KA 1V26A 1V8PA 2PH7A 4H7KA 4HEA1 1XTPA 2GUGA 3LS2A 2BBWA 4XD7D 3NWOA 4D9CA 5BWLA 1FSGA 2XMDA 1XFAA 1ZN7A 4NAUA 5BNTA 1A4RA 3OLXA 2UZIR 1CHNA 1YJ5A 2B1RA 1WM1A 2AMVA 1AMOA 2V0GA 1ZNWA 4QJIA 4URHA 5C80A 1T34A 4ZVPA 2E82A 3VYTB 2PKEA 4XWOA 5DTJA 5F2OA 4P53A 1PWYE 4DUGD 1NJGA 3L8EA 1UJ6A 1DG9A 3WJ1A 5CEJA 4YREA 1MJNA 1AOXA 3NTRA 4E2XA 2OYSA 1NAIA 2GHIA 3IQWA 4H3VA 5JS2A 4LEIA 3PFWO 3HZZA 1Q6ZA 1E1QD 3Q6NA 1PQUA 5G4KB 5JBIA 5EHNA 2GCGA 4EHDA 1KYYA 4IP0A 3AR7A 2P3OA 1C4XA 4E5YA 4IXDA 3WGNA 1UZLA 3D8RA 4Q4HA 3OEHD 4CLOA 1YR3A 1JMYA 1M10A 3ER6A 2FPMA 4Z1MD 2E49A 2NM0A 3IQZA 4GQBA 2H29A 1X7ZA 2N42A 3H83A 1CLEA 1OLXB 3A05A 5CP8A 1L7MA 3VH2A 1KARA 2JI4A 4LWOA 2A59A 3HMKA 3T1NA 4EW2A 1SELA 4WBNB 2R47A 2BGNA 3RFUA 4RAQA 3WK8A 4RH3A 4ZVOA 1DLIA 1K7EB 2HA4A 1AU9A 3SHOA 3ONVA 1CULC 2ONZA 3HNOA 2PGIA 4Q9AA 2OV2A 4KZPA 5TNXA 3T5MA 3MUNA 2FRVA 4LPSA 1SA0B 1P2DA 2NVOA 4Q7JB 4UHEA 3QA9A 1ODKA 2BEKA 4NSNA 3UMMA 1BG6A 4RQAA 2YWBA 4LRXA 16PKA 2FQ1A 2ZWVA 3B52X 3DDWA 3PGA1 4ZAWA 1GTG1 5K4AA 2WKQA 2E1PA 4IQ4A 1X74A 1ZI6A 4OQEA 2CHGA 1K5GA 2WWXA 3UT5B 4CIDA 5FI0B 1R8QA 2FMHA 2IE0A 1NN1A 4XA8A 1EXWA 1JYEA 4CQMD 2QDKA 3V8NA 2XMQA 4YQZA 4LFAB 2YQ5A 4L9SA 2F64A 4CM5A 1T5OA 3HXMA 1PZFA 1YE5A 4K9QA 1BXRB 3S2UA 3TL3A 4DBLC 5A4DA 5FXMA 3BJEA 1CJCA 3GJTA 4XQGA 2R7LA 4ZP1A 2QV7A 4YQEA 3CLHA 4Z0NA 1KK2A 3KTAA 1GARA 4UPDA 4MYDA 3UXEA 5BXYA 4ZI5A 3CV3A 1FNCA 4B75A 2Q2NA 5CFOA 1G20A 1KERA 4J7CA 1HC7A 2FQQA 2W93A 4ZYYA 1OZFA 1GZ5A 2RGUA 3B48A 5FNVA 5ULLA 2CXSA 4Z9BA 4E5SA 1AKUA 1XCJA 1BDJA 2ZIXA 1AD2A 4J2HA 4DG5A 4G24A 7REQB 3FHTA 3PGLA 3SY8A 3LC0A 4JR1A 4YV7A 1J1ZA 1Z25A 3TXYA 1SBHA 4JT9A 5B58T 5TPWB 1KI7A 2WPDA 