4D3DA

Structure of imine reductase bcsired from bacillus cereus bag3x2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
285
structure length
285
Chain Sequence
b'NRKSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMINE REDUCTASE
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
total genus 116
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3dA01
2FRDA 4RVHA 4NBUA 4CMHA 2J5KA 3I4FA 1VJ1A 4KQXA 4PLGA 2NV6A 3WLFA 3K73O 4A7PA 3ZDFA 2NVBA 1EK6A 3AOEA 2ZB3A 5ER9A 1MLDA 2Q45A 4NBWA 3ZWOA 1JA9A 4QECA 3UXYA 1UXJA 4OO3A 2X86A 2VNSA 3RUEA 4A03A 1YQXA 4CJXA 5FF9A 4RVFA 3WNQA 1NAHA 1YXMA 3MJEA 4R1NA 3DTYA 5KJEA 1PZFA 4J4HA 3SX2A 2P9CA 4OQZA 1UZMA 5DZSA 3PDJA 4B8ZA 3WTBA 1WWKA 2HSDA 2X9GA 2GN9A 3MWDB 1VC2A 4XYGA 4ZN6A 4CQMA 3AU9A 2C82A 5TC4A 5TRTA 3ADPA 5T5QA 2AQHA 2NACA 2DPHA 1PS8A 2P91A 4GI2A 3OQ1A 2Q1TA 4NI5A 5IXYA 1EE9A 2PTGA 4BO7A 3H3FA 4ALLA 5JDIA 2RIRA 3DHYA 4FBGA 3IS3A 4BO9A 1VL6A 1V3UA 3I9NA 1VLLA 3JQFC 4CMKA 3RKUA 4I9UA 2GZ1A 1Q0QA 3ZWWA 1NYTA 2HQ1A 2VHYA 3I9JA 2WWRA 5KKAA 3RKRA 4MVJM 4EZBA 3EVNA 4QO8A 1NVGA 3EGOA 5HTOA 4YAEA 2Y0DA 3KXDA 1HSOA 4ND5A 4QTZA 1HZZA 4MP8A 4PRLA 2DM6A 1B0AA 4DIOA 4YQZA 3RUFA 2Y93A 4DPMA 3PK0A 1HE5A 2ZQYA 3E18A 3H6KA 1DIAA 2AG8A 2CDCA 2OMEA 2X8LA 3IUSA 3UW3A 4EJ6A 1VM6A 2P4HX 4QX6A 3RC1A 2HJSA 4NK5A 4TSKA 3WWZA 1NR7A 1C1XB 4HY3A 1AN9A 4QT0A 4ZVVA 5CDGA 5A9RA 1K6IA 4J90A 1OI7A 2AG5A 2CUKA 4B3JA 1NPDA 5AYVA 4UUMA 4II3A 4RVUA 4XCVA 3RUCA 4DPKA 3PTZA 1BVRA 1U1IA 2XPCA 2G5CA 5I9NA 4DTIA 3G3EA 1BMDA 2DBVO 1SAYA 3B6ZA 2A94A 3DR3A 3GF4A 2VUSA 1XLTA 3RASA 3GGPA 2A9FA 1VJ0A 1HDZA 1GEEA 3HG7A 4OXNA 1B3RA 4YJHA 4A26A 1CIVA 3HZZA 5EQDA 4I5GA 4U6QA 5TJ9A 5C7IO 5DULA 1NAIA 1A7AA 1Y8QB 3SVTA 1GV0A 3UCXA 2NNLD 4AJ4A 4FFNA 1QYDA 4NBRA 4D3SA 2XF8A 1BDBA 1EQ2A 3O4RA 1X1TA 3HSKA 5EINA 4ZGWA 1AXGA 1OOEA 3L77A 4L4SA 3H3JA 3SLGA 3GGGA 1NHGA 4C4OA 2CVZA 2Q4BA 3GNTA 4J91A 4XQ9A 4DLLA 1YRLA 2YHIA 4PFJA 2JD0A 3WXBA 1DHTA 1R4NA 2VWGA 4BNUA 3GFGA 1Y5RA 4PLTA 3TOXA 2QZZA 4R41A 4I9NA 4DQUA 4JIGA 4B3HA 4HNHA 3AM3A 4MIYA 1H94A 1UH5A 3S2IA 1MUUA 3MCVA 1SC6A 3KSUA 4U5QA 1UP7A 2P4QA 3PHIA 2HRZA 2V6BA 3VDQA 3ZWPA 5G4KB 4RPKA 1YO6A 1X7GA 3QVXA 3JQ7A 2O2YA 1YOVB 5L7TA 2Y68A 5EMHA 1I33A 3JQ8A 4D46A 4B7CA 1ZK0A 2NQ8A 1I36A 3QA9A 4PLCA 1ISFA 3I9KA 3LDHA 3K31A 3DMTC 3SBOA 5JMPA 3AY7A 3CXRA 3HN2A 5HBRA 1WAMA 1GL3A 5JBIA 4XYMA 3VPXA 4IPTA 3K30A 3U3XA 2R6JA 2W2KB 5FI5A 4CMEA 4I9HA 1WNTA 1Z74A 5ES3A 3FF4A 2JD2A 2IDZA 1R66A 1DLJA 4QFDA 3TRIA 3JD1A 2PWZA 1LA2A 2B5VA 3B1FA 2NU6A 2WD8A 3UOGA 2I99A 3GC6A 1ZK4A 4IDAA 5BQFA 4D0SA 4FOOA 2HRBA 2GRAA 4M86A 3L4SO 3TZHA 4EYEA 1DJNA 2EGHA 4HFNA 1KERA 4YRAA 5A3VA 1XQ1A 4YYZA 5GZ3A 4M1QA 2FR0A 4BKQA 3TOZA 2GZ3A 2AW5A 5JY6A 2B69A 4BKRA 4GMFA 3F3SA 4U8GA 1EFLA 3L6OO 3GAZA 4PLHA 1MFPA 4OYRA 4RF2A 2YV3A 3NGLA 4P4GA 4NIMA 4YVFA 2V6MA 5F1KA 4FC7A 1QKIA 1W73A 1PGNA 5EESA 3IP1A 1F12A 2QYTA 5BSEA 3MJVA 3K9QO 3OA0A 2VWPA 3C85A 4CMGA 2TMDA 4CQMD 1EMDA 1E5QA 1JAXA 4IDCA 3W4KA 2YJZA 5I7EA 1PJ3A 5L4SA 4Z9YA 5ICSA 1KS9A 2F1KA 1YONA 2OORA 1Y6JA 3WYBA 3FPLA 1XKQA 1MXFA 3KB6A 4NU5A 1JDJA 5JE8A 1R0KA 2GR9A 1ZBQA 4PLPA 1T4DA 4XRGA 4YQYA 4ALIA 3SJUA 3N74A 1H6CA 2NVWA 4GX5A 1PEDA 1RM0A 3AFNA 1KY4A 3ZI0A 1OC4A 4PLZA 4OXKA 3TZCA 1ORRA 4B4WA 4KQWA 1I10A 3AUTA 1IPFA 4ND2A 3JQGB 1P9LA 5IZCA 2I65A 4I8XA 3E03A 4OXYA 1S6YA 2QYSA 3WG9A 1I0ZA 2B35A 2IZZA 1UAYA 4EEXA 4EUEA 3HADA 2Q49A 4G65A 4DLAA 1TT7A 2ZYGA 5HA5A 4EJMA 5CDUA 1BXGB 3UUWA 3QVOA 1O0SA 1C1XA 3IKTA 2Y0EA 2VHXA 3JV7A 3BMCB 3BYZA 1DFGA 3I5MA 2GLXA 4QUKA 5A04A 2C59A 4BNMA 1PJCA 1ARZA 1LDMA 5DCYA 2C54A 4W7HA 4BQPA 3KHUA 3OECA 4CM9A 1LLDA 1QR6A 4NFSA 2W2LA 2VOEA 2D4AA 2PKQP 3FBTA 3FR7A 3LC1O 3OJFA 1UZNA 1KETA 5KJCA 3FTPA 4XQEA 1X13A 4FN4A 4AJPA 2VZ9A 4YAJA 1PQPA 2AE2A 3D4NA 1H5QA 3PYMA 1Y8QA 3JCZA 4AG3A 1N1GA 4WEQA 1R0LA 3BTVA 4E0BA 1PZEA 1UDBA 3C1OA 1IUKA 4FIZA 5F3RA 4K26A 4IS3A 3SEFA 4BNLA 1SMKA 1U5CA 4NH4A 4Y6PA 2NU9A 2Q2QA 2Z95A 3PHGA 4R9SA 5DNAA 5CAEA 1NHWA 4EW6A 5KVSA 2FPPA 3VVCA 2NTVA 2C7VA 4Y67A 1HXHA 4WLNA 1BHSA 5T8KC 3WYCA 2YYYA 1ZVMA 1GUYA 2J5RA 1DIBA 3ZH2A 3NDJA 3DZIA 4AJNA 4W6ZA 4FFLA 3G17A 3RD5A 2I9PA 1MG0A 4CR6A 5TX7A 2X0RA 5IZ4A 2P5UA 3PIDA 1XQ6A 3NT4A 4MVJH 3Q6IA 2P2SA 3ZWAA 3VVBA 1ENOA 2YW9A 3TNLA 2DLDA 3I4CA 3OFSA 1XYGA 1X15A 2O7SA 1YOVA 3FSRA 4FJ2A 3AWDA 3T4EA 3ZWBA 3EYWA 5GMOA 4TVBA 2QX7A 3RBXA 4BNXA 5A1TA 2E49A 5HWSA 3STHA 5IAAA 1ZK1A 3OIGA 2VHWA 3ZHBA 1PWXA 3H9UA 3QQPA 2BD0A 2W2KA 2O3TA 4ID9A 2YV1A 1H6AA 1LSUA 3CPSA 4WECA 3ZU3A 2EGGA 1E3SA 1AXEA 2Y99A 2V7PA 5FI3A 3U4DA 5TT1A 3LC7O 3PHHA 3AY6A 3DHEA 1JVSA 4BNVA 5DT9A 4DQVA 1DLIA 3GAFA 3ZWXA 5IN5A 4WOKA 3ONFA 2YFQA 1ZMOA 1BXZA 4RL6A 2QRLA 5I9LA 4PCVA 2YY7A 3WTCA 4Y6SA 5G4LA 2AEFA 3CEAA 3E82A 3KSZO 4PRKA 4N5NA 4J0FA 3H9EO 3IC5A 3JYOA 3H65A 2B36A 1EUZA 1ADFA 1C0IA 5T6BA 1VL0A 3DZFA 4Q3DA 1WZIA 3JQEA 3HWRA 7ADHA 4GKVA 2FWMX 1XWFA 5DCUA 3DZHA 4PLYA 4Y8VA 4I5FA 2X0IA 3DBRB 5C5IA 3JQ6A 1NTOA 3NTRA 3TWOA 2BMAA 2C7GA 4WLEA 4CV1A 4EITA 4IQ8A 2NADA 2AQIA 4JJGA 3DHNA 1KBZA 1R15A 3C1TA 2X9VA 