1M66A

Crystal structure of leishmania mexicana gpdh complexed with inhibitor 2-bromo-6-chloro-purine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 133
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m66A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m66A01
1LEHA 4OXYA 3ST7A 1YQXA 2P5UA 3DXFA 2PY6A 3VVBA 4Q3BA 3OQBA 4WLEA 4IDGA 3CTVA 1P3DA 3KSZO 3BHIA 2P9CA 3QW2A 4KQWA 3TNLA 5CEJA 1G0NA 5KJFA 2CD9A 5KKCA 4KTTE 1ZUD1 1D3AA 3JD0A 1Y8RA 1I2BA 1QLJA 1Q7BA 3GF4A 4MKZA 2B0JA 4O6VA 5ADHA 5TF4A 3HFSA 4DMMA 3GVXA 4J4HA 1NNUA 2PGJA 2DTDA 5F5LA 4YB8A 4PRKA 3PHGA 4GGOA 4BNFA 3UXYA 2BFMA 2QIOA 2FP4A 3OICA 4KUGA 4YRBA 1ZXLA 4ND2A 4RVFA 3WBBA 1HE2A 3BMCB 1B14A 3FNGA 3WGZA 2BMAA 2HCTA 4DWVA 5TLSA 1LJ8A 1HDXA 3VC7A 4YCAA 1PJ2A 3Q2IA 4AFNA 5JYDA 4E2ZA 1I36A 2B5WA 4N5NA 2H63A 4BB6A 1SOWA 1UJMA 2SCUA 4EEZA 3I4CA 4BNVA 3QVTA 1WXDA 5KVCA 2NTVA 4W7HA 2O2SA 2Y67A 1U9JA 2BHLA 1OC2A 1SO8A 1PIWA 5HWSA 2ZB8A 4BKOA 4LK3A 1LDGA 4BO1A 1DAOA 3QV1A 4BIIA 3VPXA 1BVRA 3PJEA 3EDMA 2PNFA 4FBGA 3ZWVA 4CUKA 1N9GB 3AUSA 5KJCA 4Y98A 2VHWA 5EL0A 2AXQA 2VQ3A 4IPTA 3L9XA 3AY7A 2VNAA 3C24A 1VRWA 3E8XA 4YJHB 4N5LA 2EF1A 4FFRA 1P31A 3FBGA 1HSOA 2HAEA 3RFTA 3WGTA 5FI3A 3V2GA 4EGFA 3WGYA 5CEFA 3B6ZA 2ZIZA 5MGBA 2NU7A 2J3HA 4K28A 3E48A 1NQTA 4ND5A 4H16A 2OP0A 4WLFA 5JCJD 5BSHA 5DCYA 4XB1A 4NH4A 4IMPA 4NHEA 3LZ6A 1MXHA 4HP8A 2LDXA 4WGGA 1T2DA 3T4EA 3W8FA 3LQFA 1N1GA 2EIHA 3AI1A 1GQQA 1YKFA 4JNKA 2BFAA 2PKQO 1T4DA 4DRYA 3ZGYA 3TSCA 2OUIA 3WGHA 4YT5A 3O8QA 5IFLA 4J2OA 1WVGA 2Y0DA 1T2FA 3ZZNA 3ZNPA 3HADA 1NM5A 1T4BA 5TRTA 3IKTA 1X7HA 2ILTA 3AJRA 3PIIA 1LI4A 5KVVA 3PZBA 1GAEO 4PLFA 1HKUA 2HSDA 3A06A 3PXXA 1YONA 2FHSA 1V0JA 4LRTB 4RPGA 3TOXA 3UKOA 1LSJA 2NVWA 3EYWA 3V8BA 4BKPA 4ZVVA 1PWXA 4LVUA 4RVUA 4F3YA 2W2KB 3RC9A 3BXXA 2EERA 4Q3NA 2B37A 1R15A 2DKNA 3GOHA 1ZEMA 2WYWA 5T57A 1NR7A 4IY1A 4E2YA 1M2WA 4CLXA 3IOYA 3OJLA 4XJSA 4HWKA 3X2FA 5EINA 5AVOA 3ZHXA 1QYDA 4O5OA 1FDVA 4D79A 3NYWA 1AHIA 2NM0A 3C3XA 2GDZA 1J6UA 1OZAA 2ZB4A 5IG2A 1EK5A 1RM5A 1TT7A 3F5SA 1GCUA 4FFOA 1CYDA 2I6TA 2B4TO 5DBIA 5JDIA 1N1EA 4YT4A 5MDHA 1TXGA 1UZLA 3WMWA 3DHYA 5CEEA 1XLTA 4R9RA 5C5IA 3AY6A 4Q9NA 5EJ2A 3QWIA 2CF6A 4PLZA 1UXGA 2J5RA 3F9IA 1V8BA 4YQZA 5GZ6A 4DIOA 4MVJA 2V6FA 2X22A 4KUHA 4J49A 3DBHA 4CV0A 1JAXA 3U4HA 1EQUA 3BIOA 2ZJ1A 1P0CA 3ADPA 4GSKA 5BSGA 1H6DA 3ENKA 1HXHA 4FB5A 3PLRA 1FDSA 3Q1LA 1YDWA 3AM4A 3KYCA 1ADBA 3ROQA 1BGVA 3FNEA 1E1MA 3KTDA 4OXKA 3I9OA 1Q0HA 5EMHA 3ZV5A 1D8AA 2C29D 1PJTA 4LGVA 5LCXA 4DA9A 2P68A 2IXAA 1IUKA 3FSRA 3H8VA 1WP4A 5EIOA 2Q99A 4I5GA 2Y1GA 4YYZA 2FWMX 4ITUA 1EBFA 3LC2O 1NASA 3MWEB 3H3FA 3DEYX 1PJ3A 5JPIA 4CLHA 2PD4A 5DP1A 4GKBA 2NVUB 1S7CA 1JAYA 3ONDA 5A05A 5THKA 3U0BA 1PWZA 2Y66A 4L0QA 3TZKA 1DSSG 2FR0A 1MXFA 1Q0QA 1NP3A 1LSUA 3WFJA 1PGQA 3E18A 1HE4A 2PH5A 3FHLA 2AG8A 4J0FA 1MX3A 3U4DA 4CL8A 4R1TA 1ZSVA 2Y99A 3LT1A 1J4AA 3FPLA 2W90A 1A5ZA 4PG5A 4W7IA 5JMPA 1GPDG 3PHJA 2OGUA 4QO8A 4W9NA 3VDQA 5I7VA 1MG0A 4PN3A 1LXCA 1F14A 1P1RA 4F6CA 4R5HA 1LDBA 5I8ZA 2GRAA 3LU1A 1ORRA 4E12A 1ML3A 5BQFA 5IN5A 1HL3A 3FNFA 4Z0PA 3JYPA 2P9GA 2I66A 3OJOA 5I9NA 1BDBA 2X23A 1KYQA 3DBRA 3PQFA 3IIEA 4UREA 3GH3A 1PZHA 5ENVA 2H1SA 4U0JA 1E77A 3WOHA 4WCDA 3EUWA 3FD8A 1H2HA 2E49A 1GUYA 3PRJA 1HDRA 3CMCO 3SX2A 4R3WA 2JCYA 4ROSA 1OAAA 3RIHA 2C7GA 2VHVA 3RASA 3IL2A 3PWSA 4QTZA 5IF3A 5FWNA 3W4KA 4AJEA 2PA3A 4DVJA 4WCFA 3PFWO 1VLLA 4XKJA 4BO8A 1VL6A 2C07A 3PHHA 3WGIA 2YDYA 1UP7A 2X0RA 2JL1A 3WNQA 1JKFA 1X7DA 5L45A 3RVDA 3QVSA 4ZRNA 3W8EA 4YAEA 5KJ1A 1R0SA 2R00A 2XXJA 2VUTA 4RZHA 4ZJUA 4B4VA 5IN4A 5KVSA 1KVSA 3H5RA 4I8XA 4F46A 4JGBA 3H9JA 2YHIB 3DOCA 3A1NA 1LC0A 3VH3A 3PWZA 3PZRA 4RF3A 1SOVA 1NWCA 4URFA 5ITVA 1W73A 3I52A 3KSDO 3DZIA 3IAHA 5K6AA 1N2SA 2Q49A 3F5QA 2LDBA 1QORA 1E1LA 2X7HA 2YDXA 1GYRA 1LRLA 2WEKA 3BMQA 1DB3A 4IJVA 3TWOA 1EVZA 2IXBA 3AOEA 1D7OA 1JA9A 1CEQA 3D7LA 5JO0A 1I32A 2D8AA 3EZYA 1ZO8A 3A28A 4I5DA 3TRIA 3DTTA 3NTRA 3ZWAA 2NU6A 4E30A 5C7LO 1X1EA 2X0JA 1HDYA 4ZD6A 3ZNOA 1ENOA 4B79A 4AVYA 4NK4A 2DFVA 1DDOA 2HDHA 2IRWA 3ZH2A 1W4ZA 2BGMA 1ZZEA 3I6IA 1Y7TA 1W6UA 3HDHA 2JKVA 1K6XA 2Q46A 1Y8RB 3JQ7A 4P8RA 4PG6A 4DXHA 3PK0A 1HLDA 4GMFA 1LX6A 3KHUA 1NX6A 4Y6SA 5HA5A 3JD3A 1R4NA 1LTHR 2Q2QA 1HE3A 4CR7A 5GZ1A 1IULA 3WX0A 4A27A 5U1PA 2D59A 3AM5A 4ONEA 3GVIA 3PI7A 3OMLA 1JWAB 2B83A 4NJMB 4CLRA 1GD1O 1I5RA 3GFBA 3KBOA 4N54A 3AU8A 3VZSA 4U8GA 4B4UA 1IHXA 5B4TA 4OSOA 3KLMX 3H6KA 4TMFA 5DZSA 4ZQGA 1KVRA 4R5MA 1ISHA 2I76A 1HZZA 1PQWA 1QP8A 1XG5A 4EYEA 3QQPA 1XA0A 3RROA 4FC6A 2DUWA 3LLVA 2C7VA 1U3WA 4XD2A 4JK3A 1NPTO 3ZWXA 1EE2A 2EKPA 1LSSA 4XGNA 4E33A 5ICMA 1JTVA 1N5DA 1NQOA 2Y1CA 1IL0A 4LMRA 3E1KA 4D44A 5CDSA 3I9MA 3LC1O 1G0OA 4PVDA 3P5SA 1SZJG 4LCJA 3V1UA 2HQ1A 2I9PA 1I3MA 1NQ5A 1BDMA 3JD2A 3RUHA 4NIMA 3JQEA 3L6DA 4NFSA 1HT0A 1R0LA 2AEFA 3TPCA 5DP2A 1JW9B 4J2HA 4IDDA 3S55A 1LC3A 5JY1A 4E32A 4GL4A 1T25A 1UXKA 1VKOA 3F3SA 1I01A 2DBZA 4FJ1A 2PR2A 2HO5A 5TT0A 3O8QB 4DPLA 4D3FA 4MOWA 3GNQA 1GEGA 1XIVA 4HXYA 4E6PA 3BHMA 4OO3A 5AYVA 3CEAA 1EEHA 1P1HA 4JP2A 4UEOA 