1M66A

Crystal structure of leishmania mexicana gpdh complexed with inhibitor 2-bromo-6-chloro-purine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords Glycerol-3-phosphate dehydrogenase
total genus 133
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m66A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m66A01
4TKMA 4ZQFA 4D45A 1ZK3A 1E3IA 1IL0A 1E5LA 1QXSA 2ET6A 1ZK4A 2DT5A 3AWDA 2WJPA 1D1SA 1JTVA 2CD9A 4FD3A 1ONOA 5KVQA 3ITKA 3I4CA 4INAA 4B3HA 1JKJA 4A5OA 1WAMA 2CVQA 4QO8A 4EUHA 4U0KA 3GEDA 1MXFA 4AVYA 3EK2A 4ND3A 4YQZA 1U3VA 4IJWA 4WK6A 3RROA 4RPHA 4Y8VA 4ZD6A 4PLVA 4R16A 5JSFA 4BGVA 1LDNA 3KSUA 1B8PA 3GF4A 3RUEA 3DONA 2VYNA 2H5LA 3BHMA 1LRKA 1A27A 3AUTA 3MOGA 1U5AA 1FDWA 3GNSA 2IZ0A 2CF5A 3ASVA 2Y1FA 3MWDB 2DPHA 2D0IA 1ADBA 5T67A 4BO0A 5CEEA 2D8AA 3D4NA 4OL9A 1A7KA 2Z5LA 1ADFA 3G1UA 5G2OA 2DM6A 1KIFA 3ZHXA 3HDJA 3DTTA 2YV1A 4JBGA 1KYQA 2PTGA 2Z1MA 3QWHA 1HDOA 1KY4A 2PK3A 4PZCA 4J6FA 3VVCA 1I3LA 4ZGWA 2B35A 1Y1PA 4FGWA 1NFRA 4RQTA 4AJOA 3GOHA 5ICSA 3W1VA 1XU7A 2PKQO 4YB8A 4ALLA 4XA8A 5CEJA 1HL3A 4BKOA 2V6GA 2JFHA 2FR1A 1R4NB 3ZWOA 5TLSA 1GL3A 2O3SA 5L4LA 1O0SA 1T2CA 2X23A 3F1LA 2W2LA 1O5IA 3TL2A 2WM3A 1V8BA 4IGFA 2O48X 2XPCA 3CSDA 1DPGA 3FN4A 3BTSA 3MJSA 4L8VA 4CUKA 4I5DA 4EJMA 5KTKA 1Y5MA 3OHSX 3BHJA 1G0OA 4PZDA 2EJVA 1H2BA 2J3JA 3LT4A 3CZRA 1EFKA 2GPTA 3ONEA 1LSJA 2OGUA 1Q7CA 4CM4A 1EBUA 4A03A 2AE1A 3E9QA 3Q6IA 3G0OA 2JJYA 3A4VA 1TB4A 2X58A 3QIVA 3PXXA 1C0KA 2VWHA 2WE8A 1MFZA 2Y0EA 4QT0A 4DPKA 3PQEA 1E6UA 3AI2A 1PWXA 2FR0A 4FFRA 2CNBA 3QQPA 3AJRA 1X1TA 4PG4A 2PD4A 4D42A 4R5MA 3L07A 1AE1A 2NQTA 1RM0A 4OH1A 5FI5A 3TZCA 4RORA 2GN8A 2NUAA 1HSZA 1C0IA 3GVXA 4JK3A 3W8DA 3EYWA 3K30A 4HY3A 2X8LA 1ZZEA 4R3WA 1SB9A 5HTOA 4BNXA 5KJCA 3WDSA 2JHFA 1EZ4A 3P2YA 4BGIA 4CMKA 2UVDA 1GEEA 1GYRA 2C2XA 4NNJA 1E1MA 3WGQA 2EG9A 3TPCA 1YOVB 4IBOA 2CDCA 4OKNA 3PFWO 1PTJA 6ADHA 1PWZA 4RCVA 3UICA 4I9HA 2Z95A 1KEPA 3ZNQA 4JP2A 1CDOA 1G1AA 4GMFA 3ZWYA 2D2IA 5F5NA 4AJ1A 3GPIA 3MWEB 4ZQGA 2G82A 4A73A 5A05A 5A3VA 5EQDA 4WLFA 1NFFA 1N1GA 2NLOA 1XG5A 2D1YA 1NX6A 1DDOA 2Q1UA 3DZFA 4JJGA 2PH3A 1X13A 2YYYA 4MKRA 3ZWCA 1UXJA 5JC8A 3GG9A 4WLVA 5F5LA 2EGGA 4CV0A 1UDBA 4W82A 3KRTA 2BGKA 1ONNA 2EWMA 4K6FA 1VLLA 3ZGYA 5T64A 2ZB4A 4TQGA 3OJ0A 1XQ1A 4L75A 4PVCA 2V6MA 3MJEA 4ITUA 4LMPA 4XYLA 3AU9A 3ZV5A 5TS3A 3CE6A 5TX7A 1QSGA 3A28A 2OMEA 1FJHA 5DOZA 3TJRA 1LUAA 3LT0A 5BNFA 4E6PA 4BNLA 2YDYA 2AQ8A 1QR6A 4CLXA 2JD1A 5TC4A 4CLRA 1QV6A 1ML3A 3RFXA 2BRUA 3DBLA 4WJZA 1BGVA 4OXYA 4CM6A 2QZ9A 4H3VA 2RH8A 4XRRA 5JYDA 4D79A 4UUNA 3JQ8B 2FY8A 1BW9A 1SCUA 4U6SA 4IDAA 2HMVA 3PRJA 5I9LA 4CMGA 4WLUA 3X2EA 1K6IA 1ISJA 4DBVO 4LMRA 5L3ZA 3ZU5A 2AHRA 5H81A 5L40A 5IAAA 2GGSA 2BFOA 4HV4A 4BO1A 1AXEA 1LLUA 5A9SB 4RLSA 1WMBA 2O4CA 1YE3A 2W98A 4O6VA 1ULUA 1X7DA 2DPGA 1PEDA 1E6EA 4R9RA 1ENOA 4LRTB 2NTNA 4JN6B 1XELA 4UUMA 5HRUA 1DC5A 2W2KA 3ANMA 3ABIA 3PYMA 4FJ1A 3DZHA 3H9JA 3QV1A 1IHYA 1P1IA 3R3JA 1PSDA 3WBBA 4W99A 4GI2A 5L7WA 3EVTA 3GEMA 4FSHA 1EMDA 1QYDA 1GQQA 4KWHA 4AG3A 1P0CA 1JVBA 2C07A 3I83A 1MB4A 3B1JA 2D5CA 4JBIA 5U4QA 1IZ9A 4FOOA 3ZNNA 2IYPA 3DBLB 2JKVA 2VHVA 5IG2A 2DBQA 3P2OA 1P44A 2GZ1A 2GZ3A 3F5QA 4DRYA 2IZ1A 4WCFA 2HMSA 1DJNA 2GCGA 3FCOA 3Q2KA 2NU6A 1DIBA 5DOVA 1IULA 4MOWA 4YQYA 1PS0A 3NTRA 3EDMA 5KNLA 4YJGA 2HDHA 1DFHA 4RVUA 4UEJA 1XHLA 4O0LA 1WDMA 4KTTE 2CY0A 4FR5A 4YT4A 3HFGA 4DIOA 5CG2A 3IAHA 3I6IA 4E5PA 4E2WA 4B3JA 1LBEA 1MC5A 1O89A 4J9VA 3WJAA 5K9ZA 3K92A 4WE3A 1LTHR 4XR9A 2X0NA 4FDAA 3C7CB 2EKLA 2VYVD 3EVNA 3T4EA 3KYCA 4W9NC 1NP3A 1IYZA 1H6CA 3GAZA 3FPLA 4RJTA 1E1NA 1MGOA 4EZBA 1QV7A 3H9QA 4J90A 3W4KA 3SVTA 1YBAA 4QEDA 3PLRA 4GQAA 3O8QA 3DC2A 2XXBA 3KVOA 3S2GA 1C1DA 3M2TA 1GV1A 4D3SA 3C1OA 1UDCA 1I10A 3QWAA 4YR9A 3GDFA 1JN0A 1UZLA 1P74A 3H6KA 5HWSA 2DU8A 2HO5A 2B5VA 3IUPA 3BTVA 2O50A 1I36A 1UR5A 4II3A 4O63O 3P5SA 5JYEA 1NM5A 3GDOA 3HUDA 2GN6A 4ZRMA 1OFGA 1K89A 1YWGO 3GDGA 4GX1A 2ZTLA 3UF0A 1LEHA 2IXAA 2Y0DA 2VHXA 1HYEA 3NV9A 2O2YA 5BSEA 2D3TA 4DVJA 4IQ8A 4UVGA 1D3AA 1R0SA 3NJ4A 2EKPA 4YJHA 2JL1A 1LRLA 2IE0A 3CUKA 5F3RA 4E0BA 4IS2A 5EMHA 1ZMTA 4NR0A 1VC2A 1E3WA 5H82A 3JQ6A 3HDQA 1BXZA 1SZJG 4JGBA 5BT9A 1GD1O 3U4HA 3H9GA 2Q99A 3AK4A 5F1KA 2C20A 2FPPA 3RBZA 4DQXA 1YRLA 1E77A 2JCXA 1WVGA 4UAGA 1R0LA 3AY7A 2G5CA 1T2FA 2JAHA 3KYDA 3UCEA 3AI3A 4YAKA 3ANLA 1Q0LA 3AY3A 1J6UA 1Q0HA 5IDQA 5KCZA 3DZKA 8LDHA 4J7UA 3OEYA 3Q0EA 1R0KA 3LC1O 3MCVA 4JBHA 4EUFA 1PS8A 4EJ0A 5TQVA 1KETA 2FR8A 3RSHA 1ZSNA 4BOYA 2DFDA 4XQ9A 3PHJA 2PGDA 1LDEA 4BNUA 5FYDA 4G65A 2VHWA 4I9NA 2EGHA 3PPIA 4LN1A 3ORFA 1CRWG 4DIFA 4OXKA 1B15A 3G1TA 3TOXA 4NBWA 4GVLA 5G0SA 4CM1A 1HLPA 4DPMA 4IZIA 4NFYA 3BMQB 4U5QA 1RWBA 5GZ1A 4KDFA 1TLTA 3IKTA 1EDOA 4XQCA 2C7GA 3JYQA 4NH4A 5BNTA 4ZICA 4O1MA 1H5QA 2DUWA 1ZMOA 1U8XX 4Q3EA 3V2HA 4I5GA 4GBJA 1E6WA 3INGA 1NXQA 4L9RA 4P22A 3RKUA 4RDIA 3TL3A 1E5QA 1N5DA 1O9BA 1T25A 4XYBA 3RCBA 1T4DA 1TT7A 1BHSA 5L7TA 4IPTA 3DDNA 3PIIA 1A5ZA 5DDIP 1HDRA 3PDJA 3ZWAA 4H16A 3RBVA 3U49A 1B3BA 1R6DA 4HFJA 4RQUA 2Y66A 2JAPA 4LISA 2QQ5A 2Y68A 2ZJ1A 2AXQA 