4D3DA

Structure of imine reductase bcsired from bacillus cereus bag3x2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
285
structure length
285
Chain Sequence
NRKSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords IMINE REDUCTASE
total genus 116
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3dA01
4WASA 5HBRA 1JAXA 4DRYA 4R51A 4UUNA 3U4DA 3DWFA 3H5RA 2JCYA 3TPCA 2VRBA 3GRPA 1J0XO 3F9IA 3A14A 4IDBA 4OJNA 1HSZA 1X13A 3GLQA 4J7CA 2P68A 3LK7A 4G2NA 1H5QA 1NAHA 1EMDA 2PKQP 4UUOA 1SBYA 1ZNQO 2X4GA 3VDQA 3MEQA 5T6BA 3E5RA 1LJ8A 1QXSA 3GFBA 2B35A 4P4GA 3VVCA 1O5IA 2Q46A 3WNQA 1X0XA 4IDGA 4X54A 3ZNQA 2B4QA 2GLXA 1XCBA 1GV0A 3AU8A 3GQVA 4UVGA 4XEHA 4BNFA 3MJEA 5I9LA 5JCJD 1N9GA 1C14A 2YFHA 3JYLA 3OETA 3JQFC 2BFOA 3QVXA 2HJRA 5EQDA 1GL3A 1D4FA 1ZJYA 2HCTA 3GMDA 1EFKA 3H3JA 3RWBA 1LEHA 2CNBA 2EWMA 2ZYGA 2G5CA 2Y1CA 4JBHA 3SX2A 4E13A 3L77A 2NACA 2C29D 1EE9A 4II3A 4XWYA 2J6IA 1YO6A 4BGIA 3GMSA 5ILGA 4BV8A 1BHSA 4XYBA 2EXXA 4LRSB 3O03A 3OM9A 1CIVA 1VLLA 3ZWXA 5B4TA 1JKIA 5BNTA 4GX0A 1I32A 3CXRA 1B8VA 3W6UA 1O8CA 3CTVA 1ENZA 5IZ4A 3B6ZA 3CMCO 4CR6A 2XPCA 3S8MA 4W9NC 2VYND 2NLOA 2A9FA 3D3EA 5DN9A 2Y1EA 3VVBA 4GWGA 2IEDA 3BZUA 2CSUA 1XU9A 1H6AA 3K9QO 1NASA 4E3ZA 4WLFA 1C3VA 4ESOA 2OBNA 2PGJA 4YEDA 1GPJA 4YJHB 3UUWA 2X9GA 2Y67A 2JD2A 2PGLA 4UULA 1GZ6A 5B1YA 3MJSA 3DMTA 3AOEC 3KEOA 1BXZA 1JWBB 3Q2IA 4OH1A 2HUNA 1L1FA 3QRWA 1SNYA 1V3TA 1HKUA 1DHRA 3G3EA 3TZQA 4TRJA 1E77A 1B0AA 2Y99A 4NFHA 3OJEA 5KWEA 4FJ0A 1B15A 1LRKA 3CTMA 4LISA 1HDZA 2UDPA 2HMUA 4CMEC 3Q0EA 4ZRNA 4FJ2A 3VAZA 4FFRA 3WDSA 4CQMD 2BRUA 3BHIA 2ZIZA 2VZ8A 4RF5A 1JKFA 1M2WA 3S55A 1YOVB 1EVZA 2X0RA 1EQ2A 4DBVO 3TN7A 1K6XA 1LDNA 1W6UA 2EKLA 3FTNA 4UVIA 5CAEA 4D0SA 4HFMA 4GQAA 3Q9NA 4EI2A 4J90A 1S6YA 5JY6A 3P19A 4BO9A 1HWYA 3C1OA 1IZ9A 1DC6A 3RJ5A 3JQCA 4GWKA 1JVBA 3UOGA 1XHLA 3PJEA 3IJRA 2I65A 3WG9A 2JKVA 2BFPA 1GV1A 3R1IA 4TZKA 5FYDA 3Q6IA 1EFLA 3NUGA 2JL1A 4RQTA 1AHIA 3LVFO 3ZU3A 1WLYA 1A9ZA 1SPXA 1E5QA 2CY0A 4BV9A 1KEVA 4FOSA 5BQFA 4FS3A 1BXKA 4JBIA 2VHWA 3WJ7A 3PHGA 1KEUA 4Y6PA 3UFXA 4AJ1A 3AUAA 3QY9A 1X7DA 4II2A 2Y0CA 1CETA 1OZAA 3SEFA 1GYRA 1LNQA 4E5KA 4CMCA 2QQ5A 4M49A 2JCXA 2J8ZA 2RHCA 3AI1A 2AEJA 5JSFA 4A27A 1S7CA 5KJ1A 4HXYA 3ZWBA 4CV3A 5A9TA 5GMOA 4IQ8A 2P4QA 1D7OA 3WTBA 3KRTA 2FSSA 3WGYA 4YAKA 1NPYA 3IKTA 4CM8B 1UUFA 1NBOA 2YY7A 2PGDA 3B1JA 2HSDA 4OMUA 3RFXA 5TJHA 1MX3A 3RBZA 4BB6A 4MKZA 5TF4A 4EJ6A 3PLNA 1X7HA 4LGVA 4U0KA 1NTOA 3QV1A 1ZW1A 2P9CA 3RI3A 4IGFA 4R9RA 3HN7A 4W9NA 4E2ZA 1PGOA 5FI5A 2VCYA 3U5TA 2DPHA 3ZCXA 2FN7A 3UKOA 1PJ2A 4LCEA 4R5MA 5DP2A 5THQA 3WNVA 7ADHA 3V1YA 3ZN2A 3NEPX 1YE3A 2CDAA 1CWUA 1EUZA 3FRJA 4RVUA 2CDBA 1R4NB 3VH1A 5HRUA 1TXGA 1J5PA 1KETA 4E5NA 1ISFA 3DZHA 3I3OA 4EGFA 3GHYA 3ANLA 3KLMX 1GD1O 2R00C 2PA3A 2FR1A 2DC1A 1LX6A 3OHSX 4JROA 4RPJA 5AXDA 2C2XA 4LVCA 3AU9A 3Q3CA 3S2FA 4EZBA 2QYTA 4YA6A 5AXAA 1Q0QA 3N58A 1E3SA 3ETEA 3GUCA 1SB8A 4PRLA 1KERA 3UGKA 3KYCB 2I67A 1Q7CA 2ZB4A 3U4HA 5KVVA 5EJ2A 3U9LA 4QQRA 2AHRA 3WMWA 4OGWA 1PJLA 4BQPA 3MTJA 4IPTA 3VZQA 5IXSA 1J49A 4CLRA 3VPXA 5GZ3A 1Z45A 2JD1A 5U9CA 1ENOA 4N5MA 1ADGA 3K30A 4CM6A 1TI7A 2YQ4A 1ONPA 3SC6A 1GQQA 4BMVA 3G0OA 3KETA 2BHLA 2C82A 3LT4A 1N92A 2Q99A 4EBFA 1FDSA 4EITA 1LBEA 1U9JA 4JK3A 3ICCA 2Y68A 4J4HA 4AJ4A 4R1SA 2DBRA 3W1VA 1YQGA 1ZMTA 5DOZA 3PTZA 4TMFA 1PZFA 5L53A 4JBGA 4P4NA 3H9GA 4RVFA 5TT0A 3B70A 3AM4A 1NVTA 4DMMA 4WCFC 4MP8A 5IZCC 3RUEA 2E49A 3OICA 3W6ZA 3ANNA 4QXMA 1DXYA 2OGUA 3I9LA 1YXMA 3VH4A 3UH1A 2EEZA 5AOVA 1A4UA 4OSOA 4NI5A 5T8KC 2O7QA 3M1AA 1OBFO 3AFMA 4O0LA 4XYGA 3V5NA 1Y5MA 3ROKA 2NU9A 4PLTA 3AFNA 3FD8A 4WEOA 1W73A 1SB9A 1V8BA 1GUZA 1NR7A 4ALNA 3WGIA 1RM5A 2FZWA 2P5YA 5JBIA 2Y1FA 5F1KA 2O3QA 4MINA 2FHSA 3AK4A 3VPSA 1OC2A 3QWIA 4DIFA 2J5QA 1UDAA 3IQDB 5GZ6A 1I24A 1YS4A 4R16A 1O89A 2GZ3A 4LMRA 1WZIA 2EERA 5JC8A 1BSVA 2IZ0A 4ID9A 4MIYA 1E1KA 3O38A 1T26A 2WD7B 2UAGA 1FDUA 1IULA 1BXGA 1ID1A 1EEHA 2ZTMA 3L4BC 1EZ4A 1UR5A 3PVZA 4P4LA 3SJUA 3INGA 3TOXA 4BO0A 1N7HA 3DHEA 2G82A 3VZPA 2WDZA 3KTDA 2QG4A 1H9BA 3DAFA 4IINA 1HE3A 3FBGA 4KDEA 4A7PA 3E48A 2B37A 1QKIA 1SOVA 1TT7A 4Z0HO 3OQ6A 1I2BA 5JDIC 2VHXA 3ONEA 5DF1A 4CMIB 3ETDA 4J9UE 1U7HA 2RHRA 3GEDA 1UXKA 2F1KA 1KS9A 5DNAA 4BNIA 1HDYA 1LQTA 3I6QA 3QWBA 2NADA 5KOIA 3C24A 1O6ZA 1ISMA 3NT4A 4QO7A 5I8WA 1ONNA 1EDZA 3HADA 4HUJA 4XR9A 3KVOA 3QHAA 3LYLA 3F4LA 2RBEA 5I7SA 4PG6A 5EMHA 4PLFA 4YQYA 5KJEA 3WB9A 1ISHA 4FOOA 3HZZA 5G2OA 1R15A 3D1LA 4L4RA 2XXBA 5T8KA 3VC7A 3RSHA 3H3FA 2WYWA 2Q1TA 1BRMA 4FFPA 3DEYX 3F4BA 2PH5A 1L7DA 3PHHA 4M55A 3PFFA 1GYPA 5F21A 1JTVA 3BYZA 2P4HX 2CVQA 4WCFA 3WGHA 4KUGA 2C5AA 3BTUA 3RU9A 3RUFA 3UAGA 3OQBA 4IZHA 4JN6B 1YJQA 2QW8A 4DREA 2C7VA 3VTZA 4O59O 4ZGWA 2POQX 5A9SA 2OFPA 2X0NA 4RPKA 4NBWA 3HJAA 2GASA 4GBJA 1UXHA 4ZQHA 3GRKA 2HLPA 1Q2XA 1E6EA 3ZWMA 5K6AA 3ZGYA 4U6QA 3T7CA 1MXHA 1GEEA 2OHXA 4IM7A 3LC2O 5MGBA 1K3TA 4Q3CA 4GGPA 2YHIB 3B1KA 3GHHA 3I4FA 1DAOA 3JQDA 5I9MA 2EP7A 5JMPA 4GX2A 1RYEA 3INTA 4XB2A 4XYMA 1F17A 1F12A 4EYEA 3JQBA 3ZHZA 4TSKA 1IHXA 1HLPA 1NPTO 2A4KA 4NIMA 