1M75A

Crystal structure of the n208s mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVSRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Crystal Structure of the N208S Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m75A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m75A01
1DB3A 4HWKA 4IZHA 1PS0A 1ID1A 4FFOA 4ZICA 1R0KA 3A14A 3ORFA 4PG7A 1PJBA 4JROA 3ZNNA 3AW9A 3RKUA 1HSZA 3CXRA 4CQMD 1HL3A 4N7RA 5JAIA 2HO5A 1U3UA 3KV3O 3B1KA 4IDGA 1JVBA 3I3OA 4NBVA 4NHEA 1WP4A 4PLZA 1GUZA 1RPNA 3GN2A 1BRMA 1C0LA 4AJOA 2WWRA 4Q3AA 2AEMA 1O9BA 3QVOA 4MDHA 4R54A 4PLWA 5A05A 3O8QA 2ZQZA 1DC5A 1U2DA 4AJNA 5HTOA 3C1OA 3D4NA 5KJ1A 2OZPA 3GPDG 4FFLA 4GX1A 5T6BA 4GI2A 2NU9A 5I8WA 2POQX 4DMLA 1Y1PA 5T67A 2HK9A 2QRLA 4A73A 4CQMA 4XD2A 1PJTA 2AMFA 1M76A 3E1KA 1E3SA 3OF2A 4J2HA 4AJJA 1EQ2A 3E6AA 4UEOA 3OFSA 5L7WA 1CF2O 1XU7A 4WLUA 3ULKA 1E7WA 4HADA 5EL0A 5HS4A 5G0SA 3EHEA 2O3QA 3OICA 3K9QO 3FPLA 4OOEA 4YT4A 3AUSA 1HLDA 2A92A 3GR6A 2JCXA 5K6AA 3SLGA 1ZK4A 3K73O 4M8SA 5G0VA 3U0BA 3HB4X 1TVEA 3M1AA 1LX6A 2IXBA 1T2EA 2FR0A 5A03A 3LT2A 4YQYA 3WLEA 1DFIA 4IJUA 3WQSB 1HDXA 1EUZA 3ZU4A 3DAPA 1R4MB 4U0JA 1NPDA 2WJPA 5BSGA 4CV3A 4DXHA 4WOKA 2X58A 4ZVVA 3G49A 5CHEA 2ZTVA 3WNVA 3V1YA 3HWRA 4YRDA 5BNFA 4DLAA 4MPDA 1U7HA 3A4VA 5DULA 2Q45A 3WYBA 3WYCA 4ND2A 3LZ6A 3DR3A 1KETA 2SCUA 1ADFA 1PX0A 1T1SA 4GL4A 5FI3A 2GGSA 2NTNA 2RH4A 5HWSA 1RM0A 1Z74A 2O2SA 4YJFB 5JC8A 1A7KA 3KOUA 5CDUA 4Z9XA 3E9MA 2TMDA 3GAFA 2B4QA 1N8KA 4D42A 3I9LA 5JXWA 2PH3A 4UVIA 2CVQA 5EPOA 1LDEA 4IS3A 5JMWA 3ENKA 2Y0EA 3RD5A 3FI9A 3H9QA 4ZQFA 4J4BA 1ZXBA 5ICMA 4D3SA 2GRAA 2DLDA 1PQUA 1CJCA 1SZJG 4OHUA 3ZWNA 3GPIA 2ZKLA 3EDMA 3NX4A 4J7UA 2Y93A 2EIHA 3ZWPA 5CDSA 1DLJA 4BNJA 4OXNA 1ZJYA 4K6CA 1D8AA 2PY6A 5ER6A 3DOOA 3S1LA 1PJLA 2WD8A 2ZCVA 2P9EA 3ROQA 3OIGA 2EJWA 5A1TA 3RFXA 3RWBA 1J5PA 1GTMA 1YS4A 1V3UA 1KBZA 2W2LD 3LU1A 1T1RA 1YL6A 2WE8A 4JIGA 2DTDA 4BHTA 2NQ8A 3DMYA 3ROKA 3O8QB 1ZW1A 2Q1UA 3GMDA 3E18A 3LVFO 5BNIA 1XHLA 4OXKA 3STHA 5CEJA 1FDUA 4ESOA 3UCXA 2WEKA 1HDRA 4CQMB 2QZ9A 3BHJA 4RO0A 3FBTA 4PGFA 4C7JA 5KJEA 3RFTA 2Q4BA 4EEZA 4J4TA 4FW8A 6LDHA 1E1KA 2W2LA 4NH4A 4MVJM 3GQVA 4NJMA 3B1FA 4PVCA 5AXDA 3RBVA 1SAYA 4EJ0A 2BI8A 1E3WA 1YGYA 2BFOA 3I9KA 4L73A 1B8VA 4IDDA 1KVQA 1VJ0A 1PR3A 4D3FA 1T24A 3GZ4A 3JQGA 3WLFA 3IAHA 2VT2A 1E1NA 1I33A 4WEOA 3ROMA 1EVIA 3CKYA 2NM0A 3F9IA 1YB1A 1ZH8A 3PIIA 3WG9A 3E03A 2IE0A 1R4NA 4KOAA 4IMRA 3QE3A 3G0OA 2H63A 3M2PA 4FOSA 4Y6RA 2XPCA 4DA9A 1LLDA 1RM5A 2Y1GA 2PWZA 1WDKA 1P33A 1R0SA 4QTZA 5JCXA 2YHUA 1F14A 2YV2A 4KMSA 4CJXA 5LDGA 4FBGA 5I7EA 2AE1A 5JO0A 2GPTA 1S6YA 1FDSA 4BO0A 1NFFA 1E0DA 3BMCA 4YB8A 3ZWCA 2HAEA 3FR7A 5BSEA 4CR8A 2JHGA 2PD3A 1F17A 3HG7A 5ICSA 3GNQA 1MXHA 2X6TA 3RU9A 5KTKA 5CFZA 3E5MA 2V6FA 3MTGA 1AGNA 5EN4A 1O6ZA 5F1KA 3P5SA 3AOEA 4R51A 3NUGA 2PLAA 3L07A 1H5QA 4J7XA 5DCYA 1P1RA 2PD6A 1LUAA 1N92A 3D3WA 3ZU3A 4QSMA 3C7CB 1RM4A 4B7UA 1D1TA 3JQBC 5KOIA 5IDXA 4KWIA 3GNTA 3GRPA 4Q3BA 1O5IA 3ZV3A 2A4KA 4Z0HO 4BUCA 1DJQA 4WLFA 4CV1A 3LDHA 1ZBQA 4O5OA 4RLHA 2GZ3A 2Y0DA 1DIHA 2GZ2A 1LLUA 3LLSA 2NVBA 2YQ4A 3W8EA 1YDWA 3PK0A 4JX8A 3ZWOA 2GN4A 4WLNA 1IPFA 1OZAA 3MJTA 3QJ5A 2YFHA 4TVBA 2AE2A 6ADHA 4R1TA 3FNGA 3JQ7A 3OQ6A 2J8ZA 3ST7A 3JD4A 2PK3A 3GAZA 5CDYA 3Q3CA 4DUPA 5K9ZA 2IEDA 1H6DA 2NTVA 3AFNA 4RPJA 1D3AA 1GL3A 4BB5A 4R9RA 3SJUA 4NJMB 4L76A 1T2AA 4H3VA 4PLCA 4CM4A 3RUFA 1UR5A 1EFKA 1OC2A 3GEGA 1T25A 5DOZA 3ZHXA 1E3WB 2G1UA 4Q3DA 3A28A 1QP8A 1XA0A 2C82A 3JQGB 3DFZA 4ZQGA 1VC2A 3GG9A 3OSUA 3SEFA 3X2EA 4B79A 2B35A 4I9UA 3OECA 3OH8A 4DMMA 4EUFA 2B5VA 3TRIA 1R4NB 1G0OA 3UVEA 1GDHA 1GCUA 4RVSA 3DTYA 2X22A 4CLHA 2IZ0A 1U3VA 5BR7A 3DZFA 2ZTUA 1P77A 4BO1A 2X7HA 4CQLA 4DYVA 1EVZA 2HUNA 3EK2A 1KC3A 4GAEA 4E32A 1PJ2A 2P5YA 4P22A 5U4QA 3CZMA 3I6QA 5JBIA 5EIOA 4QEDA 4WGGA 2VTDA 3PYLA 2CVZA 1HSOA 4LSMA 1B15A 2X5KO 4J9VA 3RBZA 1G0NA 2CSUA 3BMCB 5A5FA 5A9SA 4UAGA 3VVCA 1I24A 1VKOA 2HCTA 2ZQYA 2X4GA 1YQXA 4ZN6A 5A5EA 4D0SA 4JP2A 3DL2A 4N18A 1DAPA 3VTZA 2ZJ1A 1P31A 1BW9A 4KTTE 1UUFA 2IODA 2O3TA 2BFAA 3RASA 4XDYA 4GVLA 4ID9A 4DQXA 3U4IA 3D3WB 3B6ZA 4I5DA 2DAPA 3U4DA 3KVOA 4YAJA 2CF5A 3H3FA 2VZ8A 1X7DA 2R00C 3VH1A 2C0CA 4RLSA 3PHJA 4DWVA 2JJYA 4K26A 3EUWA 3PZBA 2YW9A 3VPHA 5KWEA 4PZCA 4RCVA 4MOWA 1KERA 2J5KA 1I32A 4A7PA 3TOZA 3UN1A 1B26A 4E5YA 3KSZO 1ONPA 4QXMA 3ZWAA 1O94A 1MB4A 3LYLA 4EGFA 1DRUA 1HZZA 2O7QA 3FCOA 4GLLA 4UUNA 4UUOA 1B8UA 1ISIA 1NQOA 2DQ4A 4O1MA 4XB1A 4L8VA 2NU8A 1DIGA 1EUDA 4ZJUA 3V5NA 1S7CA 1U3TA 1LDNA 2J5RA 5L9AA 4PLVA 3MJSA 3JQ7B 4DIBA 4NI5A 1LC3A 4RL6A 3WGQA 2JD2A 3WGZA 4BMNA 4MP3A 2BELA 3QA9A 4DVJA 4ZHSA 4CLRA 3C24A 3FTNA 4YRBA 4FGSA 4F45A 3TNLA 1XCBA 2W2KA 1ADCA 1U4OA 2W4QA 2IYPA 4CM4B 3R3JA 2LDXA 3H65A 1BSVA 2XAAA 2UDPA 9LDTA 2J3IA 2PGJA 5ER9A 3RUHA 1EK5A 4E5KA 3EZLA 3MWDB 3VTFA 3PLRA 3H3JA 2JCYA 2NU7A 1UP4A 3NJ4A 4G81A 5G4KA 4GKBA 1UP7A 1QXSA 4BKRA 5IF3A 1YQGA 2ILTA 1ZSNA 1A9YA 1PIWA 2PTGA 2ZB4A 1GEEA 1LSSA 3KSUA 2GD1O 3KM0A 4TKMA 4BO6A 1M75A 5IDYA 4QECA 1GEGA 5IXSA 3WMWA 2DBQA 3HADA 5AQ1A 5TIIA 5DBFA 2I66A 