3TN7A 2C59A 4RPGA 3PGJA 3VH1A 1PJQA 1DHTA 1ZSYA 4ALIA 4BMSA 3M1AA 3DZBA 1PGOA 3U4CA 1A4IA 5DZSA 2FPGA 4PFJA 1LLCA 2X4GA 3FBTA 4LGVA 3FR8A 1EE2A 4KTVE 2UAGA 1HWYA 1Y8QB 5IDWA 4LSWA 3FWNA 3LVFO 5EL0A 1E7SA 3QW2A 3MEQA 4PG6A 5JE8A 4OMUA 5JLAA 4NZ9A 2PZMA 4OOEA 4ZQHA 2WMDA 2IYOA 1I3NA 1BXGB 3BYZA 4HWKA 4TWRA 1IHXA 3AOGA 3AUUA 2G76A 2CUKA 4IINA 5CP8A 2O23A 2O3RA 3KSDO 3FWZA 3GGGA 1NASA 2P68A 5IDXA 4UVIA 2WYVA 2BF7A 1HKUA 4XZ3A 5MGBA 1M2WA 4W4TA 4Q3AA 1SEVA 4NPCA 5CFZA 2OP0A 4OAQA 4GWGA 4NI5A 5IN5A 4DBZA 3IIEA 3TFOA 3ZHYA 1HDGO 2YJZA 2IZZA 1VI2A 3U3XA 1C1XA 1U4SA 4Q3DA 4YTEA 1WP4A 3JQAD 4WNIA 4N5NA 1UXHA 1KVQA 4NU5A 4CMEA 3KM0A 5B4VA 3Q2IA 4JLWA 4DGSA 9LDBA 4FW8A 3KV3O 2Q2WA 1H6DA 3GVCA 5BSGA 5C7OO 1NR7A 2JHGA 1SOVA 3H3FA 1T2EA 4NBRA 2CVOA 3QVOA 4H7PA 5G0TA 1X14A 4MVJF 4P4GA 5ILGA 2Q1SA 2J3HA 4Y6SA 3BXXA 3ZZNA 3F9IA 1CERA 1GDHA 3WTCA 4BB6A 3U4IA 1FDTA 3GT0A 4CR7A 3SJUA 4IDEA 3RC1A 4IJKA 4AJNA 4L4SA 3HWRA 1IZ0A 3GY0A 1YXMA 1WZIA 5A04A 2YY7A 2P9CA 3O8QB 2V6FA 1ISIA 3V5NA 1EVYA 1A9ZA 1LLQA 4YAEA 2A9FA 2FSSA 3QE3A 1HDZA 2VZ8A 3Q9UA 3K96A 1HRDA 5IFLA 3WIDA 1NPTO 3BZUA 3GN2A 2GLXA 4RF2A 3OA0A 2GERA 5I7FA 3I9OA 1NBOA 5KJEA 3M1LA 3DHEA 2P91A 3V1YA 1E7MA 1NFQA 4CM9A 2GN9A 1N8KA 1N9GB 4OKIA 3F47A 2VYVA 1L7DA 4WECA 3VPGA 5A03A 2XXJA 3P7MA 5TJ9A 1E7YA 3RAJA 2O7QA 2JCYA 3DHYA 1D7OA 1GCUA 5ITVA 1D8AA 2NM0A 2RBEA 4KUEA 2R6JA 2VYND 1GCOA 1JDJA 1UP7A 2TMGA 3S1LA 3COSA 3K9QO 3LF1A 2DTDA 3P19A 3WYBA 3LU1A 1YOVA 1BSVA 4MKZA 1R37A 5IDYA 2EIHA 2Y05A 1T1SA 2BMAA 3ZH2A 4CQMD 2YFHA 1U3TA 1PJ4A 2QRLA 4O5OA 4MVJD 3WGYA 3ETGA 4C7KA 1WDLA 4LCJA 2OUIA 1VL0A 4UULA 3I1JA 3GNTA 2YW9A 2GF2A 4MVJP 3L4BA 4OOFA 2VWPA 4DQVA 2HAEA 4WASA 4GKBA 3TZQA 4BMVA 4BS9A 3FTPA 4PLCA 1SB8A 4MKXA 5FEUA 1P3DA 3S8MA 3PEFA 4F6CA 4BNNA 3M2PA 1DBVO 2X0RA 2VT3A 4DC0A 1QYVA 3AOEA 4MIYA 4BO2A 3H9EO 4X54A 3WSVA 4IXTA 3KSZO 5L53A 3EGOA 3BMCA 4UVDA 2O3QA 3EZLA 4YJFB 3MZ0A 3AM5A 3OICA 2ILTA 3ZN2A 4CV2A 2Q4EA 4IJUA 1CQIA 2J8ZA 1H2HA 4KUGA 4Q3NA 1T1RA 4GMGA 3BTUA 4MINA 4YAIA 4NJMA 5FWNA 3OETA 3C1AA 4HUJA 3C7DB 3QJ5A 3L77A 4ALKA 3RI3A 1W0CA 1RM5A 5ER9A 2PD6A 1DAPA 2BFMA 2Y1OA 5JCJA 4BO7A 4CM3A 1HETA 1Z82A 1PZFA 3NT2A 1ZO8A 4FN4A 1KBZA 2C7VA 4DQUA 5ILOA 1E92A 2D5AA 4IDGA 2EXXA 5EN4A 1Q0QA 5G0VA 2OORA 3QWBA 1KVUA 3H3JA 2ZCVA 4YT5A 3JQAA 1ISGA 3ZWWA 4WCFC 5JAIA 3I23A 5HBRA 1B16A 3ASUA 4J1NA 1EVZA 5CAEA 4R1UA 1DO8A 3IMFA 4TSKA 4MIOA 4BKRA 4J4TA 5COAA 1C14A 1VM6A 2VUTA 2YV3A 4PRLA 4QXMA 3LLVA 4WLOA 5CDUA 3GNQA 2J6IA 2CVZA 1WWKA 3DWFA 3VVBA 3V2UA 4ZA2A 3CPSA 3E5MA 3ZU4A 2FOIA 4BNYA 4BGEA 1XQ6A 1EUCA 3WGZA 3ICCA 4I5EA 1ZXLA 2DVMA 5DCYA 1E1KA 1ONPA 3INTA 4JJFA 2A92A 1JQBA 3HADA 3WTBA 3CH6A 4DLAA 1YL6A 4R41A 4OXNA 4B3IA 2RIRA 3GFBA 4L0QA 4NHEA 1A71A 4J7CA 3C7AA 3DQPA 1R66A 3DBRA 4IQ0A 3QVTA 1VKNA 2FPIA 1YJQA 2EW8A 1O6ZA 3RVDA 1MX3A 4W6ZA 4MVJI 1KC3A 3NRCA 1SO8A 2DTEA 4GVXA 3K2EA 4M89A 3ZDFA 1HYHA 2PZKA 3FNHA 2Q1WA 4P8RA 3L9XA 4DTIA 3U62A 2Y1CA 2X9NA 1A72A 4IDFA 3DAGA 3BMQA 3FNFA 1HYGA 1TXGA 3HFSA 1PX0A 3QSGA 1WXDA 3EUWA 3GVHA 2X5JO 4UVHA 3RU9A 1DC3A 4E33A 1DRUA 2NSDA 2R2GA 3OIGA 1ZBQA 1ZNQO 4RPKA 4FFNA 2DQ4A 3MTJA 4R4JA 3DZJA 4RGBA 5KWEA 3EZYA 3WGIA 1ZK2A 1NTOA 1S6YA 3H5AA 1ZEMA 4Z3DA 2G17A 3IL2A 5I7VA 2HCTA 4ALJA 4UVEA 3WFIA 2Q50A 3C85A 4DMLA 3JQ9A 2BI7A 2AEJA 4M49A 4NG5A 1E1LA 1X0VA 3FF4A 4BB5A 4J3FA 1TA4A 5EJ2A 5L4SA 1N1EA 2VNAA 3D64A 1P9LA 4M54A 3H5NA 3HE3A 2Y1EA 4L4XA 3S2FA 3GA0A 4AL4A 3A9WA 1EQUA 4XKJA 1GPDG 3I52A 1M66A 4RL6A 3AU8A 2OL4A 1PJSA 1XSEA 3DFZA 3NAQA 4I1IA 4OYRA 2X86A 3WJ7A 1EFLA 2NADA 2ZQYA 1IPEA 4FBGA 1Z7EA 4QFCA 1I2CA 2O7SA 4CMBA 1M67A 2W2KB 3WMWA 4XWYA 2OHXA 3WMXA 1DB3A 2X6TA 2VZ0A 1ZW1A 3E18A 1LSOA 2GDZA 3FR7A 1H6AA 3DB2A 1LDMA 1I5RA 1ZFNA 4PCVA 1P77A 1HE4A 4B4VA 3G79A 3UW3A 4DLLA 3OJOA 5L51A 3LT1A 4MP8A 1K3TA 3Q3CA 1P1JA 4CMJA 3ZU3A 2Y67A 2OBYA 1NQAO 4MVJE 1XGKA 4CL3A 4HXYA 3KOUA 5L7YA 1XKQA 3RU7A 3UXYA 4P4NA 4XD2A 5A5FA 5MDHA 3HB5X 1OC2A 4ESOA 4PLHA 3K73O 3ADPA 3PZRA 4FFMA 2QIOA 1F8GA 1ENYA 4D7AA 1PJTA 5G0WA 1BDMA 4BKPA 4TRRA 4YRDA 3I9MA 5TJHA 5B4TA 1I8TA 1R4NA 2P4HX 4BV8A 5K0ZA 4W7IA 3IJRA 2R00A 1I30A 3GGPA 3JQAB 1ID1A 2AEMA 2J5QA 4IS3A 4GKVA 1YDEA 3ZWBA 1M6WA 4YYZA 2ZYGA 1Q2XA 3OM9A 2FWMX 4J1SA 1S7CA 3U5TA 5B4UA 1HLDA 4RF4A 4ONEA 2R00C 3BMNA 2VCYA 4Q3CA 4J4BA 1KEUA 5ENDA 4D3DA 4BKQA 1XWFA 1R4MA 1XR3A 2Q4BA 4JROA 3JD1A 5AOVA 1ZUD1 2AG5A 3GHHA 4GX0A 2ZYAA 3UAGA 2I6TA 3OJEA 4NBUA 4A27A 4BO3A 2LDXA 3RWBA 3W4IA 3GRPA 2C2YA 5A4DA 1CJCA 1L1FA 3UUWA 4J49A 3RKRA 1U2DA 2HRBA 2CZCA 5DF1A 5JDIA 5LCXA 1YB4A 3LZ6A 5DBIA 4CM8A 5JCXA 4FQ8A 4BQPA 1VJ0A 4IDCA 3E8XA 3TQHA 1T24A 3B1KA 1T4BA 1HXHA 3RUCA 1WNTA 2WDZA 1JVSA 4I08A 4ILKA 3JQGA 3WFJA 4ZU3A 4NFSA 4BNMA 1V3TA 4HFRA 4S1VA 4EEZA 1XCBA 3KTDA 3GQVA 4CM4B 1ZVMA 3EC7A 3ZWVA 2HK7A 2B83A 4QECA 4WEQA 2YZ7A 3DBVO 4R54A 4EJ6A 3ADOA 2AA3A 4KUHA 1Z73A 5DT9A 5GMOA 3SC4A 3F4BA 1PQUA 4RPLA 3VPSA 3C1TA 3M6IA 4FFPA 3PJDA 3OF2A 1C1XB 3OQ6A 1NR1A 1GYQA 4E21A 3KLPX 4Y6RA 1GZ4A 3ETEA 4QSMA 1T2DA 1PZGA 3IJPA 2UV8A 1J4AA 4B8ZA 2SCUA 1MC4A 