1PTJA 4NFHA 3KO8A 3ZU3A 4BGEA 4JJIA 4I9HA 4RF5A 4KWHA 2J5QA 1HETA 2Y0EA 1K5HA 3GAZA 1Z6ZA 3ZWMA 1GZ3A 1T24A 2Y93A 1ULSA 3JV7A 4GI2A 2HMUA 1FDTA 3H9GA 4Z9XA 4DC0A 2X0IA 1O89A 4IINA 5ILGA 1YJ8A 2BRUA 2RCYA 3DBLA 3UAGA 2FZEA 4QECA 2GD1O 1RM3A 2QRLA 3M1AA 1B2LA 3WLFA 2DTEA 3BTSA 5GMOA 5KVQA 1CJCA 4RCVA 4GVXA 4IDAA 4PLCA 1JVSA 3VPHA 1GDHA 4BO7A 4WLNA 1LDYA 3KEOA 2NQ8A 2R00C 2O4CA 1I8TA 4FFMA 1UXIA 5K0ZA 2FR1A 3JQ8A 3L6OO 5GY7A 1GU7A 3PJDA 5TGDA 1NFRA 2FY8A 5G0SA 5L7WA 4II2A 1I30A 1DIAA 2I65A 3MJCA 3FN4A 3GA0A 1QXSA 4MP8A 1H6AA 3GEGA 3VH1A 5K6AC 4MIEA 2IEBA 1YGYA 3ZV3A 2CY0A 4R51A 2WJPA 2JHGA 3S8MA 1UZMA 5T5QA 3V5NA 1T26A 1PS9A 3DDNA 1ZIDA 3K30A 1SB8A 3AOEC 2AEJA 4XIJA 3P7MA 1JU9A 3ON5A 3CZRA 1KIFA 5G4KA 1U5AA 4D3SA 3N7UA 3JQFC 2C59A 5COQA 1BSVA 3V2HA 3MTGA 1QG6A 3QHAA 4CMHA 5L4SA 4PLHA 1E3EA 1O8CA 2AEMA 3ADOA 3WMXA 3L77A 1CIVA 3GHYA 2AQ8A 4YRDA 4UUPA 1M6WA 4ALLA 2EJWA 1N8KA 3JQBA 2P91A 1ZSNA 5TT1A 4F6LA 4WNIA 3MJSA 3DONA 4OKIA 1QV6A 4OXNA 4XYLA 1WMAA 2YZ7A 3JQ9A 4JQCA 4CMEC 2E48A 1A7AA 1XHLA 3COSA 1V35A 3DR3A 4MP3A 3TDKA 2X5JO 4BNYA 1LRJA 3KZVA 1NBOA 3GN1A 1OBFO 2RHRA 3C1AA 3JQGB 4I08A 3HJAA 4BKRA 1VSUA 1XCBA 3GGPA 1XU7A 3UN1A 1VJ1A 3KM0A 3SJ7A 3Q9UA 2W4QA 3PPIA 4B7CA 4YRAA 2JCVA 1YL5A 2VHXA 1W8DA 1D1SA 2VWQA 4BGIA 3IQDB 3EHEA 4BVAA 3ZWBA 5LDHA 1SB9A 5LC1A 1E5LA 3WTCA 5A04A 1GEEA 4XYBA 3MTJA 4EEXA 1D4FA 1YE3A 1H6CA 1NWHA 2PD6A 1K6JA 4XB2A 4J0EA 4R1UA 4AJHA 3OHSX 4FGWA 2AG5A 1PL6A 3G0OA 3D3EA 5A4DA 2NQTA 2X58A 2BI8A 5L9AA 1YQGA 5JAIA 5L95A 4RF2A 7MDHA 2P4QA 1HF3A 2RH8A 1WNTA 3E6AA 2AE2A 1YXMA 3WTBA 3JYQA 2O3RA 4KTVE 1M67A 3AI3A 4CM1A 1EFLA 1KC3A 4WNCA 1SPXA 3DB2A 5K9ZA 4WE3A 3RU9A 1Y8QB 2EP7A 1DFIA 3FBTA 3HN7A 2OMEA 4EITA 2CSUA 2E4AA 3B20A 3NJ4A 3RBZA 2QRJA 1NHGA 5ES3A 4DUPA 1U2DA 1PU2A 3MJTA 4BQRA 2O2YA 2HLPA 3GFGA 4IZHA 2VZ9A 2X5KO 3M6IA 4LMPA 4OIMA 1E7QA 3EZLA 1YL7A 2HUNA 4AJOA 5I7EA 3C85A 1C0KA 3CXRA 5TNXA 4BO2A 4NI5A 1C0LA 1PGJA 3RBXA 3H5AA 2QRKA 4ILKA 1JVBA 2BFPA 4LCEA 4W4TA 4LSWA 3GVCA 3LT4A 5JO9A 4PVCA 1HTBA 1PJLA 4A73A 1XGKA 4FW8A 1UDBA 2WM3A 1Y1PA 3EC7A 1KERA 1ZW1A 3GMDA 3WB9A 5HM8A 1PX0A 3K2EA 1C1DA 2DM6A 4CQMA 4YA6A 3D4NA 4IXWA 3INRA 1DAPA 3K5PA 4D7AA 1I2ZA 1LLCA 1Z74A 2WMDA 1P45A 2G82A 2QW8A 1I24A 4RVGA 5BNFA 1R12A 2AW5A 2P2SA 4HX5A 3JQ7B 4X54A 1MGOA 1WDKA 4B4WA 3O4RA 4JLWA 4TWRA 3GY0A 1E6WA 1I33A 4IDBA 3RUFA 5L7TA 4YTEA 3GRPA 2PD3A 3CIFA 1R4NB 3QIVA 4JX8A 4GX2A 2QQ5A 1H9BA 1QYWA 4CM4A 4UUOA 5T8KA 2P5YA 3VAZA 1WDLA 1GTMA 1PQPA 3G3EA 4QXMA 1QYCA 4HUJA 5G0TA 3CKYA 3DFZA 5JFOA 4CLRB 1U7HA 1E3LA 4WEQA 5F1PA 1O94A 4M55A 2PGDA 2ZYAA 3VDRA 4EI2A 1BXZA 1U7TA 1MUUA 1E7WA 4UAGA 4PG4A 5EPOA 1PGOA 3GR6A 4UEJA 4XEHA 4CM6A 1JKJA 2I3AA 2YW9A 1G1AA 1H5QA 2C5AA 2V6GA 4JROA 3QA9A 4OMUA 1A4UA 1O5IA 3L0DA 4Z9FA 4YPOA 4XZ3A 3ZCXA 1VKNA 1IYZA 4LISA 1GUFA 1AXGA 1KS9A 3M1LA 5AXBA 2B36A 5IDYA 2EGGA 4KP7A 4OSPA 1U3TA 1E3WA 4XIYA 5T6BA 4CUZA 3AI2A 1O0SA 3ZNQA 5H83A 5TJ9A 9LDTA 4IDFA 3V1TC 3RKUA 3TL3A 5DNAA 1VC2A 3EGOA 2QG4A 3G79A 5IZCA 1P9LA 2VWPA 3WXBA 3H2SA 2VRCD 4BO9A 2GYYA 3SXPA 1I3LA 1Z7EA 3ONEA 4Y67A 3RAJA 4JN6B 5JW6A 2JAPA 4DLLA 4K1LA 4JCOA 1CWUA 2WD7A 3JD1A 3E03A 5LDGA 1DC3A 3I3OA 4CM3A 3ANLA 1MA0A 1KY4A 4Z3KA 2UYYA 5TIIA 3BMOA 1E7SA 3DC2A 3C1TA 2VYVA 4YJGB 1Z73A 2NADA 4D45A 2HMTA 2PLAA 1QLHA 4DYVA 5A03A 3I9NA 2ZKLA 2FMUA 3OEWA 3ROKA 1AN9A 3GAFA 3ROPA 1C0IA 3S1LA 2WTBA 1NVGA 3W4IA 5DULA 1HRDA 3QWAA 1ARZA 2AA3A 2AQHA 4YT8A 3DBLB 1E3JA 1P1IA 1R4MA 2WDZA 4MVJF 4DC1A 3R3SA 2OP1A 4R3NA 1FMCA 1YH3A 2I99A 3STHA 5CG1A 2WSBA 4XYMA 4ZQEA 1YBAA 1A27A 3GG9A 1H93A 2D3TA 4OQYA 2H9IA 4CMKA 5CDYA 4RPHA 5IZ4A 3JQ8B 3E82A 3FR8A 3D1LA 4XRRA 4IS2A 3VTZA 3KSUA 2TMGA 3AM3A 3NGXA 1KVUA 2VTDA 4P4GA 4BV8A 1TLTA 3PQEA 3RC1A 1GQ2A 3LLSA 1AUPA 1Q7CA 3FI9A 2VOEA 4H15A 4BKQA 2FPPA 3ANNA 3W4JA 3GT0A 3VKVA 3VVCA 4TVBA 3OIDA 3K8ZA 3D3WA 1R66A 2D5CA 2YQ5A 3K92A 1WWKA 4RLSA 3JQAD 5HTOA 4AJ4A 4BMVA 5G4KB 4BKUA 1NAHA 3TF5A 3H4VA 4CMCA 4H3VA 4PZCA 3PDJA 1XWFA 5TX7A 4L74A 2CF5A 1BG6A 1M76A 1FJHA 4ALJA 3RKRA 4D41A 1X14A 1A9YA 4AJNA 1ZK3A 3VOSA 1ONOA 4XYEA 1OOEA 1C1XA 4IIUA 3ZU5A 2BKAA 4CMBA 2UV8A 3GZNA 4DQUA 5BR7A 3PFFA 4I9UA 3ENNA 2HRBA 4J4TA 4KUEA 1I0ZA 5J23A 2P4HX 4RO0A 4KMSA 2HJSA 4UVIA 5KJEA 1UDAA 4M86A 4N5MA 5EQFA 3NUGA 5KOIA 5IAAA 3E5MA 4YQYA 3EMKA 5JYEA 4Z6KA 4Q39A 3S2FA 4L75A 5T8KC 1JN0A 3PGJA 4FGSA 1HZJA 4QQRA 1P1JA 5CFZA 2EHDA 3FF4A 4PLTA 4MDHA 3TZCA 3NDIA 4WPGA 1ZK0A 4XR9A 2GN9A 4L9RA 3RBVA 3CUKA 3LF2A 4I5EA 3IDSA 5A9TA 3D0OA 3CMMA 3JQCA 4J43A 1DIRA 3ZI0A 4NNJA 3BA1A 4PG7A 5TS3A 1BW9A 1DBVO 4HFNA 4YACA 3JCZA 1KY5A 4WASA 4U0KA 4KQXA 1Z75A 5DCUA 2BD0A 2DTXA 5HS6A 2A92A 4UVGA 3OM9A 3JQAB 3Q6IA 2EKQA 2GERA 2VTEA 4Q3CA 3UOGA 3GQVA 3AOGA 4E5KA 1GV1A 1N92A 5ITWA 3OA2A 1JDJA 4BNWA 3BTVA 1WZIA 3MEQA 4O0LA 3AFMA 3SLGA 3HDJA 3L4SO 2W2LA 3LT2A 2D2IA 5AXAA 2B35A 4BOYA 5BSEA 9LDBA 1ZJYA 4XCVA 3NT2A 3AUTA 4R9SA 3G17A 1X15A 3R3JA 4YAGA 1SBYA 5JDCA 4FS3A 5KWEA 4DBZA 2UAGA 3I9JA 4TSKA 3D4PA 1KEVA 1KETA 1GYPA 5B4UA 5L4NA 5IZCC 4ALMA 2JD2A 4M1QA 