3GMSA 4MKZA 3C7DB 1NR7A 1PL7A 3ANNA 3U4HA 3VPGA 4B3IA 1BVUA 2EXXA 4R5HA 5I7VA 1WDMA 3LF2A 5A9SB 3KRTA 4OKNA 4JJGA 1TT7A 1UXKA 2PA3A 5DBGA 4IZIA 5JS6A 2PNFA 3GUCA 2PKRA 4L4RA 2O7SA 3O26A 1EBUA 3L4SO 2J3JA 4EJMA 3OA2A 2PKQP 1BW9B 5JDIA 2HMVA 4UULA 4WEQA 4A27A 4GLOA 1QYDA 1GQ2A 4CM3A 2AQ8A 2HRZA 5A9RA 4F6CA 2EHDA 3ITKA 2E82A 2VUSA 3BHMA 1E7RA 1AHHA 4RORA 4C7KA 5IZCA 5JE8A 1C0IA 1H0KA 4Y9DA 3D4OA 3H9UA 3I4FA 4MKXA 5DP2A 4K28A 1LLCA 4I5FA 4K9DA 2FR8A 1ZEJA 4LCJA 4E5PA 3PJFA 5AXAA 1CWUA 1MUUA 2X8LA 4Y6SA 3PTZA 4YPOA 1JKJA 2NNLD 2ZTLA 4DBVO 3CUKA 4FC7A 5CEEA 3ROPA 4J91A 5KVQA 3AUUA 1DXYA 1QYWA 3GG2A 5ITWA 2EP7A 4CMAA 4R1SA 3DC2A 5MDHA 4J16A 3PIDA 4CMGA 2W98A 1R37A 4OQYA 4FC6A 1AXGA 3WWYA 5ITVA 3MTJA 3L77A 1LA2A 4EJ6A 1GADO 3I4CA 2DFVA 4I9NA 3PHLA 1GU7A 4CLRB 2Q2WA 3BMNA 2J3HA 1P0CA 5H82A 4YXFA 4R1NA 3ZU5A 2O4CA 2W2KB 3GC6A 5A3JA 3ZDFA 2YUTA 4BGEA 3KXDA 3PEFA 2NWQA 1EEHA 2ZB7A 3DWFA 3G1TA 4ALJA 2YV1A 2DUWA 1MG0A 4NBUA 4NNJA 1DJNA 3L6OO 1KOLA 3F6YA 3QW2A 2NUAA 1PL8A 1GAEO 3MJ4A 5GY7A 5G4KB 4FCCA 1A7AA 4HKTA 3UW3A 5DCWA 4YWJA 2A94A 1BXKA 3RUEA 3RBXA 3WGHA 1E7YA 1B3RA 1OMOA 3KETA 1WLYA 4R3NA 1IYZA 1NVGA 1UZNA 3OP4A 3V8BA 2BGKA 2IXAA 3ONDA 4IINA 2I3GA 2EKLA 3KYBA 1HTBA 2C20A 2PZJA 4OO3A 3GOHA 1IZ0A 1ISMA 1MGOA 1NHWA 1L1FA 4EUEA 4WJZA 1OFGA 3QIVA 4PFJA 1HDCA 3VZPA 2Z95A 3EZYA 4YYZA 1L7DA 4CR7A 4YR9A 1I3LA 1ZMTA 1H9AA 4BNMA 4DYDA 1ZKMA 4G65A 2X1HA 2IRWA 4XIYA 3L4BC 1PJ4A 2YHIA 3WTCA 4BS9A 4Z6KA 2D5AA 3O4RA 4YDRA 5TSDA 2VCYA 4YJDA 1DHRA 2WMDA 4J3FA 4Z9FA 4HFRA 5I9LA 3RUIA 1PJSA 1GV0A 4YJHA 3T7EA 3P2YA 3EY4A 2P4QA 2VNSA 1DPGA 4ONEA 2PD4A 3IKTA 1MP0A 3FF4A 1ZK2A 4II2A 4WOJA 4Q9NA 3BIOA 4II3A 3AM4A 5KIAA 4GVXA 3PQFA 1KEWA 5GMOA 2DVMA 1Q1NA 4YEDA 4B7XA 1JA9A 5F3RA 4CV0A 2WE7A 1YE3A 2DPHA 4IGEA 4K6FA 3IJRA 1CETA 2DBZA 3GVPA 3VHRA 3C85A 3PRJA 4CLXA 1O95A 3ZNQA 4BO3A 1KEPA 2UAGA 3HZZA 1Z7EA 1TB4A 2D2IA 2JCVA 2FSVA 2UV8A 5ADHA 2GERA 5GZ6A 4P4LA 4OGWA 4YTEA 1T4DA 4W99A 3PJDA 2QW8A 1C0PA 4J7CA 4AL4A 2FSSA 2JD0A 4OL9A 3KO8A 2GUGA 4BV8A 1CIVA 2O3UA 8LDHA 4WNCA 1X1EA 5I9MA 4M89A 2B37A 3BMNB 4KDFA 3VOSA 2B0JA 5KJCA 1XWFA 3TZKA 4UVHA 3UH1A 5DOVA 5IDWA 4IJVA 4Y6PA 1KY4A 3TZQA 1JAXA 4J0EA 4JJIA 4CODB 1KVTA 5H83A 3KEQA 4BO5A 4PG5A 3VZRA 2VOEA 5T64A 2RH8A 3DO5A 4WUVA 3S2IA 4EDFA 1NFRA 4AICA 4BKUA 4PRKA 4O63O 1OC4A 2Y66A 3WBFA 2C5AA 1VKNA 1UDBA 3UFXA 4LCEA 3L6EA 1MFZA 1N9GA 2C7GA 4HFMA 2VN8A 3I23A 3WDSA 2W8ZA 5KKCA 3ADOA 2NACA 2BGMA 5JNLA 4J1NA 2FZWA 1N7GA 2I9PA 4NMHA 3T7CA 4R68A 3WJ7A 1ADBA 4J1TA 1IZ9A 1YXMA 1CERA 1XKQA 4J1QA 4WPGA 2PGLA 3FBGA 4TRNA 4KUEA 1P1JA 1I3KA 4PG6A 2NLOA 3RQSA 2VWQA 4HUJA 2YHIB 5KCZA 4XQGA 3NT4A 4AFNA 1PQWA 2PGDA 1JAYA 4OYRA 3I1JA 4A5OA 3BA1A 3GVHA 1X15A 3IP1A 1CRWG 1UP6A 3JQ6A 3UAGA 3SX2A 5HS6A 2C7VA 3MOIA 4CM5A 4YJHB 1ISGA 1BDBA 3D5QA 3OJ0A 4RVDA 2OUIA 4XRGA 1UXIA 3AOGA 3ONEA 3IJPA 4MVJG 3TN7A 4F3YA 3OQ1A 3PGXA 5EQDA 4ZGWA 3AI3A 2Z1NA 4J43A 1E3LA 2Y1OA 5U1PA 3OJLA 2X5OA 4BVAA 3AUAA 3CTMA 3ZWWA 5A04A 3JQFA 1SC6A 4LVCA 1U3WA 4EW6A 2JAPA 5DZSA 1I10A 4ZQHA 4QFCA 1YL5A 4LGVA 3RAJA 2I5PO 1PGQA 4AJ2A 5C5IA 1MC5A 1SPXA 4JCOA 4RF5A 1ZIDA 4A10A 4GKVA 3CEAA 4GMGA 1Z73A 4JK3A 4N5NA 1NHGA 1W8DA 1R15A 4IXWA 1EE9A 1F06A 1VI2A 3TSCA 3W1VA 3GGGA 3EMKA 2VYVD 4IY1A 4E30A 2DFDA 1MG5A 3QRWA 3VPSA 1ORRA 1JWBB 1P3DA 4W9NC 3ZCXA 4HFNA 1A27A 2GR9A 2VTEA 1EDZA 1NQTA 1Q0LA 3KYDA 4D43A 3D1LA 2P5UA 3AK4A 4PLPA 2WDZA 1NFQA 5L7TA 1NVTA 1XYGA 4KWHA 4OKIA 1GZ4A 4NK4A 4YJGA 2QIOA 4D7AA 1M6HA 3P7MA 2OL4A 1FDVA 2Q49A 5JPIA 2C2YA 3WQRA 4R01A 1HDGO 2RBEA 3Q1LA 3C1TA 2OO5A 2JFHA 4O59O 2VYVA 3HDYA 3WGYA 2HJRA 2RHRA 2V7PA 3ZGYA 2EF1A 1R66A 1CYDA 1WZEA 1BG6A 1C0KA 1I5RA 1PS9A 4MVJP 4PN3A 1YL7A 1HZJA 5I7FA 3NGXA 5KJ6A 1N9GB 4OAQA 3HNPA 3TFOA 4FFRA 5CP8A 2NV6A 1AN9A 3Q9UA 4RVFA 5TRTA 1MC4A 4YT5A 2FPPA 1UXGA 3IQDB 1JWAB 2GN8A 4W7IA 5BQFA 2RIRA 2IZZA 4UEJA 1TXGA 3PQEA 1SO8A 4IDAA 3PJGA 2PH5A 2BHLA 5EESA 1E7SA 3IUSA 5IXYA 1VRWA 1NXQA 4PLHA 3TDKA 1WAMA 4R41A 2IDZA 1VSUA 2D4AA 3A06A 5ILGA 2B4RO 5JYEA 3NT5A 2E6UX 3WIEA 3GN1A 1N1GA 1ZK0A 1G1AA 4R4JA 1LXCA 2O3SA 3NTOA 4QFDA 4ND5A 2DUUA 3GT0A 3F4LA 1J4AA 2Z1MA 5L95A 3HDJA 3W4KA 3OIFA 1I0ZA 3E9QA 1A72A 4TMFA 1IHXA 5HA5A 4AVYA 3TL3A 1DLIA 3KBOA 5JDIC 1EFLA 3ZV6A 2QHXA 1RKXA 1YO6A 1UZMA 2ZB8A 3VAZA 2EEZA 2YYYA 4EITA 2CDCA 3NV9A 5C7OO 4L4SA 2EKQA 2DU8A 3S55A 2I65A 4PIVA 3Q6IA 3L4BA 3QVXA 3WWZA 5IZCC 4S1VA 3H6KA 4ALIA 4DPMA 3ZHYA 3LC1O 5C37A 4UUPA 5L40A 2P9CA 5L4NA 1U5CA 3ZHZA 2Q1WA 2OMEA 1K5HA 1QYCA 1V9LA 2H6EA 1HF3A 2FP4A 1MLDA 3OJEA 4XIJA 5L45A 1LRJA 4HY3A 2AQKA 3ABIA 2QYTA 2EKPA 3FNFA 5K0ZA 1CDOA 4OIMA 4G2NA 2DC1A 1ENYA 4BNLA 3DHEA 4HFJA 2C29D 3HSKA 4INAA 1ZSYA 1PGNA 3KYDB 5G0WA 3DOJA 4CPDA 3OQBA 4E2WA 4GSLA 3IIEA 4L75A 4RF4A 3FSRA 3W6UA 3NTQA 5KVVA 1Q7CA 4CLEA 2GYYA 4NIMA 1K89A 4N5MA 4B3JA 4WKGA 2YZ7A 4GWGA 3U9LA 4YJGB 3G1UA 5TNXA 1EVYA 2JFGA 2X9GA 5FI5A 1LDGA 3X2FA 5IZ4A 2C59A 3I6IA 4OH1A 3IKVA 4IDEA 1JW9B 3QSGA 3RCBA 2PR2A 2HMSA 1SMKA 4ZA2A 3SC6A 3N58A 2FWMX 3UGKA 3VDQA 4RV9A 5DCUA 2FOIA 3F1LA 4EYEA 