1M66A

Crystal structure of leishmania mexicana gpdh complexed with inhibitor 2-bromo-6-chloro-purine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords Glycerol-3-phosphate dehydrogenase
total genus 133
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m66A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m66A01
4IPTA 1UZNA 3JQ9C 4GGOA 2IYOA 4CM8A 1R4NA 3ADPA 2BKAA 3KLPX 3GEDA 5L9AA 3ZDFA 2CY0A 4E30A 1PL6A 2OOSA 5LDHA 4O59O 2B36A 2G5CA 2OHXA 5L7WA 3X2EA 3ABIA 1QYWA 1JA9A 1NVGA 3OSUA 1EE2A 1JKFA 5CDYA 2NVBA 1T2EA 3EHEA 4R4JA 4XX0A 1IZ9A 3JQAB 4YT8A 4Q3NA 3VH1A 4WNIA 3HFGA 3GVCA 1GV0A 1SEVA 4YRDA 4DPMA 1HE3A 2GN4A 3WICA 3ZU4A 2HAEA 1U3UA 3ZWPA 1MXHA 3OJOA 4RLSA 2ZCUA 4P22A 2I67A 5GY7A 5H82A 5H81A 1I3LA 4RF3A 2P91A 2Q2VA 4RCVA 4IQ8A 5KNLA 2DKNA 4UUNA 5CDTA 5I7EA 4UVDA 5COBA 1P3DA 4CM8B 1QRRA 3MJEA 5KVQA 3UCXA 3FR8A 3JD0A 4E31A 4HUJA 5F1PA 2NVUA 3UICA 1GU7A 2Q2QA 4GLLA 2R2GA 4JJIA 3VAZA 4DRYA 3AUAA 3I1JA 3JCZA 2Q3EA 3OA0A 5DCWA 1UDCA 1VM6A 4K9DA 4B8ZA 2PK3A 4EUHA 1I10A 4YJHB 3RU9A 5CFZA 4J4HA 1NWHA 3BMQB 2AA3A 3I9JA 1LDGA 3E9QA 1K6XA 3IS3A 4INAA 4YB8A 1GPDG 1YE3A 3C8MA 1ZJYA 2HCTA 3GG2A 1EFLA 4BL5A 4CLRA 1J5PA 3QVTA 3GGOA 3W8EA 2YQ5A 1LDMA 2GLXA 2HU2A 2VZ9A 5EINA 1BW9B 1NQAO 4DLAA 1EQUA 3VKUA 1LEHA 4YAEA 4BOYA 3JYPA 3ROQA 4WLEA 3N58A 2BHLA 1DIAA 5J23A 1T2CA 2HRBA 5I9NA 3W8FA 2A92A 2YY7A 4A0SA 3WGYA 4ND4A 4RZHA 5LC1A 3HE3A 1GDHA 4GH5A 4DIFA 1R37A 2D5AA 3LT1A 2B4TO 3WGZA 2NM0A 3S2FA 1R6DA 3DDNA 2ILTA 2EP7A 3ROMA 3ZU2A 2DT5A 5EN4A 3PHIA 2PLAA 2JCYA 4GX2A 3D1LA 4ALJA 2DBRA 1N92A 3F1KA 3PP8A 2NWQA 3JQCA 5C5IA 3F46A 3PGJA 1Y7TA 3F9IA 5CPFA 5TRTA 1ISFA 1EVYA 3NDRA 4HV4A 4I9HA 4WLOA 1TT5B 4E13A 1BW9A 4WK6A 2C54A 4NDNE 4ZICA 5C7OO 1NBOA 3H6KA 4LGVA 1AXEA 4PLYA 3JYOA 4TKLA 3QE3A 3VPHA 5A9TA 2BGLA 4JCOA 4EEXA 3GG9A 1J6UA 2C07A 4K6CA 4GBJA 4UVGA 4AJEA 5KJFA 3BMOB 3DEYX 4MVJE 1Y1PA 5FI5A 3A9WA 4FFLA 4RVGA 2R00A 3WGHA 3CPSA 1ARZA 1TVEA 2GN6A 2OBYA 4A10A 3G0OA 4BV8A 1XWFA 2I65A 3C7AA 3CTVA 4L73A 3R0IA 2GN8A 1G6KA 3AI1A 1DLJA 1Q0LA 3BMNB 3D4OA 4Z0TA 3PPIA 4BGIA 2B4QA 4B7CA 1LA2A 2RCYA 3WR5A 3TOXA 3OMLA 4M55A 4J7CA 2E48A 5ILOA 1EBUA 1V3UA 1ZSYA 4CMGA 1O89A 2VTEA 3LF2A 5A3JA 1QYVA 1LQUA 3DTYA 1NPYA 1HZZA 4AG3A 2EKPA 2EKQA 5EESA 4DWVA 3ZNQA 5B12A 3NDJA 2WJPA 4XDZA 4CM3A 4HFJA 1Y8RB 3JQFC 3KZVA 3JQGB 4IMPA 1L1FA 1XELA 1YKFA 3WIDA 3WIEA 2Y66A 1LC3A 5IDQA 1LNQA 2Q50A 1V9LA 2VN8A 5JE8A 1QSGA 3RJ5A 3AOEA 3DOOA 3SC4A 1K89A 5JCJD 2G0TA 1P1IA 5BT9A 4NNJA 2CFCA 3QRWA 1H2BA 5I9LA 1RM0A 2VHZA 4BHTA 2NLOA 3G79A 1ZSVA 5IDYA 1W0CA 4CM4A 4H16A 3PYXA 1B7GO 4BB5A 2R6JA 4BO3A 3C1AA 4XYBA 3BTVA 4EDFA 2B5WA 2YV1A 2G76A 4DC0A 4MIYA 3H3JA 2BFAA 3GLQA 3TOZA 4AFNA 4CV0A 3G49A 4AJPA 4CV1A 1K2WA 2JD1A 1TA4A 2NVUB 4OM8A 2VNSA 3JQ9A 4IDCA 2XXJA 2NU8A 3ZNNA 5HM8A 5JAZA 2D2IA 3HDYA 4R1SA 4IM7A 3BXXA 3FTPA 3HUDA 2YZ7A 2WYWA 3CZRA 2PY6A 1Y8RA 4L8VA 4OXYA 1PR9A 1VJTA 5BSEA 1EVJA 2Z1MA 1ZK1A 3GDGA 5DT9A 1EVZA 1KEUA 1YQGA 2CDAA 4LCJA 3KOUA 3Q1LA 2Z1NA 5ES3A 5IZCC 5L3ZA 1ENZA 4CQLA 5A06A 1NASA 1T2FA 1KVRA 2J3JA 4RVUA 4WEQA 4NU5A 3U9LA 4R54A 3ZWVA 1ISHA 3RFTA 2QG4A 3R1IA 2NV6A 2D8AA 1PR3A 9LDTA 5JMWA 3PWZA 4WECA 3I9OA 1IHXA 4XEHA 1DBVO 4FPXA 4K1LA 4NBWA 3AM3A 1I2BA 1XQ1A 3U49A 5KVSA 4E2WA 1ISIA 3G1UA 4IY1A 3KRTA 3UF0A 3SXPA 4DLLA 1HRDA 1ZUD1 1OC2A 1EUDA 3DBRB 4ND3A 5TNXA 3K73O 2D5CA 1HEUA 5G4KB 1P9LA 1BSVA 4R3WA 4WNCA 4ZA2A 1GEEA 1NVMB 2EERA 2W98A 1XU9A 1B14A 3KUXA 4A03A 3C7DB 4PG5A 4EW6A 3GHYA 3JD1A 4UUOA 1RM3A 1O8CA 5DZSA 2HKIA 4FB5A 1WMAA 3E03A 2FR1A 1EK5A 2AHRA 1L7DA 2YHIA 3B1FA 1XEAA 1MFPA 2O3UA 3ZV6A 5CDGA 2O2SA 2VHXA 5CG1A 4TRMA 2D0IA 2QX7A 2HMVA 2NTNA 3V8BA 2BFOA 4LN1A 3TNLA 2OZPA 4DIOA 4XQCA 2PD4A 1MC4A 2IODA 1A4IA 4IDBA 1B0AA 1A7AA 4MVJD 5TF4A 3W8DA 3W6UA 3IQDB 2EV9A 4FCCA 4DQUA 1I0ZA 3OIGA 4RF2A 3JYQA 2POQX 2WSBA 5BR7A 1B26A 2PR2A 1PEDA 5B4UA 5U4QA 1GUZA 3K8ZA 4EJ0A 5KIAA 1JKIA 1PJ4A 1Z7EA 3HN2A 3QQPA 3ZI0A 3MEQA 4JLWA 1E1LA 2X0NA 4BNGA 2ZTLA 1H9BA 2W2KA 5TS3A 5B4TA 5I9MA 4NMHA 4Z6KA 2H9IA 3L9WA 1QG6A 2X8LA 4KUHA 3IUSA 2FZWA 5FI3A 4RF4A 4BMNA 4YQZA 3NKLA 5IZCA 3PRJA 4MVJM 2X86A 1JAYA 3D64A 3A4VA 1GTMA 2VRBA 5HTOA 3DZBA 4KTVE 2O3RA 4I9NA 2V6FA 4BNJA 1U7TA 2W90A 2BFMA 5KJ1A 1HYEA 4IXTA 4PVCA 4R1NA 5LDGA 1H6AA 4LISA 4FN4A 3L4BA 4CQMD 4FJ1A 4ZU3A 2C59A 3C7CB 2F00A 5HBRA 1CDOA 2D3TA 4KDEA 3EC7A 5ITVA 1ENOA 4L9RA 4ALMA 4JBHA 1U4SA 2Q1SA 1VPDA 1PWZA 2ZTMA 4RGBA 1DO8A 1YL7A 3GNQA 5IFLA 3AUUA 3FNEA 4BGEA 3FWNA 5GZ3A 1DC6A 3SLGA 5CG2A 3CZMA 8LDHA 1F17A 1W4ZA 5B1YA 4PG7A 3VKVA 1TXGA 1DC5A 1UXGA 4YT2A 4ND2A 1J0XO 4J43A 2HK9A 1K0UA 3KYCB 4I08A 3V2GA 1WDKA 4EZBA 3KXDA 4IS3A 3AY3A 3U0BA 1PJTA 2CMDA 1H9AA 1SPXA 3EGOA 3IDSA 4R51A 1SZJG 3P5SA 3UCEA 2NTVA 1GYQA 1EE9A 1ORRA 3NJ4A 1UZMA 1HE2A 5ENDA 4XIYA 1KEWA 4BO6A 1Q0HA 2QW8A 4IXWA 1Q1NA 4RV9A 1K5HA 3HFSA 4DMMA 1DJNA 1YB1A 2I3GA 4KWHA 1KERA 3BMQA 1GAEO 1I2ZA 1E6EA 1NR1A 3PJEA 4CLOB 3OEWA 3INTA 2NACA 1FMCA 1GEGA 4ZQBA 4E5MA 3RQSA 1A5ZA 2JJYA 3DMTC 1E92A 3VC7A 4DL9A 4XB1A 1OFGA 3CKYA 1RPNA 3PI7A 5F5LA 