4D3DA

Structure of imine reductase bcsired from bacillus cereus bag3x2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
285
structure length
285
Chain Sequence
NRKSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords IMINE REDUCTASE
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
source organism Bacillus cereus
total genus 116
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3dA01
1X0VA 4FJ2A 4B4WA 4DIOA 3K2EA 3N7UA 3OJLA 4XGKA 5IF3A 5L51A 3QLJA 1T4BA 1GY8A 1ZSNA 3AM3A 1XWFA 3PP8A 1DFGA 1LSSA 1WWKA 5KJFA 2Y0DA 2PFGA 1U5CA 3WGGA 2VTDA 4NBWA 1YH3A 4TRMA 4PCVA 2YUTA 5JPIA 4MVJI 4J49A 3PHLA 2JD2A 3EK2A 4UUMA 5EERA 3AY6A 1GAEO 2QRJA 4XJTA 3NT2A 4YT8A 5MGBA 2IYOA 1PSDA 3ZI0A 4ILKA 4XYLA 4ALIA 3W8DA 4RO0A 1EE2A 3I9LA 3KYBA 4R16A 2YQ5A 1PU2A 2IE0A 2NWQA 4IM7A 2GCGA 3O03A 1Y7TA 2RCYA 4DMMA 5GZ1A 3RROA 3Q9UA 2Z1MA 1GD1O 3GN2A 2O7QA 5G0WA 2Y1EA 3IKTA 3G79A 2X0JA 2PD4A 3ZV4A 3O26A 5COBA 4CLRB 4QEDA 5HRUA 2VYND 3KEOA 2HMWA 2IYPA 1R4MB 2P2SA 2HK8A 4II3A 4O1MA 1GPDG 5BSFA 4IGFA 5CEJA 1UXHA 4F45A 4G81A 2RHCA 3FCOA 5I8WA 1A4IA 4NZ9A 2EHDA 1U7TA 1NAIA 2EIHA 1DB3A 2J3IA 3LDHA 3H2SA 5ITWA 4UVHA 1GEEA 3AI2A 3GVPA 1DFHA 1E7WA 4XRRA 1NFFA 1X1EA 3UFXA 4R5HA 3MOGA 1WDKA 4HX5A 2D8AA 2DBQA 3PJEA 1HDRA 1NM5A 2LDXA 1H6BA 4KUGA 1ZK2A 3CEAA 4N7RA 4PGFA 3PLNA 3H9UA 3VC7A 1CF2O 3GPDG 4IDDA 2X58A 3U4CA 3RJ9A 5L4NA 3BHMA 3BTSA 2Z1NA 4UULA 2TMDA 1TT5B 1A7AA 5FEUA 2JHFA 2JAPA 3RFTA 2EGHA 3OQ6A 2CDCA 4YRDA 5BSGA 4R5MA 4XJSA 3JQDA 4LRSB 3KZVA 3JQFC 2X5JO 3AOGA 1T25A 2P4HX 3UAGA 3BTUA 1IUKA 3CH6A 3VPXA 3C85A 4XDZA 1F0YA 3L4BC 3ZGYA 3IUSA 3TOZA 1GCUA 3QWFA 2Q2VA 2HJRA 3NDIA 4Y98A 5F5NA 5IZCC 1T2FA 3I5MA 1U5AA 3IP3A 4NU5A 1LBEA 5L45A 1ONNA 1ZEJA 3DZFA 1K2WA 4E5YA 4IZHA 4R3WA 5G0SA 4CMKA 3ZU3A 4E21A 4OGWA 1NWCA 4FD3A 3IJRA 3X2EA 1PTJA 2B5WA 3SJUA 1HTBA 1U3TA 1LI4A 4XYGA 2DVMA 3RC7A 1V8BA 4Q3AA 1H2HA 2BFOA 3L07A 2O3JA 3GMDA 4BKQA 5L40A 2POQX 4L4RA 1GU7A 2JJYA 3O8QA 1YE3A 3WWYA 1NYTA 3FNEA 4E2XA 3EMKA 5AXBA 4CR8A 1BVRA 2BFAA 1HSZA 4A5OA 3JQBA 1N1GA 2G17A 2D3TA 4PLCA 5G2OA 3RUAA 2Z5LA 1UJMA 5JYEA 4GWKA 1NPYA 3QW2A 1HEUA 1KS9A 2GLXA 3FSRA 4RORA 3CIFA 2DTXA 2NLOA 4A0SA 2WE8A 2QYSA 3QIVA 3OA2A 4UEKA 1BW9B 4KZPA 2H6EA 1U28A 1YBAA 3BMCB 1AHIA 2NM0A 2DKNA 3GZ4A 5TLSA 2HUNA 4UREA 1NASA 2Y93A 1MC4A 3WB9A 2Q4EA 3V1TC 3F6YA 1NNUA 2PGLA 3E8XA 3GPIA 4E30A 3LC2O 4I9UA 3A28A 2VWHA 1GEGA 4YRBA 4YA6A 1QG6A 3IMFA 3JD0A 6LDHA 4YQYA 3WWZA 3ROQA 3BMNA 3RFXA 3RU7A 4ZN6A 2PZLA 2C59A 1S6YA 3I52A 1EE9A 1KY5A 4J2OA 4LMRA 4WNIA 5TSDA 3C1TA 3H65A 4WOKA 3V2UA 3JD4A 1ZK3A 3E9QA 4CMEC 1C3VA 1QLHA 1PX0A 4D42A 1HF3A 4D3SA 3JCZA 2P9EA 4MIYA 2HK7A 5A4DA 1B2LA 5KKCA 2W8ZA 3JD1A 4PG4A 2HK9A 4GH5A 3WXBA 3INRA 4O5OA 1E1MA 2PK3A 1AUPA 4BO1A 3M2PA 3BZUA 3NDJA 3VDRA 3EW7A 3WSVA 3RU9A 4R68A 2PZMA 1A5ZA 1YQXA 3BYZA 1O94A 1NXQA 3VKVA 4JJFA 2X86A 4WPGA 2O23A 3S2EA 3JQ9A 3ZNNA 3GG2A 1O5IA 4OHUA 3DEYX 3LT2A 3WIDA 1Q1NA 4I9NA 1KIFA 4E5NA 1LDNA 1I5RA 2EV9A 3U4HA 3IDSA 2YFHA 1CYDA 1GYRA 3VKUA 4PVCA 4CM1A 2VT2A 1N1EA 5AVOA 3PDUA 4ZRMA 4Y67A 3NDRA 4FFOA 3ZU5A 1LSJA 1I3MA 2NVUA 4NI5A 3TZKA 4FJ0A 2GZ3A 3PHIA 8LDHA 4RVHA 3GAFA 1UP6A 2OP0A 3HDQA 2QW8A 5DF1A 3E6AA 3GA0A 4HFRA 1ORRA 3CPSA 3NGLA 1X13A 3FRJA 4AJOA 3HQ4O 5FF9A 4FC6A 3CKYA 2D0IA 2BI7A 4AJIA 5DOZA 3BAZA 2C54A 5EL0A 1BXKA 1M75A 4MVJG 3I83A 1U3UA 5CFZA 1AGNA 1CQIA 4B4VA 1LEHA 1BTOA 4HKTA 3WJAA 4CUKA 5ITVA 4BV9A 1Z6ZA 4EUEA 1LDMA 3OJFA 3ZNOA 5U1PA 1FK8A 1T2CA 3P2YA 1RYEA 4CMBA 2EP7A 1YL7A 3AI3A 4XIYA 3PPIA 1NTOA 4YYZA 5DBFA 3PFFA 3PDJA 1DHRA 1JKJA 1HDCA 3ZNPA 3BHJA 4WOJA 5COAA 1D3AA 5T6BA 1OBFO 2ZB8A 2HDHA 1T4DA 2ZYAA 1VJ0A 1T26A 3AU8A 4P38A 4MVJF 3R1IA 2BELA 2RIRA 2Y1GA 3DHYA 5KCZA 3ZWXA 3Q9NA 3AI1A 4MKRA 2AXQA 1MLDA 1U2GA 2NTNA 3G49A 3B20A 4WCFC 4TVBA 3O8QB 4BHTA 4YPOA 3AUAA 1HE3A 5H83A 4J0EA 2WEKA 2B35A 4IQGA 2HMSA 1BHSA 1I3NA 4CM8A 1DIHA 5A04A 2AEFA 3ENNA 4OYRA 4BO9A 2FP4A 3DONA 5IDWA 5JAMA 1UP4A 1H94A 4E4YA 1O8CA 5CDYA 1LDGA 3DOOA 1JN0A 3ZN2A 3P2OA 3OECA 1A4UA 1L7DA 3OJ0A 2NUAA 4Q3DA 4Y9DA 2FY8A 4BKUA 4PLTA 2W2KA 3HWRA 2SCUA 1PJCA 2XPCA 4CQMA 2VZ0A 3IJPA 2VTEA 1GUFA 5AXCA 4CODB 3QV1A 4RZHA 1HDXA 2E48A 4AJEA 5A3VA 1SPXA 3QWIA 3V2HA 3WFJA 4E5KA 2OXIA 4J9VA 5A05A 5JMPA 1P31A 2NU9A 3TPCA 1FDSA 3HN7A 3NRCA 4IJWA 5FYDA 3V2GA 4AJHA 2FWMX 2Q2WA 4BO2A 3GRPA 3BMNB 2C0CA 4IXTA 5IDQA 4NH4A 1Z82A 1UXKA 2QX7A 4ZA2A 3WLEA 2FZEA 3NT4A 2C20A 2FHSA 7MDHA 2D4AA 1R37A 3I4FA 4OQYA 3ITDA 3Q11A 2H9IA 4EJ6A 2BGMA 1P1IA 5JDCC 2PGJA 3CUKA 3ONEA 1SNYA 4GX1A 3H4VA 4DMLA 1E6WA 2DBRA 3IP1A 3KSDO 1MUUA 4XB2A 3RBVA 5C7IO 3FBTA 1Y8QA 2GGSA 3DBVO 2BD0A 4YEDA 4YT4A 4G2NA 3D64A 4Y8VA 4A73A 1EUCA 2GASA 3Q2KA 2O2YA 3JQ7B 2EW2A 1A7KA 4EJ0A 2X8LA 3OIGA 2IEBA 3H8VA 4B7CA 7ADHA 3R3SA 4BNLA 3OF2A 4F6CA 3WGHA 3PHGA 4BQRA 5CG1A 5GZ3A 3RKRA 4GPD1 3V1UA 5CEEA 3VZQA 3LK7A 1EBFA 1E5LA 3FI9A 5AXDA 1UXGA 4D46A 3B1JA 4NIMA 3K30A 4BMSA 3AWDA 1B3BA 2HRZA 3DFZA 3PJDA 1ZSYA 1PL8A 2CF6A 3HJAA 5CEFA 1KVSA 4XZ3A 2ZJ1A 2NVUB 2B4TO 2PD6A 4QSMA 1CQJA 3TDKA 2JFHA 1EDOA 5TJ9A 3W6ZA 3F5QA 