4ONEA 3TDKA 4BIIA 3OBBA 4CM1A 1HE3A 1E92A 3LYLA 3JQBA 3U62A 3D5QA 5EQFA 1CYDA 1XIVA 2GO1A 3K5PA 1FDTA 3ORFA 4ILKA 4MP6A 1G1AA 3I9LA 4E5YA 1HE4A 5TJHA 4MPDA 1NQAO 1VKNA 4NDNE 1T4BA 1LTHR 3FD8A 1XA0A 4P4LA 1GFSA 2VZ8A 2VYND 2DTDA 4XIYA 3VC7A 4AJ1A 1SEVA 1X1EA 2VWHA 1NPYA 3H4VA 2YDXA 2DVMA 4BV9A 1JAYA 4EUFA 1WMBA 2OO5A 5A9SB 1CJCA 4YAKA 3AJRA 2P9EA 5L9AA 4NBVA 2VQ3A 4F6LA 3U9LA 1PL7A 3JQGA 4XGIA 4EDFA 4UVGA 4YT8A 3RC7A 2NTJA 4ALKA 3ETEA 4OGWA 2O3UA 3FI9A 1PGPA 1TVEA 1DB3A 1P3DA 2EKLA 4KOAA 1D1TA 2FPGA 4MKZA 3P2YA 2HK8A 4WNCA 4YEDA 4IMPA 1LX6A 1M6WA 1BXGA 3GG2A 4E2XA 3RVDA 1ZO8A 5KVVA 1ZXBA 3BMCA 1U4OA 4PLFA 2YQ5A 1MV8A 3ZHXA 2CF5A 5CFZA 5KIAA 4BGUA 4GBJA 4E5PA 5J23A 2UAGA 2O3RA 3FCOA 1DIHA 1HT0A 3EK2A 4CM7A 4OKNA 1HLDA 1GV1A 1PZGA 3TFOA 4L0QA 2AE1A 3ANMA 3FTNA 4HUJA 1XSEA 1O9BA 1U3VA 2W98A 5I8WA 3VTFA 1KC1A 4CM9D 1CQJA 3ITKA 3S55A 5COBA 5I7FA 2W2LD 3HQ4O 3R3SA 1BTOA 3BTOA 4NR0A 4YWJA 4R5HA 5KVCA 4DQXA 3W6ZA 3JYQA 3KRTA 5ITWA 1XU7A 5GZ6A 2VUTA 4PGFA 1QRRA 1P1KA 1PL6A 2D0IA 2VUUA 5TS3A 3ZNOA 4D45A 2Q50A 4TWRA 4BGVA 4WK6A 5L3ZA 4XGNA 3VZRA 3JQAB 5H82A 1OC2A 4Z9FA 1IB6A 2CNBA 3HN7A 1YWGO 4FW8A 3TQHA 4JLWA 1CERA 2O4UX 5FYDA 4CMAA 6LDHA 3QW2A 3OJLA 4L4XA 3V1YA 3AM4A 3KYBA 4YR9A 3ST7A 2BELA 1ISGA 4L76A 1DRWA 4H3VA 5G0TA 3JTMA 3L6EA 1X14A 2C20A 4CMEC 4FOSA 2JL1A 2H5LA 3L0DA 1ZEMA 4DYVA 1IPEA 3E9MA 3NKLA 1QMGA 1NFRA 1WDMA 2PZMA 4ZQBA 1LC0A 1JN0A 1SB8A 2FMUA 4WCFA 5CP8A 4FJ0A 4DBVO 3GNQA 3OQBA 2HK7A 2VTDA 2HMUA 1DC5A 1YB4A 2G76A 4A5OA 3B1JA 5LCXA 2FSSA 2QG4A 4NMHA 1KEUA 3Q0EA 3UKOA 3F1KA 1DAOA 1KOLA 1JKJA 4ND1A 3GZNA 5JFOA 4R1TA 3VDRA 4PG7A 4WUVA 2NM0A 2Y1FA 3GZ4A 1V3VA 5JNLA 4IQ0A 1VI2A 4GQAA 1H9BA 2VZ0A 3TF5A 1YQGA 4W9NC 1YS4A 3TN7A 1YGYA 3E1KA 3HFSA 2BGMA 2VCYA 3L07A 4UUNA 3RC9A 2A92A 3AUUA 2OXIA 4UVHA 2RHRA 1GQQA 1W0CA 2GYYA 1QXSA 1UXIA 2ZB8A 2O7QA 3NT5A 1YBAA 1I3KA 4R51A 5DDIP 4ALNA 3LQFA 4KDFA 3BXXA 1Y7TA 1YH3A 3HHPA 1PR3A 3WNVA 2PA3A 5JPIA 9LDBA 5AXDA 3GRPA 2NU8A 1G6KA 1Z45A 3O9ZA 1YDWA 4DPLA 5ITVA 1QYWA 2DC1A 4LCEA 2ZQZA 3WOHA 3NV9A 3DBRA 3QWFA 3K96A 3A14A 3ENKA 4XRRA 4DIBA 2P9GA 4X54A 3WBBA 1QLHA 1E7RA 4RLHA 3JD3A 3AI3A 4CLOB 1GAEO 1R16A 1T25A 1Q7GA 4UEJA 3DO5A 2RH8A 4CV2A 1P1FA 4QXMA 1HDXA 2B4QA 1KVTA 2CSUA 3DONA 1PQWA 3CMMA 1NVMB 1I3MA 4N18A 3PZBA 1I2CA 3HJAA 4FJ1A 1TLTA 2HMVA 4NK4A 4OJNA 3A1NA 1QYVA 3H9QA 4Q3EA 4CUJA 1W6UA 3MEQA 3I6QA 3OMLA 4M49A 5DP1A 3FN4A 3DMYA 3CH6A 2ZTUA 5A9SA 1PJ2A 4WLFA 3OJEA 2R00A 4TZKA 1U3WA 3PHLA 1ZUD1 4OM8A 1OFGA 1LBEA 1LDEA 2FHSA 4PIVA 1B2LA 1GCUA 4G2NA 3VAZA 1DXYA 3NEPX 4DGSA 4BNNA 1V3TA 3LC2O 1VPDA 4B4UA 4BO3A 4E4YA 5JC8A 1E3EA 3ANNA 1SO8A 3NJ8A 5B4UA 5CG2A 3DBLB 1EUCA 1N5DA 3WGTA 4D7AA 1ISHA 1PX0A 3V1TC 3N7UA 4N7RA 1EVJA 1MC4A 2IXBA 5JYDA 1EVZA 3PFWO 5U1PA 5BNTA 4M8SA 1GQ2A 2SCUA 4BMVA 2OOSA 3DBHB 4RPGA 1R37A 1Q7CA 1MXHA 4ITUA 3CZRA 1U3UA 3F4LA 3C7AA 1M6HA 1HLPA 4MVJD 3JSAA 4QSMA 3QVTA 3WBFA 5CEFA 1AHHA 2I76A 3CE6A 3DXFA 2JAPA 1N1EA 2EWMA 1D7OA 3UGKA 2CD9A 1Y8RB 5DF1A 1GCOA 2C2YA 3TZQA 5K6AC 3D3EA 4RV9A 4PN3A 4HWKA 5IDWA 4FD3A 1A71A 5DP2A 1P1HA 3RC2A 3KM0A 4JNKA 1UP4A 4YPOA 1UXGA 5A02A 5BNIA 2HKIA 5EL0A 2EG9A 1KVUA 1LSSA 3S2EA 4CL3A 3GH3A 4ZQFA 3ZHZA 3VZPA 1HYEA 2PH3A 5C7OO 3JQAA 4UVIA 1TXGA 3UN1A 5KJ6A 3KETA 2OBNA 5FFFA 5AXCA 4F46A 1N9GB 1M76A 3WGZA 4DXHA 4YA6A 1YKFA 2NTNA 4B7XA 1QORA 3ZWVA 3TSCA 4J0EA 1M66A 2BKAA 3PJDA 2PZJA 2OFPA 4J2HA 3ZWNA 3OP4A 3WMWA 2GCGA 4L75A 5I7SA 1FDSA 2GN8A 1PJBA 4UULA 1A4UA 1LC3A 2X23A 1U5AA 2EERA 4O1MA 4RF3A 4E3ZA 2Y67A 1ID1A 1GTMA 4R69A 4DC1A 2NLOA 4JK3A 2Q99A 5JDCA 3DOCA 3CINA 2VRCD 4D3FA 4TRRA 2Y1GA 4Q9NA 1XG5A 4D44A 4CLXA 4O5OA 1QLJA 1WXDA 3F6YA 4YDRA 4B3IA 3R3JA 3PLNA 4LMPA 1EFKA 1X0VA 1I01A 1BXKA 1T2DA 2AXQA 3NDRA 2NWQA 1PJQA 4A73A 3GVPA 4DMLA 4DA9A 4B8WA 5HM8A 4H15A 1UDAA 3GHHA 2IZ0A 2JD1A 4PVDA 2OP1A 3W8EA 1GY8A 2PZKA 2C07A 2DUUA 3OF2A 3Q9NA 4U6SA 2VT2A 2Y1CA 4FC6A 3C3XA 3HB5X 1E1LA 3X2EA 2X0JA 1WPQA 3ZU2A 3TL2A 2PH5A 1D4FA 4E5KA 3W8FA 1EE2A 5KOIA 2EKQA 4MP3A 4J43A 4E2WA 3GNSA 1OAAA 4FFMA 3V2HA 5KTKA 4UUOA 4BNYA 2GN4A 3SC4A 1DOHA 4IDEA 3F5SA 1C1DB 3JYPA 3VZQA 2J3IA 3AM5A 4E32A 8ADHA 1GZ3A 2P68A 4D41A 3FNEA 2GPTA 4MO2A 2ZTVA 3ZZNA 4Z0HO 4B4VA 1V9LA 2Q1UA 1Y1PA 5BSHA 5H81A 3WMXA 1DPGA 2QIOA 3ZNQA 3DC2A 4XKJA 3HNPA 1YL6A 1YB1A 3IJPA 1DFHA 3ZV4A 1EDZA 3BMNB 3I1JA 4CLOA 4BNHA 3WSWA 4RPHA 4HP8A 4CPDA 5AQ1A 4CMIB 2HLPA 2X4GA 4MOWA 4ALMA 3I83A 5AOVA 3B70A 4TVOA 4XD2A 5LDGA 1FF9A 2NVUB 2OGUA 3INGA 5F1OA 3L4BA 3TL3A 5IG2A 4IJWA 2O2SA 4UVEA 4O6VA 4XJTA 1WW8A 2GN6A 4XEHA 3OA2A 4KMSA 4XQCA 1KEVA 4BGEA 1P74A 1T26A 3I6IA 2HCTA 4JBGA 3AK4A 3GEGA 1D1SA 4ROSA 1CEQA 4AVYA 1ADCA 1RM5A 3W4IA 1PJ4A 3TFQA 4K6FA 3VPHA 1NPTO 3GMDA 5COQA 5IJZA 2DU8A 2OP0A 1HDGO 5THQA 4ZHSA 3DL2A 4OKIA 1DC6A 3DWFA 4YAGA 4OOFA 2DT5A 2ZYAA 1ULUA 3DBLA 1I3NA 1E3JA 1P77A 1VSVA 2G82A 3UFXA 3C7CB 1KEPA 3ZN2A 4KUEA 4GGPA 2DTEA 4OH1A 3CTMA 1DHRA 2YDYA 4II2A 2FZEA 1I8TA 4LK3A 3I9OA 3ZU4A 3P5SA 4LRTB 4S1VA 4Z9XA 3DBHA 4PG5A 2BHLA 1T2FA 3KEQA 3UHAA 4F6CA 2FN7A 2CDBA 3GPIA 2WE8A 3NUGA 4IM7A 