4DYVA 4MIEA 2VYNA 3JD1A 4B7XA 2FOIA 3JQ8A 2EV9A 3UF0A 4EEXA 4IY1A 4WOKA 4XKJA 1BW9B 1NHWA 2DBQA 4GLOA 1Y8RB 3OJOA 4IGEA 1I10A 4PFJA 2VHVA 3WWZA 3NYWA 4A0SA 2EJWA 3PYLA 3GUYA 4HFRA 2O3JA 4YAIA 1RWBA 3GZ4A 2H1SA 5TJ9A 1LSJA 3OMLA 3WSVA 5CDYA 3MJCA 4J1TA 3TNLA 4GSKA 2BLLA 2G17A 5C7LO 4ITUA 2HO5A 2ZCUA 4CJXA 1DEHA 4CM5A 1EBFA 5GY7A 3ZNNA 3L6OO 3NTOA 1DFGA 1I33A 3GY0A 4PG4A 4NK4A 4J16A 1JKJA 1FJHA 4GX5A 1EVIA 5JPIA 1NM5A 3GAZA 4K26A 5L4LA 1Y7TA 4FFMA 2AE1A 2CZCA 4E5MA 4CM3A 3PQFA 1BXGB 1YDEA 4HADA 4PLWA 3MCVA 3WGTA 4FSHA 3RC9A 4PLZA 1UH5A 1KVRA 2GO1A 3JV7A 1T2DA 4PLHA 1N8KA 3ZHXA 1HRDA 3U0BA 2W4QA 4IDAA 4CV1A 4KTVE 2Q2VA 4B4VA 2RH8A 4AJPA 3ZNPA 2NWQA 2PFGA 1RJWA 1YQXA 5B4VA 2PZMA 3W8EA 3M1LA 3IUPA 3H4VA 3V2UA 1WP4A 1XG5A 2OXIA 5I7EA 1M6WA 4B8ZA 4FBGA 1YBVA 4CQLB 4KP7A 3PIIA 1LU9A 5AXBA 1VL0A 3OBBA 2X9VA 1UJMA 2AMFA 2PR2A 1VSVA 4WCFB 3TQHA 4BVAA 2VTDA 4YACA 4S1VA 3VPGA 2WD8A 4DPLA 1EDOA 4FW8A 1CERA 3DTTA 1GR0A 1R37A 1ZO8A 5ICSA 3ZWVA 3ETGA 1LLDA 4NDNE 8LDHA 4PZDA 1T2AA 3ONFA 3WWYA 3L07A 1VI2A 2O50A 4YT4A 1K2WA 4R5HA 3T4XA 1B3RA 1Z7BA 5JO9A 3W4JA 1NVGA 3N7UA 4EEZA 2DU8A 3FF4A 3ONDA 1JU9A 2ZK7A 4CM9A 3ABIA 3GVIA 5KJ6A 1XQ1A 4FGSA 1FF9A 4K6CA 4MDHA 3HSKA 2G0TA 2R00A 2DM6A 1X1TA 2YV3A 4ND3A 1JW9B 1WNTA 3DBRA 4BNUA 5MDHA 2RIRA 2QRLA 4J9VA 5I9NA 2CVOA 3NDRA 2O4UX 4UEOA 4UEJA 2B69A 4F6LA 2C07A 3IP1A 4QUKA 3TZKA 1UDBA 4MVJE 5JC1A 1IB6A 1WDKA 1DIRA 2VT3A 1DOHA 4LCJA 2X1HA 4ONEA 1A9YA 1X15A 3BTSA 3VH2A 4U6SA 1GTMA 1LC0A 1V3UA 1GQ2A 4LMPA 2WE8A 3GDGA 1P0CA 1VM6A 4QFDA 4HKTA 3DFUA 1I2ZA 4IXTA 2O3UA 4WLOA 3HE3A 3O8QB 1HSOA 4M86A 4YB8A 4R9SA 4OOFA 2HMTA 3ICPA 3WLFA 1TT5A 2IXBA 3DQPA 3KM0A 4BB5A 4J4TA 2I6TA 5HTOA 5DCUA 5JAIA 1UDCA 1E3WB 3FTPA 3PPIA 5A1TA 2VHYA 4KOAA 1ZK4A 3FNFA 3ZW8A 4OQZA 3ZWWA 2LDBA 2C20A 3GEMA 2QIOA 5A3VA 2GCGA 3K6JA 3K2EA 3WXBA 4CUJA 5L3ZA 2NU7A 4OAQA 4EDFA 3AWDA 3D5QA 3I23A 4XA8A 1EUCA 1XSEA 4Z0TA 4CR7A 3NTQA 1H6CA 4RCVA 4KQWA 2O23A 2QX7A 4E2XA 5I8ZA 5ITVA 4NBUA 1WWKA 1MUUA 3C8MA 4FPXA 4RVSA 1F06A 3SLGA 3EAGA 1AGNA 4A2CA 2G1UA 3D7LA 3H9QA 3V1UA 1QMGA 4HX5A 2VYVA 1LUAA 3ORFA 1DO8A 1D8AA 3CUKA 1ZZEA 1YGYA 4TVOA 1ENYA 3ZV5A 4AJOA 2GNAA 1PU2A 1QRRA 2IZZA 2AA3A 3V8BA 4Q3AA 4QECA 2VUUA 2O3TA 2IXAA 4XDYA 2RAFA 5CDUA 2NU6A 5AVOA 1ZMOA 3DDNA 1C0KA 3AI3A 4R4JA 1HDCA 1U3UA 3F5SA 5DOVA 1YH3A 4F6CA 4NR0A 1PX0A 3LF1A 2C59A 3PZBA 3D4NA 1NQOA 4LSMA 3TZHA 1NWHA 3JQGA 2PK3A 4K1LA 5T5QA 1WXDA 5F5LA 3H9JA 2VQ3A 2OUIA 3BTOA 3H5AA 1IY8A 3I5MA 1NFRA 3K73O 1O95A 4E0BA 1JQBA 5T57A 3TDKA 2CF5A 3L4BA 4ND1A 1GUYA 2EJVA 4J1NA 1IUKA 1C1XB 3ZDFA 4BNZA 5HS6A 1ZUD1 1EE2A 4HY3A 1B16A 2Q1UA 5IXYA 3C3XA 4L75A 3FPCA 3GZNB 1P3DA 3V2HA 2NQ8A 3H8VA 4MO2A 5EN4A 3WQSB 3D5TA 3QA9A 3L6DA 4QX6A 2HKIA 3AM3A 2BMAA 1OAAA 1R4NA 5F1PA 1IPFA 3WMXA 4GMGA 3WOHA 2AG8A 4YAEA 1UP7A 4CODB 4O5OA 5FWNA 1O0SA 2D2IA 1MV8A 1MFZA 1W4ZA 2VOJA 1B7GO 1XR3A 3JYQA 3VH3A 3X2FA 2NTJA 1WMBA 1RYDA 1TEHA 4IDDA 3WGGA 5IDQA 3RUHA 3SVTA 3HFSA 1FXSA 2Q2WA 2ZATA 3GOHA 3ON5A 1OC4A 4BQRA 3FR8A 4KZPA 3WGZA 4WKGA 2DT5A 1BVUA 3JYOA 3TL3A 3V1TC 1HL3A 3G1UA 2PKRA 1GDHA 4H16A 4IBOA 3GZNA 1KEWA 4FB5A 5KVCA 2DFDA 4GI2A 4E12A 4NJMA 2EKQA 1BW9A 4PZCA 2I76A 4AJHA 3IMFA 5TLSA 2X5KO 1IYZA 3MJTA 3O9ZA 4JNKA 4MVJI 2GSDA 2J3JA 3BAZA 2J5RA 3HDQA 3VPFA 4CM1A 1YOVA 4I9HA 1IPEA 1PS9A 2J5KA 3KYBA 4OKNA 2X86A 4B7UA 2BGKA 4JQCA 3GEGA 1ZJZA 2GN6A 4BMNA 3F47A 3GVHA 3ZWCA 1V9LA 2DTXA 2RH4A 3CZMA 1QYDA 4IZIA 3JQFA 1PZEA 5GZ1A 5COAA 4D7AA 3M2TA 3FBTA 1YB1A 2OBYA 3QW2A 2E4AA 3H7AA 1DC3A 1MG5A 3PI7A 5ER6A 2CFCA 5C3MA 1PJSA 3A4VA 3W4IA 1BVRA 2IZ1A 1LDMA 1JVSA 3BMQB 3W8DA 1HZJA 2ZB3A 3PHLA 1XGKA 2Q49A 1D3AA 4I8XA 4Z9FA 4AJNA 1H93A 4HP8A 1DRVA 1MC4A 4R68A 3ROMA 1EUDA 2LDXA 2YZ7A 3HUDA 3OJLA 4GLLA 3COSA 1ZK3A 1R16A 1MXFA 2A92A 2C5EA 1PL8A 4A73A 4RPLA 4U5QA 5JLAA 2AEMA 3OA2A 3E82A 2V6BA 1ISJA 4CLEA 3OJ0A 1ULUA 1PJTA 4LK3A 5JCJA 3R3SA 3M6IA 1CQJA 1XLTA 4N18A 2WMDA 1R12A 3JQ7B 4AJJA 1QYWA 1SEPA 4W4TA 4E2YA 1DB3A 3GVCA 5JXWA 1A71A 1RKXA 2DBVO 2YYYA 3PRJA 4MPDA 4XJSA 5AQ1A 3DMTC 4WNCA 1H0KA 3OP4A 3CIFA 3EY4A 4FFOA 4I1IA 2Y93A 1Z6ZA 3R0IA 4F3YA 2VHZA 4TRNA 2GUGA 4R1UA 2CUKA 4OXNA 3NKLA 4RVGA 5T64A 1CYDA 3ZWOA 2O4CA 3HN2A 4KTTE 3E18A 2P9GA 2DPGA 3EVNA 1MP0A 2NUAA 3I9OA 4G65A 4J3FA 4MKRA 1PZGA 4CPDA 1K89A 1P1HA 3AOGA 5G0VA 3RC1A 1E6WA 1ZSNA 2AG5A 3ZWNA 4OYRA 4C7KA 1FDWA 5F1OA 4KUHA 1M67A 1QLJA 4OO3A 1A72A 3KUXA 1CRWG 4DQXA 2BGLA 3PDJA 4B79A 4XIYA 3PQEA 3X2EA 1BGVA 1ONOA 3WIDA 2GYYA 1DLJA 1XDWA 5JO0A 1KC3A 2VWQA 1KVUA 4QO8A 3OF2A 4D41A 4YRBA 1BMDA 2YDXA 3ZI0A 1PGJA 1U2DA 4NBTA 1AN9A 1GFSA 4BNXA 1HDOA 2I66A 4IJWA 1YRLA 4A03A 3P2OA 3KBOA 1ADCA 4C4OA 3F5QA 3K92A 4PN3A 1HEUA 2OP0A 3S2EA 1M6HA 5JW6A 4MVJG 5JCXA 4BNHA 2D1YA 4WCDA 2Z95A 4UVDA 3RBVA 2PD4A 1ZKMA 1LXCA 2BH9A 3OIDA 1V3VA 4IDEA 5ENVA 4CLXA 4GVXA 1OI7A 5J23A 4YR9A 4E2WA 1GAEO 2ZJ0A 1E7QA 4YT8A 1E0DA 1ISIA 2JAHA 2D59A 2D8AA 3IS3A 4L8VA 4UEKA 4L4XA 1G0OA 4AL4A 1IHYA 2I3GA 5IF3A 2OMEA 4M1QA 3FI9A 4CMAA 1MC5A 3DZKA 5JMWA 5DCWA 1OMOA 4DMLA 4IMPA 4N5LA 4OL9A 4WLVA 4NG5A 