4FOSA 4WK6A 4ZD6A 5TT1A 1NP3A 4CMAA 4A27A 4K26A 4JX8A 3VPGA 1U3WA 3I4CA 4M55A 3DC2A 5KJEA 3K9QO 3WNQA 4A7PA 5ENVA 1V3TA 3PWZA 3V8BA 3HG7A 4BO6A 3PVZA 3UCXA 2HMTA 4FFLA 1GYQA 4ZQHA 4L73A 1V35A 1UDAA 1UXIA 5U9CA 4P4NA 4IGEA 4RDIA 4CUJA 4AJPA 3RD5A 4PLHA 4OO3A 4N54A 4TQGA 3UOGA 1I2BA 3G1TA 1VKNA 4M49A 3KRTA 4BNYA 3F9IA 1I24A 2A35A 1DAOA 3ZWPA 4IJUA 1Z7EA 1FDVA 3OQBA 2ZB3A 3PGJA 1TT7A 1B3RA 3HNPA 2D2IA 3STHA 5GY7A 1DFIA 1ZZEA 3OH8A 4PZDA 1DRWA 2AG5A 1LQUA 3E03A 3OEWA 1LC0A 5TGDA 2NNLD 4PG8A 4DLLA 1WMAA 4NDNE 1PQUA 1P33A 5DP2A 3ONDA 4D7AA 4JQCA 4XYBA 4PRKA 4RVUA 3I9NA 1HT0A 5JAZA 1ENOA 4JNKA 4JROA 4AJKA 4HNGA 3IC5A 2WMDA 4W6ZA 5LDHA 2PLAA 4RQTA 4WUVA 4IDBA 4BNMA 5C3MA 4LN1A 4DGSA 3GNTA 5KJ1A 1C0IA 1A9ZA 1U8XX 4IQ0A 1KYQA 3LZ6A 2QZZA 5F21A 1CDOA 1SB9A 2V65A 1JLLA 1IULA 3D0OA 4KUHA 1XG5A 1H6CA 3PGXA 3UF0A 1MX3A 4R01A 3TZCA 5A9TA 4CM8B 4R51A 5DCWA 4I5DA 3KO8A 2WE7A 3EUWA 3ZV5A 1PL6A 2G0TA 3U3XA 1IE3A 4IQ8A 2B69A 4YAEA 4LVCA 3KLMX 1U1IA 2CD9A 3PRJA 1P9LA 1VL8A 1B8PA 1Y8RA 2I6TA 2BFPA 4W7IA 1GADO 1B26A 3KM0A 1EFLA 3RUHA 3HDHA 5JFOA 1LJ8A 2CZCA 1P3DA 4W9NA 4BNIA 2W2KB 3UVEA 2AQ8A 3GNSA 3R3JA 4F3YA 3JYPA 5TX7A 3HHPA 2Y0CA 1EUZA 1KVRA 4PFJA 5L9AA 1HZJA 4YT2A 3WNVA 1HDZA 1G1AA 4MVJM 2ILTA 1FF9A 5B4TA 3ETGA 4NJOA 5IAAA 2EGGA 2XAAA 2VNAA 1UR5A 4PRLA 1YJ8A 3O38A 4DLBA 1WAMA 2DPHA 1GZ6A 1A27A 3VDQA 5DOVA 2BLLA 1NFRA 2B83A 3CTVA 3BMQB 3ROMA 4INAA 4HV4A 1DRVA 3BA1A 4Y6PA 1E3EA 3SX2A 1NX6A 3GVXA 2W2LD 1EVYA 1Y8QB 4R41A 4YJDA 2O3QA 3I3OA 4UUOA 2Q3EA 3DZIA 3L4BA 2JFGA 5KVQA 6ADHA 4L0QA 3RFVA 1QYDA 4GMFA 5G4LA 2D5CA 3GFBA 4AJNA 3FPCA 2OORA 3C7DB 4YJGB 4I8XA 1EQ2A 1LDBA 4B3JA 3E5RA 2DLDA 3ANLA 1ID1A 1R66A 4XYEA 2P9GA 1U9JA 5HBRA 1ADFA 4DL9A 5BSEA 1QKIA 3H5AA 5FFFA 2E4AA 3ETDA 2PWZA 4Z9FA 4CUZA 5I7FA 1EVZA 2J3JA 1WW8A 3QHAA 3CE6A 1D7OA 4E12A 1P44A 4NBRA 1GUYA 5DCUA 3IUPA 3NAQA 2YDYA 4E33A 2BHLA 3DZKA 4JJIA 2OL4A 1H93A 2IXBA 5JDIC 2X5OA 2PA3A 4IDAA 2PGDA 3HADA 3GUYA 5THKA 1DRUA 2ZYGA 1F14A 2PKQO 1EUDA 1PGPA 4DC1A 2WM3A 3IS3A 1SOWA 1HE4A 3ZCXA 3BHIA 3S1LA 1KETA 1ARZA 2VHWA 3WQSB 4Q3EA 1RYDA 2Y1DA 1C0KA 3SJ7A 3OA0A 3KYCB 4ZHSA 2O4CA 1GQQA 3JQAA 1Q2XA 1W6UA 2FZWA 2VWQA 1UZNA 4CM4A 2V6FA 2GO1A 4XQEA 3I23A 4Z0PA 2BFMA 1GDHA 2GN4A 3EVNA 5ER6A 1YB1A 5AQ1A 1DDOA 5KNLA 5I8ZA 2GDZA 3D5QA 3K5PA 1U8FO 2G1UA 4WE3A 4B4OA 1I32A 1ZUD1 3L77A 4BNKA 3B70A 3SLKA 3V1YA 4XEHA 1GL3A 2B5VA 3P7MA 4OIMA 1JW9B 3L9WA 1VM6A 3MTJA 1FDWA 1PGJA 3EGOA 2VOEA 3E1KA 4ITUA 4JP2A 4ALNA 3FN4A 3D5TA 3G17A 2QIOA 4LCEA 3EVTA 4IMPA 3ZV3A 1ONOA 3UH1A 4J4BA 5JAQA 4EEXA 1B8VA 2VZ9A 1X7GA 4GAEA 4CMEA 1DC3A 2Q2QA 5C5IA 4DTIA 1BXZA 1E0DA 2J6IA 1BGVA 4A03A 3OIDA 3VZPA 4R9SA 2DU8A 3KSZO 1HRDA 4EUHA 1X1TA 5I7EA 3DZGA 1ZEMA 5LCXA 1RM0A 4NBVA 1IB6A 4R9RA 1ISHA 2WYVA 4YB8A 5I9NA 2FR8A 3LU1A 4BMVA 2CDAA 1YQDA 1GCOA 1XHLA 5A06A 4RVGA 1W8DA 1QR6A 1NQAO 2QRLA 3ZU4A 1NBOA 4QECA 1Y8RB 2DTDA 2G76A 3QRWA 4XYMA 3QJ5A 5F1PA 3MOIA 4RQUA 3S2GA 1CIVA 3WX0A 4B3IA 4IJVA 3M1LA 2DBZA 2VUUA 1DO8A 2YHIB 4GVLA 4BGUA 4M87A 4YAJA 2GN9A 3AM4A 4BQPA 2NQTA 4PLGA 3NT5A 4RL6A 5JCXA 4FFNA 4QXMA 4Y6RA 2XF8A 2RAFA 4BV8A 2C5AA 1DSSG 4KOAA 4F6LA 4E32A 3DAPA 3PIDA 1Q0QA 4KUEA 4U8GA 3RUFA 1YBMA 2WYWA 1D8AA 4YAKA 3KHUA 1NPDA 3CXRA 2QG4A 1SCUA 1T2AA 1C0PA 4JBGA 3DO5A 4NBUA 2G5CA 3MJTA 4NMHA 4DIFA 1VC2A 3TJRA 5K6AA 1EBUA 1X14A 3HDJA 1WDLA 4DRYA 2GZ2A 1A72A 3GGOA 2Y67A 1A9YA 4J7XA 3BTVA 1PJBA 3AK4A 4BNFA 2EXXA 3TRIA 3DXFA 4XQCA 3GRKA 4OL9A 1ADCA 1YS4A 1VI2A 2E82A 1N5DA 1IZ0A 3HUDA 1AHHA 4O6VA 4EGFA 3KTDA 3PLRA 1LSOA 1DXYA 2VHYA 3AJRA 3TF5A 1N9GA 1B16A 3CSDA 4J91A 4BMNA 2JCVA 2ZCVA 3QQPA 1N7HA 3WTBA 2CVZA 1XR3A 5L3ZA 4TRNA 4DQXA 1PJSA 3LT4A 4KQXA 4BOYA 2P4QA 2C2XA 2X9VA 3G3EA 3W8EA 4EJMA 4F46A 4YAIA 2F00A 5JW6A 3M1AA 1MXHA 4GLLA 3EZYA 3PWSA 4GX0A 4CMIA 4M86A 2GSDA 3RASA 2HRBA 2WSBA 1EK6A 4I5GA 3RKUA 3DTTA 1PZHA 2EKQA 3DFUA 3ASUA 4BO8A 3DBLB 4UEOA 3VH2A 1SC6A 1ULUA 5CPBA 4RDHA 1EVIA 3JYOA 4ESOA 2O7SA 4JBIA 4RF5A 4MKXA 3ZH2A 3F46A 3I6QA 3DAFA 4JBHA 4U0JA 3CZRA 2O3TA 5EMHA 1HWYA 4DQUA 4GI2A 3DL2A 1BDMA 3GT0A 4IY1A 1XGKA 3W4KA 4ZRNA 5H82A 3RJ5A 3VPSA 2OFPA 1FJHA 1WNTA 3LF1A 4TRRA 1KVQA 4RLHA 3F1KA 3HDYA 5KVSA 5A9RA 4RJTA 4BGIA 3WBBA 4A10A 2VYNA 2YV3A 2EP5A 4HXYA 5CAEA 4U5QA 1WLYA 4OKIA 3C1AA 5L53A 3W4IA 2UDPA 1ISJA 1K5HA 1DAPA 3JQ8A 3PJFA 4FJ1A 3U4IA 1MFZA 3U62A 5KIAA 3Q1LA 3JQAB 2R00C 1KBZA 2HCTA 1SZJG 2H5LA 4MVJE 2NTVA 2JD1A 1XU9A 4A2CA 4CM4B 5THQA 1WVGA 1UH5A 4RPLA 3UKOA 3ADOA 3DZBA 3BMOA 1XQ6A 1Y5RA 3JQ7A 4AJJA 1HE5A 3MJCA 3EHEA 3GEMA 2HJSA 2LDBA 5IDXA 2XXBA 1NR1A 1SMKA 1M67A 3GVHA 3D7LA 4HADA 4Q9NA 1P1JA 4CV3A 1NVGA 3ZWAA 1OOEA 4J0FA 2BGLA 1XIVA 4BO3A 4D79A 3L4SO 4CPDA 4RGBA 1CEQA 2DTEA 5DBIA 4CM7A 3H3FA 2QYTA 3Q6IA 4UVEA 4QQRA 4HWKA 3JQ6A 4PLVA 4S1VA 4D45A 3Q2IA 1ZK4A 5TIIA 5FI5A 3F5SA 3QY9A 2WD8A 4R1TA 2IZZA 1C1DB 2AQKA 4IXWA 4PLPA 5K9ZA 1ZH8A 1ENPA 5ENDA 4P4LA 1PS0A 1SOVA 4ND5A 3WG9A 3VTFA 4CJXA 4PLYA 3KBOA 4ZQEA 5ADHA 3U9LA 4YACA 3WBFA 4KDFA 4ND3A 3SC6A 5JC8A 2HKIA 2Y1FA 1I2CA 4KWHA 3KLPX 2EW8A 4GX5A 3OICA 4QUKA 4BL5A 1ZKMA 