4BNTA 1VRWA 4DWVA 3P19A 4R3WA 1B14A 4JJIA 1B16A 4HV4A 4P8RA 2NSDA 1PWZA 3JQ9C 2DBRA 2EEZA 4BMSA 1Y8RA 5KJFA 1FDWA 1AGNA 1H2HA 1A9ZA 1PGOA 1Y9EA 2FY8A 1IE3A 2UVDA 4MVJF 2AQKA 4DREA 1RYEA 4OSOA 4AJJA 4BNWA 3AOGA 3Q2IA 3VH3A 1A5ZA 2AA3A 1EEHA 1EBUA 3JD0A 4LGVA 2CY0A 4Y6RA 1Z75A 4CLDA 1EQUA 1ZXLA 2XXBA 5B4TA 2BLLA 5EJ2A 5JAMA 3KZVA 2GUGA 2EP5A 4WCFC 3ICPA 4WEOA 4CMBA 1C0KA 4W4TA 4I5EA 4E33A 3GR6A 4FB5A 1GYPA 1N9GA 5JS6A 4AICA 1E7SA 1I24A 1J6UA 3PWSA 3JQAD 2J3HA 3BTSA 5I8ZA 2VT3A 5HS6A 1GZ4A 5IDYA 3RJ9A 3WR5A 4AL4A 4BQRA 1U2DA 1GYRA 3ZW8A 2O3QA 2E4AA 4RVGA 1Z6ZA 3D4OA 4BO5A 4IQGA 2H9IA 1ZSYA 4K6CA 3ON5A 4XJSA 3RBVA 2JFHA 4NJOA 3UICA 2D1YA 4GX0A 3X2FA 3DOJA 1RM4A 2HO5A 2D5CA 4M54A 3WGHA 4CR7A 3SC6A 3D64A 3EZYA 4B79A 3ZV6A 4WCDA 4GVLA 5TSDA 4R01A 3ZCXA 4PZCA 2OZPA 3ASVA 2IYPA 5BSGA 4FR5A 4DVJA 3PEFA 1U7TA 3I52A 4CLEA 1NWCA 3FRJA 1CF2O 4IDFA 3H9JA 3JQFA 2DQ4A 4NNJA 3DQPA 1C0LA 5ER6A 4Z0PA 4LVUA 2D8AA 2H1SA 1T2AA 3V8BA 2YZ7A 1PS9A 3E9QA 1TT5B 4NHEA 4XA8A 5C7LO 2RBEA 2O3JA 2ZIZA 3QVSA 1IL0A 4J1NA 4FGSA 9LDTA 4HFJA 4O0LA 1XU9A 4IY1A 3JYNA 5G4KA 4MVJP 5L53A 1C1DA 1LUAA 3JD2A 1ZZEA 3G79A 4A2CA 3IL2A 4FFRA 1E1KA 2C2XA 3AOEC 2DBZA 5KCZA 3GPDG 1HF3A 3UVEA 1HDOA 5CPFA 3WSVA 1E3IA 1Q7BA 4J1QA 3BHIA 1SOVA 5IDXA 4BO4A 1YBMA 3GK3A 2CVOA 3IIEA 5KJ1A 4BHTA 5JY1A 3HDYA 3RFVA 4CM5A 1EUDA 1PQUA 3ZWMA 2FR8A 2FOIA 4E31A 2W90A 4BL5A 4J9UE 1NASA 2J5QA 4GVXA 4XGKA 5EIOA 5FEUA 2BI7A 2W4QA 4DLBA 4CMIA 3DOOA 1LRJA 1RYDA 5A06A 1R12A 2R00C 4TKMA 4HXYA 2GERA 2NVUA 4DBZA 1YL7A 4IDDA 1GADO 2AEMA 5AXBA 2Y1DA 3HB4X 3B1KA 1K6JA 2ZB7A 5JDIC 3KSDO 1HWYA 4RQTA 2CZCA 2WTBA 3WJAA 2VYVA 3KYCB 1ML3A 4Q39A 3BMQB 4NJMB 5H83A 5DBGA 4J7CA 3L9WA 5G0VA 2EXXA 5COAA 4CM6A 2I5PO 1GQYA 3M2TA 3PIIA 5CG1A 2WYWA 4OOEA 3WYEA 1J5PA 1NFQA 2IXAA 2V65A 3QWHA 4IJKA 1RKXA 4YJGB 4EJ0A 1MA0A 4IDBA 1JKFA 3EMKA 4KWIA 2ZTLA 3LVFO 2JFFA 4RZHA 1HYHA 5LC1A 1ZH8A 3TZ6A 1R6DA 5CEJA 1Q0HA 3I23A 4HKTA 5L51A 5CPBA 1FK8A 4GPD1 1ZKMA 3JYLA 2O48X 4KTVE 5IN4A 4J7UA 2RAFA 2BFOA 4Q3BA 4F3YA 4LISA 5JAIA 5AVOA 2BF7A 2QQ5A 1FXSA 2WDZA 3JQCA 3ROKA 3PDUA 3IP3A 2EW2A 3CKYA 4IBOA 5IXSA 3W6UA 4M55A 1M67A 4NFYA 1P45A 4Z3DA 1T2EA 2VRBA 3MTJA 3QE3A 1WZEA 5TNXA 4JBIA 4EI2A 3VPSA 3DMTA 1R4MB 3ZHYA 4OQYA 4F45A 5L4LA 1BGVA 4CL8A 1KY5A 2HMWA 2HK9A 1DFIA 3WS7A 3PJEA 3EUWA 1HETA 2R2GA 2HDHA 4ND4A 1E7YA 3GA0A 4JP2A 4AJLA 3NJ4A 4TRMA 2UYYA 2AMFA 4Z0TA 4BKOA 1DRVA 1EVIA 3PVZA 4NBTA 4Z6KA 1I2ZA 3FPCA 4C7JA 2O3SA 3IAHA 1XELA 3AFMA 3N58A 4UEKA 4GLLA 4TQGA 3WIEA 2ET6A 2I66A 3E6AA 2POQX 4LCJA 4XR4A 4U0KA 2PY6A 2WE7A 4YJFB 3GDGA 4JXKA 4GSKA 4C7KA 1Q2XA 2JCXA 1U2GA 5JXWA 2UUPA 4R68A 1VL8A 3GVCA 2O50A 3FWNA 1PSDA 3DAFA 3IJRA 1LRKA 3OEYA 1O94A 1Z73A 2DAPA 1CQIA 3ZU5A 3VH1A 3VZSA 3LT4A 5ILOA 4RVSA 3A9WA 2VTEA 3RQSA 2J3KA 1KEWA 3VHRA 3ASUA 4LVCA 4ZU3A 4RF4A 4UUPA 2EP7A 1ENZA 1X0XA 4J7XA 1O6ZA 3VPFA 4JX8A 4L74A 2X7HA 1JTVA 4MJLA 2Y66A 1YJQA 4H16A 3F46A 3F47A 2X22A 2EW8A 3A28A 3KOUA 1H0KA 3LF1A 4NZ9A 1DIGA 5L7WA 4J1TA 2ZATA 4P4NA 5I9MA 4PZEA 2C5EA 3RBZA 1TT5A 4KUGA 3OIDA 1NVTA 3RSHA 1TB4A 3DAPA 3JQDA 1B26A 1JKIA 5EERA 2IEBA 3EY4A 1E7MA 1PGJA 2HMSA 4R1UA 3SLKA 4RGBA 3RUAA 4NPCA 1WVGA 1CETA 3VH2A 3DB2A 1PL8A 4OMUA 4E13A 4TMFA 3AY3A 3ONDA 3HDHA 4GKBA 3WQQA 3A06A 1PS0A 3WQSB 4CUKA 4NU6A 3C1AA 5F5LA 2X5OA 3DFUA 4DL9A 3QRWA 3WGIA 1IZ9A 1YQDA 1EK5A 2Q2VA 1P0FA 4L73A 3F9IA 3WFJA 5G0UA 3ROQA 1HSZA 1UUFA 1C14A 4LN1A 4RF5A 4FQ8A 3JD4A 4UEOA 4E2YA 1F8GA 4FFPA 3E8XA 2O23A 1C0PA 1EBFA 1T1RA 3ZV5A 5L40A 4QO7A 5CDTA 3H5RA 1H2BA 4R16A 4BS9A 1E7QA 1MGOA 2OL4A 3K8ZA 4HNGA 4GX1A 1KVSA 3WFIA 2DFVA 4ALJA 1O8CA 2GNAA 1H6BA 2X58A 3DFZA 1K5HA 5JCXA 3U5TA 2Y1OA 1QV6A 4J16A 4MKRA 1SNYA 3RIHA 2HU2A 3EHEA 3KBOA 1QYCA 2PD3A 1E0DA 1SPXA 1E1NA 4XDYA 3KYCA 4AJOA 5ENVA 1B8UA 1JQBA 4NJMA 2B4TO 4INAA 4OL9A 3U49A 4PZDA 1L7EA 3ICCA 3PP8A 2DPGA 1JU9A 2VYVD 2FSVA 3QJ5A 4QFCA 4W82A 1H9AA 3OH8A 3C8MA 3ADOA 1KVRA 4P22A 4L9RA 1IOLA 4IIUA 2HJRA 1CDOA 2VHVA 3PWZA 4YJGA 1YL5A 1O89A 3JQ7B 5T8KA 4KWHA 4PG4A 4CM4B 2WSBA 3GG9A 4TKLA 5CHEA 4G81A 5IZCC 3GHYA 3M6IA 4RLSA 5G2OA 4RQUA 1WLYA 4K9DA 2LDXA 1P1JA 3R0IA 1LLUA 4D0RA 1AUPA 2WMDA 3M2PA 3VH4A 2UUOA 4XB2A 3MWEB 1ISMA 4MVJE 3GVXA 2C5AA 2P5YA 1B15A 2JJYA 2B37A 3L6DA 4WKGA 1JW9B 3EAGA 4D79A 1P0CA 3PRJA 3H5NA 2C29D 3OSUA 4KDEA 4IMRA 5L45A 2BFPA 3WDSA 2PR2A 3UF0A 4KTTE 2Q1WA 1GDHA 3EC7A 5G0WA 1SEPA 1W8DA 4D42A 5KWEA 3WLEA 3RU9A 1RM3A 1DAPA 2W8ZA 1QSGA 5JLAA 1N8KA 1R4MA 1VE9A 3CZMA 2DUWA 5KKCA 2TMGA 3RFXA 1G0NA 3UCEA 3U0BA 2XXJA 4WLVA 4YJDA 1ZEJA 2V6FA 2I6TA 1U7HA 3CSDA 3P2OA 1ENYA 4IINA 1BW9B 3DZJA 2PV7A 5B4VA 4CUZA 3D7LA 3DDNA 4Z3KA 5F1PA 5ADHA 3FNHA 4PVCA 1J4AA 3RWBA 4BNIA 5EN4A 1U8FO 1LLCA 1A4IA 4J6FA 4YJFA 4ZD6A 3OIFA 3T7CA 4E30A 3GY0A 4BNGA 3D3WB 3I3OA 4FDAA 4BO6A 4LRSB 3I9MA 3FR8A 1IY8A 1G0OA 4E5MA 4R4JA 1H6DA 2CDAA 4RPJA 1BVUA 4N5LA 2AQ8A 4IXWA 5JCJA 4J49A 4ZRMA 2ZKLA 3Q1LA 4E21A 4GL4A 3CTVA 3HDJA 5JC1A 2ZK7A 5BSFA 3V2GA 4FPXA 3V2UA 4R5MA 4RJTA 1Q1NA 4R54A 3KUXA 2EJVA 1LDBA 2X5KO 2X5JO 1L7DA 4BKPA 5GY7A 1NFFA 3WGQA 5IFLA 