2ZTUA 5ITWA 4DIOA 4YPOA 4Z9YA 3VKUA 4E33A 2PWZA 3HDJA 1PJBA 2W2KB 3LT0A 5G0UA 1I2CA 4BO2A 4R3WA 3LT1A 1NAIA 4LVUA 4CM9D 2W90A 4IMRA 5CDSA 5EIOA 3UICA 1R4MB 1ZEMA 3PIDA 3IAHA 4HBGA 1NXQA 2J3KA 5TRTA 1H2HA 4TWRA 2WE7A 3UCXA 3NJ4A 5ER9A 3DBLA 3S1LA 5JS6A 4CMBA 4ND2A 1A5ZA 3HHPA 3Q2KA 4MIOA 1KY4A 4WLNA 3UCFA 3K2BA 3LDHA 4AJLA 4FN4A 1I3NA 2B5WA 4ALMA 4GKBA 1DIGA 3ZW9A 4YAGA 3WQQA 4L4SA 4YJFB 4WEQA 1YJ8A 1C0IA 2DVMA 3OQ1A 5B4UA 5BNFA 1HE2A 4IS2A 1TB4A 3GH3A 1A4IA 2I3AA 1VPDA 4BO4A 2Q45A 3MJ4A 1Q7GA 5TT1A 2I5PO 4BHTA 5C37A 3CPSA 1R4MA 1ORRA 1A27A 1LTHR 2JFHA 2WYUA 3RKRA 3FR7A 1T1RA 3DONA 5H82A 4CLOA 2E48A 1CJCA 3FSRA 1PJQA 3ZZNA 3BMOA 1LSSA 2O2SA 2PV7A 3DOCA 2DTDA 4MVJP 3OEYA 4L73A 3DR3A 5LCXA 3C1AA 1UZLA 4BGUA 3ENKA 5ES3A 5A9SB 1NQAO 4CUKA 1BWSA 4URFA 4PLGA 4ROSA 4UUMA 3EW7A 4YRDA 1CDOA 3EUWA 4TKMA 3W8FA 1LLCA 3FWZA 3KYDA 3WX0A 1YONA 3GK3A 3JYPA 3UCEA 1YL6A 1EBUA 2BD0A 4IJKA 4R41A 4BL5A 2WD7A 4E32A 3MZ0A 3RCBA 5COQA 2X0JA 4FD3A 1MG0A 4B3IA 1QSGA 4EUEA 4PG8A 4HNHA 4J6FA 2JHGA 3RC2A 3OFSA 4XD2A 3WJAA 1PZHA 5CPBA 1UZNA 2VWGA 3GF4A 4KDFA 2B83A 1NX6A 2HK9A 1GCUA 3H2SA 4I5GA 1LDGA 4ZA2A 4J0EA 4YCAA 3FPLA 3JCZA 1U5CA 4FDAA 1DLIA 1AXGA 1VSUA 2GZ2A 3C1TA 4U0JA 5IDYA 2JFGA 1Y1PA 2BELA 4H7PA 3TFQA 3NV9A 2GF2A 2B4TO 2R6JA 3TZ6A 1K0UA 1O94A 4J7UA 4O63O 1U2GA 3SBOA 1LRLA 4B4UA 4DQUA 2NV6A 1I01A 4U7WA 4PLVA 5BSEA 4OOEA 3OA0A 1DIHA 1E3IA 2D0IA 3KV3O 5CHEA 4DC1A 2PH3A 4XQ9A 1VC2A 4Z0PA 1M76A 4RLHA 5I7FA 2Q2QA 1DIAA 1R0SA 2HJSA 2YV1A 4WJZA 5G4KA 3PK0A 4E31A 1PS0A 1M75A 1UXGA 2XAAA 1UAGA 3G1TA 2ZYAA 3VZSA 5A9RA 3ASUA 1UXJA 3GN1A 4ALJA 3ZNOA 4D43A 1Z75A 1ADBA 3DHYA 4DLLA 1QV7A 4N54A 4WLUA 3WR5A 2PD3A 3I9MA 3LLSA 3MTGA 1ZEJA 3M2PA 4RF3A 1RPNA 1U8FO 3GVPA 4BNMA 2JCVA 1DSSG 4GSLA 2GPTA 4HWKA 1H6DA 1MA0A 2FPGA 1LSOA 1N2SA 1DAPA 1U4OA 3FNHA 1X7GA 5DZSA 2P2SA 1IOLA 2OL4A 3ZH2A 4XQEA 2W2LA 3AY7A 3AY6A 2JD0A 5KJFA 2FP4A 1T1SA 2X6TA 2UVDA 1BTOA 1V0JA 2AQHA 4JJFA 2JJYA 4UVEA 4H3VA 3BXXA 3PZRA 5CP8A 3H5NA 3AW9A 1P0FA 3PGJA 1YQDA 3JQ9A 2H5LA 3I4CA 4BO6A 4JLWA 4RVHA 3V2GA 2E82A 1O9BA 1XU7A 3F1KA 3I9NA 3T7EA 2C54A 2WSBA 1P9LA 1R0LA 3QVOA 4FC6A 3QWAA 5L4NA 2X8LA 3JD0A 2YFQA 2VOEA 1E6UA 2PZJA 3FNGA 5IDWA 3MWDB 1P1RA 1ULSA 3IJPA 4LW8A 4J7XA 4A10A 4E5PA 3BMNB 3LQFA 4BO3A 3LF2A 1DHTA 4YBZA 3FNEA 1PWXA 2IEBA 3TRIA 4CLRB 1LRJA 3ANMA 4JX8A 4KUEA 3KHUA 5CG2A 1K6IA 2X23A 3NAQA 4I5FA 3F1LA 1M66A 3CKYA 2O2YA 3WQRA 4BNVA 1I5RA 3EGOA 1OFGA 1W8DA 1PS8A 4I9NA 3JQGB 4F46A 5FF9A 1SAYA 3AI2A 4YT2A 2AEFA 2AQ8A 1Z73A 3UHAA 4YJGA 2HAEA 3KYDB 2X22A 2ET6A 2WYVA 1Y81A 4AJKA 4L9RA 3E5MA 2E37A 2PZLA 4ZVVA 4DBZA 3BMNA 1DFHA 4Y67A 4NJMB 5TSDA 3SLKA 5IJZA 1HZZA 1QYXA 3EVTA 3PXXA 3MOGA 4UUPA 3I83A 4CQMB 3E9MA 4XGKA 1X14A 4ALLA 3IKVA 2Y0EA 4BUCA 2EHDA 3HQ4O 4DPMA 5CEFA 4BNLA 4XZ3A 4D3SA 3EK2A 2CF6A 4NZ9A 3DHNA 1Z7EA 3BA1A 4JP3A 3PJDA 2AE2A 2Z5LA 1XYGA 1CEQA 4RL6A 1SCUA 3DZGA 1T2EA 3JSAA 2PZKA 3ZHBA 3BMCA 4PCVA 3RUCA 1C0PA 2EGHA 3NRCA 2ZYDA 3WYEA 3GN2A 4L74A 4INAA 4TZTA 1T4DA 4BNGA 1GUFA 1NFQA 3EZYA 2YUTA 4A26A 4ZQEA 1B8PA 1CQIA 2FR8A 3DBLB 3ZU5A 4YWJA 3K8ZA 1E7MA 1T24A 3NDIA 2BFAA 4QSMA 4DGSA 4YQZA 4CMEA 4U8GA 3RROA 3GA0A 1UZMA 1HYGA 4XYEA 1YWGO 1VJ0A 2Y66A 1N9GB 2AQKA 1E92A 2DUWA 4MJLA 4I5DA 1HDXA 2NVUB 3WGQA 1Y6JA 1E1NA 4PLCA 1EVJA 4ZRMA 4OXKA 3Q9UA 2VRCD 4UAGA 1PJCA 1ZK1A 3QVSA 4CV2A 2GD1O 4BNJA 4PLYA 3BIOA 4M89A 5L51A 3R3JA 1KC1A 1W0CA 1YDWA 4B8WA 4E4YA 5L9AA 1DRUA 5A06A 4P38A 4D46A 3KO8A 4CR8A 3AY3A 4A5OA 1GU7A 3HDYA 4B4WA 4ZHSA 2EW2A 5DP1A 3L9XA 3N74A 4GX1A 4O1MA 4OHUA 1GEGA 1NQ5A 2IYOA 5AYVA 2XOXA 3DBRB 3DZJA 4O6VA 1E3EA 4Y98A 2EGGA 1IZ0A 4GKVA 4RQUA 1YBMA 4YTEA 4BKUA 5TC4A 4ND4A 4CLOB 4CMHA 2DBZA 2J3HA 4NPCA 2ZJ1A 4LN1A 1LI4A 1FDTA 3AUSA 3LLVA 4Q3BA 5ILOA 1U3WA 4RJTA 3KOUA 3KLPX 5B37A 5TX7A 3PWZA 5TIIA 5JDIA 7MDHA 1NFFA 3RQSA 1JAYA 4IDFA 4XR4A 2Q4EA 3NJ8A 5L7YA 4ZQFA 3AM5A 4YJFA 3RUDA 2HMSA 5JDCA 4R54A 1DJNA 4ZQBA 3DO5A 4MVJM 3GDFA 4NK5A 1HLDA 4BNTA 5BT9A 4NFSA 2DAPA 2Y0DA 1G1AA 2IDZA 1GY8A 1YL7A 1I30A 1HE4A 3GNSA 5JNLA 3GGGA 4PZEA 4Y9DA 3Q1LA 4R3NA 1F0YA 3OECA 4J0FA 1UP4A 3LC7O 4AJEA 5A5FA 3HB4X 5H81A 2FR0A 1E7YA 5JAQA 2ZTVA 2CVZA 2HMVA 1ZSVA 3BMOB 1GPDG 2X7HA 5CFZA 1R66A 4UVHA 1NWCA 3ENNA 3NTRA 5L7WA 4XGNA 2FMUA 4FC7A 4F45A 3PEFA 2NM0A 1WMAA 1E1LA 1V6AA 3RD5A 2H63A 4IIVA 4K28A 3JQAD 2IODA 1X1EA 1YB5A 2V6MA 4K6FA 4QFCA 3A06A 5TGDA 5CEEA 3ULKA 5K6AC 3CZRA 1UP6A 1UAYA 1FDVA 4IJUA 5G4LA 5L95A 5JAMA 3GG9A 4CLHA 1U4SA 1MGOA 4DTIA 1PEDA 1G0NA 1HE5A 5KJCA 2Q3EA 2QRKA 4OSPA 2EP5A 1D1TA 4YXFA 1HXHA 5JE8A 3P5SA 5KVSA 3PQDA 1E1MA 4NNJA 2Y1DA 4ZU3A 4WE3A 5I7VA 3ASVA 3QVWA 1UXIA 3PYXA 1WDLA 3WBFA 4GAEA 3VZRA 1QR6A 4ALIA 2RCYA 3LZ6A 4J91A 3RKUA 4ALKA 4CL3A 2O48X 5K0ZA 1SC6A 3HB5X 2W8ZA 1RM4A 3H65A 2FWMX 1E7WA 3GGPA 4JGBA 2B36A 4W82A 4D45A 4NU5A 1YL5A 1GADO 4J1QA 3RFVA 4KWHA 2O3RA 3WIEA 9LDBA 3VOSA 2D3TA 2GDZA 2Q1WA 3A9WA 4M87A 4DC0A 4H15A 4AFNA 1G6KA 2HRBA 3DAGA 3UN1A 4EUFA 1Y9AA 3IUSA 1VJTA 1PGNA 1NYTA 1DBVO 3EZLA 1ML3A 1VKNA 5F3RA 4CM7A 1CF2O 1QLHA 5LC1A 3TSCA 5H83A 5IZCA 