1E3IA 1NVTA 5B37A 4CLOA 3PQEA 4WEOA 2NTJA 1MFPA 3WGYA 3DOCA 4J1TA 2P68A 3H9GA 1Q0HA 3U5TA 1I01A 3BXXA 1PJ3A 4XDYA 3INTA 1HKUA 4ONEA 1G6KA 1N8KA 3UXYA 2O3SA 1MXFA 4KMSA 4XD2A 1HSOA 3PTZA 1I8TA 3GH3A 3ICCA 3WGTA 4AJ4A 2FSSA 4U0KA 1L1FA 1QYVA 4BNXA 3RUCA 2I99A 3TWOA 3WLFA 1Q7GA 4MVJD 1ISGA 4MDHA 5A02A 3TN7A 5I9LA 2A4KA 2I65A 5DZSA 3R0IA 3TFQA 2YDXA 4LW8A 1EFKA 1PZEA 4Z9XA 4JN6B 3S8MA 2CF5A 1K6JA 5IN5A 1E1KA 1ZO8A 1NVMB 1B15A 4B8ZA 4XCVA 5I7VA 3SC4A 2R2GA 2FPGA 4I9HA 1ADBA 4N5MA 3MJ4A 5ES3A 1LDYA 3C3XA 2XXJA 4CR6A 4MIOA 4ALJA 3OJEA 4R1NA 4BNHA 1N9GB 2X1HA 1ISIA 1K89A 1T2EA 1NPTO 3RVDA 4I1IA 2GRAA 2W98A 1ZSVA 3JD2A 1XKQA 2IRWA 3W1VA 3GLQA 3QVWA 1ZIDA 3ORFA 1SBYA 1ISMA 3DBRB 3GNQA 4OH1A 3NKLA 4N5NA 3IIEA 5J23A 2Q1WA 5JLAA 5CHEA 3WIEA 4ZJUA 1P1HA 3VVCA 5EN4A 4Z0TA 2VUTA 1FMCA 1Y9EA 2JCXA 4GKBA 2PV7A 2WJPA 3ANNA 1ZXBA 3F47A 4FDAA 4CMIB 2ZQYA 3ZHXA 1PJQA 1M2WA 3KV3O 5B4UA 3K2BA 4G5HA 4MP3A 3DWFA 1UAGA 4LRTB 4K9DA 1IOLA 3JQEA 1LQTA 2Y68A 2OGUA 2ZB4A 4O59O 4UVDA 1T1RA 1HYGA 1C14A 3ZWBA 3G0OA 1DC6A 4IDCA 4BKRA 4CM5A 5DP1A 1RM5A 2IZ1A 2B0JA 5A3JA 2ZTLA 3CTMA 3LYLA 1Q7BA 4PG6A 4H16A 3A4VA 4J4TA 1WZIA 2E37A 2Y66A 2Q1SA 2UUPA 2FSVA 4TSKA 4GKVA 3WS7A 4NJMA 3BMQA 3JQ8B 2J3HA 3JQ9C 5T64A 3TZHA 4FGWA 2DUUA 1YJQA 2DQ4A 4L4SA 4BNNA 1AXEA 1QXSA 4JGBA 3T4XA 3GY0A 3C1OA 2NACA 3GHHA 4YDRA 4L9RA 5EPOA 4XQ9A 2GYYA 3DMTC 3GAZA 1V9LA 4NU6A 1PEDA 1ZK0A 3BMOB 3RBXA 4G65A 5T8KC 2GPTA 3RSHA 4OKNA 2PKRA 4DYVA 4YJGA 3H5NA 2CSUA 2FPIA 3HE3A 4IINA 1UZMA 3PEFA 1I33A 3JQGA 2YW9A 4PVDA 1LLQA 4J90A 4CM9D 5BNTA 1Y9AA 4ZU3A 3QSGA 2ZCUA 1GV1A 1GUZA 3INGA 2Q1TA 2EKPA 1XQ1A 3HB4X 3M2TA 1I30A 4XIJA 5JY6A 5C7OO 2V6GA 4E2ZA 3LLSA 3ANMA 3T7CA 3H6KA 2G82A 5G4KA 2Q49A 2ZTUA 1DC5A 4J1NA 4OXYA 1G0OA 2VN8A 2YZ7A 4ND4A 2GF2A 1M6WA 1PQPA 1GZ3A 5KJ6A 3F1LA 5FWNA 5JC1A 1NFQA 1L7EA 3H2ZA 4HFNA 1HDYA 1WDMA 1M66A 3LC7O 4Q3BA 5F3RA 5ILOA 5A5FA 2WWRA 4OOFA 2IDZA 2VWGA 4DVJA 3EYWA 3JYLA 1TEHA 3FD8A 3MEQA 4HP8A 4JP3A 2HMVA 4NK4A 3ZWMA 2O50A 2DT5A 3WGZA 1J5PA 4BB6A 4DBZA 3PWKA 1SEVA 2I5PO 2DM6A 2BGKA 4E6PA 4B4UA 2I3GA 3H9QA 3GHYA 3KYCA 1C1XA 4ZICA 2AE2A 3IQDB 4CLOB 3NTQA 2TMGA 1CERA 2Y1CA 3L9XA 3KB6A 4MOWA 4NPCA 2NQ8A 4RVSA 4UUPA 3GUCA 3UHAA 1RPNA 4CQLA 1XA0A 1E3JA 4P8RA 4EYEA 3GOHA 4IMRA 4RF4A 1V6AA 3DBHA 1QYXA 2P9CA 1MB4A 4DC0A 2GUGA 2V6MA 2V6BA 4IUYA 5IXSA 1VJTA 2X9GA 2HQ1A 4MJLA 3GZNA 1PS8A 2CUKA 4XR4A 2ZQZA 5JDIA 5L4SA 3L0DA 3VTZA 4EITA 1I3KA 1O9BA 3WYCA 4YR9A 5A5EA 1F12A 2B37A 1Q7CA 4L4XA 3OJOA 3E9MA 5T5QA 2ZK7A 1LSUA 4MVJP 3VPFA 5BQFA 3UICA 5F1OA 4IS3A 1WMBA 3RWBA 1MP0A 3JQCA 2HMUA 4E0BA 3Q0EA 5EQDA 4CL3A 4RLSA 1BWSA 1PIWA 4U6QA 1EMDA 1EEHA 2BMAA 5HS4A 1VJ1A 1VSVA 1OI7A 1PQWA 1Q0LA 3BIOA 4QO7A 2X7HA 1PJ4A 4RVFA 5EQFA 5A1TA 3DZHA 4W4TA 3A14A 1FDUA 5KWEA 1J49A 3RC2A 1H2BA 3GF4A 4L75A 3S2FA 1JKFA 2IXAA 2DC1A 3PJGA 3VVBA 1XELA 4PN3A 4LMPA 3LC1O 5BT9A 3AU9A 3SXPA 4EI2A 3FWNA 4J1SA 3JYQA 3FNHA 1M76A 4I5EA 3VH1A 3ZWNA 2GZ1A 1BMDA 5TNXA 4CR7A 4TZTA 4CLHA 3U09A 1GYPA 1RJWA 2YFQA 4XQGA 2O48X 4BNTA 4D43A 2WTBA 2YHIA 4GVXA 1LA2A 1JKIA 4AJ2A 3PZRA 1HDOA 3DDNA 3ZU2A 5B4VA 1KC3A 4EDFA 2DAPA 4IDGA 3WSWA 2DBVO 4FN4A 3UCFA 5KTKA 3K73O 4WLFA 4QT0A 4ALMA 2J5KA 3LQFA 4NR0A 2J3KA 2NADA 2IZ0A 1VRWA 3DTYA 3OP4A 3RUIA 3KETA 1HLDA 5B1YA 3TZQA 3ZNQA 1Y6JA 3CZMA 2NU7A 3K6JA 4UAGA 4YJHB 4CM9A 3MWEB 2D1YA 2IODA 3H3JA 9LDTA 5ICMA 1JU9A 2FPPA 4NG5A 2DPGA 4OAQA 3TQHA 1E1NA 1DOHA 3CINA 4LGVA 4E5PA 1KVTA 3FHLA 2PD3A 4NJMB 1NQTA 1B8UA 4J2HA 1GR0A 3ITKA 4E13A 4OXKA 3CMMA 1W4ZA 3JQFA 1RM3A 1R4NB 3NEPX 4YQZA 3E9NA 1ZCJA 4FGSA 5FI3A 2VCYA 2QZ9A 2CY0A 4UVIA 1T24A 3KYDA 1DLIA 1JWAB 4CM6A 5IN4A 1DC4A 2FN7A 3EDMA 4WLVA 5IZCA 4WKGA 2WD7A 2O3UA 4PIVA 3ZWCA 5JCJD 1JVSA 5JE8A 1LTHR 5EINA 1IZ9A 3JQGB 1W73A 3D4NA 2VZ8A 4D3DA 4M1QA 1PR9A 3NTRA 3IAHA 4JJGA 1SAYA 1KC1A 4DA9A 3MJVA 3QWBA 1T1SA 5HM8A 3I6IA 1JA9A 2DUWA 1BXGA 3OHSX 3UN1A 4IS2A 3WR5A 4W99A 3QWAA 3X2FA 5G4KB 2I66A 4PLZA 3L6DA 2X0RA 3DBLA 3I9JA 1I3LA 4FQ8A 4Y6SA 2F1KA 4NHEA 4YRAA 4XB1A 3AW9A 4GQAA 1LC3A 3OBBA 1HYHA 3FNFA 4PG7A 5ER9A 1IL0A 1DIAA 3PQFA 2UUOA 4LCJA 2ZATA 2VT3A 3LT0A 2WYUA 4R1UA 4AFNA 2AHRA 4IBOA 2X0NA 1DLJA 3W4JA 3AOEC 2HAEA 4DIBA 4FPXA 3KVOA 4AG3A 2A9FA 1I0ZA 4NFHA 2UV8A 1G0NA 2C2YA 3U0BA 1VKOA 1P77A 3ZHZA 5G0TA 3ZWOA 2W4QA 3IL2A 3RC1A 4CMCA 2OUIA 1GQ2A 2FR0A 2Q1UA 1U2DA 3RC9A 2YJZA 1FXSA 3G1UA 1C1XB 3LSYA 2P5YA 1J0XO 4ND1A 4WCDA 4BIIA 1IPEA 1N2SA 2C82A 3GK3A 1E77A 4CQLB 2EJVA 1EQUA 4HFJA 3VZSA 2AW5A 1V3UA 3AUTA 1FDTA 1AN9A 1EDZA 3DBHB 4K6CA 5MDHA 1E3WA 1MG5A 4D0RA 4JXKA 4II2A 3GZNB 3DR3A 4YJFA 1LRJA 4HNHA 2GN6A 1KEVA 1AE1A 1QMGA 4J1QA 3CMCO 1NAHA 3WFIA 1J6UA 2OOSA 4Z9YA 1YGYA 5TJHA 1YB5A 2Z95A 3I9MA 4IIVA 1NR7A 3WMWA 3MJSA 4MVJH 2IEDA 2CNBA 4UVGA 4CMHA 3R6DA 4IZIA 3QVSA 4WLNA 3AY7A 2YHUA 5DNAA 3FTPA 4YAGA 3EZLA 3GVIA 2OHXA 3ZWYA 3JSAA 1UZLA 3QWHA 4WNCA 5IG2A 3VH4A 4XRGA 1C1DA 1E1LA 1OC2A 2R00A 4U7WA 3DZJA 4W9NC 5LDGA 3DOJA 3QVXA 1QP8A 1NQOA 1MGOA 4WLUA 3D3WB 5I7SA 3GEDA 4PLFA 4YTEA 1Z73A 3P5SA 3QP9A 4XKJA 4P4GA 4WASA 1TI7A 3K31A 1C0LA 1R12A 4M89A 