2H6EA 3GFBA 5JW6A 1HRDA 4N5MA 1I3LA 1ZFNA 2GDZA 4ZQHA 1QP8A 4IZIA 4AJKA 1K6XA 2I3AA 1A72A 1ZCJA 2A4KA 2F00A 3ENNA 2Q4EA 1KVQA 3INTA 2GGSA 4KUHA 2GZ2A 4PLWA 2BRUA 4YTEA 3GMSA 1HDYA 2IODA 4OIMA 3NTOA 4GGOA 3GDOA 4XYLA 2DTXA 1BDMA 2H63A 1LDGA 1MC5A 3H7AA 2VHZA 4GLOA 4NQZA 5TF4A 3EZLA 5MDHA 1FMCA 1NQTA 2WM3A 1LQUA 4YT2A 3IKVA 1MX3A 2WD7B 4ZA2A 4P38A 5B1YA 3GUYA 3D4PA 1ADBA 4WASA 1DIRA 4EBFA 2C0CA 3QHAA 1BG6A 2ZCVA 3RJ5A 3ROMA 5HRUA 3ZNPA 2PLAA 4G5HA 3KV3O 3NTQA 1Q0LA 1CWUA 1ENPA 3DTTA 1BWSA 3CUKA 3WX0A 5A03A 1P33A 3F4BA 3H9GA 3AUSA 3MJCA 4BMNA 1ISIA 3W1VA 3Q9UA 4J9VA 4MKXA 4JQCA 4B4OA 2IZ1A 3L9XA 3PYLA 3R6DA 3RROA 3CIFA 1IHYA 4CLRB 2OBYA 5T57A 5ICMA 4CQLB 4WE3A 1FJHA 1JWBB 1JWAB 3MJTA 3QWBA 3ULKA 4CODB 1E3WB 4YBZA 3D1LA 1GU7A 3U4HA 3JQBC 1F0YA 3S8MA 3LZ6A 1XR3A 1OBFO 3KEOA 4KZPA 3AU8A 1HDRA 2BFMA 2X0NA 1EVYA 4YXFA 3RAJA 4QEDA 4JCOA 2JKVA 4R3NA 4HADA 5C37A 1ONPA 2PGLA 2Z1MA 5CDSA 4W99A 5JYEA 1Y81A 5ILGA 4AJ2A 3W4JA 4ZJUA 4YRDA 3RUIA 2IRWA 1F14A 3KO8A 1GPDG 5JMWA 3K2EA 1B8PA 4XQGA 3S2GA 3UCFA 2EV9A 3LU1A 3MOIA 4LSMA 3V5NA 1ZSVA 4CM4A 5AXAA 4YAIA 1HE2A 2DFDA 2B0JA 3QWIA 2BH9A 1C3VA 2OUIA 1LLQA 1SZJG 1V35A 4PLVA 3G49A 4E2ZA 4D43A 4NFHA 2GD1O 2QZ9A 1O5IA 1D3AA 4YACA 3O03A 3GT0A 4WLUA 4AJHA 1B8VA 3R1IA 3GUCA 4BV8A 1Y9AA 4BO0A 3WWYA 4MVJG 2BGKA 2E37A 2LDBA 3WGOA 4JJFA 4JGBA 1T1SA 5L4NA 2IEDA 1HKUA 2JCVA 3OICA 4XZ3A 2ZB4A 1MP0A 2QRJA 2QRKA 4J1SA 8LDHA 4RO0A 1V0JA 2AEJA 3AI2A 5TT0A 4ZQEA 1UP6A 1CRWG 1T2CA 1DDOA 3C7DB 4J2OA 2X9NA 1YBVA 2HAEA 3PJFA 3QV1A 3QWAA 3TPCA 1NXQA 1BW9A 1H93A 3WGGA 1QV7A 2QW8A 1HYGA 1B3BA 1YDEA 3PQDA 4RDHA 4JBHA 4I08A 4RZIA 4W9NA 5LDHA 2QHXA 1PR9A 2NQTA 3QIVA 4B7UA 4EUHA 3FWZA 1AHIA 3FNFA 2EHDA 5EPOA 4OAQA 2NUAA 5JO9A 2VWQA 3D3WA 3DEYX 1VJTA 2DKNA 4J4BA 1EDOA 1PZHA 3QP9A 3LK7A 5KNLA 4CM8B 3K2BA 5U4QA 1QG6A 4BOYA 1DC4A 1VSUA 4J4TA 2VYNA 3HUDA 2X1HA 4GAEA 5DOZA 2PFGA 1LDYA 1PJSA 5F5NA 1E1MA 4R1SA 4XDZA 3SJ7A 3MZ0A 1IZ0A 4A27A 1PJTA 1MG5A 2O4CA 3OJOA 1PJLA 4EGFA 4XX0A 3PLRA 2ZJ1A 4N54A 1GYQA 3VTZA 5JCJD 1ONNA 3VKVA 2RH4A 4IJVA 1UXKA 3TZKA 3WB9A 1HL3A 1TI7A 4DIFA 4XR9A 1I2BA 3AI1A 1ONOA 2YQ4A 5U9CA 1V8BA 3V1UA 2Q46A 1DBVO 1FDUA 1Z7BA 3LT1A 4PG6A 4DYDA 4UVDA 3ZW9A 4IGFA 5DBIA 4XYBA 3IQDB 3Q11A 5DCWA 2CVQA 4RPLA 4YT5A 4K28A 3RFTA 3C24A 4O59O 3PPIA 2NU7A 3HFGA 1P31A 2Y1EA 1LSJA 4IS2A 3U4CA 1N7HA 4TRJA 2EJWA 4AJEA 1LEHA 4ND3A 3E5MA 3SXPA 3O8QB 1BSVA 4OSPA 4UREA 1XGKA 2WD7A 1YVEI 4CMJA 3F5QA 4LW8A 1OZAA 4WGGA 3G1UA 5MGBA 3EW7A 3BHJA 3DZKA 4E12A 1WMAA 1A7KA 1DO8A 4BB5A 4CR8A 4RDIA 5T64A 1E77A 3GQVA 1J0XO 1I30A 3INRA 2Y05A 3NGXA 2PGDA 4MIOA 3OHSX 3BHMA 1UXHA 5JSFA 1I32A 2ZJ0A 5KVQA 1ULSA 1ZJZA 4HX5A 3BIOA 1NX6A 3FBGA 3GVIA 4IJUA 4CLRA 3H2SA 2Q1SA 3WGYA 4GMGA 2YUTA 2Q3EA 3G0OA 1DEHA 1ISJA 1LNQA 4BGIA 5A5FA 4CQLA 5BT9A 4R9RA 1E3WA 3EVTA 4YT4A 4I1IA 3ONEA 3GN1A 1T24A 7MDHA 1KC3A 2CMDA 2B83A 3LLSA 1F8FA 1LI4A 1PIWA 2CF6A 1UAGA 2YV2A 5K6AA 5DOVA 3NAQA 3PHJA 4M87A 1XHLA 3ABIA 4AFNA 1LXCA 4D3DA 1N2SA 3Q3CA 1E7WA 1Y5MA 4BNFA 3M1LA 4WPGA 2AHRA 4I5DA 1U28A 1I5RA 3K92A 1F06A 2WEKA 3RI3A 4GWGA 1E6EA 4DUPA 1P1IA 3ZGYA 4FCCA 2IE0A 5G0SA 2XAAA 3PI7A 1X7DA 4RORA 4LMRA 2WYVA 3PJGA 2BFAA 2CFCA 3BMNA 1GR0A 1HEUA 4WCFB 5TGDA 4BNJA 1HDCA 2IYOA 4FS3A 4CV0A 3KYDB 3COSA 3ZNNA 4TRNA 4FSHA 3QSGA 1GPJA 4NG5A 3F1LA 1JVBA 4E6PA 4A0SA 5JAZA 2E48A 3H2ZA 5A9TA 4OHUA 3QVWA 1NR1A 1WDKA 4XIJA 3DZBA 1RWBA 2G1UA 5JO0A 1NBOA 1F17A 1U4SA 3WICA 4Q3NA 1LU9A 3GZNB 1NM5A 2G17A 1HZJA 3WIDA 2VN8A 2E82A 1IULA 2UDPA 4URFA 1Z7EA 1GUFA 3RUDA 1JLLA 3BA1A 5JAQA 1UJMA 3O38A 2JFGA 3AUAA 3NX4A 3PYXA 4IDGA 5TLSA 4XYEA 3IDSA 1GZ6A 3DBVO 4WOJA 3MOGA 3WQRA 4E5NA 1M75A 2BGLA 3M1AA 4YRBA 1LSOA 4S3MA 3PQFA 3GVHA 3PFFA 3H8VA 3BMOB 3S2FA 4CM3A 4ESOA 5IDQA 2JHGA 3CMCO 4MIEA 4FFOA 3ANLA 5TQVA 3OQ6A 2EF1A 2EKPA 5T67A 3D5TA 4MINA 4U7WA 1TEHA 2VOJA 4ZRNA 1PU2A 3MJSA 3DZGA 4DMMA 4IXTA 3DAGA 3GGOA 3T4XA 3HE3A 2FPIA 2D5AA 2FZWA 5A4DA 2GASA 4TZTA 2D3TA 2HMTA 1MB4A 4BO8A 3ROPA 5TIIA 3VKUA 3E5RA 3U09A 1YJ8A 4GWKA 1ZIDA 1RPNA 4CM8A 1GEGA 3IUPA 4M89A 3BZUA 1SBYA 4Y9DA 3OEWA 4FGWA 2VNAA 3B20A 4L8VA 2WYUA 2RHCA 3BTUA 1P44A 3W8DA 4BO2A 4RCVA 6ADHA 1DSSG 3OETA 2I3GA 4IUYA 4L4RA 1U9JA 1NP3A 1NQOA 2FP4A 2RCYA 1U3TA 3P7MA 3NDIA 2J8ZA 3PXXA 4GSLA 4HBGA 3ITDA 1DC3A 3AW9A 5JDCC 1L1FA 4CQMB 4J3FA 1PGQA 4WLOA 1M2WA 1A27A 3U4IA 3UH1A 4BUCA 4JN6B 5A3JA 3RUHA 3MTGA 4GH5A 3HDQA 1KIFA 3GOHA 2PKRA 1E6WA 1ZSNA 2BI8A 1PTJA 4BNKA 1VKOA 3KVOA 1YE3A 3QY9A 3LSYA 2UV8A 2JHFA 1W4ZA 3E48A 4ZQGA 1IYZA 4BNZA 4MDHA 4MVJA 1ADGA 1ZNQO 3O8QA 3O26A 2B4RO 4BO1A 2DBQA 3RCBA 1NQ5A 3PWKA 4RVDA 1X7HA 1K2WA 3QLJA 1HTBA 4MVJI 5DBFA 1D8AA 4IGEA 4YCAA 4TROA 2Z5LA 5C3MA 3Q2KA 4DC0A 2G0TA 4Q3AA 3KTDA 3LF2A 3K6JA 4IZHA 4LSWA 5K0ZA 3ETDA 3EDMA 1MFZA 4EEZA 2FR1A 4KP7A 4WJZA 3G1TA 2GF2A 1WP4A 5THKA 1LDNA 3GN2A 5B37A 4CV3A 1UZLA 4U0JA 4W7IA 2V6GA 1UR5A 4O63O 4Y98A 1A9YA 4PG8A 1DJQA 3GLQA 1P1RA 3IMFA 4GX2A 1S7CA 1XDWA 5FWNA 1OMOA 3PQEA 3OM9A 4H7PA 2X6TA 4DRYA 2PD4A 1K3TA 3JQ9A 2PK3A 1GUZA 4HFRA 5A05A 1K89A 4WNIA 1R0SA 1GD1O 1SOWA 