5I8ZA 3TZKA 1UZMA 3HDYA 2FZEA 4LSMA 4M1QA 5ITWA 3TF5A 2ZB8A 1SOWA 4WOJA 4N18A 1GFSA 1FK8A 1MG5A 4HFMA 2Y99A 4S3MA 4CMAA 3DXFA 4CMCA 4U0JA 3PWKA 1UP6A 3O38A 3L4SO 1AN9A 2XOXA 3CEAA 4FC6A 4PG7A 1PZHA 3LLSA 5JMWA 1YDWA 1EVIA 5TT1A 5AXAA 1AUPA 3R0IA 3W6ZA 1NAHA 1DIRA 1RM3A 4AJHA 4ND2A 4HNGA 1CIVA 2JFFA 1BMDA 1HTBA 1XU9A 4W7HA 1DIGA 2PZLA 3DHNA 3JYNA 4OGWA 3W4JA 4XYEA 5CDYA 3SXPA 3ZV3A 4PGFA 3HZZA 4N7RA 4GWKA 4CUZA 3HNPA 3JD3A 4CMEC 3GAFA 3PHHA 1PS9A 2Q49A 1LJ8A 5C5IA 4IIUA 2ZYDA 1E7WA 4GLLA 3Q1LA 5A5EA 1GQYA 1LI4A 3DOOA 2W2LD 1WLYA 1K6JA 4NIMA 3WSWA 5BNIA 3ZWMA 1LDBA 4XRGA 1Z74A 3QP9A 4A0SA 3BAZA 1HDYA 4Y67A 1FDUA 1QMGA 1CETA 1A9YA 4RDHA 2A35A 4B4UA 1DXYA 3H5RA 3R1IA 1WPQA 2ZQZA 4E12A 4CUJA 3H65A 2B4QA 2Y1DA 2YV2A 4CM7A 1GR0A 4FJ2A 4XQGA 3GN1A 5HS4A 3PLNA 1FMCA 3R6DA 1PGJA 4CJXA 1V0JA 2GN4A 3WOHA 3G17A 1LC3A 5JW6A 3QWFA 3KHUA 2CDAA 4F3YA 4BO6A 4XR4A 1DIAA 3RUHA 3WWZA 5CHEA 4B79A 4WLNA 1I32A 3OEWA 4AFNA 4CQMA 3ZWPA 5ADHA 2YUTA 4E2ZA 3DBRB 1JA9A 2GYYA 4BNTA 1VJ1A 4ZN6A 1C0PA 3C3XA 3OMLA 1E3EA 1NYTA 4DPLA 4E31A 3E9MA 3GRKA 4CMIB 2QX7A 1P1RA 4Z9YA 1IUKA 2BGLA 3AW9A 4Z0HO 4BKUA 1WZEA 3CKYA 3F4LA 3K2BA 1GU7A 1BVUA 5JC1A 4QUKA 5B1YA 1K2WA 5TIIA 3KXDA 1VSVA 5K6AA 1VSUA 5F1PA 5I7SA 1UAGA 2J5RA 1F0YA 1Y8RB 4RZIA 2YDXA 3PDUA 7MDHA 4K6CA 4CLOA 1PR9A 1U3WA 3PP8A 3VHRA 2UUOA 2CFCA 4EUEA 3ENNA 1BDBA 1CWUA 1Q7BA 4CM5A 3U9LA 1PGNA 4R5HA 2YHUA 3BHIA 3GZNA 4M86A 4M87A 5DCWA 3D4PA 3RFTA 3S2IA 2DKNA 4DMMA 3WQQA 3WLFA 5C7IO 1H9AA 5L45A 1LRJA 3ZWXA 4C4OA 3IQDB 2Y1GA 5JY6A 1W6UA 3VTZA 2J5KA 1YQXA 5T5QA 4NK4A 1NHWA 1F17A 1NQOA 1V3UA 3L6EA 4RVSA 4IDDA 4XB2A 2VWQA 3FNGA 2GO1A 2PKQP 4DUPA 1I2ZA 1LC0A 4YVFA 3F5SA 2HLPA 1U3UA 4YRAA 4E5KA 2PFGA 2HJSA 1LU9A 3JQ8A 2DC1A 2HKIA 1VL6A 3JQCA 1NVGA 4YDRA 4R01A 2V6BA 4NFHA 4KQXA 6LDHA 1SAYA 5CDTA 1P1KA 1ZJYA 2AG8A 3JQEA 4XIYA 4I8XA 5DBFA 2HUNA 4ZJUA 1MV8A 5J23A 3OP4A 1GZ6A 3WIEA 3UHAA 4CLRB 1ISMA 4XIJA 3QVWA 1MLDA 5KVCA 1LA2A 2P5YA 4TRMA 1HE2A 5JS6A 5THQA 1M76A 4TZTA 3VKVA 4CQLA 3WGHA 2JCVA 1CF2O 4YCAA 1H9BA 3I4FA 4R3NA 4C7JA 2OFPA 1O8CA 3PWSA 5BSFA 1LNQA 5FI3A 1UUFA 4RO0A 2AW5A 4LRSB 3QA9A 3DZGA 3NDRA 2BLLA 2E48A 5G4LA 4H15A 4ID9A 2VNSA 2D59A 4A10A 4BHTA 1AHHA 2QW8A 4RV9A 4YAGA 4F46A 4DL9A 1DRVA 2PWZA 3D3WA 2F1KA 4PLYA 3WWYA 4G81A 3HN2A 2OO5A 1G0NA 4RVHA 5T8KA 2H1SA 1UDAA 1GZ3A 3RUFA 4PRKA 2EV9A 3PWZA 3QY9A 3TZ6A 1ADGA 3ONFA 1ISHA 4YJGB 3NTOA 4YJHB 4JP3A 1L7EA 1DAOA 5G4KB 3H2SA 3JD2A 3PZBA 4ZRNA 1YJ8A 1SC6A 1YBMA 1KC1A 3PHLA 4GGPA 3GG2A 1KVRA 2UUPA 1K6XA 2ZTMA 2J3KA 1K5HA 3WGTA 2X5OA 3NYWA 4TVBA 1LLDA 5CPBA 4KOAA 5AXBA 3SJ7A 5JXWA 1LDYA 4J4HA 4JJIA 1X0XA 5FFFA 1I0ZA 5JO9A 4TMFA 1UP4A 1LQTA 2YQ4A 1W8DA 1BWSA 3DFUA 2PY6A 1ZK0A 4R1NA 3QVSA 2BI8A 2XAAA 3EY4A 1I2BA 1ZXBA 5DN9A 2NVUA 3U09A 1CYDA 1PL6A 2JD0A 3U0BA 3V1TC 4EI2A 3DMYA 1QORA 3WG9A 3OSUA 2NTVA 2BD0A 3MJ4A 1H93A 3X2FA 3JSAA 1JW9B 4CLHA 3GUCA 1N7HA 4YA6A 4YT8A 5DULA 1VRWA 4D0RA 1N7GA 3QRWA 4PG8A 4AJJA 1QRRA 3TRIA 4CR6A 1DC6A 3C8MA 1H0KA 1GPJA 4B7XA 3UFXA 3FBGA 3JQBC 3O26A 3GLQA 1JKFA 1PQPA 3E48A 5H83A 3ULKA 3CMMA 3WICA 2GR9A 4LVCA 3UN1A 4AJLA 3DAPA 4BNKA 2AQKA 2O2SA 2B4RO 4Z3KA 2EEZA 4IIVA 4CLEA 3ETDA 2WSBA 3GR6A 3JQDA 4IMRA 4OQZA 3RC9A 1E3WB 2VQ3A 3JQFC 4PLWA 1MP0A 2OP1A 1GYPA 1HF3A 2BGMA 1B26A 3AFMA 4IDBA 4M8SA 5F1OA 3CZMA 3UGKA 1AXGA 1OZAA 4I9UA 4L76A 2VUUA 3KB6A 4BNVA 2YQ5A 1XIVA 2RHRA 3GK3A 3FNEA 2B69A 2NVBA 5IZCA 3B1FA 4BNIA 1Q7GA 1PZEA 2J3IA 5EPOA 1A4UA 2Z1NA 4WNCA 3KEQA 4CR8A 2ZB7A 1NPYA 2DTXA 4WCDA 3S2EA 2YHIB 5COBA 3PJEA 1XYGA 1OOEA 5AQ1A 3PK0A 4AJEA 3D5QA 2GSDA 1NQTA 5CPFA 1IB6A 4CLDA 4M55A 3MJTA 4JXKA 2B36A 3PHGA 1Q1NA 3ZHZA 1YQDA 3AM4A 4BUCA 1I3KA 4IUYA 5BSHA 1F14A 2EJWA 4NU6A 4GLOA 1U7TA 3CTMA 4J16A 3BTOA 4UEKA 4Z9FA 2WWRA 4L73A 4KZPA 3HDHA 2W4QA 4L4RA 1OMOA 3I9JA 4Y98A 1Y9EA 2FHSA 1J49A 2VT2A 2QYTA 2FSVA 1DFGA 2I67A 2VTDA 4ND4A 1Z45A 1E3LA 1VJTA 4MVJH 4RVDA 3BA1A 4RLHA 4CMHA 3A06A 3OBBA 1GAEO 4BO4A 1DEHA 2X7HA 4N54A 3TSCA 4CM8B 4PZEA 4P38A 4JIGA 1VKOA 4EDFA 1GUZA 3K5PA 5BR7A 3QHAA 4E2YA 4LVUA 1N92A 4D0SA 1MFPA 2AEFA 5I8WA 2IRWA 4ZQEA 3UOGA 5KOIA 2X0IA 1FDVA 4J1TA 2C29D 4RF5A 1YL7A 2Q3EA 3KEOA 1T26A 5TF4A 1I3MA 4IJVA 2UYYA 1VPDA 3RJ9A 1KY5A 1LSUA 1YONA 2E6UX 4WUVA 4JNKA 1E7RA 4MO2A 3W6UA 3PI7A 2P9EA 4J2HA 1A7AA 1DRWA 4J91A 5KJ1A 3F3SA 5LDHA 3RJ5A 4R1SA 2NU9A 4R1TA 4IY1A 4Q39A 2WEKA 4XGKA 1XEAA 4XGIA 3TOZA 1NWCA 4IMPA 2VRCA 2HJRA 1X15A 2JFGA 3FD8A 4QTZA 1ENPA 4XCVA 4XEHA 4CPDA 1MA0A 5TRTA 1E3SA 3GMDA 2VHYA 1OBFO 2ZCUA 1U7HA 4BGUA 5TGDA 1JKIA 3RFVA 2WYWA 5JNLA 3H8VA 3B6ZA 1ZH8A 5A9SA 1ZIDA 3RIHA 2C5EA 3ROQA 1EEHA 2HU2A 2ZATA 3ZI0A 5JFOA 3D1LA 2P2SA 2F00A 1GUYA 4BO9A 5KJFA 2NACA 1HEUA 3ANNA 1DSSG 4QO7A 3ZW8A 1RYDA 2RH4A 2IDZA 3GZ4A 2LDBA 1AGNA 4PLZA 2Q2QA 2DLDA 3LSYA 2PGLA 4NBTA 1SEPA 1YH3A 3JQBA 5C37A 5TNXA 4TRJA 3BIOA 3V2GA 4MDHA 3JTMA 4D3FA 2ZK7A 1UH5A 3NT4A 4E2XA 1LX6A 4Y9DA 5G4KA 4RF3A 2PA3A 4ROSA 2ZJ0A 3PGXA 1LXCA 4PLPA 2HK9A 3H7AA 4XDYA 5JAQA 2BKAA 1RYEA 1J5PA 5AXDA 2PLAA 4DREA 3PJFA 4DLBA 1C3VA 3ROPA 1V3VA 4UUPA 