1M66A

Crystal structure of leishmania mexicana gpdh complexed with inhibitor 2-bromo-6-chloro-purine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 133
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m66A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m66A01
4UEJA 1ZSYA 3G17A 3H7AA 2ZQYA 4E33A 1LRKA 1PGOA 4ZN6A 1WVGA 3AY6A 3QLJA 2NWQA 4NNJA 3JV7A 4OQYA 5BT9A 4F45A 4B4OA 2HK8A 1C0IA 3EVNA 3KSDO 1AHHA 4MVJG 1P74A 1GZ4A 2C2XA 1MFPA 1SEVA 4FFRA 1MXHA 1IZ0A 5AQ1A 3OJOA 5C3MA 3PWZA 3GT0A 3HE3A 3D0OA 2EW8A 2FZEA 3MOGA 3C24A 4BO4A 1PEDA 3WYEA 5B4UA 5T67A 2Z1MA 3QVOA 3ENKA 1Q7BA 4J9VA 4YXFA 4YR9A 4B4UA 3VDQA 3IL2A 1RPNA 1J0XO 2JKVA 2PNFA 1IY8A 3GN1A 1E3WA 4BKOA 1UAGA 2DTDA 3DAGA 3DEYX 3AOEA 3DBLA 2EG9A 1LQTA 2CD9A 2X5KO 3RJ9A 5GZ6A 2Q1UA 1Q0QA 3L77A 2G0TA 5A3JA 3S8MA 5DT9A 1ZO8A 5JY1A 3KHUA 3OSUA 2QHXA 5MDHA 1W8DA 4AJLA 1HEUA 1C0KA 1T25A 2OORA 3C3XA 4BNNA 4CV0A 3JYNA 1TLTA 4II2A 2D5CA 3G79A 4XWYA 1E7MA 4TVBA 2GR9A 4P4LA 4Y8VA 2Y68A 2ZJ0A 4XR9A 4XGKA 1ZEMA 3U9LA 1LXCA 1ZZEA 1PWZA 3KTDA 5I8WA 4Y9DA 1TB4A 3MWDB 3WBFA 3PDUA 3ZWNA 4A7PA 4MP6A 5CFZA 2WTBA 1QRRA 3ZN2A 2CZCA 1W6UA 1HDYA 3GVCA 1M66A 4MVJD 4UUMA 3EGOA 3KSZO 3GMDA 1MXFA 3V1YA 5KJ6A 1DC5A 1I01A 2ZKLA 3GF4A 3JYPA 1XGKA 3M2PA 3FPCA 2WE8A 1HL3A 3L4BC 4ND2A 4FOOA 3UVEA 1R12A 2Q1TA 3M2TA 1PL7A 2NACA 1R0SA 3OBBA 2V6MA 1NVGA 2NM0A 2PFGA 2V7PA 1CWUA 4FJ2A 2WDZA 4GMFA 4YEDA 3GZ4A 1AUPA 1LDYA 4RO0A 2O3SA 2D5AA 4HFMA 2EHDA 2HJSA 4ALNA 2Y0CA 1OI7A 1M6HA 4BS9A 1GQYA 2PWZA 2UDPA 4GKVA 3S1LA 2YHUA 3JQGA 1PGNA 4WCFC 4IDBA 3VTZA 3IKTA 3Q9UA 2CDCA 1G0NA 2C5AA 2GPTA 4AVYA 4U0KA 1KY5A 3RFTA 3NX4A 4XIYA 1EE2A 4CMEC 3ITKA 2FP4A 2O3TA 4Q9NA 1HE5A 1A27A 3MEQA 4E6PA 3R1IA 5L7TA 3L6DA 2C29D 1BVUA 2BI8A 3GK3A 4IZIA 2NQ8A 3RAJA 3FNFA 4NBVA 3VPHA 1U3UA 3D5QA 4BKUA 2FR0A 2WYUA 3JTMA 4YT4A 5I7SA 4E21A 1ISJA 3DMTA 4NU5A 2P9GA 4FDAA 1W4ZA 2J5RA 5COBA 2GCGA 4R5MA 4LK3A 4BVAA 4CM1A 3OJFA 4N5LA 5F3RA 4QXMA 4R4JA 3LT4A 2F1KA 2QYTA 2GN4A 4RORA 4CUZA 5DP1A 4U5QA 3RJ5A 2H5LA 2BFMA 3BXXA 3C1TA 4DIFA 4RPLA 4Z9YA 4CLOB 1DC6A 1MV8A 1FDUA 3PK0A 1SO8A 2OO5A 4JP3A 3U09A 3ADPA 1S6YA 1V0JA 3QJ5A 4K1LA 4UVHA 1NQAO 2DBVO 4YJHB 1DAOA 2NVUB 4Z0TA 3I5MA 4GVXA 5T8KA 2LDXA 4IS3A 1A4IA 4J7CA 4OXNA 3ZZNA 4PVCA 2O48X 4CLDA 3SX2A 1C1DA 1JQBA 2HO5A 2YQ5A 3ROQA 4J90A 3F3SA 3ZV5A 4R1NA 2B36A 2X22A 4EBFA 1CQJA 1GV1A 4BNFA 4J4TA 4DQXA 3FTPA 4WNIA 1BMDA 3RUAA 3ZHZA 2VNSA 4B79A 3RC1A 2FRDA 2WD7A 1FF9A 1NASA 3HB4X 1PZEA 3TPCA 1CDOA 1LU9A 5H81A 4OOFA 1XQ6A 1X0VA 4XQGA 1B3RA 3IMFA 1YB4A 3EHEA 2GN8A 5G0SA 1UDCA 4P38A 2GGSA 3I9KA 2X0NA 1BTOA 4HFJA 4XRGA 2WWRA 1NPYA 2QIOA 1DO8A 3KYBA 3UCXA 3W8DA 1N5DA 1XSEA 4JBIA 4Z0HO 4RF2A 2DC1A 1WAMA 2VUUA 3ADOA 4OH1A 1LDNA 4FN4A 3ZWMA 4RVHA 4BKRA 3SXPA 2X9GA 3K96A 3GFBA 5GZ3A 2DTEA 4JP2A 1E77A 3NUGA 1KEVA 1MB4A 1S7CA 4YT8A 1ZBQA 1PS9A 2E82A 4MKZA 3W8FA 4RF3A 4Z9XA 3CSDA 1XCBA 3FWNA 1JKJA 1NP3A 1P31A 1VJ1A 4CM4A 3JQCA 3F4LA 1C14A 4OKNA 4DC0A 1JAXA 1JDJA 4O59O 3BAZA 2NNLD 1PGJA 2DLDA 5DCUA 4GX2A 2B4RO 5KKCA 3PYLA 4W7IA 3EMKA 4XKJA 1E1MA 1ZK1A 5IZCA 1E7WA 1WDLA 3AUTA 2Q99A 3VVCA 1F17A 3TN7A 4CQMD 4BV9A 2DPGA 4C7JA 2SCUA 4NI5A 1YO6A 4QQRA 1KYQA 4XYLA 3A1NA 3PZRA 2O3QA 4PLZA 6ADHA 4XQEA 2ZJ1A 4U6SA 2P5YA 3WIEA 4BQRA 4J43A 1YWGO 3UXYA 8ADHA 3WGQA 1VL6A 4XZ3A 2JCYA 5L53A 4E5KA 3EW7A 4B3IA 3JQAA 1ZIDA 1FDVA 5CDTA 4D79A 1XWFA 4KQXA 2YW9A 1EFKA 4GWGA 4B3HA 2HRBA 4A0SA 4BO6A 1WLYA 3UAGA 3AI3A 4BOYA 1DDOA 4K26A 1ZCJA 3KEQA 3PWSA 4ALMA 5HM8A 3CKYA 3WGZA 4XDYA 1SPXA 3FI9A 3JQ8A 4QEDA 3LF1A 5DF1A 1ISFA 1HSZA 5IF3A 3COSA 4BO5A 4EITA 3ANLA 3HDJA 4YWJA 3LZ6A 1XDWA 3LC2O 4IZHA 4P22A 4XIJA 2XPCA 5JDCC 3Q2IA 3JQGB 5EQFA 5TT0A 1LTHR 3HZZA 1YKFA 5KVSA 2HLPA 1HETA 3GVPA 2Y1FA 1DFIA 4ZQHA 3RI3A 1PR9A 2NSDA 3AK4A 5JO9A 2I65A 2VT2A 5L4SA 2HUNA 4DMMA 5F5LA 3PJFA 1EVIA 1U4SA 1JVBA 2O3JA 3E18A 3L4SO 4GX1A 1G6KA 5BNIA 2UUPA 4IXTA 4JN6B 3H3JA 4BO7A 5JCXA 3VPSA 4RL6A 4A26A 1CYDA 3I9JA 2W2LD 3WJ7A 1QYXA 4Q3BA 2Y1EA 4CMHA 4E2XA 4F46A 1PTJA 1I2ZA 4YACA 3FNGA 1E1KA 1EQUA 5DZSA 1XR3A 5KOIA 1V3TA 2WE7A 4Q3DA 2YQ4A 1A9YA 4ZQGA 4XEHA 3B6ZA 2BFAA 3INGA 3LDHA 1QG6A 3E1KA 1EZ4A 3KUXA 1R4MA 1GV0A 3EZLA 3I4CA 3GN2A 1IUKA 4ZQBA 2C07A 3T4EA 4IDDA 1P1FA 3U4HA 3JYLA 4BNIA 2EP7A 5L7WA 2I76A 3CINA 1UZLA 3PTZA 4FS3A 3ZWBA 4TRRA 2ZYAA 3EVTA 5EMHA 3TSCA 3H4VA 4F3YA 4WNCA 4BIIA 2V6FA 4MKXA 3IIEA 4CM5A 4YT2A 2QQ5A 4J4HA 3DZJA 4QX6A 3DQPA 1GYRA 2VHWA 1H93A 1LDGA 1SB8A 2OGUA 5DN9A 1SB9A 3K92A 4W6ZA 4YPOA 1IYZA 5A9TA 2Q46A 3OIGA 3RUIA 4PN3A 3M1LA 2NV6A 1C1DB 3KB6A 3V2UA 3WTBA 5GZ1A 1I32A 2Q2QA 3WMXA 4J91A 4HV4A 1OC2A 2Y0EA 4GLOA 2X9NA 3PGXA 3KLPX 3L07A 4R1SA 1NQOA 4UUPA 5ADHA 1X7GA 3TF5A 4D3SA 4B7CA 3MZ0A 1R37A 3IP1A 4RLHA 3SJ7A 3E48A 2Z5LA 5A4DA 2WD7B 5BNFA 2JCVA 4OKIA 5DBFA 3M1AA 5T6BA 4B4VA 4EJMA 1E5QA 3GUYA 4RQUA 5CDGA 4UUNA 4YJFB 4Q3NA 2BGMA 4E2ZA 1IPEA 1YQXA 4KTVE 3NDRA 3D3WA 5JPIA 3NDIA 5CEEA 5FWNA 4CLXA 2V65A 1HE3A 4JNKA 3IOYA 2FPPA 4O6VA 1LSOA 1LBEA 1WP4A 3EY4A 3SC6A 2I5PO 1WMAA 2PD4A 5A9SA 2WM3A 3O8QA 4YVFA 1T2EA 