2PGJA 3LT2A 3VOSA 1E3LA 5L95A 3TJRA 3L4BC 5CEEA 1Z82A 4YJHB 1J49A 3KLMX 3UAGA 3FHLA 4JP3A 4QQRA 2YHUA 2ZTMA 1ZW1A 3D0OA 3PZRA 1ZK3A 2VRCA 4CLHA 1FDVA 5K9ZA 2WJPA 3LT0A 3NYWA 1XEAA 3VPGA 2J6IA 2JAHA 4K1LA 3LLVA 5DN9A 1AE1A 1N92A 2Z1NA 1KYQA 3KYDA 4Q3CA 1EZ4A 5ENDA 1LRLA 2XOXA 4BVAA 2PZLA 3GDFA 5HS4A 1V6AA 1ZK2A 3GRKA 1WDLA 4XWYA 2YFHA 3T7EA 3ZWYA 1LJ8A 1QYXA 3IOYA 2I67A 2B5WA 3A4VA 3KLPX 2J3JA 3MJ4A 2YHIB 1SB9A 2ZCUA 3NT2A 1DRUA 4JROA 1R4NB 1N7GA 1IHXA 2D2IA 4YB8A 5F21A 1B7GO 3WJ7A 3RU7A 5GZ1A 5BR7A 2OHXA 3GEDA 5CDYA 2Y0CA 3E9NA 4BKUA 3BMQA 4AJIA 2ILTA 1UDCA 3ETGA 1RJWA 1E6UA 5A5EA 3H5AA 4CMCA 3ZV3A 1ZJYA 2PKQO 4BB6A 2GSDA 3PGJA 4XB1A 4A10A 4ZICA 1SCUA 1ZMTA 3OJ0A 4IIVA 2Q2WA 2JCYA 2PNFA 3JQ8B 3BMOA 1XCBA 5I7VA 1E5LA 4HFMA 1K0UA 2D59A 3NRCA 3S1LA 5IF3A 5L7YA 1TA4A 2E6UX 2PD6A 2ZYDA 2EIHA 1NWHA 1NNUA 1YB5A 3GEMA 2A35A 2HUNA 5BNFA 1U8XX 4UAGA 1LQTA 1O95A 1BRMA 5B12A 3FNGA 3PGXA 3BAZA 3ZWCA
chains in the Genus database with same CATH superfamily
2VKQA 3O7WA 2ZIVB 4CF5A 1GA6A 1G7RA 3HA7A 4KZKA 1VG8A 4RVHA 1R8JA 2J5KA 5CDHA 3HVRA 3Q41A 2C3OA 3WLFA 1XROA 3K73O 1QRTA 2FSPA 1YVDA 3ZDFA 1XL0A 5GONA 5DMXA 3EPPA 3PQ5A 2ZB3A 4GPEA 3H6HA 5ER9A 1EIWA 1MLDA 4UCXA 3Q8WA 4IVNA 2B1IA 2IFTA 4NBWA 2IWHA 4ZZ0A 4QECA 3EQZA 3PWTA 4JMLA 4QGGA 3VSCA 2Y76A 4QVKA 1S7GA 5F35A 1W88A 3RUEA 2BWJA 2ZIGA 4TMTA 4A03A 5EJEA 1FTQA 2H00A 4D98A 3AGPA 3OT1B 3D6HA 4EG5A 3VJMA 1Z4IA 4R1NA 2WWHA 3DTYA 4ZOAA 1PZFA 5EQTA 1L7PA 2RGYA 5KJEA 1Z3IX 1WPXA 2SHKA 4IH9A 3SX2A 5DN6A 1L1QA 1E32A 3F6BX 4JMPA 2BGRA 1NL3A 1E61A 2HSDA 2X9GA 2WJWA 4NESA 4ZN6A 4KNVA 1YZFA 2SKCA 3AU9A 1B2RA 2V58A 4KSYA 5TRTA 1TEXA 2AQHA 4MPRA 1BIFA 1G60A 2JLBA 2PV0A 3X2SA 1WDWB 2YWBA 2WWYA 4HVAA 3PQ2A 3TRIA 1NJFA 5E4FA 2YWDA 5C8YA 4NI5A 1KTVA 5IXYA 1UOPA 3DV0B 3JWPA 3KB2A 4BO7A 3H3FA 3TQRA 5AHOA 1W94A 1M8KA 4X3OA 2OGWA 3GLTA 3CLRD 4FBGA 4PHTA 4Q9AA 4Y2PA 2CV0A 2COUA 4BJ6A 1SKAA 1VLLA 3JQFC 4WZAB 4CL2A 3M81A 5IF9A 1VYHA 2DUJA 4MPTA 2GZ1A 4O2RA 1Q0QA 1ZOLA 1DBRA 1M8GA 2H9YA 3FMGA 2OZLA 4X20B 2WTNA 2XB6A 4GVPA 3WYNA 4Z2YA 3I9JA 3RKRA 3ZLBA 4CYMA 1AS2A 3ILSA 4EZBA 1ODKA 3CG4A 1V5EA 4H1VA 1ESZA 4C0QC 2O8DB 2WD9A 4ETMA 2FZVA 4FFBB 1I2DA 1QCCA 3IHKA 2FA9A 1E69A 4AXBA 1SOAA 1HQYE 2W6PA 1USUA 5F52A 5BVGA 3HBFA 2H1IA 1XF9A 2V3VA 1HSOA 1R9JA 5AVYA 4PRLA 1M2VB 2DM6A 1F4LA 3BXPA 2BUBA 3IMGA 3Q5DA 1B0AA 3OPXA 4YQZA 2VPXA 4QOFA 1AOXA 3D31A 3RUFA 5B3LA 4B6FA 4QZVA 3MK31 5CX4A 2QYHA 3SHWA 4BVFA 1SCAA 2XHZA 1DWUA 1KZ9A 1Z07A 2HJHA 2XE4A 5AJTA 5ADVA 1IVNA 3B3AA 4IW3B 1WKBA 3HJFA 3KVYA 4NK5A 1ULHA 2F64A 2JI9A 2D62A 4JLJA 2HF8A 4FIDA 3SNKA 1AN9A 1JXQA 4E14A 4JLKA 5A9RA 2FR8C 5A2GA 3GYBA 2AF3C 1NPDA 2WJHA 3HM9A 4UUMA 1XEWY 4RVUA 1D0IA 1F51E 4GPAA 5EHXA 2DG2A 1BVYF 2WU0A 2ZWIA 5HGJA 5EJ6A 2JHAA 4GM4A 3B6ZA 3DR3A 2VUSA 1OIWA 1KMNA 1XLTA 1JYFA 1UWCA 4F5ZA 3KZKA 1Z37A 1OV4A 1VJ0A 4FGUA 4F1KA 1VCNA 2X4DA 5A4KA 5DFAA 2VP5A 3W2EA 4CCYA 3CNOA 4AMBA 4HDKA 4AMZA 1CIVA 4PZ0A 5AI4A 1NUTA 4I5GA 1CKEA 2PO7A 4GD3Q 4L7QA 2C4KA 1ECCA 3UB4A 4Q0MA 3DFFA 2LXNA 1J1ZA 3ZY4A 1X7XA 3IULA 3NWPA 3PC4A 4WA7A 1FY2A 1DXOA 3ANXA 3UJDA 2OYCA 1Y8QB 1RRKA 5CUQA 1IONA 3UCXA 1TYBE 5JCOA 1VBKA 3LHFA 4JOBA 4QYIB 4AJ4A 4Q03A 2QRQA 1P2GA 3B52X 1EQ2A 2VXOA 5AK3A 1WZ2A 3DVQX 4N8SA 1JAHA 1BE1A 4W7SA 4G8CA 1SVLA 3Q7IA 2RAVA 4L8YA 5EINA 2NU9B 4ZGWA 3GGGA 3CZPA 3GNTA 4J91A 2YHIA 1UZAA 3ZQ6A 2CNDA 4HQ0A 4KXVA 1XHFA 1E8NA 2H2HA 1CEYA 2D13A 4PAMA 2IA5A 4LOAA 1T0UA 3GFGA 4CCAA 5K0EA 1FC0A 3OEEA 1K6EA 2PX4A 2RGGA 3V9AA 3HCCA 4MLZA 3TPZA 1XKTA 3MJFA 2QD1A 4HNHA 3AM3A 4DVGA 2FPUA 3BIFA 3AB8A 4J0DA 3HB1A 1MAHA 1YQTA 2F43A 2AN5A 4U5QA 4Q6WA 4Z1OA 2SKDA 4BN4A 5DASA 4ZCTA 1YQEA 2ZYUX 3C97A 3UA4A 3P0FA 1WUYA 1RRMA 1G55A 2H8GA 1M54A 1G98A 1X1QA 1SXJE 2CMGA 3FFWA 3ZWPA 1IOWA 3RIXA 2Q5QA 1D03A 1I6LA 1E62A 1E1RA 3QVXA 5JEDA 3WLTA 2H1CA 1D2NA 3T3MB 4KO4S 5EP2A 7AT1A 5L7TA 3F2IA 4RKFA 1ZAKA 3WL6A 3QOXA 2GZMA 2GZDA 3WLMA 1RWOA 4PLCA 1WXHA 5K6TA 4LYHA 3DMTC 1L5ZA 1ZNWA 3SBOA 4MV7A 1WL8A 3MINB 2LR0A 1HFEL 2IH5A 2PXAA 5JBIA 3V42A 2VDUE 4Z8YA 4M38A 2RGNA 2W2KB 4ZPJA 5KUTA 5DPMA 3VKHA 2AZDA 3FZYA 5KSYA 4QTXA 3AVYA 2B7CA 3QKTA 4JJ6A 5GPBA 3BXHA 1QRAA 4EW1A 4HEA1 4QFDA 2P9FA 2YVKA 1C2TA 3IPLA 4NCNA 1DVRA 1S5PA 4RA9B 1LA2A 4YQEA 2P69A 2NU6A 4M0DA 3UOGA 1OLXB 3GC6A 3N8KA 2I9KA 1ZIXA 3TQIA 2Q1XA 4BFTA 2GRAA 4MZXA 4WN3A 1KZ1A 2JDID 1JECA 3J81k 4BX8A 1CY8A 3R9XA 3YASA 1G8JA 1KERA 2ZLBA 2ZRBA 3FDZB 4ZP1A 3BSYA 5A3VA 1UBGA 2HV8A 1QYRA 4BKQA 1OREA 1XEXA 1R5OA 3IE2A 4NSNA 4W8HA 2AW5A 2O7NA 3TOZA 3LX4A 3WWDA 1H23A 4PYIA 3F3SA 4NCAA 1E9EA 4MXDA 4BVJA 4FX5A 2QM7A 4OYRA 1SKQA 2YV3A 3NGLA 3ND8A 4X44A 4YVFA 5FFNA 2QLTA 3IMCA 3A1UA 1A7UA 2QMYA 3RAEC 1PGNA 2EQBA 3BGDA 5EESA 3BFJA 4A8JA 4JLOA 1IAQA 2CUNA 5BSEA 5EJ7A 1ULAA 4NMMA 1M83A 3DNMA 1X8LA 2VWPA 5HSGA 2GCOB 2WF5A 2GPNA 3FVVA 4GE0A 4KB5A 1Y6QA 5EJ4A 4DA0A 4D96A 4CMGA 2Z98A 3V8EA 1XT6A 2ZUEA 5CLHA 3HKDB 1G1MA 1JAXA 2H3HA 2QMQA 3V80A 3PX3A 4RM2A 5ICSA 2AFIA 1KS9A 3QYPA 4RESA 3OT5A 2C5LA 5K4HA 1EG7A 4QNNA 1HURA 5LP6C 4QT4A 1L7VC 1OD6A 5JE8A 