1DHRA 3WYCA 3I4CA 4BNNA 4MVJA 3JQDA 1GQ2A 2IZ0A 1PQPA 3QVSA 2Y0CA 5TQVA 5JNLA 4L75A 1LJ8A 4Q39A 1MV8A 3HZZA 2X1HA 1LXCA 1IZ0A 1DXYA 3Q9NA 1VI2A 3F47A 2VYND 3ZH2A 3S2IA 4BVAA 4N5LA 3RU7A 5L4SA 4MP8A 2NU9A 3UH1A 1YGYA 2WD7A 2UYYA 3GHHA 4HKTA 2B0JA 3L6DA 1YDWA 2JCVA 5GMOA 2HMSA 1U2DA 1KBZA 4JBGA 4EGFA 3PDUA 1O95A 3D5TA 5AYVA 2VRCD 4EEZA 1YOVB 1E3WA 3AJRA 3K31A 1VLLA 3QY9A 3DBVO 4Q3CA 2GZ3A 3AY6A 2VTDA 4CMKA 1ZVMA 4IBOA 1T4DA 4GSKA 5G4KA 3WTCA 4CMCA 5JBIA 1HTBA 4BO1A 3RI3A 5JAMA 2JHFA 3H9JA 1JU9A 1HDRA 1I24A 4JBIA 3ASVA 4LVCA 3VVCA 3GPDG 4TRJA 2ZCVA 2NNLD 3DXFA 2I99A 3FNHA 3WGIA 4ESOA 1OZAA 5TGDA 3I6QA 3BTUA 3E82A 5DCUA 1EUZA 2Q1TA 4UREA 4BNKA 1P0CA 1CETA 3N7UA 3MWEB 2VRCA 1NHWA 4KUGA 1HE5A 1N7GA 3FR7A 1RJWA 3WGGA 3NTQA 1DIGA 3DZJA 3OQBA 4NIMA 3Q3CA 3GN2A 5DP2A 4L74A 1RYEA 2Y0DA 4IJWA 1SOWA 4JXKA 3GGPA 4WOKA 3I83A 4RLHA 3VTFA 3HN7A 1DSSG 2AMFA 2C7VA 3T4XA 4L4RA 2GO1A 2W2LD 3A14A 1M6WA 1UAGA 2GASA 2IXAA 4MKRA 4U0KA 1W8DA 3NX4A 4RPKA 1JLLA 3SVTA 1N5DA 5G0SA 2J5KA 4MVJG 3ONEA 2AQHA 3CTMA 4OAQA 4IDAA 2E37A 2PFGA 1JW9B 1MB4A 3ZN2A 2X6TA 4OH1A 1ZK0A 5TLSA 3JQAA 4RO0A 3DFZA 4I5FA 4OL9A 4JP2A 2ET6A 4B3JA 1X0XA 1KY4A 1HL3A 4WLVA 3OEYA 2EKLA 3DBHA 4UEKA 2Q49A 1QKIA 2QZ9A 3RSHA 4PN3A 4Q3EA 1ONNA 3PDJA 4LRTB 3M1LA 3O8QB 3EZYA 1KVQA 3PIDA 1XKQA 4Y6RA 1NNUA 3RBXA 3HB4X 4RQTA 3BTSA 4NI5A 4FW8A 4A2CA 1N9GB 3AU8A 5IDWA 3WGQA 4IQGA 2PV7A 1GR0A 4HY3A 1E1MA 4UVEA 4CQMA 5BSFA 2W4QA 1YH3A 1Y9AA 4YRAA 3ZU5A 3SEFA 4AJ1A 1GZ6A 4HBGA 2CD9A 2DTXA 1GCUA 4ZQEA 4W7IA 2WM3A 5CEFA 4XRGA 1H6DA 2D59A 3PK0A 3UUWA 3DHEA 2VHVA 5T5QA 1IE3A 4RDIA 1H6CA 1FDWA 1HLDA 1NWCA 3G1TA 4YPOA 1GCOA 3IKVA 3EAGA 3DAPA 3KV3O 4OXKA 1CERA 2GN9A 5K6AC 3IKTA 1HSOA 3D4NA 2ZYDA 3PLRA 3DZIA 5A02A 2X58A 3RBVA 4BQPA 3ONFA 1CQIA 3O8QA 2PD6A 5BQFA 3RUDA 2YHUA 1U5CA 3U3XA 3BMCA 4KOAA 5KKCA 2O23A 2J3KA 3S8MA 4FC7A 4II3A 1N9GA 4BO5A 2YDYA 1ZFNA 5FEUA 3CEAA 4BB6A 4D79A 1F8GA 3LC2O 4JN6B 1DC4A 1P1FA 5I7VA 2WMDA 4HFMA 4ZRNA 3W4KA 4XYEA 2IYPA 4TKMA 4HNGA 3AK4A 3RFXA 3QV1A 1UP7A 5KTKA 5JFOA 1P74A 3CUKA 3WNQA 1KC3A 3ORFA 4OO3A 4AJIA 4WCDA 2GNAA 1D4FA 2XXBA 5THKA 3MZ0A 4TZKA 2UVDA 3G17A 4ALKA 1ZK2A 3Q0EA 4NG5A 1DIRA 4B7UA 1AE1A 3QHAA 3V1YA 1GQYA 4MPDA 1AHIA 2AQIA 1KEPA 5G0WA 1D3AA 5L45A 4IINA 1Y8QB 4WUVA 4HNHA 3DMYA 4RJTA 3LF1A 3PFFA 1KVUA 2WE8A 1Z45A 1QORA 1QXSA 3LT0A 1Y9EA 3LVFO 3NRCA 3IJPA 2I66A 2VHWA 1Z7BA 4P4LA 2A35A 1ADGA 2PTGA 3K2BA 1O0SA 1DHTA 4KDFA 3DHNA 4XYLA 2WD7B 2DAPA 3H8VA 1HYGA 1B15A 4JP3A 3RUEA 3WQSB 1V8BA 3LDHA 4CM5A 4BMSA 1R4MB 3E5RA 5BSHA 1E3JA 4B8WA 4IDFA 2HQ1A 3VTZA 1YB4A 4R69A 3K9QO 2YFQA 4CLEA 3C1OA 1U3TA 3NGXA 4D43A 1EBFA 3WLEA 4ALLA 1G0NA 3EMKA 3OIFA 4AVYA 3H9EO 3IJRA 4IZHA 4AJHA 1XGKA 4B4WA 1R66A 1T1SA 3LC1O 4J1NA 1IB6A 2NQTA 3BTOA 2DBZA 2QRLA 3PTZA 3M2TA 4RVHA 3WYBA 4DXHA 1CQJA 3PGXA 3QP9A 1C1DA 2ZYAA 3U5TA 1H6BA 2DPGA 2PGJA 1BXGA 3VH4A 4UULA 1HLPA 4U6QA 1OOEA 4GPD1 2AE1A 2ZIZA 3RUCA 2IEBA 4OYRA 5F21A 5MDHA 1PS9A 2IZ1A 1LI4A 2AEFA 3PZBA 4KQXA 5JCJA 4CLHA 3OJFA 4Q3AA 4BQRA 3K96A 5FF9A 4IJUA 5JSFA 3E8XA 1OI7A 4E12A 1U9JA 1YXMA 3H2SA 1HF3A 4JK3A 6ADHA 4C7KA 4PZEA 4IMRA 1MG0A 2IEDA 5G2OA 4MP6A 1JVSA 3MTGA 3BYZA 1IPEA 2SCUA 2PA3A 1ADBA 3HADA 3GC6A 4J16A 4AJ2A 4DBZA 2LDXA 2ZJ1A 2C2YA 2WYUA 2A94A 4WPGA 1WZIA 4CMHA 3VPXA 4BNHA 4HX5A 5GZ1A 4BIIA 1C1DB 1HZJA 3E48A 4RORA 1NPDA 5COAA 2EEZA 1VRWA 2Q1UA 4D3FA 1HDOA 1PTJA 3VDQA 4HFNA 2QYSA 4WGGA 1DDOA 3GAZA 1X1EA 5JW6A 4BNFA 4IZIA 4BMVA 4MIEA 4Z0HO 3QVWA 4FFMA 4NK4A 3VDRA 2P4QA 4TZTA 3AFMA 4BGVA 4CMIA 4QFDA 4U0JA 1UUFA 1X0VA 3U4DA 2X9VA 4MDHA 5JY6A 3ZV4A 2H5LA 4RDHA 3LLSA 3WJAA 2RAFA 4J2HA 2O3QA 1AUPA 2JFGA 5T8KA 1RYDA 3IOYA 2O50A 3DR3A 3UVEA 3QSGA 5T57A 4WE3A 2VHYA 3ZW8A 4M54A 3OETA 2EW8A 1C1XA 3UGKA 3AI3A 3OBBA 5C37A 3PXXA 2V7PA 3RUFA 3JQGA 3KYBA 2BLLA 4PRLA 3ZNOA 4RPGA 3ONDA 1SB8A 4JJFA 5IXSA 2ZB7A 3P7MA 3I3OA 2PH5A 2GYYA 4P38A 3NV9A 4FFRA 5JYEA 3EYWA 3L07A 4PG4A 5ER6A 3SJUA 4BNMA 5JO9A 3VPSA 2FZEA 5TJ9A 1HXHA 1E5LA 3AUSA 1E7SA 3RC9A 5I8WA 3MWDB 1RM4A 2PD3A 3WBFA 2FMUA 3PIIA 1A72A 4ZRMA 3H9UA 4QUKA 3ZW9A 4D41A 2P2SA 4YAGA 3OQ1A 4URFA 5HA5A 4R68A 2HLPA 3ZWBA 4D0SA 4L0QA 4PZCA 1DRUA 4IIUA 4YAIA 1XG5A 4XGIA 3KVOA 4B7XA 4XYGA 4FJ0A 3GN1A 1BDBA 3TRIA 1G0OA 4YJHA 3GRPA 3EVNA 1ONPA 2W2KB 1GFSA 3CE6A 3OJ0A 4IS2A 2VT3A 1I5RA 2OUIA 5IDXA 1QLHA 1X1TA 3TL3A 3D3WB 1DRVA 5DULA 4QQRA 3ZHZA 4F6CA 4BO8A 1BG6A 4D0RA 2GCGA 3U4IA 2AEJA 4ALIA 1ZJZA 2FR8A 4DTIA 5A04A 2HUNA 3HSKA 3TSCA 3RFVA 2QQ5A 4JJGA 1ZKMA 4HFRA 1Q2XA 4WCFB 5BNFA 1Q0QA 3WFJA 1YOVA 1WZEA 3QWFA 1I3MA 3GZ4A 2Y1FA 2ZB8A 3DBRA 5ADHA 1PS0A 5KJCA 3GMSA 3GVIA 3PJDA 1GL3A 3BIOA 4PLHA 2DTEA 2X9NA 1D8AA 4Y6SA 4YAKA 4S3MA 1NR7A 3WFIA 1ZK3A 4H7PA 3IMFA 4PLTA 3E18A 3O38A 4M89A 4BGUA 1BMDA 2YHIB 2CNBA 3H5RA 1BTOA 3ST7A 2DTDA 3LC7O 5DN9A 1QV7A 3KSDO 4MVJF 1ULUA 4CPDA 1P1RA 1B16A 2FWMX 1FDSA 1LU9A 2VYVA 1YS4A 3L4BC 4FOSA 3QLJA 1EMDA 3RBZA 1R0SA 1QR6A 4YWJA 4J9VA 4GKVA 5L7TA 1T26A 3FPCA 3UOGA 1TT5A 1FDTA 5TT0A 4GGPA 1EEHA 3TPCA 5IG2A 2NADA 3F4LA 4IDDA 2VQ3A 3RC7A 2RHCA 3EDMA 2XAAA 