3RJ9A 1AE1A 4K26A 4GMGA 4E5YA 4BNIA 4N7RA 1ZMTA 5ILOA 3T4XA 1HYGA 1CERA 3WWZA 3ICPA 1F8GA 1DRUA 1XKQA 3KYDA 2Z95A 3VH4A 2C0CA 2ZTMA 3WYEA 4DPKA 4YXFA 3SC4A 2X86A 4M54A 2DFDA 2HKIA 3V2UA 3OF2A 5CDUA 2VCYA 2PZMA 2OL4A 1DOHA 1ZEJA 3WR5A 3KRTA 2PK3A 3GGGA 3DOJA 1GQYA 4B3JA 1DRWA 4NZ9A 4MVJG 3SVTA 4RORA 1ONPA 1PEDA 5L4LA 1TT5A 2EP5A 4O59O 2IEDA 3UCFA 2UUOA 2Z1MA 5I9LA 5COAA 4C4OA 1C1DB 3WICA 2HRZA 1SEPA 2H5LA 4GGPA 4BNLA 2D4AA 2DBVO 5AQ1A 4HV4A 4OJNA 4OL9A 1U1IA 3NKLA 4CPDA 5A3JA 3WLEA 5F3RA 4MVJI 1W0CA 1Y6JA 3NTQA 4FJ2A 4FN4A 1R37A 2XPCA 4WLUA 5IDXA 4Z0TA 2C54A 3ETEA 3C7CB 4L8VA 3RJ5A 1F12A 3QJ5A 1YJQA 1PJQA 1B3BA 2Q2VA 3H3JA 2JFGA 3HN2A 1DPGA 3WJAA 3T7EA 3PJGA 1ZH8A 4CM4B 4D46A 3LC7O 5G4LA 5JDIC 3LT0A 5DCWA 4UVEA 3NGLA 2BH9A 3Q0EA 2DVMA 4MO2A 4FJ0A 2NSDA 5I8WA 3WIDA 4CV1A 1NXQA 4EDFA 1ADFA 2VYVD 4WK6A 4Q3AA 4M8SA 3RWBA 4PGFA 4BO3A 1TEHA 4B7XA 4UVHA 4F45A 3KV3O 1FDWA 2EW2A 4MP6A 2BGLA 5G0VA 4DTIA 1U5CA 3ORFA 1LSOA 1T1SA 4YWJA 1ZJZA 1ZK1A 1E7YA 1PS8A 2VZ8A 4JJGA 1ZMOA 4HBGA 2FSSA 3QLJA 1YWGO 5BNTA 3GK3A 2EV9A 3QVOA 3KUXA 4IQGA 4L4RA 4XGIA 1EUCA 1OI7A 1PZFA 4CM7A 1ADGA 1T2EA 1IZ9A 5A1TA 2UVDA 3L6EA 1BHSA 4R54A 4OH1A 4MVJE 5H82A 3GMSA 2Q45A 3DMYA 2O3SA 2B69A 3SEFA 4XQGA 1EQ2A 2D0IA 1IY8A 3ITKA 3PLNA 3PWKA 8ADHA 1LDNA 3MJEA 3K31A 3DZJA 4RL6A 4TVOA 3WSVA 4BQPA 2C82A 3C7DB 3EAGA 2IZ0A 4MVJD 3NJ8A 4GWGA 4RQTA 3FTPA 5C7OO 3ICCA 2WD7B 2ZCUA 2IYOA 4M49A 4W9NC 3QP9A 3KEQA 1EUDA 3AW9A 3GLQA 1VSVA 5AXDA 3WG9A 1H6BA 1V6AA 3RUIA 4EBFA 5IDWA 2TMDA 3BMOB 1V3TA 4ZQHA 3A9WA 5C37A 4GX1A 4HKTA 4ND4A 3BZUA 3QWFA 1LA2A 2O7SA 4E0BA 2BF7A 3PTZA 1P77A 3SC6A 1ONNA 1ZVMA 2Q1SA 1TI7A 1T2CA 3I83A 5KIAA 5DOZA 3HUDA 4IJKA 5JLAA 3VKUA 3O38A 4CODB 2PKRA 4YEDA 1IPFA 4CQLA 5FEUA 4CL3A 4BNKA 1PL7A 3HSKA 5HBRA 1R4MB 4AJKA 3KVOA 1B8PA 2DC1A 1M75A 2VHZA 1HEUA 3PIDA 3OSUA 3N58A 3B1FA 4WCFC 4J16A 5G0UA 4WLOA 3T7CA 5CG2A 4OHUA 3AFNA 3LYLA 1PZEA 5CPFA 3DZGA 3NDJA 3O9ZA 4NDNE 3IUSA 4BGUA 4R4JA 2EJVA 1GCOA 1C14A 2Q3EA 2X9GA 1E3IA 1YOVA 4CMGA 1ENPA 4AJJA 4FQ8A 1K0UA 4XDYA 3WDSA 3QWBA 3PDUA 3WGQA 2I67A 3R6DA 1YO6A 4CM8A 5U9CA 4DPMA 1V3UA 3OA0A 4GH5A 5CP8A 5DDIP 4EUEA 1A71A 4AJPA 2DQ4A 4O63O 3DBHB 5H81A 1I3NA 1MP0A 4P4NA 4D0SA 4YAJA 1AXEA 1PQUA 4BNNA 4NPCA 5L3ZA 4DREA 3KYCB 1IOLA 2F1KA 4TRRA 5JXWA 4XX0A 2ZTLA 2J8ZA 1UAYA 5TSDA 1QKIA 1XDWA 2FSVA 3V1YA 1E5QA 4D42A 1UR5A 4WLVA 3DWFA 2EW8A 2HJRA 3UGKA 3MJVA 2O7QA 1BXGA 3JYOA 3UUWA 4NU5A 2B5VA 4AJIA 1DC6A 2I3GA 1NR1A 4OM8A 4BS9A 1PR9A 2X9VA 2X6TA 1MFPA 2OBNA 3OECA 3OQ1A 1A4IA 4CJXA 5JCJA 3HE3A 1C1XB 4FFNA 4QUKA 4GVLA 1P44A 2NU9A 3OEYA 1YL6A 4R1NA 5CDGA 3GZNB 4IZIA 3FRJA 4RF4A 4WJZA 1F06A 1ISGA 3TFOA 5F5NA 2WYUA 1NAIA 1VL0A 3GPIA 2YY7A 2O3TA 3WS7A 4UUNA 4EUHA 2WD8A 2G76A 1UH5A 1PJ4A 2ZCVA 2JJYA 1LUAA 4J6FA 2EKLA 3O03A 5COBA 4A2CA 4J7UA 3PYMA 1DFHA 4IQ8A 1U8FO 3DL2A 3WIEA 4EJ6A 3QSGA 2A4KA 1CQIA 2CDCA 1BXKA 2JD1A 1EVJA 3ZWPA 3VPGA 1HDCA 4IM7A 1B3RA 3BTOA 3OIGA 1GZ4A 3G49A 3Q9NA 3FNHA 4Z3DA 1UXHA 3NEPX 1DLJA 1UUFA 5KTKA 1WZEA 1ZCJA 1BW9B 1M66A 5JAQA 4WECA 4KWIA 1QMGA 2GLXA 2GR9A 3PHLA 5A3VA 2YQ4A 1RPNA 3DBRB 2OOSA 1DLIA 1DEHA 2ET6A 5EESA 3A4VA 3GNTA 3M2TA 4IGEA 3TZQA 2Y05A 4RLHA 4J91A 3PHIA 1CF2O 4JJFA 4NG5A 5JBIA 2O23A 5JY6A 2EWMA 4ESOA 1DJNA 4HY3A 2ZQYA 4LW8A 4I1IA 4PRLA 3C8MA 2R6JA 2Q1UA 1F0YA 3IC5A 4E3ZA 3KETA 1ISJA 4WCFB 1Y9EA 3DFUA 2PZJA 3HNPA 5T64A 4C7JA 4DYDA 3BHJA 4J1QA 3HFGA 2E37A 1YVEI 3G1UA 1Q7GA 4KOAA 4RPJA 1Y9AA 5BSFA 1DJQA 2NACA 1F8FA 1E3SA 2V6MA 1HSZA 1LQUA 1XYGA 4R16A 5FFFA 4MVJH 5C7IO 2HK9A 2YUTA 5KCZA 5ER9A 3GNSA 4YBZA 1YDEA 1LBEA 4RVHA 2XF8A 3UCEA 4PLYA 3B1KA 2NTJA 3GZ4A 4J1TA 3GEMA 2OO5A 2JCXA 3UVEA 2GSDA 2VWHA 2Q4EA 5EQDA 3BMQB 3RI3A 4M87A 4QX6A 3H9EO 2GF2A 1ZXBA 2IODA 4TROA 4ZU3A 1MC5A 3MZ0A 5A02A 4PLGA 4BO4A 2VZ0A 2ZJ0A 1RM0A 3DQPA 1NPDA 2AMFA 4J4BA 1DO8A 3P2OA 1R6DA 4GAEA 1JWBB 3QE3A 2JFFA 4B3IA 4MVJM 1XQ6A 4A10A 3H9QA 1YB4A 1Z82A 3WJ7A 3MOGA 4J7XA 1RM4A 3KYBA 4GLOA 3UH1A 4IJUA 2VT3A 1ENYA 3K2BA 1D1TA 1LRKA 1Q0LA 1VE9A 1XU9A 5EN4A 5JCXA 4WKGA 3L9WA 3RSHA 4WOJA 3W8DA 1WAMA 2J6IA 3BYZA 3O26A 3CINA 2FZWA 4HFJA 1RJWA 2BI7A 3RD5A 3RUCA 1EK6A 1SC6A 3VZPA 3WWYA 4QSMA 2GUGA 5IJZA 4Y6RA 1TVEA 3RFXA 3CZMA 4E5NA 4RPKA 2Y68A 3DZHA 3GDOA 1HWYA 1Z45A 3S2IA 5BNIA 4LRSB 1ZSYA 4EUFA 2CZCA 5T67A 3W1VA 4Y8VA 2Q1TA 5TQVA 3KB6A 4NFYA 2J3KA 1EDZA 4TRMA 3ZWWA 1OC4A 4IUYA 2Q1WA 2YYYA 1BMDA 1CETA 4R69A 4G5HA 5A9SA 1PZGA 2BELA 4O1MA 3WQRA 1MLDA 2PKQP 4NBRA 5F1KA 3IUPA 1B8UA 2OBYA 4UEKA 2Y1DA 2YFQA 2C2XA 3WQQA 3F6YA 2X8LA 2GGSA 3CPSA 3LF1A 3WYCA 1UZNA 1C3VA 1YB1A 5JC1A 3QY9A 4NJMA 3JQBC 4AL4A 2CDBA 4ZICA 3QVWA 3ULKA 4A0SA 1NPYA 3JQ9C 4FDAA 4MPDA 3D5TA 2GN6A 4CLEA 4EJMA 3ZU4A 3VZQA 2OORA 4BV9A 2FOIA 5DT9A 3LDHA 2PV7A 4ALKA 3K73O 1DC4A 2E6UX 4EW6A 1ISFA 2ZB7A 4BNHA 1WPQA 4BNXA 4YJDA 2AQIA 3W6ZA 3JQDA 3L4BA 3HZZA 3AU9A 1U3VA 1E6EA 3F47A 1ISIA 1NFFA 4NK5A 1YB5A 1HYHA 1Y5RA 3CTMA 3MWDB 1CRWG 3GRKA 1N7HA 1EVYA 1NYTA 4U6QA 4RQUA 2IDZA 2QYTA 4RJTA 3AY3A 1NVMB 2NLOA 1ENZA 3U4CA 4E5MA 1WMBA 1L7DA 3ZWOA 5CDTA 4R1SA 