4D3DA

Structure of imine reductase bcsired from bacillus cereus bag3x2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
285
structure length
285
Chain Sequence
NRKSVTVIGLGPMGQAMADVFLEYGYSVTVWNRTSSKADQLVAKGAIRVSTVNEALAANELVILSLTDYNVMYSILEPVSENLFGKVLVNLSSDTPEKARKAAKWLEDRGARHITGGVQVPPSGIGKSESYTYYSGDRVVFEAHRETLEVLTSSDYRGEDPGLAMLYYQIQMDIFWTAMLSYLHALAIANANGITAEQFLPYASAMMSSLPKFVEFYTPRLDEGEHPGDVDRLAMGLASVEHVVHTTQEAGIDIALPATVLEVFRRGMKTGHASDSFTSLIEIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Activity and Stereoselectivity of Nadph-Dependent Oxidoreductases Catalysing the S-Selective Reduction of the Imine Substrate 2-Methylpyrroline.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords IMINE REDUCTASE
total genus 116
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2014-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4d3dA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d3dA01
3WG9A 1HDXA 3CE6A 3IJPA 2YHIA 2FY8A 1BGVA 4QO8A 3DZKA 3AW9A 4YCAA 3OMLA 3ZU2A 4CUJA 1OC4A 3IKVA 1VM6A 4JROA 4IDAA 4N54A 3AU9A 1EE9A 2DBZA 1C1DB 1M75A 3DMTA 5CG2A 3VVBA 4IQGA 2X1HA 2OXIA 1SCUA 4MVJI 4NG5A 4RZIA 3OJOA 1NHWA 1VJTA 1KERA 4OSPA 4CUZA 3K8ZA 4BL5A 1MC5A 3EK2A 4J7XA 3WMWA 3AWDA 3N74A 1BDBA 1I30A 1F14A 1QV6A 3N58A 1ZSVA 2YFQA 3JQ9A 2Y1FA 4NJMB 3GH3A 3ZN2A 3MJCA 3E82A 3RSHA 4B8ZA 5H83A 5KVVA 2W2KA 2GSDA 3C85A 1VPDA 4P38A 3HE3A 1XLTA 4WUVA 5A9SB 2Q45A 1NVTA 1ZSNA 2IEBA 1AHHA 4DLBA 4Z0HO 5I7FA 1QG6A 3G49A 1DOHA 4Z6KA 5KNLA 2FHSA 4O6VA 4RZHA 1R0LA 5ER9A 2OFPA 4O0LA 5ILGA 2X9NA 4J4BA 2BMAA 2X0RA 4KUGA 4D3DA 4DC0A 2PY6A 4E2ZA 2W2KB 3JCZA 2DFVA 4CMCA 1N1GA 1Z73A 3D0OA 3FCOA 3F1KA 2OOSA 1A27A 4RPLA 5JY6A 4RVDA 1LLUA 4AJJA 1GTMA 4FFNA 5ENVA 1NWHA 1V0JA 1VRWA 2SCUA 1PGPA 3I9MA 5ER6A 4CLOB 5IXSA 3HDHA 4IIUA 3I6IA 2PKQP 1N5DA 4XQCA 4BV8A 4WKGA 1I8TA 5AVOA 5U1PA 1YE3A 3UH1A 1ENYA 3LZ6A 4PLGA 2CNBA 2Y1CA 4XYGA 4EJ6A 3VTFA 1Z7EA 1I5RA 1PJQA 5HTOA 4K9DA 5G0TA 1CIVA 4OM8A 3DTTA 3JQGA 4L8VA 4IGEA 2X7HA 4DXHA 3WLEA 4E31A 3D5TA 1X0XA 3WNQA 1H5QA 5JAZA 5J23A 5CG1A 1NWCA 3HHPA 4RV9A 3HB5X 3ZHYA 1XQ6A 3JQEA 1A9ZA 3DBHB 3GHYA 1T4DA 2V6FA 4LK3A 1NFFA 4ZQHA 4I08A 3ZWNA 3U9LA 4IPTA 3HDYA 4XWYA 2PD6A 4W7IA 1D7OA 2OUIA 1I33A 1EDOA 2YY7A 3H4VA 3JD3A 2OORA 3KYCA 1VL8A 1W6UA 2Y66A 3RC2A 2NU6A 4E32A 4PLWA 3GVHA 1FDSA 4CR6A 1KS9A 4AL4A 3ULKA 3C7CB 1GUFA 1E3JA 1U3UA 4ZRNA 3NYWA 4K1LA 3ONFA 3OQBA 4RDHA 4FIZA 3H5AA 4ONEA 3KM0A 4J1QA 4XKJA 4UVGA 4BO7A 5G2OA 1EQUA 3JQFA 3EYWA 4OXKA 1NQOA 3DONA 3L4BA 3VZSA 5F1PA 9LDTA 4PCVA 1SAYA 4E5YA 4GWGA 3VZPA 1G0OA 3IQDB 3WWZA 3TPCA 1PZFA 2DBVO 1J5PA 1VI2A 2UYYA 3IJRA 2J3HA 1DPGA 4KP7A 2O2SA 4R1NA 1XQ1A 2ET6A 2GZ2A 5L4SA 4TWRA 5G4KA 3DHNA 2GN9A 4HUJA 1VJ1A 3PYLA 2VHXA 3QY9A 2A4KA 4DGSA 3GFBA 3Q9UA 1YB5A 1NPYA 3WYEA 4DMMA 5A03A 3DB2A 2DC1A 4NBUA 3LK7A 4J1TA 4LRTB 4XEHA 3TL3A 1YDWA 1CERA 4BO2A 1TVEA 2IXBA 3H9GA 2PKQO 4PLVA 1O5IA 1ARZA 1P33A 3M1LA 1B16A 3EZYA 3FNEA 4CUKA 2Q46A 2Q4EA 4PLFA 2D3TA 4ALLA 3LC2O 3O4RA 4CQLB 2V6GA 3AK4A 5JO9A 4PRLA 5COQA 3WQQA 1X0VA 3DAFA 4WOJA 5JY1A 1QLJA 3E5RA 4FFLA 1XGKA 2ZTLA 3LC7O 3WFJA 2B83A 2O4UX 3GGOA 4BB6A 1CQJA 1C0KA 2G82A 1WLYA 1JKFA 1YONA 2AG5A 2NU9A 4R01A 6LDHA 3PPIA 3GN2A 2GZ3A 1R4NA 5FF9A 3ZHZA 4ZN6A 4J2OA 4AJ4A 1KY5A 2XPCA 1LDNA 1EUZA 5AXBA 1IPEA 3UCEA 4YA6A 2D5AA 1U9JA 4I9NA 4DLAA 4M86A 4CMKA 5IZCA 3H9EO 3DZGA 3S2IA 3DFUA 4A5OA 4FCCA 2B4RO 4OGWA 3PJFA 4R51A 2JHFA 5I9LA 3PHJA 2JAPA 1HZZA 4UULA 4H7PA 5I7EA 4BKUA 1YB4A 4W9NC 3MJTA 4E33A 1LSJA 3KBOA 2VRCD 3LVFO 3PWSA 4G81A 2NU8A 3W4KA 4ESOA 1B8PA 3NJ4A 5TS3A 1WAMA 2Y1GA 1DXYA 1K2WA 5CHEA 3TZCA 3V5NA 5B4UA 5JW6A 2HJSA 3CKYA 2R00C 3F5QA 3NT4A 2VHYA 5DDIP 3I52A 3GVXA 4D46A 5MGBA 1IHYA 1PJLA 3GVIA 4CMIA 2B4QA 1K6IA 2DPGA 2VNAA 4LMRA 2EERA 4NK4A 3ZV5A 4B4WA 1PGQA 4FFPA 4J0FA 4BNLA 5HWSA 3ASVA 2A94A 2EF1A 3PVZA 4E0BA 1O94A 4K6FA 1JKJA 2RH4A 5L3ZA 2O23A 2P68A 1YQGA 2VWPA 1HYGA 2PFGA 2I9PA 3FR7A 2CUKA 4FSHA 1IUKA 2R6JA 4AJEA 1WDMA 2QX7A 4D43A 3RCBA 4IJKA 4DRYA 2ZB8A 3M2PA 3RUFA 4CMBA 4FJ1A 1IPFA 4LCEA 4BO3A 3L07A 1AHIA 2IXAA 2JCYA 2WJPA 3KZVA 5DOVA 3W8DA 2BFPA 2HMUA 4WCDA 1YQDA 2I65A 4CV1A 1P31A 2HMVA 4DUPA 4R1UA 4J6FA 1M6HA 4JQCA 4JXKA 2Q4BA 4OXYA 1PS8A 3BZUA 3RUHA 5EPOA 1LEHA 4E4YA 1GEGA 1HL3A 2YV1A 1Y8RB 3O9ZA 1EVZA 4MP3A 2AE1A 1KVUA 5BSFA 3TFOA 3NTOA 4IQ8A 4CL8A 2JFGA 3JQ6A 4EITA 4K6CA 4ITUA 3FR8A 1ONPA 2QQ5A 2GN6A 1E5QA 1P44A 2H6EA 3Q6IA 1PJBA 3BTUA 3TZQA 4FGWA 1AN9A 2Q50A 3LT2A 4ZVVA 5K6AA 3ZWYA 4YTEA 1E3WB 2Z1MA 3HSKA 3NV9A 3DBLB 2P5YA 4LSMA 4RF3A 2HK7A 1ISJA 4CM4B 1DHTA 4BMVA 4I5GA 4G2NA 4DIBA 1ENPA 3ZV4A 4R54A 3WGZA 3S2GA 1CQIA 4N5MA 5IZCC 3U4IA 2W90A 2O7SA 4U5QA 1Q2XA 1H6CA 1UDCA 3GRPA 3JQFC 3ZWOA 1NPDA 2FSVA 2ZIZA 5A9SA 2HSDA 2G1UA 1RYDA 3E03A 4MVJM 2OHXA 1SEPA 1ADBA 4HKTA 4OKIA 2NUAA 5G0VA 4B7UA 3JQAD 2CF6A 4Y6RA 4C7JA 1Z45A 2ZB3A 2ILTA 4WEOA 1I3NA 2I76A 3DOCA 3BYZA 4DYVA 2AA3A 3C7DB 4NBRA 2WEKA 4FOSA 1BHSA 2CSUA 4XIYA 4HY3A 3CH6A 3INTA 4F6LA 2EG9A 1ULUA 1LDYA 2O3UA 4JCOA 1RM3A 5IDWA 2DQ4A 2NVBA 1MX3A 2EHDA 2E37A 3UN1A 1QSGA 1SEVA 2Q49A 3LC1O 4BS9A 4D3SA 3ZW8A 3QSGA 2WYUA 2PA3A 3AUUA 