2E37A 5LCXA 2BH9A 5ICMA 1IE3A 3PZBA 2Q2VA 4RF4A 2HRZA 3JQBC 1BXGA 3MTJA 4MVJH 3BHMA 5CDSA 2AQ8A 4HY3A 5C7LO 2ZCUA 1X7DA 5U4QA 3FR7A 3ZV3A 3BMCA 3MWEB 1B8UA 3DTYA 3N7UA 3TZHA 1UXIA 4RF5A 3GEGA 2PZLA 3E8XA 5F21A 1YL6A 4AJOA 1YS4A 1L1FA 1D1SA 3UGKA 3KOUA 4J7XA 2AA3A 1B0AA 3JD2A 3PP8A 1I0ZA 1N1GA 4IJUA 2I99A 4G81A 4K28A 4CM9D 5JLAA 4DLAA 3ETGA 1YDEA 1EFLA 4NIMA 1MG5A 3GRKA 4HP8A 4KOAA 4ND5A 1VJ0A 1HZJA 3OQBA 5HBRA 3QSGA 3B20A 4G65A 5EESA 2W8ZA 2GSDA 4P4NA 3S2IA 4BMSA 5KVCA 4CQLA 3X2FA 3W8EA 2YV1A 5JCJA 5CPFA 3DBRA 1HLPA 1E3JA 2BI7A 3PXXA 2X4GA 4AFNA 3G49A 2YZ7A 4GKBA 1RYDA 2EIHA 4LCEA 3B70A 3D5TA 2HSDA 1A7AA 3K2BA 4E5NA 1PL8A 3ORFA 1WW8A 2R2GA 1SAYA 4WLFA 1DEHA 2VTDA 2PA3A 5HS6A 1Z7EA 1I33A 9LDTA 1E0DA 1E5LA 4NU6A 2FHSA 4R01A 1DAPA 3DAFA 1O94A 4AJIA 1M6WA 3H65A 3JD1A 3JQ8B 3DZFA 1GQQA 1E6WA 1YL7A 2VQ3A 2YDYA 4NMHA 4YQYA 4AJNA 3AOEC 1NR1A 3H2ZA 1GTMA 4ZGWA 2YY7A 2PGDA 4OIMA 3GDGA 2FSVA 3AU9A 3ZU3A 4CMGA 3TL2A 3BYZA 4BGIA 1Z45A 4PZEA 4JIGA 1I3MA 4OHUA 3GNQA 3LC7O 3ITDA 4LMRA 1Y5RA 4J2OA 1YL5A 3RBVA 4QO8A 1U3WA 2FR8A 1ADCA 3BMQA 3DOOA 3HDYA 5A02A 1NHGA 4XQ9A 4EUEA 3VKVA 5B12A 2PKQO 1ZUD1 5I9MA 1LC0A 3DAPA 3CPSA 2EKLA 1T2CA 2R00C 5KNLA 2GERA 2GRAA 1E7SA 3E9MA 5CHEA 4J3FA 4BB6A 5JBIA 1UXHA 4E5MA 4IQ0A 1KERA 1PL6A 3DZIA 1NPDA 3GFGA 4NR0A 1H2BA 1Y9EA 4IMPA 3ZI0A 3GVXA 3GHYA 1FJHA 3ONEA 4R9SA 1QLHA 4GSKA 4IGFA 3W6ZA 2AQHA 4FJ0A 1KVQA 4D3FA 3ANMA 3NDJA 1I5RA 1HWYA 4WK6A 4GVLA 4AJKA 2Y1DA 1FMCA 2DUUA 4XCVA 3C7DB 1EUZA 1R4MB 3O26A 4M49A 1IZ9A 3QVXA 3DO5A 4BNHA 5JXWA 2ILTA 3ZNNA 4W82A 1O0SA 5I9NA 2RH8A 1A72A 3E03A 5IDWA 2X6TA 3PIDA 1IOLA 6LDHA 4FB5A 1RM4A 3ZW8A 4RVFA 4XX0A 1F12A 1HYHA 4IGEA 3RD5A 3WLFA 4PG8A 4I5GA 3TZ6A 3HDQA 3JD3A 3L9WA 1MFZA 5JAZA 3V1UA 4O1MA 2P68A 1WZIA 3ROKA 2DKNA 3B1KA 1R0LA 5KVQA 2WYVA 3KM0A 5EJ2A 4CMCA 5BSHA 4N18A 5JAIA 5DBGA 2QZ9A 3DL2A 3D4PA 2EGHA 3KSUA 4MPDA 2AG8A 1XQ1A 2ZB8A 1LA2A 4A03A 4CV1A 3PWKA 3DZGA 4JROA 2HU2A 3ZWAA 4Z9FA 3TFOA 4ZRNA 4R68A 3D3WB 1PGPA 2F00A 2EW2A 3UFXA 2CF6A 3AU8A 2E4AA 2O2SA 2ZK7A 2DBQA 3NRCA 4JJFA 3ZU4A 1LNQA 3FBGA 1NX6A 4BGEA 2UVDA 1MC5A 4MP3A 3HQ4O 3OIFA 3K31A 5A9SB 1B15A 1AHIA 1LI4A 3TWOA 3H9UA 4EZBA 1UP4A 1P1HA 2H6EA 2OP1A 4PRLA 5KJ1A 1HSOA 5AXCA 4PLWA 2ZTVA 3HDHA 3PIIA 1BXGB 2X7HA 1ZK0A 4M86A 2FPGA 4IQGA 4NJMA 4P8RA 4R5HA 1XYGA 4E2YA 4X54A 5LC1A 4CUKA 5T8KC 2ZB3A 5I7FA 4J9UE 2X1HA 1HKUA 4E0BA 1ISIA 3F47A 3NTRA 4J4BA 5JW6A 3INTA 1I10A 1Z74A 4XYBA 4CL3A 5THKA 1ZK4A 1GAEO 3IC5A 1EE9A 4HFRA 5AVOA 3ZWOA 1GDHA 4HXYA 5TSDA 5FEUA 3BMOA 2EEZA 1D3AA 1YBMA 3JQ7A 4K9DA 3GAFA 4PLHA 2O50A 3VZQA 1HYGA 5C7OO 2HK9A 4IDFA 3FRJA 1HZZA 3QE3A 4DRYA 2CVOA 3PHIA 5AXAA 2Z95A 4MO2A 4XYGA 4ALIA 2X0RA 4CUJA 4PG6A 1X13A 2FOIA 4L8VA 3JCZA 1QR6A 3AM3A 5FFFA 1NR7A 4DQVA 4QO7A 3ANNA 1U7TA 3OIDA 5I9LA 4FQ8A 4M87A 2DU8A 2J6IA 2Y99A 4MVJI 5COQA 4A5OA 1I3LA 4YCAA 3M6IA 1Y7TA 4N5NA 3GG2A 4IJVA 1HDCA 4TQGA 5F1OA 4DGSA 2R6JA 3QRWA 4LGVA 2XAAA 3G1UA 1P44A 2C2YA 4YJGA 2HDHA 2QRJA 4B8ZA 3E82A 3WX0A 3ZDFA 1I30A 4M55A 4IM7A 3VOSA 5G0TA 3NGLA 3H5NA 2Q1SA 4I5DA 2VT3A 3ZWCA 3QP9A 4R51A 3KO8A 1GD1O 3QWFA 3DZHA 5F5NA 2B35A 4J6FA 4YAKA 4WJZA 5IJZA 1V6AA 4GGOA 1LC3A 2Y1OA 1PQUA 4TROA 2Z1NA 2VWGA 2PD6A 3LT0A 3TL3A 3O38A 3O9ZA 3N58A 1RM0A 4D44A 4TKLA 2CVQA 3BMQB 1QYCA 1ZNQO 4AJJA 4L4RA 3GLQA 4DYVA 1Y8QA 2ZIZA 1DLIA 1P1IA 4OL9A 2P9EA 2YYYA 4GBJA 3VDRA 1A4UA 3DONA 5MGBA 1EUCA 2BLLA 3RVDA 3TOZA 3QIVA 5TNXA 4R9RA 4WOJA 1PJSA 1UDAA 2IXBA 4PG4A 4UVDA 3CUKA 4AJPA 2Y66A 1WNTA 1NNUA 1XU9A 1ISHA 4FJ1A 1YOVB 2PLAA 1X15A 3O03A 4UAGA 4A27A 3ZH2A 5I7EA 2NUAA 1H9AA 4B4WA 1Q7CA 3U3XA 2JFGA 2JD1A 1MUUA 4NFHA 3GGOA 5EN4A 3VZPA 4TVOA 3NT4A 5HTOA 1ZXLA 3NTQA 1H6BA 1P0FA 4YAJA 4GSLA 1B26A 1SBYA 2H63A 1I3NA 2JD2A 2Y1GA 4GPD1 4ND1A 1UJMA 3EDMA 1B8PA 3IS3A 4KUGA 1GQ2A 1ONPA 2BHLA 4IUYA 4RQTA 3RIHA 4UVGA 4GX5A 3LQFA 3RUDA 3T4XA 3AY3A 3VPXA 1NWCA 1C0PA 1IPFA 4CR8A 4FFOA 1ULUA 4ALKA 1PJ2A 1MLDA 3KBOA 4ZRMA 4D41A 5JDIC 3W4IA 1RJWA 2PGJA 1LEHA 2NLOA 2X23A 3MJVA 3FCOA 1Y81A 4TZKA 3L6OO 4FW8A 3K9QO 3OFSA 2VHXA 4DLLA 4IDEA 4Y6SA 1E1NA 3UF0A 4N5MA 4OQZA 3EC7A 5A3VA 3ZWPA 4S1VA 5ITWA 1H6AA 5CP8A 4I1IA 4XA8A 1JA9A 5IZ4A 2RBEA 1XU7A 4AG3A 2G5CA 3TNLA 2EKQA 1ONOA 1XHLA 5CG1A 1YVEI 4FFLA 1NFRA 4D0RA 1Y8RB 3UCFA 4CLRB 4HADA 3RFXA 1MG0A 1OZAA 2ZCVA 3IJRA 1AN9A 4MIOA 3WYCA 3OQ6A 2HK7A 1A5ZA 4U6QA 5K6AA 3V2GA 4QTZA 4E31A 2DT5A 1ZMTA 4B3JA 5ILGA 5EPOA 2EWMA 1JWBB 1VC2A 4OXYA 4BNVA 2ZTMA 3HHPA 4NG5A 2EF1A 2I9PA 4KUHA 1TT5A 3CMMA 4NZ9A 2YUTA 1Q7GA 1LDEA 5KKAA 1BRMA 2DPHA 2NU7A 2OL4A 3GVHA 3I6IA 2BELA 3OICA 4CMIB 3PRJA 4BNGA 2BFPA 5DBIA 1U3VA 5U9CA 4BNMA 4YJDA 1GEEA 4EDFA 2E48A 1BSVA 1TXGA 4MP8A 1DXYA 3Q2KA 3VC7A 3PYXA 3Q3CA 1ZSVA 3R6DA 4PG5A 2AE1A 2NU6A 3ZHYA 4S3MA 3DMYA 1GUZA 1P3DA 1FK8A 1A9ZA 1DHTA 2ZATA 4H3VA 5KJEA 5KTKA 2A92A 4J0EA 3ZHBA 3I9MA 1DIRA 3MTGA 5TIIA 3L9XA 5L9AA 1J49A 1A71A 2IYPA 1LDMA 3C85A 3MJEA 4IXWA 2VN8A 4YRBA 3NJ8A 2RAFA 4XR4A 5TQVA 3WQSB 4GX0A 3GA0A 3ZCXA 2FMUA 3PHHA 4JBHA 4LN1A 4Q3EA 3TFQA 3CH6A 4K6CA 3TJRA 4J1TA 5ER9A 