1M75A

Crystal structure of the n208s mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVSRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Crystal Structure of the N208S Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
source organism Homo sapiens
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m75A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m75A01
1QLHA 1E0DA 2FPGA 4WKGA 4GX2A 1CYDA 2WSBA 3EYWA 1EK6A 3JTMA 4Z9FA 3WSWA 1G0NA 2VCYA 4GX1A 5B4TA 1DOHA 3C7DB 4L4RA 2LDBA 3PHJA 4FC7A 2Y1GA 3FNEA 1WZEA 3MOIA 2G1UA 2X6TA 4RLHA 4LVUA 1K0UA 2OP1A 3ONDA 4CUJA 2G82A 4IY1A 4M1QA 3ZWPA 4WEQA 5L53A 1ZEMA 2ZCUA 4P4LA 4U5QA 4OSOA 5EQFA 3ZU4A 4WLFA 2PA3A 4Y6PA 2Z1MA 5ENVA 3UCXA 5DBFA 4WCFB 3EVTA 4RV9A 3BA1A 2UAGA 1LLQA 3NJ8A 2HMVA 3PHHA 3KV3O 3KM0A 3OIDA 2ZTLA 3X2FA 3OICA 4PGFA 2VT2A 2RCYA 4L4XA 4DBVO 1DRUA 4I08A 3ZW9A 2HMTA 2J3JA 1F14A 4D45A 3COSA 3DFUA 1LDBA 3RBVA 3WFJA 4HBGA 1P45A 4PLGA 4AL4A 4E2ZA 3ADPA 5G0WA 2C07A 1F8GA 2E49A 3JQBA 5FI3A 3RASA 2RH8A 1HDOA 2OGUA 4EITA 1BSVA 3RUFA 2W98A 3DBLB 5CAEA 2PNFA 1SB9A 3EAGA 5BSGA 3DB2A 2CVQA 3MWEB 2ZYAA 3W1VA 4XRRA 3L07A 4U6SA 4A27A 3V2HA 3DZFA 4B3JA 1VC2A 5MGBA 5MDHA 1O6ZA 4PZEA 2HAEA 1EUZA 5TSDA 1Y8RA 4YVFA 4J0EA 5BT9A 5KJ1A 3WS7A 2V6MA 1V8BA 5F3RA 3CMMA 4OXKA 3FR7A 4XDZA 2VWQA 1GCUA 3JQEA 3OMLA 4A2CA 1D8AA 1GEEA 2ZK7A 1X0VA 3ZNQA 2YV2A 4WLUA 1P1IA 3JQ9C 4BIIA 4XKJA 3AM4A 3EVNA 2HDHA 2VZ0A 4OMUA 1PQWA 2WEKA 2XAAA 4JCOA 3RWBA 1QYWA 3C7AA 3H6KA 2B5WA 3NJ4A 3IUPA 4DYDA 3QWFA 3NAQA 3VH3A 1NM5A 4IDEA 2C29D 1UAGA 4AJ1A 3D3EA 5ER9A 4BMVA 1PIWA 3AUUA 2TMDA 1ONOA 4OSPA 3E03A 3IL2A 1I5RA 2HMSA 3V8BA 3BTOA 4L9RA 3A06A 3PVZA 3GDFA 2IRWA 3I52A 3PEFA 4NBTA 2VRBA 1QORA 4BNNA 4P38A 1YVEI 3D5QA 5IG2A 4J9UE 3BMNB 4CQLA 1DEHA 1Q7BA 4DLLA 2Q50A 1R15A 3NTOA 4ZD6A 5TJ9A 4C7JA 5GY7A 4J2OA 4AJ4A 3QVTA 2X58A 5HTOA 5F1KA 4B8ZA 1GR0A 1M76A 1IUKA 2BKAA 5ILGA 1BVUA 3RAJA 3DOCA 3IMFA 4M54A 1NVGA 3F4LA 3PJEA 5DCWA 1ZK2A 4BNLA 1CEQA 2PR2A 1UXIA 3GNSA 4D0SA 2GF2A 1N1GA 5HA5A 1R4NA 4AJJA 3U4IA 2VUTA 4I9UA 3CMCO 1P1RA 2B69A 3N74A 5FFFA 3SLGA 3I23A 1HE3A 3PHLA 1U7HA 2J3HA 5JYDA 3OH8A 3R0IA 2YV1A 4JX8A 1N8KA 3T7EA 4AJLA 3SC6A 1FDTA 2QRJA 1AN9A 3D7LA 4F45A 4OJNA 1SB8A 5JYEA 1P3DA 3JQGB 4OXNA 3KBOA 3LC1O 1U4OA 1GYQA 8ADHA 4UREA 1R0KA 4KP7A 3JQDA 4OH1A 1JWAB 1P9LA 4B7UA 1GQYA 3TOXA 3MZ0A 3U4DA 4BNGA 1T4BA 1ADCA 2B0JA 2NVUA 2J3KA 2NVBA 2ZQZA 4GX0A 2FZEA 3AWDA 2D59A 4U0JA 1IOLA 4BB5A 1WPQA 3FCOA 2WYWA 1ISFA 3JSAA 3PJDA 4MVJH 1T2DA 2DU8A 2Q4EA 1H0KA 3GAFA 3NX4A 4PG6A 5ADHA 1C1DB 5COAA 2VYVA 2WD7B 1QKIA 9LDBA 3ZWVA 3FI9A 4P8RA 3L6OO 3LF1A 4FGWA 1WVGA 1E3EA 3H9QA 2Y1FA 3A28A 1RPNA 2JHFA 3OQ1A 5G4KA 1W4ZA 3DXFA 3CKYA 4Q9NA 4QXMA 4URFA 1I30A 5JMPA 1YDWA 3STHA 2QQ5A 3UVEA 4CODB 2IDZA 1O0SA 4ILKA 4Y9DA 3U09A 1RJWA 3A1NA 5JDIC 3DZGA 4K28A 1B8VA 5DF1A 2EGGA 1TB4A 3FNGA 4ALNA 3TFOA 4H16A 4GGOA 4XIJA 4ND5A 3QVXA 4R41A 1GV0A 3TNLA 3QQPA 3LT4A 4D46A 4E2WA 1U7TA 3DBVO 1MX3A 3L77A 4IMRA 4FDAA 4H7PA 4QO7A 5AXDA 5BNFA 1MFPA 1GAEO 3EZLA 4MVJA 1DDOA 2OORA 5CDUA 1TVEA 4NFYA 3K31A 4EEZA 4Z3KA 3I3OA 3LT1A 4Q3CA 2WE7A 5KVVA 1YQGA 4FFNA 1I01A 4DUPA 5CDYA 1J49A 3JD3A 1U8XX 4FD3A 5F5LA 2GGSA 4RF4A 3WOHA 4BNZA 1F06A 3LF2A 2E4AA 6LDHA 1HDZA 1O95A 3DONA 5K6AC 1MP0A 3OJLA 2R00C 2Q46A 5T5QA 4IUYA 4FB5A 4HFNA 4YJGB 4BQPA 3OSUA 2ZATA 4Z0TA 3DQPA 3VPFA 4RPKA 2EJWA 1EMDA 3CH6A 4CMIA 1SAYA 4W7HA 1K5HA 3AU9A 3V1UA 1WWKA 2PH5A 5BQFA 2Q3EA 4YAKA 5ICMA 3GFBA 5L7YA 3QP9A 4NI5A 3JD2A 3UGKA 5FYDA 3OECA 1FMCA 1PJTA 3HDQA 1XSEA 5JXWA 3HNPA 1W8DA 3AOEC 1P31A 1U2DA 2PGJA 3MTGA 4BKOA 1BVRA 4PG8A 3PGJA 1IE3A 2Q2VA 4UVGA 1VJ0A 2VN8A 4RF3A 1QXSA 5A9TA 2I65A 2NU7A 4XYGA 5HWSA 1R4MA 2BMAA 2RIRA 3PHIA 4UUMA 1B15A 1NFQA 1E1KA 3MTJA 5JAQA 3GZ4A 5HM8A 1GYRA 2Q1WA 3B1JA 5G0SA 5JDCA 3GAZA 4G5HA 4L75A 4ALMA 4QSMA 1BGVA 2ET6A 5TS3A 3B1KA 5JO9A 5ITWA 3DHEA 3JQAB 4DQUA 1ZBQA 5THQA 4AJIA 1YB1A 5U4QA 4II2A 2PH3A 2W2LA 1TEHA 4ZU3A 1H9BA 2PZMA 2O4CA 3DBRB 4RJTA 2PZJA 1SBYA 1FJHA 2YQ4A 4QT0A 1YDEA 5GZ6A 3WGTA 3L6DA 4YAEA 3B20A 4GX5A 1NPYA 3PZBA 1QMGA 2GN4A 3F6YA 4X54A 3GVHA 1B14A 3H7AA 4TWRA 1LRKA 4GMGA 2AG5A 4EW6A 1EQUA 3HQ4O 2X5KO 4FBGA 1X0XA 1X13A 3MCVA 4U0KA 4WLOA 4QECA 4IS3A 4R69A 1CJCA 5A05A 1PWXA 4CM8B 4JGBA 1UDBA 4KUEA 2PD6A 4MPDA 1IHXA 5CHEA 3PRJA 3VHRA 4BGVA 1E7YA 1Z75A 1NPDA 3GLQA 1L7DA 1I36A 2C82A 1X15A 1U4SA 1P44A 1KETA 2DUWA 2VZ9A 3QLJA 2FY8A 4GWKA 3VTFA 3E48A 4CLOA 2I9PA 4GWGA 4MVJD 1JAXA 2DTDA 4D43A 1UJMA 5AXCA 4GSKA 3E6AA 1KVRA 2X0IA 3KYCB 2W4QA 4R1UA 3KRTA 1IY8A 3ZU5A 2B35A 2JAPA 1IZ0A 3VDQA 1PZFA 2ZQYA 4EJ0A 1JVSA 4CLDA 1NHGA 3QJ5A 1CWUA 2FWMX 3ASUA 5KKAA 1D1TA 1Y8QA 4J4HA 4I8XA 1DC5A 3GEGA 5B1YA 1ZXLA 3DHNA 1GZ3A 1MB4A 1A5ZA 3EMKA 1GPJA 1WZIA 3ZHXA 4F3YA 4OXYA 2CSUA 3HG7A 1NAIA 2EHDA 4R16A 3RUHA 3GRKA 1BDMA 3H8VA 4M55A 5EERA 2CNBA 1U1IA 3DZHA 2AQHA 4E12A 1SOWA 2DM6A 3PQEA 4OO3A 4YDRA 1OAAA 5EJ2A 2OBNA 1I2CA 3WYBA 3SEFA 4CLRB 4BKRA 4CQMB 3AY6A 1HEUA 4WNIA 3AM3A 1PS9A 2C54A 1ZJYA 3O8QA 5JLAA 2J5QA 1CF2O 3DMTC 4XIYA 4CM4B 1K6IA 2O2YA 1DJQA 