4FD3A 1BVUA 4J9UE 3T7CA 2B35A 1DOHA 1PZEA 1WLYA 2X7HA 1KVSA 2ZK7A 3FF4A 3H9GA 4NJOA 3BMOA 3MJSA 3EY4A 4MOWA 1N8KA 1EUCA 3LT4A 1DAPA 3OHSX 2BMAA 4DPKA 4PG6A 3JD4A 5ICMA 5DBIA 4B3HA 4CV3A 2X0JA 3I9MA 2Q1WA 2GERA 3QIVA 5HS4A 5JS6A 3VZSA 1E7WA 5JCXA 2GZ2A 2OFPA 1GYRA 4HXYA 3KSZO 2PNFA 2PH3A 1O9BA 3G3EA 2G82A 1K3TA 3NEPX 4TRRA 3WG9A 2GGSA 2OORA 4DA9A 5CDUA 1YJ8A 2Z95A 1YRLA 4LK3A 3LQFA 2ZKLA 3KEOA 5G4LA 3C24A 2B5VA 4KTTE 1WP4A 5CEEA 2P5YA 3F1LA 3ZWYA 3LK7A 3WGOA 1QYDA 3ANLA 5EERA 3ZWMA 4BNVA 1U3VA 3ICPA 2D1YA 3K6JA 1B8VA 4BNZA 4ND1A 4R1UA 3QWIA 5IXYA 2BGKA 1BXZA 2GD1O 3PHHA 4FGWA 4DC1A 4Z0PA 1JWAB 4YTEA 2ZJ0A 4K28A 1VKOA 2V65A 3PYLA 3ON5A 1ZBQA 4OGWA 4FS3A 5JXWA 4NJMB 4WLFA 5AXBA 1X14A 2B37A 1PZFA 4J6FA 3T7EA 3PLNA 1V6AA 3HB5X 1J4AA 4GL4A 3DBHB 2VNAA 3ETDA 3TZQA 4B4VA 3DC2A 4GWKA 3ADOA 1JN0A 3HDHA 4M49A 2BH9A 2HJRA 1TLTA 1Y8QA 2C5AA 3EUWA 4MP3A 3DFUA 1A71A 1PU2A 2JFHA 4GI2A 4XA8A 1CF2O 5ENVA 1NVTA 4CR7A 4UUMA 1ENYA 4IGFA 1ZXBA 4JIGA 1C0IA 5EQFA 3MJVA 1QP8A 3SBOA 2CUKA 4NQZA 4B4UA 3CH6A 1ZXLA 4MJLA 1DPGA 3JD2A 3WLFA 4J4BA 4J3FA 4YDRA 4YJFA 4ALNA 4Y8VA 1N7HA 1PJBA 1W73A 2DM6A 4NBVA 3RCBA 3WNVA 4CR6A 2IXBA 3ZHYA 1JKJA 5G0UA 2BD0A 2DC1A 3L6OO 3H3FA 3S2GA 5C7LO 5DDIP 3JQ8B 4CV2A 3CMCO 1GYPA 2RIRA 3AWDA 4O1MA 2HDHA 1U8XX 1X15A 1NFRA 1YWGO 3P2YA 1IYZA 2DU8A 2EW2A 1N1EA 1PL8A 5KKAA 2B69A 4TVOA 5BNTA 1YO6A 1P1JA 1Q7CA 3FBTA 1PSDA 3E9MA 4YACA 4ZQFA 1BXGB 2CDBA 5F5NA 1NTOA 1SAYA 5H83A 4QSMA 3ZZNA 3RASA 3P19A 1LSSA 4OQZA 2H1SA 1V0JA 2DLDA 2EJWA 4TRNA 2H6EA 3HWRA 3H4VA 4JGBA 4J1TA 5JAIA 5EMHA 4BNYA 4CUKA 4EUFA 2UAGA 2C29D 2Y1DA 3MJTA 4YVFA 1E7QA 1HT0A 4CMBA 1E3EA 1DJQA 3VPGA 5F3RA 1HETA 5DBGA 4FFNA 2A9FA 3KO8A 1M66A 4U5QA 1U7HA 1L7EA 1M76A 2A4KA 2GZ1A 1ZW1A 3DZKA 5T8KC 1KOLA 5G0VA 1VE9A 4B4OA 4Z9FA 5T64A 4KZPA 3OP4A 5DBFA 2PZMA 2DVMA 4F46A 4CMEA 5TJHA 1ID1A 2C82A 1HKUA 1ZO8A 1LQTA 1PZHA 3NTRA 3PQFA 3KLMX 2HJSA 3I6IA 3QWBA 2UDPA 1XHLA 3N74A 3QWHA 3S55A 4W7HA 1Z73A 3IP1A 3ITKA 4PLGA 2O3TA 4BNIA 5HWSA 1PJLA 2JHGA 1AN9A 3DOJA 4EBFA 4ONEA 1T2AA 1HDZA 2LDBA 2UV8A 1YL6A 1KY5A 5A5EA 2GUGA 1PGNA 3KBOA 2OO5A 1JDJA 2IRWA 4PFJA 4Q9NA 3SJ7A 2J3IA 1HE4A 2PGDA 2O7SA 4WEOA 4GMFA 4QTZA 3MOGA 2V6GA 4Z9YA 2EHDA 3CXRA 3BZUA 4LSWA 2VYNA 2X5KO 5A05A 4BUCA 4LMPA 3WDSA 4N18A 1I8TA 1NX6A 1PGJA 3SLKA 4XZ3A 3INRA 1MLDA 1ZCJA 2PZKA 1A27A 3V5NA 2F1KA 1TEHA 3IAHA 1Q7GA 4WJZA 5HS6A 3OM9A 2X5OA 4I5EA 4E33A 4NJMA 4XDYA 1HYHA 3UCFA 3GGGA 1F8FA 4O63O 2Q2WA 1LRJA 3V2UA 1ADFA 3PHLA 1KVTA 2DFVA 1GUFA 1M2WA 1WWKA 2W2LA 1IUKA 3AU9A 4I5GA 4W9NC 1SCUA 5COQA 3WJ7A 2BRUA 5BNIA 5A4DA 1NM5A 3I9NA 4M1QA 1ZMOA 1I32A 4DIBA 2FSVA 2GF2A 3GAFA 1H94A 3ENNA 1PGOA 1UXJA 2OXIA 1C0KA 4D45A 5ITWA 1CWUA 5A9SB 3ZV3A 1SNYA 4QX6A 1B2LA 1DIBA 1OBFO 4XD2A 2EJVA 1UXKA 3DBLA 3GY0A 1YBMA 4XB2A 2O7QA 4OSPA 1CJCA 3L77A 2P9CA 3D4PA 4HWKA 4CQMB 2YW9A 1HDYA 2CSUA 3RJ9A 4PZDA 1FF9A 3ZWOA 4N5NA 1Y5MA 2J5QA 1NXQA 4OJNA 3JQ7B 5FFFA 2VOJA 5JPIA 3H65A 3TQHA 4I1IA 5T67A 4E3ZA 3V1UA 4ZHSA 5EJ2A 1Z6ZA 2CF6A 4B3IA 2CVOA 3RC1A 1SO8A 3B70A 2E82A 3GFGA 3NUGA 2OP0A 3COSA 4FFOA 4IIVA 2Y93A 4H15A 2GRAA 3GK3A 3RAJA 4NZ9A 4BO9A 4CLOA 4NBRA 3WSVA 1N2SA 1SBYA 3TF5A 2BI7A 1Y81A 3WMXA 2NVWA 2WYVA 3LYLA 4XKJA 3ZWXA 2RHRA 2PGLA 2I6TA 2O3SA 4EYEA 3KTDA 5JDCC 3VOSA 2JFFA 3JQFA 3NJ8A 1T1RA 3CMMA 5IZ4A 3WQQA 2NUAA 3L9XA 3UHAA 2NQ8A 4BNXA 4W82A 3FNGA 4E0BA 1PZGA 3GNTA 1NAHA 2OL4A 1H5QA 1P0FA 4IJKA 4W9NA 1MXFA 3B20A 1OC4A 3Q11A 3DTTA 2DQ4A 2OGUA 2G1UA 1OMOA 1HDGO 2JD2A 4RZIA 2Y1CA 4BO0A 4S1VA 3BHIA 1GPJA 2O4UX 1P33A 3PWKA 2Y1OA 5JAQA 3B1KA 1GUYA 5CEJA 1UXHA 5JDCA 3IP3A 3P2OA 1ONOA 3RWBA 4R9SA 2RH8A 5KVVA 4BO7A 2WTBA 1Y6JA 1OAAA 1VJ1A 4GX0A 3OJEA 4IJVA 4PG8A 2TMDA 2QZZA 4MKZA 1U4OA 1T4BA 1BRMA 2HMWA 3C85A 3FTNA 4RVDA 4F3YA 1F06A 1ZEMA 1BXKA 3NT2A 3GFBA 1X7GA 1CEQA 1PGQA 1TB4A 1BDMA 2HMUA 4Z3DA 5TT1A 5A5FA 5L95A 3BHMA 2IZZA 3I9KA 3M2PA 3R3JA 3RIHA 4UUPA 2VYVD 3UN1A 4DPLA 1ISGA 1VL8A 2UUOA 1IOLA 3AFNA 2VZ8A 2FHSA 4XGKA 3AOGA 4CMIB 4DBVO 1A4UA 3U62A 1XIVA 1EZ4A 4GX5A 2X0RA 3D3EA 1E0DA 4PRKA 1LRLA 3NT4A 3ROPA 1O94A 3LLVA 5LCXA 4D44A 4A7PA 1ISMA 4XJTA 3DONA 4NPCA 2O3JA 4YEDA 1YVEI 3E9NA 1VJ0A 3TWOA 1K6IA 3E6AA 4RF5A 1R0KA 2NTJA 3AOEC 4R9RA 1AHHA 1E7YA 1X7DA 4ZQHA 5AXAA 2J3HA 3PWSA 5TIIA 3OFSA 1ML3A 3Q2KA 3RUHA 3TJRA 3RC2A 3OIDA 3JV7A 3Q2IA 1VSUA 5EL0A 1UDBA 3GT0A 1D1TA 1V3TA 3MCVA 4NK5A 2PZJA 4OHUA 3W4JA 4EI2A 4CODB 4FFPA 2V6MA 1U28A 1S6YA 2X5JO 2AG5A 3ZCXA 1YBAA 4DLBA 1P1HA 2OBNA 3BMNA 4BKQA 5K6AA 1FXSA 4Y98A 3BA1A 3JQAD 5L40A 4J7XA 4ZN6A 2EWMA 5JLAA 3K2EA 4WCFC 5K9ZA 2BELA 4KWIA 3VH2A 3TZKA 1UDAA 3FI9A 4UVIA 3RUIA 4IDGA 4QO8A 4BNWA 4CMAA 1Z75A 3HHPA 5JDIA 3DZHA 2W8ZA 5CP8A 1BGVA 1WDLA 4ZJUA 2Q4BA 2BF7A 3ZHXA 3VPFA 1I36A 3DWFA 3WBBA 5EPOA 1ZK4A 4J7UA 2QYTA 1DC3A 4IUYA 4QEDA 3L4SO 5F1KA 4A27A 5CAEA 2FOIA 4ZGWA 5A3VA 4MVJP 4P4GA 1ADCA 4CUJA 1XYGA 3O03A 1LSOA 2ZATA 4RPLA 4DMLA 1WPQA 4G65A 4L76A 4O5OA 4QO7A 5L51A 8ADHA 2PWZA 4QT0A 4J91A 1D1SA 4GVLA 1NAIA 4C4OA 3ETEA 5FYDA 5T6BA 4RQUA 2AG8A 2IE0A 1QLJA 1EDOA 1UP4A 3MOIA 