4RLSA 1X7HA 2FR1A 1ADGA 1V9LA 3BMOB 3R3JA 4IINA 5IXSA 2VYVD 3JQ7B 5ER6A 1E3WB 3QY9A 3RSHA 4RGBA 1Z75A 3DBLB 4LMPA 4BUCA 2UYYA 1T26A 4L4XA 3AW9A 2PGLA 3PEFA 1C1XA 3AM5A 5CEJA 1K5HA 4KWHA 3SBOA 1H6CA 3QVWA 1VKOA 2WEKA 3D7LA 3I83A 3W4KA 2YV2A 4R1TA 3F4BA 2E6UX 1H94A 2JHGA 3E5RA 1F8FA 4NQZA 1OOEA 4NBWA 4O63O 4J0FA 1HE2A 1UP7A 3MJ4A 4JLWA 5A1TA 4XGIA 4I5FA 4DREA 2VHVA 2YHIA 3OETA 3QWIA 2W2KA 2ET6A 1NQ5A 3MCVA 3OHSX 3U0BA 4YT5A 2VWQA 5L4NA 3JD4A 4RDIA 4D45A 2J5QA 2P91A 5AYVA 4KMSA 1UXJA 3QQPA 4Q39A 5DNAA 3T7CA 4BNKA 3OJEA 4L4SA 3V2HA 1CETA 2GYYA 4JQCA 1VM6A 1LJ8A 1ARZA 2PKRA 4E2WA 3I9LA 4PGFA 2C54A 5L3ZA 3UHAA 3NTOA 1EBUA 1A7KA 3C1AA 4NHEA 1DFGA 1RM5A 2EERA 4GWKA 3WNQA 4DLBA 5GY7A 3GPDG 3UUWA 3S55A 2JCXA 4IQ8A 2X58A 1F8GA 2PTGA 4JK3A 5IDXA 5TT1A 4OM8A 1EDOA 1Y8QB 4MVJA 3AUAA 1UZMA 1D4FA 1WMBA 1F14A 4DXHA 4E30A 4CMEA 4OXKA 1C3VA 5DCWA 1GU7A 4W9NC 3RBZA 1LUAA 5KIAA 1HDGO 1KC1A 4XYEA 4DA9A 1TVEA 4JJIA 4CODB 3JD0A 4AJ1A 1EVZA 2AG5A 4BO3A 1MGOA 2Y0DA 3DOJA 4LW8A 1EMDA 1X1EA 5TF4A 4LSMA 2RH4A 5TJ9A 4NH4A 1C0LA 1NWHA 2CSUA 4ILKA 3GDFA 2IRWA 1DIGA 3IUPA 4PVDA 2NVWA 2FN7A 1SNYA 3WSWA 5JSFA 3GVIA 2OZPA 3RU7A 2EV9A 1ZMOA 3ETEA 4AJ4A 4AL4A 1W73A 3LU1A 5L7YA 3DR3A 1ZFNA 3PI7A 1PJCA 1T2FA 2VWHA 2YV3A 3DZKA 5A5EA 2C7VA 3IDSA 1NM5A 3P2YA 3GNSA 4EI2A 2HMSA 4YTEA 1DIAA 1E3LA 3BTOA 4NJOA 1U7HA 3RC2A 2HKIA 5JNLA 2YFQA 4HWKA 1D7OA 1ADBA 2CDAA 3D64A 3ONDA 3SVTA 2O7SA 4HNHA 3JQ9A 3DHNA 5JC8A 5EINA 4BNTA 1OFGA 3A9WA 3LLVA 5F1PA 4AICA 4EEZA 2VOJA 1ENPA 4RDHA 2VUTA 3HSKA 4IJKA 3SLKA 5JO0A 1TT5B 1R6DA 3PQEA 5EQDA 3WGHA 4WLUA 1QYVA 4YYZA 3OJLA 4L9RA 4D3DA 3W4JA 2CF5A 1KETA 4ONEA 1P0CA 1Z73A 4H16A 1N9GA 3VH4A 3WGOA 3U5TA 4Y6RA 4II3A 4MOWA 3VHRA 4AJHA 4IIVA 2Q45A 1ZSNA 4CPDA 1V3VA 2WMDA 2CUKA 5G2OA 2ZB7A 4HNGA 4OO3A 4DL9A 3DOCA 4FSHA 2NTNA 5TLSA 5DDIP 3NEPX 2PZKA 1GCUA 3OECA 3BHIA 1OMOA 4DIBA 1DC3A 1GCOA 1HDOA 2OBNA 2VYND 3NT5A 1D8AA 4JGBA 5ENVA 2EXXA 3W1VA 1N92A 3ENNA 3Q1LA 3SC4A 1JW9B 3DFZA 1L7EA 4W99A 1I2CA 5IN5A 1NAHA 1IB6A 3PQFA 4XDZA 1P45A 3L0DA 1BW9A 1NBOA 2Q2WA 3JYQA 1HLDA 3S2GA 4OSPA 1KS9A 2NU9A 4WLOA 3B1FA 1VPDA 1O95A 4D0SA 3ZHXA 1PZGA 1QXSA 1KVUA 3GY0A 4J2HA 4CM4B 1GPDG 3NYWA 1C1XB 2G17A 2XXBA 4R3NA 1UUFA 5TGDA 2VCYA 4CMJA 2VZ0A 2GN6A 4MDHA 5IXYA 5COAA 3UICA 3E9NA 4J1NA 3WB9A 4RCVA 3RUFA 4L73A 1RM3A 1GADO 1E7YA 1YB5A 3FNEA 3OA0A 4GGPA 2VNAA 5LDHA 4BKPA 1QP8A 2YHIB 1JTVA 3WLEA 3TRIA 2W2KB 2DTXA 4WEOA 4MVJM 2I6TA 1GPJA 1UXGA 1I8TA 2HMUA 5CAEA 4Z3DA 4J1QA 1YH3A 2DBRA 1PJBA 3GGPA 1K2WA 4BKQA 3JQAB 5JC1A 3AJRA 3WFJA 3AUSA 4CQMA 4WKGA 3UN1A 1X1TA 3RU9A 3I6QA 1VJTA 5IFLA 3AOGA 2FY8A 3ZWWA 4XQCA 3GG9A 3EAGA 3VKUA 1AXGA 2X0JA 1ISGA 4DPKA 1ZJYA 3GC6A 1QV6A 2PZJA 5JDCA 1GUYA 1DB3A 5C5IA 1VL0A 1J4AA 4WLVA 4QECA 4E5PA 3KYCA 2AHRA 3LT1A 4B8WA 5BNTA 2GF2A 5G0WA 4FOSA 4QUKA 5ENDA 4C4OA 2IEDA 4F6LA 4Y98A 3HWRA 4R69A 2OBYA 4FGSA 3OA2A 1ENZA 1XA0A 4J7UA 1YBVA 2QZZA 3FWZA 3VTFA 5L4LA 2X9VA 3LYLA 4PFJA 3FBTA 4HKTA 4NFSA 3V8BA 4HFNA 5G4LA 1O6ZA 5GMOA 4ESOA 1R0KA 1QSGA 2QX7A 2DAPA 4DYDA 4M8SA 4BNYA 4CLEA 3RKUA 2NU8A 1U1IA 1EK6A 1K6XA 2PR2A 4DBVO 3NGXA 2I3GA 5DP2A 3FR8A 1BWSA 3U4IA 3PHGA 1VKNA 3JYOA 1LSJA 5H82A 3AM4A 4OOEA 4GAEA 3BMNA 4YB8A 2C59A 1ENOA 3GH3A 3Q11A 2XXJA 1NVMB 2VRCA 3I9OA 4DC1A 5EL0A 3KVOA 1HE4A 4CMAA 3GZNA 4DIOA 3AY7A 2DM6A 4BO9A 4PIVA 4CV2A 3GDOA 2V6GA 2D1YA 2BFOA 4RVSA 4NBRA 3FN4A 1U8XX 1VSVA 1XELA 4IJWA 4CR6A 5TC4A 2W2LA 4OSOA 4BGVA 4YAIA 2JHFA 4EJ6A 1J6UA 1F0YA 2IYOA 5LDGA 1ONNA 3ULKA 3GHHA 3OF2A 1KOLA 3U49A 4RPJA 4U8GA 2HCTA 3A4VA 1O5IA 3H5AA 3NT2A 4FD3A 4WGGA 4NK5A 3MJCA 1U9JA 4WPGA 2Q49A 5I8ZA 2Y05A 4ZQEA 1NTOA 4FIZA 1AE1A 1NYTA 2D3TA 3I9NA 1I36A 1LQUA 2YFHA 3ZW9A 2BF7A 4PRKA 2A4KA 3I4FA 3RC7A 4MVJF 4UULA 2VZ9A 1LLDA 4CV3A 1NQTA 3GUCA 3K6JA 1N9GB 5JY6A 3HUDA 3C7AA 2P5UA 3CMCO 2XOXA 4EW6A 5C37A 5HA5A 2UV8A 1PJQA 1B7GO 5A9RA 1HF3A 2B5WA 3QW2A 2P4QA 5AOVA 1YE3A 1ML3A 2D59A 3DMTC 1UH5A 4I8XA 5JYEA 2W4QA 3U4DA 1YGYA 3HNPA 1PJ3A 5ITVA 2P4HX 1EBFA 4LRSB 1PSDA 1MA0A 5DOZA 1PJ4A 1DRVA 4D46A 5JAMA 3WWYA 3UW3A 1G1AA 4B7UA 4RV9A 1KC3A 1E6UA 4XD2A 5U1PA 4CLOA 3ZV4A 2NTJA 2WYWA 4ITUA 3JQBA 5TS3A 5CDUA 1E1LA 3RCBA 1QYWA 3S2EA 4CM3A 3WR5A 1P1KA 2X5JO 1B8VA 3O8QB 4XYMA 3VH2A 4UUOA 3P5SA 3PJEA 3F5QA 2OMEA 2V6BA 3H9EO 1LRJA 1UDBA 4MIYA 1IL0A 1YB1A 2AE2A 4Z6KA 1WZEA 4BMNA 4MVJE 3OEYA 1DRUA 2HMWA 5K6AC 2D8AA 3A06A 3BMCB 3TZCA 5JMPA 4YRAA 1E3SA 4DWVA 3ZU2A 4D43A 4PLTA 3KYDA 2ZB4A 1LSUA 4ALLA 3H3FA 5KJCA 3DDNA 3MJSA 3EZYA 2JFHA 1CJCA 3HG7A 4NBTA 3H9QA 1EDZA 3JQFA 3HJAA 1U2GA 4KDFA 1PZHA 4F6CA 3JQEA 3I52A 3QWAA 4OMUA 4ZU3A 1VLLA 1U28A 4IMRA 2VRBA 1N2SA 3OMLA 4CQLB 4FGWA 1CF2O 1T1RA 2WJPA 3OM9A 3WGTA 5IN4A 2Q4EA 3DBRB 1ZEJA 4J16A 3TDKA 4IBOA 1G0OA 1X14A 2FWMX 3LF2A 5TX7A 1B2LA 2PK3A 4CM9A 1GUFA 2W98A 3WG9A 4AJEA 4CQMB 4QFDA 4ZA2A 4EEXA 2J3HA 3C8MA 4WLNA 4L76A 1H6DA 3F5SA 3D4NA 1EUDA 4TRMA 1P1RA 5DCYA 4BGUA 4LRTB 1DRWA 4ROSA 3VZRA 3Q6IA 1OC4A 1PQPA 4Z0PA 4RPHA 3DHYA 2C7GA 1NPTO 4RPGA 2GN9A 1DIHA 1H9BA 1ZJZA 1U5CA 1R4NA 3KYCB 2C5EA 4CLHA 3JQAD 