1PTJA 4R3NA 4WLEA 3PQFA 3K2EA 4PN3A 1LSUA 3L77A 3PYXA 1ZIDA 5AXCA 4ZU3A 4JJGA 5DP2A 1C0LA 5JYEA 3VAZA 1Z6ZA 2O3RA 3BTVA 3AFNA 4KDEA 1V6AA 2J5KA 4HFJA 4YJHA 3DBRA 4CMAA 3GN1A 1DFHA 2YW9A 3RBXA 1EDZA 4LW8A 2OP1A 2HJRA 1NQAO 1P1IA 2GN4A 1QYDA 2X86A 4QO7A 3ZWXA 3NAQA 3A14A 3DAGA 3RIHA 3HN2A 1UP4A 4L4XA 4YJFA 2BKAA 3FHLA 5C7IO 4W9NA 4G65A 1ZNQO 5B4TA 4TRJA 3UVEA 1MGOA 3ZWVA 2C82A 3PWZA 3K5PA 2HMTA 2YQ4A 4IDBA 1H93A 3VH1A 1OZAA 3MWDB 4FPXA 1M2WA 1ISIA 1R4NB 3V1TC 3B20A 4ALMA 3SJ7A 1U28A 3Q3CA 1YL7A 1C1XB 3WGTA 3AM4A 4OIMA 5U9CA 1ZJZA 4P4NA 5KJFA 1BXGB 1ZKMA 3GAFA 2BI7A 2Q2WA 3OIGA 4YEDA 3ETEA 1QV7A 2WD8A 3I3OA 1PQPA 2PH3A 4J7CA 4ND3A 3PFWO 4QSMA 4PLHA 3D1LA 2Y1DA 3OJEA 4R5HA 3C1TA 5DBGA 3GNTA 3WJAA 3RASA 1UUFA 4FFMA 1GU7A 4BIIA 3C3XA 1VC2A 2CY0A 4HADA 2C5EA 1A4IA 4O63O 2BD0A 2G5CA 3H7AA 2IZ1A 4H15A 4BKPA 3GEMA 5CEEA 3VKUA 4BO6A 1VL0A 4NNJA 4ZQEA 3HN7A 4A0SA 4YAKA 4UVEA 4BO8A 4YJGB 3UAGA 4Z9YA 4GLOA 3RC9A 3AY6A 2WYWA 4B4VA 5BR7A 4II3A 4DIOA 2VHWA 2EIHA 2FOIA 1YQXA 3PRJA 3GY0A 3UKOA 5DZSA 4FW8A 4WE3A 1KBZA 4E2XA 4CM3A 1MV8A 3GDGA 1CDOA 3OA0A 3WQRA 4MIOA 3JD4A 5KVQA 3GR6A 4BGVA 4W99A 2YDYA 5K0ZA 3WB9A 1WMAA 3SJUA 4Y8VA 5KJ6A 3ZH2A 2X8LA 5CPFA 2NQTA 1WVGA 4PLTA 4GSKA 2AW5A 4GX1A 1LDGA 1S6YA 4EUFA 3PDJA 2WTBA 1RM0A 5T67A 1U7HA 1KOLA 1U5CA 2XOXA 3VKVA 3Q9NA 3RFVA 3R1IA 4W82A 1HEUA 1P0FA 3RROA 3NT2A 1ML3A 1PZHA 3MEQA 4F3YA 3T7EA 1UZMA 3DFZA 4TKLA 3QVOA 3QW2A 3E9QA 4KWHA 1U2GA 2PD4A 1EEHA 1O8CA 4I8XA 3EZLA 4WNCA 2IEDA 3RBZA 3NJ8A 1TT5A 1PJ2A 3MOGA 3Q1LA 2IZZA 2O50A 3KLMX 1I32A 4IMPA 1KEWA 5DN9A 2P5UA 2W2LA 1KY4A 4M1QA 1VE9A 4J0EA 5A05A 1YH3A 5DCYA 3U4CA 1KIFA 3B1JA 4E2WA 5EN4A 3U4HA 3FNGA 4U6QA 1E92A 1GV1A 1YVEI 2TMDA 4ZJUA 2X0IA 4ZQBA 1E3EA 1Y6JA 3AI3A 1R4MA 4QFCA 4XGIA 4CM9D 4WLOA 4NZ9A 1D1SA 2J5RA 2GO1A 4TRNA 5T64A 2RIRA 3LT0A 5THKA 2QG4A 2JCXA 4TRRA 2VYNA 1SB8A 2EXXA 3TWOA 3FTPA 4QTZA 2VCYA 2NTNA 3COSA 1O0SA 1YO6A 4EUHA 1ZZEA 4E30A 2V6MA 4CLRA 2ZQYA 3B1KA 1C0PA 3ENNA 1GQQA 5KVCA 2A35A 1DAPA 3DQPA 4XR9A 3ONEA 3PZRA 1SC6A 3ONDA 3O8QA 3QE3A 4WLNA 3K9QO 2CDCA 4BNXA 3CMCO 4F6CA 1WMBA 5KJCA 1EVIA 4A03A 5L40A 1DJQA 1MG0A 5TSDA 2P4QA 4FN4A 2GLXA 3ROMA 1ZK2A 2QZ9A 2ZCVA 2GUGA 4BKQA 5IN5A 4GGOA 4GVXA 3BHIA 4JBIA 4ND2A 4J90A 1YB1A 3V2HA 4IJUA 3IUSA 1GADO 2LDXA 1N8KA 3CSDA 1RWBA 1ZO8A 1R4MB 1MFPA 3JD0A 1T24A 4XX0A 4GL4A 3MJVA 2CVOA 1LSOA 2QHXA 5JDCC 4UUMA 2FP4A 1WDKA 1T4BA 3FWNA 2UUPA 3F4LA 1Y9EA 3C1AA 1DFGA 1PU2A 2AQIA 1WNTA 1PIWA 4X54A 1O9BA 4L4SA 3ZCXA 1K3TA 4LVCA 5GY7A 1SNYA 3VPSA 3QV1A 2F00A 3WXBA 1DEHA 1U8FO 3FBGA 5IF3A 2UAGA 4J2HA 3W6UA 3V8BA 3BHMA 2H1SA 3HFSA 1OMOA 5KKAA 1FDVA 1B7GO 1NNUA 4QXMA 4CODB 1ZJYA 1GL3A 5GZ1A 1NAIA 1DIHA 3KSDO 3FSRA 2GD1O 1P1RA 2GGSA 3SXPA 1EMDA 2JD1A 4DBZA 1H6BA 3QLJA 2X5JO 1Q0QA 2Q1UA 5TLSA 3ZZNA 4RLSA 3NTQA 1NYTA 3AJRA 1QP8A 2VZ8A 3OEYA 3NKLA 5A3JA 1ZFNA 5B4VA 5L53A 1SO8A 3OQ1A 1WP4A 3GQVA 3ZU3A 4WCFB 4CM6A 4RCVA 1BRMA 1P77A 1PQUA 3LF2A 2VHVA 4XR4A 1XHLA 1R66A 1XG5A 4MVJF 4NK5A 3UOGA 1NAHA 4CL3A 4EW6A 5JE8A 3VC7A 1B14A 1P1KA 2EW2A 1D3AA 3EDMA 3Q2KA 5TC4A 1J49A 4BQRA 2PGDA 3S2FA 2ZQZA 2ZJ1A 2GF2A 4TRMA 4BNTA 3H9UA 4PG5A 3LDHA 2JAHA 3ZV6A 3KEOA 1GYRA 3H6KA 1E6EA 2PZJA 4MVJA 4E5NA 2DPHA 2JFFA 1YL5A 1V8BA 1YWGO 5CAEA 3KVOA 4DL9A 2I6TA 1CYDA 4CM8A 2VHZA 3HG7A 4WNIA 1M76A 3ZU4A 3LLVA 4M87A 4RDIA 2Y05A 1Y9AA 2B35A 2X0JA 4IM7A 1F0YA 1PQWA 3SX2A 1LRKA 3ZNPA 3L4SO 1JA9A 1XU7A 4GMGA 5THQA 1EFLA 1UXGA 5CDUA 1KETA 2GRAA 4I5EA 3ITDA 1GPJA 2C54A 3AY7A 4IMRA 5KJEA 1T2EA 3OECA 2PZLA 3FRJA 3T7CA 2WYVA 3M2TA 2NTJA 4WJZA 1EE2A 1HRDA 3PJGA 4HNGA 3FPCA 4Y9DA 4XGNA 3GNQA 2YUTA 2VN8A 4KWIA 4P4LA 4A27A 4QT0A 2GZ1A 4RPKA 2RH8A 4JLWA 3VTZA 2EW8A 2BELA 5BNTA 4KUEA 4BNJA 4FJ2A 1GZ4A 5CEJA 3B70A 1W0CA 2OBNA 3ST7A 1ZEMA 3OEWA 2VRCA 2D8AA 2Q2QA 4R69A 7MDHA 1BTOA 1S7CA 2ZKLA 1A5ZA 1KVSA 4UREA 5I9NA 1KEPA 5JDCA 5DOZA 5KOIA 1GY8A 4GBJA 4DQXA 3STHA 5AXAA 4HXYA 4N5NA 1TT7A 3DC2A 2AQHA 1JDJA 1MXHA 1PS9A 1YL6A 3KO8A 3WR5A 2YQ5A 3Q11A 2OO5A 4RVUA 4PVDA 3GZNB 3DR3A 4Z0TA 2B5WA 4JBGA 4NI5A 2QW8A 3D64A 2HO5A 4PVCA 1U4OA 3E18A 4FDAA 4PG4A 4EJ0A 3MWEB 4MP8A 1Y1PA 5LDGA 3I6QA 1FK8A 3K96A 4PZCA 2GDZA 2YYYA 1F8GA 3RUEA 3KLPX 1PL7A 3IP1A 1EBFA 2C2YA 2DUUA 4I5FA 4O5OA 1ZCJA 1UZNA 4ALJA 1Q7CA 2P9GA 3K92A 3P19A 2B69A 1M67A 3E9NA 4LSWA 4N18A 3U49A 4IJWA 1NPTO 2XAAA 1QR6A 1XCBA 3W1VA 4R41A 4FFOA 1DDOA 2B5VA 1LLDA 1LRJA 4RF2A 1RKXA 1NFQA 3T4XA 1SZJG 1ZXLA 1NM5A 4BVAA 1MFZA 1B8VA 1QYVA 1ZEJA 1ZK0A 2WM3A 4AFNA 5F1KA 2FRDA 1ZSYA 1P3DA 3BMNA 3JQAB 1E7YA 3EHEA 2B36A 3SVTA 5FWNA 1KYQA 3MZ0A 5IDQA 2DLDA 1DC3A 3ZWWA 3QVWA 3UICA 3BTSA 3WQSB 4DQUA 2BFOA 1DBVO 3MJEA 4RO0A 5T6BA 5AXDA 4OH1A 3VPHA 2VUSA 3D5QA 4CLRB 2WWRA 4Q3BA 1OOEA 5G0SA 1G6KA 1PSDA 4NHEA 4RPJA 4XGKA 4BNVA 1DRWA 4GKVA 1F8FA 2D4AA 4YQZA 1W73A 4ZHSA 3TZHA 2HKIA 3PQEA 4MOWA 5A4DA 1EQ2A 1KEUA 4LISA 1ISMA 5GZ3A 2DBRA 1H0KA 2X9VA 1RM5A 2OGUA 1UP7A 3WSVA 4R1SA 4MP6A 3CTVA 2EP5A 3O38A 4S3MA 1GZ6A 1E3IA 2CF5A 3PXXA 4IINA 1FF9A 5IZ4A 5I9MA 2Y99A 5CP8A 1O95A 2Y67A 1L1FA 1WXDA 1LDBA 3F9IA 3I9LA 2D1YA 1BXZA 4QEDA 1LSSA 3Q2IA 5C7OO 1NXQA 5L7WA 3JYNA 2C0CA 1EVYA 4K28A 