1R0KA 2GR9A 2WMNB 1T4DA 3TGPA 3MIIA 4XJXA 4G5XA 1MN6A 5TEWA 3TM4A 4EAAA 3CLVA 1RYBA 1CBUA 1RBZA 3F3YA 1X9GA 4IIYA 5FOQA 5L8VA 5EZ6B 5J2UA 3FTDA 2JFYA 3IO3A 4FHCA 4Q4HB 3IAEA 1T9BA 2PRYA 2BMWA 2NSYA 3U0VA 1XCPA 3WA7A 3CVUA 1E2BA 4YPOA 3D6NB 5FJIA 1LS6A 5LNK6 2QP9X 1EDDA 1I10A 1IPFA 3HCDA 1AGRA 3JQGB 4IWXA 3QF4A 3VR4H 4OXYA 4IKEA 1TCBA 1XXHE 2QYSA 1PI3A 4AWXA 3N7AA 4G36A 3WG9A 2B35A 2IZZA 4UM5A 5EIBC 1J9EA 1GPMA 3OFJA 3B9RA 2YVAA 1MBZA 3HCPA 13PKA 3HADA 2AX4A 2Q49A 3L49A 3O2JA 4JBWA 3WV4A 3EEQA 1TT7A 2XQFA 5HA5A 5C3UA 1RE0A 3RVSA 2ASEA 5B58C 2E2WA 1FYVA 2Y0EA 2JIZA 2D2FA 2JH8A 2VHXA 1ACLA 4AROA 3JV7A 1BHJA 2KM1A 2V7UA 3OFNA 4BU0A 4QYSA 1Z5ZA 1FEZA 2XH8A 3LI2A 7REQA 5G53C 2F67A 2A2ZA 5ALGA 2FQQA 4LXUA 5BYJA 2I6SA 3C8DA 4W7HA 3AINA 4BQPA 4C2UA 2DUNA 5CFQA 1W5AA 4NXMB 1M2JA 2LKCA 4CM9A 1UK6A 3IVRA 1SWWA 3DWEX 1JS1X 2H7YA 3FBTA 2XNKA 1UZNA 2AUMA 4HXEB 1Z22A 5KQSA 3BSFA 1QQTA 4XB6B 1EGAA 1X13A 1VHJA 4XUEA 2YMLA 3PFCA 4AJPA 1HYQA 3F5FA 3KZNA 5KYYB 5JHGB 2YN4A 1PQPA 1QHHA 3K70B 5TQ0B 4HNRA 5FADA 2CJFA 2O2DA 3L7YA 3H7IA 3PYMA 3WQBA 4HTAA 5HE9A 2NXNA 1H4SA 3DKRA 2J9FB 3KQTA 4WEQA 2A59A 1GZVA 3SCZA 2QORA 3U4QB 1U8YA 3PEYA 1K98A 1PZEA 1R0YA 4TYMA 1IUKA 3BH7A 3CPJB 1JX6A 2FSVC 2VA8A 2DR0A 4B2PA 3W2GA 3JRNA 2ZVDA 2ICAA 2H2IA 3PHGA 4R9SA 5CLLA 2UZ3A 4K9NA 1N6OA 5JI2E 1NHWA 1JAIA 3T7KA 4C0WA 5FNZA 4IIHA 2C7VA 4UBKA 3ZVKA 5ALVA 2VRNA 3EZNA 1AC5A 1PZMA 3RUPA 3WYCA 5D3MB 3FKSA 4NF2A 4QDTA 1RXIA 1ABBA 1JEYB 2R86A 4Z4EA 1O58A 1GUYA 1Z2CA 3HWWA 1JHRA 2IKQA 2HL6A 2WKRA 3UB3A 4XM1A 1RWQA 4CTMA 1P17A 4FFLA 3IUQA 2AMLA 1JPJA 4MGYR 1MG0A 5AI9A 2WAOA 2VPWA 1I1OA 2X0RA 2O1SA 2YYSA 4P7FA 5FOXA 3TW4A 4I19A 4MVJH 1QE5A 2QMUA 3JU3A 4DRXA 1HNZB 2WIJA 3B5JA 3HVKA 1X2EA 3FZQA 3M6UA 4G1FA 5DRTA 5E3IA 1ZVVA 2DLDA 4IFTA 2VPZA 1O6BA 3QPUA 1JG6A 1I7PA 2Q2NA 2HA3A 5LXTF 1X15A 2IW1A 1YOVA 2O7SA 2Q0QA 3ZE9A 4O4IF 5C31A 4K3UA 4R2KA 4QQFA 3T4EA 2WV7A 4X60A 5HIJA 1VBMA 3RBXA 3A2MA 3QELA 4BNXA 4EYQA 5HWSA 3STHA 5A1TA 5IAAA 4EHBA 3OIGA 4RZUA 4WL0A 2O2ZA 3FOCA 4MKFA 5DTQA 3PFIA 3ZHBA 1PWXA 3KG2A 2I6UA 5E2BA 3O92A 3KQPA 1V4NA 2FPOA 3GJXC 3FLBA 5CR9A 4YQFA 2GN0A 2XKBA 4MQFB 1M0TA 2Z2XA 3L0IB 2YWEA 3HUUA 3ZU3A 1RXVA 1YMVA 1E3SA 4ACAA 3MMNA 3EXFB 5JJ5A 1YRQA 4MS3B 2V7PA 1J9ZA 1TCAA 5T4FA 4NJEB 1ZRSA 3IXMA 3OM0A 3U4DA 4BDTA 1X1RA 4AKHA 3PHHA 3DHEA 5AVWA 2X40A 1FW6A 2D1QA 2VNKA 3AO0B 3PGVA 5IN5A 3ONFA 4WK2B 2IGBA 2QRLA 3IJ5A 4F3RA 2YY7A 1O57A 2DCUA 4LJ9A 5GJBA 2KBEA 2AEFA 2Y77A 4K87A 3KSZO 2KJQA 4BCBA 4I66A 2KLHA 3UAOA 2W2NA 4N5NA 3HMKA 3FIUA 1QWOA 2EZ4A 3IC5A 3LH5A 2B36A 1ADFA 1C0IA 1E96A 4CQJA 3QVMA 4P4UA 4DBLC 1A9TA 1CU1A 1D1PA 3HWRA 1RP1A 3DLHA 4FYIA 5FR1A 2EDAA 5DCUA 1XWFA 3STYA 5KI6A 2PJZA 1NBHA 4PLYA 4Y8VA 2X0IA 3DBRB 3JQ6A 1NTOA 3A6DA 1JBQA 2C7GA 3HV0A 4EITA 2NADA 2AQIA 2YWXA 3DHNA 3PF9A 1G20A 1R15A 2NV0A 3HKEA 3WSTA 1KYYA 4D1YA 3ZE8A 4JEHA 3OBBA 3FUCA 1ZH0A 4IEEA 2C57A 1HE3A 1KI6A 1VE6A 1L5HA 2Z58A 2PZAA 3S2ZA 3D5QA 5EQFA 1JLHA 2GO1A 4FOTA 1NX9A 1FFHA 1FDTA 2GTPA 1CD5A 1G16A 1YNOA 3ADKA 3ZE6A 4BDSA 1G1AA 2AXEA 5B6PA 2O8BB 2HR1A 5TJHA 1PG5A 2IX9A 4HWGA 4HOYA 3TM5A 3PUYA 4NDNE 2J09A 4BQFA 2XV1A 1G8HA 1BEEA 1GUBA 3BFVA 4V0QA 5JTUA 1XA0A 3P0JA 2CFRA 4LYJA 1MPTA 4P4LA 5EI5A 2X0FA 3HY3A 8AT1A 4KCGA 4JXZA 4AJ1A 4YDHB 2YV5A 2BRUC 3P96A 3VNVA 2YDXA 1Q3TA 1JAYA 2ETVA 4XLLA 3X1XA 1NW5A 4ER5A 3SC2B 5IAGA 1DCMA 1PW5A 1YV9A 2BONA 2PMCA 3G2HA 3U9SA 5LMNB 2P9EA 3LX6A 4MR7B 4TV8A 5K0GA 2VQ3A 3TQQA 4XGIA 5I9TA 4DTCA 5CLFA 1NUSA 2VNJA 4YT8A 2AKEA 4AYTA 3WLSA 2NQ2C 3GIWA 1SXJB 4RIEA 2O3UA 4CIYA 3U4AA 1F7VA 1PGPA 2CWDA 1DB3A 2WHRA 5FL3A 5GOZA 4BX2A 1P3DA 2EKLA 1XTZA 2R5NA 2FPGA 2NYVA 4HZGA 1TEVA 4OXRA 3EXEB 1C9MA 1LX6A 3H5IA 1ZS9A 2J4CA 4JODA 4B47A 2IDMA 3ETHA 1EUCB 1NI4B 1Q0RA 2BEVB 3H5LA 3PXEA 3I4LA 3TB6A 1IBSA 4AULA 1ZXBA 4BFLA 1U4OA 2F1IA 2ARKA 2HCBA 2I3DA 1QOQB 3Q3EA 1RZVA 2C9OA 3ZHXA 5LKRA 2CF5A 4B80A 5F3WB 5KIAA 2AD1A 4JEMA 1KSFX 4BGUA 5IMSA 2ZRKA 3PE6A 4MCHA 2OFFA 1V37A 2HEGA 2VFAA 4HDSA 1Y6GA 1ESEA 2ZUDA 4DB4A 1HT0A 4CM7A 5JJKA 3VBCA 1G19A 1TTQB 3P9PA 2C8KA 4F4IA 4ARBA 3I8OA 3L18A 2A5LA 2FYTA 3A6PC 1PZGA 1ID8A 1Z8DA 2AE1A 4LGCA 4HUJA 2P5TB 5AT1A 4ZGBA 1VBNA 1UBFA 2IE8A 3RRNA 2DSNA 1BWQA 1KC1A 1LD3A 4Y6QA 4K03A 3C5CA 3S55A 1ND5A 1EP3B 1CUSA 1Q16A 1NN3A 2ZVJA 4RSHA 4AX8A 3FZEA 3H11B 5FOTA 1S96A 1R0ZA 4FZJA 1IXYA 3E9DA 4C7BA 2BGWA 4R5HA 1N6KA 4OA5A 3W6ZA 1M1YA 1TQ2A 4DQXA 2F8SA 5KDDA 1XU7A 1WBDA 1CUZA 1J25A 1EX9A 3GOQA 4O8CA 1JLSA 1QRRA 3IAUA 3OUTA 2OKGA 4EELA 2KWIA 2R8XA 4UM9B 2ZI3A 4OFXA 1KZYC 1XCJA 2HU8A 3MQ2A 4TYQA 4B83A 4BGVA 3GLRA 5AVRA 1KJZA 3R5HA 2ISSD 4P84A 4LF5B 4OJMX 4N6OA 4WK6A 2NUPB 2DGDA 2BFFA 1FX0B 3OCCA 1ECGA 1CX9B 1T2NA 3ZHTA 2QE6A 3K0CA 2C2WA 5FYDA 4DKXA 1F60A 1M2NA 4Y2VA 5AKYA 3GA5A 2RI1A 1SELA 1XHEA 2B20A 5F98A 1S2NA 1QIDA 3BK7A 2WMOB 4L4XA 4RH1A 2VDWA 2WVJA 1U8CB 3ST7A 2C9YA 1ZRNA 2RHMA 2QENA 2OLJA 3I01M 2FPWA 3Q3HA 4H3VA 5AOAA 4ZAXA 1F9EA 2NX2A 2C20A 2W58A 4L5YA 5FWDA 4DV0B 3MAJA 1A2BA 1XCMA 1OFCX 1ZEMA 4OREX 4F5DA 4RTRA 4C22A 5CLJA 1RRFA 1RC1A 