3WIDA 4ALJA 2VHZA 1O8CA 2B0JA 3PFFA 2HJRA 2JJYA 2JL1A 4NBUA 2HMVA 2O4UX 4N7RA 4RZHA 1EQ2A 1TI7A 3NAQA 4WUVA 3IP3A 1DLJA 2G76A 2R00A 3B1JA 2BGKA 1IHYA 3HADA 5IZCC 1KBZA 3U62A 3I23A 1WDKA 4L74A 3STHA 2Y67A 4M89A 1KEUA 2ZQZA 4JCOA 1E3IA 4CM6A 3WSVA 1T4DA 1B14A 3HN7A 1M75A 4MVJP 3IUSA 5FI5A 1DOHA 3TZKA 1DJQA 2AEFA 4CR7A 4RPKA 1DPGA 5JMWA 3BMNB 1JVSA 3P7MA 3KEOA 1JAYA 3RASA 2IXAA 4E32A 3GRPA 4R54A 3ZGYA 4OAQA 5AXDA 1YJQA 3GZNB 3NJ4A 5HRUA 5THQA 5CG2A 1ULSA 5J23A 3N74A 4R3WA 2GDZA 4I9NA 2P2SA 1PJLA 3WXBA 2B69A 1J5PA 3KRTA 3WNVA 2VZ8A 1H0KA 1KY4A 4BMVA 1EK5A 1SMKA 1DSSG 1GFSA 3ICPA 2ZTLA 4UEKA 3GEMA 2GZ3A 2YJZA 2IZZA 1N7HA 1SOVA 3RWBA 3BA1A 1BGVA 3HFSA 2QG4A 4CMBA 2C20A 1OBFO 3EYWA 4UREA 4W4TA 4TZTA 2TMGA 1JLLA 1BHSA 4LVCA 3WMWA 1Y1PA 2IODA 4FFMA 1DFHA 3CTMA 2G1UA 2CVZA 4ND4A 3V5NA 1BVRA 4BV8A 1ZK3A 3PDJA 2D0IA 4LSWA 2WD8A 1GL3A 1GY8A 1KVRA 3KZVA 4M1QA 1K3TA 4PG7A 1U5AA 5FI3A 1Z82A 1SC6A 4UVIA 5H83A 3ABIA 4ZQFA 3ZWVA 5IDYA 1SZJG 3VH3A 1LDBA 5CPBA 3ICCA 3ZU5A 3WJAA 5C7IO 1QMGA 1HXHA 3WBBA 2O2YA 4GH5A 2BRUA 2EJVA 2OXIA 1H5QA 1HYEA 2NVBA 3GPIA 3WGGA 5A06A 3MOIA 4A73A 1O9BA 1UXKA 3GGGA 2OOSA 4P4GA 4BB5A 3ETDA 3AI1A 2O7QA 3OP4A 4DQUA 3FNHA 5CDYA 1I24A 3QV1A 1R15A 3CIFA 4I5EA 4KTTE 1Y5MA 3G0OA 3PLNA 3I3OA 2AEJA 3DZBA 3ROMA 3QWHA 4KUEA 1GZ3A 2DUWA 3QHAA 4MINA 3OH8A 2IDZA 2PZMA 3RROA 4W7HA 5A05A 3ZNOA 3PFWO 3S2FA 4H7PA 2B37A 4NJMB 4EUHA 1L7DA 1Q0HA 1RYEA 4FCCA 3VAZA 3ROPA 3JQ9C 4E5YA 3CXRA 1DC4A 4CM8A 2YDXA 3KYDB 2BKAA 4YAEA 1MX3A 1EVYA 4WLEA 3DTTA 1NXQA 1Q1NA 4INAA 2OFPA 1XEAA 2PY6A 4YJFA 3DWFA 3WYBA 3NKLA 4FPXA 1DIBA 3UOGA 4OYRA 3O4RA 1WPQA 3ST7A 4FFPA 4DTIA 5JS6A 1PIWA 1PWXA 1NFQA 3QVTA 4CJXA 2GO1A 3H2SA 3HFGA 4TWRA 1I3KA 1ZXBA 4ID9A 2JD0A 4BNXA 4BNLA 5BQFA 1YXMA 2PH5A 4BNZA 2BD0A 5KVVA 4IDGA 2WSBA 1FXSA 1RWBA 1TEHA 1XKQA 2EJWA 4TSKA 4WCDA 4CMKA 1Q2XA 3LK7A 1KIFA 1ZVMA 1DBVO 3OEWA 4KDEA 5EIOA 1LX6A 5EERA 1AGNA 2AQIA 4E13A 3IAHA 2VTEA 3E9QA 1D1TA 1ZKMA 5HWSA 2G82A 4L0QA 4XGNA 1U4OA 1VSUA 4K6FA 1CRWG 4YJGB 1PS0A 3SJUA 3IKVA 2RHCA 4BL5A 4EGFA 1O89A 2OHXA 3F1LA 1NFFA 5JCJD 3RUCA 3R3SA 3L4BA 1M76A 1R4NB 3OQ1A 5L95A 2I67A 4QSMA 5T57A 4Q3AA 2HMTA 3QA9A 4I9UA 3WQRA 3EUWA 2I66A 4I9HA 1U3TA 3T7EA 3E5MA 1PZFA 1LLQA 2X5OA 1V35A 4PLCA 4PZDA 2HAEA 2PV7A 4PLGA 4WCFA 3TQHA 3UKOA 5TJHA 5IDQA 1E7RA 3AFNA 3D1LA 1UR5A 4BNUA 1JKIA 2JAPA 4NDNE 1FDWA 2C0CA 2DFDA 5B4VA 5A5FA 4BO2A 3DFUA 4CM7A 1QYDA 3CZMA 3E6AA 1P1JA 3PHLA 4FR5A 4KQWA 4L75A 4LCJA 4Z3KA 4HX5A 4IPTA 2AEMA 4J49A 1M67A 1NAIA 2ZTUA 1OAAA 2GUGA 4EYEA 2E49A 1T2DA 1VL8A 1YDWA 3ZWYA 4R41A 1U2DA 2LDBA 4FBGA 1AXEA 1SOWA 3PYMA 2RCYA 1ZW1A 5BSFA 2J3KA 1GEGA 1YBAA 4ND3A 5JDIA 4GL4A 3JQDA 4JBGA 1BXKA 4E12A 2X86A 1N7GA 2PH3A 4XRRA 1HDZA 4TRJA 4DPMA 3GNTA 1LLUA 1JWAB 2CY0A 2VRCD 1QLJA 2FSSA 4NPCA 3ZNQA 4PZCA 3PJDA 4IDAA 2DFVA 1K6JA 4UEOA 3DB2A 1P9LA 1Q0LA 5JE8A 4FFNA 1KEWA 5ES3A 1YJ8A 1HRDA 4KWIA 5A03A 3ZV6A 4IY1A 1Y9AA 3UH1A 4A2CA 1VRWA 3BZUA 5BSEA 4Y67A 3H8VA 4YBZA 5BSGA 4C7KA 1V3UA 3GR6A 4YDRA 1ENYA 1GYQA 4GI2A 2CNBA 2ZYGA 1T24A 4PLPA 4RVDA 1Y6JA 3PHJA 3D4OA 1DHRA 1ORRA 2DQ4A 3BTVA 1HDRA 4WEQA 1U8FO 1PX0A 4NK4A 2A94A 5A04A 5JFOA 1YRLA 3RUEA 3QWBA 4BQPA 5BR7A 1N1EA 1BDBA 4N54A 4TRNA 2RHRA 4J1SA 5G4KA 1B3BA 3EK2A 3FPLA 3WTCA 2VUSA 4ZVVA 3LSYA 2DVMA 3FD8A 3RC9A 5I7VA 4DMLA 3F9IA 3LLSA 1XIVA 4KP7A 3HB5X 5K0ZA 2Y93A 4JJGA 1P33A 3PQDA 4NFYA 2GZ1A 4BNWA 3CE6A 3FTNA 2JFFA 4GLLA 3K30A 1DJNA 2AMFA 4G5HA 4WECA 3L6EA 3LC1O 3ZWXA 3K2EA 4YAGA 2Q4BA 2IZ0A 1FDTA 4DVJA 3KLMX 1Z7BA 3H9JA 3ZNPA 3OJ0A 3RKRA 2P9CA 1K6IA 3K73O 3Q0EA 4U7WA 1JKFA 3A28A 1XG5A 1R16A 4I08A 3VVBA 4ZHSA 4CM8B 1ISMA 4IS2A 4LISA 3HN2A 2TMDA 3DBHA 4LVUA 2VOEA 2PKQP 8LDHA 1HTBA 2Y1CA 2B4TO 5ICSA 1EEHA 4XJTA 2A35A 2B5VA 3AFMA 4XB1A 1CQIA 3I1JA 3H5RA 1WDMA 2FZWA 4BNJA 3K8ZA 2QW8A 1PJTA 3VPGA 3VH1A 4PLFA 3F6YA 5B1YA 2JAHA 4R1UA 3RUHA 1TA4A 3H9GA 2NQTA 3CEAA 1TT7A 1LRLA 3IQDB 3G3EA 2DBZA 4BO1A 2IEBA 2RIRA 2VYVA 4CL8A 3AWDA 3CTVA 3F1KA 9LDBA 1GR0A 1B16A 1T1SA 3H6KA 3W6UA 5HS4A 2EGGA 1EVJA 1QV7A 1UP6A 4WASA 4ZJUA 4TMFA 4WE3A 1RKXA 3GOHA 3PVZA 3X2EA 4PLVA 1VI2A 3C7CB 2CMDA 1T2AA 3DBVO 1CERA 3WGYA 1VE9A 1KVTA 3KV3O 4BHTA 3BHJA 4JX8A 2GASA 2J3JA 3DC2A 1PQWA 1SEPA 3GAZA 1XLTA 5FF9A 4DPLA 4MKRA 1ADFA 1UAYA 2O4CA 2NADA 2UAGA 4BO8A 4ZICA 5K9ZA 5ILOA 3KXDA 1P77A 2H9IA 2Q50A 3ASUA 2UUOA 3K5PA 1HT0A 4U0JA 3UCEA 5F1KA 1K89A 4RZIA 2QRKA 4RJTA 1UZNA 3D3EA 3JQFC 4W9NA 4WCFB 4Y6PA 7ADHA 1E6EA 3TOXA 3VZSA 5B4TA 4D42A 5L51A 4E4YA 1QORA 4Q3CA 3LVFO 1F06A 2GLXA 1ZH8A 2H1SA 4H15A 5KCZA 4R16A 3WGIA 4OGWA 2C82A 4XJSA 3RBXA 2GNAA 4O5OA 3SLGA 3PJGA 5FYDA 3U4CA 1M2WA 4D7AA 4EJ0A 4A10A 5L40A 1E3EA 1E7QA 5DULA 4YQZA 1E92A 3V1TC 2AQKA 3AI2A 4IIUA 2GZ2A 2J5KA 3NV9A 4HUJA 5IG2A 2J8ZA 5AXBA 2B83A 1WWKA 4DUPA 4M54A 1CEQA 3PPIA 5G0VA 1MP0A 3DHEA 5G0UA 4MJLA 3RQSA 3RFVA 2AW5A 4O0LA 1N8KA 5DOVA 4URFA 4RVUA 4YRDA 4HBGA 1YONA 1LSSA 3INRA 1BG6A 1JU9A 1T4BA 3GEDA 3FF4A 1R66A 7MDHA 5CEFA 3GQVA 4UVEA 2B4QA 3C1OA 3LT2A 5L45A 5IAAA 2AXQA 3DXFA 2XF8A 5KWEA 3AUUA 3P19A 