5I8ZA 4E5PA 5JBIA 4DPKA 2NVUA 2ZTUA 5G4KB 1SOWA 1V3VA 2VTEA 2FR0A 1B3RA 3DZFA 4EDFA 5B12A 1E6UA 4KTVE 1KVRA 3CIFA 2PTGA 3R3JA 4D45A 2VWQA 4GQAA 1YBMA 3DMYA 3I9NA 3DZJA 3ICCA 4MKXA 3JQ7A 4LMPA 5H81A 5EJ2A 4AJHA 2ZB7A 1JKIA 1B2LA 1HE3A 4L74A 2GR9A 3R3SA 3DTYA 5HRUA 4BV9A 1A7AA 1R0SA 3WS7A 2VT3A 2HK9A 4M49A 4EYEA 3BMCB 3DO5A 4GX0A 1ID1A 3MTGA 1BWSA 1H9AA 2W2LD 3RQSA 1LTHR 4I9UA 4WASA 3GPDG 4BMSA 1JU9A 3GG2A 5KCZA 4KZPA 1Y5MA 2Z95A 4PGFA 4ZICA 2X23A 5A02A 3HFGA 1NX6A 5ITWA 3WIEA 4YACA 2DM6A 3GAZA 4CPDA 4DBVO 4L4RA 1OFGA 1JWAB 1UAYA 3VZQA 3BAZA 3LT1A 2W98A 1MB4A 4GLLA 3BMQA 3BA1A 3ROQA 3H5NA 1VKNA 5JO0A 4PRKA 3WGIA 4CLDA 5G0UA 2VUTA 4J49A 3TFQA 1PWZA 1SB9A 3VPXA 4NJMA 5TX7A 1K6XA 3BIOA 3DHYA 2J3KA 4ROSA 2I5PO 1HDRA 3DBLA 1U3VA 4G5HA 3PTZA 3WTCA 3PHHA 3P7MA 3D4PA 1I2BA 3K30A 3KB6A 5JAIA 3JYOA 2AG8A 3FI9A 2NU7A 5DT9A 4H16A 3MTJA 4A26A 1T2DA 4ND5A 4A2CA 3AUAA 1ZUD1 3H3FA 4FJ0A 5JPIA 4IJVA 4OL9A 1AXGA 1P9LA 1R37A 3P2OA 4Z9XA 5GMOA 2POQX 4M8SA 5L7YA 3HDJA 4XRRA 1Y5RA 3NX4A 3IAHA 2CDAA 1VSVA 4BUCA 3BMQB 1HT0A 1MG5A 4J1SA 3GDOA 4YQYA 3F4BA 3GVCA 4M55A 3PIDA 4IXTA 3RU9A 1TLTA 4PZDA 1A71A 2BFAA 4JNKA 1N2SA 1OAAA 2PGJA 2VUUA 5A04A 4ZGWA 2DT5A 3ANLA 4QX6A 4ALKA 2ZJ0A 1CRWG 3P2YA 1C3VA 3JQCA 4MIYA 2VWHA 5A1TA 1SBYA 3C7AA 3RJ5A 1T1RA 4DC1A 3JV7A 2QYTA 1JVBA 3ZI0A 4GMFA 4XRGA 1LU9A 4NFYA 3WOHA 3AFMA 4INAA 1FDUA 5TIIA 5G0WA 4GWKA 3ZW9A 2UUOA 5L4LA 3BXXA 5C5IA 3GMSA 2HU2A 3AUSA 4WEQA 4XDZA 5B1YA 2BHLA 4M54A 1SPXA 3WMXA 4UEOA 3H5RA 2RCYA 4RJTA 4CM1A 4KDFA 1IE3A 1LQUA 2VOEA 1LRLA 2JCVA 3KHUA 4JK3A 2H9IA 1GD1O 2WSBA 4BQPA 3CZRA 4UVDA 2Z1NA 3HZZA 1YJ8A 4HFNA 2ZTMA 5I7VA 2BGKA 2G17A 3D4NA 4WECA 4HFMA 1SMKA 3QVXA 3E9MA 1TEHA 3BMNB 3JQAA 2NACA 2O3TA 1M66A 4YDRA 1ADCA 4KOAA 4DTIA 5A9RA 3PLRA 1X1EA 1HDZA 3C8MA 4AJ1A 4CLXA 1IULA 1E3LA 1A4UA 1E7WA 2HDHA 3PK0A 3PQDA 4D41A 3GDFA 5FYDA 1RM4A 1P1JA 1GPDG 3GZ4A 3RVDA 4WCFA 3DBVO 3LQFA 4GX2A 1R15A 3GEGA 2D5CA 2DTEA 3OIDA 3RFTA 4EEXA 4ZD6A 1NTOA 4EUEA 5C37A 1Y8RA 3DBRB 3DL2A 4WPGA 3AUTA 3SLGA 1GDHA 4NR0A 4PZEA 1E0DA 3E1KA 3F46A 5KTKA 2NVUB 4CQMD 2PNFA 1HSOA 4U0JA 3VPGA 1BDMA 4M89A 2I99A 4XB1A 1AE1A 1DO8A 3ENKA 3OJFA 2YZ7A 5L7TA 4YAIA 4NPCA 4OQZA 5EERA 2GASA 2HMSA 3CPSA 1I24A 5A9TA 2WE7A 4BKOA 1ZH8A 3I1JA 4ZRMA 2LDBA 3OP4A 4IS3A 3TSCA 2JL1A 1LLCA 4CM8B 1LC3A 4CV0A 4B3IA 5COAA 4BNYA 1YOVA 5EQDA 2NADA 5TJHA 5TJ9A 3CUKA 4XQEA 2C20A 3RUCA 2P9EA 3RFXA 4P8RA 3EVTA 4ILKA 2H63A 1ZK4A 1KC3A 3PYMA 3KOUA 4OAQA 4AICA 1XDWA 1T2AA 1TT5B 4PLPA 5DNAA 1XYGA 4GKBA 1EZ4A 4GH5A 2HRBA 4HNHA 4WLUA 1ORRA 1UH5A 4ZQFA 5TF4A 1FDTA 3S8MA 4QUKA 1LXCA 4NFHA 1B8UA 1Q1NA 3DWFA 3UCXA 3ZDFA 2CMDA 1R6DA 2BLLA 1JVSA 4L76A 2NVWA 3A06A 3IUPA 4DPMA 3NUGA 4DWVA 3GMDA 4FQ8A 4URFA 4CQMA 2E48A 2ZYDA 3X2EA 4CMHA 1UDAA 3OJ0A 5CDSA 1X7GA 3PGXA 4TZTA 5FI5A 4CM4A 5F5LA 3QIVA 4AVYA 1T2FA 1Q7BA 1GUZA 2EKQA 5BT9A 2AEJA 3G17A 1VJ0A 1XWFA 2GCGA 2ZB4A 5ICSA 1BW9A 3QQPA 4IQ0A 2QRLA 1I0ZA 1LNQA 3EGOA 3DOOA 1DLIA 3WBBA 4EEZA 3OBBA 4D44A 3L0DA 4XQGA 5TRTA 3ZWCA 3PJEA 4UVHA 1IZ0A 2PGLA 3I9OA 4PLCA 3AOEA 4BO0A 3GUCA 3JSAA 3ZHBA 3DOJA 1AUPA 3PWKA 1F17A 1LJ8A 2AMFA 4FBGA 4Q3EA 4W7HA 3QWFA 1B15A 2NLOA 1Y8QA 1ZK3A 4FGSA 4D3FA 1DRUA 1V3UA 4IZIA 1V3TA 4BKRA 5IN4A 1HE5A 2B0JA 3RJ9A 1IZ9A 1H94A 4FR5A 4D7AA 3JQDA 2RBEA 1N92A 2EGGA 5F1OA 1LX6A 1EBUA 4U0KA 1OC2A 4J43A 3TNLA 3TDKA 3K31A 1E6WA 4A7PA 4CM7A 4LVUA 3DXFA 3GZNA 2IZ0A 1ZMOA 4BB5A 1PJ4A 3RKUA 5LDHA 3WFIA 3ADPA 3PDUA 1U3WA 4XJSA 5DCWA 2D59A 3AOGA 4QECA 1E77A 4XQ9A 3KYDA 4O59O 3U3XA 2PKRA 3NT5A 2BFMA 2V65A 1ISGA 5DBIA 1U2DA 2FZEA 2NQ8A 5KKCA 4J16A 1R0KA 3IIEA 1J4AA 3DZBA 2NTVA 3ON5A 5TGDA 2DKNA 2JKVA 1DC5A 3H9JA 3D3WA 1I01A 1EUDA 3F3SA 3WLFA 1P74A 5H82A 4AJLA 1QRRA 3VVCA 1B3BA 4RPHA 4YJDA 5ES3A 4CM9A 1I3MA 5AOVA 1Z7BA 1JAYA 1X15A 2CZCA 2O4CA 2RHRA 4PFJA 2RAFA 3V1UA 4YAGA 3AM5A 5JAQA 2VT2A 5AQ1A 3RUIA 5K6AC 3A4VA 4L75A 4E5KA 4YPOA 2FR8A 3FF4A 2VWGA 3IS3A 4C4OA 2Y68A 1BXKA 3KETA 1WW8A 3WGYA 3SC4A 4CMGA 1QYCA 4DPLA 1SOVA 2XF8A 3TZ6A 3UHAA 4AJKA 5T57A 3ZNQA 3W8EA 1RYEA 3GG9A 5CFZA 1TA4A 4CV3A 3KUXA 1Z74A 2J8ZA 3LU1A 4XA8A 2HCTA 4FOOA 4TROA 1T1SA 1HE2A 3U5TA 1HXHA 1DIRA 1U7TA 3PP8A 5C7LO 5JS6A 3G0OA 5JAMA 3LLSA 4LRSB 3L4BC 3U4DA 3ETDA 2I66A 3WIDA 1BW9B 5L45A 5F21A 5CDTA 5HS4A 1LBEA 3K2BA 2YV3A 3NGLA 4FC6A 4RF4A 3ZWPA 1GQ2A 4BO4A 3IDSA 4E3ZA 3KTDA 5TNXA 1XR3A 3GOHA 1ADGA 5JNLA 2GNAA 2D2IA 2YV2A 1N7GA 3SEFA 4CMJA 4AJIA 1V35A 2OMEA 3VH3A 5BNIA 5EESA 4QFDA 1QLHA 1BMDA 1YBAA 4OO3A 4BGUA 3QWHA 1WDLA 2JFHA 2UV8A 3TF5A 1YS4A 3IL2A 2AE2A 1ADFA 4B3HA 3QRWA 4FC7A 1PJCA 3WTBA 1NASA 3JQ7B 3TL2A 1BG6A 3E6AA 1N9GA 5MDHA 2FPPA 2YFHA 3HADA 4RPGA 2E4AA 2GYYA 4FS3A 1WZEA 4YT5A 3AI1A 2R00A 3ROKA 3ADOA 3GC6A 2EP7A 2IDZA 1GR0A 1IOLA 3ABIA 5FFFA 1U8XX 3GGGA 3OICA 4LGVA 3KEQA 3DEYX 5ADHA 3NGXA 4GSLA 3UCFA 4KMSA 4Z9FA 4B3JA 1PJ3A 1HKUA 4EBFA 2P2SA 4JBHA 3DZIA 1ZMTA 5CEFA 2OP0A 2J6IA 4YJHB 1CETA 2QZZA 5CPBA 4CLOA 3NDIA 4IGFA 1LUAA 1N1EA 4OSOA 3TOXA 2IODA 4BNIA 1YBVA 1VL6A 1YXMA 2QYSA 2WE8A 2DAPA 1YKFA 1UZLA 5KIAA 4GVLA 3K73O 1E7SA 2Q2VA 1GCUA 1G0NA 1UAGA 3BHJA 3GEDA 4GI2A 4BNHA 2NNLD 3JQ9C 4J9VA 3AM3A 