2G17A 3HJAA 3G3EA 1IYZA 1K3TA 4GQAA 1Z73A 2AG8A 3RFXA 1Y9EA 4J1QA 4DPKA 2ZB4A 3I1JA 1Y81A 4YJFB 3BTVA 3FR8A 3E9MA 5IDWA 3HB5X 1OC2A 5K9ZA 1SEPA 1YRLA 2BGKA 2O3SA 4MIEA 4YT2A 4RVUA 2D2IA 4BKQA 4DYVA 1NXQA 4C7KA 3Q1LA 4A73A 4BNJA 4DXHA 1B0AA 3ZWYA 3FN4A 2W2LD 4HUJA 4K6CA 3WTCA 4YT5A 4A7PA 1QSGA 1HETA 4IGEA 4YRBA 1A27A 1ZMTA 4XB1A 1E5QA 3ITDA 4MVJP 1O94A 3F4BA 2GO1A 5TT0A 3ETDA 2IYPA 1QYCA 2P2SA 4OAQA 1IPEA 3QWIA 1MC5A 2DBQA 4J43A 1UP7A 4QTZA 4Q3EA 4CUKA 1HSOA 2O7QA 2EJVA 2A4KA 4OYRA 2DLDA 2JKVA 1XKQA 2EW2A 3L9XA 1NQAO 2YV3A 3ROMA 2Y68A 1R0LA 2EGHA 2SCUA 4CR8A 4L76A 4LMPA 4QEDA 3OBBA 2ZTMA 4AFNA 4E4YA 1Y9AA 3ZH2A 4I5EA 2AW5A 3G0OA 3ANNA 3O38A 2RBEA 4XR4A 2O4UX 2P9EA 2FN7A 2J8ZA 1RYDA 3MEQA 4MP6A 2GNAA 3HFGA 1A71A 4E30A 4F6CA 1TT7A 3DZBA 1E77A 3C8MA 3IP3A 1P1HA 4FCCA 1LSUA 1DIHA 1KC3A 1O9BA 1GQQA 2DPHA 2WYUA 4CMCA 1KY4A 4FN4A 3BMCB 1M6HA 3D4PA 4FW8A 2P5UA 4S3MA 1YB5A 1ONNA 4D3SA 3L6EA 1D1SA 3QWAA 5THKA 1YS4A 4OL9A 2A9FA 5IXSA 3KEQA 4RO0A 2H5LA 4PG7A 2HK7A 2H6EA 3E82A 3OJ0A 5IDXA 1H6DA 4W82A 3S1LA 4E13A 1W0CA 4WK6A 4B4WA 1GCOA 4CLEA 4J16A 2EXXA 3WJ7A 4OQZA 1FDVA 1PR3A 1DIGA 1R66A 4GGPA 4ITUA 3RSHA 1ISJA 1HXHA 2X8LA 3K96A 3JD0A 8LDHA 5A03A 4ALJA 1BXGB 1T2AA 2NUAA 2X4GA 4N54A 4YR9A 2R2GA 5KTKA 4CPDA 5TNXA 1NYTA 4JLWA 5A5FA 3JQ7A 3RKUA 5JS6A 3UUWA 3O4RA 3BMQA 4PCVA 4FOSA 2NU8A 3F1LA 1ZK3A 4YWJA 5IFLA 3ZZNA 4KWIA 4LCJA 3JQAD 1NBOA 2HJRA 1CETA 2VNSA 4QUKA 4NBWA 1O5IA 4OGWA 1BW9A 4YRAA 4ND3A 1H9AA 1KVTA 5CEJA 5G4LA 4N5LA 5C7OO 5LDHA 3EHEA 1NNUA 4R1NA 3SJ7A 2OFPA 3WMWA 4IZIA 2F1KA 3PK0A 1HE2A 4R3NA 4C4OA 3ROQA 1DAPA 2PWZA 1Z7BA 2H9IA 1P74A 2Q2WA 4OHUA 3WICA 3G79A 3AM5A 3QVWA 4EYEA 4RVSA 3PPIA 2RHCA 4D44A 2GLXA 3RUIA 4HWKA 1KVUA 4UEJA 3OM9A 1YJ8A 3GOHA 1DC4A 5T57A 3K2EA 4OOFA 2NU6A 4JN6B 4W9NA 5DCYA 1EE2A 4GLOA 3RU9A 3WGOA 1EZ4A 1XELA 4NPCA 5I7EA 3E9QA 1QP8A 3UCFA 2CDBA 3H9GA 4CR6A 3RUCA 1ZO8A 2BHLA 4TRJA 3DO5A 1DBVO 3HADA 1LLDA 2OHXA 3W4KA 2NACA 3WB9A 5KJ6A 3BTUA 1ZCJA 1Y8RB 4BGEA 3GA0A 3ZDFA 2Q1SA 1TXGA 1EFLA 3W8DA 1QYDA 2F00A 3I9MA 3NUGA 2BRUA 4XCVA 5DCUA 4FSHA 3DTTA 3WQRA 1FDWA 1R37A 3DOOA 3WGIA 1K6XA 1LX6A 4Z3DA 1WMAA 3D3WA 4WCFC 4AJOA 3U4CA 1N1EA 2XXBA 5EQDA 2IEBA 3U0BA 4INAA 3FRJA 1ISHA 3DZKA 2XXJA 1PL6A 2G0TA 5HS4A 5JCXA 2FHSA 2PK3A 3E5RA 1Q0QA 2O48X 1IZ9A 3FWNA 2G76A 1P1FA 2Y1EA 4CM9A 4CQMD 3NT4A 2PGLA 5L7WA 4B3HA 2POQX 2AEFA 2C2XA 1ENOA 2GD1O 4F6LA 3FTPA 4AJEA 4BO2A 2OL4A 5DN9A 2I3AA 1RM3A 2X22A 4CQLB 1NR7A 2C7GA 1EUDA 1ENZA 5KJEA 3JD1A 2PV7A 3NKLA 4RVDA 2VNAA 2D5AA 1XWFA 1NQTA 2QZ9A 5B12A 3OJEA 3FPCA 4NDNE 5G2OA 1P77A 1MFZA 3OETA 2W2KA 4PIVA 5JE8A 1MUUA 3WGQA 3NT5A 3PIDA 3ZV3A 1VRWA 4YRDA 5ENDA 3BMOA 3F5QA 3H2SA 1BMDA 1PR9A 1NQ5A 1J6UA 4J90A 2E6UX 1YOVA 4GMFA 5TIIA 1WMBA 5CP8A 1XU9A 1K89A 4ZQBA 2YHIA 2JCXA 4LSWA 3A14A 3JYLA 4BB6A 1MXFA 2NVWA 5T8KA 4PG5A 2ZTVA 1YBMA 3EW7A 3JV7A 4I5DA 5KJFA 3D5TA 1PTJA 1I24A 1G6KA 3PLNA 1L7EA 2ZB3A 3I9KA 4R51A 2IXAA 4A0SA 4A03A 2X7HA 4R5MA 3X2EA 1CERA 5KVCA 4E5MA 4GL4A 1DPGA 4UVDA 1EVIA 1X1EA 3K73O 3PJFA 4CJXA 1DHTA 3LZ6A 2X0RA 4HNGA 2HK9A 4CMBA 4O1MA 3QW2A 1NQOA 3DAFA 3GG9A 3V5NA 4IZHA 1TT5A 5L9AA 1ZEJA 1H6BA 4OQYA 5EPOA 3RUAA 2NVUB 1EVYA 4M87A 4EEXA 3S8MA 2GPTA 4ND1A 3PDJA 4I5GA 2CDAA 1WP4A 4Q39A 1IB6A 5IJZA 4WE3A 1SC6A 2DVMA 1LU9A 4XGIA 3TRIA 2DC1A 4BS9A 5IXYA 5JCJD 4KDFA 4JBGA 3KEOA 2O50A 4G81A 3PGXA 2XOXA 4IDAA 4ZN6A 2EKPA 2WDZA 4UUPA 3QY9A 4GI2A 2EKLA 4DTIA 4YYZA 4PZCA 3BTSA 5I7FA 3WGZA 3MJCA 4TRMA 3HB4X 5G4KB 4PLCA 1PQPA 4J0FA 1WLYA 5BNIA 1HDGO 3VPHA 2I67A 3JQCA 1PL7A 3U5TA 4FFOA 4PLYA 3KOUA 1T25A 1HSZA 3H65A 4FFRA 1LJ8A 1L1FA 1AXGA 3WNQA 2DFDA 2HQ1A 2BGMA 1P33A 4N5MA 4NMHA 3IS3A 1F0YA 3GMSA 4MJLA 1SCUA 3JD4A 2W8ZA 1KYQA 4PLHA 3LSYA 1HT0A 2NSDA 3HFSA 1U8FO 4UVEA 3WX0A 2CFCA 2ZJ1A 3L0DA 2ILTA 4N5NA 4IDDA 1RM0A 4MDHA 3U62A 4WCDA 2YYYA 1LDYA 2AQIA 3GDGA 5COQA 1HZJA 1VSUA 3WGHA 4F46A 1GDHA 1N92A 1OMOA 2ZCVA 3S55A 3TF5A 3QE3A 4N7RA 4CUZA 2V6GA 3VH4A 1ZVMA 4A10A 4BNIA 1Z6ZA 2UUOA 3GNTA 2A94A 4NFHA 4YBZA 3OIFA 5GMOA 1PGNA 4CMIB 2HK8A 5GZ3A 2E37A 5DP2A 3ONFA 3MOGA 1ADFA 1ULUA 4XZ3A 2BFMA 3ZWCA 1RM4A 1X14A 1S7CA 4YACA 3ASVA 1PGPA 5KVSA 1H94A 3GPDG 1YL5A 3DL2A 1C1XA 4IXWA 4QQRA 3ZN2A 1E3LA 2BI7A 3V2GA 4B4OA 1Q7GA 4D3FA 3K30A 3OQBA 3WLEA 5A4DA 4AVYA 4XQ9A 4BNVA 2OUIA 3KLPX 5JY1A 3CUKA 1LC0A 1XDWA 4BUCA 4S1VA 5CPBA 1R4MB 1F12A 1A7AA 4EI2A 1XCBA 2EP7A 1G0OA 3PP8A 5EMHA 3U49A 3Q3CA 2VRCA 4QFDA 4E5YA 1UDAA 5B4VA 4E0BA 1RWBA 2O3QA 3I4CA 4MVJI 3DBLA 2ZB7A 2IE0A 2JCYA 1GYPA 2DQ4A 5EINA 5ITVA 1HYHA 1OZAA 1VL8A 2Y67A 4BO4A 4JNKA 5U9CA 3ZU2A 4DQXA 3D4NA 2RAFA 4E5KA 3ROPA 1UZLA 1X1TA 1HE5A 1TI7A 2JHGA 3IKVA 4MP8A 1O89A 4PLTA 4CMJA 3F9IA 1I33A 1ZW1A 2GRAA 3GRPA 4AICA 4K9DA 4MKZA 1D4FA 1F8FA 5TJHA 2NWQA 4TKMA 4BNKA 1BTOA 4WLVA 5JSFA 3O26A 5DT9A 3BHIA 1UP4A 1RYEA 1DXYA 1PSDA 3HN2A 2WWRA 4G2NA 3EK2A 3C1OA 4CMAA 1LSJA 2X1HA 3FD8A 3FPLA 1BDBA 3G1UA 3TL3A 1LBEA 4EBFA 4WGGA 2JD0A 5CFZA 1ZSVA 2I76A 5A3VA 4TRRA 1VKOA 3G49A 4NK5A 1C0IA 3WMXA 4ONEA 4DREA 3CE6A 4CLOB 4Y6RA 2EEZA 4FIZA 1YL6A 3R3SA 