5MGBA 4JLWA 3DZHA 2FPIA 4I5GA 4BNVA 3F4BA 5AOVA 1H6CA 4OJNA 2G76A 4B8WA 2CZCA 1SB8A 1GQQA 1SOWA 1XQ6A 1Y9EA 3AUTA 5JLAA 4F46A 1VL0A 4CUKA 3GVXA 1PGJA 4DLBA 3I5MA 5CG2A 3U62A 3EW7A 1LDYA 1FK8A 3PLNA 3GDGA 2NVUB 1KVUA 1NQ5A 1JDJA 1FF9A 3D7LA 1A9ZA 2C2XA 1R16A 3KYCA 4WLVA 4AJPA 2UUOA 1Y8RA 2VWGA 3AJRA 4PLTA 1K2WA 3QVSA 4U8GA 3BMQA 3DZBA 1U4SA 3ADPA 4AG3A 1TEHA 2OBNA 5ILOA 1KC1A 4U5QA 4D41A 5JY1A 4DC1A 5KNLA 3G3EA 3SJ7A 1LJ8A 1DFGA 4LN1A 3BHIA 2WSBA 3D3EA 1TA4A 1D7OA 3QVWA 2GO1A 3EAGA 3UHAA 4CM9D 1C1XA 1DEHA 2HSDA 3DONA 1E1MA 2Y67A 4E6PA 3IC5A 3JQEA 3ZNPA 2Z5LA 5IN5A 5I9NA 1E6UA 3WGOA 4UVDA 3RUAA 3QWHA 4XWYA 4WASA 3D64A 4DL9A 4CM6A 5CG1A 1DIBA 2HK8A 4IIUA 3ICCA 3DTTA 3HDQA 1PSDA 2X23A 3GRKA 1JU9A 4M54A 4YAGA 1GZ6A 4CM9A 1MXFA 4GQAA 3H9JA 1ULUA 3INGA 3PZRA 4Y67A 5LDHA 3CPSA 2AHRA 3MJCA 5HM8A 1LSOA 2O50A 3VH2A 5CPBA 4D45A 4MVJD 2BFPA 5TGDA 4MVJF 1LRKA 1QMGA 2P9GA 3NJ8A 1NPTO 1DFHA 1RYEA 1YBMA 2JAHA 3AU8A 3Q2IA 3S2EA 1F0YA 4ALLA 3AI2A 3CMCO 3HQ4O 3INRA 2W90A 1G6KA 3PVZA 4H15A 4MIYA 3QWFA 4BNZA 2VHYA 1BWSA 1Z75A 2BI7A 4HBGA 4U6QA 4WE3A 2G82A 3COSA 3GFBA 5I7SA 1P9LA 3DAFA 1T26A 4HX5A 4MVJA 1PGOA 4Q3EA 4CUZA 1Y7TA 3I52A 5L51A 4CMIA 2NTJA 3IUPA 2FZEA 3NKLA 4NFHA 4TRRA 3W4JA 1DBVO 3JYQA 1Z7BA 5U9CA 3ASUA 4WECA 4W9NA 3ZW8A 3PWSA 2FPGA 4B4WA 3TOXA 3I9MA 1X7GA 1ZFNA 1LSUA 4B8ZA 3RC7A 1UDAA 4YAKA 1V8BA 2AG5A 3QWAA 4FPXA 4YACA 4FGWA 1IULA 3GUYA 3K6JA 4U6SA 2JL1A 3KUXA 4I1IA 4BMSA 4C4OA 4QUKA 4CR6A 5JDCA 1A71A 3WB9A 1IY8A 2GSDA 5GZ1A 1PJCA 3I9OA 3WFIA 3R1IA 4XR4A 3HJAA 3FTPA 4BNUA 5C7IO 3RC1A 4RF3A 4E2XA 3GNSA 3SLKA 3UICA 3TPCA 3VKUA 1U7TA 4BO7A 3KYCB 3IS3A 1Y8RB 1Q7BA 4BGVA 4NFYA 1PGPA 2VHVA 1V3VA 1UH5A 3OHSX 4BNIA 3ZZNA 3BMQB 4BNTA 4BGUA 1QLHA 3AFMA 3PHIA 2HMWA 2PZLA 5TF4A 1Y5RA 4BNXA 3ICPA 2ET6A 4OXYA 4P8RA 1E5QA 1Z6ZA 2JFFA 1Z45A 4NBRA 4E5MA 1SOVA 4KP7A 1V35A 1EZ4A 2J3KA 1EUCA 3UCFA 2RAFA 1C1XB 4TZTA 5COBA 5TJHA 1GYPA 1UDCA 2Q99A 4MVJE 4A03A 4ROSA 4J49A 1GUYA 1Q2XA 4WNIA 4CV2A 1PJ3A 1ZXLA 2WD7B 1HXHA 4I08A 1PZGA 5LC1A 3GGOA 2WYVA 3JQFC 2AEFA 4LW8A 2DT5A 3S8MA 1N5DA 2WYWA 5DBIA 4HNGA 2CVOA 5BSFA 1LEHA 3ZWYA 4DQUA 3JD3A 1EBFA 1KIFA 2NQTA 4BO8A 4XGIA 1XIVA 1I01A 3H9GA 5L4SA 3FD8A 4UVGA 3EVNA 4D44A 2O3JA 1E77A 1LU9A 2Y1DA 3EYWA 4JJFA 5A4DA 5JCJD 3JD2A 4U7WA 1GYQA 3GDFA 3GVCA 3L0DA 4EEXA 4PLGA 3BTVA 3LQFA 1UXHA 2QQ5A 2ZJ0A 3D0OA 3U49A 4B3HA 3JD0A 2PV7A 2YFQA 2UUPA 5JAQA 2P4HX 4B4OA 1YB4A 2VWHA 4FB5A 4UREA 4LSWA 4KUGA 3I83A 4RVHA 5JAMA 5FWNA 4BNWA 1NR1A 4N5LA 1Y5MA 4OQZA 4CMIB 4JN6B 4ZQEA 2GCGA 5JCJA 5JC1A 1DIRA 4KZPA 2OORA 4U0KA 3DOCA 4ALNA 4JGBA 1LDBA 2OP0A 2CF6A 4M49A 4BNHA 4CMKA 1DSSG 4O0LA 4ZD6A 4ZRMA 2OGUA 1ZO8A 5JAZA 2C54A 3EGOA 5IAAA 1NM5A 1ISFA 1Q0QA 3NYWA 3DAGA 4H7PA 4RGBA 3CMMA 4GH5A 4RVUA 1I2CA 3ZU2A 1TT5A 4NZ9A 4FOOA 2VUTA 5TT0A 1BMDA 4E2ZA 3F5QA 1T2CA 1YQDA 3WGTA 1W0CA 3VKVA 3AWDA 4KTVE 3VH3A 4AJKA 1AE1A 4M1QA 3LT4A 2HK7A 4A26A 5B4UA 1HE5A 3M1LA 7ADHA 1N7HA 3WYEA 5B1YA 3JV7A 2O23A 1E6WA 2GZ1A 3JQ9C 3KLMX 4ZRNA 3ZV4A 3PWKA 3U5TA 3G79A 1ZK1A 4XYBA 4EI2A 3AU9A 2BLLA 4NBTA 3U4CA 2VRBA 1ENPA 4GX2A 4R9SA 5FYDA 3S2FA 3W8FA 1NBOA 3HFSA 5L7YA 7MDHA 4M87A 5G0UA 4ND4A 1K0UA 3WGIA 1GYRA 2H9IA 4CM7A 1GZ3A 4I9HA 4FIZA 1CQJA 3HB5X 3GLQA 4TVOA 5DN9A 1PTJA 2IEBA 4YT8A 3RIHA 3PGJA 4BB6A 1DAOA 5A06A 1XSEA 4J1SA 4CM1A 3LLVA 3HHPA 3F1KA 4IJWA 4KUHA 4E33A 3A9WA 4RQTA 1ZEMA 1HDZA 2CMDA 4AJHA 3FRJA 4QT0A 1B7GO 1VE9A 4IDBA 1NP3A 1SNYA 4LRTB 2ZB3A 1NPYA 4FFNA 3E48A 4XJSA 5F21A 3UKOA 3ZNOA 4JBIA 3UUWA 2Q50A 4XQEA 1GUFA 4S3MA 4E21A 4UEKA 4CMJA 1JTVA 1NNUA 2RHCA 1QV7A 4W7HA 1WNTA 3DMTA 3GHHA 9LDBA 1GCOA 2O48X 2B5WA 4HNHA 3DBHA 2G0TA 2YDXA 1ISHA 1UJMA 4RQUA 4IQ8A 4EBFA 3OIDA 4BNKA 3TFQA 5THQA 4BNNA 4RZIA 2CNBA 4CMCA 4MO2A 1DIAA 3H2ZA 1PS8A 3PHGA 2V65A 2Y0CA 2HRBA 1E5LA 2ZIZA 4FQ8A 3D5TA 1LLQA 2VQ3A 1P45A 2ZCUA 3OBBA 1VJ1A 1YKFA 2I3AA 1XGKA 1RWBA 3KB6A 1WPQA 1CQIA 3OM9A 4NK5A 3TZHA 1E92A 4BKQA 1OBFO 3RUDA 2CY0A 2TMGA 5AYVA 1TT5B 4IDFA 5TQVA 1ONOA 3CINA 1YOVA 2QG4A 1ZMOA 2RCYA 3OA0A 2V6GA 1V0JA 4GWKA 2X86A 3RJ5A 1GY8A 2V6MA 3OMLA 1WMBA 4NBWA 1X1TA 4XJTA 4Y8VA 3JYLA 3QHAA 2ZATA 3Q9NA 4DLLA 4TWRA 2AEJA 3ZWBA 1P1IA 2ZYGA 3JQAD 5BNTA 3AY3A 2VHZA 4D3DA 1U2GA 1N2SA 1ZSVA 1ADGA 4DQVA 4YRAA 4PLYA 4R5MA 1EK6A 2Y99A 2ZK7A 1M2WA 2J6IA 1BTOA 2ZTMA 2PZKA 4JNKA 3PP8A 1ARZA 3CH6A 4JP3A 2F00A 1V3TA 1E1LA 2Y1EA 3RUCA 4IIVA 1YONA 1VJTA 4R1UA 4BO4A 3PI7A 2GN9A 3MEQA 5EINA 3HE3A 3JQAA 1R0LA 3FNHA 4EUHA 4R69A 4YA6A 2CDAA 2VT3A 1XEAA 5ENVA 5ES3A 3OEYA 2NVWA 2B36A 2Q1SA 3EVTA 1YBAA 2D1YA 2WYUA 3DZKA 3PFWO 3DHNA 5COQA 4NU5A 1TLTA 5KVCA 2HKIA 1YRLA 1M67A 3H7AA 1BXZA 1YH3A 2C5EA 3K8ZA 3QP9A 1NQAO 3WFJA 1P74A 4YAEA 1E7MA 4QQRA 4TQGA 1YJ8A 1D1SA 1PWXA 4J2OA 3VPFA 2DTXA 3DBRA 2I67A 2X0JA 3KZVA 1X0XA 1ENZA 3WBBA 1B0AA 2AA3A 4KDEA 5GZ3A 1M66A 2DPGA 2CD9A 1NASA 2HJSA 3PFFA 3DBHB 1Y9AA 4GX0A 3C1AA 3WR5A 1J0XO 3ZWVA 3R6DA 4E31A 4JXKA 2DBVO 3RVDA 3TZCA 5JYDA 1IUKA 3O9ZA 2Y1FA 3M6IA 4CUJA 1HKUA 3B1JA 3GEDA 3MOGA 3VZQA 3FHLA 3H4VA 4CMEA 4NPCA 1ULSA 1HDOA 2D59A 4WLOA 