5A5FA 3D3WB 1LI4A 3GGPA 1F06A 2O3SA 1EUCA 3F1LA 4MKRA 4RVGA 4DREA 2VTDA 1U4SA 3M6IA 3RI3A 2CD9A 4YB8A 3PLNA 1IYZA 3DDNA 2X9GA 4GPD1 1I36A 2DTXA 4II2A 5G4LA 3GPIA 4QQRA 4YRDA 4Q39A 3I4FA 4NMHA 5JYDA 4YWJA 4EZBA 5CDYA 4NU5A 4J4HA 3DHEA 4F45A 5HA5A 5JMPA 2FWMX 1F12A 1Q0HA 2DU8A 3P5SA 1QXSA 3KXDA 1Q7GA 4YBZA 4MINA 4EGFA 3S1LA 5I8WA 4D0SA 2PH5A 2X6TA 4RVSA 4KTTE 5L95A 3SLKA 1HDCA 3TJRA 1WWKA 2W8ZA 1ISFA 3RC7A 4AG3A 4IXWA 4MVJD 4AJNA 4MVJP 6ADHA 1UR5A 4Q9NA 4YT8A 1DRVA 1FDWA 3I83A 3H3JA 3LSYA 5EINA 1ONNA 5ENDA 3EW7A 4XZ3A 3V2UA 2AXQA 2JHGA 2Y1EA 1BVUA 2Q1SA 1EK6A 4IS2A 1HDGO 5HBRA 1BSVA 2DBQA 1MUUA 4UVIA 4BO5A 3RBVA 3S55A 2ZCUA 3AU8A 3GHHA 2DVMA 3ASUA 1K89A 1NHGA 3H65A 4CMIB 4IZHA 1I10A 2X5OA 3QWAA 3WGHA 1VKOA 4R16A 2BGLA 1A9YA 3B6ZA 2QRKA 3WGQA 3I4CA 1GAEO 3D4OA 1H2BA 5LC1A 2X58A 3ZGYA 5JCJD 4UUPA 3UF0A 1Y81A 3GLQA 4ND4A 1GCOA 2C59A 3C24A 3VOSA 3FNHA 2OL4A 3GT0A 3G79A 1PGOA 5U4QA 1E7QA 2WD7A 4N5LA 4UUOA 3SC6A 4I9HA 4J3FA 4CR7A 4OOFA 3BTOA 2A92A 1XIVA 4NH4A 4IBOA 3WGOA 4RVFA 4U7WA 1UXJA 1PL8A 5DP1A 1J0XO 1E3SA 1DC4A 1NQ5A 1MC4A 2VZ9A 1HSZA 3PZBA 4Q3AA 1M6WA 3RKRA 3HDQA 3JQGB 1HWYA 1ZVMA 2NWQA 3KRTA 5ITVA 3BMOA 3QVTA 3V1YA 2HRZA 8LDHA 1ZXBA 3JQ8B 3L9WA 1UXHA 3EMKA 1QMGA 4GX5A 4Z3DA 3WICA 4B4UA 1NP3A 4OJNA 1DB3A 3JYQA 3ZWBA 3HQ4O 4ALIA 3L6DA 3JYLA 4NFSA 5IG2A 3DZHA 1LLQA 2PR2A 4ZQGA 2E82A 5DCUA 4YYZA 4U8GA 4J91A 3TOZA 1E1NA 4KQWA 4MVJE 4BO9A 1PWXA 5CDGA 2W4QA 5KWEA 1LDEA 1LDMA 3VZRA 2G0TA 1UP6A 2BH9A 3KYCB 1K0UA 1GYQA 4OOEA 2BI8A 3FBTA 4E13A 3JQBA 1Q0LA 3X2FA 4CQLA 4NIMA 1PX0A 3MOIA 2AQKA 3KSUA 3PGJA 3PIIA 3INGA 2GERA 1X7HA 4E12A 4BNMA 3GF4A 5BSEA 4HFRA 4PLZA 3K6JA 4JN6B 4TMFA 2QIOA 3KV3O 3OM9A 2Q1TA 2FSSA 4UEJA 3TN7A 2PLAA 5JC8A 1D1TA 1FJHA 2O3QA 4XIJA 1DJNA 1K6JA 4Z0PA 3WWYA 1DIBA 5EL0A 1GFSA 3W8FA 2FMUA 2C07A 4YJGA 4BMNA 4I1IA 2VNSA 4IIVA 2R2GA 1WPQA 4RORA 1C14A 3O8QB 3VHRA 1XA0A 2AEFA 1HDOA 1ZK1A 4OXNA 2X22A 1KEVA 4YXFA 4J1NA 1E1MA 2C7VA 2EGHA 1ZBQA 4R3WA 3PHGA 1ONOA 1E5LA 3GVPA 2G76A 3HUDA 4P22A 5T8KC 5KVSA 4B7CA 2X4GA 4PIVA 1KVQA 4BNGA 1V9LA 3EUWA 4B8WA 4HV4A 1GEEA 1AXEA 4I5DA 4B7XA 4LN1A 1Z82A 3W4IA 4UEKA 1HTBA 5KJ1A 1X14A 4PLYA 4W6ZA 1N7HA 3WGGA 1XEAA 1H2HA 1HYEA 4YJFB 1NFRA 2C7GA 4UAGA 2H5LA 2YHIB 4CLHA 1ZW1A 1UXIA 2O48X 4RGBA 4B79A 2FR1A 3I9JA 4R68A 3RAJA 3AI2A 4ID9A 4KQXA 1D4FA 4L0QA 2PZKA 3O26A 3RD5A 1QYXA 2Y0DA 2F1KA 2P91A 3FWZA 1MP0A 2Y0EA 4RLHA 1PJTA 3DBHA 4MDHA 5IAAA 3WJ7A 3IKTA 2ZYAA 1X1TA 2CDBA 3ZNNA 5DULA 2E49A 2IYOA 4DMLA 1VSUA 1JQBA 2C29D 2JD2A 1PL6A 2V7PA 1FMCA 7ADHA 3ZU5A 4YRBA 2OZPA 4B4OA 2CFCA 4BNFA 1R16A 4O1MA 2I3AA 2B37A 2BGMA 4YAEA 2WDZA 5T5QA 3EY4A 1ISHA 2GPTA 1YGYA 3GNSA 1T26A 3G3EA 4NJOA 3BMOB 3VPFA 1TB4A 1X13A 4XYMA 4L73A 5HS6A 1IY8A 1JW9B 2HLPA 2Y1OA 1EK5A 3D7LA 3NRCA 4MIEA 3LF1A 4BNNA 4CLEA 1PZEA 2J3IA 2PWZA 3WYCA 1DIAA 3ANNA 3HB4X 3OF2A 3I23A 1OBFO 5L4NA 4RF5A 5BNFA 5JLAA 3UW3A 2EWMA 4CM5A 5IDYA 3FTNA 2HK8A 4R1TA 8ADHA 3PHLA 3FNFA 3ETGA 4Y6PA 3WX0A 5L51A 5T8KA 4J9UE 1LQTA 2Y0CA 1CF2O 2ZTVA 5A3VA 1PZGA 1B26A 5IXYA 2D0IA 3PJDA 1D8AA 3DAPA 4TKMA 5EQFA 3WNVA 3HWRA 4BGEA 4XYLA 1HE4A 5TT0A 4JJFA 4E5MA 3QWIA 1TXGA 1U1IA 1LC0A 1CWUA 1PR3A 1I3LA 3RU7A 1NVGA 3GUYA 3L6EA 4FB5A 5JDIA 4ND1A 4YT2A 1YJQA 3TZKA 5K9ZA 2WD7B 2IRWA 4DVJA 4OMUA 4YT4A 2BRUA 1JN0A 4MVJH 4OQYA 1G1AA 1U5AA 4RL6A 4D42A 1I2CA 3UXYA 1A7KA 3O03A 3ANMA 1GQYA 2WMDA 3G1TA 3FPLA 1L7EA 9LDBA 2CVZA 1MXFA 3GK3A 1I2ZA 1IB6A 4WK6A 5IJZA 1QKIA 3V2GA 4E2YA 3HJAA 3H2ZA 3LYLA 5COBA 4Z3KA 4K26A 3ICPA 4ZA2A 3C1OA 5A06A 3JQBC 2C5AA 3ORFA 4NU6A 3CZMA 1E1LA 3QJ5A 4Q3DA 3B1FA 1NR1A 4TVOA 5EIOA 1HLDA 4MO2A 3FD8A 1UXKA 1PGJA 3ROPA 4A73A 3GFGA 1P1HA 3NDRA 2EKLA 3VDRA 2DUWA 2VQ3A 3WBFA 3KYBA 4NBTA 1JWBB 1HLPA 4IUYA 5JC1A 1YOVB 1QYWA 1E3WA 3U62A 2Y93A 5JDIC 3VDQA 2X0NA 3N7UA 4Q3NA 3EVNA 3IOYA 3L9XA 2AQ8A 3IMFA 4Y6SA 4JJIA 3UGKA 1C0IA 1H6AA 4S1VA 1NBOA 4WCFC 3PFFA 2V6BA 3VH4A 1DIGA 4JP3A 3VH2A 1HDYA 1Y7TA 2GN8A 4JP2A 3MJ4A 5DBFA 4KUHA 3A28A 4BNKA 1E7RA 4R5MA 2HUNA 3GRKA 4EJMA 4TZKA 5FEUA 2O2YA 1XSEA 2HQ1A 3OJLA 2VYVD 4DLLA 4JIGA 3RC1A 1DSSG 3ITKA 4BHTA 2O3JA 4P4GA 3HNPA 4MKZA 1L7DA 1BVRA 2OBYA 3RUAA 2EEZA 3AY3A 1KC1A 4R4JA 4AJPA 2AEMA 1GYPA 4PG6A 1NR7A 2NM0A 4XDYA 3U0BA 1P1FA 5JFOA 2FPIA 2AHRA 1J6UA 2TMGA 1NQTA 4MJLA 4JX8A 4CR8A 4BGIA 3I5MA 3WSWA 2YHUA 5AYVA 2JJYA 5BQFA 3JTMA 1IHXA 1LA2A 4XYEA 3JD2A 1H9BA 2RHCA 4WLFA 3W4JA 1TI7A 1O89A 5JXWA 2PD3A 3U09A 2EJWA 1R12A 2VYVA 5DF1A 3SBOA 4OKNA 3OA2A 4WGGA 1KVTA 2HAEA 4IDCA 3WYBA 1NVMB 4XD2A 4L9RA 4MVJG 5ILOA 3DMTC 1DAOA 1MLDA 3S2EA 1YDEA 3JD1A 3W6ZA 3E48A 1HZJA 4W4TA 1U3TA 4J7UA 3OSUA 4YAJA 1W8DA 2DTDA 2P4HX 2Q1WA 3R0IA 3ZNOA 3Q0EA 4DIFA 1IL0A 2CVQA 2VOJA 2NSDA 3G1UA 2BF7A 4BOYA 5I7SA 3NEPX 3E8XA 3CEAA 1CEQA 4ALNA 2YDXA 4EI2A 1K5HA 4RQTA 4RVHA 4PG8A 1P0CA 2Z5LA 3PI7A 4HBGA 5GZ6A 1JTVA 4WOKA 3I9KA 4YR9A 3LT4A 2P9CA 4YRAA 2J5QA 2PV7A 2PZMA 3TRIA 4CMEA 2YJZA 1N9GB 3ZHXA 1HETA 4LCJA 4XYBA 4OHUA 1GZ3A 3M1AA 3ZWMA 3JYPA 4HWKA 3CINA 2VZ0A 3EC7A 5JCJA 5EMHA 5TT1A 4N7RA 4AJ2A 4RQUA 4DQVA 2UDPA 1DC6A 1PEDA 4YVFA 3GA0A 1Z75A 2IYPA 1RPNA 3QHAA 3OHSX 1XU9A 5A5EA 1E1KA 4GAEA 1RJWA 1T25A 