1XKQA 1P45A 2DQ4A 2YQ5A 4BNKA 5EERA 1DC5A 8ADHA 1LQUA 3L9WA 3QWHA 1V35A 3K5PA 1I8TA 3EMKA 2VRCA 2VNSA 1KVTA 1VE9A 2HMWA 3HWRA 3EHEA 4EW6A 1ENPA 3OSUA 5HM8A 1I36A 2V6GA 2B5VA 1F14A 4D44A 1ADFA 2I99A 4B3HA 2GRAA 3K96A 5G0SA 1QG6A 2BF7A 4QTZA 5C7IO 2C2YA 2JHFA 1FK8A 1B8UA 1NHGA 3E1KA 4PIVA 2X0IA 1SO8A 4RVDA 2F00A 4RPGA 5A03A 3FHLA 4TQGA 3TF5A 1T2CA 2EW8A 4M8SA 3L4SO 2YDYA 1XELA 4RO0A 5A04A 1RM0A 3DBHA 1BG6A 1GCOA 3D0OA 1ZXBA 5EESA 3VKVA 1ISGA 2GR9A 4BNNA 4HFNA 4RF4A 1JWAB 3C7CB 1D1SA 1RM3A 3AUTA 3JQ8B 5DCYA 4CQLA 4R69A 2UUPA 1B2LA 1KVQA 1MFPA 4HV4A 2DLDA 1AXEA 2ZB7A 4W99A 3ZHYA 5BSHA 4CQMA 4RF2A 1OOEA 5IAAA 4W7HA 3G49A 5C7OO 4HNGA 1Y8QB 2QRJA 4IDCA 1FMCA 5U1PA 1ZSYA 3DZIA 2HQ1A 2HK7A 3QE3A 2W2KA 1MB4A 2B0JA 3DOOA 3D64A 4EJMA 1LSUA 1JLLA 4XX0A 4XCVA 1C1DA 2GN4A 5DDIP 1B3BA 2VT2A 4YAJA 4JXKA 5KKAA 5CDGA 2FZEA 4Q39A 4E30A 2PLAA 4HFJA 1KYQA 1PGQA 1WAMA 2VZ9A 3FN4A 3IIEA 3DXFA 2GGSA 2IE0A 3E6AA 3SXPA 3GNQA 1QYVA 4CMJA 4DL9A 1DJQA 3PP8A 4OIMA 3JQBC 1LDYA 4JP2A 2JFFA 3CINA 2FPIA 2HU2A 3DAPA 3T4EA 4DWVA 1U28A 1DRWA 3PDUA 4D79A 4TKLA 3CE6A 5CG1A 1PL7A 1Q0LA 2GN9A 5A4DA 4R1TA 1Q0HA 2QHXA 3RASA 4EUHA 3JYNA 2V6FA 4AJ2A 4J43A 1PQUA 2J3IA 4ZD6A 5CEJA 4ZJUA 4CMIA 3KZVA 5KCZA 1J4AA 3GC6A 1P77A 3MOIA 1B14A 4OM8A 4L76A 4N7RA 3WSWA 2VWPA 1ZVMA 1PGPA 5EINA 2HDHA 3RFTA 3DB2A 1E5LA 1Y9EA 5A5EA 1SEVA 2D4AA 4GVLA 5LDGA 2TMGA 1IE3A 4IQ0A 3CSDA 4LSWA 1E3WA 3WYBA 1E3LA 1T25A 2NTNA 3QSGA 1VJ1A 4WOJA 3WS7A 4JJIA 1HYEA 3OJFA 1Q7BA 3HDHA 1XEAA 4GPD1 4W6ZA 2ZQYA 4FFNA 3U49A 2ZTLA 3GDOA 4NBVA 4FGWA 2C0CA 4JIGA 4BKQA 5JY1A 1F8GA 2DFVA 4DPKA 1PWZA 3IC5A 4DQVA 3C7DB 3MJVA 1A7KA 3B20A 4CM8A 3ZV3A 2IYPA 4Q9NA 3KYCA 4J1SA 1P33A 3A28A 3ZWAA 4Q3EA 1LLQA 1PJ4A 5C5IA 2YV2A 2R2GA 2X5JO 3HNPA 2Y05A 4AG3A 2UYYA 4IIUA 1XWFA 1N1EA 2FRDA 3OEWA 5G4KB 2OOSA 1K5HA 2UUOA 1TA4A 1JA9A 3AOEA 4G81A 3EDMA 4BNYA 1Q1NA 2C7GA 2OO5A 2PY6A 3MWEB 1NR1A 4Z3DA 3RBXA 3RVDA 4IQGA 1N5DA 3PFWO 1SMKA 1ZFNA 3I1JA 4WNIA 3VDRA 4RV9A 2B4RO 3PGXA 4DYDA 4CL8A 1R6DA 5A02A 3KSZO 3HG7A 4OQYA 4J2HA 2WM3A 4DXHA 2Q50A 4Q3NA 4ZICA 3TFOA 1ZCJA 2X5OA 3ZWPA 5ADHA 3AJRA 1E7RA 3BHJA 3NGLA 1U8XX 4MP6A 2P5UA 4ZN6A 1PQPA 4C7JA 3LT2A 3FWNA 1H6BA 4XIJA 5FEUA 2FY8A 2UV8A 3O26A 1ZH8A 3HFGA 4JCOA 1P1JA 4BIIA 4Q3DA 1QYCA 2BFMA 4FIZA 3P7MA 1EVYA 2PNFA 3PJGA 2YW9A 4XDZA 5COBA 5BSFA 3JTMA 2CMDA 1TVEA 4QT0A 4YDRA 4W7IA 1DPGA 2PKQO 5FI3A 4B3JA 1SOWA 1VRWA 4I9UA 1GYQA 4PGFA 4NJOA 1KY5A 3I6IA 4MVJD 3NT5A 5ENDA 3INRA 4RZHA 1WPQA 3KEQA 5TS3A 1VL8A 3ZU2A 3RU7A 4XJTA 2VWHA 4RDHA 4I08A 1X0VA 2NVUA 3O8QA 3DZBA 4UREA 4DIBA 3WTCA 4WK6A 3DMYA 4IJVA 4YRAA 3IP3A 4D3DA 4PG5A 2EG9A 4Z6KA 2QZZA 1KBZA 1L7EA 3L0DA 5FFFA 4ILKA 1DC4A 1KVSA 1WW8A 1NPDA 5CPFA 5KIAA 4BO8A 2Q1SA 4DVJA 3GPDG 4PLPA 3DZFA 5LDHA 3L6EA 5JAZA 1PQWA 1C0LA 4BOYA 1Y5RA 3H2ZA 2PD6A 4WPGA 4FR5A 5A3JA 1P44A 1XIVA 4Z3KA 3PHJA 4WGGA 2YHUA 1K6JA 2HK8A 3LU1A 1BDMA 3ADPA 1HF3A 3DC2A 3JQ7A 1U3VA 2YJZA 4OKIA 4TROA 5TNXA 1T2FA 4XQCA 1LDEA 3R6DA 2V7PA 4KWIA 1H94A 3F46A 3GR6A 4EJ0A 3JD2A 1DIBA 1U1IA 2VTEA 4BS9A 3VPHA 3QIVA 1ZK0A 2AQIA 1HDRA 2NVBA 3PYMA 4XRGA 3K31A 1HT0A 5JYEA 3U09A 2NVWA 4WECA 3ADOA 3RUAA 1C1XA 4NU6A 2XF8A 3H9UA 1PSDA 4YT5A 5KTKA 5L40A 1NP3A 4WLEA 1U3TA 2Y1GA 4MVJF 3KB6A 4DLAA 1KIFA 2BKAA 2OORA 4MVJH 4GH5A 4BGVA 3G17A 2DKNA 3OIGA 3RJ9A 1NVMB 4XGIA 4NH4A 1HYHA 3QQPA 5DBIA 4MVJA 3STHA 4BO1A 1TT5B 1PR3A 3TWOA 4PVCA 5DT9A 4Y8VA 1H2BA 3ZWYA 5HWSA 3F6YA 2DTEA 1JN0A 3WLEA 5AXCA 4YJGB 3NX4A 4XB1A 3JD3A 1QV6A 3JD4A 1P1FA 1ARZA 2ZCVA 4CLDA 1GZ3A 3QJ5A 4RZIA 3I9KA 3ITDA 1AUPA 3TL2A 5BSGA 2G76A 3IL2A 3D3WB 2BI7A 4CUZA 4DUPA 4BMSA 3G79A 1U5AA 4WUVA 2VUSA 3DOJA 1P1KA 3ZV4A 1PIWA 4DA9A 4TRMA 1F8FA 1IL0A 3ST7A 4XRRA 1PR9A 3E9NA 3U3XA 3QVTA 4RLSA 3OIFA 3P2YA 6ADHA 2Y1OA 3PJFA 5JYDA 4CMKA 1EK5A 4BO7A 4M54A 4P8RA 4MOWA 1ZIDA 2GERA 2O3SA 3BHMA 5K9ZA 4E6PA 5HA5A 4DLBA 4YYZA 4KMSA 3QP9A 3CEAA 5A05A 3F3SA 2XXJA 3TOZA 5KNLA 2CDCA 4D0RA 5DBFA 1XQ6A 5KVQA 3H6KA 4FQ8A 4D42A 3PWKA 4GGOA 5DBGA 3WGOA 1NNUA 3CMMA 4J2OA 6LDHA 2BGMA 2QZ9A 3GFGA 3WFJA 1PTJA 1LC3A 1E7SA 1YVEI 4JJGA 1C1DB 2GZ1A 3DFZA 3VTFA 4BNWA 1Z74A 5BR7A 2Q4BA 3GVXA 3JQAA 3S2GA 2X58A 3FCOA 3D4PA 4OXYA 2H6EA 3AUUA 2OP1A 1EK6A 3Q11A 1Y8QA 1Z82A 3ZV6A 3U4CA 3GT0A 4FJ1A 1I3KA 2CD9A 1AHHA 3SC4A 2PTGA 3GGOA 1P31A 4D3FA 3E9QA 5JDCC 3UVEA 3ROQA 3E03A 4IXWA 4GL4A 4BO5A 1HETA 5IFLA 4NBRA 4TRRA 1GZ4A 5G0WA 1HTBA 2OZPA 2ZB8A 4YVFA 1I3LA 1I3MA 4BKPA 2VUTA 4L0QA 4TVBA 5CDTA 1QORA 3DBHB 5BNIA 5L45A 3B1FA 3NDJA 2V65A 3QWFA 1JDJA 3IOYA 2VYVD 1EQUA 4IS3A 4PG7A 4NMHA 5KKCA 2EKPA 3IDSA 5EQFA 1Y8RA 5THKA 2NTVA 1LA2A 3JQ6A 3TJRA 2NNLD 3BTVA 3CH6A 1H9AA 5IDXA 2D5CA 5F5NA 3H9EO 1WZEA 4ND5A 5B12A 2ZKLA 2DUUA 1DDOA 2GN8A 5L4SA 2WEKA 1VKOA 2FSVA 3I52A 3KSUA 4PRKA 1E3JA 1A7AA 3EC7A 4FCCA 1BDBA 1WVGA 1SZJG 4NQZA 2YHIA 4CMGA 4Z9XA 5T67A 1P74A 1PJ3A 3EYWA 3UXYA 5ICMA 3OH8A 3JQEA 2BI8A 3C7AA 4KQXA 3QLJA 3DL2A 4QEDA 4ZQGA 3ROPA 2JAPA 3VHRA 4K9DA 3ZU4A 3SJ7A 1TLTA 3U62A 3D3WA 5U4QA 3DBVO 4B7CA 2NQTA 4R01A 1N7GA 3KXDA 2VZ0A 4PVDA 4CM4B 4RORA 2WJPA 