4MIEA 4PLYA 5TRTA 1QKIA 3VPFA 2O3UA 2X0IA 3CZRA 1KEPA 4AJ2A 2PD3A 4GMGA 1YOVA 2O23A 2X8LA 3BTUA 1V8BA 1ZK2A 4YA6A 1BDMA 1HDXA 1LLCA 2CDBA 1NVTA 3BIOA 1PGQA 2EKPA 1ID1A 1YQGA 3P2OA 3WS7A 1SCUA 2OUIA 1PS8A 3WDSA 4XB2A 3WICA 3F46A 2Q3EA 3WOHA 2A9FA 1BXZA 5T64A 1GZ6A 5B37A 2VWPA 2GD1O 1CIVA 1NHWA 2IE0A 2BGLA 2VHYA 3TZQA 4PCVA 4BO0A 2O3RA 4DBZA 5T5QA 3JSAA 3KETA 4E3ZA 2J3IA 2IZ1A 2POQX 4FC6A 1K0UA 5G4KB 3PLRA 2EP5A 3ASVA 1PU2A 3MJTA 1YQDA 4QFCA 4TKMA 3G1TA 1W0CA 3JQ6A 4JXKA 1GYPA 1IHXA 2QYSA 2CFCA 4QT0A 5JAQA 2HQ1A 4B7XA 2W90A 3R0IA 4WOKA 1X0XA 3Q9NA 2OP0A 1MC4A 3A14A 4RVGA 1IULA 1Y8RA 2D4AA 4CLRA 1PR3A 1KVSA 1H2HA 4GQAA 1JN0A 2NTVA 4G2NA 4KZPA 4YJHA 2NVUA 3DBHB 3WWZA 1BW9B 3SEFA 4FC7A 2QRLA 2ZYDA 2I3AA 1FDSA 1I2BA 3IJPA 3ONFA 1WXDA 4EUFA 3ON5A 2FPIA 4ZD6A 3FHLA 1Z6ZA 3WFIA 2BMAA 3QVSA 4IDCA 2VYNA 3GMSA 3WQQA 3PGJA 3FSRA 4CMIA 5JYDA 2D2IA 2Q1WA 5KJFA 3BTSA 4OJNA
chains in the Genus database with same CATH superfamily
4HSEA 3LCCA 1N2EA 3PJRA 4OHBA 1JQAA 1E5VA 3CLHA 4RGQA 1WABA 1WVGA 3AY6A 2NWQA 5BT9A 2M6LA 4OQYA 1V5WA 1FMJA 4B4OA 2HK8A 5K05A 2J0UB 1YT5A 5ICEA 3KSDO 2VDVE 4EUSA 4S12A 5FPSA 4LX8A 4MVJG 4I4IA 3A36A 3IODA 2C2XA 4FMCB 5AUQA 2KS6A 1EFPB 1SEVA 5CXUA 1MXHA 1L5FA 3OJOA 4JLKA 1DX9A 3PWZA 3MAAC 3D0OA 5CNKA 2EW8A 5DNDA 4LWPA 1JUDA 4B80A 5JD6A 5JSQA 4KR6A 1FDOA 2IP1A 1ZUNA 3R4CA 1PEDA 4UE6A 5B4UA 4GOKA 1HDEA 3UJBA 1DBIA 1Z9BA 3IIIA 5C3UA 4P31A 2IHNA 4TXMA 4DA7A 2VDNB 2JRCA 3LV8A 4B4UA 1XMVA 4JLNA 4IKEA 1J0XO 2OXRA 4YV7A 2HHJA 4WNAA 1PWYE 2JIQA 4L0CA 4EABA 2UUCB 1J9EA 1YI0A 1A1VA 3QX7A 2V74B 2VP6A 1KDZA 5CFRA 4FFWA 2BPOA 1H2WA 3KZOA 4P58A 2GBIA 3AOEA 3DBLA 2EG9A 1XDGA 1LQTA 2X5KO 3JWIA 1TM2A 4WOCA 4MRMB 3RJ9A 3G1WA 4CG2A 1WF3A 3AHIA 5J5CA 3D8RA 1Q0QA 3NBMA 3WE7A 3P32A 3OPQA 1CUEA 5DT9A 1ZO8A 2AYZA 5EZQA 5KYYB 1QGUB 1OI4A 2QHXA 3OSUA 5FPYA 2M6RA 3R7NA 1GKKA 3UT6A 5K3AA 1W8DA 4AJLA 1RRCA 4FZ5A 3O1IC 2YWXA 4BNNA 1G21E 2FJUA 2EWWA 3JYNA 4INZA 3V7YA 2PBLA 3G79A 1I9GA 3CN7A 4CCYB 1NVVR 4FLFA 3E8MA 2Y68A 1WD5A 3AV3A 2Y9ZA 3GCGA 4N0PA 4XGKA 3IPXA 2QM3A 2B5OA 4KLRA 3U9LA 3NDPA 2AN1A 1PWZA 3HCDA 3E7FA 1BS2A 4ZU6X 5CLGA 4YJ3B 3PDUA 2HLDD 2IA5A 4KREA 5CFZA 3EXG1 2BEWA 3LHSA 5H16A 1U8YA 4HEA6 4DMCA 8ATCA 2WTBA 1ZIOA 3N8GA 4KFCA 3GUHA 1MDFA 1ZD8A 1M66A 1ULBA 1JF8A 2EQ5A 5TGZA 1T5OA 4HJXA 3LCVB 4JV5B 2BUBA 4FEGA 2AMYA 4UUMA 3KSZO 4RKRA 4ZJYA 5CLFA 4L4ZA 2FEWB 3V1YA 4JENA 5KJ6A 1PP4A 1DC5A 1I01A 2ZKLA 2VZEA 3HJBA 3M2PA 3DVQX 4LJYA 2HI0A 4R40A 3SQXA 5ITZB 3Q15C 5HCNA 1HL3A 3KAKA 3TTWA 4IGKA 5DTJA 4JQYA 3FTFA 4BECA 1RC1A 3LJKA 3M2TA 4GBED 2CK3D 2NACA 1R0SA 3GT7A 4JL6A 1JXMA 3FCUB 1AD2A 2LCFA 1AUPA 4DR1B 1QO0A 3KB8A 4N03A 1E9RA 2JIZA 3FLMA 5FR2A 3QSYA 4EVSA 2BFEB 1ESZA 2D5AA 2GK7A 4HFMA 2JH9A 4MV4A 4XGQA 5IBQA 3GI1A 1C5KA 4ALNA 3EOAI 1WETA 4BS9A 4DV6B 5J2TB 2RHWA 4XVCA 1XALA 2YHUA 3JQGA 1F8YA 1KK1A 2BGUA 1T8SA 1M54A 2OCDA 1UWLA 3BC1A 3K7EA 3D6NB 1BDJA 4AVYA 3K94A 1KY5A 4L4YA 4ZYWA 1YTLA 1M1YB 5I9TA 1GSHA 2IY7A 3BWVA 2Q2OA 3CWCA 3NX4A 2XQFA 4FYIA 2A9PA 4OM7A 3RWOA 4CMEC 4ZCQA 4PYLA 4XFDA 2MSKA 4JI6B 2C8VA 1MAUA 3H5TA 5EYPB 5H0IA 4D9KA 5IU6A 2FP4A 4OFXA 1IQRA 1SVNA 4IEIA 4RANA 4ENRA 1SCUB 3G2JA 1FUYB 3L6DA 2C29D 1LF0A 1YR7A 2BI8A 4Q1EA 2JBAB 1FFYA 4RIEA 3RAJA 3VPHA 2YINC 1YRHA 2FR0A 4M8KA 3LA8A 2VSFA 4YT4A 1FCJA 2QZPA 2BIFA 2P9GA 2ZSDA 4FDAA 4DR3B 1WHTB 3UKJA 4L16A 1AX9A 3G9QA 5HQJA 4J0IA 5COBA 1XK7A 3OWXA 3KKPA 2FXVA 2GCGA 1CJBA 4LK3A 2HWYA 4B34A 4MXDA 1B41A 2IEZA 4R05A 1Z5GA 4H7KA 5FR1A 1DXHA 1TYEB 5CCBA 1Z0DA 2F1KA 2QA5A 4C0WA 1GUBA 4EUNA 4L5AA 3NASA 4Q48A 2BHSA 3O8OA 1UM8A 1QIGA 1JB1A 2YZ2A 3QXSA 4RORA 1FUEA 3HKDA 4U5QA 2H5LA 3A8TA 2E6KA 2HBRA 4M1MA 2VSNA 3RJ5A 3C1TA 4JLJA 4RHEA 5I4BA 2V96A 1PF7E 3IALA 2B9VA 1MV8A 5FPPA 2HHLA 3CVUA 5J5VA 1QIKA 3WKCA 3ZZTA 1C8KA 1NBAA 2XMZA 2OO5A 3ENWA 3GEPA 1RAHA 2QVGA 1Y4DE 4DWWA 1IB0A 1N5OX 2FV8A 4UVHA 1ETHA 1YAHA 4YJHB 4BMOB 1LS6A 3FLAA 2Q6LA 4Z0TA 3S7TA 2R7KA 1JGTA 1P9RA 1A4IA 1T8PA 3SX2A 5IM4A 1C1DA 3ZJ5A 3ROQA 3L7LA 4J90A 1NR5A 2XE8A 3L0SA 2DHDA 4BCDA 4R1NA 2JJMA 4ESVA 5K0FA 1N6HA 2B36A 2X22A 2BFWA 5CFPA 2PUGA 1AC5A 1QHXA 5C81A 3N7TA 4WERA 3FFXA 4WNIA 1BMDA 4KN9S 2VNSA 2BM1A 2EYUA 1NASA 2FF5A 2RGWA 2WJHA 2DH5A 3NFYA 3KSMA 2GDJA 4MGHA 1RLOA 3TTUA 4I1VA 1B3RA 3FHCB 2B1IA 3OD5A 3UHPA 5G0SA 3ZDAA 2WA2A 1G38A 1BTOA 4DT1B 4XRGA 3K9WA 1NPYA 2X0EA 2GD0A 2QIOA 3U0VA 1V47A 2FYTA 2IF0A 1UMCA 1UBKS 1N5DA 2WHPA 3N2ZB 5AOCA 3TQRA 4LQLA 3ADOA 1E2IA 1OCEA 5DBOA 2A0WA 6ABPA 3ILVA 4K2HA 1W48A 2GHRA 2NOAA 2VJCA 4D99A 4YCDA 2X9GA 3FUXA 1RKBA 1A5AB 1XJWA 2JEYA 2R8OA 3GFBA 4HH1A 4ZPJA 5FBVB 4K6GA 4MMYB 1QIEA 2P7IA 1KEVA 1MB4A 4PAWA 3ZC3A 1ZBQA 1PS9A 2E82A 4MKZA 4YT8A 2ODEA 4RF3A 2HBQA 1YU9A 2OZVA 5HRAA 4XTCS 3G5LA 5KOHB 1XCBA 4F8JA 1JKJA 5DTQA 3INNA 2GRUA 2H1VA 2MIIA 5G1PA 3CHYA 3GLTA 3JATA 4B4DA 2PT6A 4DC0A 4IF4A 3QMVA 4OQPA 2WU3A 3FZEA 1JA0A 2FFQA 2UVPB 3CF6R 3PYLA 4W7IA 1JQ3A 2Y0BA 3EMKA 3FYHA 2VF5X 1KZ4A 1E7WA 2FUG6 2Q99A 3TN7A 3PVSA 2V9CA 2DPGA 1F6BA 3R7WA 4BV9A 3E7DA 4C7JA 1D0VA 1Q1BA 