4XGNA 4F45A 2FPPA 3DL2A 3JSAA 2AXQA 1ZH8A 3A1NA 4J2OA 4LSMA 2RH4A 2JKVA 1IPFA 1GZ3A 3PYMA 4ZQGA 3I52A 1NQTA 1XLTA 4PLCA 3OF2A 4TQGA 1YQXA 1SMKA 3UW3A 1YONA 3H5AA 1B8PA 2Y68A 4FBGA 4E5YA 2VUSA 2I3AA 4YJGB 3D7LA 3QVXA 4RPJA 2VWQA 3VH3A 1PS8A 2ZYGA 2VOEA 3BHJA 1PJCA 3WYEA 4LMRA 2O48X 3Q6IA 4QXMA 4UEOA 1QV6A 3GPIA 4ROSA 1I2CA 4W99A 4Z3KA 4ND5A 5F1OA 3W4IA 1NHGA 5KJEA 4YRBA 3UKOA 3PJGA 4Z9XA 2H63A 2VWHA 4CM1A 1C0LA 1MG5A 4GAEA 4HP8A 4JNKA 2P4HX 2VUUA 2NU6A 1PJQA 1NFFA 2XOXA 1EFKA 3LU1A 4WLNA 4M87A 5JDIC 1B3BA 4O0LA 2J5RA 4FR5A 1K6JA 5C7IO 4DQXA 5THQA 2HK8A 1I33A 2OMEA 1ZSNA 2GR9A 3H2ZA 2YDXA 2EF1A 4N5MA 2FR0A 3GUYA 3GH3A 4WLUA 4XCVA 2I9PA 3IUPA 5I7FA 1DFIA 1H93A 3SX2A 2Q99A 3FBGA 3GRKA 2C20A 3PZRA 1I3KA 2VCYA 1NQ5A 2C2XA 3B1JA 3ZWCA 4BV9A 4AJ4A 1DFHA 3INGA 1E3SA 1IULA 3AM5A 2FN7A 1LRKA 1Y5RA 2X23A 3DO5A 3ICCA 1R0LA 1GY8A 1VSVA 3I9LA 4ID9A 4NFSA 4OOEA 4P4NA 2ZQYA 4CM7A 2AEMA 4YAJA 5KJ6A 1T25A 2V6BA 1EVIA 3PQEA 4PIVA 3L6EA 3D3WA 3HJAA 4NFHA 3S1LA 3WGTA 1ZEJA 1F0YA 4BKUA 4YR9A 1WAMA 1UZLA 5EIOA 1IL0A 1R4MA 4WASA 5IF3A 4A5OA 3FHLA 4Q3BA 4XRRA 5EQDA 4JQCA 1WNTA 1YJQA 3JQEA 3ITDA 1N1GA 1XCBA 1O5IA 4PLFA 2PKQO 4IDEA 4J4TA 4FJ2A 4A73A 1FDVA 4GLOA 4AJNA 4OOFA 1YDEA 2G17A 2XF8A 6LDHA 1ZNQO 4E21A 1MP0A 1FK8A 2X22A 3R6DA 4J1QA 1KETA 3JYLA 4U7WA 4LCEA 2YQ4A 2EG9A 3TL2A 3AM4A 3QJ5A 5JC8A 2AQ8A 4DYDA 3DQPA 1NPTO 2ZTVA 3DAFA 3FWZA 3MTJA 4CMJA 1LDBA 5A9RA 4RL6A 2OP1A 1E7MA 2Q45A 2FPGA 3FRJA 4JX8A 2WDZA 4YBZA 2GPTA 4CM9D 3IC5A 2E4AA 3NGLA 2YV2A 4ITUA 4FDAA 3STHA 3U4HA 3V1TC 5MGBA 2PKRA 4AJKA 1IHYA 1PIWA 1UP6A 3GZNA 1TI7A 1XU7A 4M86A 1EK6A 3FD8A 1E3LA 3FN4A 1XA0A 3EW7A 1CYDA 3M1AA 3KM0A 4IGEA 3UAGA 2JD0A 3F6YA 3X2FA 3PQDA 4D3DA 3ZHBA 4AJOA 3B6ZA 4A26A 5K0ZA 4DREA 4OKIA 3DHYA 3H5NA 4E6PA 3T4EA 1PX0A 1LDYA 1LC0A 4FSHA 1I30A 2QRJA 4CM9A 2EXXA 5L4LA 4LRSB 3NYWA 1X13A 4OKNA 1LX6A 2X9GA 2O2YA 2P9EA 1E3WB 1E5QA 1SOVA 2DBVO 5AVOA 3HDQA 4R41A 4FOOA 4JROA 4AL4A 3D5QA 2JAHA 3C3XA 2ZQZA 2RBEA 3KYCA 4GX1A 3H7AA 3U4CA 1MX3A 2P9GA 4R1TA 4W6ZA 2Q4EA 4QFCA 3F5SA 3WSWA 3KSUA 4FIZA 5KOIA 3O9ZA 1U3WA 3DBLB 4E5KA 1D7OA 4D3SA 3GEMA 1LLDA 1VKNA 4M8SA 1H0KA 5G0TA 4CQLB 1UXIA 2WE7A 3ENKA 3SC6A 3WX0A 2VT2A 4BNUA 4UVHA 4NR0A 1SB9A 4E4YA 4GVXA 5B37A 3K92A 3TDKA 2XPCA 4KMSA 1A7KA 1AXGA 2I5PO 1VL0A 4TMFA 5KWEA 2J6IA 3ZWNA 3HNPA 1MC5A 2X4GA 5A03A 2Y1GA 1T2DA 4PLPA 4ZD6A 3RUAA 4E2XA 2CZCA 5IN4A 3BMCB 4XR9A 4AICA 5DP1A 3I4FA 3A28A 4EJ6A 1MFZA 5JC1A 3ASUA 1P45A 4ILKA 2CF5A 1DIHA 4NBUA 1R4NB 3TZHA 1C0PA 4BNLA 2JAPA 5IN5A 4DQVA 2HMTA 3ZNPA 4I5DA 2CVZA 2DUUA 1YB5A 9LDBA 1IY8A 4R5MA 1VC2A 1TT7A 3FCOA 2WD8A 4R5HA 5L4NA 3VVBA 5TC4A 3PVZA 4W4TA 1DB3A 5JYDA 3L0DA 1Z74A 1XR3A 1P77A 1M75A 2YYYA 4KP7A 4OXNA 4J90A 4E2YA 4OSOA 5DCYA 1YL5A 4R3NA 2FPIA 3LSYA 2VWPA 1HDXA 3BAZA 3DOCA 3JQBC 1GADO 3NAQA 4BO2A 4E5NA 4PVDA 4CM4B 4XWYA 5ICSA 4RVSA 1E7RA 3KYDA 1NP3A 2HRZA 3LT2A 3WQRA 4G81A 3TZ6A 3PEFA 3OQ6A 1EQ2A 3JQ6A 3R3SA 2Y0EA 1I3NA 1GD1O 2Y05A 3EVTA 3TFQA 5U9CA 4BKRA 1T24A 3GDOA 4XQ9A 3DMTA 1U2GA 1PJ2A 3PJFA 5DNAA 3ROKA 1PJSA 1KEVA 4MO2A 1MGOA 3F4BA 4TWRA 4MVJI 1GQQA 2Q46A 4EITA 2PKQP 1P31A 4P8RA 3EK2A 3W1VA 2Z5LA 5AQ1A 4FQ8A 3V2HA 1J49A 2NU7A 2FP4A 1JQBA 5CDSA 1RM5A 3RVDA 2TMGA 3OICA 4EJMA 2JL1A 1U5AA 1G1AA 3MJ4A 5C3MA 1I01A 2ZB3A 5A9SA 3O4RA 1KC1A 5TSDA 3QWAA 2ZB4A 1RWBA 3NDIA 2ZTUA 1BWSA 3OJLA 3E1KA 4O6VA 4MINA 3OECA 2J8ZA 2C0CA 4Y9DA 3RD5A 3UXYA 1UH5A 3VZRA 5HRUA 3OA2A 1U8FO 1SEPA 2C7GA 3AW9A 4U8GA 1KS9A 1DFGA 1UR5A 1KIFA 2CDCA 3JTMA 4BO4A 1KYQA 4U6SA 1H2HA 2CVQA 3TFOA 2C5EA 4RVFA 1V35A 2EP5A 4CL3A 4XYMA 4FGSA 4H3VA 3E5MA 4GSLA 3ZU3A 1LLUA 4WKGA 3H9QA 4J0FA 5KCZA 4WOJA 4YJDA 2DPHA 2UUPA 3GMDA 3HG7A 1ZMTA 3AI2A 4DUPA 4CL8A 2E6UX 1R12A 4HADA 5IJZA 1P44A 4J1SA 1A9ZA 1FJHA 4I9UA 5CHEA 4L4SA 2YV3A 3DZGA 5AXDA 4UAGA 3O26A 1XSEA 4XQGA 1YQDA 4BNTA 4WCFA 4UEJA 1XDWA 4X54A 1O6ZA 4G5HA 1LLCA 3GUCA 3JD3A 2AE2A 4TSKA 4CMEC 3QVOA 2GDZA 4E5PA 4AJJA 3WWYA 4F6LA 1PQUA 3F3SA 2VWGA 4KUEA 4MKXA 5B4VA 3I23A 1RKXA 4Q3DA 2FRDA 4BS9A 3S2EA 4D7AA 4XQEA 3GDFA 5DOZA 2Y99A 5A1TA 3M6IA 1JTVA 2Y67A 3A06A 7MDHA 2WWRA 4CLDA 4XJSA 4R01A 1V3VA 4EUEA 4IQ0A 2E49A 3K30A 1S7CA 1PJ3A 4YA6A 3FPLA 3RKUA 4CJXA 2BGMA 4OIMA 2EIHA 4DYVA 4Y6PA 3GNSA 3ETGA 1R16A 2JCXA 2BI8A 3NT5A 4II2A 1CRWG 3PHGA 1ISJA 4YXFA 2YUTA 1NFQA 2HO5A 1PWXA 4QECA 4LVUA 5TX7A 1E1NA 2D4AA 4YYZA 3KHUA 4YJGA 3GVXA 5BSGA 3ANMA 3FNFA 3DAGA 1LLQA 1M67A 1E77A 4C7JA 4CR8A 4YJFB 5U1PA 4Y67A 3LZ6A 3JQ7A 3TN7A 1X7HA 2GSDA 4D46A 2PZLA 3OH8A 3TZCA 3WMWA 2BFPA 4PLWA 2DFDA 4XIJA 3VZQA 4PLVA 3MJCA 4B79A 1HWYA 3ZWWA 4OQYA 2HK7A 2YFHA 4BKOA 2VUTA 3WWZA 3U09A 3WXBA 2WEKA 4YQYA 2DUWA 5L53A 1BHSA 3WTBA 1LDEA 4TROA 1UAYA 3PFWO 1QMGA 2EGGA 2QIOA 3ZWAA 1GV1A 2FY8A 4PLZA 1U1IA 1WMBA 1LUAA 3CIFA 1PGPA 3DB2A 1VL6A 2VZ0A 4GQAA 1Z82A 3CINA 1UJMA 1ENPA 4ZVVA 4DVJA 1C14A 4PCVA 4J0EA 4G2NA 4K26A 1PQWA 1EDZA 4NBTA 4FC6A 3WS7A 3KETA 1MUUA 2P68A 5CPBA 3C1TA 4RPHA 2P5UA 4YT4A 1Q7BA 3I5MA 3GQVA 5KVCA 1C1XB 3KB6A 1HSZA 4AJLA 5AXCA 3ULKA 1P1KA 1LSJA 3ZGYA 1DAOA 3WB9A 1MA0A 4LW8A 