2VRBA 5TQVA 3AOEC 4U6SA 1PGNA 2FPGA 4IDFA 4IDEA 1JLLA 4NBVA 4BO1A 3PEFA 1DFIA 1E7MA 4IDDA 1PR9A 4JGBA 4IDGA 2FZWA 1ULSA 4F46A 5JCXA 1EVJA 2DFDA 2VYND 1VLLA 3IP3A 1HF3A 4TVBA 4D79A 4AJOA 5BSHA 3R6DA 1UJMA 3OFSA 1UDBA 3TQHA 4DA9A 2XXBA 3RUDA 3F47A 3QWBA 2C2XA 4Y67A 4D0RA 2ZATA 3A9WA 1C1XA 2HMWA 3H8VA 1C1DA 2NV6A 4C7KA 2EJVA 3H9QA 4FD3A 4A10A 3FN4A 4Q3CA 4OYRA 1JAXA 5FI3A 1B0AA 2Q3EA 4Y98A 1W4ZA 4GGPA 2UVDA 5B37A 5ICMA 3UFXA 4MPDA 3CMMA 5F3RA 4FFRA 3BMCA 1T2CA 3A1NA 3H2SA 5IDXA 4NBWA 3F5SA 4HP8A 1CJCA 1H6DA 1HYHA 3ZWAA 2ZK7A 3OQ6A 2E6UX 3WDSA 3OH8A 2Q99A 3QA9A 1WZIA 1I3KA 5F5NA 5BSGA 1FXSA 1DHRA 5JMWA 1XKQA 3D3EA 3KYDB 4XJTA 4PG7A 4XCVA 3T4EA 4BNWA 3JQ8A 4DYDA 2O7QA 2QRJA 4UUNA 5IFLA 4H3VA 2JD0A 1O6ZA 2J3JA 1YRLA 4R9RA 4TQGA 2I3GA 1X7DA 2XXJA 2PK3A 2EV9A 1ENOA 4HX5A 3UUWA 2IE0A 5JSFA 4NQZA 3CTMA 2EKPA 3INRA 4TSKA 4E6PA 3MCVA 1OI7A 1QORA 2B4TO 3IC5A 3NDJA 1Y8QB 3PHIA 4BNUA 3CXRA 1A72A 4WLVA 1GV0A 4XB2A 4BNZA 1AGNA 3OETA 3RWBA 1EFKA 3MJSA 4CQMB 3ZV3A 4CV2A 1BXGA 3QVSA 5HM8A 2X5KO 4CJXA 1GUYA 4E21A 4J4TA 1PJSA 4R9SA 1DLJA 2FN7A 1P45A 4IY1A 3KSZO 3QP9A 1PS0A 1ENZA 3EAGA 4NDNE 4CMEC 1XELA 2A9FA 3L6OO 2I67A 5L9AA 3E5MA 3OIFA 3NTRA 3F6YA 5C3MA 1MA0A 5LCXA 2ZYGA
chains in the Genus database with same CATH superfamily
4XIFA 1HDXA 3AP2A 4LZZA 1LJLA 3V8MA 4MA4A 2BCEA 1BGVA 1JB1A 3KB1A 4TQUS 5H9VA 1AKQA 1P29A 3GRFA 3OMLA 3LO8A 2IV2X 3WRWA 1UFRA 2WIAA 1OC4A 3IKVA 4YQFA 2A9KA 4LDNA 2ZYWX 2GHRA 1AQYA 3AU9A 4MJ3A 4B84A 4Z54A 4HAIA 2QTAA 3PNKA 2DBZA 4UXHA 5CIQA 1NU8A 4X6YA 3Q98A 1M75A 3DMTA 3EXIA 4XTRA 3FOFC 5SYAA 2P0AA 3ZKAA 2Q9AA 4LZNA 4QYMA 2OCYC 5FHRA 2OXIA 3F5DA 3ADKA 1SCUA 4NG5A 1DTWA 3G5TA 2CD7A 2Q9CA 1YOBA 4DOMA 1NHWA 1ST2A 1UQRA 1XHFA 3UMBA 1HT1E 2JC3A 4N39A 1L5GB 2ZM5A 5GM1A 4J7XA 4MWEA 5D86A 3AWDA 1WEKA 4L3WA 2JI7A 2XY4A 2MJLA 3REFA 3UEOA 3RJMA 3LWNA 1F14A 1QV6A 5C5EA 6AT1A 3TZLA 3ER9A 1LI7A 1TQ2A 1U7PA 2VCEA 1YK1A 2YFQA 3GLHB 3ZC3A 4NJMB 4F5EA 3MJCA 3TEJA 2FRDC 2IQ5A 2YXBA 3FNIA 3F3YA 3K9NA 2FSHA 2X2EA 1U0HC 1VIYA 4D4JA 4OJMX 1X1SA 3C85A 4G4SO 4KI7A 2JIZD 4AWXA 4P38A 2NUTA 4C01A 2D2XA 1JSZA 5A9SB 2HTFA 4WUVA 1QH8A 3MJFA 5AICA 1NVTA 1S3GA 4BN0A 3OOJA 3KL4A 3ACCA 4Z0HO 1QG6A 5ERGB 5J47A 3T6KA 1EWTA 2O8CB 5ILGA 2CNKA 4I4LA 5ALRA 3ZJ4A 4D3DA 2HT6A 2GK7A 2BIFA 4E2ZA 1PG2A 4JB0A 3JCZA 5CTJA 2P9HA 3KBBA 1A88A 2VDWA 4QDXA 1Z73A 2X40A 1KE1A 2QN6A 3RVMA 4OL0A 1A27A 2C5SA 3QX3A 1OGJA 4RVDA 3KPVA 1QVZA 2GUWA 5EYPA 1CUFA 4RY2A 3ONWA 4J0CA 1TCAA 1V0JA 4NULA 1E0SA 5AM4A 4G0PA 5ER6A 5CCEA 4A0RA 1QC5A 4K46A 5DNYB 3ECCA 1XNQB 3OSZA 3NVKI 1N5DA 4JCCA 4XQCA 3C8ZA 1I8TA 3FCYA 5AVOA 5I7AA 5IK2D 2G5GX 1S3SA 2AFVA 2XXAB 4RNDB 4LSGA 4DBLE 2RMKA 1SKYE 2Y1XA 3IVGA 2HLDA 2ZIFA 1AHNA 2NTYC 3HLTA 4EHJA 4FLEA 1A82A 3VTFA 1MB0A 3Q10A 1I5RA 5TMBA 4EDHA 1PJQA 4BQFA 1JEYA 4MRNA 3ORSA 4C6TB 2GX6A 5ALFA 1BOFA 1D04A 4JDPA 3R9IA 2B4KA 3A1TA 4AO7A 3JQGA 1OZGA 3LW7A 4U4AA 2BWJA 1C1YA 3L1UA 4J03A 1A8SA 2J67A 4QATA 5CFPA 5LYJB 1H5QA 5JAZA 4DT1A 2QI9F 1S8AA 4R8MA 4RV9A 4WK2B 1ZA1A 2HRDA 2PT9A 1DBSA 3HB5X 3HYSA 5KTPA 3ENVA 1J39A 8ABPA 3AXSA 2QLFA 3C3BA 1OGYA 2YINC 1Y1TA 1P62B 1RWOA 2CC2A 2NW6A 4I08A 2CLCX 3D6TB 1OI4A 4KPUB 4X7MA 3ELUA 3NDPA 2PD6A 4QPPA 1ZXXA 1CZNA 3G0DA 3ZPXA 4G1FA 1PNVA 3KU1A 2GM9A 1I33A 2WWTA 2ZT5A 3EA4A 1W6UA 2Y66A 4IAOA 2NU6A 4UARA 1LNSA 2P5SA 1R8YA 3NKFA 3VV3A 3H99A 3MINB 4WXPA 2XH8A 5I5GA 1U3UA 3ID6C 4B82A 4GP6A 3NYWA 3PQ3A 3OQPA 4TTJA 4HLQB 2PZFA 1E98A 2VKTA 3VBEA 2X6RA 3ESZA 4OJKA 2X4LA 1GNQA 1YJAA 4FYKA 4XKJA 1QF7A 5AJUA 1EQUA 3WJ2A 9GPBA 1NKTA 2J1LA 3BFKA 3CISA 3L0ZA 5DTMA 1DKQA 4Q6BA 1V8OA 3VZSA 1E2JA 9LDTA 3UHJA 4GOKA 1L4HA 2GS9A 5CXUA 2XUDA 4G1BA 1BWQA 2WJZB 1I5OA 2C0PA 1PZFA 2DBVO 3MLBA 3CTPA 4E08A 3H1EA 2JZNA 4NZZA 1DPGA 4G8CA 1JIVA 2O2SA 3ABSB 4BWFB 2NYUA 5L4SA 3PBKA 4GICA 4KL8S 5G4KA 1B8NA 2VNJA 1SXJB 2W0MA 3C8HA 1XTIA 2QVGA 4TYPA 2A84A 2CBXA 1YSCA 2PZAA 3HGMA 3N2NA 2PLFA 4X00A 3T0GA 4OLHA 3C74A 1C9NA 1NPYA 5JNTA 3LHSA 2DC1A 2LV8A 2CUNA 4ZODA 5I47A 2M32A 4C06A 4XEHA 5LQDA 4DCVA 3DT8A 2OORC 3U81A 2IXBA 1UJBA 1K2VN 4MW6A 1IOVA 4NLLA 5K6RA 1P33A 1Z2DA 4YR7A 2XMGA 5KSWB 5HZHA 4FFDA 2Q46A 3I2YX 4OLJA 3RIYA 1FNNA 3DPUA 4PYJA 1NJ5A 3S28A 1TM4E 1E4EA 2JBAA 1YE8A 3O4RA 1H85A 1UWCA 2IHVA 3QI7A 5JO9A 2A58A 3RIMA 7GPBA 3L06A 3WQQA 4XPIA 2JB9A 1KR5A 2XCOA 3E5RA 3KAKA 1FQOA 1WXXA 1E0JA 2WIFA 1Z4QA 1G64A 1UK7A 3SKYA 1QO0A 3A4LA 4GLFA 3EMDA 3WFJA 3I45A 4QEKA 3LQYA 4FHDA 1C0KA 2W2PA 4KC0A 2FN4A 4GF5A 5FOVA 3RS4A 1YONA 5BVGB 1TJ4A 3I2JA 2I8LA 2NU9A 6LDHA 3QV2A 3PPIA 1ZGCA 1W34A 2BUAA 4MPTA 4RKQA 3QUAA 4TGLA 5LBTA 3ZBQA 1J22A 4HUTA 5FP0A 4LVOA 4ZN6A 5ADUS 5DBHX 4UU7A 1L8XA 1JHZA 2A5DA 4YA6A 3TSOA 2V3VA 5LQMA 2D5AA 1V4NA 1U9JA 2IHZA 4KCGA 1CX9B 2QKYA 2G1AA 3KJQA 1QK5A 4KZKA 4QBHA 2R87A 4I2VA 1IVYA 4IMIB 4OGWA 2YYSA 3AKEA 4QXQA 1FPMA 1G5RA 2V4MA 3PHJA 2JAPA 4XW2A 1GGJA 1GTZA 4ZVQA 2VP5A 3HFJA 1YB4A 4W9NC 5ES4B 2EC5A 2PQ2A 3MJTA 5HIAA 1XLUA 3LVFO 2P40A 4HC4A 5FA6A 4DIEA 1DUIA 2BEKA 2ODAA 3A4TA 4G81A 4UKDA 5C4GB 4MDYA 4N0EA 1P2VA 4K3VA 4N3BA 1JIJA 5TS3A 3L7OA 1YVDA 2R6DA 3FUWA 4AF7A 4JU8A 4AS1A 3ZXSA 1COZA 1RWVA 