3W3AA 2GPSA 2YJ4A 4QQRA 4XYLA 3PZRA 3BRCA 1RYHA 4MH0R 1M1UA 5B3AA 2BN4A 3QEMB 1SC4A 3H1BA 3R20A 3BF7A 4I50B 4ZVLA 3VNQA 3WRXA 4J43A 2JLXA 3EFHA 3VR4A 1FP4B 3LP6A 1UKBA 3P4YA 3UXYA 1T36B 3K6SA 1JR3D 4LJKA 3JAWA 3G2IA 1RI4A 2JIBA 4GLBA 4XZ3A 3V7UA 4OXQA 4E5KA 4EIWA 2BTEA 1ZIDA 1FDVA 3GX1A 3ET5A 1NW8A 3MVEA 4M1WA 5BN5B 4C5BA 5BN4A 1YAJA 4EDHA 4MQMA 3EEOA 4KQXA 1TTHA 1E89A 1VG8A 2FH5B 2YW9A 4URWR 3FMIA 1PEYA 1ZGZA 2Z3ZA 2BEJA 1P5FA 2JGRA 3GD5A 3KTOA 4MJXA 4MPJA 4BO6A 3ZDYB 4BMYA 1IBLB 2WKQA 3UATA 1QWSA 1A69A 1CE8B 2B4AA 3F6EX 3L1JA 3VDXA 2D8MA 2EKDA 4JKOA 2EDCA 2HWXA 4P86A 2XZTA 2VNJA 4MS4A 2REBA 2IH4A 3FI9A 1G5IA 4AG5A 1NC1A 3J81A 2XEDA 3BRWA 5KB3A 3CNQS 3W3ZB 1X1AA 1NXXA 2OD7A 3JR3A 1Q57A 2CLLB 2GFIA 3DDSA 1JT2A 3IE0A 3GJ6A 3K15A 2VP9A 5C80A 4F91B 3ANLA 1SXIA 2CJWB 3PC4A 4HK4A 4F4HA 1IBCA 1XDWA 4PTZA 1X1BA 1MZPA 3Q2IA 1OHHD 1P5RA 1TIKA 3SJZA 1J5XA 3HZZA 2GA9A 2VP0A 4DJTA 2VVTA 2H85A 4FKZA 5J1SB 4LHXA 1M34B 3KCNA 3DPUA 2I78A 4PGHA 4G1BA 4D0NA 3KQVA 1FDIA 2OECA 3GVPA 2MSWA 3HY3A 2TYSB 1DFIA 2GXQA 1TAHA 4MLCA 5AHKA 3K9FC 3IR6A 2ANCA 3RI3A 5BWCA 2NSDA 3AK4A 2K87A 3A9RA 5LZ5A 1WULS 1T0PA 4PRYA 2QVXX 1KORA 1XRJA 4KPYA 4YCJA 1Z0FA 3KQWA 4DMMA 3AESB 1OX4A 3F6CA 3PJFA 2O3JA 1OREA 1G6KA 1P4HA 3M0EA 4PZZA 4Q7KA 2D1RA 2UUPA 2VTKA 4BO7A 2AWNA 4QATA 1I1HA 1WSBA 1GPMA 1LBSA 2R1VB 4EG6A 3OM8A 4O4IF 3AVUA 2C58A 4Y1FA 1Y5LA 3QEJA 3WJ7A 3ZOZA 2CCJA 3KKQA 3V1MA 2IZ5A 5KOJA 2RHBA 4CMHA 5EVCA 1PTJA 3LPDA 4YACA 1CR2A 3UMRA 1E1KA 8GPBA 4K87A 3A1FA 3F9CA 2PX0A 3CX7A 1WBBA 1NZJA 5B57C 3FFAA 2BV3A 1EZ4A 3QXJA 4NYMQ 2AD5A 2PFKA 2BDTA 3MGKA 4MKHA 2IC5A 4O0MA 4BVEA 3IBYA 4ZQBA 4XDGA 3IMKA 3QE0A 2MSDB 4IDDA 4K6HA 2H1CA 4TV9F 1W581 2HWUA 5FA8A 3RRMA 3NW9A 2ICAA 1TM4E 4NBLA 2I76A 3PDCA 3ZWBA 3E7PA 3GJ3A 3PE4A 4TRRA 2FEOA 1ABEA 3H4VA 1RAAA 4MWBA 4WNCA 4HB4A 3SHOA 3M83A 3HXOA 3CVWA 2P30A 4WVLA 3TTYA 4JELA 1N5JA 4QELA 2G7ZA 2H9AA 3HLYA 1KJZA 1GYRA 1NBIA 3IEPA 2RH9B 1YIOA 1H93A 1SB8A 3COYA 4M7WA 5LM3A 3BZWA 4EO4A 3IIMA 3M1LA 3ZGOA 3WTBA 4AO8A 1BJKA 5GZ1A 2Q2QA 4J91A 1JIKA 3O73A 1OC2A 1P3Y1 2ECQA 2Y0EA 4R1SA 1XMPA 2EKBA 2A9VA 3KLPX 3L07A 3NATA 4X84A 2WF8A 4CKYA 2JJ8A 4D3SA 3HBJA 1UBSB 4XJVA 1YCGA 4B7CA 4QUJA 4F71A 3TF5A 4Y2XA 2PBFA 1M6VA 4V1CB 4Z99A 4GI3A 1R37A 3U5ZB 2YY5A 1GLVA 3P4UA 1XMOB 4M9QA 4TQUS 2Z5LA 2QMYA 4LGCA 5A4DA 4W5HA 2JCVA 4OD0A 1A9SA 5I8PA 3M81A 4B4VA 1R1DA 3AQIA 3ZD9A 4BVLA 3IOCA 2BGMA 1H05A 1DBRA 2P9JA 3R7AA 4E2ZA 3H8SA 4G37A 1PDVA 3NDRA 3D3WA 1B42A 1CVLA 4OFZA 4ZOEA 5AW1A 4D02A 1Y7PA 3EGWA 3ME5A 2EJBA 5FA5A 2XVYA 4CLXA 1A96A 2FWNA 1MTOA 3UMGA 4PYNA 4O08A 3FW1A 1LSOA 1L8QA 1V26A 1THMA 5KU7A 3SC6A 2I5PO 1TYAE 1B2RA 3GBPA 4O2AB 5J5AA 5JSUA 3TECE 5HIMA 1WMAA 3VAYA 2PD4A 4IOJA 1XAGA 1ZJ6A 3O8QA 3R74A 1Z8FA 3AF3A 4RCZA 4U9IS 3G9ZA 4A6EA 2BZGA 2E37A 3ZK8A 5LCXA 2BH9A 5ICMA 3R8CA 4BZPA 3QEOA 4RF4A 5CDSA 2W8BA 3EQ9A 4N48A 2H06A 3BHMA 2AQ8A 4A0HA 4JP8A 1PFGA 1Q44A 1QCYA 1ZPDA 2YJ3A 2XCUA 4HY3A 2ZCUA 4YCCA 4ZYTA 4XFKA 2ZDQA 2CXOA 2OWEA 4UBOA 2C2MA 4QSHA 3TZHA 2AG0A 4I2VA 3MMPA 4I2NA 1H4VB 2QVCA 2ORWA 1YL6A 2O5CA 5BT8A 2ODPA 4HATA 2PN1A 4RJJA 3UGKA 4DNOA 3QHQA 2OCLA 4F97A 1B0AA 3JD2A 4E88A 5AM3A 4X95A 2O6HA 3BWMA 4KKXB 2I99A 1F38A 1QGOA 4G81A 1V9CA 2X9QA 4DLAA 3PF8A 3QFTA 5LD2C 2QKYA 2ONKA 3R7BA 2H1IA 1PT6A 2Q7XA 3WAKA 3GRKA 4HP8A 1UJBA 1O2DA 2B92A 2H8KA 3N5CA 4MUXA 1VJ0A 3OQBA 3R0XA 2V7XA 5H59A 5HBRA 3KS9A 4QPPA 2W8ZA 2GSDA 2IIVA 4BMSA 2ZRMA 2FKAA 4PIMA 3X2FA 4LI3X 4BN5A 4PCUA 6CHYA 5BR8B 1W5AA 4RGYA 4XWWA 3DBRA 4IWNA 4LXHA 4AFNA 3WAGA 4MYHA 2P4UA 4YNBA 1Z8DA 4Q4DA 1Z0SA 1REQA 1JBQA 2KW5A 4ESHA 2V8BA 1E6MA 3AZPA 5A0FA 4ZMRA 3SI7A 4Y0AA 1EA5A 1RI5A 2HSDA 4FFSA 4YMTA 3EH1A 4YV1A 2AJ8A 2PWAA 4A0RA 4GU5A 4UAVA 1Z22A 2E1RA 1WW8A 2H17A 1WB4A 3NAZA 1SAYA 1PUXA 3QBDA 4GHWA 4LRYA 5T41A 1Z7EA 4W1SA 5I5GA 3RPEA 4BMZA 1AUXA 1E5LA 1UM9B 1RACA 1DAPA 1TEZA 4RTQA 3DAFA 1O94A 1SIBE 3EEIA 4H0FA 1U2QA 4U7TB 4XWGA 3JQ8B 4OJYA 1XZBA 3HKEA 1JR2A 1EHYA 3IUEA 1ZDMA 1NR1A 3S70A 3USCS 2ZPUA 3BXHA 3MB8A 1GTMA 3SSNA 3UXEA 4ZXFA 1U7OA 4QEKA 1O54A 2ZE5A 3GDGA 2FSVA 3N1UA 4C3ZA 3HJNA 1X7XA 2GKSA 2R60A 4QQKA 4V2IA 3W5DA 1Z45A 1KKLA 2VF2A 3E7WA 4YUAA 3I04M 3NHAA 1V1JA 4OHUA 1QP0A 1J8DA 5F4BA 4QTYA 2OORC 1E4YA 2PRSA 3T5AA 3MTBA 1YL5A 4MGZR 3OFNA 1J2TA 1HRKA 5DMHA 3VU1A 4B3RB 1SHTX 3DOOA 3RK1A 3IPYA 4JB0A 1NOIA 3DL4A 3HDYA 1FQKA 1RLUA 2QNIA 3VKVA 4HX2A 2PKQO 3TDMA 1NJ8A 4RA9B 1QO0D 4O4JB 1Y6ZA 1PLLA 1XTIA 3PNPA 3LIPA 5FEMA 3C43A 3AEKB 3CPSA 2ID4A 5IJ9B 1T2CA 3VM6A 5KTPA 4N0MA 2O14A 4B45A 3NHUA 4AAYA 5EHGA 4EA8A 5CHEA 1ZM3A 4H7JA 1SBCA 4BB6A 1WMDA 3A25A 2J5XA 1KERA 3GFGA 4NR0A 5EIEA 2XA9A 5ED0A 1L8AA 2P0YA 5J4YA 1FJHA 4OGGA 5LQCA 4TX1A 1RPJA 3ONEA 2WV9A 1SK9A 4GSKA 5SY9A 4IGFA 4X97A 4ECEA 2AQHA 3UFBA 1O77A 3NDJA 1OPRA 1HWYA 1J22A 1DV1A 1ZCBA 4WK6A 5CYPA 1EP2B 5DFAA 4ISCA 1AG9A 3JWPA 1H42A 4KDRA 3C7DB 1KK0A 2AI2A 3MJRA 3O26A 4M49A 1NI3A 3DO5A 3QVXA 1OUMA 3R9KA 4BNHA 1FTGA 2R25B 1ZVJA 1F4LA 4KMRA 4QE3A 2XBLA 3FB4A 1R6AA 2YMPA 4DG8A 1A72A 3SM9A 1AXRA 1OVGA 1T9ZA 