1E6WA 3FSRA 1LSUA 4CLXA 1ZIDA 3PHJA 1WVGA 2IDZA 3GZNB 4CLRB 3KYDB 4E32A 1B8UA 5JO0A 3IIEA 1E1KA 4N54A 1E6UA 3KEQA 4NU6A 3GOHA 1WDMA 3JQBA 4E2ZA 1AGNA 1C3VA 5JMPA 4K6FA 1ULSA 1GZ4A 7ADHA 2O4CA 3GF4A 3QW2A 4J49A 1NQOA 4CUZA 1F14A 1ZZEA 3K5PA 3Q9UA 1LBEA 2EGHA 1E3IA 3WOHA 1JAXA 1A9YA 2R00C 3RROA 4N7RA 3GR6A 1JVBA 2YJZA 3QA9A 1DRWA 3VZPA 3AUTA 3HQ4O 4MIOA 5IAAA 3IL2A 1CIVA 3GEGA 2I76A 1QYXA 4PGFA 5ER9A 1M6HA 4TVBA 1B3RA 4NHEA 3UFXA 1SC6A 1FDUA 5JY1A 5I8ZA 1R15A 3D0OA 5DF1A 3GVPA 4YCAA 4YT5A 2B4RO 1W6UA 2X0IA 2HSDA 4GWGA 2NSDA 1WXDA 3CSDA 3GA0A 1DLIA 2B83A 1PL7A 4KQWA 2QRKA 1WW8A 1NYTA 3RKRA 4L4XA 5ILGA 3JQ8A 5DOVA 3EZLA 4OMUA 3DZFA 4NH4A 4CM6A 3GVHA 2QHXA 1BVRA 4NFYA 1LDNA 1QYCA 2FSSA 4MVJH 4D42A 2Y1EA 1LTHR 3ANNA 4GMGA 1XQ6A 3W6ZA 3JYNA 5I7SA 4XR4A 2AW5A 1F12A 4GKBA 5GZ6A 5L7YA 2AQKA 3HDJA 3AY7A 3NTOA 4I8XA 4BKPA 4R16A 4DGSA 5AOVA 3ZV5A 1HDCA 3F5QA 2DBQA 3VHRA 1JWBB 1DEHA 5FWNA 1YBVA
chains in the Genus database with same CATH superfamily
3GARA 4IPTA 1UZNA 1GTJ1 2RHMA 3B2EA 3JQ9C 4MQMA 1J1UA 1E4EB 1SHTX 1B43A 2FWAA 1R4NA 3ADPA 4ENSA 1J9EA 1E96A 3U7GA 1UKBA 5CA1F 3GEDA 1XKXA 4GW3A 1J00A 3IT1A 1U9YA 2CY0A 1GA1A 1U2TA 2OOSA 4KX3A 4MZDA 1WMEA 3VX3A 2B36A 4JQSA 5AVWA 3X2EA 3KVVA 2APJA 2ECPA 1EE2A 4PAOA 1AH2A 2CL7X 1T2EA 2NVBA 3BGSA 2WMOB 1VLZA 2XSZD 5AK6A 2D13A 3CM0A 2XT0A 4WNIA 2O1EA 3DEZA 1EBBA 1NQUA 1SEVA 4M4SA 4YRKA 3H2GA 3ZU4A 1RHJA 1TQ2A 2HAEA 2GJ8A 4YUWA 1WV1A 2WG0A 1N78A 3IIJA 1CEEA 3EEQA 3GCZA 2FETA 2XKKA 4R1OA 4DC9A 3D2CA 3H9BA 1O08A 2BBSA 1G4AE 1J07A 2P91A 3LKDA 2ZROA 4RCVA 2YXBA 4MDYA 2DKNA 2RGEA 5KNLA 4UUNA 1W36B 3TRHA 5CDTA 2SBTA 3FFAA 2ODPA 2H0AA 3GFOA 4G0NA 1R0RE 1YMUA 1G9SA 5KVQA 3KB1A 4IXNA 4AUKA 2PPVA 4LJSA 2G08A 16PKA 4LRYA 4EMUA 1ECPA 3R3ZA 3NWJA 2WG1A 1YA4A 1UDCA 2GCIA 4X20A 1SCKA 5ALNA 2BR3A 2FEAA 2YMLA 3W6OA 3WGNA 3RW9A 3U7FB 4EHHA 1I10A 3LVRE 5KSYA 4IILA 3CEPB 2PZEA 5TQ0A 2AA3A 2WAXA 4P80A 1LDGA 4YB8A 3GG2A 5H80A 3A25A 4O1HA 2X42A 1EFLA 4BL5A 3NBZC 5DXAA 5DHQA 2NSYA 4JYBA 3QVTA 3RU3A 3GGOA 3PHCA 2Z2KA 2VDNB 4XVQA 1DX6A 4G4JA 3UANA 3Q2OA 2RHBA 3AVPA 3HA5A 4MV7A 2HU2A 3DKVA 4S24A 4YASA 5EXPA 2VZ9A 5EINA 4DA4A 1BW9B 2BKLA 3A58B 1S3IA 4DLRA 1RLIA 2X3UA 4JDUA 4DLAA 4F56A 2WT8A 2PYDA 3O21A 4C89A 3QF4B 1SCJA 2P9QA 4URZR 1T2CA 2HRBA 2OM2A 1GWNA 3VTAA 2AGVA 2E3JA 4FVTA 4YAWA 4ND4A 1CJBA 1CDEA 3VU9A 5LC1A 5BVHB 1C30A 3OX3A 5D2CA 1SCUB 4DMRA 2C78A 4INOA 1BE6A 3N8DA 2D5AA 2OBLA 3L8MA 1G2IA 2B4TO 3LT1A 4LWPA 2X0EA 3ROFA 3WGZA 4EJSA 4F72A 1WTAA 3CW8X 4DNQA 1NVDA 3DDNA 2D2EA 2EP7A 3NM4A 2DT5A 3S70A 1CZOA 5JZ9A 1XZ8A 2DY0A 1G7TA 1CUHA 1G21B 2BZSA 3DVSX 3P0FA 1UBCA 2RGUA 4U9IS 1TRKA 2QSJA 2ID8A 5IHXA 1B76A 2JIZA 2BSAA 2VFAA 3PUIA 4OSEA 4R9UC 2YIDA 3T5BA 3ZXUB 3NALA 4LZLA 4Q4DA 2VPQA 4MUXA 2IEIA 2VT7A 3BQNB 4Q82A 5TRTA 1ISFA 3HJTA 3OEHA 4O3FA 4WLOA 3KOWA 4E13A 2C54A 4ZICA 2IK8A 1IHUA 1JU4A 2KHZA 5E3JA 1NBOA 3H6KA 4OHWA 1NQVA 4PLYA 1IZYA 3ENZA 4JFAA 3VPHA 4V1CA 2BGLA 1K8RA 3A3PA 4EEXA 4G8JA 4B82A 1CVIA 1NURA 5EHIA 4K6CA 2O20A 2YXPX 1XPOA 1T1EA 4Q7MB 4NEHB 4U2BA 4AJEA 3ZBQA 3LIIA 4BUZA 1EINA 1KKMA 1N2JA 1Y1PA 1NP6A 1HMYA 1YB6A 2GBCA 2JLRA 3AETA 4FFLA 1Q74A 5G40A 4CL0A 4EELA 3O3CA 2GN6A 3CVVA 2GZAA 2OBYA 1BEUB 3D31A 1A8SA 4UZSA 5L6LB 2G6TA 1WCIB 1RAFA 2I65A 2LCIA 2UZ0A 1Q7RA 3R0IA 4L9SA 4H6WA 4PQFA 1G6KA 2OCIA 3SC2B 1Q0LA 5IM4F 1OIVA 3OIUA 1PLLA 3A8TA 3E22A 2RCYA 1FRZA 2N1BA 3OZDA 2CNNA 4DM7A 1UFKA 4N3CA 4N76A 4I8DA 1JLMA 2BKXA 2JRLA 4RVOA 3OMLA 2RMKA 4YGXB 2WW8A 3VISA 4CKCB 3U7QA 4PHGA 5EE5B 3WJ1A 3HU1A 2J7PA 1O89A 2BMWA 3STVA 4LNUB 3O8OB 1LQUA 1UJCA 3KL2A 4LSZA 1FPMA 5KYKA 2VHTA 5LIRA 4US2R 5DM70 2YN2A 4KE6A 1HZZA 4YIKA 4ESOA 4KIWA 4FGJA 1L5QA 1GA4A 1SIWA 2EKPA 2VDUE 2WU0A 2EL9A 3B78A 3F5DA 5EESA 5B12A 1FNDA 1U5BA 2O8DB 4X91A 1RQLA 3UFBA 2AMVA 4PX5A 3KTAA 1CQJB 4FDUA 2ADMA 4CM3A 1ABEA 1Y8RB 4HFJA 3KZVA 4NCIA 3KOXA 4Z1MD 2YW2A 1F3LA 4X85A 5TDHA 5FUBA 3WIDA 2BHRA 3IDOA 4M0DA 3WIEA 5AVSA 1D9ZA 1GG8A 1RDFA 1HQCA 2DBYA 2QMOA 5IMSA 4NQRA 5IDQA 2DPXA 1JBQA 1V9LA 2VN8A 5JE8A 3M89A 3HS3A 3PQ5A 3RJ5A 3TLBA 3B3FA 5KTYA 3AJ8A 1A9XA 3FPBA 2WIGA 3ZY6A 2W6CX 5JHHB 4ZZ0A 1YI0A 2G0TA 4XFJA 5FOSA 5ALVA 3MJRA 2FFJA 1JFVA 1H2BA 3QRWA 2JLSA 2VHZA 4UFNA 4BHTA 2IHNA 1ZU4A 3G79A 4I46A 5IDYA 1L3BA 2E1RA 3C3JA 1W0CA 4CM4A 3PYXA 4TKUB 4ZCSA 1Q1BA 2AJCA 2K5UA 5A7GA 3FDZA 2R6JA 1NW7A 3C1AA 1R5JA 2REQB 4Q1CA 2QRNA 2YV1A 4DC0A 4MIYA 1I9GA 3GLQA 1V5GA 4HPJB 3I5YA 5HCUA 4CV1A 5F7XA 2JD1A 5IBQA 4AZTA 5DGTA 3U7HB 4OBWA 4HQFA 2HQOA 1TJ3A 1GAJA 2P6UA 2JAUA 4H31A 3ZNNA 1TZMA 1XUOA 1DAKA 5JSUA 5JVDF 4KRXA 1D6JA 2DHRA 2QTFA 3HUDA 2WYWA 1NJSA 1Y8RA 4OXYA 1PBTA 1PR9A 2QSZA 1ZI6A 2Q5CA 4ZCTA 1GPKA 2C2BA 2ZXUA 2FMIA 1N25A 2GEUA 1ORVA 2Z1NA 4RM3A 3PQ3A 1ENZA 3U3MA 4JS0A 5LYJB 4RVUA 3BRSA 1GGKA 4WEQA 3EEOA 1SXGA 3DT9A 3HK2A 1GRNA 3NC4A 3A11A 2XTAA 4GYKA 3QI2A 5CYOA 1R9NA 4FIDA 1E9SA 3RFTA 3UO8B 4ND8A 3KJXA 5FD8A 1TNDA 3R1IA 2V3CC 5HQJA 2NV6A 1BXRA 2VNKA 2G88A 3WADA 4EOGA 4OMDA 4WECA 4C87A 3WDMA 9LDTA 1G21E 3TLAA 3T3PB 5IYZB 5IKMA 1N7JA 1WW3A 