1QF6A 1NFRA 2ZUSA 3QKWA 1RPJA 4U2CA 5AW4A 4GNKA 2XCRB 1EFCA 2D6FA 1LC0A 2AEEA 2BEUA 3FCXA 4LGMA 5KAMA 1SB8A 3EF1A 4WCFA 5G1OA 2YC2C 3RYHB 1HDEA 1ODJA 3ANSA 4L4ZA 3IQGX 3GNQA 3L7CA 4MV5A 1N0VC 2CE7A 1XK6A 3CTPA 1H5UA 2N0SA 2G76A 3LVRE 2NOAA 1RYYA 1WV1A 4ZI7F 5MN5A 2YRWA 1EXMA 3WQHA 5IH7A 2YN0A 4HG2A 4HH1A 1Z5OA 1E6KA 1KEUA 3EAQA 1YFJA 2XMQA 1YVPA 1CNMA 3F1KA 3KPYA 2Y9PB 1JKJA 4ND1A 3GZNA 1R50A 1PEKE 3VDRA 4AMYA 4TYWA 1XXHB 1Y89A 1N3LA 4WUVA 3SYKA 1DJLA 2VIIA 3JTEA 1QPGA 5D5PA 4GPTA 4W5OA 4OBWA 1P7PA 3GZ4A 3X1ZA 5C5EA 4Q82A 1VFNA 1RRPA 4Q34A 1AY0A 5CIWA 3QYFA 2VZ0A 1UMBB 5LQNA 2EKBA 2IC5A 1SD2A 4WW0A 2WHYA 3DD1A 3HFSA 1QHNA 1E1QA 1R1DA 1V1JA 2WPDD 4QBTA 2Y0PA 4ZHQF 4UUNA 2IHBA 3BWEA 2A92A 1GAJA 2OXIA 3VGPA 3O31A 4ANFA 1Z5VA 2RHRA 4CKEA 1QXSA 3H17A 3MJHA 3PDIB 4YLGA 5ITSA 2VQDA 2ZB8A 4CF7A 3DDOA 1E2HA 2YZ2A 4ODIA 3PC3A 3U3ZA 4V24A 2OCDA 4R51A 5SYNA 4B2LA 5GVSA 3PXAA 2G28A 2CN1A 2PA3A 9LDBA 3RADC 3L7KA 2FUKA 2QVYX 3GRPA 5JS8A 1G6KA 1PK8A 2HA2A 2I6XA 2VDVE 3V1LA 1SU6A 2H65A 1CUEA 1TA0A 3NV9A 3GZTB 1OAOC 2O1EA 1HH4A 3AVPA 3LXUX 4M0EA 4O8ZA 2CUZA 4X54A 4PSDA 4DIBA 4RV5A 5J3JA 3ROFA 4C76A 3JD3A 3OZVA 3WJ2A 3JAMA 1GAEO 1HT1E 4U2KA 2W9XA 1R16A 2I6FA 1JXOA 3TRKA 3EWSA 5HUHA 4QICA 3IUMA 4N9QA 1P0PA 1TKCA 1P1FA 3JASA 3L1UA 2ZBFA 2D54A 3D54D 4FQ7A 4TYPA 5F7OA 5A4FS 2B4QA 3DONA 3IE1A 2AJTA 2QL5A 3CMMA 4JJ7A 1WB4A 3QBDA 3HJAA 4FJ1A 5HDQA 5BQOA 3UT5B 2X8BA 3CEJA 3MM4A 3Q5GA 2G1JA 4OJNA 1QYVA 3H9QA 4N7MA 2J9YB 2ODWA 4YV7A 2OHIA 4UU0A 2EQ5A 5C32A 1V16B 1S3FA 2XEXA 4GNRA 1VJCA 1OFUA 3CH6A 1DL5A 3DJFA 2ZTUA 3E70C 5ALUA 1DI0A 2AUNA 5FUYA 4MWGA 5IJAA 1AK2A 3SY8A 3PHLA 2WZQA 1O96B 1OFGA 1HFWA 4WBSA 1LDEA 2FHSA 4PIVA 3L7IA 5CH8A 8ATCA 1XZJA 2QTMA 3A4TA 1DXYA 2OWDA 4IP0A 4F4JA 5K03A 5EY5B 3DE5X 1HNXB 4LHSA 4BNNA 4RCZA 2WTXA 4BO3A 3G0HA 4O2AA 3HO1A 1E3EA 1JH8A 1S8FA 3N3AC 3NJ8A 3BQMB 3OTWA 5B4UA 2GFIA 5JXIA 5KTRA 3O8RA 1TEZA 4Z3OA 2R7AA 1UBCA 4FOLA 5LB4A 4PYLA 3LKZA 4D7AA 5DBOA 1ISHA 1S2DA 2NTEA 2RB5A 1UJ4A 1N4DA 4MAAA 3V1TC 5JECA 4N7RA 5JSZA 1ZAYA 3UTDA 5JYDA 1EKXA 2EHJA 4NS1A 5BNTA 3QEJA 3K3PA 4M8SA 1GQ2A 4IHQA 3RARA 4R2LA 3IBGA 1N77A 1R37A 4GC5A 4IH4A 4GYKA 5LOVF 2QN8A 1X8KA 5SV2A 5TE9A 2Q3LA 3GLHE 4YJ2F 3DULA 3ZVMA 3PJRA 5LUAA 2GBIA 1P7WA 5KMGA 3JSAA 5HIKA 5KYXB 1RBMA 4RV4A 3OJWA 1AHHA 3ZCTA 1LV7A 4NOKA 4B87A 1N1EA 2DEUA 1OLSB 3EZ6A 3P2KA 1WQ1R 4P35A 4AF6A 4C30A 1GXSB 4RV9A 3M5DA 4HWKA 4I1OA 1AQYA 3OZAA 3ZKAA 5IDWA 1K9SA 3EZGA 3H8WA 4FD3A 4NC9A 3KQUA 1YFLA 2X15A 1U9IA 3A2NA 3N2LA 1UP4A 3O2NA 4KN8A 4A1FA 1ELOA 3LZCA 4KGXA 4XFDA 1J2YA 1FNSA 1COWA 2A1TS 1LWNA 1F3OA 4W5WA 4XX0B 3D7NA 1D2CA 5CBPB 1LSSA 3QSYA 4ZQFA 2ALJA 2MSWA 3ICWA 2YFKA 2FFJA 3VZPA 1JHDA 3I8XA 4PPNA 2XUFA 3LQ2A 3IPXA 4UVIA 4UUQA 3LX8A 4C7VA 3MWFA 1WCIA 4G25A 3OZIA 3KETA 4BASA 5AXCA 1IXSB 1PR4A 2ZSJA 5FRDA 1MHPA 4DXHA 1YKFA 2OHOA 3K53A 2DHRA 4L6CA 1K6MA 3ZWVA 4EF6A 2BKAA 2NSJA 1OI4A 4MRRA 2PZJA 4J2HA 1WTAA 1ZUNA 1MJFA 3ZWNA 3WMWA 5CBKA 2M32A 4JJKA 5CYFA 2AK3A 5J2TB 4EY3A 3UATA 2P3LA 4JZYA 4CKWB 2MCFA 2XCUA 3PHCA 1A4UA 3M33A 2EERA 4UARA 2Y67A 1TU0A 1O08A 4Z8XA 3IQZA 4R69A 5J63A 3SKYA 1U0NA 2HREA 1QZZA 1A9SA 5EUBA 1A2QA 4MKGA 4ZYWA 2VRCD 4P92A 3FNBA 2Y1GA 2OA0A 4B71A 1XG5A 4DMRA 5IT0A 2PIAA 4X85A 4JLBA 3PLNA 3PGLA 1SCDA 3KL2A 3DO6A 3RC8A 1IBRA 3OTIA 1EFRD 1A5AB 1NBMD 2OP1A 4PWZA 5LN1A 2BR5A 4CDRA 2DUUA 3ICVA 1QVRA 2Y1LA 4AZSA 3TUZC 4NMXB 2AN4A 2VT2A 3FNRA 4DA6A 2OQVA 1ONBA 3EFHA 2F9FA 2FJUA 1Q6YA 2RH5A 3A6HA 1E1LA 3TCNA 2TS1A 1UFKA 4KU4A 3L5KA 4HUQA 3EOBI 1FB5A 1D4FA 1DDIA 4U8HA 4EY5A 3ZVLA 3GRZA 5G3ZA 4MP3A 4RLQA 4J43A 4DYHA 3N86A 6Q21A 4QUBA 1WRBA 2Q5IA 3T0IA 3RAPR 5T7BA 2QRNA 2ZGVA 3F5SA 1MC1A 5EVCA 3VZQA 5FLYA 2J3IA 3RSZA 4FLEA 4E32A 4X7RA 2P68A 3JWEA 3NUQA 1MCZA 3CLTC 4KEAA 2HA0A 2JIPA 4HD8A 1VKZA 3ZZNA 2G7ZA 2JK0A 3ENQA 4N0DA 4N1AA 3PGKA 2X1VA 5JS2A 4S05A 1Y1PA 4G8JA 3MPUA 3VU9A 4O02B 4BYMA 5H81A 4BEWA 3GP8A 1E9RA 1DPGA 1M3SA 7YASA 3RVLA 5DV9A 5E9JA 3O47A 4N3GA 4X24A 4RD2A 3M4YA 3CEMA 4YUAA 3ZV4A 4CLOA 1FTWA 1QH1B 3FPAA 1JSZA 3BXGA 4MV9A 3WSWA 3TD6A 4LXYA 4QXAA 4W8GA 3CZ5A 4CMIB 1UT8A 2QTHA 5IYZF 3EBLA 4MOWA 3ZWQA 3VYRB 4ALMA 3I83A 3KWMA 4QJIA 5AOVA 3RS9A 4TVOA 5LDGA 2PL9A 4J3JA 3UJNA 1NUQA 4B84A 3B89A 4F85A 4NULA 4IUDS 2CVPA 1TX4B 2WYOA 3L4BA 1TO1E 2OC9A 3BH0A 4YP9A 4BRUA 4D02A 5IG2A 1K8RA 1ZZGA 2JGMA 3PRKE 3R5XA 4JT8A 3BXEA 1RLJA 4M60A 4O6VA 4XJTA 4XEHA 1EU1A 4HLNA 1VHQA 5BYBA 3NH6A 4KMSA 2F6RA 3L7NA 3V48A 1GGEA 4QAQA 4G37A 4EEKA 5HMLA 2QYOA 3NBQA 5HGXA 4HNSA 1P74A 4B3MB 3UJ7A 4G01B 1TVCA 4CWAA 1QFSA 5D51S 3AK4A 3EDYA 3GEGA 4P6VF 4ROSA 1H3EA 1ZI9A 1K08A 1G5RA 1X2BA 3ILHA 4WKCA 5CXSA 3ESRA 3PUIA 5KOHA 2EATA 4K6FA 1TFUA 1N6NA 3K05A 1YI8A 3ZUPA 4L4YA 5AUQA 1XD2A 2ZXFA 5E2AA 4LSGA 2NNWB 1CLUA 4M83A 1DC6A 4NX2A 1FUYB 4JC4A 1JILA 2H2DA 5CIQA 1N9ZA 1CLEA 1ULUA 1JB1A 3DBLA 5P21A 4FCTA 4OJQA 1RAFA 3KXIA 1X1BA 3C7CB 3LWDA 4RSRA 5DJ5A 1ZCFA 2PFSA 3WP0A 4MQ6A 3RAGA 3D2LA 4Y0AA 2O8EA 2A1IA 2DFNA 3RS3A 3M3PA 4II2A 5AJHA 5LMZA 1I8TA 2ESRA 1U8ZA 1P91A 2E4XA 3I9OA 2ZRIA 4LK3A 