4BKPA 1XLTA 3ASVA 4FW8A 4HUJA 5DT9A 1OFGA 2C07A 2JFFA 1HL3A 3RAJA 4EW6A 2ZJ0A 4R1SA 1E5QA 1X7DA 1XCBA 3JYNA 1E6UA 4QTZA 3TZ6A 4ALKA 1Z75A 1P1FA 5TF4A 1X0XA 1LU9A 1TVEA 5DDIP 1CWUA 2JKVA 2W2LA 1GZ4A 3EY4A 3C24A 2NU6A 1UP7A 2YV2A 3PXXA 1YONA 3OM9A 4H3VA 1DIGA 5KOIA 3JD3A 5JCJA 2Y0EA 4AJ1A 4WLEA 3ZW8A 4LSMA 4RZIA 3PHHA 2JD0A 4BO5A 4OMUA 5IFLA 3MWDB 2OBYA 5H81A 1TB4A 1KVUA 1D4FA 1H5QA 1YRLA 4CL8A 2EJWA 3VPHA 4D41A 1E7YA 3WGOA 2ZIZA 2A94A 1OZAA 4MO2A 4RPKA 1GPJA 2GERA 2PR2A 2VUSA 5JXWA 1I36A 4M54A 2OO5A 5L7WA 1LLUA 1O95A 1ZXLA 3FNGA 3KYDB 3OFSA 2QRKA 1AXGA 2WD7B 3PYXA 4AL4A 3DBRA 4TKMA 3DQPA 5HWSA 5EJ2A 3A9WA 3ETEA 1ZVMA 3BTOA 4CM3A 3FR8A 4R4JA 2X22A 2YY7A 4E2YA 2CFCA 3N74A 4TMFA 3FWZA 4QFDA 5AOVA 3AFMA 2JHGA 1GQYA 3A06A 3COSA 4P22A 1BXGB 4D44A 1MG0A 1HLPA 4PZEA 3GDFA 3FTNA 3ZW9A 5IZ4A 2C7GA 2AG8A 2JL1A 1LUAA 5JO0A 4RPHA 3H9JA 3ULKA 1H9AA 3TOXA 1R0KA 1CETA 4DYDA 1UDBA 2EG9A 3NX4A 5GZ6A 1B14A 3B1KA 4FSHA 2UAGA 3DB2A 4WCFA 1KERA 2O2SA 2C7VA 3GEGA 4FCCA 1N7GA 2PTGA 4LVUA 1UDCA 4E3ZA 3TFOA 3KOUA 1P0CA 1VE9A 4JK3A 2PKQP 4UEJA 4NFSA 2WDZA 4S3MA 3FPLA 2CVQA 3MCVA 1JWBB 4PZCA 1MV8A 2GN8A 1EVJA 4L76A 3D1LA 3B6ZA 5JO9A 3ZWVA 3NJ4A 3VH3A 4KTTE 5JSFA 1OAAA 4QO8A 2HO5A 4D3FA 2VRBA 5ILGA 3RI3A 1IHYA 1YB4A 5L7YA 3S55A 1SEPA 5DCYA 3RBZA 4ZQBA 3SBOA 2D59A 4B79A 2PH5A 5BSHA 4Z0HO 3MZ0A 4O63O 2JAHA 4HY3A 4BO7A 1PWZA 3OSUA 1ISFA 1ADGA 3UW3A 1LNQA 4BO4A 2PZKA 2Y99A 4J7UA 4Z3KA 3PYMA 3ON5A 4J3FA 4ND2A 1E3WB 3N58A 1X7HA 1KY4A 1JTVA 1UUFA 4YJFB 2I76A 3GMSA 3P19A 2O4UX 1E3LA 3HSKA 3JV7A 4RCVA 4CLDA 3VHRA 4MP8A 1TA4A 4RF3A 1ULSA 2YYYA 1U4OA 4CLEA 3H5RA 4CQMD 3WGQA 2VOJA 5DULA 5IXYA 4CV1A 5G0VA 5CG2A 3AFNA 2HU2A 2H63A 4LSWA 2H1SA 1F8GA 1E3SA 3PI7A 1DIRA 4H7PA 3ZWWA 4GBJA 3ONFA 2O3RA 2AQHA 3HB5X 4NNJA 3WQRA 2HSDA 5JDCA 4TRJA 4DPMA 2E49A 4MINA 3VZRA 1H6DA 3PK0A 4OM8A 3F3SA 3RCBA 1O89A 2RH8A 1Y1PA 3T7EA 5F5LA 3MTGA 4WGGA 3DMTA 1DHTA 3ICPA 1R15A 3TL2A 1WXDA 5CPFA 4FB5A 5T8KA 1PJ2A 2W90A 1GV0A 3ADPA 3OEYA 1NWHA 4XX0A 2Y05A 3ABIA 2AEMA 5BNFA 1U4SA 3SEFA 1GTMA 1LLCA 1ZMOA 3VOSA 4WJZA 4EZBA 4NQZA 1I10A 1YOVA 3KUXA 1EK5A 1P45A 1E6EA 5A9SA 3E82A 4GWGA 4XGNA 2Y1OA 1Z45A 3ZV6A 1ZNQO 2BH9A 4E2WA 1K3TA 4MPDA 5JS6A 2B36A 5K6AC 4ID9A 1R0LA 3NV9A 4J43A 3ZDFA 1PGNA 2ET6A 4K6FA 1QRRA 4Z3DA 3F4BA 5TT0A 3I1JA 4WECA 1QYWA 2J8ZA 5I9MA 4TWRA 5BNIA 4C7JA 4E5MA 1PGQA 3IOYA 4Z6KA 3K92A 4K28A 1PWXA 1YBVA 3K96A 3JQBC 1QLJA 3QE3A 2PY6A 3H7AA 2VWPA 4X54A 3KEQA 1MA0A 4ZQGA 5IDYA 3TNLA 2OMEA 2GNAA 2PNFA 1NHGA 4FOOA 1F06A 1PR3A 3O9ZA 4UUNA 4GGPA 3WGIA 5L95A 3SLGA 4XWYA 4BNWA 3QA9A 4ROSA 3GDGA 1U7HA 3GR6A 3H9EO 5JYDA 3HFSA 1HYEA 3C7CB 2VRCD 3PQDA 4Q3CA 4QX6A 3OQ1A 3FBGA 4N5LA 2UVDA 1YO6A 1LX6A 1JDJA 5U4QA 1RWBA 4FIZA 2Q45A 4OJNA 1ONPA 1RM4A 3ROKA 1ZJYA 1B0AA 1P74A 2I9PA 2CMDA 2PH3A 3NUGA 3UUWA 4AICA 1WPQA 4CV0A 4RVDA 1RKXA 5JY1A 1K6IA 1O0SA 5L4LA 3I9OA 3VAZA 2FOIA 4IIUA 3L6EA 4BNZA 4WEQA 1W0CA 2OP1A 5JAIA 2YQ4A 1R16A 1QYCA 1V3VA 1U3VA 4KDEA 2NU8A 3TL3A 5C7LO 4DPKA 4QFCA 1E92A 1H6AA 1JAYA 3HFGA 1Y81A 2RH4A 4FR5A 4WCFB 2AEJA 3ZHYA 1E7RA 3WICA 4CV2A 4DLAA 4M8SA 4AJLA 4GLOA 1VPDA 5B12A 1PZFA 3AM5A 4BNVA 1MC5A 3C8MA 4OSOA 4U6SA 4YJHA 3RIHA 1EZ4A 5HTOA 4DUPA 1YKFA 2CDBA 2Q4BA 4EEZA 1ZBQA 4KTVE 4GX2A 2AA3A 5TC4A 2RBEA 4URFA 4I08A 4K1LA 5KVVA 3QVOA 2VHZA 1R4NA 3EC7A 1XDWA 3PYLA 1KEPA 1VLLA 2JCYA 3NYWA 3WTCA 2X9NA 1JVBA 1YDEA 3PHJA 2FR1A 1XU7A 4W82A 3RUEA 5CDGA 1DEHA 2J5RA 2VHXA 1KEWA 3ZZNA 4BS9A 4DBVO 4EUFA 4IPTA 3TSCA 1DPGA 2BRUA 4FS3A 1QV7A 2D5AA 2J5QA 3U49A 3RUDA 2B4RO 4J16A 2AE1A 3D4OA 5G0UA 4OQZA 4OXNA 4BUCA 1YXMA 2VYVD 4HBGA 4RF2A 1TLTA 4KP7A 1CJCA 4YVFA 1WP4A 5C37A 2QHXA 4GMGA 5JBIA 3S2IA 2OBNA 1VL6A 4FFRA 3QVTA 1DBVO 4JCOA 5IJZA 2DFDA 1Z74A 2V7PA 5KJCA 2VQ3A 4A26A 4ZGWA 1ENYA 4DWVA 1OC4A 2HLPA 4TZKA 2I67A 4BNUA 2C29D 3M6IA 1HXHA 1P1KA 2CVOA 1LLDA 4MVJA 3B1FA 1PGOA 4J4HA 1ZK1A 3HN2A 4YXFA 3D4PA 3GGPA 1YOVB 4PLWA 1QORA 1BSVA 5A9SB 4B7UA 5CDUA 4RPGA 4L8VA 1J4AA 2ZKLA 4O0LA 4E31A 4I5FA 4LK3A 1N92A 4FFMA 1IHXA 5CDSA 2E6UX 4Q3NA 2Q50A 1D1TA 1ENZA 1PZGA 4WLOA 3D3EA 3OMLA 5KKAA 4C4OA 5TS3A 1IY8A 4YCAA 1YVEI 3Q3CA 5AYVA 1K6XA 3LVFO 3GGGA 4FBGA 9LDBA 4R3NA 2VHVA 2VRCA 4Q39A 4B7XA 2XOXA 4ALLA 4OOEA 1IPFA 1Z7BA 1VL0A 3AOEA 1P1RA 1XEAA 4OSPA 3KSUA 4DPLA 1BDBA 1E7SA 1E7MA 1O6ZA 3MJEA 4KWIA 1M6HA 2X0IA 3ST7A 4D0SA 1DJQA 1KEUA 3V5NA 3WYEA 2B4QA 1A71A 2X5KO 2BF7A 4BNGA 2X4GA 5CP8A 3LF2A 3WJ7A 3PZBA 2ZYDA 3WQQA 4LISA 1R6DA 3OIFA 4IDEA 2OZPA 1UAYA 4R69A 3GN1A 4CLRA 5K0ZA 1JAXA 3NJ8A 5F1KA 4DXHA 1R4MA 1ZFNA 2C5EA 1NHWA 3PIIA 4NFYA 1H0KA 4YWJA 3D3WA 5A03A 5DBGA 3E5MA 1BRMA 1LDEA 1BVUA 1H9BA 2VNSA 2ZTVA 3GVCA 4YBZA 5TRTA 1PJLA 3JQAD 2Q46A 4XGIA 2EERA 3DMYA 4ZQFA 4BVAA 2UYYA 5EESA 3E18A 2NVWA 1ZMTA 1DIBA 3HZZA 2DFVA 3WMXA 3NTOA 4L74A 4YT5A 1PS9A 5BR7A 1YDWA 1HZZA 1YL6A 4RV9A 4TROA 2EF1A 5L7TA 4NBTA 1NQ5A 5ICSA 5AXAA 4J6FA 2RHRA 3E48A 3I9KA 4FC7A 4PG5A 3IKVA 5COQA 1TT5A 1KOLA 1VSUA 4BGVA 3SVTA 1ZJZA 2NV6A 3AUSA 3ENKA 2FRDA 3GC6A 2X6TA 3KXDA 5JMWA 3WOHA 4GGOA 3C7AA 4XR9A 4ZVVA 2EWMA 2P5UA 3ZHBA 4HFMA 