4RAOA 3T8YA 1DWOA 2VL7A 3PIDA 3NWPA 4R0VA 5U4XA 5EEHA 4ZKDA 1YUBA 5IH7A 5MN5A 1OILA 1EPUA 2N3ZA 3EFBA 1R3DA 3HCFA 3RD5A 4F3YA 5K0BA 1TA0A 4F2PA 1NNSA 4PG8A 2WJ3A 2WA1A 3BDIA 4C7XA 2Q5JA 4GOJA 1RD4A 2H0RA 3UTDA 3JD3A 2OO7A 3DFMA 1B8NA 4KHZA 2WMOB 1BD3A 1EYZA 5IJWA 4HL6A 1L4MA 1WZIA 1MB0A 2DKNA 5FWXB 2VDJA 1JHQA 1KI4A 3LLCA 4ZC8A 1AKRA 3R5HA 2Z3VA 1FVHA 5J47A 2WAMA 3LXMA 2V3VA 3NPMA 5BSHA 4PRZA 3AKZA 2QZ9A 2FWIA 3D4PA 1OFTA 3R3VA 1IWOA 1ZKDA 3KSUA 3IO5A 1XQ1A 2XECA 2RBKA 4A03A 1UIMA 5JSZA 3MJDA 3U7QB 4YRJA 4JROA 1WCIB 2DKFA 1BO6A 2DKOA 2WTEA 4YR7A 5HOQA 2GEJA 4Q3KA 3TFOA 4F3KA 2ZIFA 1XTPA 3DVAA 4R68A 4XLTA 4ZRNA 5ARCA 4JBYA 1PGPA 1X1RA 2H5EA 3LY5A 5AK3A 4TQ9A 5KMGA 2CWDA 3U7RA 2ZK7A 4EB3A 2DBQA 3D81A 3INYA 1OLUB 3OZUA 5FHQA 1GT91 3DEIA 4UDYX 3FBGA 1ETUA 4BGEA 2UVDA 3QOWA 3KKOA 4UCXA 4AB1A 4MP3A 2R8PA 3HQ4O 3MMXA 3QA3E 1B15A 4L6IA 4I1PA 2ORIA 1AHIA 4FFBB 3TWOA 4Z9AA 1TCCA 4ZAZA 2BOVA 4D26A 4MA4A 5J2UF 2OP1A 5ALMA 4PRLA 4YJ2A 5C32A 3MRVA 4NAUA 5AXCA 5AVXA 2H0AA 1I1NA 2ZTVA 5EXSA 2D1QA 1ZK0A 3GFQA 1KQNA 3B5EA 4NJMA 5AUNB 5TR9A 2XE6A 4I5IA 4X54A 4KQIA 5B58C 4AIRA 3K70C 1NVXQ 1EHIA 1QK3A 1YE8A 4IDNA 1JLSA 4AS3A 1HKUA 4P7FA 4PHTA 3L7CA 4UU8A 1GLNA 1VRCA 4K9PA 1H1LB 2R2AA 3MCWA 3OOEA 4KV7A 2I1WA 2QTNA 2XVXA 1V45E 3KOOA 4C03A 5J4HA 5JW6A 2Z0MA 1SHUX 2OO3A 5DEIA 4E1BA 1MVOA 3ANXA 3NIWA 4OI1A 2OLJA 1A8PA 3IC5A 4OQLA 2C7PA 5AVOA 5I3ZA 4XIIA 1GDHA 4TTPA 4I3HA 4ARZA 2C9YA 3EXHB 4JYBA 4PM4A 1T5HX 4ZVQA 3PNKA 1X38A 4K9DA 2JARA 4PLHA 4DKJA 5F3DA 4LWZA 2ENWA 3TBKA 3VZQA 4OJQA 2FRDC 3RNLA 1HZZA 1TM7E 3CG0A 3AZOA 4I55A 3VO8A 2CVOA 3PHIA 5K6TA 5BSUA 4UZFA 3H2BA 1WXXA 2Z95A 4TM8A 4Q05A 2J5BA 2BZ0A 2C3UA 2O1WA 2FF7A 2J9FB 2X0RA 4PE5B 3NHJA 1X39A 2LV8A 4YK7A 4LBYA 5FFFA 1NLZA 4RK1A 1SUSA 3OIDA 5JAHA 2NTYC 4E5UA 3Q3HA 3GJ4A 5G53C 3A7EA 3AFHA 5F1OA 3GG2A 4IJVA 1HDCA 2ECFA 3CY6A 3DJFA 4TQGA 2R6JA 1S2LA 4QM6A 1P44A 2ZCJA 1T5SA 3KR1A 2I2FA 5AHWA 3PI6A 3TQIA 1JQDA 4ARUA 1RC8A 3Q41A 5JCOA 4OUDB 3E82A 5ALSA 3WX0A 1I30A 3ELYA 4M55A 1U04A 4ER7A 4OREX 4RKYA 1CFZA 1JKXA 3RHFA 4BATA 3K8OE 3ABQB 2IYAA 2W2OA 3CCFA 3NGLA 3O75A 3QQ5A 4I5DA 2VT3A 2WFAA 3COZA 5B2FA 1ZR4A 1PE0A 5JI2E 1JTEA 1CF9A 1W5TA 4WZBB 3TSYA 1MD9A 4QC2A 3DZHA 2IOFA 1MR3F 3LBHA 4ZMSA 5E6RA 5AJWA 4KC0A 1SU4A 3MMSA 4QUAA 1C80A 2V5AA 5KTYA 5B7NA 2Z1NA 5DB4A 1JX6A 3QKIA 5EE0A 3LT0A 3TL3A 3N58A 1SKQA 3OSZA 5IASA 2XXAA 3DMGA 1IY9A 3FVTA 2ZTHA 1GZUA 3BMQB 4TKLA 1ZNQO 3VAAA 2P3OA 4UTZA 3PHCA 3PXGA 2WKSA 1DLIA 1UAAA 1KK2A 4GEGA 4GBJA 2A30A 3KEGA 2TMYA 5EJGA 1K9VF 2ZVPX 3T7KA 4NXNB 4K40A 5MGBA 3LH5A 3DTVD 5K45A 5EZ6B 5TNXA 3F6RA 2ONCA 1BKDR 4RESA 1PJSA 1UDAA 2IXBA 5LU8A 3LVBA 4KAAA 1XZFA 4UVDA 2D13A 1XVAA 2WRZA 3DUWA 3O3MB 2B6HA 2MR5A 3JZFA 4DCJA 2C3PA 4LBWA 1TM5E 4QUHA 4AJPA 1HFJA 1TZMA 1NNUA 3HJCA 1ISHA 1D4AA 3NIDB 7YASA 1YOVB 2XCOA 5EI5A 4Y1GA 2PLAA 4UAGA 2ZRBA 2WNSA 1RXCA 2F3PA 1V8OA 3L7NA 3OOHA 2QX4A 5AJHA 3GRFA 4B4WA 1MBZA 1Q84A 2JFGA 4YMIA 1X74A 3E3NA 5EN4A 3SYNA 5LL6P 5HTOA 3COJA 1F9EA 3QKWA 1ZXLA 3VTKA 3H9BA 3O2QB 2GYWA 4YAJA 1B26A 3MIZA 4JLBA 1JDBB 2A5LA 1I3NA 1GRRA 1YB6A 4MQEB 3QX3A 3EDMA 5JVDA 4LJ4A 5EWLB 1ONPA 2GLUA 2VPPA 3E84A 3C3DA 4IUYA 4KVFA 3T4XA 4CL2A 2V45A 3UMMA 1FA9A 3M4JA 2JNWA 1C0PA 2CXSA 3FXAA 3D6UA 4LQDA 3CF4A 3DAYA 3FNRA 1DQZA 4ALKA 3FJOA 2D06A 4D41A 5JDIC 3AWIA 3W4IA 1RJWA 2RGAA 3VYTB 3MAGA 1XP8A 3MJVA 4H7IA 3ZX4A 1ZD3A 2JH8A 3G8CA 5LYJF 3L8GA 2OVFA 2M1XA 3WK7A 3VKHA 1U0GA 4PR3A 4RBNA 5K3OA 3ZWPA 1H6AA 2JEOA 3TVTA 3D6JA 1A5SB 1AK9A 5IZ4A 1HX7A 4ZRDA 1XU7A 1Q14A 2G5CA 2X8JA 1SVSA 3H1FA 2EKQA 3MG9A 5D7BA 3EJWA 1XHLA 1JKMA 3DE3X 3R40A 4FFLA 4UU0A 5FJJA 1CK4A 5CD9A 3W1WA 5CG1A 3QKTA 2X5NA 4QXAA 5HFAA 2PO7A 5NLLA 3UCFA 4FE4A 3RFXA 5A1JA 5FH9A 1DC8A 4DSTA 1LJLA 2AVDA 2VSYA 5CT9A 4NOJA 3G9TA 4QTZA 3RTDA 4M88A 2ZZKA 3L8YA 3V9AA 5HK8A 3T7AA 2DWUA 5F23A 1YVRA 2HCFA 1Y9ZA 4W1RA 5EPOA 2I6FA 1JWBB 2Y9PB 4CWAA 5DW3A 4BNVA 4F5DA 3HHPA 1N9KA 4TL8A 1NIPA 4RW0A 3TX2A 1RYZA 3LCRA 1LDEA 3LL4A 1BRMA 2PM8A 4LYDA 3HYNA 3LA6A 3GVHA 4B6OA 2F9MA 2P40A 4Q7EA 3L84A 5KTOA 1PUJA 4CMIB 1X42A 2V6JA 3CISA 4BNGA 2BFPA 3DLCA 1U3VA 4KIFA 1M7HA 2NNWB 4MAMA 2O7VA 1L4NA 4A16A 3PUVA 5M2QA 1Y3BE 3E9DA 4MP8A 1DXYA 1XDUA 1Z4OA 3KWLA 2J32A 1SCIA 3PYXA 5IP5A 3SZGA 1ZSVA 2RB5A 4GMHA 3H5IA 2AE1A 4PG5A 4B84A 3V80A 4S3MA 2HYIC 5ALRA 1EWTA 4HUQA 2HZBA 2RH5A 4OIFA 1NSFA 1XD9A 4IOKA 1DHTA 2V98A 2ZATA 1U1GA 5KTKA 2QN9A 3OIUA 1LNZA 4J0EA 3BVPA 1DO0A 1ZP6A 3I9MA 5TIIA 2HHAA 3L9XA 3F8WA 3Q8XB 3FSGD 4RCYA 3C85A 4EB6A 2SBTA 5C8ZA 2PX3A 3V1LA 1MENA 2GARA 2WZBA 2XUKA 3FF1A 3NJ8A 3WGUA 3IELA 2Y8EA 5TQVA 1XL1A 5EE3A 1Z5OA 2C88A 4LN1A 4E5SA 1Y37A 1HEYA 3QKSA 1EGHA 2ZRNA 3TJRA 4DIMA 4YCLA 2RGBA 3IMCA 4CKWA 5FHRA 3OCXA 1JLRA 4P3KA 5EP2A 5HJEA 3GLIE 4YC7A 3U1TA 1ZM4A 3R3JA 2AK3A 4WW0A 2GEFA 3KU4A 2I2AA 3C8ZA 5ER6A 5B64A 1R10A 5CTJA 3QY9A 3RSHA 3REGA 1XTJA 3OAAA 4LMPA 2YNMC 4YIKA 3ACDA 4H4DA 1FOEB 1GWNA 2PGLA 4X20B 1EJ6A 4FEEA 3LDGA 4ZKEA 2IV7A 2GZDA 2G5GX 1GFWA 3G7UA 4UAJA 4FZRA 4MICA 5FTMA 3SBOA 4EH1A 4AU1A 