3ILHA 1MMFB 2ZCJA 1N2SA 4TKZA 3T35A 3QLVC 5FBHA 4CCAA 1YT5A 2WHXA 4BX2A 3R4CA 3SHTA 3TO5A 2WFLA 3IVCA 3WHPA 2B69A 2YJ6A 2YVQA 3I92A 1NLYA 2WMYA 3O1LA 1O5TA 1NP7A 2EP5A 3H9GA 4KX3A 4WY5A 3RUPA 5KNDH 4WNCA 1QRTA 4L15A 5FTMA 4OHZA 3JQPA 2IZ7A 2AN5A 3ANNA 4IDAA 4CM4B 4CQLA 4RKFA 1NPDA 1H1LB 4LDPA 3QUTA 2MYUA 3FVTA 4QRDA 2Q99A 4Q4CA 4CDMA 1XRQA 2DWPA 3FNEA 4URXR 3H0KA 1AS0A 4CBVA 1JAZA 5CA1B 2JGDB 1BU5A 4Q3EA 2XKJE 3EGCA 1MH9A 3C70A 1HDIA 2JIZA 1C30A 4MTCA 2QNIA 1ODCA 4NE2A 1P6UA 3Q7PA 4AI6A 1W4ZA 1E4EA 2HB6A 3T3OA 3V8MA 1Z39A 5L3SA 1K75A 4LXXA 3ZBPA 1E5TA 3WVNA 5I45A 3ADKA 3B9RA 1EVEA 4LUCA 4ZIRA 3UMCA 4JI0B 2WJ4A 3L9WA 1L4UA 4M87A 4DCJA 1SVSA 1E66A 2WV9A 1KMIY 5K8JB 4K0KB 2Q9CA 4ALLA 4CG2A 4MS4B 4N5LA 3OPYB 1IY0A 1MFZA 1S1MA 2OCAA 2WJ6A 3KDPA 4KQXA 3WBJA 3OJEA 2CNNA 3U4CA 1RHKA 3ND7A 3PYXA 4LYGA 4U2DA 4E5NA 4OJTA 5HBGA 1H65A 1X1BA 2XUZA 2ADOA 3GQVA 2FUEA 2HDWA 4PF1A 2FWIA 2GEKA 4N39A 4OOFA 5AHWA 4A10A 4EARA 4J7XA 3GROA 4DEVA 4P35A 1EB9A 3A8TA 5E6UB 4P5EA 1FFWA 1KWGA 1GV0A 2O05A 1N5DA 2RHLA 1E9FA 1AK9A 5KMGB 4FMDF 2O8FA 3LCVB 4HDNB 1SUEA 1VIMA 2BW0A 4BNJA 3V2UA 3NC0C 2HU8A 1NF3A 1BDHA 2QPTA 2C59A 3DW1X 2Z3ZA 4KOAA 4AURA 3OG9A 2EBFX 1GRVA 4FEEA 3E7FA 5AOVA 4M7PA 2J5BA 1II9A 1TVEA 3DFMA 3IQFA 3MAGA 3MMPA 3UICA 1EWVA 2GTHA 3VH3A 5ALPA 5AVQA 4B3TB 3BK7A 1BW9B 4WHMA 1NG9A 1CDDA 5ADWA 4DJJA 1MV5A 3T9FA 4WNYA 3I5XA 1JIJA 1I32A 4UKDA 1JJBA 3LPCA 3G2IA 1DXHA 2NW6A 3U09A 1TLTA 5E7MA 3MB5A 3CH6A 3KYBA 4YO7A 5FBQB 5GWXA 3SQOA 3ZV7A 4CMGA 3UG7A 1B4DA 3TUZC 2ONYA 5ALFA 2H6EA 2Z3WA 3P0FA 5FAKA 1FFXB 1CQJA 3NEAA 1XJWA 4D0SA 3A7EA 1AKWA 2QXYA 4RVCA 5J2TA 1EQ2A 3OKCA 4V1CB 2IS4A 1UKZA 1XC7A 