4C7KA 5GMOA 4CQMB 2ZB7A 3L6OO 3LT1A 2BKAA 1OMOA 4TKLA 1LXCA 1PL7A 1B7GO 3GFGA 5KVCA 5T67A 4GSKA 8ADHA 4B8WA 4N18A 1R0SA 4J7CA 2VYVA 4BKOA 1P0FA 4AVYA 4IJKA 4GSLA 1TXGA 4BB5A 2AMFA 1DJNA 1V0JA 3FR7A 5LC1A 4KQWA 4MKZA 2P91A 3FF4A 1ZW1A 3WDSA 2NVBA 3EAGA 1I2ZA 1T2DA 3DAGA 2NSDA 3DHEA 5DN9A 1QSGA 4FFPA 5HS6A 5T57A 3WYBA 1E7QA 4W7HA 3T4EA 3UGKA 1Y5MA 4J9UE 3W6UA 1HDGO 4XA8A 1HE2A 2FMUA 4CMJA 2EKLA 3DHNA 1F17A 3GG9A 1F8FA 2I3AA 3O4RA 1XYGA 5TQVA 4BGEA 1XSEA 3GDOA 1D1SA 4IDFA 3JTMA 3AY3A 3F4LA 3U4DA 4NK5A 1LRLA 4TVOA 1K0UA 4B3HA 4BO0A 1PJTA 1YL5A 1X15A 5CDTA 2EEZA 5EIOA 1UXJA 3A1NA 3ROPA 2GD1O 2AQIA 2Q99A 4CLXA 3LLVA 1YQGA 3W8FA 1YWGO 3UCEA 4DQVA 1BW9A 2QQ5A 1ML3A 1SB8A 1GFSA 1IYZA 2BI8A 3BMCA 3NGXA 4BNJA 2R6JA 2GR9A 3GQVA 1HETA 3K8ZA 1QV6A 1LRKA 4GL4A 3RQSA 4MP6A 1CRWG 2PZJA 4RPJA 4DREA 5JNLA 2A92A 5HA5A 4JLWA 4CMGA 4R54A 3PFWO 1JQBA 1S7CA 4MIEA 1WZEA 4JIGA 1BG6A 3OETA 4H15A 1SO8A 3AUUA 2YV1A 4EBFA 2ZTMA 2X23A
chains in the Genus database with same CATH superfamily
2ODEA 3DVAB 2FUKA 2O8EA 3CW9A 5IF3A 3OJLA 4LJ5A 1A8IA 2NAPA 2WOJA 2VSOA 2XYQA 3I01M 5F2OA 4HH3C 5K20A 4ARIA 3QPDA 1TYEB 3AM3A 2CE2X 1A7JA 3FMPB 3PP8A 1I7NA 1WWKA 3GXOA 3TIGA 2QL9A 3OM0A 1ND6A 2Y0DA 3SOZA 5FL7A 3WKCA 2ZDQA 1CY7A 5C5EA 3I62A 1TC1A 2VTDA 3AF4A 1Y80A 3QMPA 1IN8A 1Z5GA 3BIXA 2XSZA 1I3OA 2YUTA 4AF6A 1WKVA 2I3BA 3OQNA 2ZVDA 4GOKA 1EP2B 4IHKA 5SZHB 4ZC8A 2BEUB 5MGBA 1Z4JA 1ZL0A 3HCWA 3Q9LA 5IJ0B 5L6LB 2H48A 4ILKA 2DPLA 3PEEA 3SD7A 3ER9A 3QVLA 4KPFC 4LIPD 4RO0A 1J21A 3MJFA 1BGWA 1EE2A 3ZG6A 5GQSA 4EY5A 3DWIA 3JAKA 4OMFG 4TMZA 3VV3A 1Y7IA 3CY6A 1G3RA 3M81A 3SDZA 4B6SA 6YASA 5JH7A 3GCDA 1GLNA 1Y7TA 1A2QA 2H08A 1DS6A 2JJ2D 4IDHA 1GIAA 1OBVA 2Z1MA 1GD1O 3RYTC 1QVAA 3G5MA 4BDTA 3L0SA 4YCBA 3KYJB 3IKTA 3G79A 4OSEA 4MW2A 3THWA 3P45A 1N75A 3LPNA 4DBLE 1U0HC 1YFZA 4A16A 1E60A 3I05A 4EI7A 2V7EA 1R4MB 4II3A 4BQOA 4U4AA 1UQTA 4A6XA 1LI7A 5CEJA 1KJ8A 3G5TA 4G81A 1OI2A 3HL0A 5I8WA 4Q6WA 5J1SB 3I58A 4XFDA 2GD2A 3LUAA 4KLNA 1U7TA 1NAIA 1VHWA 3M6FA 3PC8C 3QKRB 4NYIQ 2J3IA 5H70A 2LE0A 4R8MA 4B43A 5G3YA 3AI2A 5HQ3B 1YS6A 1K8RA 4KNWA 3GQBA 1AN0A 1NFFA 3FJ1A 3L8FA 3FGZA 4R5HA 3RTEA 1XDDA 3QMWA 1FL9A 3PNOA 2DCMA 1WDKA 4ZEVA 1T15A 1E4OA 2EWWA 2DBQA 3PJEA 4HPXB 2AFHE 1HDRA 1Z0ZA 2ZBRA 4AU1A 3ZCTA 1J2JA 4IIXA 1W9HA 3QUTA 4LQ4A 3LLCA 1CF2O 1ORDA 1ODFA 2X58A 1RWOA 1XDGA 2JLCA 1G5RA 1IAVA 1NVFA 4MYTA 1XZFA 3BX1A 4UULA 3FMFA 3HKCA 1TT5B 3MGBA 4QEZA 2DWCA 2ZYUX 1RHMA 4P4SB 1QWOA 4G26A 5L3SB 4LTMA 3GROA 3KZVA 4MI9A 3OE7A 4EB6A 2ZI6A 1T25A 2CEAA 3QU2A 4LYDA 1E98A 3IIJA 3C85A 5GOZA 3VPXA 4OJKA 5AKYA 2F1JA 3ZGYA 1GCUA 3GAMA 5KYVA 5BXYA 2M6KA 3NDIA 3O6VA 3GJYA 1T2FA 3AINA 2FCRA 2NZXA 2PQ0A 3NXSA 4KQ6A 2VJPA 1LBEA 3FHJA 5EHXA 5KDDA 4UTXA 5L45A 4JUBA 4E5YA 4OU5A 1TC2A 3BE5A 5P8WA 1N78A 2ERCA 2FFAA 4XSHA 1E4VA 2GEKA 5H3LA 1JJVA 4RHUA 5EMMA 1KJNA 3DL0A 3PT5A 1J5XA 2C8VA 5BVGA 3X2EA 4JLNA 2ID9A 3KR9A 1AS3A 1S2NA 3HCRA 2W2XA 2GF9A 2PL9A 2J08A 2WMNB 4X63A 1XJCA 4ZVRA 3RC7A 4KIWA 2BFOA 4D3YA 3N0WA 4YP6A 3L07A 2JPDA 1R5NA 4C6RA 4DLXA 2R5FA 3U7QA 2POQX 5ALYA 5FNVA 3ZI7A 1OLXA 4L4RA 3B52X 3EB9A 3ZX4A 1LCIA 4UDNA 4D3XA 3JVUA 5INTA 5LUAA 1SXPA 3OZAA 2PDAA 2IU0A 1XVIA 2HWYA 1SVIA 3V4LA 1BVRA 2JG3A 2BFAA 1NC1A 1PLJA 2G17A 3KVYA 2D3TA 3RUAA 2QGZA 3UT0A 1XRLA 1A8UA 1CY4A 1VIMA 3PFNA 4I1YA 5FFMA 1XQ9A 3LTNC 5F98A 2DTXA 3RQIA 2N46A 5F73A 1UC8A 3AKZA 1UXOA 1BX0A 1NW8A 4UDXX 2E4VA 4Q1AA 3U3KA 2ZRBA 3A32A 2QAGC 5CT9A 3I39X 3A3OA 3BMCB 4XCQA 1DGQA 3FZQA 2DKNA 4PIMA 4CIYA 3HGMA 5TLSA 5K3FB 2HUNA 2ZJ4A 1DJOA 4MRMB 4UREA 3M0EA 1E9DA 1FP7A 2WYHA 1S2IA 4U2KA 2Y93A 3AR8A 4G23A 1GZ7A 1Y4AE 4QDTA 2YIVX 4RVOA 4DR5B 3WB9A 2QMQA 5KOHB 1J1ZA 3QEMB 4HXEB 4F4IA 5CBPA 3E8XA 3DE5X 5EWJA 5K1ZA 1OASA 5I6DA 2E1PA 1WG8A 2HA2A 4RHXA 3A28A 1PUXA 3B38A 3TLJA 1GEGA 2LIVA 5CB0A 4MW9A 1SHZA 2PZAA 4OJQA 4CI9A 4YA6A 4FYKA 2EJCA 4K6HA 3OM1A 4RTNA 1NL3A 1R4ZA 3ZS9A 3U3RA 3D6NB 4N65A 1QVZA 2PZLA 4ZN6A 1TVCA 2C0QA 3K7EA 5A62A 3Q8WA 1EE9A 3B51X 4LMRA 3AC0A 1M33A 3I2HA 4FN5A 4OHCA 5ICEA 5KU1A 1I7DA 1XTTA 4PAQA 3H65A 1L7QA 2HBYA 2Q41A 3SBDA 3WK4A 2Z4SA 4TS3A 5F4BA 1EZ1A 3T1YB 3UBTA 4V0NA 4Z1OA 1OYYA 3K0SA 2HK7A 1B2LA 2WG2A 1TJPB 5IAKA 5I47A 1G21A 5IKXA 2HK9A 2V6IA 1PRYA 2RGEA 4O5OA 4KHPB 2MSKA 4Y2GA 2PK3A 2PUDA 1AUPA 2VYCA 3BF7A 3ZVNA 1APBA 1CUBA 1U7OA 1B8NA 1L5LA 5L8VA 3BG5A 1TJNA 3PLAE 3ZDBA 1EGHA 1WBDA 3WSVA 2XNDA 1GZ5A 3QQ5A 2PVCA 4XPZA 1ZM2A 2YBEA 4YRJA 1S1MA 2MR6A 2BGJA 4R68A 1JDSA 5D84A 5EGNA 4XVUA 3L79A 2P9HA 3V7YA 3BYZA 3NAZA 4KHZA 3M4NA 3HB1A 5CVCA 1G9XA 3NBXX 4JJFA 4M0MA 5ECYA 2O23A 3PI6A 1E9SA 1O5IA 3ESAA 1SKYE 4BPRA 3HGQA 3R7SA 2XIQA 4LJ9A 3LT2A 1SCKA 1K2VN 3WIDA 1Q1NA 2FA9A 1ZP6A 3LXRA 3REQA 3A27A 3P2KA 4DQDA 3CN9A 2FMIA 2J33A 4UHCA 1P1CA 1FXWF 1EH5A 3GGSA 1DJLA 3W3AH 1MVOA 1KE2A 3UAYA 1GGFA 1GYRA 3V7FA 1QYIA 4PVCA 3VKUA 1SUWA 1NNSA 1N4AA 3FXAA 3IELA 4Z54A 2BTOA 3NDRA 5CW2A 4OI0A 4FFOA 4BN0A 3D2CA 3V48A 3X1XA 1WMDA 2RK4A 4KAXA 4X6LA 3AR5A 1CZHA 4JL8A 1BHJA 2PX4A 2B8JA 1EFHA 3EFBA 4XFJA 1M0WA 3RGWS 4AZ0B 1XJWA 2P2LA 3GJZA 