5JFOA 1E7QA 3B1FA 2GN9A 2RHRA 3H5RA 1N9GA 1FDUA 1MXHA 1QV6A 3P2YA 5H83A 5JW6A 4D41A 1EDOA 1PJBA 1PU2A 2FOIA 2NLOA 2VHXA 4Z6KA 1Y5MA 1TA4A 1DLIA 1DLJA 1AHHA 3GVXA 3PTZA 4H15A 1HDXA 1XYGA 5AXAA 3WLFA 2VQ3A 1DAOA 2C59A 1Y8QB 2BLLA 4GVLA 3H2ZA 4CLHA 3ZWXA 3CSDA 1JTVA 3PXXA 3BHMA 5IZ4A 1ZK4A 4BV8A 3ZU3A 1Y5RA 5I7VA 1DC3A 3VTZA 2QW8A 4D3DA 3JQ9A 3G1TA 4JIGA 2Z95A 1NWHA 4BO5A 4DL9A 4MVJG 2AXQA 3RKRA 3CTVA 5C5IA 4BNHA 4UVIA 2BI8A 2YQ5A 3INTA 4XWYA 4WECA 1IHYA 3WIEA 4FS3A 1GZ4A 3BYZA 1GV1A 5I8ZA 3I6QA 3TZQA 3F3SA 3AUAA 1WAMA 2UVDA 5DDIP 4BO1A 1HL3A 3DOJA 3GGGA 3NRCA 3O8QB 3WQSB 1T1SA 4UAGA 3ENNA 2LDXA 1JU9A 3VZRA 1RKXA 4UULA 3RC7A 3WYCA 3TSCA 3WBBA 4DQVA 4BKPA 3LYLA 3V2UA 1MG0A 2YFHA 4P4NA 1LDGA 4IM7A 4YB8A 4O59O 3AI3A 3WWYA 4DBZA 1VSVA 1JAYA 1E7WA 4YJHA 5KOIA 4CM5A 2VYVD 1KBZA 1NTOA 5DNAA 1GD1O 2IZ0A 1LDMA 3KLMX 3PLRA 2QRKA 3BZUA 3B70A 3QWBA 3MJEA 5TT1A 3E1KA 1PS8A 3GK3A 4M49A 2JL1A 4TROA 3U3XA 1YJQA 5A5EA 1KIFA 1MC4A 3QSGA 1H6AA 3VC7A 2JFGA 5I9NA 1LNQA 2QZZA 3AOGA 4HP8A 4FJ1A 3JQ6A 3WDSA 2JFHA 3I83A 7ADHA 2Y0DA 4OKNA 4RF5A 1NP3A 3K9QO 5AYVA 3ZCXA 4NG5A 5DP1A 4RL6A 2UYYA 3LDHA 3FF4A 5KJCA 2DTXA 6ADHA 1AGNA 3P5SA 4XJSA 4MVJM 5IN5A 4IIUA 2G5CA 1OC4A 2VHWA 4LRTB 3HDHA 1XG5A 3AY3A 1UXJA 2Y0CA 4J6FA 5CDSA 1N7GA 5C7LO 5JAMA 1IPFA 5B37A 3H4VA 3DWFA 3VVBA 3P2OA 5F1PA 4CM1A 3LLSA 1UXGA 4XA8A 1PZGA 2OZPA 1KEVA 2BD0A 1TLTA 2GSDA 4MO2A 3L9WA 1Z45A 3NT2A 2HU2A 5TRTA 2GUGA 1DO8A 4EUFA 1CDOA 4CLXA 1N5DA 4GSLA 1EBFA 2VWHA 4RPJA 3JQFC 4EJ6A 1E3WA 1GL3A 2ZKLA 3W6ZA 2CF6A 3K5PA 4NZ9A 3JQ8A 5I9MA 3RC2A 2ZYDA 4HNHA 4EUEA 1HDCA 2Q4BA 4DVJA 1XHLA 1NASA 4R9SA 4P22A 3WBFA 2AE2A 1ZNQO 4EGFA 1WDKA 2GCGA 3GVCA 2P91A 3KO8A 4IDFA 2ZJ0A 4AJ2A 4EUHA 5CEFA 4WUVA 3INRA 4BKUA 4QO8A 1ZFNA 3BHJA 3UH1A 4K6FA 3VZSA 1UR5A 5JDIA 3MJ4A 1U3TA 4BNYA 3M1LA 1OBFO 5IDQA 1ZK1A 3PWZA 4CMGA 1M6WA 1BXZA 3I9OA 2PLAA 2AHRA 2D3TA 2HMWA 3QIVA 4PG4A 2WYVA 2YJZA 3TZKA 4CV2A 3UAGA 3MWDB 2HCTA 3P7MA 1K2WA 4DPMA 4YA6A 4CL3A 4D42A 4B3IA 1V3VA 3JQ7B 5H82A 1IL0A 3FNHA 2FPPA 3BMQB 5AVOA 4IDCA 4Y98A 4HXYA 4KQXA 3RI3A 1P1KA 3QVSA 3D4OA 3OF2A 4E6PA 2VHZA 4E33A 2DBZA 4GVXA 1MV8A 2GASA 1XEAA 2QG4A 1BW9B 4IXTA 4NU6A 4PRKA 5K6AA 4D0RA 2R00A 1YGYA 4IINA 4IJWA 4NJMB 5JPIA 3UN1A 1P0FA 1CQJA 1H93A 3H5NA 5KWEA 1YE3A 2GZ2A 1VL0A 2EG9A 2PTGA 1WNTA 2J5RA 4Q3NA 2NM0A 3DMYA 4DWVA 5AQ1A 2DPGA 1U28A 4PFJA 4ALKA 1B7GO 1ISMA 2OMEA 1JA9A 3GEDA 2AE1A 3IDSA 4MOWA 4CMEC 3ZWNA 1PZEA 1BXKA 3AOEA 3U9LA 5A9RA 2YFQA 3L4BC 3NDRA 4JK3A 2VWGA 3Q9NA 2I6TA 1YL7A 2TMGA 2B5VA 4Q3DA 4NNJA 4NJOA 3KZVA 4O63O 4RCVA 3GQVA 4ZRNA 3OP4A 3NGXA 3Q11A 1EK5A 3S2EA 3LK7A 4W7IA 1KERA 4CV0A 1E3JA 3HN7A 4XB2A 3M6IA 1SNYA 3CPSA 4J1NA 2CD9A 1ZH8A 4KTVE 3DZIA 1DB3A 4Z0PA 4YTEA 3UF0A 2CUKA 4LN1A 2X5JO 2GR9A 1EBUA 4GBJA 1VPDA 1R16A 4KZPA 4BMNA 1SZJG 5TLSA 1E6EA 5JY6A 3GMDA 2YZ7A 1I3MA 3EY4A 2FMUA 1NFRA 3ETEA 4B4UA 5CG2A 5FWNA 1ONPA 1LA2A 3FSRA 3JCZA 3MJTA 4ZGWA 4DC1A 1Q0LA 1NVMB 3E9NA 4RPHA 1A7KA 1VE9A 3E18A 2FR1A 3TQHA 3UFXA 1A4UA 1YWGO 1HYGA 1AUPA 4RLSA 5TGDA 3ZV4A 4DLBA 3JQBC 4CR7A 1M75A 3GG2A 3GR6A 1WDLA 4CLRA 3F5SA 3NDJA 3C24A 2GZ3A 3SX2A 3ONEA 1XIVA 1GFSA 2Y1CA 3QRWA 2CZCA 5U1PA 4JBHA 1UDCA 4CM4A 4RF2A 2W2KB 1LC3A 1Z7EA 3DC2A 1GPDG 2D8AA 3H9EO 4FFPA 4WASA 3BMOB 2Z1NA 1I8TA 1A9YA 2PFGA 4NQZA 1YOVB 4YJFA 2EKQA 1C0KA 2H63A 5LCXA 1PJQA 3IP1A 3ZNOA 2C5AA 2Q49A 1YQXA 2YHIB 3NDIA 3WQQA 3WNVA 4AJPA 2Y1OA 1HKUA 2BFPA 5C7IO 3PIIA 2XF8A 2HJSA 5KCZA 1E1MA 4NBUA 3D64A 4IGFA 2EIHA 3KYDA 4J7CA 1ID1A 3RJ9A 2PD3A 1S6YA 4JXKA 1K6JA 4WLNA 1PJ3A 1J5PA 2WTBA 5TQVA 4EDFA 5CDGA 4XGNA 3GEMA 1VL6A 1EVZA 4XR9A 3D1LA 3PYLA 5KVQA 5L4NA 1YB4A 1BG6A 3INGA 1TT5B 2HKIA 2JJYA 3HSKA 4N18A 1Y6JA 4JROA 3QA9A 1JKFA 3I6IA 3CZMA 3DMTA 4CL8A 1JW9B 4BNWA 2QHXA 1CIVA 3GC6A 1I2ZA 2GERA 1QR6A 4Q3AA 4MVJF 5L40A 1B3BA 1DRWA 1ENPA 3Q2IA 4J49A 1H6CA 4FJ0A 1DRVA 3GN1A 4AJKA 4DIOA 2V6BA 1YXMA 4J7UA 3FHLA 4HFMA 3SJUA 1B3RA 3WGYA 4NHEA 2VUUA 4LSMA 4ND4A 2UV8A 1I3NA 1T1RA 2PD4A 2FR0A 2DBVO 1PZHA 4E21A 4D7AA 1Y1PA 5A06A 1U3UA 3N58A 2J3IA 2FRDA 5LC1A 1X7GA 2VYNA 3DBHA 1QYXA 4II3A 4RVHA 3H9UA 3JYPA 4FPXA 4IS2A 3SC4A 1IULA 1DFHA 3VZPA 1EVJA 2D5CA 3M2PA 4MKRA 3I4FA 4BMSA 4PLZA 4E2XA 1T4DA 3EC7A 5A9SA 4LK3A 1JLLA 2I66A 5C37A 3EDMA 1E3IA 2AA3A 2EF1A 3DEYX 3ANLA 2VZ8A 1Q1NA 4FJ2A 4E31A 4TKLA 5A02A 4MKXA 5COBA 4XD2A 5BNTA 2J6IA 2IEDA 3VPXA 1ISGA 4WEOA 1A72A 3ANMA 4I5FA 1PJ4A 4NIMA 2Q45A 4BO7A 4DPLA 3OQ6A 2OBYA 1C0PA 4ALLA 2Y99A 2YHUA 4IDGA 5ILOA 2A92A 3OIGA 4TZTA 2J5KA 5TF4A 1PJLA 4BGUA 3AJRA 3K2BA 1RM5A 2P9GA 1R4NB 4P4GA 3KB6A 3VH1A 4ZJUA 1HLDA 2C7VA 4NBVA 1NX6A 5ER6A 3OA2A 1I3KA 3NTRA 5FF9A 3Q2KA 2JD2A 4DLAA 4DC0A 2EERA 4BGIA 1C1XB 2OP0A 3AUSA 1VI2A 2YDYA 3CZRA 4PN3A 4DA9A 4ZQHA 1R6DA 3K92A 4CM7A 1N7HA 1BRMA 3KVOA 1XR3A 3N7UA 5K0ZA 5DBIA 2IZZA 3RD5A 1Y7TA 1WDMA 1DIBA 2NU9A 1OFGA 4I1IA 1H5QA 4BNTA 1MLDA 2WJPA 3IIEA 4RPLA 4BNUA 4LW8A 4RVGA 4DRYA 1GEGA 3S2IA 4IQ8A 1ENYA 1ARZA 2HSDA 2RH4A 2EWMA 3GZNA 4J1TA 2O3JA 2WD8A 3WXBA 1WW8A 5A1TA 4ZICA 1HYEA 2DBRA 3GVPA 2YDXA 1V0JA 3OA0A 2Q99A 3VKUA 