4KMMA 2Z2XA 4UHFA 2C84A 3PQFA 1MDFA 5C7YA 4BFVA 4ENTA 4DC9A 3EEQA 1JA0A 4DR5B 1FP1D 3TLGA 5TF0A 3S1SA 4H4DA 4LNHA 4D0LB 2PR7A 621PA 3W3ZB 2F59A 2QU8A 2ZSUA 1BJTA 2OECA 2EAUA 2VNAA 3PFBA 4XOIA 2PX3A 3MFYA 5K3SA 2WAMA 2YUIA 1XX6A 1NQAO 2ZE6A 3GRVA 3PRYA 5HUQA 1B1AA 2X5KO 2ZJ8A 3ZTYA 5M04A 5EKUA 3JQ6A 3SZOA 2O1SA 3FSJX 2QW1A 3T95A 5HUHA 3LTNC 4LF9B 5JZVA 3CJTA 1RPNA 1BS9A 4RACA 2ZRIA 4C03A 1T4CA 1DJMA 1Y7LA 3UATA 1YR6A 3DUWA 3QVJA 2EZ9A 4CL0A 3HH8A 4RHYA 4M76B 1MT3A 4IG4A 1IC6A 4KXNA 5DSTA 3FTNA 1UPXA 2BUAA 1P4HA 4KQGA 1U2ZA 3PUJA 2JCVA 1YONA 2ZB2A 5NULA 2I0FA 1K9VF 2AXEA 3IHKA 1BXZA 2LE0A 1JPVA 3RFVA 3T7JA 1C7QA 4Q4HB 4I55F 1SKYB 2YMMA 5B1SA 5IM5A 4JB0A 1UKAA 2E0IA 3DKRA 3G5UA 4JYCA 2Q8PA 1JLLA 4WIAA 3X1YA 2B92A 1YK0A 1X7ZB 2ZE7A 1QB8A 3FCUB 1CY7A 1JR4A 3FPLA 2Z1NA 3H2GA 3IKVA 3TIXB 1C5KA 4G0OA 5JO9A 5EE9A 2BGWA 4E46A 5D3MA 1M7HA 1EXNA 3C74A 3DZBA 3FPHA 2EKDA 1YFLA 2E18A 3T5DA 3KAJA 1CR2A 4WZZA 4JC8A 5F7XA 2QQ5A 5MN5A 4M0FA 3CSSA 5TVGA 1UM8A 4PSAA 4BNWA 3EEBA 3MQ2A 1T0PA 1XXHE 2FOLA 1UBLS 4JJEA 2Z98A 4UEQA 3NT2A 5CCXA 3VX4A 5B36A 1FNMA 4PG5A 2OBLA 2ZBEA 5DIFA 4EZEA 3FSGA 4UE2A 3QU5A 1AV6A 2JEOA 1USWA 4DPKA 4XPIA 5E4TA 3UHOA 3OO1A 2M6SA 1WDTA 3B6EA 2B21A 1F6WA 2KX7A 1UINA 3DA8A 4G0NA 2ZJ3A 2D0IA 5HBRA 5AJWA 1L3CA 5EZSA 1JEJA 4K6FA 1QBGA 3LCMA 5T67A 4AZ3A 2XITA 2ZTSA 2F3UA 3D6FA 3AU9A 3G7NA 2BGMA 3TQHA 3TTTA 4YP9A 2FMXA 4BGEA 3QVXA 3ZU5A 3LUHA 5C2JB 2ZR0A 3KTAB 1PR3A 3VO2A 2Y1LA 2VJBA 3COZA 4KBYA 3V1NA 3GP8A 2QLJA 1FSSA 3AUXA 2AW3A 4IDBA 5CW1A 2RI0A 1G20B 3SI7A 3QWAA 2HGSA 2YDYA 3N3AC 4E6PA 1JDBC 4FT4A 3PENA 4QXQA 4CN9A 4EMBA 2WJHA 3NIBA 3EDOA 4OREX 4ITUA 2ZIXB 3M4XA 1N2IA 