2OAGA 2R00C 2IHJA 1JJFA 2VHYA 3QFSA 4O4JF 2YL2A 4D46A 3DDHA 1BMFA 4J8PA 3OQOA 4RMIA 3GVIA 3OURA 5J5AA 5FBQB 1AGXA 5FHQA 2OB2A 1WDWB 2IP1A 1DT3A 2CYCA 1SGWA 2QJFA 3P9YA 4LMRA 4QGSA 1NN0A 3G2QA 4LK2A 1SVUA 3ZV5A 3W78A 3GP5A 4DTCA 3MWKA 3HA2A 2PFSA 5CK4A 5CU7A 3ASVA 2EF1A 1L5HB 3KB2A 4B3CA 4E0BA 3IQIX 4ZZ1A 4EENA 4M8IA 1O94A 5A6SA 2RH4A 2VJMB 3IH5A 5L3ZA 3MT7A 5K8UA 2O23A 2P2NA 5C8VA 3TNFA 1Y5LA 1F51E 1ZD1A 2BPOA 4LGMA 2WD9A 4OGGA 2JGRA 2E85A 2BGTA 3G0BA 2J9XB 3DD5A 2PX8A 2Y0PA 4PGHA 2R6JA 1FSGA 3NWBA 4AJEA 1WDMA 2B9EA 4FYMA 4Z4CA 1CJSA 2QX7A 3HUEA 5C3UA 1IHPA 2HA3A 4YCLA 1B6SA 3LBFA 3IAFA 5C1PA 4KO3S 5CVJA 1ZD5A 1RBYA 4BO3A 1EP1B 1QB8A 1OQAA 1C5KA 2K6GA 4OQNA 3ZS8A 3L3BA 4X62B 3H97A 3I9V1 3TMKA 3KQKA 3D9QX 2HMUA 3VR5H 1BEZA 1E63A 4MVWA 3RVPA 4B2PA 3K8QA 4RKRA 5FPYA 2FUG1 3MCAA 4JQCA 2K7FA 4MDFA 3FPFA 2ORED 1FFAA 1K4YA 3BWEA 3RUHA 4JYZA 5DK6A 3NANA 2VDVE 1EXNA 3COYA 3AEZA 3EH2A 5DWQA 3GD5A 3VMMA 2AMJA 5TPWA 4E46A 5H9WA 4MP3A 3FVRA 2QX6A 4G5SA 2PWPA 3TR0A 3ZX5A 5BSFA 1OX4B 2W5UA 3VR2A 4D2IA 1BJKA 3ORHA 4CL8A 1I94B 1F4LA 3RB8A 4BY9E 2JH3A 3DQZA 3EQ6A 4EBBA 1EGQA 2FSFA 2D8MA 2JZCA 3MCUA 4GXTA 2H6EA 1PJBA 2NO7A 3TPFA 3TZQA 5LYJF 1AN9A 2Q50A 2XZTA 4R1MA 1R0XA 2MINB 4KN5A 1AQ6A 4NCKA 3O47A 1LQ2A 3GLIE 1IH8A 1E9SA 1XTZA 2P5YA 5IKPA 1T9AA 2HK7A 2EZ9A 1NBEA 2R4TA 4CM4B 5D7NA 4YMVA 3V33A 3HTXA 4I5GA 2G40A 2XMCA 1G3IA 1FYDA 1NX9A 4X90A 3W05A 3ZGVA 2O5RA 1BX1A 5BWMA 1X9HA 3FPBA 3OOEA 3F98A 3I73A 3GB9A 4ZAVA 2E4UA 3QA3E 2O7SA 3DDWA 2C5FA 4U5QA 1H6CA 2FZ5A 3CNOA 3ZWOA 1NPDA 2ZIZA 4CTKA 3IBFA 4RS4A 3BORA 4A0QA 1RYDA 3LX8A 2CCGA 4JL8A 4MVJM 4Y2SA 4JJ7A 5D3MA 2EATA 2QP4A 1BHO1 3DV0A 2QTVB 5JASA 4RMJA 4ENUA 4KHZA 2ZYHA 2Q0HA 2XGOA 5G0VA 3JQAD 2CF6A 4TQAA 4C7JA 5MN6A 4WEOA 2DT8A 1I3NA 1G4HA 1Z37A 5D87A 3WBJA 2AA3A 1ZNYA 5HX7A 1Q6ZA 3CKMA 3OTHA 2NPFA 1ZRNA 3WV4A 3E9ZA 1U2PA 1CHDA 2GPWA 4F6LA 2VVTA 5HIIA 1DBWA 2FPPB 5DDIP 2EG9A 4IH9A 2MCFA 2X0EA 3SQLA 4M9ZA 4BE7B 3SWWA 1LDYA 1GGNA 3L8GA 1YIDA 1XXLA 3D8UA 4MYRA 2OV1A 1OFHA 3EUFA 3MTIA 3P20A 3VR3A 2E37A 3LVRE 3RT1A 3UN1A 1SEVA 2PGIA 2CFTA 3WP1B 2HDNB 2ZIAA 3ZW8A 2QT9A 3RS2A 2WYUA 3QEOA 3WYFA 3SAJA 3B85A 2IU6A 3K2EA 1A2KC 3LQRA 4PN3A 3LDAA 3AGQA 1LSUA 4NXNB 4UBJA 2JJ2D 3I30X 1ZIDA 5AXCA 5AW6A 3MAAC 5ICCA 2YNMC 1F48A 3CX7A 3QNMA 3UT5A 1OI2A 2VF4X 3BK7A 4I55B 2WP0A 4ZJPA 3H75A 2O3RA 3T95A 5HGXA 2VP9A 1XJQA 2EBUA 2GWRA 2QRQA 1U8AA 1Q95A 4KDEA 4OGFA 2PIAA 1V6AA 3IUEA 4HB0A 4D8UA 3GN1A 3R77A 4M1OA 3W3AD 1N0UA 3P1JA 3KHSA 2I6XA 3BCHA 2HJRA 3DQQA 2YYZA 3LUGA 4G1MB 2GN4A 1TZCA 2VK4A 4OBBA 2QT1A 2JJ1D 1QGED 3OFJA 4G37A 3KQMA 3DAGA 1KO7A 3O84A 4LG1A 1CF9A 3HN2A 1WKVA 1U65A 2XCSB 1RRMA 3MCWA 4FN5A 1A1VA 3N53A 3JASB 2YZ2A 2HJHA 1J00A 1KI7A 3F49S 3MGAA 3N0WA 3NHBA 3TTTA 1J1IA 2DPXA 1EM8B 1DBQA 1Z2EA 3BF7A 3ZH9B 5EVJA 5CDFA 3BIJA 1YVRA 4TRJA 4DXDA 1MGOA 2BZ1A 3QENA 4HYYA 3C48A 5KI6A 4LEIA 4PZLA 3ZWQA 2ZJFA 3K5PA 1SCIA 1CE8A 5TEVA 5HKKD 3AV3A 1MOPA 3C5EA 5F1YA 3C43A 5IWAB 4CKWB 2H29A 5ALNA 4TTPA 2YNMA 3K94A 1OFVA 4KFRA 4TLCA 3VGJA 3BILA 1U3DA 1B0UA 5K3DA 5C1OA 1W2GA 2YIJA 4XB6B 4YUXA 5AVUA 4LOJA 1GLVA 4JY7A 2P1RA 5DN6A 5U9CA 5L6LB 1A1SA 5KJFA 3LWDA 4R8VA 3LTNC 3HUTA 3LOQA 2QM8A 1Z56C 4C6RA 4RTNA 1Y80A 2R3SA 4Q1CA 3RWOA 4AI6A 4S1OA 4YEDA 2OGWA 1KDYA 3HJFA 1M2EA 1W4BA 2PH3A 4ND3A 4LYAA 5L3SB 5IJ9A 3HJHA 5SV2A 1T2VA 1EFVB 1Q15A 4N9WA 4R5HA 2ID9A 4L5IA 1S1CA 3GNTA 3SSOA 5FXMA 4JVLA 3MXTA 4HT3B 4FFMA 3SBEA 4F4DA 4H7IA 4BC1A 2OO7A 1PUIA 5FA5A 4DCNA 4BIIA 2OCBA 5BN1A 4X44A 1Z5OA 3L7IA 1JNYA 1J5XA 4HADA 4CW7A 3H7AA 4H15A 2IZ1A 1JB9A 3F74A 3GEMA 3E5NA 4CFZA 2OHIA 2YOGA 4QOGA 1Z16A 3FX2A 3HYTA 3GJ8A 4KH0A 1VL0A 3QHQA 3R3HA 4ZQEA 3HN7A 4A0SA 4C4YA 2OV8A 2JBHA 5JAHA 1X8JA 4EHBA 5MFPA 3TLCA 5HQ3A 3H7IA 1Y6QA 3AY6A 3R5JA 4YJ3A 3HZHA 5BR7A 1GGVA 4CKEB 2WJWA 2EIHA 1IN8A 1YQXA 1WZ2A 1JWLA 5DZSA 2HHAA 4FW8A 3VU3A 4B3GA 1KBZA 2O9JA 4HGZA 1EIZA 3KFLA 4TMTA 4EECA 3OLVA 3OA0A 3JD4A 4PF1A 5KVQA 2EQ5A 4TV9F 2CUTA 4H59A 1HY3A 2YDYA 1C9JA 3MYYA 1Y1SA 2HM7A 2QN8A 5DIZA 3X1MA 3PDCA 2IBTA 4QARA 4TVKA 3A6ZA 4MYHA 1F9AA 4Y8VA 1ZHOA 1HG0A 3MGGA 4GSKA 4LDZA 3Q5DA 4DT1B 4GX1A 1LDGA 1GWNA 1S6YA 1ZAKA 2AK2A 3PDJA 2N46A 4CEJA 3EBLA 2IXGA 3GQBA 2Q21A 1KOLA 4BVGA 3T7AA 5D2CA 4KKXB 4FWIB 3Q9NA 4UUBA 3DSRA 5CB4A 2UVPB 5B7NA 2V7QA 4DA0A 1Q3TA 3RROA 3GJTA 4PCAA 1ML3A 2WTNA 1LPOA 4MEAA 3M8KA 1XCOA 5CCXA 1HNWB 3R09A 3DFZA 5LBIA 1RDFA 3UWDA 4FDTA 1NZFA 1FJGB 1CIPA 1T1EA 1EEHA 1O8CA 1QRAA 4I8XA 4NV3A 5IBCA 1RXUA 2WUWE 3MOGA 2FUKA 1YBFA 3Q1LA 5HKBA 2IZZA 3KLMX 1J7KA 3P52A 5DN9A 2IIBA 2P5UA 1E8DA 3I01M 4M1QA 1HMYA 4EFNA 2LCIA 2QSUA 2OWDA 5A4JA 1S2MA 4IOMA 3ZXXA 4Z4QA 3AVWA 2HPVA 5EN4A 4UQOA 5I01A 1Z28A 1E92A 1Z2AA 3DNPA 3AHEA 3T9DA 4LWOA 2ZTSA 1DARA 4QGBA 5B2FA 4F84A 4C7OA 2WYHA 3DNMA 5B6IA 2VHCA 1FZTA 1DAFA 2X0IA 1T0PA 1JZTA 3A9SA 4N82A 3DEAA 3V4SA 3AI3A 4WQMA 5FO1A 4LFCB 4EL5A 5L3QA 5IH3A 3ECSA 2J5RA 3VI3B 2GO1A 3KVYA 4P36A 1NTRA 1Z3IX 4TRNA 3WGLA 1F0NA 2FW0A 1J25A 1KKUA 2YC2C 5DSXA 5THKA 1ISPA 1FU4A 2HA6A 3VGPA 1KI6A 2FSPA 3GMIA 3WK7A 5KYWA 1SB8A 3ZBUA 4CIDA 4ZV7A 2JIBA 1O0SA 4Z7NB 3VO8A 5HVNA 4AIIA 1C0PA 