5IUNC 4FPXA 1R2QA 4YECA 3AM3A 1I2BA 1GGFA 2I2AA 2F3QA 2AFHB 2OQVA 1M10A 1M2KA 4DLLA 1ZUD1 1ESNA 3C4QA 1JFFB 4IHKA 1EUDA 1GRCA 1Z7YA 3P0HA 1X80A 5KTNA 2E21A 4N8SA 2D5CA 1QGED 1KSGA 1F2VA 2DXIA 2K2QB 3SU8A 3JYHA 5DYGA 1YR2A 1JI0A 3NC0C 3NNDA 2EERA 2FWPA 2W98A 3DLPX 2NXEA 1B14A 3E3MA 3KUXA 4WN9B 5CIWA 4A03A 5FJIA 1FOEB 4IGKA 4PG5A 3JS5A 1HDIA 3O74A 4C0JA 4RAOA 3MWJA 3KQWA 5EIBD 5FCDA 1O8CA 5JS8A 5AI8A 1VHJA 1L7DA 2AHRA 2QPTA 3ZD7A 1NJ8A 1Z8DA 1XEAA 2XCIA 1MFPA 4RKFA 1OYOA 5FIUA 4F8EA 1PVOA 5CG1A 4EMTA 1E6LA 4GQBA 2X7JA 3MAJA 3GYGA 3BA6A 2H4JA 1EXMA 4LN1A 3ENVA 1XCMA 2GYWA 4N49A 1KI7A 4WXMA 4C0QC 2YZNA 2IODA 1A4IA 1SVNA 1XCOA 3E3LA 4HDRA 3W77A 2ZZKA 1YCHA 2DPMA 1EFAA 4ML3A 1GUDA 4CT5A 2GM3A 4R1QA 2EL7A 2OYRA 2YH2A 1ZMXA 3W8DA 3W6UA 1NW8A 4EGCB 2XEDA 1MEOA 2Y0PA 3AYZB 5EUQB 1KEEA 2EV9A 4BXOA 5IC6A 4DQUA 3PBKA 3FMIA 4FWIB 5LP6C 3UWSA 2I7DA 4F38A 3OQMA 1X1AA 4HC4A 1MVOA 3TR6A 1P61B 9GPBA 4L4ZA 3DT6A 1TJNA 4L3VA 1ZIYA 1PEDA 1DG9A 1N4DA 5B4UA 3KB8A 5DM1A 1JKIA 3D7KA 1VZ3A 3IKLA 1JDBC 4HAOA 3HN2A 3VAYA 3IX7A 1OWPA 3NDBB 5H02A 1Z5OA 1E1LA 1U0RA 1GL7A 3OZVA 4BNGA 1DVRA 3QVJA 1LH0A 5IDVA 3ABOB 4V3BA 1JHOA 2O6LA 4EJSC 1MMFB 3QZUA 2H9IA 3HGTA 621PA 3JRWA 4WKPA 1S8OA 4RZ3A 1LBIA 3L9WA 5HFNA 1A4RA 2GHRA 4YRIA 2OV6A 3WLRA 1MF7A 2RCNA 4C1NA 1U94A 4QU0A 4EYSA 3V8VA 4YQZA 3RJZA 2PUCA 5FNZA 5KTPA 3NHKA 5BR8B 1MO5A 1XTTA 1LK0A 2HGZA 4H7DA 2H2AA 1JFSA 4RTSA 4G1FA 3SAJA 1KI6A 3DE0X 5DHUA 4I7EA 1BU5A 2XQIA 2QN2A 4MITA 4KTVE 1VBKA 5EP4A 3WK7A 2OD7A 1OLSA 2WJJA 2V6FA 1S02A 4BNJA 4BDTA 2W90A 3QEBZ 2BFMA 4D6YA 3L4JA 1CVLA 1J09A 3DF9A 4IXTA 2BM9A 4R1NA 4M7PA 5LDGA 1H6AA 3A32A 3U4GA 1XV5A 4QLOA 5HJ5A 1JXAA 1YJBA 4R8VA 1SQGA 3OKPA 3C7CB 1OIWA 2QVGA 3CKLA 3OZFA 1ZRNA 4LHYA 2D3TA 4KDEA 1EHIA 5ITVA 3MINB 3CCFA 1GPH1 3WKAA 1RZVA 4L9RA 4YP9A 5I4IA 2HF2A 3O8DA 3EWNA 2XE7A 3FMGA 4EYOA 3AHGA 4U2KA 3W2EA 3NMUF 4PZLA 1MQ8B 1I4WA 1YL7A 1NXPA 3NOQA 3AUUA 1N5KA 2WUWE 3OOJA 3NHJA 1KJZA 4MQEA 3CZMA 1F17A 5B1YA 4PG7A 1DC5A 1A9QA 1UXGA 4YT2A 5JQGF 4BZQA 1ECLA 4J43A 5MN4A 4NXNB 4MQLA 1TPYA 3LCJA 2NPFA 2WU4A 2CBXA 3AG6A 3WHIA 1QYRA 1WDKA 4B44A 3K9NA 2ZEJA 3DWEX 4IS3A 4F2PA 2EJCA 3B48A 1N8SA 3C7KA 2H0QA 4NZYA 2C7BA 2PMFA 1HH4A 5ALDA 5EE1A 1XRMA 1VLHA 3QYFA 1IWBB 1GP2A 4MV3A 3V48A 3UK2A 1U63A 3HCOA 3UCEA 3NJ4A 4Z99A 3GJYA 4NBKA 1HZZC 1HE2A 1UZMA 2H1FA 5ISMA 3S0JA 1U7XA 3I3SR 4BO6A 1DQSA 4GP6A 1DCKA 2YC4C 1Q0HA 2H1WA 3HBJA 2XRMA 3MD0A 2IA5A 2Z2JA 3PNVA 2D2VA 4GUAA 4IXWA 1K5HA 3TLCA 3HFSA 2C5LA 4V3CA 5AW2A 4XX1A 2I3GA 4KWHA 3ZHOA 2RHWA 3CUSA 4UBKA 3ZLVA 1E6EA 2EFEB 1ND5A 3KSRA 5CGQB 1CKEA 2CFSA 2GBPA 3OEWA 5CW1A 2NACA 3A4TA 3AH8A 4QLBA 2H1RA 4ZQBA 1QRUA 3IMGA 1II8B 1A5ZA 3DMTC 4OX9B 4Q7EA 2PJRA 3DDOA 1E92A 3VC7A 1SFRA 4DL9A 1I7NA 4M9ZA 2GBIA 1LF0A 4JMLA 3GFRA 1KO7A 3PI7A 5F5LA 3T1TA 1DZIA 3DF7A 1BWRA 4R40A 1M0TA 4UNSA 2XT6A 3AGPA 3RIYA 1TCAA 4BNNA 4RTQA 1AV7A 3JQDA 2E4XA 1FZTA 2NO6A 3W04A 1FQOA 1JT9A 1W9HA 1Y3AA 4FNAA 1WCYA 3AQIA 4AP6A 1XZBA 5LLTA 3V9PA 2R11A 3HZZA 1I94B 1PKEA 1DXYA 1RR6A 2WUGA 3PPXA 3LOQA 4KVFA 4MGKR 3V7UA 4BUJA 3ZH2A 3S2IA 4BVAA 4P7BA 1VMDA 3UH1A 4G6ZA 1K7FB 1PZXA 3JQQA 3NDPA 2GXQA 3GHHA 1S0UA 4M9QA 1A5AB 2QL5A 3K8OE 3NPAA 1F5SA 3ESRA 3QTBA 4LNAA 4ZEWA 1YDWA 4F4UA 1WULS 4KPGA 4DRXB 4O3MA 2HMSA 1U28C 1U2DA 2GZRA 1RYYA 1UM8A 2VHCA 3C8HA 4JBGA 2Y9MB 4MRNA 4O4HB 5EI5A 1O95A 7AT1A 1FRVA 1WA5A 5JD4A 3OTWA 2VRCD 2JBAA 4Q34A 1L4GA 2XMQA 2YWXA 1ZD9A 2P75A 4GMKA 4EHBA 3DBVO 4JHLA 2UKDA 1DKMA 3H1PA 4Q3CA 1W94A 2AV6A 3SN6A 7MHTA 1F6WA 3AY6A 3LYAA 3U7JA 4DY6A 4IRUB 3OWXA 3GJTA 4QL3A 2RGNA 3WNZA 2CNOA 4CFYA 5MHTA 4BO1A 3RI3A 4WJKB 2I7TA 1YGPA 3E9YA 3H9JA 2OVBA 4RIFA 4KPUB 4WXPA 1I24A 3GJXC 3TH5A 4C0BA 3ZWDA 3O2SB 5EXDA 3FNBA 2ZCVA 3KZOA 4OQXA 2CL5A 3EIEA 4DT1B 4PNHA 5CLFA 4J8PA 1RHUA 3ZJ4A 2DE0X 4G5QA 3HHEA 5TGDA 4Q03A 1OFTA 3H2BA 3ANYB 3VKGA 1P0CA 5HKKA 1DKLA 3PGVA 1B6TA 4G37A 4IV8A 4O08A 4QTXA 3FR7A 2XJ4A 4C30A 3PX7A 3AVUA 2EOAA 1XTPA 2R87A 2XODA 3Q9LA 4BFXA 1T5LA 2I6FA 3GN2A 2VP0A 3RS3A 2FTKE 4LXHA 4IJWA 1UCFA 2GAFA 2FG7C 4JXKA 4M9XA 3GGPA 1E1RA 3EXIB 5H68A 2QM0A 1CZUA 5CX1B 4RLHA 2RHGB 2I80A 4WK0B 1YJAA 2AMFA 3IQHX 3QKWA 2LTAA 2FLKA 2G9UA 2PX4A 2ZIXA 3ZZ1A 2XB2A 4MUJA 1D4ZA 5I9IA 4IKOA 3A14A 3GRCA 1FTWA 2IXAA 3U80A 6GPBA 4N40A 5EJ4A 3MFYA 5EFOA 1GDTA 3FRIA 1VLVA 3LY5A 2OCAA 1UEXC 3HLTA 4GPEA 2Z8YM 3AVXA 2QR5A 2AQHA 3KAPA 3PFCA 2IV2X 4OAQA 1OPRA 1HYBA 2O2IA 3AONB 1ZK0A 3RSFA 2QL7A 4U7PB 4ZWNA 4BX2A 1G38A 4HI0E 1OBVA 4QU5A 5ITSA 2QVCA 2AVNA 2C5HA 4JP2A 5FBKA 5CDFA 3HR4A 5J47A 5EWJA 4WADA 5EJ9A 1H8ED 4X66B 1SQ6A 1YI1A 3MGGA 3S40A 3LUKA 3DBHA 2PS1A 1VKRA 2CYAA 4LXTA 2G9RA 3CR7A 2PSSA 4RHTA 4DB2A 5ELXA 3E53A 1P19A 4Q3EA 4CKWB 5AHOA 3WISA 4DKJA 1JKXA 3O8QB 2FZVA 1ZGHA 1YHNA 3UAYA 3ZIDA 3M49A 4RQTA 3EIXA 5HHTA 2GARA 2CLKB 2AFRA 4BAUA 2RDMA 1HKHA 4A6PA 5SY9A 3TNFA 4CT0A 2RHDA 1P2UA 2C5GA 2BYTA 3AU8A 1SZCA 4IQGA 1GR0A 3B52X 4OJMX 2X0DA 1Z5VA 4JJ6A 5BSFA 3RFCA 2MMCA 4YMGA 3K94A 4TZ6A 3PPVA 4QGGA 4KR3A 3MJDA 4HBGA 2CD9A 2DTXA 4P58A 5LM3A 2XOKD 1W5TA 4O4JA 