3N3BC 4YMUA 1ZHHA 2WEKA 1BQ4A 5AKLA 3JASB 2RG7A 4R1TA 5KTNA 3EXFB 1AGPA 1NATA 1H94A 2K2WA 4FT2A 5AI9A 2OZEA 3P9NA 4NQZA 4O63O 1UP7A 1V2HE 1HOTA 3TIIA 3GLFB 3KJHA 4XGIA 4QLOA 3PNVA 3QVGB 2GAJA 2OOKA 1S8OA 4MW1A 4MLZA 1U8CB 3QWIA 5ALXA 4LJSA 3FUTA 4F1JA 1U7UA 2UYCA 2J5QA 2P91A 2XWBF 4J0JA 4Q39A 5C4MA 3KK0A 4RY2A 3I1YA 1P7YA 3LKBA 2PG3A 4Y7CA 3UGTA 4BNKA 4TV9B 3K2IA 3RS0A 3PICA 3V2HA 4BQIA 2GYYA 2H51A 2F8LA 4JQCA 4D74A 1VM6A 2XGGA 1LJ8A 1N3BA 3H6HA 4CKXA 4CKEA 3GW8A 4F2HA 2ZRQA 2C2BA 4ME6A 4E2WA 5BXQC 5BWOA 1U1EA 2QGZA 3BCHA 1APBA 1DPFA 1AZSC 3Q6NA 3P27A 3UK0A 3ER6A 2BR3A 1U7DA 2WAYA 5EHQA 2H1OA 3C1AA 4CDMA 4FM9A 1RM5A 3WNQA 5GY7A 3LO8A 3RTBA 2JCXA 4G8CA 4P5PA 2X58A 3IMGA 3OHMA 2PTGA 3Q98A 4ETWA 2R1ZA 2W48A 4P5DA 5BPFA 3I76A 1Y8QB 4NATA 4RTMA 1MEOA 1P7CA 2DB3A 4U39A 3K5IA 3LLUA 4L28A 3EEFA 1WSDA 3B8HA 1FEZA 1F14A 3TOSA 2G67A 3QTBA 1MORA 4NJEB 4E5VA 1U9IC 3L02A 1AN0A 1C3VA 2WF9A 1MJNA 1W47A 4R2LA 2WW8A 5DCWA 1GU7A 4W9NC 5BWMA 2EBHX 1ODCA 6PFKA 5KIAA 1HDGO 1WMSA 4XYEA 4QQNA 3ZKWB 1ODLA 1TVEA 4JJIA 2RONA 2HF9A 3JD0A 3OCUA 1G8SA 3SIXA 5A4IS 3A2KA 1KZ1A 4RMNA 4G4SP 4X8LA 1IEWA 4RKFA 4LW8A 4F4JA 1GTSA 1X1EA 1KQFA 4NOKA 5TF4A 1XHFA 2NUAB 1MABB 1J2JA 3TX6A 3KQUA 4ILKA 4BGDA 3OI7A 4DY4A 1G60A 2W37A 1I4LD 2B1RA 3B2NA 4TMWA 1DIGA 4FYKA 3OZSA 4TLDA 1G2OA 2NVWA 3IX7A 4LHSA 1U7WA 4UBLA 1PJ8A 1A97A 4DJFC 4DZTA 4LXUA 2EV9A 1EWYA 3D8SA 3ETEA 3EULA 4G07A 2WM9B 4IVPA 4Z1MD 1NW9B 3PKJA 4EECA 1JXQA 1MX5A 5EKSA 4DR4B 2QMQA 1SUWA 1QC5B 3KZXA 3T3DA 3CA8A 4AL4A 1X3LA 4EJSC 2GTIA 2BC9A 3LU1A 1UBGA 4J0GA 4ZVUA 3UZUA 3IAFA 4II7A 4D9HA 3CEJA 5FOWA 5DI3A 1S4MA 4ZTZB 5CVVA 4HQFA 1MF7A 3IP6A 1XTBA 4TV8A 5A5EA 1SXGA 1CEEA 5EIHA 1ZIXA 2FW0A 1WVIA 4M38A 3KJQA 2H52A 3IDSA 3IAEA 3KJEA 2OGSA 4RXUA 4B2LA 1NDQA 3F6SA 1JYFA 1FFCA 4YTEA 3RVNA 3WK5A 3H1TA 2YCLA 3RYIB 3QFFA 4DR7B 3WJ2A 4QRIA 5JNLA 2QYOA 4DCCA 2RGDA 1XZEA 2JLZA 1M8GA 1XAIA 4Q7MB 3B38A 4UHHA 3T5PA 4BV3A 5C52B 2Z6AA 3EZ9A 4P3XA 1FL9A 1SXJE 1P18A 2CDAA 3AYXB 5SYAA 3GGJA 3WIVA 5CB4F 3MELA 3P52A 2WF7A 3CUSA 5B2EA 3B12A 5F1PA 2TS1A 2GBLC 5DXAA 5G40A 4RDHA 3HSKA 2F3TA 1C2TA 1DIOB 1X7WA 2PS3A 3A3PA 3LBFA 1Z2DA 3DE6X 3MT9A 2I4OA 4IJMA 4LGYA 4WLUA 5WRFA 4GNKA 4D80A 2NU7B 1RI3A 3D0RA 5DGCA 3AQ4A 4D3DA 1D7AA 4DG5A 4FW9A 4JYCA 3LI2A 4DFDA 2X19A 1N9GA 3UAOA 4P1ZA 4JCCA 3GQBB 2FW7A 1II8A 2RGNC 4C7BA 2O2DA 2V54A 3PR1A 4CEJA 3AEXA 2YOHA 2HREA 5B3KA 1RRMA 2CUKA 4HEQA 1T4GA 4LXGA 3UWOA 2UYHA 1BWQA 4FSHA 2NTNA 1Z37A 3Q3GE 4BPBA 3IILA 4TT3D 5GPBA 3V7WA 4O33A 3GV0A 2WP8J 3RRBA 1U3CA 4EYQA 1QMPA 3M5CA 2L19A 1W0KA 2V97A 1XKLA 3M5WA 3C14C 4X8OA 1T1IA 1ZI6A 5IN5A 1NAHA 2IIPA 3TQOA 1EWVA 3L0DA 3T35A 4MITA 3AJAA 4ZZ2A 1O6BA 1XI2A 3TLEA 2VK4A 5EZYF 3S68A 6YASA 4CEIB 4KQFA 4V02A 4CF4A 3S2GA 4H0CA 5IJ0B 1RQ7A 3U3MA 1VPDA 1DUVG 2QP9X 2ZKIA 4A8PA 1O95A 3LGXA 2PJZA 1K7EB 3AP3A 4K5QA 1MHTA 4IX9A 3K72B 5BV8A 3THXB 2NO7A 3N2GB 1L5HA 3ZHXA 4UOQA 4BNDB 1UEXC 1DU4A 1W0JD 1Z6QA 4MWSA 4DCVA 2L82A 5EMMA 4CM4B 3JSXA 3LW8A 1P17A 5LZ2A 4Q5IA 2H1FA 4PBSA 1U5BB 2G09A 2VCYA 3N8HA 1XYVA 4RK7A 4N12A 1E5TA 2E4YA 4RZQA 2A1TR 3REOA 5COAA 3W8EA 3ZZ0A 1CG6A 2HPVA 1SUFA 1TJ4A 4J1NA 4OAPA 3WB9A 3LD9A 4IUBS 3RUFA 1GUDA 1KL7A 1PV1A 1GADO 3C16C 1N2BA 5EAIA 1WUHS 4B6QA 2QJTA 3PFHA 3KKNA 5CM9C 3H16A 4TVKA 3FNEA 2RAUA 1YK1A 3OA0A 4WDQA 3BGIA 4DR5B 4LKRA 1UOQA 2SCUB 2YHIB 3VU0A 5BYKA 1EVKA 1L3BA 1GZHB 1YZTA 3TRIA 3WLEA 3ODGA 3LMKA 2DTXA 4L9SA 1O97C 3TZLA 2I6TA 1D04A 2YRFA 4EUKA 4NWIA 3E27A 2VXOA 5FUBA 4JH0A 4C1BA 4J1QA 3G59A 3KSBC 3ABRB 1GHTA 4X8HA 5K0LA 1B6TA 2GHQA 4Q4LA 4L8YA 4P53A 3WFJA 4HX9A 3A4NA 4H1HA 3RU9A 3I6QA 5FTNA 4XE5A 4FDUA 1MTZA 2XUQA 1BU8A 3ZWWA 4XQCA 4D9IA 1IAQA 3DUFB 3OLCX 1AXGA 1ZJJA 1ST3A 1VLJA 4YREA 1ZJYA 5IYZF 1WUYA 1QV6A 5JDCA 1Q1QA 5CNMA 3RSLA 4B47A 5CXSA 1QGUA 2FCRA 3F5DA 4EPRA 4PX9A 2ZR7A 3IYLW 1PT7A 1J4AA 1KJNA 2R9VA 4NCXA 5F52A 4E5PA 5LP6C 2QB5A 4WVFA 3OCZA 2GF2A 3H13A 3IQIX 4FOSA 3D59A 2YFYA 4COOA 5IAOA 3FIUA 1ST2A 3HWRA 4R69A 2GHIA 3H2YA 3F8TA 2A9JA 3DW3X 4MQUA 4MHSA 3OA2A 1L4KA 3QMPA 1JDUA 4YQEA 3CJQA 1E8DA 2K6GA 1ULTA 2RCNA 2VNIA 4YMSA 2X9VA 3QHPA 4PFJA 5E8JA 4HKTA 1ITZA 4NFSA 5LVAA 4YJ3A 4KBFA 3GUUA 4L02A 1QSGA 2VP2A 4BLVA 1QRDA 3V1KA 2WP0A 4HXEB 3ZGZA 2DAPA 5IWCA 5F9FA 4WFJA 1P2UA 1YZ3A 5IBRA 5CGZA 4EY3A 1FFSA 1P62B 3ECCA 3I32A 2WWXA 5F2EA 2G5TA 5D5HA 3LX8A 5FLKA 1CQPA 1IHPA 2Z9DA 3AUFA 4JI3B 1OI2A 1DX6A 1VKNA 1NDHA 4O29A 4HLDA 3VNAA 3K1AA 2C59A 2BFBB 4ZAVA 3U3KA 3GH3A 2C4UA 3Q11A 4KACA 5J2UB 3VJKA 3DEKA 1PZMA 2AZMA 2DPXA 4GEKA 4CCAA 5EL0A 3HUEA 4EYGA 4CMAA 1Z0UA 2GBCA 1C7JA 1QOQB 4KE9A 1PKXA 2MINB 3G89A 4PIVA 3UH0A 4CV2A 1XEXB 3VR6H 4XUDA 2OAQ1 1YBFA 2BFOA 1ZG3A 2BFEA 4TUYF 1TEVA 1C41A 3ADKA 3FN4A 4NYIQ 5DHUA 4CRWB 1U8XX 5KHLB 1RTKA 1XNRB 3M5PA 5HF8A 2QJOA 4NPHA 4KRGA 3LT5A 3OZBA 5MFZA 4P80A 1SXQA 1VSVA 1XELA 1RQXA 4JUIA 1NDUA 1SVLA 4NQRA 3H4TA 2WFZA 4OSOA 1QBGA 3LQYA 4P3PA 2VA9A 1CVIA 1QTRA 2XMRA 1E63A 4EJ6A 2DR0A 5A7FA 1X6VA 1F0YA 1O4VA 4Y2QA 1M1YA 1XCPA 4YRLA 3TLCA 1CY1A 1D4ZA 4C29A 1Z2EA 4EWLA 1KOLA