1I0ZA 1N1GA 2WTBA 3WICA 4YJHA 3I9JA 4FFLA 3A1NA 2ZQZA 4CM4A 2NU8A 3GG2A 2EIHA 4E21A 1ZK2A 1YBAA 2D5AA 5IN4A 2AW5A 2Z1NA 5G0TA 4Y6RA 1NQTA 1XA0A 3NT2A 2FPPA 2E6UX 3S2IA 1MLDA 4XQGA 3GNTA 4BKOA 1U7TA 3JQAB 2HRZA 2WWRA 2ILTA 4RPHA 4BGEA 5JFOA 4IUYA 1VL6A 5IG2A 3LSYA 2NSDA 1R0KA 2H9IA 1WDMA 2P91A 4YJDA 2IRWA 5L7TA 1J6UA 2X9NA 2A35A 4AJIA 3TZCA 3UW3A 4R1NA 4CV0A 1ZXLA 2I9PA 1LLUA 2VNAA 2Z1MA 4MKXA 4J4BA 4XYLA 3BMCB 4NHEA 2AXQA 3LC1O 4G5HA 3U4IA 4AVYA 1KEPA 3RUIA 4E5YA 1GQYA 2SCUA 4MP3A 4B4OA 3GPIA 4NFYA 5TQVA 3WYCA 4LRTB 1AE1A 3WBBA 1T4BA 1PL6A 1B26A 3RIHA 3ITKA 2QYSA 4RDIA 2W2LD 4AICA 5IN5A 1ZBQA 3C85A 2P9EA 4P22A 5HS4A 3W4KA 1YB4A 4S3MA 4BKRA 1DFIA 9LDTA 2A94A 3KSDO 2W98A 3RAJA 3NGXA 2EF1A 2O7SA 3JQ9C 3E8XA 3DTYA 4I5EA 3WFIA 1P1IA 3PWSA 4J49A 1HDGO 3D4OA 5DULA 2TMDA 4GMFA 3GAFA 4Y6SA 1KOLA 3PLRA 4RGBA 3RC7A 5EPOA 1QP8A 1YKFA 2VN8A 4N5NA 3O4RA 5EL0A 1LDBA 3PHIA 3BMQA
chains in the Genus database with same CATH superfamily
5GVRA 2MYPA 3REOA 3IP5A 4U3JB 3UJ3X 4Z8YA 3U4DA 2QX6A 4F92B 2BFBB 4ZAXA 3H5RA 4AT1A 4L0CA 2XXAA 2VRBA 3C1UA 1J0XO 3F9IA 3S99A 4OFWA 2LW7A 1IN5A 1QF7A 3LD9A 4PTLA 1K06A 4Q4HA 1Z36A 1JG3A 1EMDA 2PKQP 1P2TA 3VDQA 2P67A 4ATNA 3MEQA 1KAMA 4B6JA 3E5RA 2RCNA 1LJ8A 4N47A 1M0WA 3QEMA 2NSHA 5TR9A 5K2OA 5T4HA 4KXWA 1SD2A 1O5IA 3VVCA 3W9YA 3B89A 3WNQA 4EK9A 1X0XA 4IDGA 5ADUS 2B4QA 2GLXA 4QOGA 1GV0A 4UVGA 2P41A 3KX2A 3Q0IA 2YFHA 3K0CA 1TZBA 3UMSA 4UPEA 4O8ZA 1I13A 2HCTA 1GPYA 1EIWA 2Z57A 1ADJA 1EFKA 1UM9B 1V11A 1DPFA 4P35A 5DX8A 3KK0A 3MF4A 1OTHA 3TI7A 2VBFA 4DARA 4FEYA 2Y1CA 1WZNA 1XTVA 4A5SA 2XDYA 3S3TA 1G98A 1OYOA 4HATA 3B2QA 1R00A 1W88A 1XYVA 2ID9A 3KOMA 3WGLA 5AUPB 3GJ7A 2J6IA 1YO6A 4YXWA 5ILGA 4L28A 1C5KA 1ZONA 2Z9DA 3EH2A 3QLEA 4S12A 4BYGA 3PLAE 1CIVA 1JXMA 2AR9A 2P7HA 1C8VB 3OPXA 1I32A 3CXRA 4GX0A 3W6UA 2QNRA 3CTVA 1U0RA 1NQUA 5DCLA 3TX2A 5IZ4A 5K01A 1HT2E 3CF0A 4CR6A 2QXUA 1LBSA 2XPCA 3S8MA 2C4WA 4XE5A 5H3HA 5JZMA 3AXSA 2HA0A 2BZ1A 3FOEC 3D8TA 1MH1A 2A9FA 5DN9A 1W1UA 1ZA2A 3QUCA 1JS1X 4GWGA 5IAJA 3VVBA 4HTFB 1EA5A 1VE3A 2IXDA 1XU9A 3EFOB 5KNBH 4E3ZA 2Q3HA 2CUNA 1HM5A 3E4CA 3LX4A 4ESOA 2XQIA 3TB4A 5E1OA 3DLIA 1KR2A 1M6VA 4YJHB 3UUWA 1MJNA 3B6IA 3D7MA 4AY6A 3MJSA 1PFWA 3C3YA 3DMTA 3G8BA 4OH1A 4GO1A 4GRAA 3DTVA 3V4SA 1L1FA 2X0KA 1Z2DA 1S9HA 4C2TA 3FVWA 3UJ6A 2FF7A 5HMLA 3PPXA 1CULC 3HUEA 4ZAYA 5CYFA 3RS0A 3WADA 8OHMA 3T1NA 1IBCA 2DMRA 4EGCB 1E9DA 1UBTS 2Y99A 1VFPA 2CMGA 3OJEA 4JEMA 4MZXA 3AYXB 2DXIA 2UDPA 1ST3A 1A9XB 2BI4A 4K88A 4KR0A 4OY3A 3FBWA 4ZRNA 3VR6D 1N9KA 3HHEA 1L5MA 4M7OA 3VAZA 2I3ZA 4FFRA 4CQMD 1II8B 5BSUA 1Q2UA 4K03A 3SLRA 1M1XB 3ER9A 4PO3X 5AKIA 1NF3A 1FYXA 1JKFA 3DEZA 1UL1X 5BSRA 4MKFA 4BLUA 3OCUA 3ESZA 1KFJB 2QRGA 1HNZB 4IDHA 3OFJA 3QF7A 1KYZA 4D0SA 2WSLA 1S2MA 1A50B 2FWRA 3ESDA 3K9GA 1XDGA 2OB1A 4OHPA 4J90A 1QG2A 2GRJA 4G8JA 4ND8A 2PXHA 1QGDA 2RMKA 2R47A 5KI6A 3PENA 4P81A 1T3ZA 1TTQB 1ECLA 2JATA 3HGTA 3JQCA 3PDIA 2CB0A 1JVBA 5K20A 4FFBB 5JCZA 3TIFA 4LX8A 1YGPA 2Z6UA 3HJCA 4FDLA 1BIFA 2I65A 3WG9A 2C95A 4WKBA 3MUFA 3R4VA 2JKVA 4TZKA 4ND8B 3ROFA 3HXMA 2QJFA 3B78A 3Q6IA 1EFLA 3T5MA 5E3HA 4R8MA 3THWA 2AOUA 4S1PA 3ZU3A 4QDKA 5ES4B 3GLRA 3R5KA 2V3WA 2HA4A 1OYVA 3ZZ0A 3LY9A 4RS3A 3U3OA 4YJ3A 2VPWA 5BQFA 4BMDA 2BR3A 4FS3A 4JBIA 4W5OA 3PHGA 1XCPA 1AZSC 5F7ZA 1NBIA 3NBFA 1JG6A 3AUAA 1X7DA 3MPOA 1M2NA 2Y0CA 4EHNA 4LTDA 2PKEA 4ZHQA 4NZNA 4HLCA 1LNQA 4YUVA 1YZFA 3ZE6A 1K6EA 2DGDA 2QQ5A 4M49A 1QVRA 5ED0A 2SBTA 2FPWA 2J8ZA 2B25A 3O94A 3AERA 2G25A 3FFTA 1HPLA 5AKJA 1H4VB 1S7CA 2BFCB 2A7XA 3LHSA 4URUR 4Z4CA 1GTSA 2W4MA 3LWNA 1XKTA 3DKKA 4HXYA 2ONJA 4AMUA 4JJ4A 5A9TA 4MI9A 5AUOB 4CTMA 3KRTA 2WG2A 2R86A 4R0MA 1IOVA 2BVNA 3DHWC 3PBKA 4IHQA 5BUZA 1U98A 1DAMA 2HSDA 3I01M 4OMUA 5SZIA 1J8FA 1MX3A 1UZUA 1WOYA 1XTPA 2OZKA 3CX8A 3LNTA 3QFTA 4YJ3B 3RBZA 5TF4A 3VSBA 1K88A 1G3UA 1NUAA 2QWXA 5DTJA 5AVRA 1NG9A 3QXHA 1C29B 1PK8A 3GLVA 3QV1A 4LBWA 4QBHA 4QU8A 3LAWA 1J9ZA 2FEXA 2PR7A 3K16A 4PSCA 1LZLA 4HAUA 4CDNA 1L5GB 4W9NA 5DH9A 2F8SA 1UMDB 4EHJA 4CCYA 1FLAA 2XIQA 3FWYA 5AM0A 4QEKA 2DPHA 3ZCXA 3TNFA 2FEOA 1A9OA 2PL3A 3NHPA 2PNJA 5JWOA 4R5MA 4BFWA 1C50A 1ZL2A 5DP2A 5EXDA 3WNVA 7ADHA 2QL6A 4JLUA 1KRWA 3ZN2A 1UBGA 4PZLA 1P73A 3H1BA 2CGEA 4GM4A 5BOVA 4GOKA 3BL6A 3WMGA 2EFCB 1J5PA 5MN4A 1ISFA 5T3UA 3I3OA 4TWJA 4EGFA 2GEFA 2BL4A 3ANLA 3Q72A 1GD1O 2PA3A 5DLEA 4R1OA 3HBFA 4NONA 3BREA 5E95A 2DC1A 1G20B 3MTIA 2XLCA 4PIPA 4DNOA 1IXZA 2WQ7A 2ISQA 1QFJA 2ZPTX 3Q3CA 1ZJ5A 4DLNA 4BZXA 2A7QA 3KPYA 2VQEB 2QYTA 2ZBFA 4YA6A 4E88A 2J0EA 1E3SA 2E6KA 1QFSA 2NP6A 1KERA 3KKLA 4Z4QA 1XWIA 3EPJA 4XIIA 4W1RA 4G5GA 4DA8A 2GN2A 1U0BB 2RK6A 4K7JA 5KVVA 5T4FA 3U9LA 1U7ZA 2AHRA 4A6PA 4QHYA 3ZS8A 1AN0A 1A95A 1PJLA 1Y4UA 2PXCA 4TV9A 4W6QA 4BQPA 1H0RA 3R2JA 3HJFA 5B3JC 2JLXA 5E1BA 1J49A 4CLRA 5K8LA 2BCGY 3FPEA 2Q5QA 4X7PA 3RQIA 3EXHC 4PAQA 5U9CA 4H3SA 4N5MA 1ADGA 5A5GA 3N0VA 1TI7A 2YQ4A 1ONPA 1NI4A 3FCAA 4JCCA 3SC6A 4CF7A 1QOZA 3E53A 1X77A 2GF0A 5B7PA 4TTJA 3G0OA 2W2OA 3FF1A 3LT4A 2ASVA 2C82A 3PNVA 2Q99A 4L4ZA 3TZLA 4HQ0A 3BPSA 5I4CA 1L7RA 2OB2A 