1JVBA 1T8SA 2JC3A 2DR2A 3IP1A 4KN8A 4IO0A 4JVMA 2JFZA 1N2GA 1GSHA 3DD1A 3EVBA 5E4FA 4B17A 2XZOA 3NOXA 3ZK7A 2XKAA 3TTWA 4EJ0A 3BXPA 1Z34A 2BGRA 4QYWA 5D84A 4BFUA 1R0LA 1U6JA 2WFLB 4ZC1A 2B1GA 2H17A 2XVAA 3ZE6A 4CKCA 2EQBA 1W581 3LYUA 4I6GA 4J90A 4PZZA 4UOEA 2OCIA 4DWVA 1F9AA 2UYYA 1D9XA 2D1FA 4UFNA 5WRFA 2B5VA 3PF8A 4A0FA 4IQGA 1P62B 4CQLB 1VMKA 1MB3A 4IJQA 1U2DA 4FYXA 1XWWA 3PC8C 2W7TA 2OP0A 2OESA 3KXKA 1QBKC 3FX2A 2Z8ZA 3PNSA 4K8RB 4WFIA 5B7NA 4F8EA 1NUQA 4A6DA 4IJVA 1SVLA 5GOZA 1FSPA 1JHQA 1N5RA 1OHHD 1UM9A 3AY0A 3PXCX 4MRPA 1QMGA 3QTTA 5DNVA 3NGLA 4C87A 4EB8A 4CR7A 3QVSA 1B6GA 1WY7A 1DC6A 2IEGA 1IZ7A 2QI9F 3G59A 1C30B 1P2UA 2XXBA 1FC0A 3ITDA 3OFND 2XMRA 3KOUA 1T4BA 4H60A 1E4EB 1G2QA 2WKSA 8ADHA 5L3SB 2FZ5A 3TEFA 1RXEA 3PHHA 3RSFA 4ZVQA 2FE1A 4ENPA 5I9BA 3TCXB 3HYNA 2JCSA 3GI1A 3KLNA 1ZJYA 4ZIRB 2B35A 4HX5A 2FR8A 1DKMA 3NUQA 3T7AA 3TWOA 4BO7A 1UQTA 2B4RO 3DCYA 1ULBA 5LP6A 4BN4A 3O9ZA 1W2HA 1ECBA 1Z12A 4D3SA 3HR7A 5DDIP 3NGXA 3MMXA 2X9NA 4B79A 3H17A 3PD0A 1CQZA 1DJLA 1E77A 1T9CA 2FLVA 3IHLA 1X2EA 3PXDA 3QW2A 4DIEA 4DZRA 4RD6A 1E2EA 1HT1E 1HM5A 2J9FA 2YN0A 3F46A 3WL5A 3QJYA 2VYQA 4WVFA 1SQ0A 4UMVA 1E2GA 2ZAGA 1FMFA 3U9SA 1QLWA 4JLSA 4DHEA 3L0BA 5K4HA 3HUEA 1IL0A 2ZT8A 5AW7A 4QWMA 5JZBA 1I1QB 5JNRA 4EYOA 2ZM6B 3P5SA 2O8FB 4RZIA 1UIMA 4GDFA 2G17A 2AG8A 4C89A 1QK5A 2P3SA 1CNEA 2Q07A 3RHSA 2REQA 1XZLA 1D5CA 3IQGX 3M4YA 4NENA 1M6NA 4AXBA 3UT6A 3ITKA 4ZK2A 3C6XA 3FR7A 3BQ9A 4KP7A 3PXAA 2O57A 3ZHTA 4X63A 1QPBA 2GTPA 4RMNA 1Q22A 2GBFA 3GGOA 1NN0A 2PXHA 2P2NA 3FW1A 3O9VA 5BW8A 2PZFA 3NHSA 3MIIA 1T0UA 2RDMA 3WTBA 4YP0A 2PZKA 2OSVA 5AM4A 5AW9A 5A05A 5A4JA 4DLRA 1Y8AA 4TYPA 5BQXA 