4GAEA 4UEOA 4BQRA 4YRBA 4E5YA 2I5PO 4XJTA 2O3UA 1HDCA 3JQ7B 4IM7A 1FXSA 3LK7A 4KP7A 5ER6A 3RD5A 1EDZA 2B4TO 2X9GA 4K26A 3KZVA 4BIIA 4OQYA 2AE2A 2ZTVA 3WB9A 2GASA 3HB4X 4J0EA 3SLGA 3T7CA 2D4AA 2OOSA 2QZZA 1F06A 2HQ1A 4AJPA 4B4OA 4CL8A 3NEPX 1O94A 2OBNA 3I6QA 4J1QA 5F21A 3UCFA 2X5KO 4IXWA 1ARZA 5CG1A 1H6BA 1R16A 1SBYA 1P45A 4FCCA 4J43A 5L9AA 4DWVA 3I9NA 3JQ7A 1DLIA 1NAIA 2NU8A 5JPIA 3SLKA 4EBFA 4Z6KA 3TFQA 4QFDA 5AYVA 2DBRA 3JV7A 4R69A 5JBIA 1E3JA 1TVEA 1U2GA 2DFVA 3OQ1A 5FF9A 5TSDA 2A94A 3W8FA 1K0UA 1ZSVA 2VHZA 4NMHA 4IQGA 1DFIA 1ZJZA 3Q9NA 4XYGA 3ITDA 3ROMA 4HFNA 2EERA 1OAAA 2X22A 4E5MA 2I76A 3OA2A 3GZNB 4E32A 5IF3A 3GUYA 5A02A 1PJBA 3TNLA 3BMNB 5T8KC 3VOSA 3PQFA 2WE7A 2NQ8A 3OH8A 3H9UA 3KBOA 2HMTA 1N2SA 1YS4A 3EHEA 2IEDA 3HSKA 1BXKA 1KOLA 3EAGA 1QKIA 2DAPA 3KUXA 1GTMA 1P33A 3D3EA 3OJLA 1G6KA 3IUSA 2EHDA 1MUUA 3NGLA 1GY8A 2DBVO 2PNFA 3RQSA 4PLFA 2DBZA 2POQX 1JAYA 3ON5A 1IPFA 4N5LA 2P4QA 3B20A 1HT0A 1HZJA 1QG6A 1KVTA 2GD1O 4J7XA 5KIAA 2IODA 3AM3A 3V8BA 2GZ2A 1PJ2A 2WD7B 4XB1A 3ZV6A 4AJKA 1AHIA 4CQMB 4WEOA 5A1TA 1MG0A 1U8FO 4UUOA 3DO5A 1V9LA 4HKTA 4AJ4A 4NDNE 1U28A 4XX0A 3QLJA 4N5MA 1I24A 4NK5A 2V65A 1FDSA 4QQRA 2NTJA 3IKVA 1Z75A 3WNQA 2CDBA 3PHIA 4AJIA 1PJLA 1PL8A 2PGJA 3OIFA 4R68A 2PH5A 3L4BC 2CF6A 4EW6A 2EP5A 5IJZA 1B14A 3INRA 4BNFA 2QG4A 2AQHA 2QRJA 2YFQA 5LDGA 4FPXA 1PL7A 3O9ZA 4PLTA 3MJVA 4LK3A 3SX2A 3NX4A 3VH4A 4E5NA 1HSOA 3RUAA 1JWAB 1NWHA 4FB5A 3JD4A 5L95A 1B0AA 1RJWA 1ORRA 2C54A 2HRZA 4ZQBA 3VDRA 2QHXA 1P1FA 2ZKLA 3ICPA 4K1LA 5C3MA 1DLJA 4E3ZA 1ADCA 3I9LA 2UDPA 4ND5A 1IOLA 2E82A 4EGFA 5IZ4A 5EQFA 3NUGA 3HJAA 2Q45A 2WD7A 1EK6A 4KQWA 3KETA 4NJOA 4BL5A 1IE3A 4PVDA 2NWQA 1NVMB 3WYCA 3GPDG 4CODB 4J0FA 5IZCC 1PGPA 4MJLA 3DR3A 3WLEA 3JQFA 3JYOA 5KJ6A 4ALNA 1BVRA 1W73A 3T7EA 4LCEA 4B8WA 1HE5A 5IN4A 5K6AC 5DP2A 1I33A 5TT0A 1GEGA 1XLTA 4O59O 3VZRA 5HM8A 5GZ3A 4MVJA 2EKQA 3FHLA 2NNLD 3HQ4O 3CXRA 2VRCD 4MP6A 3BMOA 5EIOA 4A26A 4XDZA 1V6AA 3DMTA 3ZW9A 3D4OA 1TT5B 4WGGA 2BHLA 1YKFA 5HA5A 4XQEA 5CDSA 4Z0PA 1ZCJA 4OM8A 1NHGA 2O3TA 3NJ8A 4TZKA 4HP8A 3JYPA 4RVGA 4FFLA 2CSUA 3UCXA 4B7CA 1R4MB 4BV9A 2B5WA 1PR3A 3PYLA 4P4LA 3VH2A 4R51A 4TKLA 3MJCA 3K6JA 1WW8A 3BMOB 1NVTA 3O4RA 3PQDA 3WR5A 4XGNA 3LT2A 3PFFA 4FGSA 4E4YA 5KVVA 3E9NA 3IS3A 4K28A 4U6QA 5ENVA 5A06A 5THKA 1U1IA 4OSPA 1SMKA 2HMUA 3S55A 3DEYX 3B70A 1PGQA 1U5CA 3NT5A 4OHUA 3H2ZA 3GEGA 5EESA 3E82A 4BMNA 3PJGA 1CEQA 1Y6JA 4UREA 1B7GO 2X9VA 1LDGA 1V35A 2IXBA 3E03A 5EERA 3UKOA 2BH9A 3LC7O 1PIWA 5GZ6A 1KEVA 3L0DA 3PVZA 4J2OA 3A1NA 3CTVA 1XDWA 3V1UA 4II2A 1B2LA 4HADA 1BTOA 4EITA 3A14A 3VPFA 3AI1A 1X7GA 5HS6A 4BNJA 3RC2A 1IY8A 1R12A 3HG7A 4WLEA 5GY7A 4PIVA 2GNAA 4YJDA 1JU9A 1KVSA 2NV6A 4YBZA 4YEDA 5T6BA 3WGGA 1KEWA 1C1DB 1MXHA 4JCOA 5COQA 1H94A 2I9PA 3DBHA 3FTNA 5DP1A 4CMIA 2Q46A 1QYCA 3WQRA 3GFGA 3HN7A 1M75A 3RBXA 3CINA 3OQBA 4U8GA 1UZNA 4WKGA 4MVJM 5JY1A 3D5TA 2VZ9A 5I9MA 1P31A 2QRKA 3G49A 1JLLA 3R3SA 1TT5A 4Y6PA 4DXHA 2I66A 3NGXA 3LF2A 5L4NA 2OXIA 4TRNA 2ZB3A 1F8FA 3VPXA 4FJ0A 4BNZA 1ZEJA 4GX5A 1EUZA 7ADHA 1U9JA 5CDGA 5AXCA 2O4UX 4GX2A 3ZCXA 3AFNA 2P5UA 2WYUA 3F6YA 4YAJA 1ENZA 3TWOA 4PN3A 4TVOA 1TEHA 2PZJA 4MVJG 4KMSA 2NVWA 4ZHSA 3EMKA 1YB5A 2C0CA 2E4AA 3ROKA 4K9DA 3ZWNA 2I3AA 2NVUB 1B8UA 4GPD1 4L74A 2NU7A 2I65A 4CV3A 5IXSA 4JX8A 4BO8A 3LYLA 1PJCA 1EUDA 3E1KA 5EINA 4HBGA 4Z0TA 1RM4A 3JYLA 4CLOB 3I9KA 1NPDA 1YBVA 1QLHA 4IZHA 4YACA 3NKLA 3AUSA 3GGOA 3L9WA 2XF8A 3VPHA 2HSDA 5I7EA 3F46A 3DTYA 2WTBA 2FN7A 4BVAA 3ENKA 4PLGA 1JWBB 3VH3A 3ZNOA 1ZK1A 2FRDA 3C24A 5JDIC 1SNYA 2BELA 2I99A 3KYBA 3ONDA 1RPNA 4RZHA 1Y9AA 1QYWA 1U4OA 4MP3A 1ZKMA 1BXGA 2VRBA 4AICA 2EP7A 3PIDA 5DCUA 4WPGA 1FF9A 1J0XO 3DMTC 4FS3A 3H4VA 2GUGA 5U9CA 1EK5A 4DYDA 2AQIA 3U4DA 3N58A 1EBFA 1YL5A 1ULSA 3FPCA 2H6EA 5I9NA 4YT2A 4GGOA 3RUIA 2EW2A 3WGOA 3IOYA 3GMSA 4D43A 4A7PA 3FI9A 4E30A 5B37A 1Z7BA 4NBVA 4G2NA 3WNVA 1OC4A 4MIEA 2VUSA 1VL8A 3UVEA 1EVJA 1JAXA 4KWIA 3HHPA 2IEBA 3ST7A 5A9TA 3DZIA 4OO3A 2Q1TA 4R9SA 4CQLB 4DIBA 2YHIA 2TMDA 2FZWA 3L6DA 4B7UA 2X0JA 5JDCC 4D41A 5CEFA 3OIDA 1Y81A 4Q9NA 1VE9A 2VN8A 5DBGA 2RCYA 3QWIA 4DC1A 3RASA 4U7WA 3VZQA 2GRAA 2H63A 1Y8RA 3AUAA 1ISFA 1TI7A 3N74A 1HDXA 2C5AA 3T4XA 1N9GA 3DOCA 3UH1A 3WX0A 3I3OA 4A2CA 4EYEA 1C0LA 3TDKA 3SC6A 1YB1A 1P0FA 5T57A 2W90A 4DYVA 4QX6A 4B4WA 1EQ2A 2BFPA 2A4KA 1LSSA 3FRJA 1KERA 5ES3A 1M6HA 5A3JA 2G0TA 1UAYA 1P1HA 3F1KA 2Y0CA 4ZVVA 3LDHA 4ND1A 2C82A 5U1PA 4GSLA 1UXIA 3BMCB 3DBHB 5JMPA 2WD8A 2VTEA 4IGEA 3O03A 4ALMA 1UXGA 4I5FA 1NNUA 5KKCA 4AJ2A 3LC2O 4OJNA 3MTGA 3DOJA 3RC7A 3CMCO 3ZHBA 1F12A 3WXBA 5KVSA 4XYMA 4FOSA 4EEXA 4NJMB 1NQ5A 2B0JA 2CMDA 3K31A 3OFSA 1Y5RA 4W9NA 1X1EA 3NDJA 4YWJA 1BG6A 1KS9A 1T2AA 1Y7TA 3DL2A 2FMUA 4TROA 3EW7A 4BNGA 1I01A 2RAFA 4RPJA 3ZNPA 3E5RA 1UJMA 2VWGA 1UXKA 2BFAA 3NDIA 5JAMA 4D44A 4WCFB 5JDCA 2HMWA 4FIZA 4CM9D 2QYSA 4GSKA 3ZV4A 3WBFA 4DA9A 3VTFA 5C7LO 5KKAA 1DHRA 3WYEA 2I3GA 1OI7A 4BNHA 1DJQA 5AVOA 2JD2A 3TZHA 3KO8A 2PR2A 3WS7A 3CIFA 3FSRA 1B3RA 4YXFA 3LQFA 2VOJA 3GVPA 2X1HA 3VKUA 2PD3A 4CV1A 4PG5A 4F45A 5B12A 1QLJA 