1Y8CA 1D9XA 2ONZA 4INPA 1P9RA 2VPPA 4MRSA 5LXTF 4DG8A 2A35A 3EEIA 1O97D 3ONEA 1M2VA 2GM3A 3ONDA 3PZRA 3O8QA 1FFCA 2RB4A 3TX6A 1XT6A 2CDCA 1F3LA 4BNXA 2CLKB 3Q5EA 4AMZA 4ZEMA 1Y6FA 4ZOLB 4B6OA 4HVCA 2J3MA 2VBCA 2CLHB 3KT3A 4Q4AA 4JUDX 3MNFA 4BIMA 4MROA 5T3YA 1KPHA 2GLXA 1M6VB 1ZK2A 2QZ9A 3NAMA 4MCAA 5BQXA 2WAXA 3UYLA 4D92A 4QE3A 4J0QA 2A9RA 3PTLA 3G02A 4ND2A 5CBKA 4KR6A 2WAOA 3IUNA 4DUGD 3V2HA 4FDMA 5BUSA 3W5UA 1G8PA 4D4GA 1G291 4BMCA 2ZJ3A 4NG4A 2VTBA 3JD0A 3ZDEA 1JDBC 3T4UA 1TCVA 4D8WA 2ZWVA 4GL4A 5JDCC 2AFIB 3EFEA 3FZQA 1U1EA 2HSZA 1WDKA 3FVTA 1T4BA 1ATZA 1NRWA 3TBFA 1OV4A 3I0ZA 4LOKA 3GEHA 4GYWA 2UZ3A 2AQIA 1L3BA 3G2HA 2E89A 3E84A 4LVCA 1P39A 2C04A 4WXRA 1PX2A 1U7DA 5GY7A 4ER5A 5KX5F 5C46F 2HSGA 3QV1A 3HV0A 5CH5A 5AP9A 3WXBA 1FBTA 1PJZA 1KFBB 1M2NA 1U8FO 2JGKA 5IF3A 5JXIA 4L4UA 2UAGA 4CIBA 4J2HA 4YHBA 3W6UA 5BR4A 4L9AA 4B09A 5JS8A 3HFSA 3TD2A 2AH5A 2CUZA 3ZGOA 1EDBA 1B7GO 5EZYF 5J4YA 2VATA 3ITEA 3NTVA 5EC8A 1RQPA 1JKJB 4ARAA 1DIHA 1C9EA 1JKMA 2YHAA 4M9XA 4YCDA 4C7BA 3EC2A 2ONYA 4H31A 3DCNA 1DX9A 1RMYA 5ARDA 5FL3A 1H2RS 2EQBA 3CNHA 4OH7A 3GFFA 3QBJA 4C0LA 4FMBB 5IC6A 5EPEA 2X5JO 5TLSA 2Q1UA 2XCQA 1JEEA 4RLSA 1Z6YA 3C3WA 3KJEA 3M83A 3DWEX 2FWBA 5ALTA 4TN5A 1GTJ1 2ZVQX 2VZ8A 3AJRA 3OEYA 2L2QA 4AURA 2AXEA 2XRFA 1MVLA 4HMOA 4IQ4A 3OEHD 3GA7A 4B46A 1M1YE 3OQ1A 3F0TA 4WCFB 3V32A 1EJBA 3TXXA 5L6MB 5IHXA 5LFAA 3LF2A 2OZLA 4R8RA 4NK5A 3TS1A 2Z2XA 4E1AA 3UOGA 2QLNA 2WPDD 4Y9TA 4EW6A 5JE8A 3VC7A 1B14A 3VR4D 1P1KA 4URWR 1KJ8A 2AW3A 2VPQA 5IULC 3WVNA 4Q12A 2MMGA 3Q2KA 1KQNA 4TWIA 1RFLA 3FOAA 5ELLA 2DHQA 5HSGA 4BQRA 2PGDA 2FXVA 4E5UA 1U11A 2GF2A 1RIFA 4NCIA 4BNTA 3D6AA 3MVEA 4KQ1A 4RACA 2ZUCA 3ZCSA 4K86A 1ZH4A 3QXJA 4F12A 1GYRA 5G53C 3T5MA 1OH8A 4TLAA 3FSGD 3VNSA 5AVZA 1TRKA 2A0YA 3GBVA 2P6UA 1SUIA 4YRSA 1G5HA 1V8BA 1YWGO 4L51A 3KVOA 5CAEA 1CYDA 1NVKA 2G9RA 1F1BA 1RVV1 3NBMA 4WNIA 4C89A 1I13A 2HF7A 3PQ4A 4RDIA 2Y05A 1WHSA 1Y9AA 4NU0A 3HRKA 10MHA 4JJKA 2X0JA 5F2EA 1O6BA 3V7YA 1EM8A 2VH1A 1LFDB 4B6FA 1JT9A 1XU7A 4ICIA 4MHTA 1BQ4A 1NSFA 4U3JA 1AQLA 2I1QA 4I5EA 3WAKA 1GRVA 1FUIA 1SG0A 1V5WA 1E6LA 1MAUA 1O57A 1GPJA 2FPRA 3AY7A 1X7XB 1L1QA 2ZRJA 3FDJA 4IRXA 1MJ5A 2PZLA 3FRJA 3T7CA 2I33A 1E79A 2P41A 3FSJX 4CF5A 3MTBA 1EE2A 1HRDA 1WSWA 3PJGA 1T9CA 2QD3A 4V03A 3WLOA 4B2IA 2VEDA 5PGMA 2R8BA 3IO3A 2VN8A 3QKWA 4WZAA 1LWNA 3FOBA 3H5VA 4BQEA 2GZ1A 4F4IA 4MR8B 1GFIA 4JLWA 3VTZA 2EW8A 3OG9A 2H1IA 3PSHA 4MQ4A 1MVOA 2QLTA 4JYBA 4FJ2A 4PZUA 4UBOA 3AVPA 4GUDA 4DXAA 1RD4A 1W0CA 3NVAA 4JEIA 4NZNA 4C3UA 1J8VA 2VRCA 1TZJA 2G0NA 1RRGA 3GX1A 2ZKLA 3IUMA 1YS1X 3RF6A 2QG6A 1Z34A 4K2AA 1KEPA 5IX8A 4H17A 5DOZA 1FS5A 4LQ4A 2OYSA 4DQXA 5JDCA 1ZOLA 4EHDA 3LBAA 1ZZGA 2CE7A 1VSQA 4BLSA 5L8VA 2GH1A 3OUTA 3IT2A 1MXHA 1PS9A 3T7SA 1YL6A 5DVZA 4BYGA 4BEBA 3EOBI 5KNBA 4PVDA 1J9ZA 1E3TA 1JEQA 2R6FA 4UDYX 3PUJA 1CUVA 4Z0TA 4EG6A 3UAYA 2XWQA 4PVCA 4K6KA 3E18A 1J24A 5EP4A 3SFTA 1GTSA 3T1NA 3OQJA 1EDDA 2BV3A 4PPGA 4U7PB 3V2IA 1RKBA 5AT1A 1Y1PA 2PUJA 5KU7A 2A14A 4XJVA 4BU1A 1II9A 2C5BA 3IGFA 3AL0C 5IT0A 3K96A 4PZCA 3QU5A 3ZTWA 2QAGC 3H4IA 3KU4A 3T52A 1JFLA 3R5HA 4KN8A 1EBFA 2DUUA 4O5OA 4X7PA 3FA2A 1XO1A 4YRCA 4HDOB 2OBLA 1XZ8A 2ZAGA 3A31A 2CLEB 1SQFA 3IQGX 3LQ2A 3E9NA 3IEIA 3TLGB 3QF4B 3WLIA 2ZZNA 1QR6A 2ZJBA 3EIQA 5JI3E 1DDOA 1GPKA 3HVJA 4OQLA 1Z4MA 1RKXA 1Y4UA 4C3ZA 2E55A 4LE1A 4CKEA 2OC4A 1I4TD 5CT8A 1NW7A 5ESRA 2OSBA 2I4RA 4D82A 3ASZA 1PI3A 2WWWA 2IELA 1ZSYA 1D4AA 1JA1A 1KYQA 3DTNA 3HU3A 3BGWA 3MZ0A 5DTIA 1M2OB 2WZCA 4RSGA 1SUEA 3ZWWA 1R6AA 1UMBB 3UICA 4Q4HA 4ZI3A 2I2XB 2BFOA 1JHYA 4QRDA 4RO0A 5T6BA 4NFLA 4CLRB 2O1EA 5D01A 4OMDA 4C4TA 1V7QA 1VYVA 3M6UA 3JARB 2REQA 1PSDA 2FJPA 4PZAA 2C78A 4XGKA 4GU5A 2Z0MA 2P6RA 4MKFA 3IMEA 4YQZA 3T9EA 1W73A 2Q6IA 3T35A 3TJZA 1Q74A 1ZDMA 1J42A 2M98A 3PQEA 3MERA 4MOWA 4B80A 2DQZA 4JYPA 5GV8A 3GLFA 3W04A 1IN5A 3MWDA 1S8FA 4WKBA 1ISMA 1EVQA 1ZA2A 1OY1A 1VJRA 3K70C 3O3CA 3E4CA 2KS6A 3PXBA 1IY1A 1RXYA 2CFSA 1H0KA 2X9VA 1G5QA 2OGUA 1IEQA 1OFUX 1GNTA 4MYCA 5B57C 1W88B 5CGZA 4GL2A 2OK7A 1EFRD 2OM6A 2X42A 3O38A 4KO4S 1GZ6A 2PRZA 2Q5EA 1X86B 3UHPA 2NZXA 2YWRA 3QUBA 1YMVA 5IZ4A 4Q03A 1U0SY 4AXXA 2FPIB 1L1FA 4JC8A 2ECKA 3ZEAA 2XUJA 5LXTA 2PX3A 4QIHA 4HAZA 1D2AA 2P8JA 3I9LA 2RHTA 4KE9A 4Y2RA 4JBWA 4NOLA 4BTVA 4EI8A 3AB3A 3ZIAA 5TPWB 4DR4B 3DW3X 3PB3A 3O8LA 4XUGB 4MPJA 1E1QD 4DWVA 1EVYA 4K28A 2IE8A 4JD5A 5LLSA 3SQDA 2D0OB 4HGRA 4KBYA 5EWMA 5K3FA 1B6TA 3EOZA 4E5PA 4LF7B 5AW5A 2K2WA 1V3VA 3GOQA 1B3RA 4N4AA 5B12A 3G8YA 1E6UA 2HNBA 1KVRA 3CIFA 4HH3C 4DMUB 2FXIA 4G89A 4D45A 2EP8A 2CJWB 2C9DA 1GCGA 2Z58A 4Q4JB 1YBMA 1Z3CA 2PUDA 4CIAA 2WSIA 1QNFA 2AT1A 4N3GA 1SM4A 4HDQB 2YWXA 3RRXA 4WKOA 2O2IA 1HE3A 2G6BA 4PSDA 1A3CA 4L74A 4EJ2A 2BN4A 4IIXA 5DHUA 3TZBA 2DR3A 2ZE6A 1YCFA 4A16A 4R83A 2BFEA 4KLZA 2VT3A 2JNWA 2OYRA 4M37A 4TWAA 1ID1A 4X8HA 3HC7A 5AVVA 4HGOA 2QSJA 4YMTA 1FEZA 3GPDG 4QPZA 4MV3A 4HX2A 4R7TA 2QTHA 4OK3A 2D74A 2F1JA 2X23A 4JEMA 2J3QA 3OJWA 4JXJA 3HFGA 3WLKX 1NX6A 3CM0A 4DILA 5FWYA 5ITWA 2DFNA 4OHMA 2ORVA 3WHIA 5C52B 1ZG3A 3UO8B 3GAZA 1T29A 4UNRA 3ITNA 5KOJA 1J21A 1FU7A 2ASEA 2UZ0A 2ZKIA 4QRIA 2LIPA 4KBFA 