1DRUA 1O9GA 3GCZA 3KVOA 4MLPA 4YH1A 4PSKA 4RORA 4EO7A 1OD6A 1A8QA 2R96A 5ALQA 5CCBA 3D7KA 2ZUDA 2R7AA 3OX3A 5AVKA 5J2TB 4MYTA 3QOYA 3R0IA 1WHSA 1O4WA 4FOPA 4HQKA 4MI3A 2XWPA 1T1JA 2E6KA 2ZXFA 2ZS9A 4JP5A 3HSYA 3TLGB 3N2ZB 4D5EA 3ZIAD 2HK7A 4QWWA 1LF5A 3FOWA 3WDKA 3W3AH 4CKEA 2JLSA 5JQWA 2P9GA 2C5AA 3ZHBA 2X4IA 4M1EA 4NNJA 3VSDA 2Q6IA 4YBZA 2GN1A 5F1OA 1TLLA 3UUEA 4H35A 3UMJA 1IJEA 1K6MA 3ZD9A 4IGAA 1YMQA 3TQSA 5J5CA 4TROA 4IF6A 4HQLA 3DTTA 2IH2A 1KORA 4GKAA 1ODSA 3W8DA 3DVQX 4ZRDA 3DTYA 2HSGA 5DSZA 2AH5A 3TF5A 5D3QA 4B7XA 3K9BA 2C7VA 4IS3A 4K9DA 3AFOA 5F7JA 5ITSA 3AF2A 3HE3A 3W8NA 3K53A 3PKJA 3ZNQA 2PWPA 2QLBA 2ZR9A 3U4IA 4MICA 3E2PA 3WWCA 4CKZA 3EQ6A 4BMZA 4E2FA 5F4BA 5F9MA 1T4CB 3UN1A 1J99A 1RQNA 3WQRA 1NVXQ 2R11A 2VPXA 3THXA 2ON6A 5ITVA 3ISTA 1J5EB 2FRDA 2I2XB 3W9YA 3ZIUA 2GBGA 4C1NA 3VTKA 3TD2A 3L46A 1IBRA 3QPAA 2FHPA 2W6CX 3HWX1 1XA4A 121PA 1YQQA 2HDOA 2I1LA 1EINA 1YE3A 3Q7TA 4YALA 2OOKA 1N9ZA 2ID4A 3GBSA 5CA0F 3NRBA 4YMIA 5IT9A 1JLLB 3BMNA 4ZXFA 2ATCA 3ZDCA 3RRZA 4D9IA 4LQLA 1VHQA 3H1FA 4B6RA 5HF6A 2EDCA 1ZLXA 3OI7A 2FEKA 2PA0A 1KP2A 2DPHA 4LZNA 5AQ1A 4O8CA 4Z0PA 1L7QA 1JG7A 1P1BA 2C4WA 4NONA 4FD3A 3VPAA 5ISMA 4ZT5A 4Q01A 1N8NA 1XQYA 4BC0A 4NU6A 1Q1QA 2GETA 5E8RA 5F9HA 4ISCA 3UAYA 4TMTA 1CPYA 1H0KA 5GVRA 1RPZA 2G09A 2EU8A 1P61B 1RXWA 2EG5A 2PD4A 4B7ZA 2HF2A 2VNIA 4RKWA 1K89A 2FLWA 3JARA 2JLZA 5H70A 1MQ9A 1VLQA 4RULA 4D57A 5CHYA 3ETNA 2VA8A 3LDHA 1WNTA 2H5JA 4WX2B 4XPIB 4IVQA 1LSSA 1V8OA 2XGSA 5I9LA 2XA9A 5F4ZA 2FFJA 3L82B 4ZOBA 1W96A 3WBKA 1P75A 3RT9A 3FSRA 4LSGA 1S2LA 3CZCA 3R5TA 1PNVA 3KU1A 1WPGA 3V7NA 4HLUC 1NIJA 3MD0A 1WNFA 4AZ3B 1PF7E 4O2AA 4ZOQI 4CM1A 1JHVA 