3D3WB 3E6AA 3JD0A 3IP1A 4G5HA 1CQJA 3AOEC 3K8ZA 4WOKA 1GADO 1QYXA 1WDKA 3OECA 3VC7A 1O95A 5JO0A 3IDSA 3AY6A 2Y93A 1LQUA 1GQ2A 4E13A 1QP8A 1YQGA 5ICMA 3L6OO 1B8VA 3GHYA 4LW8A 4OIMA 3GC6A 3STHA 3KYCB 3MOIA 4URFA 3KLMX 1GV0A 1HZZA 3GH3A 4Z9XA 4D46A 2HK8A 1GUFA 1YO6A 2ZTUA 3G3EA 4FFOA 2EF1A 1D4FA 3N7UA 3SBOA 3VDQA 1E0DA 1HE3A 3VAZA 4RVFA 5LC1A 2P9GA 1Z6ZA 1D1TA 1RKXA 1E7QA 3RUDA 8ADHA 9LDTA 2AMFA 1WMAA 2RHCA 4KDEA 4BO5A 4YPOA 1DOHA 2H9IA 3D7LA 3PTZA 3PYXA 5G0UA 3JCZA 3GVIA 3IP3A 4BNWA 5A9RA 5JCJD 3WQSB 4J9UE 3W8EA 1PJ3A 2B37A 1PQWA 1PU2A 1DC4A 3DAFA 4HX5A 3I5MA 3VZPA 2V7PA 4JQCA 4F6LA 1DIHA 1Y8QA 4GL4A 4HNHA 4YJFA 2OZPA 3Q11A 2Q2VA 1SPXA 2FP4A 2O3JA 3JQGB 4Q3BA 1X7HA 4FC7A 4XJSA 2ZIZA 1EE9A 3IC5A 3OJFA 3D0OA 3SEFA 3KYDB 3NTQA 4OSOA 2E49A 1XA0A 3VZSA 4GH5A 2PV7A 2PKRA 1YVEI 5IXYA 1R15A 2W8ZA 1W4ZA 3JQ9C 1YGYA 5BQFA 2VOEA 5DNAA 2E37A 3ZU2A 2DUUA 3QVXA 4NQZA 1BW9B 2G1UA 4MPDA 1BRMA 5JAZA
chains in the Genus database with same CATH superfamily
3R20A 1CJBA 4P5EA 3LFTA 4P82A 1V7CA 2VBGA 1IL0A 2ET6A 2WU8A 3C98A 2ID4A 3CX4A 3I04A 3O74A 4U4AA 2WJPA 1D1SA 3VR3D 4LJLA 4LE2A 4EX7A 2APJA 3I4CA 4K9KA 1NC1A 2XE7A 4B3HA 3B5IA 3BRSA 2PPLA 4HYYA 2YFKA 1QPGA 2W6JA 4NE2A 1OLUA 2G40A 4QO8A 3CXUA 4EUHA 1KSGA 3O90A 4MYTA 4XSHA 4YQZA 3C41J 1F4LA 2EKZA 4MIKA 1L9XA 2KBFA 3DE6X 1G9SA 3QKRA 5IBRA 2ORVA 1G2PA 5KDOA 1RE0A 1TX4B 1VG8A 4CMEC 3GF4A 2VYNA 1LRKA 4LECA 4YPVA 1A27A 1KAMA 4Y9RA 1U5AA 1DAGA 1EGHA 1GGEA 1WY7A 2GFQA 2Z2XA 4ICIA 3M9WA 2QBYB 4TLDA 1R50A 2JI8A 5T67A 4BO0A 4QA9A 3W7AA 1LWNA 2HA6A 3IPAA 5HK8A 1L6RA 2JEOA 3GLKA 4WK2B 4KFRA 1A7KA 3AHFA 3G1UA 1W49A 2J0UA 1KHHA 2WIAA 1I4DD 3V2IA 2ZI3A 5G2OA 3ZY2A 2MR5A 2XA2A 3ND9A 3ZHXA 1RU3A 2ZVPX 1P60A 3F6RA 3TMYA 3QPUA 4U2DA 4DCVA 1HDOA 2VHTA 4H17A 4ZVSA 1DOZA 5FOQA 3K70B 1Y1PA 1SXJD 4RQTA 2YWHA 5ICSA 4J3JA 4IAOA 4GDMA 3TH5A 2PKQO 4EHLA 1I1NA 1XHEA 5CW1A 4DEYA 1HL3A 2V6GA 2W6OA 1RVDA 4OJKA 4QU5A 1UKCA 2AUTA 1E8NA 3AJ8A 3L6RA 5H9VA 1L2TA 1MRNA 4B3XA 4Z7JA 4BX0A 1T2VA 1GL3A 1KYYA 4TS4A 2K6GA 3QIAA 4N3CA 1T2CA 1O58A 4M37A 2H4WA 1QHEA 2W2LA 3OJWA 1SY7A 4YUWA 2WM3A 1N2GA 3NDPA 4H0FA 4H3KB 4HS4A 4IF6A 4YI3A 4D9HA 3BTSA 5F1YA 4U7PB 5KHAA 3BEDA 5TVGA 1G17A 2IHTA 1HMPA 3II6X 3R0VA 4I5DA 1JI0A 5AJZA 2HJ9A 3BHJA 2WNIA 2P8SA 3O8RA 2A58A 3CR8A 1ZLYA 5CU7A 4PZDA 4MA4A 1H2BA 2GPTA 2UYCA 2GJ8A 2PRYA 2OGUA 3FOCA 5KYXB 4B09A 2DH5A 2AE1A 3HR8A 1V5GA 1F6DA 4RYDA 1QGDA 3A2LA 4XWGA 1TB4A 3ELDA 4PX5A 2JKYA 5FO1A 1U2ZA 2PRKA 3Q7QA 2R6FA 1PWXA 2P5TB 5FFNA 2H18A 3JWEA 5DIZA 2VAVA 5G3YA 5JJIA 2AFHE 4D42A 3QYJA 2JLUA 1XAIA 2G9UA 3L07A 1AE1A 2NQTA 4L8GA 1AMOA 1O0BA 2R60A 2IU4A 1PO7A 1WCYA 3GFVA 4Q4DA 3VDMA 1HSZA 1C0IA 1WMEA 2AXPA 1XFAA 2OHOA 3GDHA 3A4IA 3BVPA 4LYYA 5ICCA 1OTYA 1ZZEA 5YASA 4PGHA 4QBKA 3GLIE 3AEKB 5K3SA 3ZI4A 3M1IA 5LNK1 3WDSA 3P2YA 4Z4FA 2A78A 4QJ4A 4HH0A 1I9CA 4BGIA 1GYRA 1MAHA 1W36C 1SHKA 2I4IA 1BROA 2E4ZA 2EX0A 1DJLA 2NUAB 1E62A 3FHOA 4PC2A 1Z2PX 1D6MA 3DNMA 4M9SA 3X3HA 1UBKS 1GL6A 1ZCAA 1E9FA 3JQPA 3JSXA 2R87A 1N3LA 3OCZA 5F9FA 3PFWO 1A50B 2VH2A 3KD2A 3E2IA 3U31A 2VDMB 1NBHA 3OZEA 5TQ2A 3ZNQA 1A0OA 4JP2A 1BN7A 1CDOA 1CRPA 2W22A 2D2IA 3W2EA 2BEWB 2QL7A 3MWEB 4ZQGA 4A73A 5A05A 3AHIA 3IQIX 2VXBA 4HUQB 4LA4A 2QJFA 3ACCA 3HVRA 2NLOA 1NX6A 1DDOA 4JJGA 1CY4A 4B33A 5HIAA 1X13A 3ZWCA 1DPFA 4Q19A 4MV0A 3UFBA 5JRDS 1MRZA 1UXJA 3QKWA 4RA9B 1J8MF 4FGKA 4RLQA 1FP1D 1KYWA 3KNZA 3MIIA 1PD0A 2XI4A 1Z62A 3N7TA 4BJ3A 3IBFA 2JASA 3CF4G 4CV0A 4Y6LA 3IXLA 3ZLUA 4ACBA 1XO1A 2JBHA 2NZXA 1RXCA 5E3HA 4F9EA 1VLLA 1DEKA 3OBIA 5C34B 2V7WA 4YIHA 3EIEA 3N2EA 4TKUA 1XQ1A 1ZNYA 1YFJA 4ARZB 1KH2A 2YN0A 4PVCA 3HI6A 1FS6A 3MJEA 4ITUA 2PT7A 3A1VA 5EKXA 4XYLA 4AUEA 1PJAA 1ZPDA 4B1FA 1AGRA 5BUZA 5JR3A 4NXMB 3LD9A 1Y5IA 3D6TB 3OOHA 3SY8A 1ZW6A 4YROA 2C3UA 3C2QA 3QVMA 5TPWB 4S35A 1FJHA 1M8FA 1HE1C 5DOZA 1JXOA 1UBRS 5LLSA 5C1IA 3CX3A 5BNFA 1YSCA 4H08A 2V0NA 4LFBB 3PR3A 3T3EA 4DG5A 2AQ8A 1EK1A 4LRXA 3CZ9A 4LI3X 4YJ3A 1UEJA 4NATA 3NVKI 2BRUA 2VATA 4HAWA 1RQGA 2HI0A 1FP4A 4S1PA 1BGVA 2JH3A 3N2LA 2H16A 3AF3A 3IQZA 5TS2A 1CQWA 2QZ9A 4H3VA 3TS1A 1KAOA 3NTLA 1V37A 1XCOA 3C3MA 3I8SA 3MHPA 3GARA 1CRZA 2J4FA 3NC1C 4X8LA 4U6SA 4UOQA 2HMVA 3PRJA 4CMGA 4JJ6A 4RTKA 1NIJA 4CF3A 1CF4A 1ISJA 5IAOA 3H8WA 3SYTA 4IG4A 1JQ3A 5B3LA 2Q4TA 2X4LA 1GPNA 3MQ4A 2CXXA 2DQSA 3P71T 3KCNA 2PAFA 4BO1A 1AXEA 1LLUA 5A9SB 3B60A 3M89A 3A70A 3Q3EA 4J75A 4DMRA 1ND5A 1PEDA 1E6EA 1VOTA 4CCWA 4LRTB 4JN6B 2GZHA 4UUMA 3PL5A 2J1LA 4UCFA 1FQOA 3ANMA 3KKPA 1K7EB 2XADA 2HGSA 3NBYC 4B3CA 3KTAB 1UBCA 4OBWA 1IH8A 3LWDA 3H9JA 3QV1A 2F8TA 1J1IA 1VL1A 1M6VB 4QZVA 1A5SB 1KORA 3DOIA 4H0NA 5EYPA 5C4MA 4QARA 1GQQA 3BPSA 3LZCA 4EEKA 1FFBA 3AM1A 1Q7TA 4JBIA 1Z0SA 2FCAA 2IYPA 3DBLB 2JKVA 3UC5A 3W04A 1IHDA 2ZR0A 4UBJA 1P44A 3N2ZB 2GZ1A 2JZOA 2W2XA 1THMA 1P2DA 3OM1A 3GFPA 4MGYR 3RG2A 3N8IA 3F5QA 2W6ZA 3DEKA 1DJNA 4M1WA 3NEYA 3V7NA 1U8AA 3T1HB 2Q5IA 2IH5A 4D8XA 1GSIA 3BGDA 1T2UA 2PS9A 1UDWA 4R9UC 4BQFA 5CUQA 3KU1A 2GCEA 4MOWA 4YQYA 1J2YA 5J2UF 1RPZA 2HDHA 1N6OA 4K6MA 3T3DA 4BTEA 5K6TA 1N3IA 