2ZSKA 3RK4A 2BGTA 3FJYA 4HN4B 4W7IA 3RVQA 3SEAA 3D2LA 1IXYA 3MTDA 4TVKA 3W1WA 2AKEA 4NP6A 4S35A 3KSMA 3BGDA 1H6DA 2D59A 5F73A 2X4DA 3DHEA 5DN6D 1RPZA 3LCRA 3D2AA 3HYNA 3LMKA 1T1JA 3OKAA 1CRQA 4MW4A 1E3TA 4LKOA 2DJIA 4WFQA 1IE3A 3BL8A 4XPIA 4CFZA 1UMCA 4ASUA 3COWA 4IP0A 3KXPA 1CLEA 1GU0A 1QMPA 1AU9A 1WB6A 2Z1DA 3FZQA 3DAPA 4PZYA 3R6GA 4G26A 5DE3A 1KIAA 1V2HE 2CHQA 2XUZA 4MB0A 4ETNA 4Y2HA 4WZZA 1HSOA 1K9SA 2HF7A 3O9MA 2IS1A 3OZBA 4XH9B 4B80A 5KI6A 3A6PC 4Q1AA 3CCBA 5FLEX 3UNXA 2RI1A 1TFUA 5K6TA 2JFZA 3O8QA 2HDWA 4DXDA 5BQFA 3RG8A 3AEQB 4H1WA 4UW9A 1DARA 2VF4X 4II3A 3DNFA 4ESVA 2XE6A 3IP5A 1G41A 1ZNYA 3GZJA 3V1KA 5EP1A 4BB6A 4XM1A 3VPBA 3LC2O 1KWKA 1N33B 1M5UA 4RXUA 1Z2DA 4ZRNA 2M98A 4QBTA 1PUJA 2OXRA 1QRSA 2IYPA 2G9QA 1G60A 1L6RA 3LZCA 5FNVF 3LUAA 2AR0A 3QV1A 4JLPA 2PV0A 1UP7A 5K3CA 5BV7A 4ZZ1A 5JJCA 3M8KA 2EZ4A 3K70D 1QH8A 1TUEA 2F3RA 4H7IA 1WMSA 4UKDA 4X65B 3U26A 1ZN2A 1IPHA 3KB2A 4KQHA 5GPBA 4AJIA 1W6RA 4OK3A 1VYHA 2GNAA 2Z2XA 4JI2B 1AHNA 2ZT6A 3IR6A 2IOHA 1K8YB 3IESA 3R75A 5KNBH 1QBKC 3X1KA 4ALKA 1DEXA 4ZAYA 3EGDA 3CH4B 3PXAA 4NG5A 2J0VA 2I2CA 3LX5A 1AE1A 4UPDA 2FKAA 2ZIVB 2IOQA 3KQUA 2P2YA 1DKQA 1KEPA 2PWBA 3FFXA 2FWBA 3RS5A 5A5GA 1XVAA 1B6GA 2GXSA 4BNDA 2JFBA 4HNHA 1PD0A 3DZ8A 2M9MA 3PEWA 2B94A 2MIIA 1K8XB 1NSTA 4YH1A 4RJTA 3PFFA 4FSDA 2HT1A 1X77A 5IWCA 3LVFO 1Y9EA 4ZREA 1DL5A 2OAGA 2IU0A 1OFUA 2H1OA 1ADGA 1MTOA 1E66A 4IXDA 2JA2A 5IK2D 3SDZA 1DIOB 2DAPA 4OHBA 1Y82A 1NOKA 1E6CA 3E23A 3HU5A 2BHNA 1B15A 4K5QA 1RP7A 4FYJA 3RUEA 3X44A 1E2BA 4OQNA 4YMSA 4KAXA 1XYYA 4G56A 1LJUA 2FPIB 2H2IA 3HVIA 1G5PA 2L82A 4Y2XA 4AP5A 4KSCA 4CKYA 1KFBB 2HQ1A 4Z9AA 1DJMA 3P9KA 1YB4A 1RXYA 2B9VA 2HJHA 2IUEA 1RSZA 2X2PA 3AEUA 4MV6A 3RWMB 4NXMB 2ORWA 1GG5A 3C1OA 3V32A 1EBFA 3RSLA 2QV0A 3OIFA 5F52A 3TINA 5E3IA 4ARAA 3CF6R 5AJTA 5EE9A 4LQLA 3H87A 4BMZA 5BUZA 4UTZA 3UF0A 2NQTA 4QELA 3BTOA 1IBRA 2HZ7A 2VSFA 4TWAA 4YMTA 1OZ0A 3KLBA 2O0KA 3M2TA 3WYBA 4DXHA 5B58T 4LFAB 1CQJA 4D4HA 3PGXA 5AVTA 3UA3A 4OHRA 4DM3A 5HW0A 3ZS8A 2IXFA 3U5TA 1H6BA 1U90A 1XB2A 3T3NA 3OQPA 1UANA 3RT9A 3TZLA 1XQYA 3VH4A 1DBRA 2IEBA 1LPNA 4OLFA 3KAQA 4YQEA 3VU1A 5C1BA 4ARCA 3BD6A 1K88A 3GT4A 4G9EA 2Z83A 1JHQA 3KKNA 4FEAA 1VL2A 4KQXA 2J0UA 5JCJA 3EXG1 1EPUA 3EGXB 4JQZA 5EZQA 4BQRA 4F2GA 3CVWA 5BN1A 4IJUA 5IJXA 2HIAA 3O7MA 1OILA 1U9JA 1E6KA 2A9PA 3H2SA 4LI3X 1K3UB 2GJSA 3SHVA 2JFXA 1SM4A 3BZBA 1IJKA 2F17A 4UOQA 4C7KA 4EW1A 5CD9A 3BYZA 1LS1A 1Q17A 2SCUA 3P4UA 4HDAA 1SRQA 3OOEA 5HCNA 5DWDA 2GM5A 4OI0A 1QTNA 2LDXA 3UHOA 2ZJ1A 2WYUA 2WV7A 4HDSB 1NRXA 3CN9A 1U7WA 1GLVA 1WZIA 2YOFA 1E1QA 2HTFA 2JVKA 4QYTA 5HF9A 2QSYA 3LL4A 3GPCA 3I0ZA 3R9KA 1VRWA 4D3FA 1GUAA 2Q1UA 4HAXA 4XD7A 2QYSA 2J3EA 4MLDA 4WGGA 3ISVA 1X74A 1L5YA 3ABZA 2O8FB 3QPCA 4BNFA 3P8ZA 5KWEA 4R2JA 4U63A 1GPAA 3MT7A 3GIDA 1USGA 5H8WA 3FYCA 3IDQA 1ORTA 2QZ4A 1R6XA 4MR9B 4DJTA 5C35A 3HVJA 3O94A 2PMEA 3VDRA 4EMBA 2H9AA 4BGVA 3U1BA 2ZDHA 1XDGA 5CU7A 4ED9A 4DDVA 1X0VA 3NHFA 2TRSB 3ZV4A 5L9AA 1NVEA 3WJAA 2Q3LA 2FRDC 2P77A 2ZE7A 3MTBA 3T94A 5F2NA 5BVGB 3OAAA 2Q8NA 1H8HA 1BOFA 2CXSA 4DCSA 1SBNE 2JFGA 4OMFG 1FFXA 3ZDCA 3IOYA 2O50A 1HOXA 4YQFA 3OI7A 3NVMB 1G3QA 4KFSA 3L0IB 4C2AA 4YFVA 3UMFA 1U5BB 3I6YA 3OETA 4I8IA 3VR1A 1JHPA 3DTVA 1ZCAA 2ZRFA 3MTQA 1UQUA 4HPWA 3SLRA 4A91A 5K0FA 5J2UB 3PXXA 1WZ2A 2BLLA 3MGAA 1I4LD 3V6LA 2M6LA 1P0MA 2YS6A 4BP1A 1SB8A 4JJFA 2C7QA 1H23A 1YV9A 4KK3A 1MJNA 3BCHA 2PH5A 3QMPA 1L9XA 2GYYA 1JHYA 1P9NA 2OZEA 4K7JA 3QH4A 4H3SA 3S7TA 5ER6A 5JYEA 4PG4A 2NX2A 4BNMA 4NONA 1NXVA 4JOBA 4EF5A 1AZLA 1OVMA 5ARDA 2IYWA 3DKPA 2FZEA 1E2QA 2C4NA 5AKEA 2BCEA 3AUSA 3MIZA 5AHXA 3SCZA 3Q7IA 3EN0A 4CI9A 1XKTA 1DV2A 1AGRA 3D43A 3I53A 3M4YA 4RD3A 3HMKA 3WBFA 4JXJA 3PDWA 4QUKA 1ZGJA 2J9XB 3Q87B 5AKLA 3S68A 4Z4GA 4YRMA 5HA5A 3T7AA 1I7QB 1RACA 4TV8B 2B4YA 5JPCA 2G9ZA 1TLLA 3A7EA 3CVOA 2VSNA 1NXWA 4IIUA 4YAIA 3DGEC 4MLCA 1FSFA 4BLWA 2MYTA 3TTTA 4B6GA 4F93B 3KVOA 3M7IA 4C5BA 1Z5PA 2BFDB 2EDAA 3TIXB 3TRIA 1BCRB 2XZPA 4Z2AA 1G0OA 4CCSA 5CIYA 4YJHA 2PU5A 4XM2A 1TRHA 3BIJA 3RSZA 1RWXA 1FP7A 3S28A 1RXUA 4XVHA 1D1QA 1OXTA 1C80A 4I1RA 3CE6A 3I8SA 5FT9A 3JU3A 2I6UA 2ZWPA 3GGDA 3GLFE 3W2TA 1O6CA 3TL3A 1M0SA 2G04A 4C1BA 3ZHZA 3EA4A 3ZLJA 2UZ3A 2QN6A 1BG6A 1S2GA 4XUEA 4EL5A 4OQPA 2GAJA 3U4IA 4DTIA 3EPPA 3R5HA 3HSKA 1P2SA 2A8YA 1UWCA 3L3BA 1BROA 2LKCA 3OFNA 5ESDA 1ZKMA 4H7JA 4WCFB 2AFHA 4MJ7A 1F5NA 3WFJA 3AEKA 2QLBA 5ALGA 4YRCA 1NLFA 1CF4A 4O8ZA 2YCLA 4MQ5A 2Y1FA 3N1UA 3WB2A 2O57A 3GLVA 4YY3B 2FVYA 4YCSA 3CRMA 5LIPA 4RTPA 3NVKI 2ZRDA 3HXTA 2Q3DA 2N47A 2A67A 1D8AA 1OVGA 5TPWB 1AF7A 4QC2A 1NR7A 2NU9B 1ZK3A 1MAAA 2P90A 3IMFA 3O38A 4MGEA 4M89A 2C83A 4BGUA 3H5RA 1BTOA 3A05A 4LECA 2DERA 1PZNA 2PLNA 4FE3A 3M70A 1KR2A 3D54D 3MW8A 2D4HA 3OCWA 4RA6B 2J0EA 4CPDA 4M1SA 1FDSA 1LU9A 5J4HA 5C2JB 5BW5A 3PC7A 4LGCA 4RGQA 1EMDA 3PVCA 1R0SA 1W88A 2ZYRA 4IWNA 5JAHA 1KS2A 5L7TA 2WHXA 1OJ7A 1SXHA 1TUIA 2JI9A 2BFCA 3D9QX 1C9KA 3PE6A 3MRVA 5E9AA 4GGPA 4QRHA 2A5FA 3I76A 2MYUA 3V4PB 3SQNA 1WQ4A 3RC7A 1THZA 1ZOLA 2C2HA 2O6HA 4PC7A 2RHCA 2ATVA 4FD3A 