1R0KA 4K6FA 4NR0A 3HB4X 4B7UA 1RWBA 4PIVA 3ZNNA 4UUMA 1EDOA 3H2ZA 2HK7A 1X7GA 2QYSA 4CQLB 1NVTA 1PL8A 1KOLA 3SJUA 1K3TA 1DFGA 2JAHA 3OQ6A 1ID1A 1WW8A 4OQZA 4WEOA 3E9NA 1SMKA 3UFXA 3R1IA 4RDHA 1ADCA 2EG9A 4LVCA 3K96A 1DXYA 3HB5X 2RH4A 1O95A 3ITDA 1YOVB 2EGHA 3RQSA 1LLUA 2Q2WA 4ALNA 4E5PA 4BUCA 3QWHA 3TOZA 1DRVA 2OZPA 3WGGA 1H9AA 4CM8B 4YAIA 2Y1OA 2YV2A 3PEFA 1GFSA 1KEPA 3UW3A 4TZKA 2ZTUA 3I5MA 1V3VA 3U3XA 2Y1FA 3IS3A 3RUDA 1Y81A 3N74A 4J9VA 4KDEA 2UUPA 5GZ3A 3I6QA 1JKIA 4D43A 4PCVA 1Q1NA 2FR8A 3R0IA 3KXDA 4OYRA 1P33A 3SLKA 1GPJA 3BAZA 1YBMA 2QZZA 5IXYA 3IKVA 5U4QA 1K2WA 1KVTA 1HE5A 4DQXA 2R2GA 4GWKA 3DAFA 1EZ4A 3IMFA 1BXGB 4DIFA 3HG7A 4M89A 3JTMA 4PLPA 4AICA 3C1OA 5ICSA 1FK8A 3HDQA 1IZ0A 4QO7A 4DL9A 7ADHA 2WE8A 4ZRMA 4ND1A 3GUYA 5EERA 2OHXA 4E2XA 1SNYA 4GBJA 1E1KA 1WLYA 2O50A 1QRRA 3BMNA 4CMIA 1XELA 4BNTA 4CUJA 1LDEA 4OGWA 4S3MA 3DOOA 4BNJA 3HQ4O 2X5OA 4TZTA 1L7EA 4YT2A 2J3IA 1J0XO 4W6ZA 4YAKA 3GPDG 2ZYDA 1M6HA 2VHYA 4RGBA 4YDRA 2DBQA 2I5PO 2AE1A 2GN8A 3H65A 3B70A 1EFKA 1C0PA 1TB4A 4UVDA 5JS6A 4G65A 4U6SA 1HDZA 2O3UA 1LNQA 1LDMA 1TA4A 2ZQZA 3ZWYA 5L7YA 3IP1A 4WOKA 1GY8A 1DHTA 2GO1A 5FI5A 4DIBA 3JD4A 1E7MA 3OH8A 2IE0A 5THQA 4BO6A 4ZQFA 4CM9A 3ZN2A 2C20A 4IQ0A 4QFCA 5C3MA 4IDCA 3DTYA 3P2YA 1KC1A 3F1KA 4R68A 1U8XX 3OFSA 4MVJP 3NTOA 2G0TA 4W99A 2VOJA 4J1SA 2IYPA 4CLOA 3FWZA 4Z0HO 3I4FA 3Q11A 3INGA 1YRLA 1DIHA 1ISMA 3GDFA 3JQGA 4CQMD 2V6BA 1SEVA 3TZ6A 3VHRA 4XA8A 2YHUA 3QVXA 5KNLA 4RPLA 2DBRA 3Q3CA 4G2NA 3NT4A 1U4SA 3AUUA 4B4OA 2HK8A 1B7GO 2VUSA 3DMTA 2VYNA 4AG3A 3TFQA 4N18A 1ZNQO 1NTOA 3RCBA 3AK4A 4TRNA 4OKNA 4FCCA 2ZB3A 5BT9A 1GADO 1O6ZA 2G1UA 2YV3A 2JD0A 3VPFA 4FC7A 1H0KA 2OXIA 2NNLD 4L4SA 5DBGA 5F1OA 3K6JA 2VNSA 3Q2KA 2HMVA 2D5AA 4P38A 2XOXA 4A7PA 4BO0A 1ULUA 4TKLA 1G6KA 1IHYA 4MKXA 1JQBA 1MV8A 2Y0CA 3U4IA 4I5FA 3G1TA 4TQGA 3I9LA 1S6YA 3CH6A 5IXSA 2GZ2A 4C7KA 4QEDA 3RU7A 4CV3A 5B4VA 3TQHA 1B0AA 2RAFA 1DC5A 3L4BC 2PFGA 2X1HA 4FFPA 1H94A 1E7RA 1SCUA 4DLAA 1A7KA 1Y8QA 1VL8A 3ZU2A 3ZWNA 4AJ1A 2D1YA 2WE7A 4ND3A 2DAPA 2FPGA 3ETGA 4RVSA 8LDHA 1XEAA 1PJCA 1U3UA 5TC4A 4CQMB 1QYXA 2Y1EA 4A26A 1BVUA 3ZHYA 1CDOA 5A5FA 2BGKA 2CNBA 2ZK7A 4PZEA 4IBOA 1I10A 1FF9A 4ZGWA 1MG5A 5I7FA 5DOVA 4UULA 3ZV6A 3EW7A 3ETDA 3SBOA 3OETA 3VPSA 4II3A 4BMSA 4E2WA 3PYLA 4RDIA 3FR7A 1PR3A 4FOOA 4YJFA 4B8ZA 1T1RA 3JQFA 1GV0A 2PZLA 4NQZA 5L40A 2CVQA 1X13A 2JFHA 4GPD1 2W98A 3OP4A 4DBVO 4GQAA 1X1TA 4DQVA 4OOFA 4K9DA 1KEWA 2UDPA 1PSDA 3H9UA 3JSAA 4NU6A 5F21A 5ER6A 1QSGA 4B8WA 1YS4A 1J49A 4CMEA 3AWDA 3CSDA 3DZKA 3OBBA 2FPIA 4E13A 2O3QA 1EUZA 4LN1A 5FYDA 3UHAA 1DIGA 4A03A 1XSEA 3ZV4A 4XQEA 2XXBA 5DN9A 4XR4A 5A9SB 3OJFA 1K6IA 3DHEA 3PP8A 2V7PA 4TRJA 5CAEA 3GG2A 4XRGA 2QHXA 5A5EA 2NUAA 4XYGA 3U5TA 4GKVA 4RVDA 2E82A 4MINA 4IMRA 1X0VA 3AUAA 3PQDA 3FPCA 3ASVA 3KLPX 1P0FA 2BFOA 3INTA 3KOUA 4IDEA 5FF9A 2C2YA 3ZW9A 4PG8A 3U49A 4BL5A 3BMCA 5B1YA 1E3WB 5L53A 1AHHA 3P19A 3DHNA 3F4LA 3IJPA 1QYVA 1OFGA 2YFHA 5JNLA 3ZHBA 1QV7A 4HNGA 5G2OA 1R16A 4YR9A 4TKMA 4ZA2A 3HHPA 3CE6A 1A9ZA 4PLWA 5HRUA 3OJ0A 2VUUA 3NAQA 4FOSA 4FPXA 1DIBA 3I1JA 1N9GA 4NMHA 3RUEA 4NBTA 3DAPA 3NT5A 4L73A 2BLLA 2RIRA 1NQAO 2AHRA 3EVNA 4YJHA 3IJRA 1UXJA 2HMWA 3EVTA 2DT5A 1UAGA 1PJSA 1VM6A 4JP3A 1HDOA 4ZHSA 1RKXA 4ZQBA 3F1LA 4FFLA 4CLDA 2Z5LA 3MJ4A 2B4QA 3E5RA 1I3KA 3FTNA 2VN8A 3EK2A 4EJ0A 1LLQA 1U28A 1ZFNA 2CFCA 1MB4A 1J5PA 2J3JA 4H7PA 4J3FA 1P1KA 3RC2A 3GHHA 3C7AA 1Z7BA 1PS0A 1E0DA 3MCVA 1VI2A 4U7WA 3WGOA 4OAQA 4P22A 2CUKA 2F00A 2PTGA 1BRMA 3D5QA 3WYBA 1BTOA 1ZK4A 3DMTC 1B16A 4DLBA 2CDAA 3VTFA 6ADHA 4NBUA 3JQ6A 2FN7A 2CVZA 1RYEA 4BB5A 4JBHA 2A94A 2P9EA 4FIZA 1Y5MA 5JSFA 3PVZA 3ZHZA 2G17A 4GLLA 2X4GA 3D4OA 3LVFO 3NRCA 3PJFA 4YJGA 5I9MA 5JDCC 5JMWA 4RZIA 5G0WA 4XDZA 2O4UX 3ANMA 3K9QO 4S1VA 5DBFA 3QRWA 3GEDA 4QFDA 2DUUA 4MIYA 4J9UE 3NV9A 5JC8A 1PGPA 4BNGA 2DPGA 4BNUA 3VH2A 3F46A 4U5QA 1PGNA 2X0NA 1EVIA 3OJEA 4AJ2A 4E4YA 1PJBA 3A14A 1EMDA 4CM9D 2W2KA 2YV1A 1UDCA 1KBZA 2RHCA 2B4RO 1VPDA 4J1NA 4K6CA 3I9KA 3ZDFA 2DU8A 1E1NA 3D3WB 1GZ6A 4CR8A 1CQJA 4W82A 2QZ9A 4DGSA 3DAGA 4OOEA 4Z9YA 5KKAA 2ZYGA 4A5OA 1GR0A 4ID9A 1YQDA 3ZWCA 3UCXA 5I7SA 2Q50A 2O3JA 1K89A 3NDRA 1LQTA 4INAA 1DHRA 2RBEA 2XAAA 2V65A 1O9BA 2QX7A 2VYND 1UP6A 2W2LD 4BHTA 4PFJA 2VRCA 2FRDA 4IJWA 3BMNB 3GUCA 3X2EA 4CMIB 2NV6A 4D0RA 5B12A 4NBVA 1GYQA 5KJ6A 4BO5A 2AQKA 2HU2A 5AOVA 3EY4A 4L76A 4YVFA 4HADA 1OMOA 2GZ3A 1U4OA 3M2PA 4E31A 2YJZA 1MC4A 5HS4A 3RFVA 2X9NA 1B26A 3GN2A 2VRBA 4CR6A 2GCGA 1ZBQA 2NTNA 4XQ9A 4BMNA 2OFPA 3TL2A 2J5KA 4Y9DA 2WWRA 1YBVA 2C5EA 1NHWA 3W6UA 1KVQA 3LK7A 3D64A 2IZ1A 4MIOA 3ROMA 2NVUA 3DBVO 4WUVA 1P1FA 1ZK2A 1A72A 2VWGA 3I23A 4R01A 3FCOA 1T2AA 4I9NA 4ALIA 1B15A 3GDGA 4MKRA 4BNMA 2EEZA 4L4XA 4XGKA 3WBFA 2G5CA 1BWSA 4CLOB 3IP3A 4XJTA 1AGNA 4NJOA 3NX4A 3WNVA 4IXTA 4Q3DA 5CPBA 4CMAA 4FSHA 1EE9A 3GVPA 1Q2XA 4NBWA 2NWQA 5JAZA 5B37A 5CHEA 1SAYA 4CMJA 2IZZA 3JYLA 1RYDA 3L07A 3PYXA 2ZTVA 1E6UA 1H2BA 4JBIA 3S2GA 1XQ1A 1VJ0A 4XQCA 4IS3A 4KDFA 2VT2A 3GC6A 5IDQA 1QR6A 3ONFA 3F4BA 4EZBA 3S2EA 2GNAA 4AJLA 1UP4A 4GSLA 