4AJLA 4IS2A 5T8KA 1FXSA 1F8FA 4HXYA 1DC3A 3TF5A 3KHUA 3QWIA 3FWNA 3Q11A 3IL2A 1Z82A 3JCZA 1SBYA 3NTRA 4Z3KA 5AXBA 5JDCC 4IM7A 3QV1A 4Q39A 1YOVB 1WWKA 1XU9A 2X0RA 3JYOA 1LI4A 4CMHA 3DXFA 2VHWA 2VRCD 4ITUA 1I30A 2BRUA 3BTOA 4XYGA 2UVDA 5B4TA 2EGHA 3GEMA 3IOYA 1DRWA 4J4HA 3VPXA 4ZQBA 5A02A 3K96A 4L0QA 2GNAA 1YDEA 1H94A 2OBYA 4XB2A 3ANMA 1NWCA 5TS3A 1OAAA 1QSGA 2EW8A 1SB9A 3WSWA 1ML3A 4FJ1A 1M6WA 3WJAA 1HYEA 2UYYA 1SCUA 4MIEA 5IG2A 1PZEA 4FD3A 1TI7A 1GPDG 1IE3A 4E5NA 2VRCA 5IJZA 1KYQA 2EG9A 1D4FA 4Z0TA 3JD1A 2P2SA 1C14A 3WTBA 3DZJA 3LK7A 3W6ZA 2QX7A 4GGOA 1J6UA 4NR0A 4Z0PA 3ZW9A 2NVUA 3JQAB 3JTMA 3H5AA 4E2YA 2QZZA 5T57A 3JYPA 2VYND 3PQDA 2P91A 1U9JA 1GFSA 2HU2A 2YDYA 3JQ9A 4H16A 3TZ6A 1JN0A 5IFLA 4IDCA 5B37A 2JD1A 4PRLA 3ETDA 4PZDA 1I3MA 1NAHA 4E0BA 2CUKA 2X5JO 3D4PA 2XXJA 1ONNA 1NWHA 1QR6A 4CM8A 2PKQO 1QRRA 4MINA 3OETA 5C7LO 1WW8A 1U8FO 3C7AA 4PCVA 4FSHA 2OFPA 3AY7A 2FY8A 3HN7A 1F8GA 3H8VA 3HN2A 3BZUA 3CSDA 4NDNE 5IN4A 3DBRB 2VYNA 2X9VA 3CE6A 3LF1A 4TKLA 5LCXA 1R6DA 3GGPA 3ANLA 2XXBA 2X9NA 3QY9A 4KQWA 4QO8A 2Y05A 1YVEI 3I9NA 1UAYA 4RPGA 1K6JA 3NDJA 1IPEA 4QO7A 1W6UA 2AW5A 4CMBA 1VLLA 1GR0A 4AJ1A 4LVUA 3ON5A 3NDRA 2FRDA 3MJEA 3DB2A 1KEVA 3DBVO 1K6XA 3G17A 3ZV5A 1XR3A 4XYLA 5FEUA 1XDWA 5FF9A 3GH3A 3PYXA 4CL3A 3V1TC 1NYTA 1ZCJA 3L9XA 1Y81A 3DHYA 3JYNA 1XQ1A 1P1KA 1VSVA 1HYHA 3FPCA 4R3WA 2CDBA 1FJHA 2CFCA 3ZWXA 2A9FA 4E13A 3L9WA 5A9TA 1JKIA 1QYXA 1LQUA 1X7HA 3F47A 5IDQA 4LK3A 5THKA 4BOYA 1Y8QA 2FN7A 2IYOA 2B4TO 3UCEA 1AUPA 3N7UA 1MX3A 1XELA 4GBJA 4MVJH 4BV9A 3LSYA 4BO9A 4WCFC 5G4LA 2Q2VA 3DZIA 3E82A 4OOFA 1YJQA 4Y98A 1PR9A 2VZ0A 3K92A 1H9BA 3O03A 5CDTA 2P68A 3TL2A 4Q3CA 2X0IA 3WGGA 4DTIA 4RPLA 1LQTA 1P1FA 1KVRA 1HE2A 2HMUA 4IMPA 1VM6A 4RDIA 2FR1A 3VZSA 5EERA 4XCVA 3U3XA 3DZGA 1C1DA 1GD1O 4XX0A 4XQ9A 3DBLA 3N74A 2IZ1A 5ENDA 3WX0A 4KQXA 1O8CA 2HQ1A 5TX7A 1Y6JA 5F5NA 1P0FA 1RYDA 3B70A 3E5RA 3GDOA 1EVJA 3WOHA 3ZN2A 4AJIA 1KY5A 2VHXA 4Z9YA 3PPIA 2VZ9A 3Q2KA 4XA8A 5J23A 3DEYX 4IXTA 4BMVA 4MP8A 1B2LA 4E4YA 3VVBA 2EV9A 3BYZA 3PYMA 2B83A 4ALKA 1PQPA 2O4UX 5JW6A 1X13A 1ENOA 2VOJA 1NAIA 4YQZA 2JHFA 2E4AA 5TT1A 3A1NA 3DDNA 2BF7A 4BNGA 1WZIA 5TLSA 2NADA 1X0VA 4M55A 4TSKA 3ETGA 3K2EA 3M2TA 3WNQA 4CM8B 3AY6A 3L6DA 2OP1A 4P4NA 1HDYA 2GF2A 1H93A 3HDHA 2EP5A 3RFVA 4FFMA 4BQPA 2DTEA 1C3VA 4DGSA 3KTDA 3T4XA 4B4VA 2Q1TA 3MCVA 4M86A 1Q7GA 4NFSA 1UXJA 5EQFA 3C8MA 1VL6A 4ND3A 1DOHA 4XGNA 2WD7A 3FWZA 4LISA 2YJZA 5KJFA 1NVMB 3LC7O 4XR9A 2J5QA 2QRJA 3W8DA 1ISJA 1E7QA 2V6BA 1L7EA 3DMTC 2A35A 3V1UA 3BXXA 1H6AA 3KLPX 2H1SA 2R6JA 2C07A 1RM3A 3VC7A 3FR8A 2AG8A 1E3JA 3OJFA 1PZHA 4XKJA 3DQPA 1A4IA 1A5ZA 3WSVA 4AJEA 4TZKA 3KSDO 4DRYA 2BGLA 3IP3A 3ZWMA 4URFA 1QORA 4ZU3A 1Y8QB 2AQHA 3FNEA 3BAZA 4NJOA 3H2SA 3PHHA 4XYEA 3BMOA 1P1HA 4TRJA 4EZBA 1IOLA 3LT0A 2GN6A 4FN4A 3KEOA 4MIOA 4IBOA 2Y68A 4HP8A 4RDHA 3GZNA 5CPFA 1EDOA 2Q4EA 5G2OA 5JSFA 2G5CA 4IQGA 4BO2A 2OOSA 3GY0A 3NEPX 3V2UA 3QLJA 1OI7A 3Q0EA 1P44A 3AM5A 3WICA 4D79A 1QV6A 4CLDA 5T5QA 3NDIA 4LMPA 1DDOA 3C3XA 1B16A 1C1DB 1MA0A 1DRVA 3DBLB 4RPKA 5HRUA 1EMDA 4YCAA 1KS9A 3F3SA 4CLOA 5G0TA 3EC7A 1UZLA 3SXPA 4XYMA 1O89A 4FS3A 4OSPA 5A3VA 2YV3A 1X14A 4L4XA 1BVRA 1PWZA 1HE3A 1HWYA 3ZI0A 2Q46A 1UAGA 2I99A 2QRKA 3CIFA 2X0NA 4I8XA 2XF8A 1XG5A 1PEDA 3S2GA 3AM3A 3E9NA 4J9UE 3JQCA 5F1OA 1YB5A 1DC6A 3RI3A 2WTBA 4QX6A 3F46A 5DP1A 2BMAA 5EMHA 4DPKA 3QVTA 4YT2A 1HYGA 4DIOA 3E8XA 3NAQA 4L74A 2D8AA 1W4ZA 5BT9A 2Y1CA 5B4VA 2EJVA 4K1LA 3SBOA 2DBRA 5DDIP 3V2GA 3JQ8A 2AQIA 4E3ZA 4HV4A 2E49A 3LC2O 1NX6A 2XOXA 3P2OA 4F6LA 1A4UA 1QYVA 2E48A 3UXYA 1EQUA 1H2HA 1ZNQO 2EERA 3RJ9A 3PJEA 1WVGA 5K6AC 1MFPA 4WLEA 2DM6A 3WIDA 2OHXA 4R16A 3GK3A 3QWBA 3MZ0A 4GGPA 4DPLA 1U8XX 1N1EA 1I2ZA 1T2FA 1I2BA 2FMUA 4LRSB 4CQLB 3AI1A 1LDMA 1K6IA 4O6VA 3ONFA 4B7CA 1H6BA 1Q0HA 1IHYA 1AHIA 4RJTA 3K30A 1FDWA 3TJRA 3RC9A 3W4IA 2R2GA 4OMUA 1SEVA 4N54A 1LRLA 5HBRA 2Q2QA 1YWGO 4WCDA 3FN4A 1QKIA 2YQ5A 5B12A 1YBVA 4UUMA 4YAIA 2ZYAA 1I8TA 1HRDA 2BD0A 4CMEC 4FFPA 1KEUA 1I36A 5JY6A 1T2DA 3GA0A 5T8KC 4W82A 3ITDA 1BGVA 2PZMA 2YY7A 2ZYDA 3LT1A 5CDGA 3B20A 3NGLA 3BMOB 4PG4A 4MKRA 1MV8A 1ZZEA 3JSAA 3GZNB 3T4EA 1VPDA 3INTA 1R12A 2QYSA 2NU6A 4GPD1 3ZH2A 3R0IA 3CTVA 3K5PA 4GMFA 5FFFA 3SC4A 1PZFA 1QLJA 3UOGA 1KVSA 4MVJI 4P4GA 2HLPA 3GF4A 4NQZA 4IUYA 3K31A 4AJ4A 1K3TA 4MJLA 1ZUD1 4A2CA 1E3IA 1WXDA 2HMTA 4B4UA 5DNAA 1B8PA 2H5LA 3SVTA 2AXQA 1BXGA 3JQDA 1GPJA 3WMXA 4CLOB 2BFMA 5I8ZA 5TC4A 2D5CA 4ALMA 4DIFA 2Q3EA 1GQYA 5JMPA 3RROA 2VUUA 4J90A 1LC0A 8ADHA 4FJ0A 4BNFA 4WCFA 4IPTA 4LMRA 3PDJA 2G17A 3WS7A 3OJOA 2O2YA 1XLTA 4P38A 3JQBA 4PG8A 3BTSA 4JQCA 4ND1A 5KVSA 1H2BA 1HETA 1V6AA 4BQRA 1RJWA 5F5LA 4YVFA 2I76A 2FHSA 4FR5A 4CL8A 3RKRA 3H9EO 2I6TA 3HUDA 3NRCA 4DBZA 3K2BA 4XEHA 4PZEA 4A0SA 4BGIA 4NG5A 3JQ8B 4JBGA 3MWEB 1HE4A 4RPHA 3HFGA 5JFOA 5DF1A 1E6EA 3ZHBA 2VWPA 4FDAA 1JLLA 3V2HA 4UVEA 5L3ZA 2DKNA 2GDZA 4BIIA 4YBZA 4IQ0A 3DFUA 3H5NA 3BTUA 3PWZA 1JVSA 3RC2A 1HLPA 1J49A 4WK6A 5COAA 3OEWA 1PJQA 1JQBA 2WM3A 4PLFA 1BHSA 3IMFA 4Z3DA 5C3MA 3UF0A 4FJ2A 5L53A 3PXXA 