2CY0A 3RIHA 4YAJA 3DAGA 3GFGA 1G1AA 2OOSA 2Y05A 4HFJA 3GH3A 4O5OA 1LDEA 1NHWA 3NV9A 3C1TA 4XEHA 5F1OA 4J2HA 3RFVA 3OEWA 1HF3A 3PYXA 4JJGA 1EFKA 4GKBA 3Q9UA 4OOEA 2BH9A 3LLVA 9LDTA 1PGQA 2P4QA 2O3TA 1PGJA 3PYMA 1DFIA 5EESA 4PLFA 5C3MA 1XU7A 1SMKA 4R5HA 1B8PA 4U8GA 4XYMA 3ICCA 1UXHA 5HRUA 1R0SA 4HADA 1KY5A 4J91A 4BQRA 3R1IA 3GPIA 2EV9A 3WYEA 2VYND 1T2FA 4PVCA 4CM9D 4RZIA 1P1JA 4FR5A 1PJCA 3VDRA 5KIAA 5CEEA 1CQIA 3FBTA 3O9ZA 4HFRA 4YT8A 1KC1A 2GDZA 3FTNA 4J3FA 3ZW8A 3F1KA 3GF4A 3T4XA 1U3WA 3D0OA 2R6JA 3W4JA 5BSHA 2HRZA 3LQFA 2P68A 4K1LA 3CINA 5JDCC 2D4AA 1Z82A 3BIOA 4L74A 4BOYA 1W73A 3RUEA 1QG6A 4RORA 1U2GA 4FOOA 4E5NA 1N9GB 3VAZA 4Q3BA 3ORFA 1CRWG 3TZ6A 3SLKA 2NV6A 2QRLA 3WWZA 3MJVA 1GUZA 3GT0A 3TOZA 2C20A 4GLLA 4IQ0A 4ESOA 3FWZA 2CDCA 1Z74A 1JDJA 1XGKA 4FFMA 3DTYA 1V35A 3WJAA 4BNFA 1B2LA 1WXDA 2Q1TA 2HO5A 5TC4A 1FXSA 1LI4A 2NTJA 4FQ8A 1I32A 4WCFA 4ALIA 4ZQEA 2P5YA 1GADO 1SPXA 2B4RO 4KMSA 1DIAA 1NVTA 5DULA 5IZCC 1DHRA 5IDYA 3IJPA 5AXBA 4XX0A 5B4UA 1PGOA 4Y8VA 4R68A 3GUYA 5FEUA 1ZJZA 1YBAA 2CF5A 1VLLA 4R54A 3VOSA 2PGDA 3PDUA 3I9JA 1LEHA 4WOKA 4YT4A 7MDHA 1C14A 3PWSA 4RDIA 4I9NA 3VVCA 1EEHA 2HRBA 3HDYA 1MGOA 3PJGA 4RGBA 4ZVVA 5T6BA 4A26A 1HDRA 4G65A 2D1YA 3GHYA 3G17A 2PZKA 3C3XA 4YJHB 4YPOA 4BO0A 1XQ1A 4TRNA 3QV1A 4XYBA 5CDTA 2DUUA 2NADA 4E5PA 4XJTA 1F17A 5G0UA 5BSEA 1ZMOA 3AFNA 2GN8A 3RBZA 3ZWWA 2GYYA 3DZJA 3KSUA 2CVOA 4HY3A 3CIFA 2AMFA 1UZMA 1W6UA 5LDGA 1ZKMA 2GN6A 4ID9A 5KNLA 4YCAA 2QX7A 4NBRA 3S2FA 4MP3A 3HE3A 4M86A 2WE8A 5JMWA 5HS6A 1NPTO 3GGOA 5IN4A 2VTDA 4WNCA 3TDKA 3GN2A 4AJHA 3H9JA 2VHVA 5H81A 2YW9A 1PL8A 2DTEA 3FNFA 3AI2A 3LT0A 2FSSA 4B4VA 3CEAA 4RVFA 3BMNA 4JP2A 1KEPA 2DAPA 4QFCA 1HRDA 4UVHA 1B16A 2C5EA 1ORRA 2Q1UA 3ZHYA 1LLUA 2B4QA 1PS0A 4OKIA 4FC6A 4FGSA 2X0NA 1J4AA 3JYQA 2NQ8A 3WSVA 4JBIA 4RPGA 2OO5A 1GU7A 1HE4A 2VT3A 4YJDA 3KUXA 1C0LA 1XA0A 2H1SA 1E3WB 1V3TA 3DDNA 3RC1A 3F46A 4Z9XA 3JQ8B 4XRGA 3AU8A 1UXKA 3H3FA 2IYOA 2FR8A 2V65A 2UUPA 3ZWMA 3HWRA 1GQ2A 1PWZA 4XDYA 2P9CA 5L3ZA 5KKCA 3W4IA 3UHAA 4PZDA 1LSOA 1LTHR 4RZHA 3B6ZA 4B79A 4GH5A 3ZNPA 3UICA 3SXPA 2EW8A 5F21A 3EUWA 3LVFO 3LU1A 3FBGA 2YY7A 3JQGA 1LSSA 4GPD1 4LGVA 3WGGA 1HWYA 1ZXBA 3O03A 2DFVA 4UEKA 3JYNA 4LRSB 3OHSX 1YBVA 3R3JA 4DMMA 2VWPA 4NH4A 1E1LA 4TZKA 4TVOA 2VRCD 4RDHA 1KOLA 2HLPA 3W8EA 4OIMA 1PEDA 3BAZA 3T4EA 4AJNA 1U3VA 5HBRA 4LVCA 3ENKA 4NR0A 3V1YA 1HLPA 3PFWO 3VH2A 4PLWA 4AG3A 3GDOA 5L51A 4NK4A 2NTVA 1E92A 3OJFA 3AK4A 4O6VA 1C1DA 1ZSNA 3LT2A 1T26A 2PKRA 4R3WA 2WD7A 4ZQGA 5F5NA 3ST7A 4B7XA 2HUNA 2BFAA 2O23A 2V6FA 3RC9A 5EL0A 3UKOA 4CV3A 1B8UA 4ZRMA 3SBOA 4CM3A 1DC6A 2FP4A 2X9VA 2OXIA 4JJIA 3ABIA 3H5AA 3LC2O 3H3JA 3M1AA 3ZV6A 5L4LA 3NEPX 1LUAA 2FZWA 3ETGA 3PQFA 1DIRA 1QRRA 4CMHA 3K6JA 1I0ZA 4BO8A 3IOYA 3RUDA 1YKFA 1NAHA 4J7XA 4KWHA 3WIDA 4R1SA 1MA0A 5GZ1A 5IZCA 4YQYA 1KEUA 2QYSA 2Y66A 3IAHA 2VUSA 3MJSA 1ZIDA 2AEMA 1V9LA 2VOJA 3P19A 3KHUA 3BXXA 3RU7A 3ON5A 1E1NA 2PKQO 3GUCA 5AOVA 2ZIZA 1DFGA 4TVBA 3U4HA 5JNLA 3WTBA 4I9HA 4KTTE 4IPTA 1ML3A 3HHPA 4BNXA 4UUOA 3GGPA 5G0TA 3F47A 3OEYA 4Y67A 2BF7A 4YJGA 5T64A 1SEVA 4IJVA 4MVJE 1E6UA 1Q0HA 3RQSA 3PZRA 4J9VA 3KSDO 1N2SA 4HV4A 2IODA 2JFFA 4ND2A 3IC5A 1T24A 3AUTA 1VJ1A 5EIOA 4BO9A 3GNQA 1H2HA 2AEJA 4DMLA 4E2YA 3AI1A 2PY6A 4RQUA 3DHYA 4W6ZA 3RCBA 2NNLD 2VOEA 1QV7A 2NTNA 1KS9A 4JQCA 3UW3A 4LMRA 5JC1A 2ZTUA 4R01A 3DAPA 3KXDA 3PFFA 3ZNNA 4W9NC 3ULKA 1FK8A 1NR1A 4ZA2A 5IAAA 3WG9A 1B26A 4O0LA 3PWKA 4XQEA 3VZQA 3V1TC 2BFOA 3W8FA 4LCEA 1PX0A 4BO3A 2X86A 5BSFA 2AQ8A 1M66A 4MIYA 1GUYA 2YUTA 3ZGYA 5J23A 1YQDA 2ZYGA 2E82A 3QWHA 3Q6IA 1O8CA 1UAYA 3EGOA 2VTEA 1A9ZA 3JQAA 2Y0EA 1DSSG 2DT5A 3K8ZA 3NGLA 1QLJA 2Y1DA 2B37A 4PLVA 3EZYA 5T67A 1JWBB 5DBGA 2X9NA 4XYLA 1V3UA 1KVQA 3DBRA 4R4JA 1LRLA 4FFLA 3UXYA 3UOGA 5I9LA 4NFSA 2X9GA 2D0IA 4BHTA 3KYDB 1PJ2A 1I10A 1I3LA 5DOZA 2JD1A 1X7DA 2X0JA 1BWSA 4KDEA 5I8WA 4L0QA 2HMUA 1PJSA 4PVDA 5ICSA 3A9WA 1YONA 2C2YA 1LXCA 1OOEA 4H3VA 1UZNA 1H2BA 3SVTA 5JO0A 5L7TA 4E3ZA 1C3VA 1YO6A 1T2EA 2XPCA 1KVSA 4CM8A 1E5LA 1SOVA 3ZHBA 1T2CA 4BV9A 3ICPA 4IQGA 4WJZA 5EN4A 4J1SA 2GZ1A 5CPFA 3VPGA 1AE1A 3AY7A 4E32A 4KUHA 1AXEA 1EE9A 1YH3A 4GAEA 4JJFA 1VJTA 1NFFA 1E7MA 2X5OA 4R9RA 3TWOA 1EUCA 3KYBA 3RBXA 1JVBA 3ZWBA 3VPSA 1GY8A 3WR5A 3LC7O 1JKIA 3IQDB 3HDJA 5L95A 1M67A 2I5PO 4L4SA 3TJRA 1LQTA 2P4HX 2BGLA 1HDYA 3KYCA 3IKTA 4D79A 3RROA 4XQCA 4KQWA 4UUNA 1ZZEA 1ISIA 1P0CA 2JAHA 5IF3A 1A4IA 4ROSA 1UP6A 1GTMA 1OI7A 1SO8A 3D3WB 4TMFA 1ADGA 2B4TO 4IIVA 2PKQP 3NTQA 5T8KC 2ZB8A 5JBIA 1ZUD1 3W6UA 1LQUA 1DJNA 1E6WA 1UUFA 4IJKA 4DIFA 5CG1A 3DBHB 1LLCA 4MIOA 3CTMA 2WM3A 4L73A 4BL5A 2NQTA 1JN0A 3IUSA 3ADOA 1U5AA 2DKNA 1ZK0A 1PQUA 4KOAA 1ULSA 2O2SA 4UEOA 4QX6A 4YXFA 5A9SB 4IJUA 4CQMA 3T7CA 5G0VA 3OFSA 4PRLA 1HZZA 3C7CB 3TPCA 4YAGA 2PZLA 3ZWOA 3GVIA 3OJOA 1GUFA 1J0XO 1FDSA 3E8XA 3ROKA 2B83A 4J4BA 5FI5A 4HX5A 4OM8A 5A3JA 2FPIA 2O3UA 4M89A 5L45A 4U6QA 1KEWA 3DR3A 2V7PA 3GHHA 4M8SA 1AHIA 2Z5LA 3TL2A 3E5MA 3KSZO 2BELA 3WFIA 3R6DA 4CMKA 3S2GA 1EQ2A 3Q0EA 4B8WA 4W99A 1E7SA 1R12A 1U9JA 4W4TA 3NYWA 4CV1A 4R1TA 2Y93A 