4QDKA 4LRTB 4S1VA 3ZU4A 4PG5A 2BHLA 1B41A 1T2FA 2CHGA 3KEQA 3UHAA 3O8DA 4Z4IA 3GFPA 4MUKA 1DJPA 2PUEA 2FE4A 4DWVA 1ATZA 5JQWA 2VEOA 1ORVA 3V2IA 2I6GA 3ZK9A 1B16A 3SE7A 4AMGA 4NENB 4P8RA 3EDRA 4UHFA 3JQ9C 1OKKD 1L5VA 5FHRA 4HV4A 1MX1A 2EEZA 3BE5A 1JEAA 4OHVA 3TAXA 2I7DA 5KJFA 2YXPX 1M1NB 4C08A 1AGNA 2R11A 1A9ZA 3CM0A 3MG9A 4JWTA 5JMWA 3T5CA 3L84A 4B4KA 3C3WA 4P08A 5ABPA 2G4CA 3T1VA 3CJRA 3ZEIA 4AJJA 4BNWA 5D7NA 9ATCA 2AA3A 3T3EA 2MSLA 5LYYA 3JD0A 2CY0A 4AY3A 1GN8A 2I1WA 3V9PA 4KVAA 1S2GA 1JQKA 1WXWA 5KWSA 2B25A 2G36A 3KOMA 4QL3A 4R3UC 3SS9X 1ZXLA 2CLSA 3AQIA 5B4TA 4CEHB 2HQRA 5EJ2A 2OCGA 5JAMA 1JKMA 2EP5A 3KHSA 5GQSA 1RPZA 2WF7A 3U3OA 4EKDA 3BOSA 4I5EA 4PWYA 1UKEA 1IBCA 2Z30A 5DM4A 2J3EA 1NOKA 3AC0A 3JQAD 3C98A 1RQ2A 2VVTA 3EPLA 1EK0A 2G9UA 2E4YA 1FSZA 1X7ZB 3BTSA 5HS6A 3DYVA 4AL4A 2OENG 4FYJA 1WMDA 3NFRA 1U1DA 4KLAA 5DLYA 4GOND 3ZW8A 1DS6A 2C7BA 2F7SA 1S01A 1Z6ZA 3GAAA 1IBKB 3D4OA 4FMCF 2ZT7A 3OZWA 2H9IA 1K1EA 3HU1A 3RBVA 3MTDA 2OHGA 5EP3A 1PLJA 1GAXA 9GPBA 4J29A 4HGOA 2DHCA 2CMKA 1QZUA 2R6CA 3BM5A 4GX0A 4PM4A 3FDFA 5BN5B 1EJ2A 2BFBA 2CLLB 2DFLA 2F3RA 2VI5A 3A1DA 3AJ9A 3DT9A 4LWPA 3D64A 3CR3C 5EGNA 1BMFD 1ECJA 1JQLB 1XF1A 4ZC1A 3W90A 3TBHA 1W87A 1E79A 2ATVA 4PZCA 1PJ8A 1UBHS 4MR9A 1A88A 5BSGA 1NXPA 3W2HA 1EHCA 4IHJB 2QTNA 2ZSEA 1QDLB 2CYAA 4IDFA 3TZLA 3JQFA 5FULA 1C0LA 4B3TB 2D8AA 2OG2A 3BWYA 4KQKA 1TCVA 1AS3A 2I1VB 3DPUA 1EK2A 3AIKA 5H4HA 1K5GA 1WB6A 3OLCX 4GRIA 5DGTA 2PUVA 1C30A 4WTOA 2WLSA 2CKMA 4HZUB 1H2EA 3F98A 4ZQCB 4GYJA 3ZIAD 4RTLA 3TRHA 2FRDC 3GROA 3FUTA 4CL0A 9LDTA 4BMZA 4IY1A 2HF7A 4LJ6A 3DLBA 1Z62A 3LLCA 4MVJP 3JYHA 3DQQA 4UOQA 4A2CA 2REXB 3NXSA 1E1KA 1TK2A 2J4DA 2QMOA 2C2XA 2EBUA 3AOEC 4C6SA 3J80A 3H8JA 2DBZA 4P5DA 5E3HA 5KCZA 3GLHB 4FHFA 3GU3A 3AEYA 4TT3A 3TW6A 3HXQA 2OHHA 3WSVA 1E3IA 3ED1A 4TUYB 4WFQA 1Z0DA 1SBNE 5F4BA 1SOVA 5IDXA 3ICEA 3CEPB 1YBMA 4K6GA 5F3DA 1AT1A 1QF7A 3QMPA 1I4OA 2CVOA 4D3ZA 1KEEA 1XNRB 4ARZB 2P3QA 2Z5FA 4C3UA 5JY1A 2QRVA 3ZI7A 2BMJA 3HSSA 5IWCA 2VEDA 1PQUA 4H7HA 2FR8A 1PT6A 2B9EA 4E31A 2V54A 3FF1A 4X7PA 4J9UE 5DSZA 4BL5A 5C8VA 5K8UA 1IDOA 1B42A 4LDAA 3U61B 3L4EA 3TAHA 2BI7A 4DLBA 2F1HA 1MENA 1SU8A 2FTKE 3KLNA 1LRJA 3OPYB 5A06A 5C8XA 2R00C 1C7ZA 2QBYA 2PO5A 4TKMA 1XMQB 4HXYA 2QS9A 4OK3A 3ZQKA 2ZJ8A 4LBVA 3BK2A 4Y0VA 3WJ1A 4ZCIA 1QO0A 3U37A 4IDDA 4OHPA 4CXMA 3I2FA 5GADl 3N59A 2MYUA 2XDAA 2CT8A 1T5HX 2XQGA 3H16A 4KE7A 3EC1A 4M0KA 1K6JA 4E5VA 3ZDXB 1W36C 3UXMA 4PAQA 1W0KD 3OE5A 5JDIC 1JH9A 3MT8A 2VHCA 1IIRA 3OZCA 3UIEA 3ZJTA 1UC5B 2Y6UA 2JLCA 2V7BA 1KDRA 3G5AA 2FN4A 3KOXA 1XRLA 3QNUA 3V7UA 3WJAA 2VYVA 5IU6A 1JFVA 1QNFA 3SXJA 5L3QB 1JQEA 1M72A 2HLNA 2YQZA 2J85A 3DV9A 3HLYA 4KV9A 2OQIA 4NJMB 1GKYA 3VVLA 4P3PA 3OWHA 2Z2JA 5EC8A 3K9FC 4QXRA 1HC7A 3B9BA 3L92A 1FRQA 2R8RA 1GQYA 4FDTA 3ZGOA 4MCAA 1BD3A 1F2UB 2WYWA 2X9LA 4MGIR 1EE1A 4GRDA 3VKWA 1TRHA 3ZHVA 4Z54A 4BPBA 2IXAA 2ECOA 4YJGB 1RKXA 1BYIA 3DXXA 1MA0A 3H1FA 1DEKA 4EJ0A 3F71A 2ZRHA 2ZTLA 3LVFO 4UFPA 1YS1X 2EBFX 2WFAA 4LE0A 3FH0A 5DIFA 4TTSA 1ZH8A 3WADA 1HL7A 3TZ6A 4P7KA 5CEJA 1Q0HA 3AR3A 4HKTA 4ZJZA 1K7YA 3OQOA 1TECE 4IDHA 1ZKMA 3D4LA 2O48X 2XT0A 3UUFA 3DGFC 1HLGA 2SNIE 4L15A 4LXQA 2QQGA 4NOLA 4PV7A 1UMCB 2BFOA 3A9UA 4LISA 5DIZA 5G1NA 2BF7A 3W06A 3G7SA 1CZRA 2ZS8A 3LUAA 3OF5A 2D3WA 2WDZA 3O94A 1UKBA 1VOTA 3D0QA 1H2FA 3EG5A 1CUDA 3PDUA 3IH5A 2QE7A 3JQCA 3OAAA 2COKA 4MNTA 2WG0A 3K1ZA 2OV8A 4IBOA 4MRAA 1F2DA 1D9ZA 1M67A 2QP3A 4MI3A 4RA6A 3R41A 5HVNA 5K09A 5ADUS 1T2EA 5J4LA 2HU7A 5GONB 3QE3A 4A0RA 3PRYA 2TMKA 4HI0E 1US8A 5HF8A 3WGMA 4JUAA 3LKVA 3U6KA 2PVCA 3HA3A 1I5OA 1E2KA 3LBIA 4JVOA 4PYNA 2ZDQA 4P58A 4X7MA 3PFKA 4BP3A 3TTYA 4EI2A 3DMTA 3UXEA 2I4MA 4G89A 4F45A 2OCYC 3QUSA 4J6EA 4MVYA 2W93A 3O4JA 3DS8A 3O6VA 2R2GA 3LYUA 4LDNA 4AJLA 1PDOA 1TOAA 4TRMA 1DIOB 4WBNF 4Z6KA 621PA 1DRVA 4YMLA 1FLAA 3PVZA 2DFKB 4Q9IA 3THRA 1BCSB 4KREA 1OHHA 1XO1A 1GKIA 1YJ5A 4ETNA 3OPMA 2AKYA 1RI2A 1DKRA 3E6AA 4LCJA 1XI2A 1YHYA 4PZYA 1CXZA 1Z9BA 4XR4A 3VNRA 1H1LB 2PY6A 1LTKA 2VHJA 1KHTA 3TE7A 3GDGA 4JXKA 4KXMA 3T7AA 1TKBA 2MMGA 1E9AA 3DO8A 1Q2XA 2WM9B 4UM7A 3UJ6A 1CTQA 5K8IA 5JXWA 2V3CC 1Y9DA 5FTKA 2EG5A 3W3AD 3HWSA 1J2JA 3AIIA 4QHYA 5KYVA 3PNPA 4TV9F 4FT2A 4BFZA 2O50A 2XE8A 2Z08A 4C3OB 3P52A 3IJRA 1JFFA 4FYXA 2HLHA 1O94A 2ZYRA 1G2OA 1Z73A 5C46F 2DAPA 3BD7A 3RVRA 5A6SA 5BORA 3ZU5A 3RRJA 1R3DA 2QN2A 4DT1B 3LT4A 1OROA 2VPTA 1CJUC 5ILOA 3QX9A 4ZVPA 3RVNA 1N25A 1TQDA 2DQYA 3AHGA 2VTEA 5CVTA 2OCAA 1HFKA 1GT6A 3RQSA 3K0FB 1KEWA 1YR8A 4BLRA 2KB0A 4RF4A 1I4WA 2QP4A 1L4HA 4OYHA 5JH7F 3JZMA 1U1CA 1X0XA 1GUDA 3Q6NA 2G1KA 4J7XA 4EY8A 1YGPA 2XNCA 3WLPA 2JBAB 3R24A 4JX8A 4P93A 3T3PB 1SUIA 1JTVA 1E4EB 4RPIA 1YJQA 1C4XA 2JGDB 3NEAA 3U6BA 3AM1A 3NR2A 4IVQA 5LP6A 3F47A 4LQCA 5HKBA 3VNQA 1H0KA 3AV0B 3LF1A 3FNQA 2ANBA 4INOA 3OUUA 2O05A 4J1TA 3ZY3A 2C5EA 2YVQA 2ECQA 2HX1A 2AMVA 2Q5LA 3HJBA 3ONWA 3RSHA 4L8WB 3TOCA 3CUUA 4AZ3B 2HBRA 1SURA 1W5TA 3TNYA 3TLCA 5BRJA 1Z2AA 1PGJA 2WAXA 1VPTA 4EG1A 1P6XA 1L7XA 1RC0A 1SM4A 1YB7A 4PCAA 4RIGA 3WO1A 3QBJA 4NPCA 2XJ9A 2IP4A 5G3YA 4Y2JA