3MJVA 1OOEA 2O3RA 1U5AA 1FDTA 3PDUA 3ETEA 1B14A 1U1IA 1T4BA 1WDLA 5AXCA 4D46A 2HDHA 4L9RA 3I9JA 5DT9A 5CEFA 1E3EA 3ENNA 3WQQA 4BKOA 2E37A 4RZHA 1I3NA 4XZ3A 2JKVA 1PL6A 4D0RA 3GVIA 3O38A 4J6FA 2PFGA 4BL5A 3GHYA 4DREA 1DC4A 4DC0A 3TQHA 2LDBA 2EGGA 5H81A 4W4TA 1FMCA 3TWOA 3IDSA 2OXIA 1QG6A 1LBEA 4G5HA 4J0FA 4OSOA 4XQCA 4BNYA 1BDMA 4W6ZA 4OM8A 4ILKA 1B3BA 1SEPA 1EE2A 3VDRA 1PU2A 1CEQA 1R4MA 4IJKA 5F1PA 3AOEC 3GFGA 4GX5A 4JBHA 4I5EA 4BKPA 1W73A 5TJ9A 5JO9A 1ZVMA 5BSHA 5KKAA 2EWMA 4GSKA 3P19A 3R3SA 1ZJZA 4NU6A 5CAEA 1LSJA 4TROA 4PVDA 1ZK3A 4XGKA 3RU7A 3H5RA 4MP6A 4X54A 3CZRA 1BXGB 2BKAA 5AVOA 4RF2A 1F12A 3NT2A 4RVGA 1HEUA 5EJ2A 1LNQA 1O0SA 2GLXA 2NSDA 1NTOA 1HT0A 3U09A 3WXBA 2EW2A 1GV1A 4YJFA 2D3TA 1VL8A 3ASVA 1U28A 2B69A 1DHTA 4WCFB 1WMAA 1DO8A 3RSHA 2F1KA 5L4LA 1LTHR 3VH4A 4IGFA 4Q3NA 1IB6A 4TRMA 4XDZA 2BH9A 3F5SA 4XRRA 1IL0A 1AXEA 2D0IA 3QQPA 2R00A 2GASA 2VNAA 4E12A 1JKFA
chains in the Genus database with same CATH superfamily
3HEAA 2GRJA 3TLZA 3E8SA 3EULA 4FFDA 2Y1LA 4LV8B 1PS0A 1TU0A 2HZBA 2WFMA 5TB5A 5LKRA 3NHLA 2G07A 1NTRA 1ZMRA 3BICA 4CCAA 4JROA 2OBMA 1T5SA 2WKQA 5IBQA 1EUYA 2V8BA 3FUCA 3MT8A 3ZZUA 3C74A 1EAYA 1THMA 2WSLA 3GCDA 4CQMD 3IAS1 3VC2A 3COWA 1HL3A 5G1NA 2QBYB 1SCQA 3HBMA 4DCMA 2HO5A 3F7NA 2IA5A 3KV3O 4QTXA 3EMBA 3VBCA 1JVBA 2WKSA 5LUAA 4NBVA 3QXJA 1CS0A 4AM8A 3PUXA 1WP4A 3KR0A 1RPNA 3B2QA 3G0GA 4Q9DA 2VK2A 4Q3AA 5CXSA 1PLKA 1TF5A 1ZDMA 2RH5A 1O9BA 3QVOA 3SP1A 2FW0A 1NU6A 2QTWB 3EDQA 1MO4A 4WN9A 1TJYA 2RHWA 4REQA 4MV0A 5JMTA 1Z5ZA 1H1LA 3UC5A 3D4NA 1GXSA 3EFOA 1SBNE 4YUZA 4FFLA 3GPDG 1Q14A 4GX1A 5T6BA 2XMPA 2P1ZA 1PNVA 4LKRA 3DHWC 4O02B 4B6EA 1Z0UA 3MS7A 5DSZA 3DP7A 3A0UA 1IBLB 4A73A 2EFDB 3IULA 1GA1A 2LR0A 3R5SA 4DXDA 3SXUA 1WB4A 2AYYA 4NMXB 2GYUA 3CRVA 3IDAA 5SZIA 1KMQA 1VG0B 2VP9A 4P36A 3DL4A 3EHEA 3AKYA 3OICA 5JUWA 1GTJ1 4N01A 4EJSB 1N2JA 3EQ2A 4EFMA 1IBMB 3AUSA 2J45A 1E4EB 4GXTA 3G8DA 4NZNA 2XDYA 2ZVQX 2OC9A 4YS6A 1XZQA 5GJCA 4M8SA 5G0VA 3K0FB 4DNOA 2XADA 3HB4X 4JP8A 1TVEA 3ILHA 3M1AA 3UTDA 4BPBA 1LX6A 4G89A 4C0WA 3KB2A 2H1IA 2Q5CA 1Z4JA 3RS0A 4ZOQI 3LT2A 5EQJB 3THWA 1USUA 3OCCA 1DFIA 3GW8A 4KJXA 1AK1A 2CHUA 5LYYA 1IIRA 1VHDA 2XYQA 3DAPA 1R4MB 3MWYW 1ABEA 3NWOA 5A7HA 2XGJA 5EPUA 1Z2PX 4FMDB 2V3VA 4LXIA 5AP9A 4Z3OA 2ZTVA 3CFYA 5B58C 1P9WA 1OGYA 3WNVA 3UHOA 4DLPA 3U60B 1Z38A 3S3TA 5JOQA 3ETLA 5DV9A 1E5XA 5LBIA 3H0EA 5DULA 1OF1A 3G0CA 4GZ5A 2O1EA 5HQTA 5IKMA 2YZGA 1W36C 1XROA 1L9KA 1F20A 3IQXA 1ADFA 1T1SA 5DBOA 4LZZA 1E2BA 5K0TA 1GCAA 1RM0A 1S3IA 1WA5A 2O2SA 4TMKA 5JC8A 2YL2A 4HMQA 1U80A 3KQSA 3KX2A 4N6NA 3LDAA 2XNJA 2WQZA 4FLMA 4DCOA 1TMOA 3GAFA 3V33A 4FFBB 1Z2EA 2IUTA 1JA0A 2BBWA 2CK3A 2PX2A 4IOJA 2ASEA 3IERA 4D42A 3DZ8A 1HH4A 3O95A 5E8JA 4UVIA 4C43A 1R8QA 4J0IA 5EJEA 3WSTA 4RHUA 1VLVA 1O3YA 2MSLA 4UHHA 2BAGA 4JVNA 1E2FA 4ZQFA 2G7MC 2ZSFA 2J9FB 1KTIA 4YCNA 1FYFA 4JX9A 4D3SA 1UBKS 1PQUA 4MS4A 4PYIA 3O4HA 3BFPA 4IJQA 4J7UA 1UFRA 3SR0A 2JA2A 2VAPA 4AYTA 2YKGA 1Y3AA 4HAZA 4JXXA 1XVAA 1XC7A 2Y1XA 3STVA 4BXOA 1YKSA 4OXNA 2BCJQ 2Y1WA 1Z4KA 1XJQA 2PY6A 4F72A 1VE3A 3ROQA 1MB3A 4F4DA 2PQ6A 1QGDA 3DL7A 3OOJA 5A1TA 3JWPA 4L3VA 1GN8A 1XZBA 1H05A 4YAUA 1EZ1A 4Q16A 1YS4A 1V3UA 1KBZA 1AMOA 4DMKA 5F9FA 2Z2JA 3FOCA 3NOQA 4QUBA 1QR2A 3Q12A 1KJ9A 4JIGA 3GYGA 3I6BA 2NG1A 3M33A 3ZJYA 4FYXA 4MYUA 2VVTA 2OCAA 2XX3A 4YK7A 1XHLA 5DHSA 5CEJA 1LBIA 2JGRA 4CKWA 3UXMA 1NI4A 4KN5A 5AMXA 3TRJA 1SVKA 4AKEA 4ESVA 4TYMA 3TD9A 1I7DA 4UMDA 3RV3A 3DMDA 2H29A 1TYBE 2P6OA 2FG6C 2OV1A 1T3ZA 3FBTA 5BN5B 4C7JA 3AG5A 5JRZA 5K8UA 4ZMRA 1G291 4J4TA 1SCJA 2WF6A 1E1KA 4NH4A 2XJ9A 3PRKE 5JSHA 5KZMB 2ZJ4A 4DCTA 1RWQA 4MVJM 2I7VA 4GZLA 2D1QA 3ZYCA 3EZNA 5AXDA 3D8RA 1SAYA 1UZUA 4LFCB 4KITB 1T2UA 1ISSA 4Q47A 1BN7A 1E3WA 3L6RA 1YGYA 4JSYA 4HH1A 2IIQA 4BVLA 2H17A 4DCJA 3IAUA 5HKKA 1KVQA 3RYCB 4H3HB 1JDBC 1P5FA 1PR3A 1VJ0A 3EF1A 1Z29A 1L4BA 3U39A 1I33A 1KQGA 4WEOA 2NM0A 1RPJA 4X1YA 1IHDA 3WGUA 3WG9A 4PRYA 4EY6A 2WJVA 3BXZA 1VMIA 4KOAA 2NPFA 5JXHA 3IE1A 3QE3A 3M2PA 4LXUA 4R2KA 3L0PA 3RYTC 2XPCA 4DA9A 1TF7A 1LLDA 2JLQA 1U7UA 2OQ2A 1WDKA 5IM4F 1P33A 1R0SA 2FQXA 5JCXA 2YHUA 4U9IS 3AH8A 2WUWE 3BRSA 3EZ2A 1GL9B 2ZRBA 1H1DA 2R7MA 4FBGA 4WNAA 5I7EA 2WQ6A 4X85A 5ALKA 2HT1A 2Z43A 1P7CA 2DCMA 2V0NA 3E7FA 5C8ZA 4P34A 2OLJA 1C50A 1XZKA 1E0DA 1FFBA 2V5UA 3QMMA 4YB8A 4AZ0A 4EQ6B 4GP9A 1JHQA 1CUYA 3FR7A 2A0XA 1ZM7A 5KOYA 2PD3A 3A2LA 4U3JA 3SN6A 1ZX1A 5D3QA 3R09A 1JEQB 1TKCA 4H59A 4JA0A 4B35A 2J09A 5FWAA 1XWIA 2XGGA 5KYKA 1U02A 1GRCA 2V6FA 1AY0A 1AGNA 1IAVA 5F1KA 3SFZA 2AFIE 5EIAA 4C6RA 2B1GA 4W6QA 2CNLA 1ONBA 3GFOA 3QUCA 3L07A 1WXQA 1PD1A 2I7CA 1MX5A 2JI6A 1IEQA 5F77A 4TV8B 1ORDA 3V8EA 4YRKA 3CN9A 4HO1X 4RK0A 3ZU3A 1N2HA 4B4DA 1KSHA 2GN1A 1DUSA 2ACWA 3SQDA 3ZXXA 4RYDA 4ROTA 3ABQB 2I1VB 4IEEA 2FOLA 3LFUA 2AOUA 5FPTA 2HM7A 3CUEF 1GPWB 2DY0A 3GFQA 3PB3A 3R3VA 2JCBA 1K0FA 4GXRA 3CH5A 1O5IA 3N0WA 4Q3BA 3ZV3A 2JFWA 2G6TA 4EB3A 4B32A 1GPKA 4BVKA 3A0RB 5DMXA 3P0IA 4TS4A 3KQMA 5CVUA 1KI8A 3FUWA 1KYXA 3A25A 4O5OA 1OZ0A 3ZQJA 4MI6A 2ZUCA 2XTNA 3M4ZA 1ECPA 4BMXA 