1FDSA 1NMEA 2RHJA 3OLXA 3OWOA 4EITA 4YUAA 4EZIA 4EYSA 1IVYA 4R1SA 2DBRA 3DDHA 4RDXA 1YQGA 1ZMTA 4KAXA 4NE9A 5I3CA 1W5FA 2W4IA 3VSAA 3L41A 1Z6TA 2R7LA 2WZQA 4RVFA 4DCJA 2G72A 2AK2A 3B70A 3AM4A 3JR3A 2ZUVA 4KN8A 4QATA 1WCV1 4A4DA 2PX8A 1Y3DE 2E4WA 4EFNA 4Z1MD 4U7DA 1DQNA 1WKCA 2WFMA 5IUKC 4MP8A 3N59A 4HN4B 4WOCA 3P4UA 4V1CA 1S8OA 3W6ZA 1WXGA 3BSSA 1EFHA 3ANNA 4HLDA 4LWPA 1OXXK 2CFTA 4ZO4A 1WS6A 2FW9A 1ATIA 3G5TA 3N87A 4NOLA 4MUIA 3VI3B 5KX5F 4G3XA 1KH3A 3UAVA 3ITEA 5AOVA 2R84A 2R1VA 3BBPA 4J0DA 4AY2A 4P84A 3LY5A 2B1JA 4D9GA 5EXPA 4HQOA 1G3MA 1G20E 3GLIA 3MT8A 1UM8A 4PZAA 1Y5MA 4FX2A 2X8AA 3BGWA 3FIUA 4XYGA 3W2TA 2P6OA 2YYZA 4JJAA 3AFNA 4HQNA 4OBEA 4QJIA 2F3QA 4YP6A 4BP3A 1LW6E 3F9CA 4P93A 4EJSA 3V4VB 3SMQA 2NO6A 3GYGA 3ML1A 5FWYB 3RPEA 1EWTA 4WJKB 4WWHA 5CDFA 5KTYA 4ALNA 3WGIA 4X92A 1RM5A 5EC8A 3VDMA 1C4KA 1IHOA 1VE7A 3HCPA 4DMFA 3QYFA 2J5QA 2W2XA 3Q3IA 2H1IA 3E7WA 4HYYA 5D87A 4G5XA 1FJXA 4HB4A 3TS1A 2C2HA 1YS4A 4CL0A 4LMRA 1BWPA 2GZ3A 4EF5A 4PFKA 1U2GC 3ELBA 4Q4JB 3DLBA 1UFVA 2X2OA 3U9TA 5JC8A 3A1UA 4CG1A 4DLSA 1CVIA 1RVDA 3CH5A 3ITNA 3O38A 5TPZA 1IULA 2UAGA 4ZT3A 1ID1A 3SE0A 2YIMA 2E4UA 1X7ZA 2G09A 1Q5PA 1W94A 4HPXB 4D99A 2JH8A 1DX9A 3L1UA 1IU9A 1R10A 1N57A 1EWYA 4LPKA 2G82A 2G36A 2CW5A 2VCHA 4C03A 4Z1MA 1XTTA 4KDEA 1CUGA 1WSWA 5JSFA 2RG1A 4GF5A 2L2QA 5LOVB 1C7QA 4K3VA 2YZ2A 3NASA 1JG7A 1P9NA 1OH8A 3EAFA 3H11B 1FNMA 1RYNA 1U7HA 2RHRA 2XUPA 2R1ZA 3GEDA 2AX4A 4FZVA 4J9UE 3HFRA 2K87A 4JMPA 5J2TF 3A1FA 1OIWA 4YPFA 1RXSA 1KMCA 3LWZA 1T1JA 1UMBA 4H9GA 1HDYA 4Y2HA 1LQTA 2VK2A 1N6LA 4ZI7F 3QWBA 4A9AA 3A37A 5KOIA 4I7EA 3TE6A 1G8AA 4TT3D 1ISMA 4F3KA 3DOHA 1ONNA 1EDZA 5JZOA 1EK1A 2HHLA 4FTWA 4V2IA 3QHAA 1VLVA 1MT0A 2RBEA 4PG6A 1QCYA 2JGEA 4LV8B 3W77A 1ISHA 4LJ5A 2IVFA 2BM0A 1M34A 2ODTX 3D5EA 5HE8A 3V34A 4ZKDA 3VC7A 4FR0A 3BCUA 3O2QB 1NVWQ 4RULA 1W36B 3E9ZA 3WI7A 3TIVA 1J2TA 1MO5A 5HIKA 1JQ3A 2PH5A 2F1OA 2BGNA 3IEIA 3G5LA 1GYPA 3KKMA 2OENG 4ZT6A 2CXXA 3T0GA 4Z7QB 1A77A 3GAAA 2QY9A 5JVDB 1ZD5A 2P4HX 3E7DA 4MQUA 3BTUA 3KKPA 2X77A 3OQBA 1MTZA 3T1TA 1FQWA 3ADBA 2LKDA 2L42A 5JNSA 4ZK6A 4NE7A 3MELA 4I4NA 3B8EA 1C81A 2FN3A 2JVKA 4MLDA 1LNSA 1Z37A 3VTZA 4BWGA 2ZJ5A 4X66B 2BBOA 3PQ6A 3QW4B 2C5FA 2H4YA 2JLSA 4KVFA 2XCOA 1R2QA 2OG1A 2X8JB 4ZV7A 4HEHA 5JCPA 1DEOA 4MW0A 3GRKA 4GGMX 2D06A 3HYCA 3VYWA 4MGKR 3OO1A 2XUHA 1IBLB 4QFBA 1XJ0A 4FR2A 1QE3A 2OHXA 1CUEA 2O7NA 2CHGA 3IQEA 4YNBA 2R6DA 3TTUA 2FX3A 3VNRA 1DWQA 4OA5A 4OQFA 4MWGA 1A4RA 2PKXA 3JQDA 5IBPA 3T1QA 1MW9X 1CHNA 4MCAA 3HO8A 2GK6A 2X8JA 3AJDA 4XB2A 1TKCA 5JWRA 1VHJA 1W1WA 2PWBA 2UYOA 1WDTA 2CMKA 3JQBA 4NKRA 4CGYA 2W6JA 4DLTA 1OXKB 5JECA 4PXSA 1L0BA 1P0QA 3F71A 4F3TA 1NXSA 1AKUA 1WRBA 4RH1A 5CXUA 2FOIA 3JQ8A 4EECA 1NUTA 1SHJA 2JLQA 2BMJA 3DPUA 5ARDA 2ZUUA 3PT5A 4A2QA 4AM8A 1NE7A 5I9SA 4DV6B 4N76A 4GLOA 3HCNA 4PO8A 4BX3A 4D02A 2VHVA 2XTJA 5FUWA 3NYWA 3GH1A 3O8OA 2ARKA 3HYRA 4GYYA 1JJAA 4HZIA 1I6LA 4MUBA 3KBBA 4Y2RA 2WWYA 4N48A 1TGYA 5TJ9A 3WSVA 1LSJA 3A3NA 1UOOA 1ZI8A 4BP1A 4KRFA 1L5NA 1MW8X 1NXPA 4J1TA 1SBCA 2JCBA 4OLHA 2BLLA 2G17A 2AOXA 4ABYA 3DGFC 4ITUA 4RA9A 4KQEA 1S2NA 2HF7A 4CJXA 1DEHA 2QF7A 5GY7A 2NNWB 4NJEB 2GAJA 3WB2A 3CNQS 3GY0A 1I33A 1DDGA 5LQRA 4ZOQI 5F52A 4GP7A 3QSYA 4NHOA 2F8TA 3CSUA 5L4LA 1Y7TA 2RJNA 1GITA 4UCWA 2B8WA 3RYIA 1Q83A 4CM3A 3BWXA 1BXGB 4UZFA 1BMQA 3CRQA 3E5NA 4GU5A 4EPTA 1BNCA 4C76A 1E9RA 2YZKA 3WGTA 4JB8A 1M34E 2RKWA 4PLZA 1UH5A 4IIHA 4BMXA 2A59A 4PLHA 4S35A 2ID4A 2BZGA 1Y1KE 3AJAA 5CLGA 3U0BA 1TQ2A 4H7KA 1GKLA 2RH8A 1C3EA 2QJRA 1I6KA 1GGVA 3K1YA 4GSYA 4BFYA 3BAFA 5SICE 1MQAA 2A58A 1IAQA 3CZPA 1YQXA 3JW8A 2PPLA 5B4VA 1LF5A 4B0OA 1D2HA 1OF1A 1SUAA 1S3SA 4X45A 5HK9A 1WP4A 1XG5A 3K35A 2OXIA 1PBTA 2YFYA 1M6WA 3TNDA 4FBGA 5CT8A 1RXYA 1YS7A 1R1DA 2C8KA 4B8ZA 5IKEA 1VOTA 4MW1A 4BP9A 1GNSA 4C6RA 1VL0A 5LNK6 2X9VA 3L0CA 2ZWVA 5LJIA 3UUFA 4BVAA 5M29A 5BWBA 4G4JA 4S1VA 1V1MB 1X38A 3FCSB 1PVDA 1XCGB 5ALNA 1VG0B 1S0UA 1LKZA 1CNFA 3DTTA 3FUVA 1O2DA 1N5JA 3DV9A 2AI2A 3B3FA 1RRMA 1Y8AA 4RJ2A 4LY6A 1L8LA 2HX1A 4X63A 1OWOA 3BE6A 2IYXA 3DH0A 4RGYA 1NYQA 1S2IA 1SC9A 1EI9A 4QTTB 4D4JA 5JT1A 4NDNE 3PC2A 3EPRA 1ORIA 3KJNA 3CW9A 3ZJYA 1D7AA 4PZDA 2O50A 1EGMB 3HSSA 3NRBA 5DNEA 4PSUA 5KDOA 3QE0A 3N7UA 4RPIA 3SIWA 4EHLA 5IC6A 2ZK7A 2QTRA 1OVGA 2QRUA 3OEED 4H0NA 4H60A 1FF9A 1FFAA 2QTFA 4OP3A 3EXAA 3JVDA 4TQ9A 2DM6A 2DOKA 2R00A 3TO5A 1B43A 1WZUA 4EHFA 4LMAA 1PWYE 1MAUA 1FS4A 3DBRA 1IZ7A 2WTXA 1M0TA 4BNUA 2ASEA 1ES9A 5EJEA 1A5AB 3FTEA 2QRLA 4ENUA 1US8B 4UEOA 1G5QA 3QE9Y 4YJ3F 1WMSA 4KO4S 2P0YA 1FPQA 1LPAB 2PO5A 4QUKA 1EK0A 2W6MA 3TZKA 5CVEA 3UFXB 2DJ5A 2MINA 1CF9A 3D31A 1IB6A 1WDKA 4A82A 3FE2A 4QQ8A 4QYMA 2FZVA 1TQ8A 5FD8A 1V5IA 3KQSA 1DIRA 4HHEA 2JJ1D 4BAGA 3EUFA 3NHUA 4EY4A 2P27A 1SHZA 7GPBA 5K99A 5KYWB 2ORED 4ONEA 3V55A 2IW3A 4U6SA 1BN7A 4JOQA 1F2TB 1FFCA 3H1FA 1GTMA 1WNFA 1T1GA 1LC0A 1V3UA 2Z6QA 5HCIA 1FUIA 1P0CA 5K6TA 2IS6A 2HWKA 1E0JA 3G9UA 4IXTA 1EFPA 2B3TA 2O3UA 2YWXA 4K9PA 4MEAA 3RV3A 4WLOA 4B6OA 1JFTA 3QY0A 3O8QB 4YB8A 5ITSA 3SYTA 2AWOA 1B74A 4MCHA 2ZR9A 4OOFA 