3ZW8A 4FD3A 2HMSA 5A06A 1N7GA 2CVOA 2Q4BA 3TZHA 1E92A 3JQAA 4J7CA 3OIFA 3WFIA 3DZFA 1NFQA 2JHFA 2Z1NA 4JXKA 1WDMA 4ZN6A 1EBUA 2GZ1A 2EXXA 3TN7A 4GX0A 3KYDB 2PH3A 3MOIA 4XWYA 1KEUA 3TJRA 4BNZA 2GPTA 3UF0A 4G81A 1XR3A 3GGOA 4IIVA 1LLDA 2NVBA 4JBGA 2O48X 5JE8A 4D3DA 3E9MA 4B3HA 3RUAA 3HWRA 3BTUA 1GUZA 2H6EA 2GN4A 1P74A 2PWZA 5L51A 4P4LA 4PZDA 3GVHA 1HDGO 4IGFA 3DZBA 3WSWA 4LSMA 3WQSB 2NU8A 3VZRA 2ZATA 5ENDA 3B1JA 4GX5A 4Q3EA 1B8VA 6LDHA 4PLVA 1TT5B 2WYVA 4FR5A 4CM5A 4R41A 2GASA 1X0XA 4QT0A 3PGXA 1IB6A 3UICA 1HYEA 2YHIA 3HDYA 1I2CA 3U09A 1L1FA 1VJTA 3JYNA 3H5NA 3RC7A 2PZKA 2DPHA 3U62A 5TJHA 1V9LA 2PGLA 5A9RA 2A35A 3DO5A 4DMLA 1GL3A 4MJLA 1FXSA 1IE3A 3E9QA 4J90A 1MFZA 2A9FA 5JAMA 5AXCA 4HFMA 5DF1A 1IPEA 4YJFB 2POQX 3H7AA 4E21A 3U9LA 4HFRA 2W8ZA 2CMDA 3ABIA 4RV9A 1F17A 3FWNA 1LU9A 4HNHA 3LSYA 1U2GA 4KZPA 4Y6PA 1ZKMA 1HLPA 2DLDA 4BGVA 4JIGA 4CV2A 3ASUA 1JLLA 1FDUA
chains in the Genus database with same CATH superfamily
5IH7A 1YR9A 3LWBA 1Y80A 4QE3A 3UAXA 4IDGA 2BH2A 1G5HA 5ARDA 3W9SA 2Q5HA 2FPIB 2OBFA 1Z7GA 3H87A 1JU4A 3K1YA 5H80A 3TNLA 4ER6A 3DTNA 2PUWA 4RWZA 2XUPA 1TZMA 2REBA 2RGNA 4AO6A 2FPWA 2M6SA 3HJTA 4A8PA 3AERA 1JWLA 2I2WA 1YTLA 4HSGA 4MMYB 3H2BA 1DO2A 3KZXA 3DPIA 4C4SA 2DXIA 3DVRX 3GXOA 2AN5A 4MKZA 1N2IA 4KN5A 4D25A 1LBIA 3B60A 3WHLA 2Q4DA 2NUAB 2FSUA 5ESWA 3GVXA 4J4HA 4WSOA 5DBHX 3UJAA 5JRDS 5J5CA 2PRSA 3KK0A 3IUBA 3PHGA 3UXYA 2HJHA 2J6CA 1VIAA 4HEQA 1QE5A 4MITA 4PPGA 2ZBQA 4BE9A 2GPJA 3PD7A 4O08A 4ZWNA 1ODLA 2P8JA 3GJ3A 4RVFA 3ZS9A 7MHTA 1HE2A 2EHJA 1B14A 4H7DA 3WGZA 4LF9B 2HCTA 1ORTA 1RC0A 1U0RA 4DARA 4YCAA 1CULC 2IS1A 2GILA 4LYDA 5JYDA 1P18A 2E1RA 1I36A 4N5NA 3CVYA 1WBDA 1SFRA 3VYWA 1C9YA 4BBAA 2VK8A 2SCUA 3NHLA 5C7YA 4LJ5A 3QVTA 5HQ3A 3PXBA 3SOPA 2DB3A 3TQRA 2J0VA 2Y67A 3PEUA 4Q7KA 4MUHA 5I5EA 4KACA 3FDZA 1NVVQ 1JFVA 4BKOA 4C88A 1JV2B 2QVGA 7YASA 3PJEA 3EOAI 4BB0A 1L5SA 3UA3A 2GBLC 4JBXA 3LDAA 3R23A 2TRSB 2XNKA 2G9VA 2VQ3A 1GRVA 4URUR 2I4TA 3T5CA 3VPCA 2BCJQ 2W43A 4JODA 5A3SA 4M8NE 2HHHB 2DQZA 4N5LA 4QHTA 2EF1A 3LKVA 2IEYA 2D1RA 2R11A 4XDGA 1Q50A 1YR3A 3OESA 1CUDA 1HSOA 3RTBA 2WNHA 1PNVA 3LFUA 3HJFA 5HUHA 2A4MA 1ZVJA 1QG4A 3REQA 5HK8A 2BEKA 1UQRA 2L19A 4L95C 1Y4SA 5DN6A 4NXMB 1U8EA 4HHEA 3H19A 4C2BA 1W44A 4HL6A 5FLXA 1FTGA 2QL6A 3COVA 1JG4A 3A58B 1RRFA 3HXOA 2OP0A 4M1YA 3PTAA 3MB5A 4UNIA 4JU8A 4Q9LA 1PG5A 1CDDA 4W5JA 3QITA 5CT8A 3VDXA 1RCUA 4PC6A 4UTOA 1SRQA 1OV6A 1T2DA 3JAWB 4COKA 3T4EA 4ZKDA 2FUNB 4V1CA 3LQFA 1J20A 1KZ1A 4RBNA 4F4HA 3FYUA 1G17A 1UBMS 2HEIA 3GI1A 2DF8A 3Q9LA 2J7KA 3QNUA 4QPJC 4R0VA 2PRJA 4X90A 2IUSA 3O8QA 1JFSA 3LA8A 3R5JA 5CX1A 4ZYXA 3L4KA 2G5TA 2JIOA 5GOTA 1M73E 3ZZNA 2A5LA 3ZNPA 4RENA 2PX3A 1T4BA 3ABOB 3O4IA 4AUKA 1CR6A 1X7HA 1ZR2A 3NETA 2JK1A 3AJRA 2MJLA 3IQFA 2BTOA 1LI4A 2GBPA 3DHWC 3FWYA 3PZBA 1GAEO 2G70A 2DWPA 5C8ZA 1M0SA 1NY6A 1WKCA 5CW1A 3ZGVA 3PXXA 4GC5A 2ZIXA 3CRW1 5ALDA 1XE3A 1LSJA 4EJSC 4Z4HA 1RBQA 1ZHOA 1OVMA 4M99A 1MNAA 4ZVVA 2CGEA 3OTGA 4ZAVA 5HKKD 5FPTA 1BC5A 1DL5A 1UK7A 3RC9A 4Q3NA 2B37A 3SSMA 1J39A 1R15A 1ZEMA 1DTWA 1NR7A 3IMEA 1I2DA 3NC1C 4IY1A 4MAFA 5IEJA 1OBOA 3OJLA 4XJSA 4HWKA 4B5KA 1H23A 1QYDA 3A6ZA 3AJEA 3DCIA 3L7CA 4O5OA 3ONWA 5EJGA 3C15C 4S35A 2NZUG 4LSGA 3TKAA 1EDDA 1Y6ZA 2A1UB 2OHHA 2ZI4A 3B9QA 3EEIA 1U9YA 1J6UA 2ZB4A 2IHVA 1RHRA 2JLSA 2VEOA 3F5SA 3GCXA 4AROA 4FFOA 4LV8B 4PM4A 4TYMA 1YACA 3B7GA 1TXGA 2H5JA 2VSYA 1JAIA 3BJIC 1XLTA 3B1YA 4BKMA 5C5IA 3H2GA 5EJ2A 2CF6A 2UYHA 3FZEA 1E2NA 3F9IA 1V8BA 3MSXA 4L8GA 4O3FA 4MVJA 5K8TA 1WEKA 2X22A 4YUXA 3DGEC 4OI2A 2OB1A 1JHXA 3BIOA 4Q9IA 3C87A 2ZJ1A 1P0CA 4MCIA 3UPUA 3VNUA 1F0NA 1VIDA 4FB5A 5ICFA 3PLRA 3D9QX 2GKGA 3AM4A 2QM3A 1X42A 3KYCA 4HDMB 3FX2A 3B1WA 5CXUA 1ADBA 3MUOA 1PFQA 4OHMA 4MAMA 5EMHA 3ZV5A 5JR3A 1P61B 2JJ8A 1J2YA 3BCRA 4NHOA 4LGVA 5LCXA 5DNUA 4X00A 4DA9A 1USUA 2ID8A 3BX1A 2IXAA 3FSRA 4J6EA 1ZVQA 3MFYA 1N6IA 2Y1GA 2DYKA 3AJ9A 1TZBA 4L4YA 1EH5A 1V16B 5H9WA 3DOEA 1UJCA 1EBFA 4W1QA 1RIIA 4E07A 4OGFA 4M8IA 1S1CA 3H3FA 2HIMA 1PJ3A 2CCJA 1S7CA 3F5MA 3ONDA 2Q3HA 1DKOA 4GQIA 4JJZA 4R1OA 3RVJA 5JWRA 1XPOA 4TZ6A 4RMHA 5CFQA 3KJGA 3OCYA 3TZKA 3LQQA 1TADA 2FR0A 2C1EA 1OYVA 3PFCA 4PYOA 4G1FA 3HWSA 5FR1A 5IBRA 3OFNA 1L5LA 3PIRA 4UARA 1XEWY 3UJNA 1BS1A 1HE4A 4H4EA 1C3EA 5AHXA 1POXA 1FP1D 1U9IA 2AG8A 4RIFA 5CK5A 4J0FA 1MX3A 1XTPA 3IJ5A 4AY4A 1B6RA 1WB4A 4UDXX 2C84A 4CL8A 5HK9A 1ZSVA 4H7HA 4GL2A 4N7BA 4YCJA 5TXGA 3TTUA 3E27A 4YP0A 2W90A 3HP4A 3UAYA 3A0RB 4LX0A 5HPYB 3U6BA 1JYFA 1OLUA 2FZ4A 3U7QB 1GPDG 1YB6A 2XIJA 3AC0A 3PHJA 4QO8A 5BW5A 5I7VA 1MG0A 2R48A 3KPYA 5CCBA 2JLXA 5DMHA 1LXCA 2R79A 3TQIA 1CW2B 2EZ9A 4D6XA 4KXYA 1HNNA 5I8ZA 2CJYA 4GRIA 5B6IA 1JEAA 2ZPTX 4MS4A 3RKSA 1XD2A 2XT9A 2RJOA 4RV4A 3ZDXB 5FO0A 5HF9A 5IN5A 5U4XA 1NOJA 1JDSA 1FTWA 3N07A 5KPJA 1NP7A 2V9CA 3ZXIA 2P9GA 3RV4A 1ADJA 2OAGA 4LRUA 1KYQA 5KHLB 3PQFA 3IIEA 1IB0A 2OVFA 4UREA 1N2OA 3OLYA 1YS7A 4GRAA 2Y9PB 1X9HA 4BY9E 2HRDA 4JOSA 1DBPA 1ZMXA 4LOHA 3FD8A 4QU8A 1W1UA 4US0R 1GUYA 1IU9A 2ZTHA 4FU0A 4KQMA 2ODPA 3R4CA 4PQEA 5C4GB 4ES6A 3V6LA 