5KREA 1NBME 4KLCA 5J1TB 5HKBA 5C53B 2O8BA 1UF9A 3DXZA 5G53C 1XXHE 3VUFA 5HRAA 1C9JA 1ESDA 1HKHA 2P90A 3A4NA 3DKVA 4J0KA 3W8EA 1ATIA 5GGYA 3AR7A 1NP6A 7REQB 4JX8A 1HQCA 1Z5GA 1XTIA 3P9QA 5FRDA 4QUJA 1IM2A 4WLNA 3WAKA 2QD1A 3CVYA 2FZGA 4BLOA 1Z39A 2AE2A 4Y0NA 1TCUA 1H4SA 1ZGGA 1M2VB 5FO1A 1P7WA 3WMRA 4DUPA 1ZUNA 4LHVA 5CJPA 5H80A 3UMVA 3UT5B 4I7EA 2OILA 4JVSB 3BWBA 3SJUA 3QLEA 4G4SP 4JL6A 2BFFB 1NIPA 1T1EA 1FMFA 3DD5A 3ZWDA 4I4TA 4A3SA 4C4AA 3OZXA 4H3VA 2W4MA 1RAIA 2XB6A 3L7IA 3NC0C 4INOA 1WG8A 3OSZA 4AUKA 5DOZA 2C9DA 2J0EA 1J33A 1LNZA 3VJRA 2UVPA 3A28A 2C82A 3MWDA 1WZCA 2WJJA 2XMCA 3IEPA 4HQFA 1M8KA 3TOSA 2VH5R 3DFZA 2R8OA 1H42A 4ZQGA 2QROA 5E7JA 3C5WP 3SS9X 4EF6A 5FNVA 4LS3A 2KLBA 4IG4A 4NU8X 2B35A 1U7PA 2DWQA 5DX1A 1LTKA 4P3NA 3BGWA 4DMMA 1JDSA 1R4NB 5L8VA 1DTEA 2P41A 2FFJA 1GCUA 3I28A 5IC5A 4HZUB 1WP9A 4ZTBA 1GAQA 2QLBA 1AQUA 2YUIA 3G13A 1Z17A 3MLBA 5DBHX 4CLHA 1WQ4A 4WA7A 3E3AA 4MRPA 5I47A 3KQHA 4BAGA 3L0OA 1UBRS 1L5FA 5EZ6B 3T5BA 4DG8A 1IN1A 1EWTA 3DEIA 4MUBA 3PKZA 4P22A 2JAOA 4BMCA 1R18A 1RVDA 1V5EA 1GKUB 2C99A 2D3WA 3H5IA 4QEDA 4Z7QB 5C5DA 4F4FA 4K9SA 2FQ1A 4C7BA 3G82C 2X2OA 3N2LA 4LSMA 2X19A 3CW8X 3BJEA 2X5KO 3C3BA 4J9VA 3X2SA 4G36A 1G0NA 1YB7A 3A1EA 3K9CA 5B6JA 4ADSG 2LIPA 2WYHA 2HCTA 5BW6B 3ZJTA 2X4GA 3JU3A 1T5TA 3BFVA 5A5EA 5B53A 4D0SA 1R8JA 3DL2A 3O9MA 1XDZA 2AX3A 2MIIA 3OQJA 1J56A 1GGVA 4RH1A 4H7IA 5DM1A 1DDGA 4IUDS 5GTDA 2QAIA 3MGKA 2A5DA 3LAWA 3UANA 1WY7A 4DB2A 1IZYA 1CUBA 2O3TA 1M7HA 1NRWA 2VT6A 3PUWA 4EF4A 4F3CA 4ZAFA 1QPZA 5GIPE 4HJXA 2VJLA 4GVLA 2XMGA 3U4IA 2Q3MA 1J97A 3D3WB 1N4AA 3B6ZA 4MVWA 4HWOA 5HK9A 1V6SA 1X9GA 4UHEA 4YCDA 1JDUA 4FZ5A 3KVOA 5JU6A 1T0IA 2P6NA 1X7DA 5REQB 4D02A 4LJ6A 4RLSA 1NRJB 1QKKA 2AVDA 5FOTA 1KPIA 3SAJA 1GU0A 3PZBA 2PDAA 3VPHA 3WBKA 2IUYA 3AB8A 3QOWA 3EGDB 4RCVA 3EBPA 4MOWA 2J5KA 2Y6UA 1WO8A 2PTHA 3HV2A 2PX5A 3KIPA 5HMMA 4WERA 4A7PA 4DQDA 4NZPA 3QPCA 3I09A 1YAHA 4CHTA 3KSZO 1B0PA 2VA8A 1WETA 1ESMA 1ONPA 2XHZA 1DO0A 2GJ8A 3AINA 2JPDA 1BOOA 1VE1A 2GXSA 4U7HA 3LWZA 4D96A 1WABA 2C2WA 2IITA 4ZQCB 2VSNA 2AD5A 3VHXB 3LYHA 3GLFE 1HZZA 2ZBPA 1I4OA 4Q15A 3C5HA 4IX9A 2NU8A 1NQOA 4JI3B 4O1MA 1D2HA 4L8VA 4N8SA 1DIGA 1ZIYA 2PRKA 4HLCA 3IHWA 1CTQA 4OCZA 1U3TA 5ALVA 1LDNA 3ACCA 2FK7A 3MJSA 3JQ7B 3W5AA 3BF8A 3MBIA 1XTPA 1A8SA 4NI5A 1RXWA 1QHHA 3FGZA 3A6PC 1XFDA 4B73A 4M88A 4QLAA 2PQMA 2ODNA 1D1QA 2ZIWB 4LY3A 4P7FA 4CLRA 1CIJA 4X8LA 2JI4A 2VPYA 1ZM9A 2C5GA 3SHVA 5HFJA 4RPIA 2E55A 3LLCA 3QU2A 1ADCA 1U4OA 1XJ0A 2M1XA 2RC5A 4KW7A 4WKNA 1CYEA 1YOBA 1OH7A 4IZOA 1U2QA 2GVZC 1E9EA 2WJAA 2XAAA 4QOGA 2MYUA 4PPGA 1Q2UA 2J3IA 1EX7A 2PGJA 2QTZA 3RUHA 4EFDA 2CB9A 3EZLA 3ZBTA 3RGGA 1Y3FE 5DYGA 3L8YA 3PA8A 4MROA 1YZQA 2XBUA 4MX8A 3PEYA 3BWYA 3H3JA 2A30A 2CL7X 2ZB2A 2N0SA 3NJ4A 4M6WA 5HBGA 4G81A 1RXIA 3BIXA 3II6X 5CNKA 4DIEA 2DXIA 4RS4A 4BKRA 4GPAA 4OLHA 4G56A 4XJVA 1Q6YA 1K8QA 5IMBA 1ZSNA 3OZ7A 5IEJA 2WP8J 1NONA 1PIWA 2BJVA 4KO2S 1N6LA 5JRDS 3JWHA 4C01A 1IVSA 1QAOA 4FUTA 2GD1O 2XUQA 4TKMA 1PT5A 2FSGA 2ZYWX 3D54D 4FHFA 3QSYA 3M9LA 3R0JA 5F3WB 5EZ5A 4MHSA 5IXSA 3SF8A 4C6TB 3VC3A 2QGFA 3HADA 4R1OA 3CZ4A 1XZMA 3O7WA 3GMSA 2H3EA 2V3WA 3C7DB 2XVAA 3VPGA 2J0UB 3AIMA 3MTDA 3BPSA 4R5HA 3H87A 3QA3E 5JARA 3U4MA 4DV5B 1RQNA 2CJXA 3IKMB 4IL5A 4LHSA 1TT7A 1UXKA 1FA9A 5DBGA 3RJZA 4IZIA 3T7AA 5JS6A 3UZUA 2PBFA 3O84A 4L4RA 2CLEB 2XBLA 3O26A 1EBUA 1H3FA 2J3JA 1J2JA 3EIFA 3H1TA 4Y1GA 3ZCUA 1DCTA 5DHTA 1US8A 4I14A 3FTFA 1O6FA 1K8RA 3VBEA 4AO8A 4CM3A 2CNKA 2HRZA 3EVAA 3I32A 3KE8A 5F4ZA 1EWQA 2VXYA 3DOEA 4JSTA 4PYLA 3EIEA 1VHTA 1NF8A 2C2BA 2REQB 3QHQA 4HWGA 4BE7B 4DCGA 1EFHA 1R00A 4CN9A 5BORA 3EAQA 1UBSB 3D4OA 3OX2A 3SLRA 3H9UA 3I4FA 4ND8B 2HPVA 2JBAB 3PQ6A 2F9MA 1SCBA 1K7CA 1ZEJA 5FA5A 1Q0PA 2GK7A 1P8JA 1YSCA 2AG6A 3D4IA 5AXAA 4CQJA 5B64A 1BGWA 3Q15C 4P4SA 1COZA 1ZONA 3EQ6A 3PTZA 1F3LA 3FOZA 3PHCA 2C9CA 4DKJA 1WY5A 1DI0A 3HLTA 3N9IA 4JBXA 2X1VA 1JFRA 4UNRA 3WOVA 3CUKA 5JNTA 1NKSA 3F3MA 3FH0A 4AF6A 1E5DA 1QYWA 1T1GA 4LNHA 3T38A 5E7MA 2GHRA 1A3CA 2WUVA 3W5SA 2H0QA 1EUDB 4D8UA 4QGHA 4HZGA 2IQIA 2R6CA 1J9EA 5MDHA 4QJ4A 3LS2A 3AFIA 4JDUA 1QE0A 1II9A 2RHLA 2W98A 4CMGA 3WWYA 1I7SB 1GQRA 2Z8ZA 1KO7A 1MHPA 4CW7A 1GADO 2ZBEA 3I4CA 4EJ6A 1I1HA 3GFFA 3L4KA 4DR7B 4YR7A 2Q2WA 2RKBA 4C14A 4PBTA 4ZYLA 1P0CA 2PCLA 3AVUA 5LOVF 3DQZA 1OJLA 1XDDA 3QBVA 3VHLB 1C29B 3KXDA 1M74A 1MOZA 2R7NA 4X45A 1E9CA 2GHIA 1L3IA 4A0GA 5ALXA 5BQ5A 2ZB7A 3TZBA 2WIKA 5CU7A 5BOVA 3G1TA 1HYBA 2H00A 4ALJA 2DUWA 2HA5A 1EJ6A 1S8AA 2VF7A 1FX1A 2ZJZA 3G5UA 3TQQA 3B9RA 3F6YA 1G5TA 4ZARA 2D5LA 2NU7B 2YVAA 2OAEA 4OUDB 4HKTA 1A7AA 4L57A 2PU5A 3C1UA 5AO9A 3WZLA 1TX4B 5DCWA 4YWJA 4TZ6A 2A94A 1NW5A 3I5YA 3SJZA 4O2AB 4JL5A 1D2AA 3PQ8A 1IVNA 4P9NA 4W5WA 2IF0A 4FYYA 1AC5A 5CJJA 5IT5A 3KETA 1WLYA 4G0PA 4R3NA 3RTBA 1J8MF 1RTTA 3V8BA 2BGKA 4ZVOA 1OAKA 3VR6A 3O94A 4QIHA 1SWVA 1IOWA 1FCJA 1Z6QA 1JE1A 2VSYA 3CEPB 3RC3A 3UMRA 1RXVA 4Q7EA 4IFIA 5KNBD 3I05A 4ER0A 1Z0ZA 4JLSA 1N0WA 3QIVA 4PFJA 4FXOA 3UA4A 3D0KA 3VZPA 3X1DA 1EX6A 1V7ZA 1L7BA 4G5OA 4WBNB 3DBOB 1JDZA 2W2MA 