4BO2A 5I7HA 3BKXA 3LQKA 3NC1C 1C1YA 2V6GA 4MS1A 1YRAA 2YWEA 3ABIA 2ZIGA 5AM0A 4HNAB 1YB4A 1BS1A 1XCOA 4N6OA 3BJZA 1JH9A 1HQDA 1KMCA 2QD1A 1N0UA 3W2EA 1NX6A 4ROSA 2D2IA 2XLCA 3P9PA 2WJWA 2H06A 3HBNA 1QRRA 2PWYA 3QTLA 2DPXA 3U4GA 3ZWXA 1KZGB 1V48A 1A7UA 3B60A 3IA2A 1B1CA 3LFHA 3M82A 1C8VB 1FQJA 3JRXA 4BIIA 3LUJA 4QUBA 4IIBA 1BDMA 1IEVA 4KH1A 4UATA 4L50A 2OCLA 5HE9A 3RVNA 3L7MA 4EJMA 3RYTC 3N9IA 1PT5A 2VCEA 4GX5A 1Z6GA 1XNJA 1U7DA 2C2OA 3I2KA 2BM0A 1DFIA 3CH4B 3VYUB 2CDNA 4R0MA 3RVKA 3P2EA 4CKCB 4U3JA 3EPPA 1ZVKA 1RRGA 2FDRA 2HREA 1ORHA 3HJRA 3ZBUA 4CLXA 4GC9A 1Z35A 3X1JA 1A1VA 3DH0A 5EJFA 2J33A 1XZAA 1OI4A 1B00A 2Q41A 3F6YA 2XTNA 1VP9A 1AXGA 5DM4A 4A0HA 4KGXA 3D1VA 1USVA 5AW0A 1LBQA 4AW9A 4BWGA 2Z08A 3PQ2A 1QG4A 3IPAA 1KYWA 4TMZA 1UM9B 3STHA 1OC2A 2DFPA 4R54A 1DV2A 1OILA 2NU9A 4CV2A 3LP5A 1ADFA 2E3JA 1E3MA 4Y2SA 3T1HB 3Q10A 1UAYA 1WXIA 2Z9DA 4ETMA 3IEUA 4CIBA 4E2WA 2QX4A 4BPBA 1UDWA 4PQYA 1XV5A 4M1TA 3NIWA 2YY5A 1ZH6A 2FZVA 4YAEA 5GJBA 2Q21A 3HI4A 4ZREA 2XCSB 4TT3A 4FJ0A 3ZVKA 2BE7A 5K3AA 5IMSA 3FUTA 5LP6B 3NC4A 1COWD 1UP6A 2EFDB 3DL0A 1WIWA 4NULA 4N0EA 2DX7A 3BRQA 3NVDA 2JAQA 3ZVRA 5JS1A 1QHYA 5K4GA 3KZMA 3VR3A 4OSPA 2WSIA 2YMQA 4ATNA 2JJQA 2J9FB 4LVCA 1LJUA 2YS6A 1PZMA 1WVGA 3GUZA 1DBSA 4OBWA 1GRQA 4UM8B 2D8MA 3RYIA 3VJMA 5KDOA 1J7JA 4GD3Q 4EPXA 3DOEA 5K03A 4F04A 3C0KA 1V7PC 1UADA 3H5WA 2HIMA 3NORA 4R8KA 2V6IA 3IMFA 1M1ZA 3N2IA 2BGGA 3O4HA 1LRLA 1N6NA 4OLFA 4C0LA 2REQB 4HCJA 4NENB 5LSAA 1B26A 2HW8A 5EXTA 4RNDB 2DFDA 4TLEA 3QWFA 2FH5B 1P3DA 1KBOA 1JDUA 2K7ZA 4QSHA 2OFWA 2PKYX 4X71A 1IEXA 3S3TA 1XD2A 1ZP6A 4AF6A 3KTOA 3U3KA 2MSNA 2ZRDA 1E6KA 3ESRA 5E3IA 4HQ0A 1ICEA 1RI2A 