1PG5A 8LDHA 2IL1A 2EKDA 1ORHA 2PLRA 2XEDA 3GAFA 1MO5A 3AIKA 3FM9A 4RVHA 4D5GA 3ZYZA 1KI1A 1RC0A 2OP0A 2V9ZA 4WIAA 4MVYA 3IOCA 4BE7B 4AX8A 4CKCA 1QZUA 3KAPA 2C4UA 4JJEA 1H3EA 4B75A 4B45A 4S1TA 1JFVA 3KR1A 2AFIB 1RZ3A 4HFRA 1ORRA 4OREX 1Z17A 4LA4A 3HQ4O 4D9NA 1DAFA 3SHVA 4M3NA 2G71A 1F51E 1RQPA 5DNWA 2YVLA 2QRZA 4FHCA 4P36A 4LE0A 4AM8A 4N0PA 2V7BA 5K5EA 2W6ID 1M75A 5FUWA 3KB1A 4MVJG 1IQ0A 1F3LA 4MH0R 1M2HA 4MQEA 4P98A 2XRMA 4N12A 1YJAA 4PC7A 4IUBS 3WJAA 5ITVA 5JT1A 2EWVA 4EPVA 5KX5A 1EDEA 1Y6GA 3QBJA 2PKEA 2PMBA 4RIEA 3OJFA 3ZNOA 5DHQA 1ESMA 3ELDA 2H52A 4NBKA 3RO7A 4LZLA 3V46A 4E70A 2HO4A 3BWBA 3MJHA 4UU8A 3BSSA 3AI3A 3EA5A 1BAPA 3I92A 3KELA 3KV1A 3OE5A 3PPIA 2YJ6A 1V7CA 1DX9A 5LQUA 1L0BA 3C5HA 1T5OA 1AKWA 2WVJA 3BHJA 3A6FA 1KSGA 2JH9A 1WZ2A 2ZB8A 1JBEA 3CLVA 2ZUBA 3R1IA 3DTVA 2BELA 4KR0A 3THYB 3QE2A 4RA6A 1SD5A 4HH1A 2GA9A 2AFHA 4NG4A 1V1JA 2J0VA 3L7LA 4OD0A 3ZWXA 4MKRA 5TQ0B 3K9LA 4JLBA 3M33A 4KB5A 1RZRD 3G49A 2WB4A 3B20A 5LU8A 2MSNA 4PHCA 2R66A 2JZCA 2P0YA 4TVBA 1EM8B 5JD5A 4YPOA 3ICWA 3CKLA 3AIIA 3IAFA 5H83A 3VHQA 3L7IA 5KQMA 4J0EA 5LZ4A 2B35A 3PFIA 4IQGA 1JHYA 2HMSA 1VLJA 2X8JB 4WERA 4BE9A 2H1LA 5C1IA 4CM8A 3DEAA 1YMUA 4M0CA 4URVR 3L40A 1QQTA 1ZGGA 2FN8A 1TAQA 3ENNA 2CGEA 3SS7X 4TPKA 1M8PA 1Q5PA 4MUAA 4QHSA 1KAHA 4AZ3A 5JAMA 2A9KA 3H9CA 2R4TA 4G5XA 2GSWA 1ECPA 3KU4A 4DLWA 2J41A 2PGIA 3TLMA 4PS0A 1JSXA 2ODTX 2YXPX 3OCVA 3UV3A 4J3JA 5AICA 1A4UA 1FBNA 2HYIC 1J90A 1JAIA 4Q3DA 4CDGA 4BKUA 4PLTA 2W2KA 3QMMA 4DCVA 1WSBA 3ADCA 1X94A 1RJ9B 3LXMA 1CNMA 5BQOA 3LECA 3Q7EA 4JC5A 2VTEA 3N2GB 4ZIRA 2LXNA 4DILA 4QFMA 2IBMA 1CY8A 1EB9A 2E48A 2NXCA 2WRZA 4LKRA 2V55B 3FCEA 3GXBA 3PU6A 4AJEA 3WNDA 2QW1A 3QWIA 2FPLA 3ZDQA 3T9AA 3UV7A 5LWHA 2OXIA 1SOUA 4J9VA 1JAHA 5IVDA 3OUUA 4G4SO 1IXSB 1T3SA 4ETMA 3KZMA 4O2RA 3TPCA 3T5TA 3PFHA 4AJHA 2AG0A 4X1IB 3G88A 4AKEA 3KLOA 1D0SA 4IXTA 4D4LA 5EJEA 1UBHS 1UXKA 1F2TB 4B6OA 4DDKA 2FHSA 2J67A 5HZKA 1PBNA 1FXUA 5TPZD 4C0BA 3Q11A 2H9IA 2CL7X 3F8SA 4IGKA 3AL0C 5JDCC 4GX1A 1ZLXA 1E6WA 2DBRA 4G2TA 2QE7D 4WBSA 2HCBA 4DIKA 2CKMA 2WWTA 1R9MA 3RBVA 3T5CA 1Y8QA 3DBVO 2CNLA 4RMIA 2FRXA 4CIBA 1T4CB 2H31A 5JRJA 1VHLA 2VC2B 4L4YA 5JI2E 1T34A 4X3PA 4C3ZA 4TLDA 4PTZA 3T35A 4J03A 1GR1A 4DLPA 3PJRA 2BJVA 5J2TB 1KYIA 2EW2A 2EKBA 2QIPA 4EJ0A 1L8LA 4AICA 2P6MA 1IOVA 1GITA 4B7CA 1XZJA 3BGOS 5FYQA 1U8ZA 5C3UA 1KFCB 7ADHA 3WGHA 1AMUA 2PIDA 1ZOPA 4L51A 5CG1A 3N2LA 5GZ3A 4DFDA 2P27A 3VZQA 1ESNA 1JMYA 1JSZA 3TEMA 1YJ5A 4YMHA 1IG0A 1YB6A 4BX3A 3QIAA 1E5LA 2X76A 5AXDA 1S7GA 3E7DA 1Q0TA 3BXFA 3MGGA 3EIFA 4RD4A 1P2UA 3TE7A 1JPVA 1XDBA 3AWDA 3DDOA 4NYMR 4BP3A 1B3BA 3JZAA 5BV2P 3SEAA 3DFZA 5JQGB 4RD6A 3OCCA 2CF6A 1Y6QA 1E3QA 1XL0A 1C41A 3EASA 3GA7A 1KKMA 2HA4A 3EVFA 1Q1GA 1R74A 1ZHFA 2AUMA 3AI7A 1QP7A 4QBIA 4QSMA 3TDKA 2HL6A 1EDOA 1CIPA 3W6ZA 4WK6A 5HIJA 2DERA 1NP3A 5I5EA 3STTA 4A27A 1GNQA 4K26A 3CG0A 1J9GA 2ZYWX 4Q05A 2QN8A 3I4CA 1FU7A 1NURA 5KJEA 1L3CA 3L8CA 1U2QA 2ADOA 3K0AA 3O4HA 3EWSA 3ZIUA 3GRRA 1QLWA 1GT6A 1V3TA 1YB7A 1X1QA 2D13A 2JDID 3DMFA 1C0EA 3L6CA 3PWZA 2Q7DA 4C30A 4ARBA 1GYQA 1Y6RA 3ILYA 4I2NA 4PZ0A 3DCIA 2QYOA 3KU1A 2ZSFA 3O47A 3VR4D 5KYWB 3ZZMA 4PQRA 1JHUA 4TLAA 3RD5A 4D02A 4BTEA 5T6MA 3WNZA 1JB1A 5FOTA 1TECE 3IGFA 3P2MA 4KJXA 2Y9ZA 1I2BA 3KT6A 1VKNA 2JLSA 2GX6A 2RG1A 2QNBA 3C45A 3KRTA 4LV6A 3F9IA 1CQIB 4CTJA 5TPWA 3QU7A 5BY2A 5JAOA 3FTFA 1FFSA 2P30A 1OXBB 3A2LA 1DAOA 1Z7EA 1FTNA 1FDVA 1IHPA 4CF7A 1XP8A 3EH1A 2Q3LA 1L1RA 1C7JA 4O1IA 2D2IA 3STHA 4JNCA 1DFIA 1ZZEA 4BYMA 3OH8A 1DRWA 3MHPA 1FDRA 2AG5A 2EFJA 2EU8A 3E03A 3PR3A 2GN0A 1RQXA 4DLLA 2W58A 5GTDA 3JPYA 3GAAA 3W5DA 1FMTA 5DP2A 4D7AA 4JQCA 4XYBA 2ZANA 4PRKA 1SQ0A 4AJKA 1DX6A 2WSSD 5G02A 4HNGA 1N6PA 2J5BA 4GRDA 2GILA 4BLPA 4W6ZA 1Z0KA 2E87A 3TPFA 3W7AA 4RQTA 3WGLA 1QAQA 4Y18A 2C95A 4JWKA 3KQTA 3NTUA 4LN1A 3GNTA 4DGSA 3FGPA 1TUEA 3F96A 1KYQA 1TKCA 2CEKA 4IQ0A 3X1ZA 2DH5A 3M1YA 4HGYA 2V65A 3B82A 1JLLA 1IULA 3CBGA 4FCTA 4FEGA 4I4NA 4Y2XA 5J58A 4F7DA 3A4LA 4EPXA 1MX3A 3SNHA 5A9TA 5K51A 1KXZA 3WMEA 4YMIA 4A0GA 1U0SY 1ZHHA 4C7XA 5BYAA 3N70A 3HXKA 2FP4B 4F6RB 2FWIA 4ECEA 4DF3A 3KLMX 2FSVC 5F64A 5KHLB 2CD9A 1V5EA 3BK7A 4ZK2A 1P9LA 3UB2A 2FVYA 1Y8RA 2I6TA 3DFMA 2BFPA 1GADO 1UWCA 1G5IA 1ZOSA 5D87A 3HDHA 1NMYA 2VP6A 1GGHA 3DVQX 3R44A 5JFOA 1K6EA 2PPLA 4UTRA 1P3DA 5LQRA 3DSRA 1NN1A 3FCAA 3U48A 3UVEA 3DDZX 1FRFS 3MOSA 2OB2A 1AZLA 3LE8A 1P6QA 4QGAA 1TAGA 5TX7A 2XAUA 5DYIA 2HHAA 1XV5A 1KVRA 2A5LA 2NSJA 2Y0CA 3DKRA 3OQIA 1M1NB 3PC8A 1W9MA 2BMJA 2XY4A 3QI7A 1AQYA 2QL6A 3ROFA 3ZZTA 4TLLB 1TQ8A 4O2AF 3R6WA 1HDZA 3AV0B 5CA0F 4QZVA 5ITZA 5HKKA 5HKOA 2IPAB 1FF9A 2TMYA 4FYHA 4BFTA 4NJOA 1MGPA 521PA 3ER6A 5IXSA 3LK6A 1O97C 1ZOIA 3FWYA 3I6BA 1NLYA 4EQZA 4ICIA 2H5IA 1QVWA 5BN3B 3U3ZA 4GYWA 2GLTA 2YXBA 3MWGA 1YJ8A 3O38A 1HTWA 3VYTB 3VDQA 3T1TA 1N0UA 3IAS1 3TIFA 2PNJA 2A5GA 1MAVA 2YH2A 4ZOLA 3CTVA 3HWWA 3NHZA 3ECAA 1DRVA 1G8MA 3QHQA 1E3EA 1QKKA 4UDOA 4ZRDA 3GVXA 2DR3A 4ND8A 1EVYA 1W5TA 2O3QA 2GEJA 3DEJA 3KS9A 5C2JB 5GADl 3DZIA 2JFGA 2PX2A 2Y2UA 3F71A 4L0QA 4WN3A 4BFSA 4Y0NA 4FGLA 5HILA 