1OFUA 1DFHA 2Z5FA 3DFIA 1BCSB 5JSYA 4C3ZA 4AF6A 2XNSA 3FAKA 4OB7A 4TS3A 5LP6F 1DWPA 1BHQ1 2NSJA 4LJKA 1IM5A 2WNSA 4DSUA 3IAHA 5LMNB 4OK5A 4G5YA 4HVAA 4JL8A 4X1KA 1S7GA 2XWSA 3UWKA 4RIFA 4KBGA 1H1TA 4MX8A 3FVWA 4WE3A 1LTHR 5GPBA 5CH3A 4FILA 3TLKA 1YZNA 3C7CB 4U02A 1XNJA 1FVXA 1XVTA 3J80A 4AIIA 3B8HA 2W0SA 4GNRA 5LMCA 3KYCA 5CVUA 5FV7A 3FZQA 1NP3A 3O4IA 2H1FA 3E3OA 4GGMX 3GAZA 4IFEA 1EXDA 1E1NA 1G18A 1MGOA 2V9ZA 4EZBA 3O2QB 4J90A 5G1NA 2C5FA 4QEDA 16PKA 4HEA1 2OM2A 3BN3A 1SH7A 4Q7EA 5D3MB 1QOQB 2QVZX 3I1YA 3FB1A 5JWHA 1C1DA 2ZWIA 4FD2A 3M2TA 1XL0A 2CXSA 3O8CA 3GRUA 4ZHQA 2OQRA 1AK9A 3HLTA 3DMFA 1M6NA 1Q0SA 4DM7A 3WJ2A 4DLSA 3GDFA 1JN0A 1G5FA 4I6EA 3X1MA 4K05A 4L5BA 2M9MA 2B8NA 5IDVA 3IUPA 4UXIA 4P4UA 4OTZA 3ISVA 5BQOA 3BWVA 1UR5A 1M2NA 2FUEA 5L8VA 1NM5A 1M7HA 3FUCA 1E6KA 2NSLA 1HO3A 3DZCA 3TI7A 4CNBA 4DOMA 5BORA 1OFGA 2YZMA 1K89A 1YWGO 4QDTA 4RKFA 3WQHA 4E14A 1QCCA 2ZTLA 3IQWA 1LEHA 4NRDA 3S7ZA 1OTXA 3UF0A 5CCBA 1HYEA 2BFFA 3CZQA 2LV8A 1FYWA 2O2YA 1U8CB 2IE8A 1LTQA 2VJBA 4R7TA 1ZHOA 3JY6A 2IPNA 1D3AA 1VG9B 1QJ4A 4KFCA 3UUFA 2Z6AA 2F17A 2FUCA 4EY5A 2QX8A 2A4MA 5KYYA 1L7QA 1VP3A 2J48A 2QTCA 2Z8YM 2FI1A 4LJYA 1POXA 2AZTA 2XCRB 3M6XA 3A6FA 4QOHA 4FSXA 1E3WA 4HNRA 3WRXC 4BFZA 2BGRA 2ZSUA 4DW8A 5BN5B 8OHMA 3F73A 3U4HA 2W2NA 4RZSA 4FXOA 3NP7A 1UANA 3C1UA 4LJ5A 4A8PA 3OQMA 4FMPA 3ZCRA 2BJVA 5DIFA 4REOA 4ER7A 4OLAA 2QN8A 3BFXA 2J6BA 3UANA 1IWPB 1Z2NX 2C20A 1GNLA 2XB4A 3QNUA 4ANFA 1U9IC 4RUKA 2QUBA 4L8YA 2JCXA 4YPFA 1X70A 4MW7A 4CEHA 2JJ1A 1R0LA 3G8DA 1VXRA 3HC7A 2X0KA 2C8LA 3BOSA 3I39X 1JIVA 1LI5A 3WA7A 2XKJE 3G2PA 1J90A 3K9NA 4MW6A 2XB6A 2FX5A 3V46A 3V8NA 2ESRA 2PXCA 3DZKA 3EXFA 3OCXA 1E66A 1EDDA 1S2IA 8LDHA 5FUYA 5JJKA 2A88A 2M2IA 3LP8A 3LC1O 2RD2A 4IQ4A 2G6BA 3JZAA 2G80A 3LG2A 3A6DA 4FYIA 4KEAA 4P6VF 4KVFA 4TTRA 1PS8A 5ESRA 3TQTA 4EUFA 1ISSA 1TNDA 4WX2B 3RS9A 1PV1A 2FR8A 2JJ2D 4HMQA 4LKOA 4HC4A 1Q50A 3WYNA 4KR3A 2FPWA 3VM6A 4NS4A 2BZ1A 2PN1A 3TD2A 1UF9A 4E1BA 1EP3B 1SD5A 2PGDA 4YIKA 3FJ1A 2JGLA 1OLXB 2VHWA 5J63A 2RGDA 1CB0A 4EA7A 4RMIA 2FN8A 2ZYHA 2IHZA 4LN1A 2F9FA 1CRWG 1KMIY 2UZ1B 2R7KA 2Q41A 3R3VA 1T2NA 4NBWA 4BUZA 5G0SA 4CM1A 5K4HA 3N8KA 4DPMA 2D6FA 1XVLA 4JVNA 1VLQA 1RWBA 1TJ5A 3EZXA 2BM9A 2UZIR 1Z4JA 5GZ1A 1M2FA 1EX1A 4IO1A 2PWYA 5K0BA 4OLBA 1EGAA 1NW3A 4NH4A 5BNTA 2ZFUA 5HR5A 5K8TA 3L8EA 4S24A 1NRWA 3LRPA 4C87A 4Q3EA 2DPLA 5EIBD 2R8PA 4GI7A 4JJKA 1E6WA 3R3WA 1M2VB 2X2FA 3AERB 2BEVB 3D81A 5M04A 4EPRA 3IRVA 4Q05A 3L05A 1E5QA 4CTNA 2FFJA 2NQ2C 5KTMA 1J8YF 2DQZA 4XYBA 1UWKA 3H75A 2KQUA 2RBKA 1D4AA 1RI1A 5BRJA 1T4DA 5K0LA 1KMCA 3HSYA 2HHLA 1YQQA 4JUCA 1RP7A 3KJHA 1NVVR 4G1BA 4YJKA 1WUIS 1F9AA 1HG0A 1NKSA 3U49A 4W5NA 4HQ6A 5HQ3A 1B0PA 4RQUA 2WNHA 3K0AA 3RIMA 4AX4A 2Y68A 3B1YA 1PFWA 3SXJA 1RBQA 1PNRA 1NBAA 1NVKA 3ZOZA 4QJ5A 4PYKA 2AXQA 4TLMB 1QJCA 5CMLA 1E4EA 4E94A 4XW2A 2WJ3A 3VH1A 5EIFA 3KQQA 1M2OB 2BEKA 2XQJA 3N0VA 1PGOA 4EW3A 1A4IA 3BERA 2BY4A 5DZSA 4QXPA 3HO6A 1VMEA 2P6PA 1EG2A 3WSTA 4B47A 5B58C 3FBTA 1WUJS 3RT7A 5K4AA 1W35A 2C95A 3HJRA 4GYYA 2VF7A 4KVAA 3OQIA 5ALIA 5EL0A 5IDWA 3QW2A 2JLVA 3W8RA 2C2KA 3GFFA 3HY4A 4QHTA 1U6IA 4DXAA 3PICA 3OQOA 4Q37A 1BXGB 3FWYA 4Y2PA 3GAAA 4B80A 1VHTA 1IHXA 1A77A 2XH8A 2JGAA 5CJPA 4UDXX 4E4TA 4JFAA 1M8JA 3GGGA 4OFBA 3G9TA 5HMLA 1NASA 2RCNA 4S1NA 3ROGA 1IRXA 1TW2A 1W1UA 3PE6A 1Y1LA 2XGGA 1GGVA 1CJMA 1HKUA 2E7ZA 2IXEA 3F7NA 3HB0A 2J30A 3MB5A 4QXOA 3J7TA 3ETNA 1M2WA 2QNBA 4X62B 3H2KA 1COWA 3GRZA 3MWGA 4Y18A 4GT1A 4RL4A 2OP0A 2XVMA 4QEKA 4MDYA 2BISA 2GEFA 1YRAA 5IN5A 4DBZA 1E5XA 1QVAA 3ZHYA 2FP3A 3LECA 3IVCA 3C3DA 3OTQA 2YJZA 2IZZA 4G9EA 4LQCA 1RQ7A 3H2BA 4L8FA 4TN1A 4G4GA 4DLPA 821PA 1SG0A 2H4JA 3TVDA 1JHPA 4N5NA 1UXHA 4NESA 4CMEA 4BZZA 5B4VA 3SR0A 1GZSA 2H9AA 1J7JA 3CZ5A 4ZV4A 1C0EA 2AKEA 3SJZA 2QVYX 1L4HA 5DTQA 3G7UA 3MS2A 3MT9A 4GKAA 3HHEA 1NR7A 3OY2A 2JHGA 3IT3A 4LBVA 3T5GA 1ZP6A 3CUWA 3H3FA 1T2EA 5FNVA 2CVOA 3I37X 4G0WA 4TMTA 1YZ3A 1RTKA 3D31A 2AFIA 2W6QA 1NBIA 4DB2A 4HX9A 1VKJA 2YVQA 1MABB 1JFFB 3F9IA 3KQWA 4M6WB 3ABOB 2PJRA 5JNWA 1UC5B 4AP9A 2QLLA 2JGDA 4CR7A 5B6PA 1DAEA 5DHQA 4LF8B 4KO2S 4LXUA 1HC7A 3GY0A 1PBTA 2KHZA 1AQIA 1WZIA 1XZIA 3T7KA 5A04A 2PQ2A 2HJVA 1PV4A 3A7DA 1J5EB 3GLIB 2V6FA 1FUUA 4I50F 2E2WA 3H4IA 4YAEA 1OWPA 1TYEB 2IV2X 2RAPA 3LYAA 5CH8A 5KNBA 2FSSA 3QE3A 1HDZA 4OD0A 3P0JA 5J4LA 1QFZA 5H02A 1Q0PA 1HRDA 4FDMA 5ESDA 4AAYA 1KP3A 3WIDA 3MUNA 5IFLA 1U0NA 1AKNA 3GN2A 2J9YB 5EXXA 1CRQA 3OA0A 5AUQA 4JLPA 5JZVA 5I7FA 2IUEA 3I2GA 1EVKA 2IIVA 2R7LA 3I9OA 3K3PA 5BQPA 2Q29A 3GJ7A 5KJEA 3AVYA 1OKKA 5GAJA 1O97D 3R5TA 1BYUA 1KI7A 1NFQA 2MSNA 4LYGA 3SYLA 5IM4F 1YUMA 2D7CA 2GN9A 5I9SA 1N9GB 2X0EA 4DAOA 1TFRA 3KPWA 1L7DA 1MAUA 1XMSA 3DV0A 4WECA 1Q5PA 1E9EA 1YMVA 3P7MA 1A98A 1DKQA 5ALDA 2PWAA 1E7YA 5BSTA 2JCYA 4NMMA 3FZYA 1D7OA 3V4OA 2HY7A 3WDMA 3SS8A 4KUEA 2DERA 3S2YA 1GCOA 1JDJA 4R2KA 4HVLA 1LVGA 3EVGA 3LF1A 2FFBA 3DF9A 3P2KA 3LU1A 3C5VA 3P19A 1H5NA 4HEA6 1RI3A 1BSVA 1QIGA 4EZEA 1D5WA 3CRMA 4QPDA 1GPBA 2X7JA 4O2AF 1OB5A 3PC4A 1EUDB 3M6UA 4O5OA 3SQMA 2NYAA 5FI1B 1NW9B 