2B36A 2O3RA 3AW9A 3JQFA 4GKVA 3I9NA 3RJ5A 1V6AA 4Y6SA 1E7RA 3TZHA 3ZWAA 3M2TA 1XQ6A 4J4TA 3QHAA 1UH5A 4NJMA 3I9LA 4NU5A 4XGKA 4YQZA 5DZSA 4A5OA 1HTBA 3VKVA 2A35A 5BR7A 5JAIA 3JYOA 3HUDA 4HKTA 5JC8A 1X7HA 3KTDA 4U7WA 4LISA 3GY0A 4XQGA 4WPGA 4XYEA 4EJMA 4ZHSA 3C1AA 4BO6A 4BVAA 5TX7A 4B7CA 3L4SO 3HZZA 4ZQFA 2IZ1A 2JCVA 4JP3A 3GZNB 3ZV5A 1LDNA 5I7SA 4IMPA 4YAIA 2AQKA 3KETA 3TFQA 2VHYA 1E3SA 1JQBA 3PI7A 4KUGA 1D7OA 2I99A 2FSVA 5JAZA 1U5CA 5ES3A 2O7SA 2QIOA 4WOJA 3DFZA 2EP5A 5JCJA 1Q7CA 3PHGA 4PLPA 4EZBA 3AFMA 3RFTA 3ZHZA 5DOVA 1EDZA 3A4VA 1I2BA 3IJRA 4Z0HO 4Z9YA 2QYTA 1MG5A 1ADBA 3BMCA 4RQTA 4IBOA 2IXBA 1FF9A 4MINA 2CVZA 1VKNA 5A04A 2WMDA 2X23A 1QYVA 3RVDA 4BNMA 1LRJA 4K26A 1BHSA 3PQDA 3TZCA 4DGSA 4CM6A 4L8VA 1ZSYA 4IDBA 1JKJA 2C0CA 3QVOA 3ZI0A 3ITKA 2CMDA 4WLEA 5L4SA 2W90A 2I3GA 1D3AA 1VM6A 2Q2QA 3TN7A 1M2WA 3C85A 4DIBA 2E48A 2UDPA 3CXRA 3I5MA 1NWCA 4YEDA 3UCEA 4CMEA 1XLTA 4TSKA 1BXGA 4TQGA 3L4BA 1Q2XA 1GZ6A
chains in the Genus database with same CATH superfamily
1QLHA 1BE0A 4GX2A 4L27A 3GLTA 3CZPA 1W76A 3EYWA 4J0QA 4OBXA 5AW4A 1TCAA 3FKJA 3ZDZB 4EYOA 5B4TA 1DOHA 2LDBA 3PHJA 5CB4B 2Y1GA 3F3MA 4YHBA 4BMCA 3EVGA 3KR0A 5LXTB 4RD4A 3OLCX 5JZ9A 4RLHA 1WSAA 3P9XA 2P35A 1PR2A 2XECA 4WSOA 1SBTA 2XF2A 3GP3A 3ONDA 4CUJA 2Z6AA 1Y7IA 3H9CA 2F67A 4C76A 2F3TA 3ZWPA 4WEQA 4FYKA 3KXPA 4PQEA 1OH6A 1Z68A 1NVVQ 2OBFA 5JI3E 3GEHA 1YCGA 4OSOA 5AIBA 4LNUB 4WLFA 2D62A 2NMVA 2BJWA 2Z1MA 3BXOA 1YHYA 3PA6A 3Q6NA 3S28A 1FBTA 5SYNA 4ZANA 2YC4C 3ESCA 4M1KA 2PXHA 2UAGA 3QVJA 2DR0A 1KKLA 2OCXA 3G13A 3KV3O 3JVDA 3H5VA 1VHJA 3CNBA 1DJPA 1GN9A 3SNHA 1IJBA 3R0JA 4G89A 4L4XA 2RCYA 4KGDA 3M9WA 3CBQA 3TLBA 1SQ5A 3ZW9A 2M6SA 1N6OA 2DWQA 2J3JA 4JUIA 1IM5A 5KDOA 3FUVA 1TMKA 3KKMA 5DNCA 4YP1A 3SXUB 1NE7A 3AVYA 6YASA 1XVVA 4A91A 2DKOA 3ADPA 1OW3B 2WJVA 5K3OA 3K8OE 3R9KA 1F8GA 1P7PA 2E49A 3JQBA 1J21A 3RASA 1E2UA 3C98A 1R50A 2DUJA 1BSVA 3HCFA 3I09A 3N8KA 2GEJA 3N39C 3PRKE 3L0PA 3W78A 4QXAA 3DBLB 1EGAA 1QHYA 4DXAA 5BSGA 3UG6A 4B3JA 3MWEB 1ODFA 5HTKA 2P3QA 3ZUPA 4C05A 3DZFA 2AI3A 3PDHA 2AD5A 2HDNB 2MYUA 2GEBA 2I6XA 3PQ3A 4PZEA 1L7NA 4AZVA 5DM70 5TSDA 2WICA 2ZPAA 4DJDC 2EJTA 4YVFA 1WHSB 3KJHA 1I94B 3WS7A 2V6MA 5KTSA 5FBWB 5F3RA 3SKYA 5CU7A 1HNWB 5CA1F 5AHKA 1DKOA 2FZCA 3K15A 1TVKB 3ABSB 3R4VA 4LXIA 2BKXA 1KJWA 3EH1A 3F7MA 4INOA 4XDZA 4YLGA 4JFAA 1D8AA 4EGQA 4HRVA 4HH0A 1OYYA 1PYOA 1P1IA 5LQSA 4IGIA 5CVVA 1B76A 3WYNA 2X15A 1JALA 5J40A 1JBQA 1BDIA 5ERXA 3RWBA 4GOND 3H6KA 2FSUA 2WFLA 1XXHA 5BSKA 4ZAYA 3QWFA 3VH3A 1QVVA 5LQKA 1F8UA 1YZYA 2ZYIA 3A3NA 4QDKA 4GHWA 5B1HA 1MB0A 1QO0D 1DU4A 3N70A 4OSPA 2QYOA 2HMSA 1GTVA 2QROA 3SS9X 1ISRA 3BTOA 3T7DA 3D1VA 2YWHA 2COUA 2C8LA 3FYHA 3ANSA 5BNZA 3A06A 3LY7A 3PVZA 1S3FA 3GDFA 4UASA 2HM7A 2V7QA 3I52A 2C2BA 2J08A 1R6TA 1QHIA 1C9KA 1XLVA 3PQ5A 5BRAA 2GCOA 5CFPA 3H0EA 5EIFA 4J9UE 2WHXA 2XCLA 4FQ5A 1DEHA 1FRVA 1YZQA 2IC5A 2ISQA 2YRFA 5IKOA 1YUMA 1E6CA 5H68A 2QR5A 4Y1GA 4J2OA 2H08A 3QVTA 2F64A 3OPYI 4TV8A 3U4QB 5DN6A 1XZEA 1FVOA 5EIBD 4JXZA 5H9VA 4FZRA 1Q14A 1QWOA 3I9V6 3KOXA 3LHKA 2WTEA 4UE3S 4L5AA 2V7XA 5HRCA 1CP3A 4DMKA 4X8HA 2FXIA 1IZ7A 2X4LA 4NNPA 1CUEA 1HE1C 1VXRA 2NXEA 1KZ4A 3DOCA 3H2KA 3KL4A 3L2OB 1NVGA 3MMXA 3PFBA 3PJEA 3CIOA 2P0EA 2R1ZA 4ODIA 5DCWA 2UXBB 3L18A 3FYCA 3FWPA 1ZK2A 2LUOA 5DYTA 3WDMA 1USKA 4ENPA 2O57A 2OCBA 3GNSA 3RYHA 4X92A 4N8DA 1CDEA 4BBAA 1N1GA 2GXUA 2B20A 2NNWB 3U4IA 2VUTA 3GLIE 1XVIA 2KJQA 3AVPA 4BP1A 4ZHQA 3N74A 4JR2A 3CX3A 4X91A 2GHRA 1E9FA 2PXCA 3PHLA 1FB5A 1U7HA 2HN9A 1SU6A 3GLGB 2WUWE 3OH8A 4WADA 2YV1A 5CLQA 3U56A 1N8KA 1WSWA 2NT4A 4DAEA 2CK3A 1U0LA 2QRJA 2FSGA 3R20A 1H1LA 4F45A 1ZJWA 1Y42X 2PBRA 4JLPA 4KR7A 3PE4A 2AJLI 3CNLA 1LS6A 1TU3A 3C8ZA 4S1NA 3UWPA 2FUEA 3AHHA 3LLCA 1KOGA 4UREA 1TCCA 4CBVA 3Q3JB 1BQ4A 1IM2A 4B7UA 5JSUA 3W8RA 1H23A 3QPWA 1Y8CA 1NKVA 1T4BA 4KVAA 2NVUA 1Z9BA 3H5IA 3AWDA 2VRWA 1BN6A 3MPOA 4ZVMA 3KHTA 4U0JA 1RQNA 1IOLA 4FILA 3DMHA 4I6GA 4PINA 3A31A 1WPQA 3GJSA 4B3XA 3FMFA 4BB5A 1ESMA 4D8XA 1G4HA 1Q19A 2DPLA 1H0KA 3GAFA 2ADMA 4QQKA 4WZAB 2O5EA 1C1DB 3LUGA 3ECSA 2Q1XA 4JJEA 5COAA 1KKMA 2GHIA 4BLVA 1OFCX 5IMSA 4GLBA 3QFSA 5HJEA 4GF5A 1WVGA 5IULC 3RSGA 3AIMA 2B82A 3IP6A 3LFHA 4EQZA 2Y1FA 3EZNA 3OJWA 2QRPA 1NUUA 3JR3A 4O2RA 4UHCA 5AHWA 2OLJA 1W4ZA 2BL4A 4L9AA 1JQDA 4PGAA 5HG0A 1KZYC 2WF9A 5JMPA 4G9GA 4FWTA 2GBLA 3STHA 4L6AA 3GLFA 3JY6A 3OZTA 1YTLA 1P17A 2IDZA 4ILKA 4Y9DA 3TGLA 3A1NA 1DDGA 5CLGA 1QX3A 3QK7A 3DXXA 1DOAA 1WHTB 3R5KA 3ZDAA 2EGGA 3QUQA 5ALRA 1ULAA 4YP6A 1WXWA 4GGOA 4MCHA 1U11A 3MWYW 2ABWA 4X00A 3WGMA 1F8XA 2BHSA 2WVHA 4E2WA 3QG5A 3NAZA 5DM2A 1NNLA 2WJHA 2WG2A 1XTBA 3KSMA 4FDAA 1MFPA 1GAEO 2XZPA 3H0KA 2G77B 4KTTE 2YIJA 3A4NA 3I62A 2AZXA 3AF2A 1QF6A 4C4XA 5K8LA 5KVVA 1YQGA 3OE7D 1RRKA 4PX9A 1E8MA 2D0DA 4MEBA 4RZ3A 4YRTA 2IHNA 1CJVC 3JD3A 3TUZC 1ZX1A 1JDBC 4FK8A 5F5LA 1UKAA 3LF2A 4QVKA 1UODA 3I5XA 1FZTA 1HDZA 2OHFA 1ECGA 1FUIA 2WKPA 2BPOA 2IUFA 4HSGA 3U1TA 1GZVA 1ZI8A 2R00C 1QGZA 5T5QA 5C8XA 2IEAA 3H1EA 3LUPA 4UHBA 4KPFC 1E5XA 5DHSA 4CCYB 2JIZA 4LDPA 1E99A 2RKBA 4DLWA 