3C3KA 3WDKA 3WLFA 2J6BA 1L4KA 2KW5A 2HUPA 3BXGA 3R75A 1PT8A 4BB5A 4F2GA 4BGDA 4XXHA 4X3PA 3ENZA 4X97A 1GFIA 2WIJA 3KSAC 5TDHA 4TLBA 4DQ0A 1E0AA 1UDCA 1E3WB 5CR9A 3RS9A 2QU8A 1W5SA 1P29A 2VSOA 5A3VA 2GCGA 2YNMD 3KT8A 4AMZA 3K6JA 1RI3A 4H59A 1Q0UA 2WFZA 3ESRA 5HIMA 5C1PA 4UMVA 3OZ7A 1Y6QA 2JHCA 2NU7A 4ASUD 4DSTA 4XA8A 2VTBA 1EUCA 2X1VA 2B7CA 3EXFB 2G6BA 4CR7A 4NCXA 1JPNA 4INZA 4RCVA 2WTEA 4E2XA 3O7WA 5KDLA 5CDFE 5ITVA 4NBUA 4P5PA 1WWKA 3K32A 3C8MA 2COKA 1T36B 3N8NA 4FHGA 4JVOA 4L3VA 5CT6A 3SLGA 3ZD9A 4TVSA 1RLJA 2VYVA 1KMQA 3GL9A 3ZCVA 1RI4A 1OZGA 1WSBA 1JFRA 2CZGA 2FP4B 5F2KA 1N34B 1ODIA 1P7ZA 4YUWA 2YUIA 4TVOA 3ZV5A 4ZANA 3Q2OA 2E4XA 4DV7B 2IZZA 4OFZA 3ZJTA 3QK7A 5AK6A 3V8BA 4M8IA 1CZHA 1IM8A 3GA7A 5EIBC 2JIPA 4MQLA 4I66A 4LGMA 1J97A 4I81A 2NU6A 5AVOA 2O57A 3SWWA 3A36A 1RSZA 3TB6A 5K8UA 1HDCA 1NXXA 1U3UA 1RKUA 2Z6VA 1YH3A 4MA4A 3L5OA 2VBCA 1DAFA 1FX1A 3D4NA 3FGNA 2F17A 2H07A 5BV7A 5F5LA 3A6PC 2DSTA 2I7DA 1VI6A 1IQ0A 3D3QA 1IY0A 3MC1A 4AMGA 1O95A 2DBYA 2VG8A 5T57A 1FRVA 4EMSA 1GNVA 4LRQA 1G4HA 1SVMA 1QG4A 2EJVA 4UU1A 1FMTA 2VHTA 2O2ZA 2Q0HA 2JK0A 1G20A 1GTZA 1QIDA 3G2KA 3N1UA 3GLIE 1BWRA 4L75A 3VO8A 4TSRA 3GZNB 2H7YA 1P3DA 1VHDA 4L0MA 4JODA 3AM3A 4FX5A 1OAAA 4JP1A 4ZT7A 1QONA 2A5GA 3SEAA 3WMXA 5KKNB 2AG8A 1A2KC 1H42A 1M2JA 1S3IA 1TPYA 1UP7A 2BPOA 2NZ8A 4HDRB 4KXUA 4O5OA 4PX9A 5BQOA 3IUMA 4UTOA 4EWLA 3VDNB 4G0PA 1G42A 2D2IA 3G0HA 4RTQA 5AUNB 3WJ1A 1MFZA 3RHSA 1B7GO 1DVRA 1GRVA 1JHDA 1L4NA 1Z4PX 2DFKB 2BGUA 5D7BA 2QVGA 1Z2EA 5GJCA 4MWCA 3NGMA 2OM6A 3TL6A 3WGGA 3MBOA 3HFSA 3GOHA 4FZRA 5DJ5A 4AZ3B 4H4EA 1KKLA 3FR8A 1DBIA 1JMKC 1G21E 4KPGA 3WGZA 4CKWA 2NVOA 1ID8A 4PTYA 2N1MA 3G1UA 2IOYA 1NI5A 4H16A 1PVOA 3WP0A 2BE9A 2V9CA 3GZNA 2VF2A 1KEWA 1H2RS 3DMDA 3LHIA 3NHRA 5LB4A 1CUWA 2FZKA 4E12A 3VUFA 5DGTA 1MNAA 3DNPA 5AW9A 4HNAA 2YH2A 1E58A 2GJSA 4WZBE 4AJHA 4HDRA 2J87A 2X5KO 1YR1A 1Z6YA 2ZRDA 2ZWOA 4WXRA 3RSQA 4CMCA 4F60A 3HDQA 2XBMA 3K1TA 4OKNA 4B7UA 1U63A 2FG7C 3HMKA 4HB0A 4NU0A 3GARA 4AZ0B 3FDZB 2GN6A 4BMNA 5DYIA 2XWSA 1UWCA 2O0KA 3VOAA 1AUVA 2L69A 4FBLA 1J8YF 1E18A 1JHPA 1YDFA 3FHJA 1Y80A 2ZS7A 4OK3A 1SUWA 2VHJA 4RZ3A 5AESA 1AH2A 4D7AA 5HMMA 1YCHA 1G5PA 3FBTA 1YB1A 2OBYA 3AM1A 4TV9F 2E4AA 4ENVA 4AZ0A 4EMBA 5B36A 4PGAA 4RACA 1TK9A 4O4JA 4FLFA 3GBVA 4JBWA 4KK3A 1P0IA 4N0MA 3L7OA 2MMGA 4PPNA 3I09A 3M83A 4PSKA 3RYIB 4OREX 2BUBA 1YT5A 2ZQ5A 3AUKA 2I2DA 3H1TA 4RH0A 4XI9A 1LDMA 1JVSA 5ALXA 2Z43A 1HY3A 2Q49A 3R7DA 2YN4A 3E5HA 4Z9FA 2G88A 1H93A 4HP8A 4QWMA 3U7JA 2ZU6A 1D9XA 1RYBA 1OJ7A 2BKXA 2C78A 2YV4A 3FW1A 4ZP1A 2CV2A 1PUXA 2GD0A 3RS4A 3OJLA 2YZ7A 4DIDA 1XHFA 3COSA 1ZK3A 5DT2A 4YCSA 5L4NA 4IGIA 2C5EA 3HM2A 4YLEA 4H35A 3UPTA 3TRJA 1NV8A 2GUWA 2GOYA 4MGZR 3UENA 1EUYA 2JLVA 4IX1A 3OA2A 1UEIA 3HR7A 4LYAA 3S40A 3QOYA 2HT6A 3OJ0A 4NYIR 4O2LA 3A25A 3DYVA 3ZVMA 3R3SA 1IUNA 1CQJA 2CVPA 2QYOA 2RH9B 1PEKE 3TLZA 2AJDA 4MPTA 1D6JA 2ZR0A 1UC5B 3KJHA 4PNPA 3GVCA 3K1ZA 4W4TA 1A71A 3MBKA 2YYYA 4EMTA 5F51A 4RWEA 1H0KA 1PW5A 1R27A 2HXSA 1JLSA 2AX3A 5ECGC 5A4IS 4W5RA 3EY4A 1TM7E 4ARCA 1MC8A 5JS2A 1U3CA 5K0TA 2PU7A 2YTZA 3GGJA 4X5OA 5I48A 2GUGA 3NFRA 1XRJA 4R1UA 1HK7A 4OXNA 3KZCA 5T64A 3ZWOA 2I91A 3V7WA 2IA5A 1BMFD 1R6VA 3E18A 3TEMA 2JASA 3EVNA 4JQOA 3OQVA 1MP0A 3KEMA 4J3FA 1KZ9A 1FPMA 2NUTA 2CHEA 1PZGA 2MJLA 4KL8S 4MKRA 5DI9A 1FRFS 4CPDA 3RC1A 1ZSNA 4GYJA 2PUBA 4RM3A 3RW9A 1FMFA 3B5JA 3KU4A 4OYRA 4EH1A 1ZUHA 3J7AC 4F4FA 4DNPA 1M67A 1JHYA 3EFOA 5I9IA 1MJFA 4X85A 5FXMA 2C4HA 4DQXA 2BGLA 3WKEA 3PDJA 2AH5A 2OXEA 3KFXA 1LWNA 4QLOA 5D6NA 2QVYX 3IB3A 1XDWA 3KT0A 3EXG1 4C4PA 4ZU1X 2XGOA 1M3SA 3ZHVA 3PNSA 1IXSB 3P32A 4B9AA 2AV6A 4LJ6A 2IV3A 2FJPA 1UBSB 3HBLA 5JXIA 2UZ0A 1KJJA 2X5XA 2X0EA 3FNQA 2YDXA 5KUTA 2PCLA 4B5KA 5D84A 5BMOA 1AN9A 1FNBA 2XGGA 1KQ3A 5DISB 3LMKA 1LTKA 4Z8XA 1A2OA 1GGEA 1ADCA 2JBAA 2QN3A 3FZNA 1RAEA 3F5QA 4R2MA 3V6MA 4C4OA 3BD7A 4YRPA 3IUNA 4C9BA 2OP0A 1KRXA 1I7LA 5LD2C 1M2VA 1M6HA 4OQ4A 4G9GA 1ZCAA 5AI5A 1KO8A 2GEBA 4UVDA 1LBTA 2PD4A 2R1UA 2UVQA 2G80A 4CLXA 5EE3A 2QQFA 3X3HA 4KPEC 4C0QC 1ZH4A 1NJ8A 2XOKD 5A7GA 2F8LA 4M99A 3Q6NA 2R6HA 4OJMX 5HGJA 4ZDWA 5EP1A 2WYHA 4UHCA 2FGJA 4N5IX 1GAEO 5DX1A 1P81A 1SCKA 2WJ6A 2QA5A 2R8EA 3MWEA 2LRHA 2D59A 2RHWA 4L4XA 2VF4X 3CSSA 1DJMA 1TTTA 1JNXX 4G0OA 3TTSA 1IHYA 4DGQA 1J8DA 1QAQA 2I3GA 2WUWE 4BDTA 1D0IA 1TFUA 1QHNA 3HUUA 1Z4NA 2OZEA 3IDQA 2IYFA 4B85A 4CMAA 1H8HD 3QKTA 4ZDJA 2QLLA 2FMKA 3DZKA 5J2UA 1KSJA 4DMLA 1FP2A 4OL9A 5CYOA 3L40A 1FZQA 4AWAA 3KQWA 3K09C 1YZLA 2OKGA 4AK9A 5AI0A 4EATA 3IB6A 1L5HA 1OLUB 3BF7A 5JCOC 1VSBA 4KFCA 2RHLA 4DMHA 2CCJA 2V4ZA 1QBKC 2XYRA 4Q05A 4WL0A 1PJBA 2JFOA 1MO4A 3WGMA 3B9BA 2W8BB 3KJIA 4UHEA 4TKVB 4U9HS 1KDTA 4OHOA 2ZCJA 1I2CA 3FY4A 1ZVQA 3CLRD 3OZEA 1Q1EA 2F1JA 2VHCA 4JKYA 4RD3A 1V5WA 4BO2A 1T9KA 3E2MA 4IMRA 5CDSA 2PWAA 3Q3JB 4PQEA 3ZY6A 4F1WA 1CW2B 1R4MB 2XNCA 1EJ0A 5IANA 3D0QA 1V95A 3DCYA 3JRXA 3UHJA 3V46A 1Z5UA 3ZG6A 4KQ1A 4PRZA 5J63A 4QYIA 2QGFA 4CMBA 4CN8A 4IJMA 1BO6A 1RQGA 1CRLA 1FTQA 2ZRQA 4MIOA 3UCFA 3LDHA 4FN4A 1MEOA 1YR2A 4ALMA 5HKAA 1T6ZA 1NTRA 