3H1TA 3UMFA 2O54A 3V2GA 1ZZEA 4RJIA 3VISA 4OLBA 2G77B 4GPIB 4M8SA 4HDSA 3GNTA 1ZK1A 3PEEA 4QGSA 4JDPA 4CEHA 4YAGA 3WNVA 1OX4A 5CFRA 1VE1A 1C0KA 5BW6B 2EX0A 2AZTA 1TXGA 4DBVO 2WG0A 1PVVA 4ZAXA 2LV8A 3EK2A 1GN8A 1P73A 5J4LA 5AHKA 1WHSB 2CJXA 3PCRB 3ZQ6A 4RENA 1CUYA 1ENPA 1QORA 3GRRA 1Y9AA 2IHJA 4XGIA 1UDBA 1QKJA 3ID6C 4GL4A 1Z0ZA 4REOA 5EZ5A 1L4FA 4G5SA 4I7EA 1B8VA 2GPYA 4CKEB 3DLTA 4E2ZA 2GCNA 5C1BA 1FP6A 1BMQA 2E37A 1B0AA 1Y0BA 1QGAA 3TKLA 2JAXA 1ZC3A 1V4VA 4Q1DA 2EW2A 1XL1A 2C83A 3EPKA 1K4MA 4ZT4A 2NLOA 4CHTA 4EJ2A 4FD2A 5I8WA 3LUBA 5G4LA 5K8LA 1KJ9A 3KKZA 1GTL1 4LTMA 3EXHC 1FF9A 5KBYA 1U0EA 2GJKA 5HILA 1NUAA 1AUQA 3ACBA 5L51A 1XEWY 3S2YA 5COQA 1B43A 4EGAA 3B1YA 1UFKA 3GBPA 2G72A 821PA 2ZIUB 4Z3DA 4OOEA 2B8WA 2XGJA 4KQJA 1P77A 2V1UA 3ZS9A 4C2UA 2AMYA 2WIAA 3NO4A 4H7JA 4L74A 2XF8A 3FAZA 5AJYA 3FUVA 3P94A 3BD7A 1KQGA 2JBHA 4R01A 4X94A 4GBMA 1RYHA 3THXB 4QUDA 2A86A 4QDXA 4M8NE 1XG5A 5J63A 4YXWA 3TDNA 2G9QA 1W2GA 2PGAA 3UC9A 3FXAA 1XU7A 3ZE9A 1DB3A 1JLHA 1VFNA 3PNOA 1HEYA 1N57A 5BOSA 1M1XB 2FEWB 4IIYA 4DHWA 2NT3A 3H7AA 1BO6A 4B4VA 3BMNB 2M6KA 3ECCA 1VG1A 1ADBA 3MLAA 4GM1A 4YY3B 4RS3A 1HNNA 2EOAA 3ON5A 1DBVO 4UZEA 1UJ4A 2ET6A 3A2NA 1Z2NX 2B4QA 5BQ5A 3UWKA 3R5SA 5JCOC 3O47A 1F14A 4F97A 3M4NA 5L3VA 2RGRA 1RTKA 1YB6A 1EJ6A 1JZTA 1SVNA 1YIDA 1I2DA 1E1RA 2L82A 5JCJA 5BV0A 1XF1A 3DBVO 3NFYA 5I9IA 2H9YA 3DEAA 3TFWA 4BKUA 2KE5A 3K09A 4X54A 1OMOA 2V97A 3JARB 5K8TA 5DNDA 3OZXA 2Q1XA 3T9AA 2BGKA 1MDBA 2B7CA 4M1MA 1W8DA 3I2GA 2HADA 4RUKA 3TRKA 5D00A 4BNMA 2JGFA 3LXUX 4D9BA 4DUZB 3GFQA 1OX5A 3UAWA 4G4GA 3O95A 3BAFA 3M6WA 4MW0A 1KQOA 4E03A 2NUTA 2D62A 1KEUA 1Q1EA 1ZSVA 4XGQA 3RLFA 4G0YA 