3IAAA 4Z0TA 3C6XA 3A6DA 5JCPA 2O8DB 4MLPA 1JEAA 5LZ5A 2QTFA 3V4FA 1WWKA 2ZDQA 3WK7A 3R2JA 5BQFA 5KWVA 5DHFA 4AJ9A 4MQ5A 3UMMA 3WNZA 3GFBA 3U26A 2AX4A 2PUVA 1CLEA 2YWGA 3GW8A 2PWAA 3ILSA 3N2IA 1MVNA 3MSXA 4C20A 3IUJA 1TD1A 2QT0A 2XMZA 3KWLA 4H3KB 4UNIA 5F1YA 1KYXA 3AVQA 2O1XA 3IJ5A 2GARA 4P83A 2HRQA 1MEEA 1MAHA 2BFDB 4OLBA 4P7FA 1U2DA 3UJ7A 1IZ8A 4QGHA 4ZCIA 1G8HA 4P4SA 5G3ZA 1BVRA 1KMHB 2HWKA 2YHSA 5DT2A 4PG8A 3PGJA 4A0FA 4M1WA 2B2XA 3R7WB 5FUXA 5JS1A 3OQIB 1SUCA 2VT7A 3LO5A 4RF3A 4JLSA 4FX5A 4CKCB 4KMOA 2NU7A 1FYFA 4EAAA 2FDXA 4HDSA 4UUMA 1B15A 1KP2A 1NFQA 4DWJA 3EXEB 4GRIA 3MCWA 1M2GA 3QIAA 4ZI5A 1TJ4A 1X1BA 3OZDA 1JDUA 1GYRA 1T1IA 1ZC4A 2Q1WA 2QQEA 1THTA 1DKRA 1XD9A 2HWUA 1RLJA 4IGKA 5JD6A 1BGVA 5KBYA 4HNTA 5LD2B 2FMFA 1Y7PA 3B1KA 2QB5A 5TQ2B 4WBNF 5BWOA 2FWRA 4PSAA 1ZBQA 5DISB 4DQUA 2VK2A 5U4QA 3AI7A 5AW5A 2W2LA 4ZU3A 1LJLA 2PZMA 3ODGA 2XGMA 1VOTA 1XL0A 2PVCA 2CHFA 4HATA 4RJTA 7REQB 1SBYA 1Z0ZA 2CFTA 3Q8KA 2X0EA 3DULA 3RB8A 1TIPA 4QT0A 4NEHB 1NJ2A 1C8VB 1O9HA 1VE1A 3IKJA 3ZGXA 4ZI7A 1TMYA 3DE2X 4OJMX 3O9MA 4GX5A 3PZBA 1L5VA 2WPDA 2ISCA 2XX3A 1IIRA 5CVJA 3H7AA 2ORED 5IJ9A 2YJ4A 4AKGA 4GMGA 1ZNXA 2Q6VA 2X5KO 5SICE 1JMKC 5ESXA 4AY5A 2ZIGA 4WLOA 2VCEA 4ZIRB 4KIJA 2RAPA 3CPJB 1WR8A 3EZ2A 4YAOA 1J2RA 1E9EA 4W5QA 1GTRA 1JPNA 1IBRA 1XT6A 2VFAA 2V98A 3CXUA 3N8HA 3NBAA 5AICA 2PD6A 1D7AA 4POOA 3OOHA 1AB5A 5CCXA 4K7JA 3VHRA 4FYIA 1LW6E 2DH5A 3SEQA 1E7YA 1Z75A 1BS9A 2GXSA 4P1ZA 3T35A 1EA7A 4JYZA 4MYCA 4Z7NB 3VTFA 4GWKA 1NI4B 1K8YB 1Z4OA 4W8GA 3AL3A 5FQOA 4EJ6A 4FEGA 1A2BA 4FYXA 4OEHA 4D43A 1KQNA 4GSKA 4M1ZA 3VV2A 4OXXA 1E0AA 3KQVA 2W6NA 5KINB 4YCCA 1F2UA 1HV8A 3GJ7A 3OCJA 3VSCA 4QOGA 1DAIA 1PZFA 2GBGA 4X7MA 5J4YA 1JVSA 5JALA 4HN9A 3RARA 1FRFS 2QP3A 4UHJA 4L0DA 1DTWA 2FZVA 4IMIB 5L3SA 1D1TA 1P4HA 3UOWA 1PSWA 3U3OA 5LR6A 2DULA 3D6MA 3ZDEA 5B1YA 5C7YA 1US8B 4CIDA 1VE7A 1GZ3A 2JEZA 1EBBA 2EIXA 3G23A 4H7KA 4N6GA 4H7FA 5F52A 3T3HA 3NUZA 2QAGA 1JUDA 2OY0A 2PWBA 4OXYA 1NAIA 4I9GA 2EHDA 4PU0A 1KRWA 1TMOA 3CNEA 4NECA 3P26A 4TM7A 2ZUVA 1BDMA 1ECJA 3FCYA 3OO1A 1RD4A 1Z88A 1U1IA 1RXIA 1IHUA 2AQHA 3OZ7A 4JEHA 5ED4A 5FXMA 1JRLA 3A7EA 4UQOA 5KHOC 4UFNA 3PQEA 1YDMA 2R7MA 4OO3A 3WWDA 4BEVA 2XB2A 1JIQA 4M88A 1P7YA 2FZ5A 4FDLA 4YDRA 5HUJA 2W2XA 4CLRB 2O2HA 5C1DA 3B53X 2J31A 2M32A 3C4QA 2N1MA 3DD5A 2BGWA 3AWIA 2QD3A 3L01A 5IVKA 3EDYA 3KU1A 4MQUA 4G07A 2FKAA 2RH9B 3K1JA 4E5SA 4CM4B 3RSCA 2O2YA 4NCAA 3A2KA 3HJAA 4GT1A 4RTLA 4FOPA 3WL3A 4PANA 1K3TA 1Z73A 3RFXA 4EB6B 3O7WA 3D6UA 3SF0A 1XZHA 1HPLA 4J1QA 4RD6A 1WXQA 4HR7A 3BKXA 3U3ZA 3I1JA 1T3HA 1Y81A 2QRGA 2YW2A 3DE3X 4JB3A 3ZBQA 2V4UA 4KPGA 3E9MA 2QVXX 3HB5X 5M3BA 1CUBA 5K9ZA 1ZQ1A 1C9EA 2BGKA 3COWA 1VJCA 4MIEA 2QRVA 2DY0A 4KE9A 1PR6A 1OBCA 3R6LA 5EZ6B 3ZDCA 4RACA 4DXHA 3SIWA 1Q1AA 1Y82A 5JZMA 4EB8A 1EG7A 1P2UA 2OZLB 1PF7E 2BEVA 4OHVA 5C8DA 1QSGA 3OZRA 1HETA 4Z4QA 1ZMTA 4XB1A 1E5QA 3TZBA 5HXAA 2I2FA 4MVJP 2CL0X 2CW5A 2ZI4A 2EBUA 1O94A 1MIOB 2P67A 3NBFA 2GO1A 5ALWA 2EQAA 2RKOA 2ZDHA 2FSIA 2IYPA 1MOQA 1ST3A 2OFXA 3E5HA 4XJVA 1W87A 4Y1FA 1GPNA 4OAQA 5C1IA 1OGIA 3QWIA 4YP5A 4PHCA 5FLYA 1PKXA 4QTZA 3ND6A 1HSOA 3CLUD 1X9GA 1ES9A 1YR3A 2XQVA 2JKVA 3F9CA 1Y1RA 4M9RA 2MSCB 3O83A 3MMPA 4RHUA 1E4VA 1U1CA 2FPUA 2X4IA 1NG1A 4F4JA 2ZTMA 4BEBA 3IDQA 3L05A 4E4YA 4X93A 1U0NA 2Q07A 3COYA 1ZCZA 2XA1A 3V80A 2AW5A 3G0OA 3ANNA 1EHYA 3VNAA 2GS9A 2HWXA 2RBEA 1VJGA 2AOUA 2JLWA 1C3JA 2FN7A 1RYDA 3P97A 4MP6A 4E30A 4LSGA 2G83A 4NU0A 2ZYWX 2CCKA 2NXWA 1XEWX 3S29A 2OECA 1CB0A 3P27A 1TRKA 3IP3A 5EFZA 1P1HA 1DIHA 2BJVA 1KC3A 2QX6A 1O9BA 4MGZR 4J8PA 1E6LA 1ATIA 1GQQA 3LCVB 2DPHA 1IATA 5E2BA 1KY4A 4L7QA 4FN4A 3MD9A 4JMPA 2V7WA 1ZD3A 3H6HA 1M6HA 3AF0A 4MQ4A 3PSAA 4TTJA 2O7VA 4FW8A 3JVEA 5ESWA 4S3MA 2FEOA 1EXWA 3AF4A 3R7NA 1YB5A 4D3SA 4KYUA 5DX8A 5LA6B 3W0LB 1MU0A 3I04A 1BS2A 4OL9A 1YS4A 4FLMA 2A9FA 2C77A 4X44A 1Q50A 4EYSA 1K08A 1Z4KA 4C04A 3MPUA 3OIVA 1BOOA 2R6ZA 3RYCA 3OJ0A 4LJ6A 2G9RA 3S1LA 2LW7A 1B1AA 3VR4A 3ERCA 3IEXA 4CLEA 1ZESA 4DDUA 4O4LA 2QNRA 1PR3A 1FDVA 1R66A 1DIGA 1FBNA 2I4OA 4ITUA 5AH0A 5HZGA 3TXXA 1AGPA 3E0QA 4BNDB 2PCLA 3K96A 3JU3A 3H7IA 5B58T 8LDHA 2A1TS 4RJKA 1M2VB 5KTTA 3EULA 4HDMB 5EJFA 1PT7A 1RJ9B 2IYXA 1M34B 2QDXA 2FPGB 3LM8A 3O8LA 4G36A 4R81A 4YRQA 3H84A 3U1BA 2UU9B 4GE3A 5JSYA 4CPDA 5TNXA 2P1ZA 5A5FA 2YYSA 1CDZA 3D02A 3VDMA 3LBFA 1ABBA 3JQ7A 3RKUA 1OXXK 1FNNA 2JIPA 4V0NA 2ODEA 2H5EA 1RIFA 2OTCA 2BGUA 2Y3IA 2QTCA 5IK2D 5JOQA 1X9HA 1J39A 1DBSA 2XCSB 3BBLA 2VNSA 3LI2A 4KFRA 4I1PA 2O8FA 4OGWA 3THXB 1XZBA 1NVFA 1RC0A 2AKEA 2WYOA 3CRZA 4ND3A 3VOTA 2R7LA 3IXLA 2I6UA 2WV9A 3IA2A 2XT9A 4N5LA 4ESEA 4POAA 3K0CC 3FMIA 4UE6A 4L8FA 3SJ7A 2OFPA 5HGXA 3T0IA 4F5WA 2I2CA 2I1LA 4AQDA 1SOMA 1P62B 4PXAA 4Q02A 1TZBA 1Z7BA 1LNZA 3FOEC 2EG5A 2P9FA 2H9IA 1B43A 4GPZA 2IYFA 1ZCAA 3WICA 2GEFA 3QVWA 1CK4A 4EYEA 1KHHA 5C1PA 3RUIA 3K5WA 4UEJA 2XWJI 2PN1A 4D4JA 1YJ8A 4E03A 3UWMA 3GOHA 1XDSA 2HI0A 4QYXA 3K2EA 1BFDA 4UCXA 1MVOA 5ARDA 3RFFA 3B60A 2G1PA 3AB8A 1F2TA 1P0QA 1SBIA 2UZ1B 5FPQA 3WGOA 2CCJA 1XELA 3AF1A 5I7EA 2GKGA 1IVSA 2GQ0A 