5DGHA 2JDIA 4Q05A 4CT4B 5AW5A 3T9FA 3RIHA 1Q0RA 5J1SB 3BD6A 3PWSA 3OEHD 2P5TB 4QTZA 5K0TA 5FWNA 4G0NA 3W4KA 2PA3A 1RWXA 4NZMA 1WETA 1MJGM 1BHQ1 2HZBA 2ZSUA 2R0QC 1VL6A 4MARA 3WGIA 2YDYA 1UP7A 2NU8B 1NVDA 3RFUA 2MHCA 5B6PA 1NVEA 1AB5A 4OATA 4XEUA 2N46A 5KJ1A 4WKBA 4YRIA 4JI1B 2XXJA 2IPMA 4ZJUA 4REQA 5DMXA 1FNSA 1PFGA 2JAWA 4KBFA 1U0EA 4F46A 3FUXA 4TMVA 3HUEA 2ZRGA 3DE5X 1D4ZA 4GMXA 3VHQA 1GGMA 3A1NA 1KYXA 4JNCA 3SCZA 5LPNA 2QXTA 4FYKA 3JZDA 1DARA 4URFA 5AW6A 5ITVA 1KAGA 2H2HA 4DEXA 5CFNA 1T5SA 3CFYA 3FYUC 4F2DA 3G9ZA 3KSDO 4RA9A 4OHXA 3DBIA 5K6AA 1N2SA 2NXCA 2Q49A 2GPYA 2YVKA 3F5QA 4DBLC 3X1JA 5DRYA 1SN7A 2VI5A 1E1LA 2PCJA 3MNFA 4JEUA 2X7HA 4DDTA 1GYRA 1LRLA 1V3QE 2WEKA 1DB3A 3CS3A 4I50B 1WXFA 3ZJ4A 2BF4A 4B0OA 4LQDA 4QRIA 1EVZA 1PT6A 5C32A 3NM6B 4IKPA 4INOA 4UASA 1JEYB 1I32A 2GZAA 2O2XA 5GJWC 1Y8AA 3O3CA 4QJ4A 4EGJA 2OSVA 1ADYA 1TIPA 4E30A 2NVOA 1RAEA 3P4YA 4L3VA 3B53X 1X80B 4A36A 2W4IA 4HG2A 2CYAA 1HDYA 2XQIA 3REGA 1YHZA 3DW1X 3NUZA 2YY6A 2B5OA 4NK4A 2UZ1B 3VO2A 1M2GA 4JUCA 4MA5A 3SQLA 3EZGA 3L6UA 3AL0C 2IRWA 4BQQA 4HVCA 4W5WA 1EYZA 4KWCA 4QJBA 2X4IA 4FIDA 4HNAB 4NCNA 1T43A 2R7LA 5D1NA 3I9V6 1RFLA 3P2MA 4DJTA 3PVSA 3TW6A 5JI3E 3QU2A 1KZ9A 4X3CA 5J40A 2O8VA 3KHUA 1V45E 2MTBA 4DMRA 2GD2A 1AV6A 2Q2QA 1HE3A 4PAMA 1XDDA 3B8HA 3LHDA 2R8RA 3BFPA 2C3PA 4IIHA 5SY9A 3WGJA 2DQSA 2IT1A 1QM5A 3C97A 3GVIA 3MJRA 3PI7A 4B6RA 2B83A 4OUKX 4UHJA 5AW2A 1DZIA 3WDKA 4G26A 1RPTA 2ON6A 2FFQA 2XA2A 2XKJE 4R0MA 3KBOA 1KJYA 1AKRA 2Z8YM 4S0XA 4ZCRA 3E8SA 5DK6A 3NCHA 2CT8A 2AC4A 5CT5A 1GWNA 1D6JA 3KZCA 2HCRA 1FP7A 3EPRA 1XTTA 1QQTA 3DFKA 4R5MA 1YR7A 2O8EB 1PQWA 2FPOA 2KI5A 4TS1A 3LCJA 1MNQA 2GZDA 3FVWA 1LWOA 4TYQA 3WLMA 3RROA 5AW8A 1N7IA 2VA8A 2GO7A 4TMKA 5AW9A 2IYEA 3KE9A 3GRCA 4FT4A 4ZHQA 1DBRA 2ZPAA 1I6LA 1AC5A 2LNDA 2P1ZA 2ZRNA 4UM7A 5H59A 1AS3A 5LXTF 2WMYA 4CT0A 1ZAYA 1GKYA 2V96A 3H2IA 3LD9A 4N0EA 3O93A 5FUVA 3DLTA 4BJ5A 4E33A 2OFXA 1JTVA 2Y1CA 5BOSB 3EHDA 3T3MB 1SVMA 1RAIA 1VSQA 2C9DA 4RTOA 3R9XA 4D44A 5CDSA 3I9MA 3LC1O 3KQUA 3B1VA 3OF3A 3AHHA 4O2AB 4A16A 5BVHA 1QU3A 1QZUA 3BILA 2NNWB 5JSZB 1SVLA 2OM2A 4TTTS 4X1IA 2I9PA 4S12A 3WK4A 1NQ5A 1BDMA 2EFDB 1U9IC 3ACDA 2LZ0A 3IEKA 3QFRA 3RUHA 3WE7A 4NIMA 3WNDA 3DGFC 4NFSA 4UPVA 2WHPA 3HVKA 3WGKA 2UVPA 1KWKA 4NJEA 4Q1BA 1DKUA 1MPXA 3E7PA 1FS5A 1LC3A 2IU3A 4DA0A 3P97A 4RW0A 1G21B 1NN5A 4IHKA 4UXJA 5ALJA 3F3SA 1ZC3A 4YLGA 2DBZA 1NVVR 1P9WA 4QU0A 2Z6VA 4S2UA 2ZETA 3LRXA 1M6YA 1WIWA 1PAUA 1YVRA 4I1YA 2R44A 1YCDA 4PS0A 4DIOA 5CCXA 1XUOA 4KPUA 3UMCA 3I01M 3JQRA 1BCSB 2JGRA 4YI3A 2LGJA 4JP2A 5DXFA 1PTJA 2HFJA 4HH0A 1N3IA 3FZNA 4I9HA 1SXIA 1FDRA 4KWHA 1SCNE 2J5QA 1HETA 3LPNA 4QC2A 1K5HA 3TGPA 1EFAA 3RRNA 1LTQA 4TWJA 3ZWMA 1GZ3A 1T24A 4KSBA 2PZFA 1FDOA 1ULSA 1OLOA 1RYFA 4FDLA 4G63A 4MQ6A 1JHAA 1Q1GA 4KAXA 4S04A 1WTCA 4QXQA 4OUDA 2F1OA 4IINA 3RYIB 1I2AA 2E4VA 4PX5A 1YJ8A 4MS1B 3IP8A 4F2PA 2XGGA 3C41J 4U39A 2ZE5A 1DAIA 3OFND 2RMKA 1T3TA 3F7MA 5BQPA 4C78A 1HNZB 5GMOA 5KVQA 2ZAIA 4RCVA 5JROA 4PLCA 3AEQA 3VPHA 4A0RA 3EXHC 2BMJA 2C8VA 3AILA 2QJRA 4BO7A 1DUIA 1ZH4A 1ZR4A 2FMHA 2RHGB 2PX6A 3HKDB 1P6XA 5JSQA 2O4CA 4FFMA 1L5NA 1UXIA 2I1QA 3O83A 3PPXA 2FR1A 2BMWA 2QRUA 4P4TA 4AP5A 1W85B 2Q9BA 3L6OO 5K0ZA 1GU7A 5AKIA 1E66A 5M29A 3VRHA 1NUPA 2R4UA 1UFRA 4IOLA 2FY8A 4H59A 2BDTA 4U9IS 1L6IA 2XMSA 1USWA 5E6SA 2ZBVA 4LECA 1JH9A 5C4IA 4Q9AA 4II2A 3AZPA 1IN5A 3MJCA 3GA0A 2LE0A 1QG2A 3CNLA 1E9DA 2B3TA 1QIDA 1H6AA 3IQWA 2PIAA 3V4VB 4CI0B 3HI4A 1V8OA 5K6AC 1QP7A 1YGYA 2I9KA 2BMEA 3ZV3A 4KK3A 1E69A 4NATA 4OJMX 4Y2TA 1UZMA 1IJBA 3V5NA 1PFYA 5IASA 3HB0A 1T26A 4TKUB 1R3UA 1ZIDA 1NVFA 4LYJA 2Q5LA 5YASA 4CF5A 1EFCA 4XIJA 1ABFA 3FVQA 4ODIA 1JU9A 3PXUA 4MQBA 4MYUA 4RD6A 3MJHA 3QY0A 5G4KA 2IJGX 4G9EA 3FSJX 4X24A 1BVYF 3V2HA 2QRMA 1QG6A 3A9CA 1DUVG 3FLAA 1L3BA 1QGAA 4CMHA 4LV5B 3KSBC 1W94A 3U39A 1W4LA 2WFLA 3DDCA 3ADOA 2BZ1A 1CIVA 3D8TA 4JI3B 1MVOA 1FMFA 1OFVA 2XA9A 1KJ9A 2VP3A 4X91A 5TT1A 1NL3A 4EARA 5HG0A 3CKKA 3MJSA 1W47A 4OKIA 3T1NA 1Z35A 4IV8A 3ZPXA 1PSWA 1Z4OA 4CKCB 1BRTA 1A7AA 3C6YA 4IHJF 5LMUB 2R6DA 3C5VA 1IWBB 3COZA 1EVEA 3COSA 1V35A 1W5EA 3QXHA 4JKIA 4Z3OA 5KHAA 3TDKA 2D7CA 5BRNA 1LRJA 1EFTA 2VDRB 4HGZA 3TBKA 3ZLTA 4BRUA 3VV2A 5IAOA 1Y8ZA 1OWMA 2B34A 1XQ9A 1IEVA 1SXJE 3FYCA 2WPNA 4RTNA 3PR3A 1KOFA 4TL9A 5AM5A 1OV4A 5AK3A 4ENWA 2A3RA 2WT4A 4NYIQ 3SJ7A 1XLUA 4Z9AA 4TSRA 1YJCA 1EB9A 5EVJA 5HRUA 4YP9A 4YRAA 2JCVA 2ALJA 2VHXA 3ANYB 2G9QA 3FOBA 2AH5A 1NLMA 2VWQA 4MDFA 4BGIA 4F4IA 4J0HA 5CH8A 4TLMB 1J9EA 1SB9A 2GB4A 4MKIA 2O59A 4GZLA 3THRA 1YA4A 5IWAB 1RRPA 2HLHA 4CTOA 4EEXA 1RJEA 1YE3A 4RU1A 5DM4A 1NWHA 3PGKA 5IAJA 3S99A 5WRFA 2CDNA 5B58T 4J0EA 1JTEA 3E0XA 1UPUA 3OHSX 5E3IA 2AG5A 5FFMA 5JJIA 2OZVA 1QHHA 2ORWA 3RS3A 5A4DA 5BWBA 5MGNA 3C3DA 3WMFA 1P9NA 1KL7A 5ARBA 1ZI8A 1RI3A 3HBJA 3U56A 4G5OA 1PK7A 1Q0PA 1H8HA 1HF3A 4FYPA 2RH8A 4CL2A 3O1JC 4IQ4A 3RJMA 4EKGA 2XBMA 4JVSB 3JYHA 4ZAZA 2Z98A 1H0HA 3NVAA 3JYQA 5FORA 3OU6A 4MROA 3HRIA 4IF4A 3AR9A 3AI3A 1AZTA 4ZYWA 1YVPA 3JW8A 4MPJA 5BN3B 3A11A 1SPXA 3DB2A 5K9ZA 2CLOB 