4ZFNA 4YR9A 3L1VA 5TS2A 4ZCSA 4DYDA 2ZEJA 4G65A 1SKMA 2X1HA 1B2RA 2IRWA 3WKCA 2O2EA 3CVJA 4JWTA 4M0LA 2FFQA 4L5AA 3K5HA 4JLVA 4D9IA 4BS9A 5JTTA 4IHQA 1XZLA 4YI5A 1M6YA 1CJSA 2PAAA 4MR8B 2ZREA 4Z9FA 3K71B 1U1CA 3MM4A 3T3IA 5I9LA 1XRLA 3CVUA 4UXIA 3TD6A 4DNXA 1O95D 1SURA 1QS0B 3P2YA 2FW8A 3Q5EA 5L3VA 1J20A 2C3YA 4D92A 1QG4A 2H51A 1IUNA 1UC9A 2Q3LA 4HWRA 3QU4A 4AK9A 5A3SA 3VV3A 3BE4A 5HQ3B 2G28A 4Q9NA 2DH6A 4PCUA 5KIAA 3G2OA 3PQFA 4GVXA 5ALNA 1Q1NA 1VYUA 2J30A 2XMRA 4CCSA 2ZM5A 1YE3A 4MPJA 1VRVA 4JFAA 5EP1A 3O4JA 4H0NA 1XQ9A 2B4AA 3K9GA 3V4RA 3AI7A 2YC4C 4C21A 5ALWA 4DGQA 1E62A 3D7KA 3C5EA 3NBAA 1DGQA 3CONA 3NATA 1YT5A 4HH0A 1MN6A 3PRJA 4CLXA 3UT0A 3ZNQA 1G8YA 4TTIA 3SYRA 3PNPA 3MG9A 1JKJB 1QIJA 1Z7EA 2FSVA 1E2JA 4WZ6A 1AKNA 2WHYA 1V5IA 3VU9A 1T4DA 2HA3A 2W8BB 2H2WA 2BONA 4LZAA 4HEHA 2Q1YA 2WVHA 3RQIA 2PANA 2QVYX 3A6JA 1GUBA 4GYKA 5UKDA 2GUGA 4BV8A 1CIVA 3BGDA 4HGQA 5BMVA 1QK3A 1X1EA 1I4WA 1Q1BA 4HJRA 4DUGD 4JOCA 4JBYA 2XEXA 3T3GA 1ODLA 4DV4B 3ZZ0A 5TXGA 1SCKA 4X61A 3UH1A 5DOVA 5JQWA 3WHKA 2AOXA 4B6OA 4CTOA 4H7HA 1ZWLA 3OE5A 4P35A 2YMQA 1THGA 4PBSA 2ANCA 2P2GA 4HLUA 4XOUA 1TJ4A 2DWCA 2QN3A 4ZT7A 4WZAB 3UAYA 4F5ZA 2G9ZA 2VOEA 1XPOA 2GAAA 3DS8A 1QRDA 1DIOB 2GTIA 3SX0A 1EP1B 3K9BA 3GUUA 4YLEA 1LS6A 4D82A 3DM5A 2IYXA 1FNNA 3QYPA 2II6A 2MSDB 5SZKB 1KI4A 1CJKC 2NUAB 4PRKA 4WGFA 4BKUA 1OC4A 4DCUA 4GKJB 3ORRA 4NS1A 2EFCB 3RVNA 3GEBA 2DFTA 4M9QA 4EA8A 2E9SA 1VKNA 1B74A 2ZWVA 3WWOA 3VR0A 1YFKA 1XWWA 2ZSAA 4D4JA 3L6EA 2HSGA 1JILA 1N9GA 4RANA 2G88A 3M4JA 4HFMA 1DBIA 3I23A 4PYNA 1UEXC 4MYHA 1DBRA 5EJ6A 2VF4X 4R0VA 4GHWA 2BGMA 5GVSA 4QYWA 4AZTA 4MUFA 3LHFA 4ER7A 2I9PA 2QM7A 4NMHA 5LLDA 1V5GA 1EFRA 2I87A 3NPMA 1YQ9A 5IW8A 3ZHUA 1LI5A 2IZOA 4OQFA 1GQOA 2QMYA 1WHSB 2YJ6A 1CDZA 4E51A 2OM2A 3LOUA 3TB4A 4Q3OA 3FBGA 4TRNA 2XDQA 5KPDA 4JHLA 3BGVA 3DMHA 3C3EA 1P18A 2ACKA 2YHIB 1JIVA 1PQWA 3EC2A 1JAYA 4O4IB 1NV8A 4KR6A 3GVHA 5TEWA 1X15A 1CRWG 4IQ4A 3JQ6A 4QYTA 4PO8A 4PZAA 2TECE 2C7VA 1Z5NA 3MOIA 4ARCA 2P9YA 1RLJA 1BDBA 1TK2A 4MCIA 1OROA 4FNGA 3OJ0A 4Q02A 4CIDA 5G1OA 3KZXA 3OLCX 4QG7A 4JYCA 3IJPA 4RJIA 4YCJA 4G86A 1ZMBA 3SZOA 4F3YA 3BD9A 1P2VA 2Y2UA 4KXUA 1SHTX 1O2DA 1CBUA 1LZKA 2OENG 2Y1OA 2DSNA 4TYPA 4BVAA 3H6GA 5D3ZA 1VIYA 2QDXA 2JI7A 2G36A 3CTMA 3G6WA 3NXKA 5C8YA 3RTCA 3TIVA 4CU2A 1Z5VA 5KTSA 5DM2A 4JVMA 2O8DB 1ZJ4A 5CB4B 2IOFK 2Z4RA 4DDWA 4QJBA 4QFCA 1JFLA 2I55A 1Q1ZA 2DPXA 2CUZA 4PCLA 4PR0A 4NYIR 3RAJA 4EA9A 1MC5A 3ASZA 3N2KA 5JI2E 5KINB 5FA8A 4F0JA 3R5XA 2JK0A 1H2RS 1E59A 4A4DA 3PRYA 3HKDB 3CEAA 4DDHA 1Z73A 1L7QA 2VAWA 4JK3A 2OGZA 4MKFA 2ZYRA 3WLLA 1PYOA 1NHGA 1QZUA 2J6CA 4AZVA 4FZ3A 2AH5A 4C05A 2FWRA 3VYRB 3PE6A 3IEUA 2ZKIA 2ZP1A 3RTEA 1JU3A 3OAAA 1VI2A 1YD7A 4MCAA 3GGGA 2G1AA 5DRTA 1J5EB 3N7TA 2JLWA 1L1QA 1VL1A 1R1DA 2DFDA 1N6OA 3F8TA 4KX5A 5AVRA 1Y3CE 1PT8A 1A27A 2GARA 2ZYSA 1KSJA 1Q0LA 1ZIPA 3D1LA 3G9UA 4ZOAA 2P6RA 1K4KA 4XEUA 3JARA 1NMYA 2R6R1 2AR9A 1MABA 2Y76A 2QIOA 2XYRA 2YHSA 3NBYC 4RAQA 1Y63A 3ZDZB 2QTAA 3P7MA 4YP6A 3ZDXB 4BEVA 1IJFA 1NRXA 2VAMA 5JPIA 1I7PA 5FL7D 2R1TB 2RDMA 3WQRA 1HDGO 2BFWA 3C1TA 2ZG6A 1GP2A 4UTRA 2WJHA 3ZDEA 1FNSA 2V7PA 2A0FA 1MENA 3GRYA 3JZDA 2EF1A 3FMVA 1R66A 3PI6A 4NOLA 3USCS 3A1VA 1EFDN 1PS9A 1UKYA 2GPYA 3E9CA 1J8VA 3IMKA 4LMAA 4LY9A 2ZJYA 4MQMA 4MVJP 1PFGA 1UKVY 2XODA 3QW4B 3RRYA 3W05A 3TIXB 4V1CB 5I7FA 3HNPA 4C0HA 3TFOA 2JLAA 5CP8A 3Q9UA 4R81A 1VB5A 1NMSA 1CPYA 1RJFA 4WY5A 2DLCX 2HHJA 4DYHA 3K9NA 2QVBA 4UEJA 3L7MA 5ALTA 1H5UA 4KYIB 3K9FC 1SO8A 4IDAA 3PJGA 3GA5A 2WPDD 1DBPA 2BEVB 4DNQA 5BW8A 1YHNA 4YP5A 2FDCA 2F6RA 1VRWA 5C18A 3DB1A 4UKDA 1A2OA 1WAMA 1N0UA 2OYRA 4AS2A 1ECJA 3HJNA 2L19A 1X1QA 2B4RO 1NXOA 1Y7IA 2IY8A 2VKQA 4WJLA 3NT5A 1FFAA 5JYEA 2ZTHA 3JZAA 3RYHA 3QI7A 4HH4A 4ON9A 3IBCA 3W5JA 1ZK0A 1T8TA 3W5IA 1FTSA 3R7SA 3K1JA 2HNAA 2Z3WA 1NVUQ 3B38A 1KI7A 1QOZA 1QNFA 3EVCA 4FCTA 1WB6A 3V7YA 4MUHA 821PA 2ZJ2A 3AJ8A 5LKAA 3BQ9A 4N4AA 3AX6A 3OIFA 1DX9A 2Q5LA 4DR1B 1SULA 4YPFA 1KYWA 5HA5A 4MV9A 3HN6A 3TL3A 2JGJA 4CG1A 1DLIA 1RLTA 1UBCA 5JDIC 2BM9A 1XTSA 5IBRA 3UAVA 3W2IA 3ZV6A 3K0AA 3OTWA 5E3HA 4EW3A 4AQYB 2VSXA 4LXYA 2PWPA 3E9DA 4EITA 5C7OO 2HA6A 1J2RA 2AOTB 1GKLA 5ALYA 4G5QA 3RT1A 4BCBA 2I65A 2W2QA 3Q6IA 3EA5A 4DVGA 6CHYA 5JV5A 3L0BA 1QO9A 4YLYA 3WWZA 2YIDA 5CX1B 4S1VA 3H6KA 3MMSA 1YC2A 3QELA 3QKIA 2O8EA 3BGSA 3ZHYA 1Z12A 3HVRA 1GFWA 3GP8A 1QM5A 1VGVA 4K46A 3RE1A 2FR8C 4EPWA 3FMPB 3NONA 5L4NA 1SR8A 3WK7A 3O3OB 2C04A 1K5HA 1MLDA 4XIJA 2G9VA 2IH5A 1TJ5A 3ABIA 2QYTA 2RG1A 1G38A 5LR6A 1NATA 1QCZA 4UHCA 5KOHA 3GJ8A 1EK1A 2P75A 3HSKA 5B7NA 1NJ5A 1ZSYA 3UG6A 4G67A 5ALLA 4Z1MA 5I8PA 4L75A 1B42A 3FSRA 1HY3A 1Q7CA 2OWEA 3CLSC 2GZDA 2X8WA 3C15C 4S12A 4N5MA 4B3JA 2XYPA 3FYCA 2FWIA 4XD7D 4H6XA 1Z7YA 5ALUA 3OC6A 4GWGA 4ZVSA 5IAGA 2LCQA 3QBJA 3SEZA 3G1UA 5HJ7A 3DDHA 2X9GA 3IRUA 2KW5A 3ICOA 3K1AA 1D5WA 3ZHOA 1FP4A 4TKVA 4AY2A 3B7WA 3ZHVA 4OH1A 3AB7A 1GG8A 2HY7A 5CVJA 1RC8A 3QSGA 2PR2A 4TS1A 2HMSA 5JZ9A 2FXIA 2XE8A 4TSFA 1Y3IA 4G0UA 3UGKA 1P2SA 2VNKA 2LRHA 3PX7A 2ON6A 4RV9A 1UWCA 5DCUA 2FOIA 3F1LA 