1T91A 2BMFA 1ETHA 2CDBA 2IUEA 1V8DA 3VNVA 1OXKB 4JV5B 3DO5A 3QG1A 2Y76A 4M60A 4XUDA 1JWLA 2QPTA 3W4KA 1OIXA 4IUCS 3K9NA 2Y8EA 3IAEA 4RZ2A 2WU0A 2EFJA 3ESRA 4HDNB 5KJ6A 3BTUA 4Z1MA 3SDZA 3CRMA 3CKLA 1DKUA 2ID7A 2WAMA 3KS9A 5BN5B 5TV2A 1KSGA 4R2WA 1KFKB 1MGPA 4X3OA 6ABPA 2Z6UA 1TXGA 1XOIA 3KQNA 4XCVA 5J9FA 1R9NA 1MB3A 5HQ3A 3DTTA 1R37A 4ACAA 3DEKA 4OHPA 3V4PB 1EX9A 1K6XA 1AK2A 3WGIA 3GUHA 4R7TA 4OQXA 3U4CA 1N1EA 1SCNE 1L4BA 1YAJA 2W2PA 2XE6A 3E9ZA 4KIWA 4B40A 5CJ2A 2HX1A 3PPVA 1H4TA 4I4IA 2QZJA 2QLFA 3KKPA 3MYRA 2BZ0A 3FRJA 5CK5A 2R1TB 2H51A 3FDFA 3VA7A 4H0NA 4D4KA 3OO0A 1Y9DA 4QBGB 3D3NA 2I87A 5HS4A 3FCXA 2PMCA 1DEAA 3OE5A 1GQRA 3L1VA 4KQ1A 4M99A 5ECWA 1Q0QA 1U0FA 3FWNA 3QVGB 2X42A 1UM9A 2BKVA 4L4ZA 4DLSA 2J5BA 3MLAA 5AR1A 1VLQA 1CRZA 1Y3IA 4YNBA 3KKKA 1XALA 5GONA 4F6LA 3I1FA 4BO2A 2OL4A 4H0FA 3HPRA 1Y3HA 3TUIC 4JOCA 5CVUA 5EHQA 1VSBA 2NZ8A 2WNHA 4KBGA 2SKEA 4DJEC 1QRTA 4K87A 2NUPB 1G6Q1 4ND7A 4RVDA 3ITNA 2VNAA 4Y2PA 3C6ZA 2D5AA 2I2BA 4DUGD 3E2PA 4RHYA 4Z4GA 1MJHA 1LV7A 2QZSA 5E1MA 1NRXA 3FPCA 2H5IA 3OJEA 2B61A 1T5TA 4QICA 4PNZA 1NUQA 2P2ZA 3ZE2B 4B0OA 1JLRA 2H2GA 1MUUA 2JBHA 4XVHA 5FV7A 3NT5A 1IHOA 3T61A 1VRWA 3WGQA 5ENDA 1SULA 3H2SA 3AETB 3B78A 4IDOA 1L8LA 2WU1A 1J6UA 4J90A 4GL2A 1U98A 4A8JB 3QV2A 2WR8A 1YOVA 4GMFA 5HFAA 3VR1A 3A9TA 1GRVA 5CP8A 2C7RA 1K89A 2JNWA 2HO4A 3MGGA 3IDOA 1G8PA 5FOQA 2YX1A 1UC5B 2HU8A 5EQTA 1YZUA 4BB6A 1MC8A 3P4UA 2EZTA 1T6NA 2Z2YA 1DL5A 1SQ0A 4PG5A 5T8KA 3EW7A 1YBMA 4I5DA 5KJFA 2OV8A 4RBNA 3YASA 4MKIA 3TG2A 3OTOB 3QH4A 2ORWA 4XX0B 5CFQA 3N2KB 4PBRA 4KNYA 3M9XA 4DV7B 5HP4A 5BYAA 4WL0A 4R51A 3KSRA 1JP7A 2OV3A 1UC8A 3GLRA 4A03A 3M3PA 3X2EA 2HSWA 1KTVA 3FFWA 2YBDA 3DDZX 1DBQA 1CB7A 4DARA 4C4ZA 1EVIA 1DPFA 5IS2A 1Z13A 2JGLA 4UQPA 5EUBA 5D7BA 1AF4A 1A2QA 1XF9A 1GRRA 2L69A 3QW2A 4QQ8A 3GG9A 4KPEC 1VSQA 4F4DA 2CMFA 1E4EA 5KB3A 3DW1X 1TT5A 3ET4A 1NW7A 1T8UA 3MIIA 4Z4IA 5L9AA 2ZUEA 3WKEA 3U60B 5EPOA 1EVYA 1ZI6A 2NUTB 3BT7A 3P0IA 2GJ4A 3JQRA 4I5GA 4ND1A 1SVKA 3KR1A 4ITVA 5B6JA 1USVA 2YXBA 2QM8A 3CISA 3DD1A 2CBZA 2DVMA 1LU9A 3KL2A 1JEDA 4XGIA 3DEHA 2DWOA 4ZAFA 3ZXSA 3EPKA 1XD2A 3KEOA 4WACA 4KODA 1Q0TA 2O50A 1QK3A 4LJ9A 5KSWB 4DHEA 2WDZA 2H9AA 1F0NA 2ZROA 5CNIA 1LK0A 1WV1A 1WY7A 3B2QA 2X2EA 4FXPA 3H83A 1Y8ZA 2PMBA 3H5WA 5IRCD 3GUUA 5G4KB 3FB1A 1GR1A 4D4IA 3TD6A 1JBKA 1QVRA 1WLYA 4PBSA 5BNIA 1MCZA 1J2JA 4B4KA 2VPXA 2BEUA 1WBBA 3RS8A 2I67A 2B25A 2Q3MA 1NBAA 1LKZA 2OYSA 4PLYA 4YONB 3F6BX 5FAKA 4IL5A 3VU3A 2C97A 4A16A 1HSZA 1G4AE 4FFRA 1LJ8A 2WIKA 4YPFA 1L1FA 4BRWA 4DCCA 1RWXA 5DM60 2XTZA 2WB4A 2HQ1A 1ECFA 3NP9A 3R4CA 5FL3A 4M6WA 4R1OA 1T8WA 3VKGA 1F0YA 2H48A 3GMSA 1NIJA 4W1SA 2W8ZA 1RLUA 1O96A 2OZVA 2VEDA 2GEVA 3WQHA 5FUMA 5LLTA 5EHIA 1U8FO 4DA6A 3WX0A 4V0RA 2GDJA 1SHZA 4EMSA 4A8PA 5IAKA 2ILTA 3L7BA 5JQGA 2UZ4A 1Y1KE 4N5NA 1WX1A 5EVCA 1GGKA 1HEIA 4MDHA 3TIIA 3T3MB 2DSNA 3MC1A 4K46A 2PFSA 2AQIA 2C2WA 2VF4X 3RWMB 4I55B 3PD0A 1TL7C 3H18A 4Q4DA 3RBAA 1ZNZA 1GDHA 1NVDA 3NXKA 3WGHA 4AZ3B 4D8VA 2ZCVA 9ATCA 4RHTA 1JYSA 1NW4A 3E15A 3OFVA 4D82A 2GK3A 3VH4A 2AN3A 1VMIA 1QKJA 4GMXA 2VZEA 2WSLA 4I19A 4PV7A 2GD6A 4YCJA 4NFHA 1N6IA 2O0LA 2ZJ8A 4LIPD 5GMOA 3RVMA 1Z6QA 2WWFA 2PS9A 1GGMA 4GPIB 3JPYA 5LZ9A 4CMIB 2D6FA 2HFJA 2E37A 2VTKA 4MUYA 2ZR7A 4UE2A 1ULUA 1F2DA 1WG8A 2BFMA 1K75A 4V2UA 2EATA 1KU6A 4YACA 3IBFA 4N41A 1GKKA 2WDPA 1ZRSA 3DL2A 1FYWA 4ZOEA 1H3EA 3Q8MA 4DSOA 3F7OA 3D7NA 3CLUC 3V2GA 2XNCA 1Q7GA 1VLHA 3OFJA 4XW2A 4RIHA 1VCIA 1XKLA 1EM6A 3KXLA 4IH4A 5HE9A 4EUSA 3DOEA 2OUIA 3ROFA 1OI3A 4C9BA 3WYDA 4OGLA 4OGGA 3SBDA 5KYXA 2GPBA 4HRXA 4OUKX 5JY1A 2CFSA 3HCBA 4TGLA 3P9YA 4C4PA 1TZCA 3G88A 2D7DA 2AG0A 2OXFA 4JITA 5LP6F 3UHOA 2BM1A 3SKXA 2NZVG 5FWDA 3E9DA 5E2IA 2A57A 4JSYA 4QULA 3F97A 3WJ2A 1OX6A 3C5VA 2IYRA 1G0OA 4OAPA 5HOQA 1E2JA 3MSCA 5D5PA 2ORIA 1N2CE 1F51E 1RABA 2P2GA 1UMBA 2P6PA 2R3SA 3F6EX 4IIHA 4PSKA 4QFDA 4C0WA 5B4VA 1G8YA 3Q7PA 1Q16A 1J7KA 1OI4A 4Q7JB 5EXXA 2ATCA 2O3QA 3P2MA 5KWSA 4MVJI 3DBLA 2PSSA 2F4VB 1MJFA 2IE0A 1GYPA 1NSFA 4P4UA 2A7XA 3WIOA 4UNQA 1O3YA 2B0CA 3BX1A 4M1TA 5E6RA 4C7OA 3EFHA 2RAFA 3H1AA 1TE2A 1E0KA 1UZLA 1W1UA 1WXHA 1JDPA 4HGZA 1RRGA 4M0PA 1TI7A 3IKVA 3PVSA 4PLTA 4TTQA 2Z04A 2P11A 2QPOA 3LCCA 3PX3A 1ZW1A 5F77A 5EYPB 1IMOA 4TYWA 2AK2A 4EY8A 2L17A 4CFYA 3F8SA 1JTEA 1LJUA 1W47A 3N2GA 5TJHA 4TKMA 4AMYA 4EB0A 4PX5A 3BWBA 3NXSA 5JSFA 2J4FA 3GEPA 1A1SA 5DT9A 2BYTA 1CS0B 1VGVA 3NQ41 1VE6A 1RYEA 3D8HA 3L82B 4J6EA 5AJUA 1QIGA 2PZGA 4B09A 1BXRB 5SY9A 5F7JA 4HDRB 3K4QA 3WL8A 2YJ3A 1T0IA 3GO4A 1N6KA 2C1XA 2JH8A 1D2GA 1QB7A 3RLIA 3FPLA 3HU5A 4E5MA 1WPXA 2B34A 3EDRA 3AG5A 3AUXA 3EVBA 4IDHA 4WGGA 1E62A 1CJTC 4BV2A 1UBKS 3LDGA 1PR5A 5A3VA 4H4EA 3G49A 1YQ9A 1PE0A 5HCNA 4ONEA 1R0XA 2Z4TA 4GEGA 2PQ6A 3L06A 1E7QA 1EM8A 4MRVA 4Y9SA 3M6LA 2YCLA 5AKYA 3FUXA 3B1FA 2GN9A 5LD2C 2B94A 5MN6A 3IAS6 1ZOIA 1N9GA 3NHFA 5H83A 1UBSB 3H4MA 4D41A 1Z37A 1EDOA 1PJBA 2WKWA 4URHA 1PU2A 1GNTA 2JI7A 4EHHA 4X6UA 3EIWA 4N49A 4L5IA 3WK8A 4E5VA 4DB2A 1X6VA 1DLJA 4I3GA 1XDUA 5IARA 3PL1A 2H06A 3OC0A 2HREA 5EXPA 5AXAA 2VQ3A 