4B5KA 1ESZA 1TTHA 4TTJA 2BGNA 4US0R 3FPCA 4GPEA 2OORA 4DIDA 1MMFB 3H2KA 2DLNA 4KQ1A 1DTWB 5KHOC 2DXIA 1LV8A 3L7YA 4X41A 4YJGB 4ZYZA 1N25A 2NUPA 4QLAA 2D7DA 2BEVB 1TE2A 2JFUA 1FRNA 2D5IA 3E5RA 1M72A 3R6TA 4XYEA 2MINB 4ZDKA 4FI3C 4UBMA 2UXBB 2RHTA 4HT3B 3WC4A 3LUHA 4CCAA 1IZZA 4PPQA 1A1SA 2DP4E 2XR1A 4CT4B 1CF9A 2W6NA 3CUUA 3QHAA 3CE6A 1D7OA 2GPBA 4KSBA 4H7HA 3T3HA 4HB4A 2VSFA 1L5QA 3OFNA 4DLRA 3SOPA 5JAUA 1K66A 3FPGA 3GLGA 3VBEA 1DQRA 5CVTA 3IUPA 2YDYA 2IOYA 2YHAA 2OL4A 3TEJA 3ORHA 3TLEA 2HW8A 1HUQA 1OYOA 2CCJA 4IDAA 1XKTA 1F6WA 2Z30A 3RS8A 5HQTA 1KZGB 3EBOA 2CWDA 3PXAA 1ODCA 4H7FA 4P5DA 2EATA 4GI3A 5AK3A 3OZBA 4JL5A 5K4GA 2XMQA 4B31A 1CQJB 5CU7A 5FBHA 1PF7E 5AESA 1KBQA 3VJRA 2PKQO 1VKJA 1EP9A 1W1IA 1EVKA 1Y82A 2J6CA 3FHCB 4LKOA 4YMTA 5HKAA 4GNKA 1ZIXA 3ZLTA 1CUUA 2ATEA 3IS3A 4A8PA 1SOWA 2Q62A 1A97A 1HE4A 3ZUGA 2H4JA 4EF4A 2B99A 1D5CA 3C5EA 2CXQA 1XTIA 1RYDA 2RC6A 4RADA 3SJ7A 3W3AA 4QASA 1EHCA 1EXNA 4ZHSA 2O4CA 2QAGA 3QEJA 1XQWA 5FORA 3UO8B 2JS7A 1R9GA 4PSUA 1X39A 2NG1A 3G9UA 1Q2XA 4D5EA 2GF0A 4ZVNA 1G64A 4QNRA 3N1UA 4TQ9A 2GHRA 2GN4A 1N0IA 5AQ1A 3BIFA 1YB1A 3VU1A 3VYVA 3U60B 2GNPA 3LDUA 4EJ2A 2GDZA 2VPQA 5CBKA 1E8NA 4BMCA 1XRMA 4WE3A 1I32A 1ZUD1 2I1WA 3EWNA 2Y9PB 3A1CA 4QREA 3RTAA 1MENA 3U7EB 4BRUA 3TTUA 5AW4A 1M34A 4DV1B 2XXAA 2WWYA 3RFUA 1W44A 3F74A 4XEHA 4H0FA 3JQQA 4C0XA 1JW9B 4OF4A 4B3MB 3EG9A 3HGTA 1FDWA 1KJIA 2Y1XA 3E1KA 1M6EX 2H3EA 3T61A 1A9PA 3CUEF 1CJUC 3U61B 3G17A 3QOXA 2JAXA 4GOLD 4MS3B 1PCXA 1Z4NA 4DCPA 3DDSA 4O8CA 4IMPA 1N2ZA 4RTPA 3UH1A 2O2ZA 4ZANA 4LF9B 5C8ZA 3AHEA 3R8CA 3ZE2B 2IOHA 2WSLA 1DC3A 1E66A 2XUDA 4K03A 4AN1A 4DTIA 4EJSC 1EAMA 1GPMA 5C5IA 3B6EA 3T1NA 1JJ7A 4ACAA 1O6GA 4MUBA 3QEAZ 5E95A 3EY9A 4MUKA 1BGVA 3VZPA 3IILA 2O2HA 4Z7NB 2F1HA 1M2VB 4MUNA 3SIXA 3W0LB 1Y1SA 4TV9B 5E9QA 1X1TA 2AZDA 1VHQA 2OYRA 2MR5A 3IV7A 4YMWA 5HQJA 5GPBA 5LCXA 1IG3A 1RM0A 2JGNA 5CJJA 3ZE8A 4EIWA 1AQNA 4BMVA 3UHPA 5KC8A 3O31A 1JH8A 1GCOA 2GTPA 4GUAA 1PHPA 3ZY3A 4RFVA 4GL2A 2O8BB 5HRCA 2NZWA 1SOMA 2QRLA 3K53A 4QECA 3MERA 3T3NA 3CNOA 2G76A 3SDSA 1HI9A 1PFVA 5F1PA 4PO1A 2CMFA 2VPXA 4NECA 3WYNA 1CUVA 4B3IA 2A5YB 4OQEA 5AKIA 4CRWB 1QR2A 1M1YE 1E18A 4IJVA 3TW4A 3M1LA 3ZCRA 2DBZA 3VR6H 4GPIB 1HGXA 2ARKA 4KOEC 4BGUA 4LF7B 4M87A 5E3JA 2VLBA 1GJRA 4PLGA 1HT3A 4RL6A 4FFNA 2WSYB 2WWXA 1F0PA 4ZOAA 2XF8A 1XF9A 4BV8A 5GVRA 1R7RA 5HJ5A 2XUHA 3TIXB 4MV3A 1IZ8A 4C07A 2ZSEA 2IIQA 3RUFA 1RPZA 2UVPB 4ZDWA 3PUWA 2IV2X 4HDRA 5HZGA 4JXZA 3MTDA 2BN4A 2CMGA 3V6LA 4YPVA 4WXMA 1PWEA 3BDAA 5JJIA 1REQA 1QF6A 1SCUA 4P35A 1TCVA 2PS9A 3ED1A 4JWTA 2B2NA 2G5CA 2YRXA 4G67A 4NBUA 5A6SB 5KMGB 5K6AA 4JSTA 3L2OB 4YUWA 3K0CA 3L1VA 4DRYA 2XDAA 2GZ2A 1A72A 1O3YA 1P2DA 3GGOA 1A3CA 1C7IA 3NNNA 1TTQB 4WZZA 2O1XA 3A4NA 4D4JA 1U8EA 4ENVA 4YDQA 3BL5A 1LPBB 3NC1C 1ATIA 4MW5A 4H31A 2EXXA 2XH8A 1VP9A 4CT5A 2MSDB 2YY6A 4O3FA 2JRCA 1XPUA 3GT3A 4FWIB 3HUDA 3VKFA 1AHHA 3HUEA 1J2UA 4QAJA 4TLBA 4RBNA 1J00A 4Y30A 4EGFA 1LSOA 2VHYA 5CVJA 1N9GA 2EFYA 2VDVE 4QJIA 4AUKA 5A5GA 4CEJA 4J91A 4BMNA 2VDQB 2EBWA 3QQPA 4HN9A 1N7HA 1P3JA 1WV1A 3WTBA 2VPTA 4NU8X 4QG3A 1YU9A 2PGNA 3B3AA 3DYIA 2PWAA 3O83A 4DQXA 4Q9AA 4TTVA 2XQVA 1T8WA 5AW9A 4BOYA 2P4QA 4FMCB 4LDAA 1VJCA 1FFGA 1GKUB 3NYRA 2VP0A 1EWRA 3TLGB 3G3EA 3B1VA 3O4VA 3EODA 4V1CB 4C7OB 4FHFA 4F46A 4YAIA 1T8RA 3URKA 2X40A 4JJ7A 3R7BA 3PQ2A 4B71A 3M1AA 3EZYA 4M86A 1U9ZA 4MB0A 1Q44A 3QXXA 1LVGA 2DFNA 1EK6A 2YWBA 3F6SA 5JHHB 5C8YB 3ASUA 4KEAA 3I2KA 3VH2A 4BWYA 1EVIA 3R7WA 1JHRA 2BFEA 2R68A 3O8DA 5KQRA 4JBIA 3QSYA 3RAEC 4FYXA 5K8LA 1BQ3A 3DAFA 4LXUA 2HF8A 1DWUA 3DNPA 3ND8A 5CVVA 1NXPA 1NYLA 4GI7A 1YK1A 4AP5A 1YA6A 2MDTA 2F48A 4PBSA 3RF7A 4C6HA 2CV1A 2B0CA 4IIFA 2JJ2A 3ZIAD 4MSUA 5BMOA 1VCIA 1Y3FE 4IY1A 4BATA 4ZRNA 3O3MB 2OCBA 3RJ5A 1MEJA 4KSYA 4B74A 2FZGA 3H4TA 4P08A 1U3FA 3LF1A 1KVQA 4TRRA 1SK9A 4L7QA 4RLHA 4NPAA 2H65A 5HF6A 4YV0A 4E5UA 3NXKA 4B6EA 2G72A 4C43A 1F8XA 1Q21A 3A04A 5L53A 4ZAVA 3JU3A 3KKQA 4GEKA 2D62A 3PJFA 3U4IA 1MFZA 4V3CA 3SM3A 4EELA 5KIAA 4EUNA 2GLUA 5K2OA 2R00C 3HL4A 2BZ1A 2UZ3A 4UEWA 4CCYB 5LZ7A 4CM4B 1DRKA 2JD1A 1G7CA 4LRYA 5THQA 1W36D 5DYYA 1EWQA 3L4EA 4OA5A 2DY0A 1KJ9A 1P8AA 2V1XA 2PG3A 1NLUA 4GSYA 2FWPA 3CT6A 2QTFA 2VHCA 2Y27A 1R6UA 1SVKA 2PRKA 3EHEA 3GEMA 3BWCA 4HYYA 4I1RA 4RK1A 4F4DA 3IEVA 3PD0A 1OXSC 3DVLA 2VXBA 1M67A 3GFFA 3MILA 4UM9D 2L17A 5DM4A 5GJCA 1I1QB 4BY9E 1YR3A 2E5WA 3D7LA 3IAUA 4B3XA 3EZNA 5TMDA 2IHYA 3NTXA 5FJIA 1AK1A 2EEPA 4M0DA 4EPTA 2R47A 1Z37A 1OOEA 5IC4A 1AG9A 2BGLA 5IVIA 2BEWA 3FDIA 4QXOA 5PGMA 4BO3A 2B8TA 1UC5B 4U1RA 5FHRA 5DN6D 5ALFA 4CM7A 2QYTA 4A3SA 1OUMA 4GE3A 3KC2A 4HWKA 1PYOA 1ZDMA 4PLVA 3TNFA 4M8NE 3KJNA 5FWYA 4A36A 1OZFA 4RY2A 3HM9A 4IRUB 3HCNA 4CN9A 3IP6A 1O87A 4MMZB 5TQ2A 4YMVA 4H60A 1JQDA 1VLMA 4R1TA 3FOBA 2PSSA 4MQ4A 1F0KA 3O91A 3R0JA 1AUXA 4PLPA 4WRRA 4WNAB 1ENPA 1XWIA 2ZUDA 1MVNA 4Y9SA 3TQQA 4UTOA 1LBIA 2C4VA 3NWEA 3KBOA 3E3AA 3MTBA 1AGPA 3ZXSA 1YUNA 2G9QA 4KDFA 5JC8A 1KH1A 1BWQA 2ZVQX 3F8TA 4RJIA 2ENUA 1IHOA 1JHQA 1OX4A 5CIQA 3N07A 2G77B 3D2BA 4ZI5A 3ZJTA 2IUFA 3FLEA 1QE0A 3A4TA 