4B6PA 1ZITA 2V1XA 3ABSB 1AQUA 1XNGA 4IVPA 4D98A 3BGOS 4LPSA 4G5FA 1PZEA 3H4IA 1C7QA 1KVSA 1PG5A 3FF4A 4QD3A 1E0SA 3OCUA 3OFKA 3STYA 4OFWA 1KKUA 3IEPA 2D5IA 2X2EA 2LW7A 3EY4A 3O7WA 3BXOA 4G97A 4IMJB 1NKTA 3DMFA 4RPIA 5JFTA 2BMAA 5FB3A 1CUAA 2WJ3A 5DO9A 1JP7A 3IEIA 1MB3A 3EMDA 2FWJA 3EGEA 3JD4A 3IMCA 5DBIA 4NG4A 2BSXA 3IO5A 3R9IA 3OPXA 3W05A 4LTMA 1Q6YA 2Q1WA 2GERA 5HS4A 5DK6A 1C0EA 1E7WA 1G18A 2XB8A 3UAXA 4D9MA 5JCXA 3WAGA 2CSXA 1BJTA 3D2BA 3KSZO 5JNUA 4XGRA 5J40A 1QG2A 4DYHA 4BWYA 3FW1A 1CJTC 4QXAA 2GGSA 1V8PA 2OORA 4DA9A 5CDUA 2VNJA 1YRLA 1RXWA 3IBTA 3LQFA 2ZKLA 1DBIA 3RVPA 2AXNA 3LQ1A 3R7WA 2QVLA 4HLUC 1PNRA 4B9EA 2GTHA 4RQAA 2QAGB 1QYDA 1AM4D 5AJYA 4BN5A 1SCIA 3GRZA 4B73A 4PYNA 3K6JA 1FDIA 3LOPA 4DLKA 4HJRA 4P2BA 3GUVA 1PFYA 1XRLA 2GD1O 2XCUA 3H9CA 1NI5A 3DCNA 1A98A 4Z0PA 2ZJ0A 4LJLA 2R4UA 2E5LB 3CS3A 3HVHA 3INYA 1YZ3A 4NYMQ 4PGMA 3PI6A 4JR2A 5I7AA 4D3YA 4E07A 1NSFA 4WLFA 1LBQA 4UTNA 3N2ZB 1BS9A 2PVPA 4RZ2A 3MWFA 2B37A 3WLTA 4HDNB 4Q15A 1LWNA 4CF6A 3HB5X 2DJ5A 5FFMA 3D6HA 3ETDA 1DUSA 4N82A 3TZQA 3I45A 3UJPA 2XWPA 2IBTA 5EC8A 4TWIA 1RJDA 2BH9A 4KGZA 4C6TB 2YOGA 1CEYA 2F3PA 2C5AA 2WHEA 3EUWA 4PAQA 3BGIA 3DH0A 4DV0B 1NBAA 1PU2A 3DG9A 5ENVA 5AKHA 5JCPA 4UBMA 4KAAA 4UHBA 3P9QA 4UUMA 3QSYA 2VDWB 1DELA 5GQSA 1UPFA 5IBPA 5BWOA 2CNKA 2Y9YA 1KAEA 3DL4A 3FLMA 4BQFA 4Q9DA 4EHDA 1Z4NA 1L4EA 3JD2A 4J4BA 4N7MA 5F33A 2YICA 2DT8A 5K2MA 3IOMA 3Q88A 4YDRA 4AW9A 5IJ0B 1LWOA 2L2QA 1OLXA 4ZHQB 13PKA 1N7HA 1DTSA 1N3IA 1TAHA 1QRDA 2HRQA 3PQCA 1M2VB 4URYR 3ADDA 5BQ5A 2QX4A 1QUFA 2IXBA 4DR7B 1IK6A 1JKJA 2O8BA 2GRUA 1U98A 2KMLA 3ZK8A 4IDHA 2GN0A 2XTNA 2Q1YA 4LXUA 4P3NA 1FVXA 3JQ8B 3RVOA 2XB4A 4RE6A 2AR7A 3PKJA 4DGQA 4CL2A 3G88A 4IW3B 2HDHA 1O9HA 1U8XX 1DEKA 4A82A 1NFRA 4GQIA 1DRJA 1OAOC 2GFIA 5JPDA 3OCYA 3I5XA 3K20A 3KIPA 1N1EA 4PO9A 1Q7CA 3FBTA 2ZIXB 5FL3A 5B7NA 4JI3B 3ZQ4A 3KQOA 4ARIA 1BXGB 3OHPA 5F5NA 1NTOA 3UA4A 4QSMA 3DL0A 4KBFA 3ZZNA 3RASA 1LSSA 3TBKA 1JIKA 5CA0A 1R9JA 2KSQA 5AO9A 4M7WA 2EJWA 3L0CA 3T95A 4KMRA 1Y6FA 4E51A 4J1TA 5EMHA 3O8BA 5AKXA 4BNYA 2XGOA 4WNAB 4FE4A 3KQNA 3NO4A 3AUFA 4DM4A 1DDIA 2EQAA 1K97A 2QAGC 3LXXA 2DUMA 4GZ5A 1BJKA 1MB9A 4RX1A 1VA4A 2UVPA 1E3EA 1DJQA 3IVMA 5DEOA 4ZVQA 5DBGA 2V8BA 2GKOA 1GPBA 2NXJA 2XNCA 2A9FA 2BJHA 4FFNA 4G41A 3I34X 4JZKA 4P34A 2LV8A 4GKAA 3WSTA 3ZIAA 3CB4A 1U7HA 2OWEA 2A4KA 1QOZA 3E58A 2JZCA 3ZBPA 3NTXA 1WX1A 4G0QA 1EAMA 2Q27A 4M1YA 4J0GA 4B4OA 1AZWA 5FOQA 1Q16A 2UYOA 2GA8A 3OP4A 2QJTA 2QU7A 1KSHA 5E38A 3JALA 3UG6A 4CTJA 2DVMA 3IBSA 4DLYA 5DIZA 2BT4A 3RTAA 4CMEA 4QPZA 5TJHA 1ID1A 2OXTA 3THSA 2BFWA 1ZO8A 1GXSA 3FVTA 4O25A 4RS3A 1EUQA 2A5DA 2G8LA 3DBIA 3NTRA 1R3DA 3KLMX 2J0SA 3QYPA 4OCZA 3I6IA 2A78A 3QWBA 1KFJB 3G0CA 2JJ2D 3QWHA 4N8DA 3BWMA 4KLCA 4QOSA 1LBTA 1NA5A 2I2BA 2V7TA 2B82A 1ODKA 3ISTA 3ITKA 2O3TA 2PUWA 4DQDA 1QIEA 4IDNA 2BM0A 4Q7KA 1FC0A 3QITA 2JHGA 1AN9A 1U8CB 4G1BA 4NBNA 4OB7A 4EBFA 4EHFA 5LMNB 1BS2A 2UV8A 3THWA 4DZTA 1XQWA 2OO5A 2VAMA 4HQNA 2IRWA 1V1MA 1YZFA 1Q92A 1WEHA 3TD6A 1FQJA 4YV7A 1U80A 4JLSA 1E89A 4EO4A 1NMYA 1QHIA 1HFWA 3CXRA 1IH8A 1DAIA 5H9WA 5LZ9A 4DUYB 1L7XA 1X2EA 1SVSA 1PGJA 1SVMA 5FBVB 4XZ3A 1KPGA 3P2KA 1EXWA 4YJ3F 1ZRMA 2JFVA 4D0GA 1M1XB 3HSYA 1PG0A 1EB8A 3V5NA 2NXNA 2X1MA 4PWYA 1F2UB 2IXTA 4AI6A 3MF4A 1EVLA 3AZPA 1GVNB 2A0WA 5HS6A 2O19A 3OM9A 3A27A 4E1AA 3ZJVA 4E33A 3M33A 4RLQA 1KQFA 3QKRB 3QXHA 4O63O 2QP9X 5F5XA 4K9QA 1SU4A 1ADFA 2QTAA 4DRZA 3QU4A 2DFVA 1M72A 3JASA 4W9NC 4XUGB 2EKDA 2C2ZA 2I87A 1Z15A 3QQ5A 4G63A 4RMHA 5A4DA 2PUHA 5J9FA 4J0IA 3R0JA 1QFSA 4MIKA 1KO8A 1ZMOA 2WSSA 3LCUA 3C48A 1E5XA 1SD2A 1UK9A 3TSOA 2GPSA 2AD1A 3QPUA 1AO3A 4DIKA 3AR5A 5JXHA 3F67A 1PGOA 1UXJA 2OXIA 1FFHA 4TLCA 5JJKA 2HHAA 1CWUA 5A9SB 1DZ3A 1U0EA 1CRZA 1E8DA 2CNWA 2VCEA 2ZQ5A 2QAGA 1TTQB 3F98A 2I33A 5SZHB 4C4RA 2BEKA 5F7JA 1GARA 5K0LA 3DBLA 3VU9B 4O2AF 1YBMA 3J7TA 2WAOA 4LWQA 4TUYB 1ZI9A 4XB2A 1OX5A 3BULA 4D82A 821PA 2O1WA 3L77A 3D4PA 1X38A 1IM8A 1RP1A 3DJFA 4CQMB 4I1PA 5D51S 5ED4A 2QJFA 3AL2A 3EFOB 1DOZA 4HAUA 3RJ9A 3WB1A 4B4DA 1IMOA 4PTYA 1W87A 1UWVA 4N5NA 5BN5A 1D0IA 3OIWA 1Z25A 2F8TA 3R5KA 1W4LA 3O4HA 3JQ7B 4OJNA 5FFFA 3CJTA 2XJ9A 3PT9A 3MRTA 2Z98A 4NKRA 3TQHA 4MI6A 5T67A 2J9ZB 3V1UA 3VKFA 4E3ZA 4QT4A 3U44B 2OYCA 4DSZA 3VO2A 3CF2A 2M2IA 5HKBA 1OGJA 1V39A 3RVNA 2FRVA 4QNRA 1VPWA 3SC2A 5LQNA 1OQAA 3PJRA 1UMKA 3GK3A 5ADUS 3O84A 3WSVA 1EWYA 3X1YA 2AC4A 1O97C 5HUHA 1XNQB 1RBQA 4HH0A 5IXJA 1BD3A 4RYDA 3B3AA 3ILHA 3GCDA 1DKOA 4UU7A 1BMFD 4RJ2A 3IXQA 4N8EA 1GG9A 4YP0A 5JDCC 3NYRA 5A4JA 8ATCA 4QBHA 3NJ8A 1JG1A 2W00A 5AOCA 1FUYB 3ORHA 1ZGGA 3KBBA 4L27A 2O2HA 5TPWA 4E0BA 1PZGA 2WZQA 4AXXA 4ZOEA 4DR4B 4PFQA 2OL4A 5J5VA 1H5QA 3GAAA 2CB0A 1AN0A 4HQ0A 1MXFA 1BVYF 4QFMA 3UGJA 3DKKA 1PK9A 3NH6A 3Q11A 4EM6A 2OGUA 4LYFA 1VJCA 2NPOA 2B1IA 4P4UA 4DA6A 4I19A 4KIFA 4A0QA 4EENA 3L7MA 1SIOA 1CNMA 4S1VA 4BO0A 4V1CI 2J45A 2ZBEA 5DIFA 3W5BA 4QULA 1EWQA 1S96A 1ZD5A 1GUYA 3HMQA 2OESA 5A1JA 3IP3A 1OXMA 1ONOA 3LECA 2C98A 3ZR4B 2H52A 1Z6AA 2JC3A 2WWFA 3F90A 2X8BA 4P53A 5KMGA 2CLEB 4C78A 3H83A 3ZJUA