3INYA 5C18A 1T9DA 2QMQA 4QU9A 5A2QA 1RLIA 5F52A 2R9VA 4HVLA 4J76A 3HL0A 1L3CA 2B8JA 5J58A 2PDAA 2FPGB 4BFUA 1E2IA 4L5JA 2NUPB 2ZG6A 4UM5A 3SEQA 2H0QA 5DNYB 2BL4A 1KK2A 2CSUA 3B20A 3AHJA 2QRJA 1NHGA 2ODEA 4TYPA 1T0HB 1U2DA 3GU3A 3LFHA 1DBWA 2AD5A 4NYMQ 2O2YA 2HLPA 2WVHA 5EFZA 4AK9A 2GXAA 3DV9A 4MO9A 5KC9A 3O7MA 3ZK9A 4OIMA 3EZLA 3C8HA 2I7TA 3A04A 3PF9A 2QJFA 4P9NA 3UJHA 3JWGA 4BFCA 2W2NA 4DT1A 3W7VA 3VZCA 1NI4A 4MRPA 4EY8A 2HGSA 5CT4A 1FSSA 3C3KA 1Z13A 4BWGA 3F5DA 4EI8A 1REQB 1SUFA 2QRKA 2ZSDA 5IKXA 1PTJC 4B2LA 3IIKA 3RHFA 5GINE 2FE4A 3LQKA 3GVCA 1TGVA 3LT4A 2H2GA 2WG2A 3VSAA 2G80A 1N0WA 3M49A 5K3FB 2XCIA 2Z2KA 1V7QA 4A73A 1XGKA 4NPHA 4B43A 1D4AA 4P84A 1B93A 1U2RA 1VHDA 3EC7A 5AUQA 1ZW1A 2BR4A 2VSQA 4V38A 3AVVA 3AFOA 3GMDA 3K2EA 4BFVA 2BKEA 4CQMA 1E1YA 4IXWA 1B23P 4JU9A 4YJ3A 1UANA 2ZWAA 5CJJA 1JBKA 4DMUB 3ZXUB 3L7DA 1JIKA 3EYAA 3KQOA 4LJ8A 4W63A 1P45A 2G82A 4IIXA 1FFYA 1UJNA 4WIAA 3IRVA 5IX8A 3ZGXA 3PI6A 1KAMA 1R12A 3WIVA 1Z3CA 4EH1A 3JQ7B 2CLCX 2V7WA 3ZCVA 3UJ6A 2VC2B 1SUIA 3GY0A 3PPVA 4DE5A 3RUFA 4P54A 4AD8A 4YPVA 3NIBA 1YR8A 1FL9A 4FZVA 3ADCA 3AH8A 1EK0A 1M3SA 2I54A 3CIFA 4MV6A 5A6SB 1NBWB 4BQFA 3MLAA 2W6PA 4DRXA 4EVIA 1K06A 2QQ5A 5LZ2A 3KJEA 5EE5B 4CM4A 4HB3A 1Q0ZA 2ZRLA 3BWMA 3DS8A 1WDLA 3G3EA 1BH6A 1GZ5A 4HUQB 5G0TA 3QMMA 2J3LA 1D2EA 4FS8A 4OHBA 2GBIA 1HEYA 2OLJA 1U7HA 4Q34A 4WXEA 4FK8A 1EVQA 2AFIB 2Q3LA 4WEQA 5F1PA 4IW3B 1O94A 1S8FA 3WDLA 3GWGA 3W9BA 4YH1A 1W96A 3BXFA 2ZYAA 3ZX4A 1C81A 4Q3OA 1FTSA 4R7TA 3RYFA 4EHBA 4D1YA 2PYIA 3Q72A 4G07A 5MFPA 4XEHA 5DLDA 1JKJA 3KOOA 2FZVA 2OLEA 3FIUA 4NCKA 3TVTA 1CEEA 1G1AA 1B4DA 1H5QA 4CF7A 5J2UB 1T6ZA 2FQYA 1EPUA 1A4UA 1GGJA 4IJ5A 1XZLA 2W00A 1E1DA 2VSFA 5F7ZA 3PQ5A 4AG5A 4YPOA 3C16C 1OJ7A 2JGAA 4J29A 3ZCXA 2UVQA 1VKNA 4FTWA 1CJSA 3HCPA 2OM6A 5ERXA 2C8KA 3BPSA 3KG2A 3SQMA 3HFJA 1HE8B 2QJTA 4I4CA 1JXMA 4PO3X 3ZHSA 2PS3A 2P27A 3M1LA 1NDHA 2VP9A 5AXBA 1TYAE 1LVUA 3MFQA 3T1QA 3ZIUA 2B36A 3VUFA 1NMYA 1X3SA 3FE2A 3IIJA 5BV2P 3NH9A 4PNPA 1V7PC 2PH7A 3FHCB 3CX3A 2J9RA 4RMNA 3UG7A 3PC6A 1GKLA 3LUFA 4IR7A 4XSHA 9LDTA 3M1IA 4B6OA 4QJ3A 1A5BB 2A2ZA 3GUZA 3CH7A 1RZ3A 5DNAA 4D96A 1FP6A 2ZSIA 3G79A 3O75A 3WXBA 1XJCA 3THXA 2VRCD 5ESDA 3TNYA 1KFEB 1VHLA 3UXEA 5ALTA 1I3LA 2XWBF 1UWKA 3CUEF 5BYBA 2RJNA 1NJGA 2ZBRA 4JN6B 2C2MA 2JAPA 2P41A 2VDUE 2NZWA 3AEYA 3BWXA 3R5HA 5CUQA 4CG0A 3H6HA 1OXTA 1DC3A 2ENWA 2K7ZA 1OILA 2V4MA 3HZOA 4HB2A 4DCMA 1P2FA 4P4SA 4U9UA 5C8VA 1KY4A 2HQBA 4DR7B 4Y2SA 2UYYA 5A4FS 3BMOA 4LRWA 3MD0A 4PQFA 1PR5A 5AKKA 2LCFA 5AWFC 2RI1A 2WWFA 5EIWA 5GAJA 3I8OA 4BAZA 3D8HA 4YJGB 4V1CI 2RGCA 1Z73A 3ESAA 3NWOA 3QU4A 5FLEX 4WOCA 3VSDA 1AV7A 3JZAA 2MINB 5A03A 3I9NA 1UPFA 2FMUA 1VE3A 4I99A 3ROKA 3SZMA 3X43A 1JPVA 4AW9A 1C0IA 3IMGA 3L0PA 1K8RA 2RI0A 1IN4A 4DM7A 1O0BA 5DULA 1HRDA 3JU3A 5DU2A 1ARZA 1QNLA 4INZA 2B1JA 5FBVB 4GYJA 3BDAA 3P52A 4E1AA 3SKYA 4EG8A 5IC6A 1E2MA 3VU9A 1TK9A 3R3SA 3P9XA 1Z22A 1H1TA 2OP1A 2YOHA 5BWCA 1FMCA 1ZU4A 1YH3A 4HLNA 1Q11A 3WY9A 3ZBUA 4EF5A 1X1CA 2OZEA 1IHDA 2WSBA 4KSYA 3VTKA 5HRCA 4XYMA 3KDAA 4R83A 4E22A 2WJ3A 1A27A 3GFTA 2WRZA 1H93A 2D3TA 3HV2A 1WMSA 4OQYA 3EIQA 4F3CA 2H9IA 3TLGA 1E5VA 2BFWA 4L6IA 1DTSA 3D1LA 3HCEA 3MJFA 1ZQ9A 3KSUA 4IP0A 5BSTA 3R3YA 4XFDA 4ZV4A 1YZKA 3HKEB 3NGXA 1LF5A 3IT0A 5DX8A 2QTCA 5DTRA 4Z0NA 4MW7A 1AQLA 3RT1A 2XDAA 1G8SA 1HI9A 2H2IA 3PQEA 4M0MA 5HE9A 3HCWA 1VB3A 2DWCA 2QUKA 2A30A 2PUJA 2YHAA 3N2GA 3IDOA 3B1ZA 1J2UA 3ANNA 1R0BA 2FW6A 1FFXA 2JJQA 4KI7A 3SK0A 5JH7A 3GLTA 4HH4A 1T5TA 2P75A 3ETCA 1JQEA 2IXGA 1M6EX 5GIOE 3K8ZA 1KIMA 3UWMA 4BLVA 3MQ2A 2VQFB 5PGMA 2YQ5A 1WWKA 3NOOA 4Q4AB 1W5SA 4C0BA 2F3SA 2PMKA 3KR0A 3UGJA 3I0NA 5D85A 4EG7A 2FYTA 4Q6BA 5MN6A 4RHYA 3H4VA 4CMCA 1M2VB 3G9UA 4PZCA 1T8TA 3OIYA 3PDJA 4B40A 1S9DA 1L4LA 2EATA 3CJQA 5TX7A 2CF5A 4HN4B 3DWIA 4ZJYA 1C9JA 3ID6C 3VAYA 4ARZA 4F84A 5DI9A 3MHTA 2CXUA 3ZJTA 3RKRA 2XB8A 4D41A 3L7IA 3RRYA 1GL7A 4RTSA 1BWQA 4P5PA 5A4KA 5BWOA 3VOSA 2AOWA 2DHEA 2WC1A 4KV7A 4QL3A 3QU9A 4FKMA 4RMIA 1OOEA 2PX0A 3G1WA 3UJ9A 4IIFA 2GPAA 1W581 2CD7A 2H08A 2RHDA 4A15A 3ZU5A 3L0OA 4PSCA 1RKUA 4BRZA 4CMBA 1W1IA 3F67A 4N01A 2ZJ5A 2UV8A 4C07A 1G3QA 2XMDA 5BR7A 4NV0A 2NOAA 3AIOA 2HRBA 3QV2A 4XLLA 1TD9A 1OTYA 2QU8A 2P4HX 2XEXA 3G5LA 2PWAA 4D8TA 1FQJA 5EZYF 5NLLA 4M86A 3KQNA 2HA3A 5EQFA 4A91A 4EGCB 4AN4A 5IAAA 4XIGS 5KOIA 3E5MA 1R0WA 3P20A 1KWGA 2Q8NA 1XRQA 4LMAA 1LGYA 3ZE2B 4E5DA 4BNDA 1GTJ1 5LIPA 4QQRA 1HZJA 4FWIB 1UOOA 2GWHA 1P1JA 4HNUA 5FOQA 1B6SA 4PLTA 1YSCA 2AR0A 3FF4A 2O5CA 2AYZA 3SEAA 1EWTA 1ZK0A 2BFDB 2QKYA 2ST1A 3V9AA 1A8IA 1WCV1 1BN6A 2VJDA 2EFEB 1U1DA 4I5EA 2F2TA 2QBYA 3AGPA 5A9TA 1RP1A 1Y4AE 2PM8A 3A10A 3EFOB 1DIRA 4RKEA 2H4JA 4IHJB 5LKRA 3ZI0A 3UMYA 4C3ZA 2C7QA 3WRWA 4PG7A 5T4BA 1BW9A 1M1UA 2ZULA 3OQJA 3JCZA 5JEEA 4IRXA 3N8HA 3NALA 1KEEB 2PGNA 4U0KA 3NP7A 3BJEA 2WSLA 4ITVA 1UBTS 4ZU1X 4EZIA 4ZMRA 4DV6B 2VBCA 2YJ5A 2EKQA 2NX2A 4KGXA 4FP9A 3GQVA 4XLZA 4Y6QA 4E94A 4JA0A 1P8JA 4RMGA 4B82A 3F2VA 3V8RA 1P5HA 1R3DA 3B7WA 4IL5A 1JDJA 1VKZA 2XAUA 1EWRA 3QTBA 2CW5A 1DAKA 1WZIA 