5K3FB 4C4PA 1CEEA 2UZ4A 3MFYA 2VEDA 3HJNA 1WDLA 2C88A 1VL0A 4EHJA 4V0MA 3O8OB 3R40A 2PBLA 2VZLA 1ZL2A 2H7CA 2P2LA 2YW9A 3CUYA 2PSHA 3G9UA 3JATA 4MB2A 5A7HA 4DR1B 1JDVA 2DFKB 2GYVA 4M76B 4OOFA 3BE5A 5I6DA 1LPMA 3ER6A 2VSQA 2TECE 4WASA 4DCPA 3L0YA 4DQVA 4OEHA 3TZQA 4FI3C 4BMVA 1P1CA 4GM4A 3VVLA 1GPLA 1LW6E 1RJGA 3GJRA 3ZY3A 4ADSG 1DBVO 4QDKA 2G88A 4KCGA 1QYVA 1NJ1A 4MIYA 2XECA 1RCUA 5IBPA 2X0FA 3HCEA 3KSZO 4A2PA 1MB3A 3EQZA 3EZLA 3HYNA 3PA8A 3AM5A 1XN4A 5CA1F 3OICA 3WWCA 3ZVKA 2VLBA 1C7JA 1W59A 2FAXA 2OHJA 2Q4EA 2X1VA 1SQ5A 3GFOA 3M9XA 4CV2A 3TW4A 1H2HA 4PZYA 3AO0B 5AOCA 1GPUA 4EMSA 1KDRA 5HUQA 4GMGA 4MINA 1O6BA 4D4MA 4UZEA 4G8BA 1QAOA 4RXUA 2R7NA 4ZVQA 3AGPA 3C1AA 1IATA 2WF6A 4HUJA 2E5WA 3OOEA 2WT8A 3DEHA 1W0CA 4HDKA 2VJLA 4K5QA 2B98A 2O52A 5ER9A 4UZSA 5GIOE 5ARBA 4TMKA 2YKGA 1RWPA 5ADWA 1NUSA 2Y1OA 4CM3A 1QUEA 1XEWX 2AYXA 2UUAB 2YVKA 2FZ4A 2W0MA 3CNOA 1VI5A 1T4GA 4QM6A 3N75A 4LOJA 1XZKA 1ZO8A 4FN4A 4NJEB 4F8YA 4TSFA 3VNUA 4GXTA 4I1SA 1P4GA 4IDGA 2IZ6A 4XFDA 4DA4A 3D54D 3CN9A 5HBGA 4B81A 1G38A 1JQKA 1M7GA 3HPRA 3ZWWA 5BSKA 1ISGA 2PGNA 3ZK7A 4WCFC 1TZKA 1UPFA 3LTEA 4V0SA 4AZ0A 5C5CA 1NG9A 1Z16A 5HBRA 3LAWA 4UMEA 1LFAA 1CY1A 1R5JA 4UHEA 5D6NA 2NUPB 3IDQA 3O7WA 3V4FA 1QLWA 2O14A 1C30B 4X64B 2J0QA 1H42A 4PRLA 5CD1A 4LJ7A 1VCMA 4ZZ2A 1N0WA 2J6IA 5ITSA 1WWKA 3UJ7A 1E1YA 4AG6A 3V2UA 4ZA2A 4H1VA 3AEYA 3CPSA 4L6AA 4JP5A 2OK7A 2I87A 1X94A 3L7IA 3MRSA 1UEIA 3N28A 3Q3GE 1XQ6A 4JVOA 4BNYA 4YCCA 1ATZA 1T5OA 2QBYA 3P9KA 4I5EA 5DCYA 3O8OA 3OZUA 4I0WB 4C76A 3MD9A 3INTA 2A92A 3HADA 2HV8A 3GUVA 5HOQA 1IXKA 1VA5A 1XEFA 2VNHA 4I9GA 4OQXA 3CH6A 3TFWA 1QS0B 4Q02A 1BS1A 5KX5F 5LP6A 4FM9A 4AS2A 4LZZA 1KDTA 3JAKB 4KLNA 2XXAB 1D6NA 1EFPB 2RIRA 4UEWA 2ZU0C 2XCIA 1N57A 2PT9A 2C78A 4JB2A 5LUBA 4NHEA 3FBWA 3SQXA 2R8RA 3C7AA 1UPTA 1PRYA 3DQPA 3WL4A 4EPXA 2GD6A 3QVTA 5DFAA 4UNPA 2EW8A 4ARZA 1O6ZA 2Y9YA 1MX3A 3OUUA 3RVDA 3UT5B 5I4CA 4W6ZA 1U8ZA 1B0ZA 4QTUB 2G5TA 3PNKA 1SO8A 1XV5A 1Y3BE 3S2UA 3K2EA 1XFDA 3BQNB 1HYHA 4FHGA 3FNHA 1LVHA 4UMVA 2C2OA 4P8RA 1AUVA 3W7VA 3U62A 4RTLA 3DLIA 4MKHA 1Y7PA 4MAFA 2BF4A 1G7SA 4IFIA 1XD8A 3UT5A 5JAUA 3HFSA 1TXGA 4KIFA 1DBSA 1RWVA 3EUWA 1X7XB 4QXQA 1ODLA 4KPUB 4UVHA 3CLHA 4EO7A 4ARIA 1ZBQA 4FFNA 2DQ4A 4QKQA 2LP4Y 2ZIGA 3UWOA 2J7PD 2R8YA 2QU7A 4HDNB 4KACA 5JRJA 1W36D 1PNVA 1PR1A 4MV8A 3R7DA 3EN0A 4CIYA 2J09A 4X60A 4LC9A 3K1ZA 4ZKEA 1NBWB 4DMUB 2ZWVA 2QIPA 5B6IA 4YHHB 1XTJA 2ZT5A 2JRLA 2XZDA 3OF5A 3FF4A 1SZDA 4FYJA 4RXMA 1LD3A 2NN3C 2Z04A 3FTEA 4TMZA 2VNAA 1Q0RA 1Q1ZA 1K7XB 1P9LA 3CPEA 3D8NA 4M54A 4UW9A 1DJOA 3HE3A 2Y1EA 4DUGD 2IX9A 1ZJWA 1W4BA 4CFYA 3GJ0A 3I01M 4HT3B 3A9WA 4DLUA 2I54A 1GPDG 1MW9X 3I52A 4CZ2A 1FRVA 2DJ5A 1RP1A 2OL4A 1PJSA 3NAQA 4LEIA 4OYRA 4WRRA 2X86A 3CKMA 5BMVB 4FBGA 1KO5A 2O7SA 3R7WB 2FZ5A 1W46A 3LI2A 3WMWA 2I2FA 1JKMA 2OHXA 4L0MA 3GD5A 2WAMA 4XWYA 2R1TB 1J0CA 4B7AA 1NM5C 4JLSA 1AV7A 2VZ0A 4BEVA 1X9GA 1AQLA 1ZW1A 4POOA 3E18A 2VJAA 1JHUA 1I80A 3I09A 4BVHA 2XR1A 2W2PA 2RONA 3UJDA 4HGRA 2O8DB 3AL3A 4CTOA 3W6OA 1P77A 4B4VA 4IFBA 4DLLA 1CZHA 1JFRA 4V39A 2YXLA 4TKZA 5KNBH 2DETA 3ZDCA 2BGWA 4NZOA 3WHIA 4WFIA 4CMJA 3OY7A 4Y2HA 2Q3CA 2OBYA 1Y1SA 2F3QA 2XKBA 5HE8A 1L5KA 5BXQC 4MVJE 1YC2A 2HHAA 4FEYA 2WB2A 4HXYA 5AM5A 3ILHA 3QVLA 1BU8A 2HLHA 3UXYA 4M7OA 2ZRKA 2RIPA 3VHLB 4X7MA 2QQ0A 3O4VA 4FK8A 1OC2A 4XWWA 2R79A 5AK4A 1KDZA 2BTQA 4A6EA 3IAM6 5ALUA 1U9CA 5LQUA 3U4MA 1KYZA 4WN9B 1YB7A 3RHSA 3B9BA 3M6AA 1F8GA 5KKNB 1ENYA 2MINB 4IIHA 4PHHA 1N5LA 3DG9A 1BDMA 4WHMA 3S0JA 3VTKA 5JEDA 2QDKA 4MPTA 3C5WP 2P4HX 2QNIA 5H0IA 2HT6A 4MLZA 5K0ZA 1Q1BA 2Y1LA 2EQAA 1UJBA 3GGPA 3JQAB 4U6NA 2HB6A 5C18A 1UKBA 1WUTA 4MS1B 2J5QA 3GJ6A 1MGPA 1FSFA 4HI0E 4TPKA 2FF5A 2YJGA 3GA5A 4YP9A 3OM9A 4LKRA 4C6TB 3PF9A 3U5TA 3MUFA 4RF4A 1ZUNB 1OBVA 4NTZA 1TEVA 1V1RA 4ONEA 3W5IA 4Q3CA 1CUCA 3UAXA 4D02A 4Y6OA 3R0XA 3EA4A 3I4LA 1JKJB 3N07A 1J56A 4GU5A 3KUDA 4JROA 4CNQA 3LTNC 2BTOA 1BCRB 5G41A 1W19A 2QXYA 3PTLA 1Z5VA 2VC2B 4RX1A 2R6DA 3WO1A 3ZE1B 4RTSA 3ISJA 3P9CA 2NZWA 2LDXA 1L5HA 1DKPA 3W4IA 3F6BX 2C5HA 4XVHA 1WU8A 3UYLA 1NA5A 1OU4A 1PAUA 2CC2A 2YBDA 4QWMA 3PFKA 5GV8A 2IH4A 1U2DA 2A9JA 3ETHA 4FE7A 4WOPA 1O6GA 3OJXA 2V74B 1YV9A 3L18A 5LCXA 3RYHB 4NBSA 1JV2B 3LZ6A 1XVVA 4BQPA 1X92A 2CVHA 1WDWB 4R71A 2BBTA 3E8XA 4PINA 1I4WA 2WZCA 3K6KA 1CJVC 2ZYWX 3TEFA 3T94A 4ILKA 5F7OA 4DHWA 3UHOA 3FVTA 1WEHA 3NHFA 1BWQA 1X9IA 1XCBA 2GF9A 3CLUC 3KS9A 4NEHB 3RGGA 5FWYA 4ZOLF 2Z0MA 1RABA 3LPCA 3HO8A 1ZVMA 4N7MA 1Q22A 4V0NA 5C1BA 2HL6A 3EC7A 2PVSA 4KHPB 4WEQA 3ZU6A 1D0IA 4JEMA 3UJ9A 3A32A 3WLSA 1QANA 4C14A 3OEEA 3UT6A 4QJ3A 4RY0A 5DT9A 3PEWA 3C1TA 2IYVA 7ABPA 4NABA 3PEEA 2ZTHA 1Y34E 1C1XB 2EL7A 4M7PA 4MO9A 1F3LA 1GYQA 4E21A 1KI1A 4RTNA 3ETEA 3ITEA 1L9KA 3VZBA 4TXMA 2ZI9A 1XZMA 2IL1A 1U0TA 1YCGA 3KKEA 1GQSA 2I2DA 3MT7A 4ZT5A 2IUUA 1MO2A 3WMEA 1JSZA 3R9KA 2YL2A 1KJYA 1UZMA 3HDYA 3TUZC 3LVRE 3OZFA 3PC8A 1BMFD 2BUAA 2V5AA 4G84A 1SOWA 4DSNA 5JHGB 4M83A 3T1VA 2V7BA 3AF6A 4YR7A 2AOVA 4N18A 3P0IA 2ZDHA 2AC4A 2L69A 4HFMA 1FNSA 1R4ZA 3RANA 3VTAA 1Q17A 2IW1A 