4OU4A 3J7AC 1E3DA 1M8FA 2BEKA 3FHTA 4AROA 2F4NA 4QBKA 4PNPA 3PXXA 1UJ2A 4LF9B 5DKFA 1RRMA 3HO8A 4LYHA 4U7FA 5DM4A 5ICEA 3ZU3A 4ER7A 5IUNC 2FEXA 1DC3A 3VTZA 2QW8A 4RE5A 2IW1A 2ZWVA 3TQSA 2QSUA 4BE4A 3G1TA 3NMUF 1NWHA 1IEXA 4UUAA 4BO5A 4NBNA 2FEPA 5FUVA 2CV2A 3MW8A 4P32A 4BNHA 3J80A 2BI8A 2E1PA 2YQ5A 3VO1A 5CFOA 2CXRA 3AVOA 3H99A 3BH6A 3W2HA 5BV1A 4XWYA 1REQA 2QI9F 1AV6A 4AKHA 4WECA 1IHYA 1P72A 2FRXA 2QJTA 3VOAA 3BYZA 2V5UA 1GV1A 2BFEB 4B6SA 1PR0A 2C1ZA 3NNNA 3GLGA 2UVDA 3CHYA 1SFRA 3CJRA 4MJ3A 3GGGA 3L04A 1ODLA 4UAGA 3Q7TA 2IOFK 2Q3CA 1JU9A 4IICA 4AUMA 4KMRA 2UZAA 1RKXA 4UULA 1CVLA 2OMKA 4LC0A 1G5QA 1NT4A 2MR5A 2W6MA 3MCTA 4GI3A 4TWBA 5EJMA 1AF7A 3V2UA 1W4LA 4BKPA 3RSLA 1EWYA 2HT6A 5HE8A 4XH9B 3WIVA 2Q3LA 4KN9S 4EENA 5IU6A 3ZTYA 2I1VB 5I47A 2VVTA 4JI6B 4DBZA 3DCIA 4RD0A 4V1CI 4EF6A 5ES4B 3QXHA 1L5RA 5KOIA 1PFVA 5EHXA 2VK8A 1I4WA 3I5UA 2PCJA 1U9CA 1KBZA 2ZUDA 3K1YA 5DNAA 1GD1O 3FOBA 3PC7A 4EAQA 2IZ0A 3IOMA 1ONSA 3TOSA 1LDMA 3EIEA 3KLMX 3PLRA 4MDYA 5C18A 5GWXA 2HMAA 1Z4IA 2GF0A 3E05A 2RK4A 1JMVA 1ZHHA 4MUEA 2K6GA 2RE8A 4QGFA 4RMJA 5CFMA 2Z9CA 2YL2A 4KXMA 4ZP1A 1G9TA 1L4LA 2DKFA 3ENWA 4X3CA 4B81A 1ZM3A 2FN9A 1I2MA 1LNQA 4DMCA 4CF7A 3AOGA 1XVUA 4BB9A 1E2DA 2QM7A 4I50F 3WDSA 3I83A 4ERNA 3NHRA 2QTBA 5LSAA 3T1OA 1YJ5A 3PRYA 3V00A 5D3KA 3ZCXA 2IOQA 1TGYA 3DVSX 2DTXA 2SCUB 4LDZA 3ZIDA 5IN5A 4XXHA 3WV4A 2GZSA 4B4DA 4LHZA 1EFVB 3CKMA 3VR6H 4D9IA 2VHWA 3QF4A 4R2HA 3FPHA 1WUIS 4GOXA 3AY3A 1H4SA 2O8NA 3IO5A 3SKVA 4ABYA 1SA0B 5CDSA 1L4UA 4CG2A 1JHMA 5JS7A 5HK9A 5B37A 3SF8A 3ICQB 2HHHB 2AS0A 2QLTA 3H05A 2FG7C 3P2OA 4DA8A 4O2AA 3CVWA 3W3AH 1Z5ZA 3GUVA 1DBPA 2OZPA 1TQ2A 1XN1A 1Q3KA 1II0A 1XJQA 2BD0A 3QX8A 5K3EA 3TH5A 5KTMA 1RC1A 4K1XA 4RMHA 1QGUB 1NMYA 1OV4A 2VJMB 5L6LB 2ERYA 3UA3A 3E23A 5JSZA 3A4MA 3E7WA 1E9DA 3ONNA 4WINA 3W6ZA 4C4SA 1LLFA 4MQBA 1WETA 1HDCA 2A7QA 4IRMA 3LGXA 1XHLA 4LKRA 4M0UA 3V7WA 2HGSA 4P22A 1PJAA 1TA0A 1DO0A 2B4AA 4YASA 4CIAA 4N7JA 2H8GA 1BCRB 2IL1A 4AD8A 1PT6A 2VJBA 2VO1A 3OEEA 3KO8A 4A2WA 2R96A 4WUVA 2YJ5A 3GT7A 3E9YA 1ZFNA 1CY2A 4GNRA 4K6FA 2R6R1 4N3NA 4ZO4A 5DRYA 3TQRA 2XXAA 5KYTA 4MV8A 4YUXA 5IDQA 3BS4A 5AKXA 4CMGA 3I9OA 3CSUA 1YR6A 3O8CA 1IWPB 3TZKA 1GL7A 2YJZA 1S9HA 1WXIA 4AAYA 1OB2A 5IP5A 2EEPA 3BB4A 2PANA 2MTBA 5J5CA 1OGJA 2PX5A 2YVUA 4Q01A 3ZPXA 3TECE 1TAUA 1E1CB 2FW1A 4HQKA 1V3VA 3M6FA 3MT8A 4XLZA 4P58A 4ZV9A 1N2IA 5HMMA 3VNRA 4CKCA 5L3QA 4OP2A 1QIFA 3INYA 2NU8B 1D09A 3QXGA 1KI4A 4FGUA 5EIAA 1Z6TA 1DNPA 4Y98A 3O4IA 1U9ZA 2AC7A 1P1KA 3AJEA 3QVSA 4TMTA 2AZDA 4B3SB 3IUBA 4GVXA 2FPOA 4FNGA 3WLSA 5K6AA 1C30B 1P9WA 3GLHE 3MMNA 3EQ7A 4MR8A 5YASA 5CBPA 1P0FA 3A2MA 3GGCA 3HB7A 3O3MB 3T7JA 1E60A 1CUXA 2XSZA 4HGPA 1KE2A 2IGBA 1LH0A 1JILA 3M49A 3VR3A 5KWEA 3L7KA 4AQYB 2FTKE 3FTDA 2XCTB 1NW8A 1XRRA 1DCMA 2J5RA 4FM9A 5BP7A 1KR2A 2NM0A 2HU5A 2C4TA 4LDJA 5AQ1A 1EWQA 3PWTA 4OBBA 4O4HA 4BCCA 4TQ9A 3IEVA 4PYKA 3DLPX 1U28A 4N9QA 1E20A 1B6SA 1I0LA 2OBBA 2OM6A 2Q6OA 4OHOA 4ZYVA 2ZM6B 1YZFA 2Q62A 2BUBA 4ALKA 1ELOA 2GXAA 2OMEA 1IMJA 2AE1A 1NYQA 4MOWA 2EJUA 1P9OA 4N6OA 1PZEA 4O1IA 1YZNA 3U9LA 3U4AA 1KDVA 3L4BC 2HCBA 2QUBA 5A71A 2FEWB 4UTNA 1D6MA 5DGIA 4N47A 4M0LA 3HS3A 3W5HA 1Y4AE 2VHCA 4DDKA 1YL7A 3W9UA 2PRIA 2A86A 5EIXA 1MIHA 2SBTA 3Q4GA 2OOKA 1WPGA 3KZVA 4FMPA 4XD7A 3GQVA 3TXYA 2W2VA 1WEHA 3NGXA 4Q15A 2OKCA 3AEUA 1NYRA 2Z6QA 4QYIB 3PUKA 4P34A 3G0BA 5FLEX 3GXOA 4W7IA 4ZOAA 2HJVA 5EMNA 1KYTA 2G5TA 2FG5A 5IAGA 1E3JA 2GTHA 2ZBPA 1EPUA 1M0TA 1ORIA 4BUZA 5I3ZA 3M6IA 3O75A 2CD9A 1MJNA 1UMDB 2YWCA 4ZVNA 2ZBGA 5JQGF 3DZIA 4DR6B 3FZEA 3PLAE 1G291 4YTEA 5BO5A 3UF0A 3LBIA 4CHGA 4NXNB 3LQQA 3N8IA 1Q17A 5CDHA 1H5NA 3HVHA 2QU7A 2WAAA 2WNSA 2BE9A 3H1PA 2XGSA 3SYKA 3W04A 3L6BA 2L82A 3ENVA 1AG9A 2J3EA 3NTLA 3RLFA 1ZITA 3GCGA 3PT5A 3PUWA 1E6EA 4V0KA 5KKNB 5TLSA 1Z28A 2IXGA 5HOEA 1COWA 2EL9A 3GMDA 1TECE 3AHJA 1RE1A 4F6RB 4PRYA 8AT1A 5FWNA 3BKWA 3E58A 4R9NA 1LA2A 1B0ZA 5IUKC 1X8JA 4WK4B 4BFXA 2J6CA 4EJFA 3U7HB 1HURA 3NEYA 1BE6A 1PYDA 3IQHX 1VE9A 3RK4A 3HCEA 3X1JA 2FR1A 4GP6A 4E7PA 4UBLA 2LPMA 4QUJA 2F62A 4ASUA 1DEXA 3BM5A 3O1IC 4RLSA 3SHTA 3ZV4A 2GM4A 1HY3A 3OFKA 3GEBA 1Z5UA 3GP5A 5SV2A 3U3RA 4CLRA 2AKAB 3NDJA 1UADA 3JWEA 4FXOA 3CEPB 4IEIA 3P52A 2OFFA 5F3DA 2BSQA 2GKOA 1XIVA 3OMXA 5CNKA 4RULA 3KOZA 4HBZA 2N42A 1UFRA 3QITA 1VCOA 4CM4A 1QNFA 4RF2A 3TO5A 1ZW6A 2ZRKA 3FVQA 4B3DA 4DWWA 4XWOA 2W6ZA 5LQNA 4WASA 3BMOB 3AHGA 4G9BA 3JATB 2PFGA 2B3TA 2H63A 4W5HA 1ATZA 3ZYZA 4GIBA 1S2DA 2H4YA 3OF3A 4MLDA 3EEQA 3ZNOA 4ZMRA 4UBKA 1YQXA 2YHIB 1HH4A 4IHJB 2JJ1D 3FNIA 3ZHXA 4RTOA 2V5VA 2Y1OA 3PBKA 1O77A 2J4CA 3AR6A 2XF8A 2HJSA 5J5VA 3QX7A 3D64A 3ZLVA 4QRIA 4BBJA 3JASA 3VR2D 4Z4CA 3W7VA 4LJ8A 4NLLA 5MHTA 5CX1B 1HTWA 2OXRA 3KOOA 4YRFA 3TKLA 4M9SA 3MS7A 4UFPA 1T4CB 3TG8A 1OFVA 2ZREA 1D9XA 1XKTA 3TDMA 1RZ3A 1QZ3A 1QCCA 1G3UA 1OWLA 3QYFA 5CDGA 5GOTA 4EFNA 1CF9A 2EP8A 2PGIA 3E3LA 3MGAA 5CT9A 1CX9B 5KU7A 3PYLA 1CZUA 2AFIA 1YB4A 1P75A 1LS1A 1H2YA 3GAMA 4JB0A 4L78A 4RFVA 5B3JC 3T7SA 4F4HA 5ERYA 1K4MA 1TYBE 2YNMA 3HSKA 4N18A 3W79A 4JROA 2JGRA 4B7ZA 2XCRB 1JKFA