3RWMB 4UZSA 3KJXA 2J0EA 5GM2A 1QH1B 4OYHA 3SLGA 4J3NA 4LHYA 3TJMA 2CNNA 3NKFA 1QPBA 2B35A 5AVQA 3TW4A 5BSEA 5ANRB 5EP3A 2Z09A 1ZJYA 5DNDA 4NYIR 5TMPA 1H2XA 3IHLA 1E9EA 2MSWA 2DLCX 1SBYA 4KCGA 4OBBA 4DBZA 3ROGA 3WZLA 1SA0A 2UAGA 1JIUA 1ZOSA 4TSKA 1YHYA 4CKWA 4LV6A 1V4BA 4LDJA 1KETA 5HDBB 3NEYA 4OQDA 3TLCA 4M1QA 4ALMA 1KAEA 4K26A 2WDPA 4E5YA 4F97A 1ZRHA 2MYTA 3A6GA 1HYGA 1IC6A 1MX5A 4LGCA 3T4XA 3WWOA 3WWZA 4EB6B 3T12A 3GLHE 4DOMA 1JQAA 2Z95A 4KXVA 3VH4A 2C0CA 2RONA 1UODA 3M70A 3VVLA 3O1IC 3SX0A 2QTRA 3LE8A 1X7YA 3OKPA 1Z7YA 3T9BA 2R6R1 1TQHA 2UKDA 3D8BA 1V5FA 3T5AA 3HCCA 1FX1A 2FUG1 1ST3A 3ZH9B 1AG9A 3E9ZA 3ZDEA 2MWMA 2AFHA 1G18A 2C1XA 1XCGB 2R6GA 2PRIA 4LZJA 3V42A 1TM5E 3GGGA 3ES9A 4ZI7F 1M2HA 1HORA 5HMMA 1MIOB 4B3JA 1VA4A 1E5TA 1CU1A 1SHUX 1CZHA 4HSEA 1ONPA 4LZOA 4MVJG 4D9BA 1PEDA 3SVTA 5KQSA 3OCUA 4BN0A 1W29A 2UUOA 5K5EA 5COAA 1WS6A 1JHZA 1K5DA 4QDXA 4F4FA 2C78A 4BZPA 4GKJB 3WICA 2HRZA 2OD2A 5AM1A 3FMOB 3VX4A 2ADMA 2WHQA 4BNLA 1FJ2A 5AQ1A 5AW3A 2Q41A 2IY7A 3MRSA 2NPIA 5KOYA 1I1HA 4FN4A 1ZGAA 1TYBE 4YMIA 5EI5A 2WV9A 3RGGA 2F59A 4LJ4A 3U2QA 5IYZB 2YZNA 3C7CB 3FYTA 1B2RA 1EFRA 4I1RA 1RXYA 1SHKA 3OLWA 1YJQA 2BMVA 3QJ5A 3FUVA 3ZKWA 3HN2A 1DPGA 1U02A 4O4IF 3HSYA 1QZTA 5FXMA 3PJGA 4QGHA 4QYXA 1OFCX 4MUYA 3BSWA 2CYCA 5FOWA 3G2PA 3LT0A 4UVEA 4KNYA 1Z0AA 1UJ4A 1AY0A 4CTNA 2XV1A 1ZD4A 3GRAA 3Q0EA 4YUAA 3FPJA 4HXEB 4E5VA 3DDWA 3V7WA 4B2IA 4TTRA 5DGCA 5I8WA 3WIDA 1EG7A 1WULS 1WZCA 2IBMA 3K32A 1NXQA 3TLMA 4EDFA 4O4LB 5SICE 2FZ5A 4GKKB 1RHJA 5KX5F 4WK6A 2PLFA 3RWBA 1KY3A 4PGFA 1AKTA 3I04M 4ZO9A 2G7ZA 4GECA 1R6XA 2PIDA 3RTAA 4B7XA 2M98A 5CR9A 4LF6B 5AHKA 3FFXA 1IMOA 2XITA 2I4RA 3LGSA 4ARUA 2VS1A 3W2HA 5KTPA 3MUFA 4HRAA 3G0HA 2IA5A 4XYEA 3CVUA 1LSOA 4YWJA 3Q4GA 1ZJZA 4WCVA 3EDRA 5D3ZA 1K3UB 1U6JA 2W2VA 3O90A 5JS1A 2E6KA 3SXUA 4DUZB 4HGPA 1Q1ZA 1NLFA 3HUTA 4R05A 2FSSA 4C0KA 1LVGA 1YWGO 4QELA 3QVOA 4QD3A 3KUXA 4L4RA 2C2WA 4XGIA 4ND7A 1OI7A 4R1PA 3EVZA 5DYTA 3NGMA 4LDZA 5K01A 4HXGA 4B31A 2Q6IA 4AECA 4DR4B 4R54A 1VBNA 2WVAA 1Q77A 3A26A 5EYPA 2Q45A 4OLBA 3LQYA 3MC1A 5K8CA 3IDAA 2HFKA 1AIPA 3PCXA 1J42A 4ZVKA 3SEFA 1D2CA 4CCYB 1HG1A 1OFTA 4PZPA 1QFJA 8ADHA 1L8OA 3DZJA 4BQPA 3WSVA 1MT3A 2VDPB 1CR0A 3K72B 4PC2A 1YCHA 2W48A 3NJ8A 2Q3JA 3Q41A 2ICAA 4C4PA 4RQTA 4E1BA 4AO8A 2WD7B 2ZCUA 2H2DA 1ZCZA 1NLYA 3QP9A 2WSYB 3T7KA 3UMFA 4TLEA 1EFVB 4PHHA 2G88A 3WG9A 1EWVA 3ZTYA 3PNSA 3TRKA 3RUIA 2Y1XA 5IDWA 4G0MA 1V3TA 2IIPA 5C37A 1DG3A 3B9BA 5DCLA 4GDFA 2IYAA 4O29A 2R66A 3QWFA 1IRXA 1FEZA 4E0BA 1ZVMA 4HZUA 2KM1A 1NF8A 5KTRA 4V0MA 2VDWA 4H3SA 1QGOA 3GCZA 4BVFA 1IZZA 2PL5A 8GPBA 1C9EA 1N1DA 4YRJA 3BL6A 4YMWA 3VKUA 1L7MA 4YEDA 3BGWA 1QCDA 3FTQA 3NPAA 1QHFA 4R1MA 4Q1AA 4Z9BA 1YUBA 4YREA 4CL3A 5HBRA 4P3YA 1JEOA 4XH9B 3KVOA 3LPLA 2P1DA 3P2KA 3TE7A 4CGYA 2D00A 2DC1A 2Z3ZA 3KJHA 4M9RA 4U2CA 4DY6A 5CDFE 5CNIA 5P8WA 4DLYA 1AVTA 1II8B 3OSUA 4OXIA 3GLIB 3E35A 3B1FA 3KB8A 4G3XA 4KWTA 2IIQA 2WJHA 1T3ZA 4TLDA 4WLOA 4B6EA 2FSGA 3T7CA 4B3SB 1M2OB 2FOLA 3R2JA 3VNQA 4ISBA 4N3AA 4U1RA 2OFWA 2IK8A 3NDJA 4BAUA 4F1JA 5H3HA 3K70D 9ABPA 1J7JA 1ORWA 1EU1A 4LQLA 2A67A 5CVVA 4TWAA 4LX8A 5JXJA 2Q3EA 1C2TA 4INJA 1K0UA 1XROA 3QWBA 1FUUA 3PDUA 1P39A 2YWRA 2P9QA 4TM8A 2I67A 5FV7A 1YO6A 4PHCA 4NOKA 3URMA 2X19A 3A6DA 2BTEA 1R18A 1TMKA 2UYOA 4WOBA 2J1LA 3JVEA 1V6SA 1JLRA 2DQ4A 1C3OA 4O63O 3RUPA 1MP0A 2ZS7A 1J0AA 4DLUA 2IEAA 3CEHA 4P4NA 4QXAA 4A6DA 3E3MA 3BXGA 5B30A 1BKSB 1K98A 4YAJA 3RS7A 3SDSA 4DIDA 1Z6YA 1A2OA 4BO3A 5K20A 4DREA 4BVBA 3ANTA 2F1KA 4EUSA 2O8FA 2G1AA 2QPOA 3W6PA 4M9SA 1GR1A 5KCMA 1V5WA 2FSVA 1XDWA 4BECA 4RUKA 3VQTA 4JJ4A 1E5QA 4D42A 2VEDA 4DEVA 5F35A 4WLVA 2VL7A 4TXJA 1L5ZA 1XXHE 3E3LA 2A5GA 2ODTX 3EIXA 3R0ZA 4RY8A 2VRWA 3KOMA 3UGKA 2GHRA 4NU5A 4C6SA 2B5VA 4PFKA 2DPLA 2I3GA 2FMFA 4I4TB 1NUSA 4X9XA 5KSPA 1QKKA 1F9EA 1PR9A 2DWOA 3ORRA 1RZRA 2OBNA 3GLGA 2FLVA 3EG9B 1U0SY 5JJ5A 3OQ1A 3ZHVA 2QTMA 3C6BA 4JJKA 3HE3A 3PCRB 1ZA2A 4TMXA 3WLSA 4FFNA 3ETHA 4BASA 4RELA 4OGKA 1KJQA 4R1NA 3G8YA 2P9JA 2B92A 4IZIA 1U81A 4ESEA 1GT6A 2FWBA 3EDOA 2YRXA 4QLBA 4WI1A 5LD2C 1VCIA 2BFCB 2QMHA 3ICEA 4NY1A 3HVRA 3IP5A 1VL0A 1DAMA 3LCRA 1WF3A 1L7OA 3RVBA 2WD8A 3G5AA 4Z1MA 4BMOB 4COOA 3UTCA 2IVZA 2JLCA 5TQ0B 4YRNA 2JFZA 1T5DX 2F4NA 1GU1A 2JJYA 4J6FA 4K1XA 3O03A 2H4FA 3OE4A 3L8DA 3QKTA 4HWRA 4J7UA 3WIEA 2XMRA 1C3LA 3VU1A 3EGIA 1PR1A 4RPCA 3ZZ0A 4EFDA 1N3BA 3QSGA 1J8DA 1YBFA 4ESVA 3M5CA 2JD1A 5CFOA 3VPBA 1PWYE 2F8TA 5FNVA 3G85A 3VPGA 1QZ3A 2Q6KA 1X7WA 4Y2UA 3HN6A 2DUJA 4IM7A 1I51A 2PU7A 3BTOA 1GZ4A 1NJ5A 3G49A 1GLVA 3P9CA 3NEPX 2VJMB 3Q9NA 3QI7A 1DLJA 1U8YA 4R0NA 2EWVA 5F9FA 3FOAA 1G5TA 1ZCJA 3HV0A 1M66A 5JAQA 4IWXA 2DPYA 3G0BA 4WECA 2G6TA 2QVZX 3IELA 4AYXA 2PO5A 1LPBB 4IOMA 3UT5B 5EZYB 4LF7B 4EHFA 5LQMA 1QOQB 1DEXA 3WAGA 3PQ8A 4CF4A 4PYJA 4G85A 4M37A 5JMOA 2F8LA 5FWXA 4D9GA 5IMSA 4HYYA 1MVNA 2Y05A 4RLHA 3K0AB 4JBYA 4FR0A 1CF2O 4YRLA 2X1VA 1VKRA 2JGIA 3SIRA 4WBNA 4ESOA 1Q84A 3CF2A 3LCUA 4ZOLF 3INNA 4MTLA 2GETA 3LFTA 3Q12A 4HR7A 3A6LA 5CIQA 4KPGA 3V33A 1IBKB 3WMEA 4E3ZA 3KWLA 4QBIA