2IYQA 3SE7A 3SX4A 3BCSA 4GC9A 3MCZA 4UMFA 4C0SA 3SPXA 1XPOA 3G68A 3I3SR 3O38A 3UFXB 5GJBA 3E8MA 1XHFA 2CMHA 2XOXA 3AUKA 3LRTA 4FGLA 4C88A 1QGUB 2JFNA 2Y92A 3GRAA 2DECA 4NS1A 3ELUA 3L1IA 3AB7A 2XJ9A 1Z33A 2REQA 3LLSA 3P0RA 1ZONA 3DCNA 5AWFC 3FYHA 3X1XA 5JD5A 2NO9A 1EVIA 1NRIA 5TT1A 5AXAA 4KGXA 2ONJA 3EEYA 1SVWA 1ZRSA 3NEAA 4K3VA 2FUKA 4UFNA 5HILA 4AC9A 2O8FA 2P9TA 4MLPA 4AUNA 3F7MA 3LWBA 1A8UA 2CFOA 3JAWB 3HYSA 1RM3A 3EGEA 3VGPA 5I7UA 1Z38A 1EWRA 4UNRA 1BMDA 4HNUA 2PUJA 4L3WA 4N40A 2QTMA 1Z5ZA 3K32A 2NV2B 4H6VA 2QAGC 5K2OA 1DEXA 5J5CA 2PZLA 2FRDC 3DHNA 1O7JA 3ASYA 2Q7OE 4AMGA 3ED5A 1SG6A 3U5ZB 1QK5A 1UBGA 2Q0QA 3D7NA 4CUZA 4QVGA 1VKHA 3HNPA 3SWWA 2HSEA 3JD3A 1ZL0A 1IY1A 2ZBRA 3B3QA 5D5PA 5CHYA 2FETA 1PN3A 1PS9A 5FHRA 4C22A 4Z4HA 2Z2ZA 4X00A 1T8YA 3NHWA 4NV0A 5C5IA 1BZYA 2I7DA 2NO4A 4IIUA 1YR1A 5BYKA 4GLLA 3PGA1 1QGED 2R96A 5CB8A 3R0QA 1CVIA 2DWCA 3DOOA 1BXRB 2EWWA 3W9UA 1K6JA 3FDZB 1GL7A 4PHTA 4J94A 3ZQUA 5IVPA 2YH2A 2ZYRA 2HNKA 1LDBA 4N0QA 1Z74A 4A0SA 1HDYA 1JDZA 1FDUA 1QMGA 1CETA 2CWDA 1T3GA 4YRJA 5BWMA 1DXYA 4Q9HA 4D9NA 3A8TA 2I1QA 4MGZR 1VMDA 3AG6A 4JEUA 4JT8A 4CUJA 2P1RA 4RHEA 5K8CA 2WHEA 4CM7A 3VJMA 4M1OA 4A0GA 3GLFA 2IWRA 4RHFA 5HP4A 1MKYA 2N1MA 3PNVA 2FSHA 2C4KA 4O2BF 3U1BA 4LXIA 2GT1A 3DO8A 4GR9A 1LX7A 2P8JA 1YRBA 3H99A 1D2CA 1AM4D 3G2JA 4DS3A 4DDTA 4X1KB 4EATA 3NBZC 3AJ9A 1B00A 1QZZA 4Z7OB 4DCOA 1I6MA 4V24A 4S1WA 1CB7A 1YASA 1DIAA 4RE5A 1K0FA 4YALA 5A7GA 2HA5A 3WWZA 2ZYIA 5CHEA 5A3SA 4B79A 4C4AA 1I32A 2B78A 3TXXA 3BSSA 3CZ4A 3MPUA 4KI0A 2ANCA 1B43A 3ZR4B 1W93A 3NETA 3ZWPA 5ADHA 5CVCA 1U1EA 2QPLA 2GYYA 5HEKA 3IVMA 4ZN6A 1P81A 1H8HD 3LUJA 4FIDA 2CJFA 3IMCA 4XWAA 2CYAA 3ZYCA 4ZAVA 4EGSA 2QMHA 4CMIB 2QX7A 1YFLA 4Z9YA 3TNJA 3HFRA 2CEAA 2OQIA 4N47A 3K0KA 1TC1A 1G2OA 3BWBA 2RGEA 3K2BA 2QTGA 3AI7A 4QUKA 5B1YA 1VSVA 4JI5B 1VSUA 4EFNA 4FZ3A 4CDGA 1UAGA 2J5RA 1F0YA 2V45A 1UK6A 1Y8RB 3HMKA 4O4HA 5J4KA 4B2YA 7MDHA 2HPHA 1PR9A 3CB4A 5KTRA 2FJPA 3E7FA 3HNOA 3PP8A 3VHRA 1KQOA 3TLZA 5GM2A 1CEYA 5EXEA 4WOBA 3KELA 1X39A 3A4TA 3VNAA 1PGNA 1Y7LA 2ADFA 1Q6ZA 3EIUA 3GZNA 4M87A 4N3GA 3DMDA 1E2QA 4LYFA 2QW1A 3D4PA 4L22A 5DCWA 4G1UC 3PUVA 2ZAGA 5BQ3A 2FZCA 2K5UA 1H9AA 4C0XA 5IYZA 1UM8A 1AQNA 4GW3A 3DMPA 4C4OA 1T3LA 3IQDB 1AQYA 2Y1GA 3NHPA 4AKHA 5JY6A 3P9NA 1CZUA 1TIBA 2FW8A 4XEUA 3EG9A 4WQMA 1DC7A 1ADYA 3D6VA 4LGCA 1F1BA 1K5GA 3D6FA 3NZEA 4NK4A 3S1AB 2PSEA 4RVSA 1C8VB 3DW1X 1JFSA 3PITA 3AYXB 1PJ8A 1GDDA 1YJ5A 2YOFA 2C5LA 4Q6WA 4GZ5A 5I5GA 2A5JA 1LC0A 1CZRA 1QBGA 1T35A 3MYRA 5IC6A 2N9UA 4YX9A 1J99A 3KT8A 4IIJB 4E5KA 1RR6A 2GD2A 2HJSA 2P4UA 4G4SO 5TMBA 2DC1A 1NVGA 1UC9A 4DN6A 4XLLA 2V6BA 1SAYA 2AG8A 3JQEA 4XIYA 2R68A 4DG8A 2HUNA 4R0MA 1N8SA 4ZJUA 5HXAA 1SOMA 1NZJA 1MV8A 2HCBA 4BVJA 5J23A 2EGUA 1XMXA 2HHHB 3WIEA 2O06A 3TUJC 3UHAA 4CLRB 3QVWA 4R7GA 1WSAA 2AN9A 5ALTA 1XA3A 3OU2A 4MW4A 3RIEA 3HL0A 5KVCA 4PQRA 3JZDA 3LBNA 3QI7A 3ZPXA 3VNBA 1UMDA 2VNKA 4HGQA 4ND7A 4YCAA 1G21B 3KJNA 4M1SA 4BEJA 2C9YA 2QRZA 2XGSA 4Q4AA 2P4SA 4R3NA 3NHBA 4KPFC 2OFPA 1T4CA 2JIPA 3PWSA 5FI3A 3CR7A 4JQSA 1HNNA 4G3XA 2AW5A 4PAOA 1ZUWA 2C98A 3ETLA 4JHXA 2VSOA 3BMXA 3V8EA 4D80A 2ISQA 3R9XA 4TKUB 5E1MA 3OPNA 3NLLA 4ID9A 3TLJA 1RE1A 4EJSA 1ZOIA 4YO8A 1AHHA 3DPUA 4F46A 2HR1A 1LS6A 2CLIB 4N0EA 1IUOA 3WMRA 1H1DA 3NHYA 3WWYA 2NYRA 3BDVA 3R6TA 3DULA 2ODQA 3GYGA 2OO5A 1G0NA 4YMUA 5CITA 2GMWA 1MAVA 4PX3A 1Z0KA 5L53A 2E1RA 4PRKA 4BWVA 4RA9A 4GVPA 1ADGA 1ZMBA 2A7XA 4GM0A 3FGZA 6GPBA 1PT6A 1B1AA 2ENWA 9ATCA 1NW7A 1CP3A 3SHQA 5B1IA 2CYCA 4B0OA 4XQ0A 1TKAA 1Z68A 1DAOA 5LP6C 2AI2A 2LVBA 4H4EA 4LS3A 1G8FA 3GNLA 3U60B 2JW5A 4BFTA 2IA5A 1V48A 2MSWA 1IM2A 3N2YA 3GG2A 2Y6UA 2DR2A 4BE9A 1K6XA 3RQIA 1QOPB 1K5HA 3AHCA 3GLRA 3H5OA 3SHFA 3U7QB 2H7XA 2BMWA 2O2HA 1SCUB 4TMWA 4P86A 5AO9A 5H80A 2LW7A 4QYIA 1LLDA 1NVBA 1C7ZA 5CPBA 5AXBA 5ANRB 4UOEA 1I6WA 4YQFA 2TSYB 5C81A 3LOPA 3EDQA 2CB0A 3E22A 2JFQA 1EU1A 1P2GA 4JJIA 5ETJA 3AESB 5E6RB 1TJ4A 2TRSB 2PU7A 2NU9B 1RYMA 4P5PA 2GN0A 3OKCA 5JO9A 3WJ1A 3NC4A 4RQBA 4KPGA 3DFUA 2PY6A 2QZSA 1BO6A 2UVQA 1GPWB 1A9TA 4X95A 5EUBA 3PQ6A 1JSCA 3ZDBA 2CN1A 2NGRA 1CYDA 2JD0A 1ULAA 4XVRA 1C8LA 3OSUA 2NTVA 2NW6A 2O1XA 2GNOA 4NEQA 3X2FA 1H93A 1MQ8B 1N5KA 2BONA 2YXBA 1PLJA 3ORSA 4RHUA 1JFTA 3VU3A 1S96A 2FXVA 3GUCA 5DK6A 3ZKAA 4DV3B 2M6SA 3K6SA 1MN6A 1XQXA 5DULA 4MRMA 4Y2JA 2WZQA 3EXEB 3OT1B 4MV1A 5BQ5A 3VU0A 1JECA 3BXEA 4J03A 1JIIA 1OBOA 2FEWB 3QBDA 3N87A 5TQ2B 4OI4A 2P3SA 3TQIA 1P7CA 2PX2A 3ZDXB 4FHEA 3TLAA 1DC6A 1R6UA 2GSWA 1XXHB 1SBTA 4DCUA 1EAMA 4ZYZA 5LU9A 4KVZA 3BE4A 2B8TA 5E2BA 1R8QA 5GIPE 4MUGA 1PQPA 3E48A 3AFHA 2VBFA 2ZOSA 2P2ZA 3LWZA 1GPKA 2O0MA 3X2SA 4EG8A 3O94A 4ETIA 4MICA 1Y98A 3DAPA 1VPLA 2WWVD 1WHSB 2AD1A 1BS2A 1XUOA 2JIRA 2O2SA 2X77A 3EQ9A 2RK6A 2XMPA 2IEGA 3N59A 3ORQA 3ZCTA 1H0SA 1TPZA 1XXHA 3EEIA 4M7RA 3WLLA 3ETDA 3C70A 3BS4A 4F3KA 3GR6A 3F4KA 4IMRA 2ZIWB 1PZXA 2ECPA 2VQ3A 4PLWA 5JS7A 1LI7A 4X61A 1JTEA 2IBTA 2QSZA 3PI6A 1E4VA 3K8OE 4KPEC 4D6YA 1KK2A 3F74A 4QUBA 2VYQA 5LQDA 3V8MA 1CR4A 2JRCA 4ESVA 3S5JA 1ORHA 1NXSA 1ZGCA 3PPXA 4FHZA