3ME5A 1UMCA 2EW8A 1JIVA 4J0HA 3V97A 4BMPB 4EMBA 5CB4B 2I62A 3NG1A 4WZAE 4FQ7A 4RV5A 4P2GA 1XD2A 1M8JA 5F9MA 5B37A 3TNYA 3U80A 3UMVA 4B7ZA 4BEJA 2WBLC 2ORIA 4L5JA 5LMCA 2P68A 3H9GA 1Q0HA 2CV2A 4BXOA 2Z5FA 3VM6A 3A6HA 2YMMA 1NF9A 1RRFA 3BXXA 4TTQA 4ZPXA 5ALMA 5J1TB 2VPWA 3HXLA 4NCBA 3AVWA 2AR7A 3IYLW 4MUMA 3QYJA 4IAOA 3UJ8A 3HUTA 3WO1A 3ENQA 3D8UA 1V1MB 1W4RA 2G67A 2X8WA 3VSDA 3A6JA 4BQQA 4M76B 2R1UA 4TUYB 2AYXA 2VJNA 4XD2A 5EIBD 5BT8A 1I8TA 3ICCA 1SU6A 4ETIA 5C81A 2FSSA 2JLZA 1JWLA 1QYVA 1WF6A 2QMOA 5M7EA 1FUKA 2QUBA 2ZUFA 1SCBA 4L85A 3TWOA 4YAFA 4LY6A 4RS3A 3WLFA 4MVJD 1TGVA 5DJ5A 1FJXA 4CF6A 4X7PA 2A4KA 2I65A 1CDZA 4GR4A 1T0UA 4HS9A 2Q0XA 4TS1A 4YV1A 3CLSC 2OLKA 2Z3WA 1CB7A 1G8AA 3BJEA 3NVMB 1J0AA 3Q3JB 4YGYA 1FNMA 1XRSB 3QPUA 4QU5A 5IN5A 2IA5A 2REBA 1NVMB 1PJZA 1B15A 4M8IA 4O08A 3WGVA 5LQKA 5D86A 3SC4A 3D54D 4BLTA 2P77A 4IRMA 1GGMA 2CW5A 1LDYA 4PX3A 4M1MA 2FF7A 3C3XA 4XWTA 2XXJA 4HDNB 5AHRA 4EHLA 2JFWA 5CTAA 4ALJA 3LO8A 4MRSA 2GEVA 3W6PA 5IABA 2UXCB 1K89A 1T2EA 1W4BA 4HWSA 4OUDB 1NPTO 1SVMA 3RVDA 4BP8A 1I9GA 1U65A 2CFRA 4JUIA 3JD2A 1S3GA 1XKQA 2P2YA 3W1VA 3HA5A 2J3MA 3O82A 1KY2A 3QVWA 4YWHA 4ZTZB 3C3JA 3ORFA 1IWOA 2X8BA 1ISMA 1HC7A 2WJ3A 3P0EA 3NKLA 5AIAA 1Z0DA 4N5NA 4C2BA 4KQHA 2QVLA 5C7YA 5ALNA 3E9EA 2IPMA 4WBNF 2CLDX 2XD9A 1CHDA 2VUTA 1X7YB 4I3GA 1Y9EA 3N9IA 4GKBA 4OP3A 1IXYA 2P4EA 2PV7A 3LPDA 1YA8A 5KWVA 4P2BA 3ANNA 3F47A 4ZAGA 4CMIB 2BW0A 5DM2A 3CCFA 2VUHB 2VT7A 3JVIA 3KV3O 4MWDA 2OPHA 4XPIA 3WJ1A 4OFBA 2XBMA 1JRLA 4IICA 3GWGA 1ZUHA 4LRTB 4XSGA 1Z2EA 1IOLA 3SBEA 4E1VA 1THTA 1O0CA 2H16A 4NOKA 2CDRA 4L3VA 4PM4A 4AWBA 1WHSB 5FUQA 1L4GA 3OIUA 3GUHA 3HWSA 1H3NA 3CRVA 5K6RA 1GGVA 4UW9A 3ZU6A 1DC6A 2F8TA 3WK8A 1CIJA 2IZ1A 2B0JA 1RM5A 1XZHA 2IXTA 3I53A 3H5WA 4FOLA 1B0ZA 3PXEA 2JH8A 1SG9A 4PG6A 3TQRA 4Q4HB 3NDBB 4JVNA 2MYPA 1OWOA 4DSUA 1COWD 1Z13A 3I9V6 4RD3A 5IYZB 2E37A 1FTQA 5CAEB 2FSVA 4TSKA 5JMOA 2J3HA 5JNUA 3JWJA 2QD5A 1YJQA 2AX3A 2YXNA 4C4AA 5CGQB 5FLKA 4BNNA 3T4XA 5T4HA 1RQGA 2IQ5A 2NACA 3QPWA 3T5MA 2PMDA 4L9RA 1RXYA 3ABQB 2YJ4A 2GJ9A 4J75A 3NHWA 3LDFA 3USZA 2RKWA 1V9LA 4NMWA 3NNSA 3RVPA 5EFOA 3BMOB 3TOCA 3KHTA 5T8KC 4RKWA 4MAFA 3ECCA 3RSHA 3D7KA 1P0PA 4AKTA 1QJ4A 4YIKA 4TN5A 5KYUA 1Y4DE 1I33A 4PVDA 4Q9IA 2ZI4A 3SDBA 1LLQA 4J90A 4RH3A 5EFZA 1Y9AA 2ZCUA 2PRZA 4DJFC 1GUZA 3INGA 1CR0A 2EKPA 1JXMA 3HB4X 4DA6A 3CVYA 3M2TA 5JTUA 1RXWA 3DLCA 4XIJA 1PEAA 1TLLA 2IEAA 4DZRA 1CZNA 2IY7A 3CLTD 3UHOA 4P33A 5C7OO 1FP4A 2VJAA 2Y4OA 2GK4A 4R6XA 1NUSA 3QG5A 4JBLA 1QZZA 1NKTA 2CC2A 2Z8XA 4Q01A 3R9WA 1G0OA 4DB2A 4WL0A 4OH7A 5BR1A 1L7XA 3ICQB 3M70A 1E0KA 2GF2A 3GFRA 4QOFA 2E85A 2H1FA 2W6IA 2WJ6A 2IITA 4WADA 2JJ1D 1I1HA 3NIDB 2H4HA 2DZDA 3KWLA 5K01A 2P1ZA 4HFNA 1AA6A 1HDYA 4GGMX 3LC7O 3DUFB 2VF4X 4CKYA 2OHVA 2QJRA 3AHHA 5A4JA 2O2XA 1T4GA 2FEAA 1G42A 3R5SA 3TQCA 4DVJA 4JI0B 3I32A 4F84A 5A4KA 2PZ8A 4YRRA 1SD1A 1Z26A 3MUEA 4UBJA 4DA4A 3ZWMA 4QJ4A 2JC3A 2DT5A 2O50A 2ZIXB 2OZVA 3TMKA 4DBZA 3LY5A 3U4GA 2L18A 1SEVA 4P53A 3NBAA 4Y2PA 1X2BA 4ZQIA 4HYTA 3W5JA 2BGKA 1IM2A 3C3WA 4B4UA 3GHYA 1YZLA 3KYCA 1OFCX 3CNLA 2C1XA 2C2HA 3RV3A 3MRXA 4HVLA 1PI3A 4CLOB 5JV5A 4HOYA 4MOWA 4RTLA 5A3SA 4RVSA 2NQ8A 2I2FA 3OVMA 5IAJA 4YLEA 2NUTA 4CQLA 5KWJA 1IEVA 2FW0A 1T5HX 1V25A 2QRPA 1DAEA 3F90A 1RZRA 4DC0A 4WKNA 2GUGA 3A3YA 3R5KA 4O4IB 2X9GA 4PC3A 4MJLA 3HSSA 2B1JA 4O4HF 4UE2A 4WVFA 1PS8A 2CUKA 1PV4A 4R7TA 2A30A 4EG0A 3SKVA 3VTZA 2O8DA 5FADA 4LTDA 4EITA 3ZPXA 2ENWA 2H59A 4GM1A 3KCNA 2FMFA 4L4XA 3OJOA 4MV0A 3CM0A 4KH0A 5LQDA 5DM70 5T5QA 3QFCA 2MMCA 2A1UA 2QBYB 3H9BA 1JYFA 1QBGA 5CFQA 5H4GA 4MGEA 1E0AA 5F1OA 2FEMA 3LQ2A 4IS3A 2ZWIA 5CK5A 5FHQA 3S2ZA 5KQGA 1Z62A 2ZRQA 1Z2PX 3G59A 1VIVA 5EQDA 2NAFA 1BWSA 2F17A 4U6QA 5FBWB 4H6VA 3UKJA 5HS4A 3PC2A 2ZB2A 3G5AA 3VR6A 4BQEA 1OI7A 4F3RA 5IFKA 1YS1X 1BDHA 1PQWA 3T5GA 2KHZA 3BIOA 3OKAA 4E7PA 7AT1A 3EGXB 1W36C 1AHNA 2I6UA 4MKIA 2YYSA 4REMA 3R7FA 2X7HA 5MN6A 2HWWA 2TRSB 3RIGA 1YAHA 3G0BA 4MDEA 4KXLA 4TYNA 4NARA 4EX7A 2OCDA 1GVNB 3F7MA 3GF4A 1PQ4A 1TW2A 1XL1A 3HJRA 4NKRA 1JHDA 4KGZA 3T5DA 3VVBA 2I2WA 1XELA 3WLQA 5IM4F 2ILVA 1LFAA 4WZAA 4PN3A 1US8A 4PNZA 3SXPA 4EI2A 3FWNA 1TMYA 1YQEA 2HXGA 2J87A 3IEXA 1O8BA 4J1SA 4MRVA 4X0EA 5BRNA 4F97A 4RKFA 2GZ1A 4L5YA 4ATNA 4JR0A 5DHUA 5EVCA 1F48A 3TKAA 1BMDA 3EC2A 5DVZA 4BVBA 4X8HA 2RGCA 4CR7A 4CTKA 1CUFA 3DMNA 4YRLA 2O9JA 4HGOA 4DJDC 5LQCA 4CCSA 2C97A 1ZWKA 3U09A 4GR5A 5EMLA 2CXUA 3A58B 3M8KA 5HHTA 1W52X 2BPOA 4ZYTA 1MC8A 3AJDA 4AJ2A 2QE7A 3AHJA 3KOZA 4EDFA 1N2GA 3RABA 1KO8A 2HWXA 3CRZA 3F5FA 3HKBA 1CY1A 5FL3A 2MTBA 3UCFA 5KTKA 3K73O 4WLFA 4IG4A 2BDEA 4EMTA 5LWQA 4EY6A 4HDSA 5DO9A 4YGXB 1W85A 1UOPA 2QT9A 4EG4A 4YV7A 1UJ4A 3C6BA 2GBLC 3L7BA 3HCCA 1T9ZA 1XYVA 3K6KA 3KTFA 4D6XA 2JKYA 3HU5A 4OXIA 1YRYE 3LBFA 5FDFA 4DV7B 5FR2A 2NU7A 3K6JA 3E9RA 4UAGA 5JALA 2QF7A 2GEUA 1SBCA 2W8BB 1JU9A 1GPNA 3EXHB 2JAQA 3OTWA 4ZVTA 4ISBA 1NOKA 4H3KB 1OHHD 3M5CA 3HR8A 4CKZA 4DSTA 2YWHA 3K1ZA 3COVA 4KLAA 2ZUCA 2HTEA 2PCJA 2VDMB 3BJZA 1MJGA 1VBMA 1X9GA 4JHLA 1B8UA 1OT3A 4J2HA 1GR0A 4KRXA 4C1NA 1W7AA 1DBWA