5DM2A 2CJPA 3LT1A 2Q6TA 4AS3A 3ZDAA 1IUPA 3BMQA 4PQYA 3BA1A 3EFBA 1YC2A 2ETXA 3BS4A 1GVHA 2IJGX 3MOSA 3DDCA 5JO0A 3TR5A 5G0UA 5ISMA 3F73A 2QZ4A 4LY6A 4AG5A 4HNVA 1BAPA 2QJOA 4RC9A 1ORIA 1K6XA 3TW8A 1D2CA 3A6GA 4AZ0A 3GLHA 1L8AA 3B1VA 5J1SB 1TEVA 4ROSA 3FWHA 2I5PO 1HDRA 4O4IA 3DBLA 5FOTA 2P79A 3QBDA 3PTZA 2C7BA 2GXQA 1C30B 3L8HA 3WTCA 5BSKA 3P7MA 3R3UA 4ZZ3A 3D4PA 1N8SA 3JYOA 3L7CA 2AG8A 1HGXA 3SJCA 2FEWB 1XTQA 4GD3Q 3MTJA 4H16A 1W4RA 2C03A 2RGXA 3HEMA 3QXHA 3TL6A 4MTLA 3OZWA 5JD4A 4KR3A 4JQOA 5LJIA 4G0OA 4JUFA 4FJ0A 2FPGB 2GEJA 3BUSA 2W48A 5CFRA 2VNKA 3DMHA 3QI2A 2NU8B 3UZUA 4A8JB 4QTYA 5J40A 1XRMA 3P2OA 1IWOA 4ZT4A 5GMOA 3V8VA 2POQX 3OWOA 4TYQA 3QNUA 4M83A 4F7WA 3Q7EA 4RZQA 3U3JA 1G8GA 1CJBA 3TO5A 1FX1A 3FF1A 3T94A 1QHNA 2J9RA 1YR8A 3E8MA 4JZKA 1Q16A 3GDOA 4YQYA 1SC4A 2J9FA 3ZTTA 3ENWA 3RRNA 3JVVA 1MAAA 3BE5A 4UHHA 3ROTA 2Z8YA 3K9BA 1LF5A 1X87A 4UD2A 1IK4A 1N2SA 1Y8ZA 3GJ0A 3EPRA 4EKIA 5A04A 4ZGWA 3A10A 4XVHA 4JBYA 1G5PA 2PU7A 3ANLA 4ALKA 1QGUA 1OXKB 1U9IC 2OCDA 3QPCA 5I9SA 2RG1A 2I4MA 3CONA 4RKYA 4DLWA 1XKXA 1FIUA 2CNDA 2J9GA 2RKBA 5A1TA 2J7PA 4PNZA 1GA4A 1T1RA 3ASYA 3P2MA 4NDAA 4WOBA 1C29B 4US2R 1JVBA 3WLPA 5IJ9B 4ZIRA 4EPWA 2Y9ZA 1R18A 3KNZA 4OEHA 3SS9X 2PGNA 4INAA 1MGPA 1S2GA 1ZUNB 4Q47A 4Z1OA 2XRZA 3PI6A 4UBLA 2FFQA 2UUOA 5FNVF 3U7IA 1ICEA 3ZI4A 2HU2A 4XDZA 2JFNA 3WZMA 2BHLA 2LXNA 4ZJZA 4GRAA 4QWMA 2O2EA 3H5RA 1SBNE 3IV9A 4H7KA 4EQ6B 5LDDC 3DAHA 2I80A 3M6XA 2RE8A 4Q7MB 4KDFA 1IE3A 2ZR0A 2ZRFA 3DOUA 3ZVMA 3AVVA 2H9IA 2WWYA 4KFCA 3QPDA 2QORA 3DE1X 3VTKA 3RG2A 2G08A 2MR6A 3Q15C 4BQPA 1WUTA 4DCMA 8AT1A 1YJ8A 4HFNA 1F7VA 2I1VB 2ZTMA 2BGKA 2PZBA 4DWOA 1ADYA 4WECA 4HFMA 4Y0AA 3H8SA 1WNFA 4RE5A 4KVZA 4EFMA 2PPLA 3JQAA 3DBOB 1JXOA 4OCZA 2BSAA 2NACA 3R7NA 3M4XA 5C34B 2O3TA 3HXLA 2B8WA 4C2AA 1ADCA 1VXRA 4DTIA 4EARA 4NCBA 5C8YB 3PLRA 1X1EA 3VOBA 4AJ1A 3LBIA 4CTJA 5KMGB 3C6KA 1YR3A 1C4WA 4G6ZA 2HDHA 3K0CA 3LNTA 3PK0A 3NHSA 2QJRA 2ZT8A 1TIKA 2C4VA 3K0FB 1TJ5A 2HGZA 4JNCA 4U1RA 3ZLBA 3VU0A 3U6BA 3ZIDA 3GZ4A 3RVDA 4CF4A 2AUNA 1N3IA 3G2MA 1N3YA 2W9XA 5KQRA 3QOFA 4IR7A 3K0AB 4PE5B 1Y8RA 4IRUB 4WPGA 4FWTA 1OLUA 3AUTA 3SLGA 3QXXA 4BCDA 2H2GA 4Z86A 4TYNA 2FMFA 5EQJB 2XD9A 1MEEA 5CA0B 3UIEA 2GPJA 4H27A 4NESA 4OA5A 4JU9A 5BWCA 3BRSA 4K05A 1PYOA 2NVUB 4CQMD 4EUSA 5KTKA 2PNFA 1ODCA 3U3OA 1RSZA 1XPUA 1MDBA 1HFWA 4QDJA 2XGMA 1SCNE 2NUBA 1BMFD 1EGVB 4CVNA 4M89A 4B5KA 1AF4A 1EZ1A 2HQBA 4XASA 4I99A 2J59A 1U7WA 3QEKA 4AJ9A 3K20A 2GASA 1G19A 2ANCA 2HMSA 1MTOA 1T43A 4BKOA 4JL6A 1ZH8A 5BQ3A 3HWX1 4ZRMA 4IS3A 5KHAA 2NO1A 3CVUA 3SYKA 2DFKB 1Z13A 121PA 1YOVA 1WCXA 3K0HA 4MS3B 4Z8XA 5TJHA 3G7UA 5TJ9A 1H0SA 5JWOA 3KQYA 2Z56A 3RUCA 2PR7A 2CMHA 2TECE 1EK2A 2W6OA 4ILKA 5KYYA 3BH0A 4WH0A 3BJEA 3ELBA 4PYIA 4OAQA 1TMOA 3KTAA 4G1UC 4TOIA 4ZU1X 2JLYA 4EG1A 1HQDA 5JJIA 1T2AA 4LV8B 5DNAA 1XYGA 2BDTA 1NMYA 2OLEA 3RNLA 4GH5A 3QYJA 4MUBA 1C4KA 4HGYA 4U2FA 5JAPA 3CURA 4L7VA 3A11A 4BPBA 1A2QA 3PUHA 1Q1NA 3DWFA 3ZDFA 1CUUA 3PGVA 4A1OA 2WTUA 2CMDA 4DUGA 4PAQA 2OXFA 3WQBA 3T1HB 4PNHA 1Y4ZA 1QHSA 3A06A 4DPMA 2VXBA 4RJJA 4P2GA 3VQTA 3GMDA 1OV6A 1HQYE 4O4JB 2ZYDA 1RPJA 1DQSA 3A1VA 1UDAA 2XADA 2AJDA 3Q7IA 1T3TA 4IKOA 4ND6A 3HKCB 3UOWA 4A2QA 4DV4B 5ALKA 1X7GA 5FI5A 1P1BA 5HF6A 3O8BA 4LQCA 4CM4A 4QBKA 2H7CA 4IFBA 2BCGY 1XDGA 1VIVA 1VJ0A 3MB5A 1BFKA 5ICSA 3QQPA 4GDFA 2NTEA 1ODKA 3S8YA 2QRLA 2XDYA 1A2OA 1RWXA 1DLIA 4XJXA 1W5FA 4JC0A 2A7XA 1V5EA 3DMDA 5LLTA 2EOAA 1Y7LA 1XTVA 4EB6B 1XFDA 4H6VA 4MVXA 2Q5IA 3VKFA 4KRFA 5NLLA 3ICQB 5IYZA 1PVDA 1A97A 2AJTA 1JR4A 2FE4A 3K72B 3KEFA 1LJ8A 3NJRA 1GPMA 4V02A 3HVKA 5CW2A 4BDTA 2NV0A 1G20E 1K92A 2Z4SA 4RL4A 5HMMA 1ZK3A 2BE7A 2AI1A 1NQUA 4D3FA 2RGEA 4FGSA 4IZIA 4Q19A 3TVYA 2QD5A 2HWYA 1QCCA 3NYQA 3RJ9A 2Z4TA 4FR5A 3JQDA 3UMMA 3FKQA 5ALEA 1FMTA 2EGGA 2FV8A 1X19A 4PSCA 2P4UA 4MS4B 5DLYA 2EAUA 3DHVA 3Q40A 3V9PA 2BAGA 3W5SA 4CG1A 4FYIA 1ZAYA 1OC2A 4KMOA 3IAS6 1ZICA 3LXUX 2XB2A 3DULA 2GEKA 2QPOA 2BKUA 4LNHA 4LVUA 2RBGA 1N6PA 2GVNA 1Q83A 3EIWA 5GIPE 5LDHA 3ADPA 1TC1A 1XF9A 3ZOZA 4BBAA 2D59A 2WSLA 3AOGA 2FGKA 2GK6A 4DAEA 2PRYA 3UMYA 2HADA 5FAKA 1E77A 3QYPA 4XQ9A 3IOEA 1ZONA 1GGEA 3CEMA 3ILVA 3EZ7A 1P3JA 3GYGA 1ISGA 1I4LD 1REQA 2R6R1 1PDVA 3U16A 3IEUA 4J16A 1XL1A 4AZ3B 4WOCA 3DZBA 2NZ2A 4JQSA 1WBBA 4F4CA 4RKEA 1FQJA 5A6SB 1AZSC 2NVOA 2JF0A 1LPAB 2YV4A 3O4JA 3D3WA 1M1YB 3HB0A 4LKRA 2ATXA 4OK6A 4LUCA 5DWDA 5DU2A 4RBNA 3VVCA 2YS7A 1KXJA 4BB9A 2QL6A 3VDNB 4DQKA 4CM9A 3ZW7A 5CRIA 1Z7BA 1X15A 2R62A 2O4CA 2D0DA 2RHRA 4NY1A 4PFJA 5EIBC 2Q07A 2P6PA 1YJCA 4F3KA 3V34A 2C4UA 4XUDA 3K70D 2YYAA 1YR9A 1E18A 4LOHA 2CFRA 5FA8A 4WFQA 3TGWA 1K7YA 1X7YB 4WY2A 1IOZA 3PFHA 3W0LB 3WGYA 1YDGA 2AYXA 4KEAA 1IY9A 2NYRA 5TY0A 1TYCA 4B6GA 4CIVA 1G38A 5CFZA 3GG9A 1KAHA 2GPNA 3PC8C 5KOHB 3PLAE 4II7A 4UZSA 2CW5A 2R1TB 4CV3A 3C3DA 3KUXA 3A4IA 5DX8A 5J3JA 1GGFA 1Z8HA 1RBZA 3DWGA 2ZSFA 2FX2A 2HCTA 3PRKE 3QM1A 4YP9A 2JVJA 4ZCQA 2D1QA 3TX2A 3R7FA 1FOEB 5JNVA 4LQLA 3SMQA 2IH4A 4YJKA 2G9UA 3HFRA 3IODA 1PFQA 4YMIA 2B8EA 1HXHA 2QTGA 4JEHA 3T0IA 1I7DA 1VECA 4UMVA 5BYJA 5C7LO 2C3PA 3SX0A 5JS6A 3KKPA 3TJMA 4MVYA 3U19A 4DA4A 1KU0A 3BK1A 1J70A 3H9CA