3FG9A 1A9SA 1PEYA 1HE1C 4TUYF 5FR1A 5CXXA 3GNSA 4NYIQ 4GKKB 4QDTA 4O2AB 1BQ3A 1C9EA 1SOUA 2OOSA 3E0QA 3NAMA 3E1SA 3GEBA 3UYLA 2Q0QA 2RCYA 5AIBA 3BORA 3EY4A 4RTNA 4MS1B 2UYGA 1JFSA 4R8MA 2J7PA 1LCIA 4JXJA 3RG8A 1EYZA 3SKYA 4KWTA 1T1RA 2J3MA 2FSIA 3LFTA 1TOAA 2O5VA 3E9EA 3NWBA 1R9GA 1TI7A 3OCJA 3BGDA 4PAWA 1Y8RA 1KKUA 2ZTUA 4I1IA 5JMPA 3PHIA 2HCJB 2ZTMA 2DT5A 3JD2A 3MPOA 4Y0VA 1F2TA 4BL5A 1E2BA 2E4ZA 4FKBA 3A3KA 4F5YA 1PFQA 4GKBA 5C5IA 1EX9A 3LX5A 2PMDA 3D4OA 3QE3A 4O4JA 5E9AA 4DCGA 3EVAA 5JARA 3A26A 1RJWA 3HM9A 1INLA 1Z6AA 2G9RA 2ZQZA 3TPZA 5C5CA 1NV9A 3ST7A 1RKBA 2QNBA 4AZWA 1DOZA 1ZH0A 2C5FA 2C61A 5HQJA 1PE0A 3A1CA 3W8EA 4ZN6A 1R0KA 2O5EA 3KYDA 4U3JB 1KRWA 4HPWA 1QGZA 4BLWA 5B4TA 1G8JA 8ATCA 4ZKEA 1PJSA 4KXXA 4FGZA 2YYZA 3DBRB 1DAIA 3GAMA 4DNPA 4C6RA 1RADA 1TQ2A 4POOA 3DFIA 1YMVA 4MWTA 3TSCA 2GK6A 1PJZA 4R3UC 3RRMA 2HSDA 4UNQA 1GTZA 3LK7A 1TIKA 1XD9A 2GDZA 1XRNA 4FWTA 5DGIA 3EMBA 3K0EA 3QXHA 3MOSA 4M86A 1L5GB 1P1FA 2QAGA 3AI2A 1H8ED 1O8BA 1WSDA 2KS6A 3GFTA 5DO9A 4S1PA 3TJZA 2NU9B 1FEZA 3JQBA 5EMLA 1XKTA 2EKZA 2QTCA 1U99A 1X94A 4HPJB 4XW2A 4BMVA 4OK6A 4CQJA 4UBNA 1Y82A 2Z8YM 2H5LA 1AHNA 5EHIA 3JVIA 3GP3A 4B6SA 4I5GA 2ZQ5A 3HRKA 3LL4A 1C8BA 3LQFA 3UW3A 4O08A 3PXXA 1PX2A 4E7OA 3CZMA 4CU5A 1T36A 3FMFA 2O4CA 2OD2A 2YJTD 3IVGA 3UH0A 3V8PA 2RHJA 1B0ZA 1KEWA 1K08A 2WWRA 1XLVA 5LYJF 2WT9A 3OBIA 4HX2A 1UXIA 2A94A 1ZG3A 4JEIA 4ZANA 4MAAA 2EP7A 2MSEB 3INNA 4ZCIA 2WFMA 5IULC 1A8PA 5TPZD 1NBMA 3AH8A 3HYRA 1CIPA 3DMDA 3N8GA 3QU9A 1FK8A 3R5FA 3RYIB 4EI9A 2VTBA 4S24A 3JYPA 1TIBA 2X13A 4WZ6A 3CW8X 4DIOA 3BIXA 3ABOB 2P6OA 3H2JA 5FULA 5F64A 2R7NA 3DQZA 1GLGA 1GN9A 1OWOA 1RPJA 3HB7A 4J1SA