5CLLA 4MITA 2WG2A 4I4TF 4BLQA 1ES9A 1GRRA 4AX8A 1DADA 3MT7A 4MR9B 2Q9CA 1OLOA 1N5MA 3LUBA 4I6GA 2BFNA 1JT9A 3F6BX 3CIOA 4MYCA 2J7PD 3TTYA 4EO9A 3WRVA 2RI6A 1RWPA 4B8WA 4OU4A 4CTKA 4AQDA 4ZVKA 2QN6A 4TTSA 3VPAA 4F71A 4B6PA 4GWLA 5FNVF 5IXJA 1P2GA 4QGBA 4CUKA 2LP4Y 1D2CA 2DH5A 4MV1A 3DLIA 5A1JA 3QLTA 2WHPB 3BRCA 2R1VB 3GVXA 2CYCA 3U62A 4AX4A 5LU9A 4KVGA 2ZYTX 4G1MB 2EBWA 4DLXA 4IIXA 1YS7A 1M83A 1KVUA 4ZZ3A 4LOIA 3PGA1 4K88A 1CY0A 3IODA 4UOZA 4EUSA 4MH0R 2Q5EA 3KYCA 3WIBA 2XTMA 3HJTA 3QVSA 4XCXA 3DZBA 3BFXA 1E1QA 3CPHA 5ILOA 5BR1A 2OBNA 4M60A 1KC1A 4ZOEA 1T15A 2YYAA 4K6KA 4K03A 2QMQA 1T9HA 1FTWA 4LN1A 4H7EA 2WSBA 3QX7A 5ALDA 3W90A 4PCAA 5CCDA 5M3BA 2GJAA 4P5EA 4CM9D 4U2DA 1SBQA 2HSDA 5K20A 2YJNA 1MH9A 4AUMA 10MHA 2A0YA 3NHJA 5DK4A 5EP4A 4GECA 4B3GA 4Q1EA 3EIUA 1SZCA 4RU1A 3WGOA 2AEEA 4U2BA 2X8AA 5FLEX 3BXEA 3M9XA 3NEYA 3THXB 2OLKA 3IP6A 3M0EA 4HS4A 2HK8A 4M1ZA 3ICCA 3EZXA 4UEQA 1BDHA 4LAFA 4X94A 3WMFA 2VXCA 2HFJA 1E2IA 1E58A 2ZI7A 1V6CA 5JZMA 1M2GA 4YI3A 4GR4A 2YWJA 3PQ7A 1V16B 3VH2A 4PFKA 4BMOB 4D45A 2WIBA 4MVJD 2HPZA 1EP3B 4KJZA 4XDHA 2FVXA 2LVBA 5EMJA 5IKEA 1QMGA 2BYTA 3FRHA 4IMJB 3Q2IA 1F0YA 2YWFA 1EVEA 1S2OA 3AI2A 3CMCO 3E23A 3IPLA 1P17A 2CBGA 3A3PA 3HQ4O 1P73A 4ILEA 4UFOA 4DMGA 2I29A 3N28A 1G6KA 2IXTA 1GT6A 3SYLA 3QWFA 1RZRD 4OAPA 2VEOA 2PE5A 2XT9A 1I80A 3HJGA 3OCWA 1XTRA 2WJIA 4MW5A 4U2CA 5TQ2B 3WC4A 3I2IA 1R0ZA 1P8AA 1BD3A 3GT7A 4RIGA 4UU7A 1ODIA 2FAXA 1G2PA 3QVGB 4Q3KA 1AMNA 3DAFA 1T26A 1TTHA 4GPZA 4HX5A 4CUZA 8ATCA 1Y7TA 2AFHA 3I52A 4LBZA 4WNYA 3F78A 4WFIA 3ORHA 2FZEA 5U9CA 1C41A 4NFHA 4TRRA 2XW6A 3G2HA 3O75A 1DKNA 4Q01A 3V8QA 4YGXB 3ME5A 5IVKA 4H0FA 4WH0A 4B4WA 1ZCBA 4H3KB 1RR6A 5DW0A 2WWGA 3Q10A 5I51A 3CUSA 5ALIA 5IABA 1L4KA 1LSUA 2G0NA 3RC7A 5A4KA 4R1QA 4IIDA 4QPNA 4B34A 1KMCA 4FPXA 4YACA 1F51E 3K2QA 1PUJA 4FGWA 2CGEA 1IULA 2YJ5A 4KBYA 3VAYA 4Z1OA 1QHFA 4TXLA 4NYJR 2XH8A 4XH9B 4LNUB 1A71A 3WB9A 1IY8A 5GZ1A 3GJ4A 5FOUA 5KMGB 5J3JA 4JZYA 5K51A 1SQ5A 4EZIA 1MB0A 4RHTA 1MAHA 3TLGB 4XUCA 4XR4A 4YRQA 5HE8A 3ZKWA 3VOBA 4BNUA 2Q62A 3R4CA 4E2XA 1ZZGA 4RF3A 1EA5A 3QLVA 3UK1A 2JLVA 5KSZA 1JBQA 2XCQA 1WJGA 2GBLC 3PFIA 1QONA 4V0SA 1GPAA 1RXSA 1WXWA 1ZGCA 3OZBA 4BO7A 3S68A 4TTPA 5ARBA 1IUPA 5DNEA 3K70B 2BFCB 1PGPA 3BMQB 3U3MA 3HRHA 2Z0MA 4BNTA 4ZHQA 2PZLA 1U6KA 5ALMA 1Y5RA 3ICPA 3O1HB 5EXXA 2PXCA 2BKLA 2P2ZA 2CBXA 1BS9A 1MEEA 2JFFA 2X9LA 4I50A 1IBSA 1YTLA 1NW9B 3B2NA 3RS4A 4E5MA 1SOVA 5H9WA 4U7TB 2P35A 1V35A 1JDPA 5A7GA 4ZAGA 3ZHTA 3THYB 3GJ3A 2VPQA 4TLEA 3G5MA 1GYPA 4MUAA 4WL0A 3KZ1E 2FUG6 2XA9A 4YJ2B 721PA 2FW1A 2J9ZB 3I73A 4FK8A 1XMOB 4OFXA 4ER5A 1ZXLA 3R5TA 2V9PA 2WD7B 3FLMA 5ALRA 1PFWA 5COAA 2W58A 3OZGA 3BRQA 4I08A 4XIIA 2C2HA 3VC1A 3GGOA 4GQBA 3M7IA 1QO0A 2RSLA 4JU9A 4TQ9A 5P21A 3UWKA 3IEMA 1M6NA 2DT5A 3RNLA 1ZINA 2OAGA 3D6UA 2C7PA 5HF9A 2AI3A 2AZMA 4M99A 1A9SA 4QICA 3RODA 3LUAA 4EKNB 4ZAYA 2CHGA 4N7BA 1EFPB 1DAEA 1FP1D 1Z68A 2RMKA 4X8MA 4FM9A 3GJZA 2EARA 3UG7A 4TX1A 4ZAZA 1CVRA 3IMEA 5HJ5A 1E77A 2Y1DA 1EDBA 5IAJA 1FE8A 3IUJA 1W75A 3GVCA 1BOFA 1G5IA 4B76A 4PLGA 5JNRA 3HM9A 3LQFA 5ELXA 2DYKA 4BFWA 4B81A 1P0QA 3CX8A 3PXCX 4KX3A 5J4HA 3Q0IA 3JD0A 4LQCA 4CKXA 2E85A 2P2YA 2UUPA 3HGQA 2P4HX 4FOLA 4IJMA 4CEHB 2AKYA 3OUTA 4UREA 4KXMA 4KUGA 5CYGA 1B6GA 3EVEA 1GWNA 3I83A 2VBCA 3FPAA 4BQSA 4DEXA 5D01A 1G59A 3G23A 3A9RA 3M6VA 4OQZA 1WBDA 4PC6A 1Q19A 3WLPA 1G16A 3P45A 2QJFA 1SOAA 1G4AE 2DUMA 4P80A 4CKYA 5CXQA 3RF7A 5AUQA 2BRUC 1M54A 4NYMQ 1SUBA 4IHAA 4YP0A 2YXEA 4RLFA 4YV1A 4KPFC 4JGBA 1BKYA 3HJCA 4L9SA 3LY5A 2JA1A 2OP0A 4BV2A 3A7EA 4IKPA 5KTNA 3NOOA 5KSPA 5IKPA 3PFCA 1P1BA 4C30A 1DSSG 1LFDB 1OYOA 5BWLA 4V0RA 1ZO8A 2EW1A 3FDIA 4ZOLA 2LV8A 4BN4A 1G63A 1F2UB 2JBHA 1X1RA 5IH3A 2ZSHA 3FCYA 1NM5A 2WKPA 3NYWA 4RGBA 2XD4A 2FWPA 4GH5A 3WLMA 4H1WA 1HG1A 5H3CA 3RRJA 2QRGA 2I6SA 1AQIA 1JBKA 1D6MA 5JSKA 1YQUA 5AKYA 1BMDA 2NNWB 3AP1A 3F5QA 5EMMA 1JI0A 4KQMA 1KKLA 1IDN1 1W0CA 1H2EA 3VKVA 1KMMA 3W7VA 4N40A 3UAWA 1Y7PA 3AWDA 1FRZA 4U7DA 3VH3A 5BRAA 3TAHA 1XP5A 1C3OB 2EX4A 2Q7OE 4BJ5A 4M1QA 4QTYA 2EFJA 5DNUA 4WIAA 3WLAA 1HE5A 7ADHA 3JQQA 1Z6AA 4HQLA 3RS5A 1QCYA 2W6PA 2OPBA 3S7ZA 4MR7A 1ORVA 3JASA 1D2RA 3EARA 3LQKA 3OKPA 4ZRNA 4GVPA 3HV0A 4WUTA 2YXDA 2JFVA 1G7CA 2WA2A 4N12A 4EI2A 1FUIA 3GRCA 4LZWA 5FHQA 4BRZA 4X7MA 4LUCA 3FJOA 2ZSUA 4GBGA 4NBTA 2E5LB 3IDZA 2Y9YA 3TE6A 3KQUA 1KQPA 3MIZA 4ZEXA 2QSUA 4UFPA 1M2FA 3ELWA 1FRFS 1EFVB 1NBOA 2XUPA 2I8AA 3HFSA 1GNRA 2I2DA 3HRKA 1NMXA 7MDHA 5G0UA 5KOJB 1ATZA 4KO1S 1XZ8A 2H9IA 4CM7A 1JEOA 1RYFA 4FIZA 1M0EA 4BDTA 3GLQA 2NUBA 4DV7B 1IHPA 2QP3A 4DV3B 1W94A 1AX9A 4A91A 1D4AA 2X2FA 3CUWA 4YT8A 3RIHA 3SYKA 1VIAA 4BFUA 2MOKA 3ZI4A 1D6JA 1Z2OX 2HIAA 4BECA 3O4VA 1BQ3A 2M2IA 5SY9A 3AM1A 4KUHA 1LD3A 1NBIA 2AN1A 4RY2A 4RQTA 1ZEMA 1OB5A 1HDZA 5FUVA 3HPQA 4MAAA 2B6NA 1B7GO 1VJRA 1QDUA 2SHKA 4HLNA 4IDBA 3ZX5A 3U1BA 5JFGA 4W5JA 3BSFA 1OTXA 2Q3FA 3ZGVA 1NPYA 5KPJA 3E48A 1UWKA 2YV4A 4X6UA 1ZJ5A 4JBIA 3HBJA 4MLPA 1GPBA 1NI3A 2XTAA 2OAQ1 3GHHA 3DMTA 4CCWA 3SPXA 2NTEA 1GCOA 1SQSA 5FQNA 2B5WA 3GLHB 3FLEA