4YAGA 3TVTA 2V7UA 1KU6A 1WUTA 2DVMA 4RFSA 4ZVUA 3PTAA 2H3HA 1VGVA 2Q6OA 3CKLA 3EBPA 1BCRB 3MYRA 4BVGA 2J3EA 1G4AE 2WUFA 3G7UA 4D4GA 3QX9A 4ZAZA 1QC5A 1AV7A 3G6WA 1Q7GA 4BHTA 5C37A 4H18A 3NBMA 1R4MA 1UFRA 4L6IA 2FEMA 2H54A 2YHAA 1E2JA 4C7BA 3DC7A 2FMTA 3ZD6A 3FR7A 2H5JA 3DAYA 1K4YA 2B1IA 2LGJA 3FSRA 1FTNA 1ULHA 4F4JA 3BZBA 3ZZNA 1UBNA 3DOCA 2DTDA 2ACKA 4MVJP 4L73A 1WMFA 5LCXA 1FFXA 1UZLA 2BWJA 1KMHA 2AG6A 5ES3A 4MYTA 4JLSA 2AFIA 1CJKC 3DVRX 3AJ8A 4MLPA 4BQOA 3STVA 1U9ZA 1XZCA 2R96A 3HFJA 4IOLA 4ROSA 4UUMA 4V0LA 4B33A 5HCUA 3ODPA 1DKQA 4E7PA 1CIJA 2AOTA 5H02A 5DMHA 1X7YA 1AQJA 4F2WA 5I7OA 3EWIA 2FSFA 4DM7A 1GA1A 4IJKA 1V7ZA 3VV2A 3MTAA 4ZZ3A 1JBEA 1RQ7A 1H1DA 3HLTA 3ABZA 4BYMA 5FH9A 2P62A 2WD9A 2X0JA 1JF8A 4UTXA 1PT5A 2H1VA 3RC8A 3Q6MA 2RHGB 2BAGA 3NETA 4H1VA 1DXQA 5E7QA 3SZMA 2JHGA 4RTPA 4TLEA 3WIUA 3LY7A 4LAFA 1THTA 5FWXB 2OLKA 5CPBA 2ZZKA 3GV0A 2K2QB 2XOEA 4I6GA 4ZI3A 1CEXA 2SECE 3IV7A 1NX6A 2BBTA 3AEKA 3CYFA 4W8OA 4N41A 3UC9A 1FFWA 1XVAA 1VDZA 4RJIA 2QV7A 1NQVA 3HKDB 3FPLA 3MS7A 2AXNA 3VXKA 2VK1A 2Q7OE 1VSUA 3NPMA 3VR3A 4TX1A 2FSUA 1QRAA 1NOJA 1Y1PA 3NKFA 4KW7A 4QFMA 3ZE1B 1KYYA 5KYKA 2IIPA 3TW0A 1KAGA 3ZK9A 3AILA 3I05A 1JIXA 5FBKA 5I4KA 3NV9A 3C3MA 2GF2A 4LKRA 2RBGA 3AVXA 4B2LA 1K0UA 2ZJ3A 4DSAA 1S2GA 1LRLA 4IIGA 3T54A 3BJIC 1FP4A 3M6LA 4UNPA 2ZYIA 3X1ZA 3SS8A 2EEPA 3OAAD 4OOEA 2ZYUX 5MGNA 3C6XA 3L82B 1DIHA 1TF7A 4OHWA 2D0IA 3I76A 5B3AA 4MW7A 3L05A 5DBEX 5CHEA 2PH3A 4Z0PA 1TK2A 3LQ2A 2R1TB 3VR0A 1DIAA 2ZFUA 3USES 4LOLA 4BE7B 3WKBA 5FPYA 3REFA 4WJZA 5GGYA 2DKOA 1NF2A 3KAPA 4LBYA 3RVMA 1BXRA 1Q1AA 1SOAA 4L8GA 1PS0A 2K5UA 3EGEA 4RTMA 2XAAA 3GDHA 3G1TA 4D96A 2ZJBA 2VT7A 3VZSA 4TS4A 1SELA 2Z2KA 2AKAB 4DWOA 1XCMA 3KEFA 1OPXA 4ALJA 4KLCA 5BRNA 2P2CA 4MUJA 5FOUA 3DHYA 5IK2D 4REOA 1E9SA 4JKIA 2Q5FA 1UWLA 1DC8A 3WR5A 4Q7JB 1G5RA 4XQ0A 1IBKB 2QVZX 1U0TA 1OGJA 2Q4DA 1ZEJA 3FROA 5FQNA 3INNA 2HQOA 1U8FO 3GVPA 4BNMA 5JD6A 1YU9A 1KY2A 1P5HA 1TZ2A 2VVTA 2PWYA 3HXLA 1C9EA 3AR5A 4QD3A 3WL4A 3QJYA 3VKWA 2C57A 2NT4A 1ETHA 1KJZA 1U4OA 1RCUA 2R1TA 3HJUA 1GFWA 5G1PA 3SR4A 4C30A 2P2SA 4WFKA 1IOLA 4AS3A 2BUCA 3ZH2A 4C4SA 3O90A 1MJ5A 2FEKA 4WKCA 5IARA 1CDZA 2FP4A 4KRGA 2X6TA 4A8JB 4MRNA 1KI6B 5EVCA 4L6CA 4IVQA 1E9CA 4DDUA 4H3VA 2VK4A 4XJVA 3IBGA 3PZRA 3GLUA 1C3OA 1GPKA 4WK0B 1MV5A 3NBXX 3ROZA 3W2EA 3JAWA 4NCAA 1VB5A 2A57A 1P0FA 3H5NA 4FUQA 4FWBA 1U0LA 2WY2D 3W9SA 1MOSA 4PC7A 4BO6A 4Q4CA 4F85A 2X2EA 2YXDA 3D8HA 3PHBE 2CBZA 4Q15A 3ZWKA 4WN3A 1XU7A 3NNNA 4YRFA 2WSBA 4G1CA 1XLTC 3DE0X 1P9LA 3IAM1 4JDUA 4OUDA 2GXUA 4I99A 5H3LA 1R0LA 1RHMA 2G9VA 3EEOA 2X8LA 3H9CA 2YFQA 1LWOA 1CUZA 1YS2X 1P1RA 3D8NA 2QNBA 3QOFA 1W76A 1ULSA 1M7GA 1DWPA 3A9UA 3FYUA 3IJPA 4L5BA 4U2CA 2ZIEA 2GVDC 421PA 3A6GA 4A10A 3FHTA 2E2WA 4BO3A 1N3LA 3FTFA 2CLOB 3F7NA 5GV7A 5FBVB 3FNEA 1PWXA 2IEBA 3Q40A 4UBNA 1KI6A 5CNJA 4QHTA 4C0KA 4MS3A 5AM5A 2CL0X 3ND8A 4KUEA 3KHUA 5BV8A 1XEXA 3N3BC 5AKKA 5FPTA 3F1LA 3SFZA 4D4MA 1VTKA 1FQKA 7REQB 5LQCA 2E1RA 2O2YA 1WSAA 3WQRA 4BNVA 4M1MA 1OFGA 1W8DA 1Q6ZA 2FPGB 2R0QC 1RWNA 4DLVA 4RSGA 4F46A 5FF9A 3WQBA 4K6KA 2CWWA 4KDCA 3R7FA 2QE7A 5C8YB 4QVKA 2X22A 2ET6A 2WYVA 4PQFA 4L9RA 5HOEA 2ZSIA 1E2UA 4FS8A 4V2UA 4LRXA 4YR7A 3DXXA 1G5HA 4HLUC 4ZVVA 4RD4A 4Z53A 3NWEA 2L17A 5TSDA 3T4EA 2FCRA 4W5TA 3E3AA 1T91A 4M88A 4NYMR 4HTFA 3PGKA 3RU3A 3SQOA 1MZPA 2ZIWB 3IA2A 2NG1A 2TRSB 2O7VA 3EVTA 4LY0A 3MOGA 4KFSA 4UE6A 4OI1A 3T9CA 2J32A 5J5AA 1VZ2A 3PCRB 1N6IA 2D7CA 1M1UA 3FVTA 3E9RA 2UZ3A 2JGDA 5ADWA 4ALLA 4GZ6A 4PANA 4EG7A 1JIIA 2Y0EA 1JEQB 3LI2A 2EC5A 2FF5A 3MCTA 4QTXA 3LCCA 4Q1VA 4BUCA 4MITA 4DPMA 5LJLA 4MDYA 3QXCA 4DDTA 4B2YA 2WM9B 3EXHA 1XF9A 4JDPA 2C84A 3U31A 4KMRA 2WIKA 2IV2X 3ESBA 4I55F 2PIDA 3TYXA 4AULA 3OQHA 1UAAA 3DZGA 3KUDA 1HI9A 4C0JA 1HORA 1S2DA 3BSWA 2ZAOA 3EGWA 2ZSDA 5ADVA 1EFDN 1TJPB 4PZZA 5NULA 2WBLC 1AMOA 4B87A 1EGAA 1NV9A 4INAA 4REQA 1PFKA 3TR6A 1XLUA 1SU6A 3O4GA 1GUFA 3EZYA 4ES6A 3OU2A 3FFAA 5EP3A 4ZQEA 1YJCA 2I0FA 2QTZA 1GILA 5ALPA 4BJHB 2Q0QA 3KXPA 4ASUA 3NDIA 4Z2YA 2H1RA 2OGSA 4XSVA 5KMGB 4IW3B 4CMEA 2DWPA 1UF9A 3DSRA 3KALA 1UZMA 5CW1A 1JXOA 3RROA 3ANSA 4XYEA 1V1MA 2Y66A 3TW8A 5LP6A 4L4UA 3TPZA 1S8FA 2F43A 2REOA 4RESA 1F4LA 4DR6B 3AHCA 4DQLA 1PAUA 1VL5A 2CBXA 4WXHA 1E92A 3CW2A 4MJLA 3I2KA 5E7IA 1HDXA 3FA2A 4DCVA 3BXPA 3EIXA 5CB8A 2GZDA 1E1NA 5E6UB 1M9NA 4Y6LA 2E0IA 4AKGA 1CQZA 3GLFE 1TZJA 1OPRA 2WKWA 1GGJA 1PJCA 1ZK1A 3TJZA 1J9EA 1Z83A 5DYYA 2GD1O 4R05A 1FNCA 4BNJA 4DJDC 4WI1A 3GLTA 1LFDB 4NH0A 3B2NA 2D0DA 2HL6A 3R3JA 2JJMA 3ZCPA 4AU1A 4B8WA 4HEA6 5L9AA 1BMTA 5IULC 1JEAA 3CPHA 3I42A 1BGWA 1SU8A 4DNQA 5BQXA 4G5YA 4CR8A 1ORWA 2E85A 3LNCA 3O92A 3F6BX 3S8EA 2BC9A 1D2CA 1II9A 3PKZA 2GPSA 4B4WA 4IF6A 5AFSA 1TIPA 3IDAA 2ZZNA 5DP1A 3HABA 2IYOA 3DZJA 2XOXA 2WI8A 4O6VA 5AW7A 2UXBB 2WM8A 4DF3A 1QNFA 2FLWA 3LW7A 4GKVA 4RQUA 4YTEA 1YBMA 2FWIA 2XNJA 3IEUA 4WZAA 5JOQA 1KI1A 3MRTA 4IHKA 4CLOB 4JI3B 4CMHA 3ZDAA 3HO6A 2DBZA 2J3HA 3FSGA 3TOCA 1PN3A 1KEKA 2ZYWX 2DH6A 3IUEA 1LI4A 2A0XA 1U7WA 3AUSA 5BXQC 2VRWA 4EVRA 1U8ZA 4Q3BA 4O4LF 3JATA 5ALYA