1M66A

Crystal structure of leishmania mexicana gpdh complexed with inhibitor 2-bromo-6-chloro-purine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase
pubmed doi rcsb
source organism Leishmania mexicana
total genus 133
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m66A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m66A01
1GADO 4DUPA 2WM3A 3B20A 4YR9A 1OOEA 4YT2A 2BGLA 3ROMA 5IDQA 3VVBA 2BFPA 5TJHA 4YJFA 3KO8A 1XG5A 1NQOA 2PNFA 2R00C 4MJLA 4B3IA 3HN2A 3L4BC 1U3UA 3C7DB 3H5NA 4NJMA 4JJIA 3LZ6A 2C2YA 2P91A 2O3RA 4INAA 4Q3EA 5I9NA 4JXKA 2G17A 4ID9A 4AJLA 3IUPA 4FD3A 2YY7A 1HL3A 4DIOA 3JQFC 1HE5A 1SAYA 4XQ9A 8LDHA 1R4MB 4PLWA 3NUGA 4D46A 2GDZA 1B3BA 1XHLA 3D4PA 3SC6A 1E3WA 2Q1UA 4ZQHA 4FN4A 1P74A 3INRA 1T4BA 2BKAA 1NPTO 2ZCVA 3WWZA 1C14A 3X2FA 1KBZA 4M8SA 1OI7A 1K3TA 3I9MA 1ADGA 1ENZA 1BVRA 1W0CA 2FR1A 3MOGA 1Q7BA 4OO3A 3FNFA 5ITWA 1EE9A 4OIMA 2O3SA 3ETDA 3VZQA 1DJNA 4E12A 2JJYA 3EY4A 3UW3A 3FTPA 4EEZA 3F4BA 4E6PA 1O9BA 4K28A 1U8FO 3CEAA 3PZBA 3TZ6A 3KSDO 3RI3A 1EBFA 2JL1A 1XGKA 3O4RA 3PEFA 1Q0LA 3ZZNA 3NGLA 4ZRMA 3ZDFA 4TRNA 3JQ6A 4YJGB 3RQSA 3VH3A 1ZMTA 3E5RA 5DN9A 5CDTA 2RAFA 3IL2A 4PG8A 3FR8A 4JP2A 4W9NC 5COAA 3ZNNA 4BKQA 4OL9A 1W73A 3KLMX 4MDHA 4Y9DA 3E9NA 2FN7A 1AHIA 1LU9A 1RYEA 3GK3A 1JAXA 4MP8A 4CLRB 3M1AA 2F1KA 2HMSA 2VT2A 1WMBA 3GPDG 1R37A 4DREA 4UVGA 1Q0QA 3HWRA 2IRWA 4R1NA 2VUSA 1AUPA 4G81A 1PSDA 1SMKA 2VYND 3KB6A 1EDOA 1P1IA 1TEHA 3LT1A 3TJRA 2PLAA 4N54A 1EEHA 3R3JA 2DBQA 1DIAA 1NQTA 3DBRB 2Q99A 4FFPA 3U3XA 4D3DA 2IODA 3PPIA 4ZU3A 4Y6SA 4YJHA 4UULA 3CTVA 2XAAA 3X2EA 3HDYA 4NU5A 1ISMA 1MG5A 5GMOA 1WAMA 2ZYAA 3I6IA 3I23A 2HCTA 1YXMA 3LYLA 3PZRA 2W2LD 3GC6A 4O63O 3PLNA 3VPXA 2AHRA 5EIOA 4U8GA 4YACA 3RBZA 1PQWA 2HMTA 4CMIB 3OA0A 2NWQA 4IMPA 1C1XB 3MWDB 4O5OA 3UICA 3IP3A 2FPGA 2I66A 2PR2A 1WDMA 3PGXA 4WUVA 1WXDA 1VKOA 3SJUA 1E7SA 3GOHA 4TSKA 1KC3A 1DEHA 3B70A 1ISIA 1DPGA 4UAGA 1PEDA 3DBLB 4BNLA 1IUKA 4I5EA 4I5GA 3OQ1A 5A9TA 3WR5A 3DZGA 3HSKA 3VKVA 2ZYGA 2P2SA 4CUJA 5A3JA 5JO0A 1OMOA 1W6UA 3W4IA 1C0PA 1LQUA 4NFSA 4WECA 3G1TA 4NZ9A 5ICMA 2WE8A 9LDBA 4BKPA 3IOYA 3I52A 4Y6PA 5F3RA 2X5KO 4BO9A 4FJ0A 3DZKA 1CWUA 2I67A 1ADCA 1LX6A 3A1NA 3VVCA 4K6FA 1PX0A 3MJSA 4O6VA 1I01A 4BNNA 4CM8A 1IL0A 1E7RA 2VHYA 4IS3A 5JXWA 1MB4A 3FNGA 3F46A 3FSRA 3GRPA 4PCVA 2VTDA 3CZRA 2P9CA 3OJLA 4AL4A 1VJ0A 5LDGA 4OAQA 5JY1A 2Y93A 1Z75A 2R2GA 2FPIA 1C3VA 4KQXA 3W8EA 5KJEA 3PFWO 3H5RA 2CSUA 3ZWPA 5B4TA 4JROA 1GUFA 1NVTA 5AVOA 4CMCA 5EJ2A 3W1VA 3DXFA 4P22A 5A9SA 2Y1DA 4B4OA 4J9VA 4WOKA 4CR7A 4JJGA 3U9LA 1H6CA 5TX7A 1K6XA 2IZ1A 2O3UA 3HFGA 1HKUA 3E18A 2B83A 3OJEA 4FFRA 2BI7A 1NHGA 2J5QA 4DMMA 4K1LA 1MV8A 4E2ZA 3K2BA 4IDAA 7ADHA 3PHLA 4UVIA 2DVMA 1OFGA 1BW9A 3BTUA 1CERA 4RVDA 3R1IA 1PS0A 3C8MA 5L53A 3ZU4A 2J3IA 3HB5X 4FOOA 4BNHA 4IDFA 4BKUA 1D4FA 2EXXA 3GAZA 1PGJA 2TMGA 3H9UA 2V6BA 4JIGA 3C1TA 2C2XA 5EN4A 2WD7B 3OECA 4MVJP 4MO2A 1HT0A 2VZ9A 4IMRA 1ADFA 1YJ8A 1V6AA 1LSUA 2VN8A 4CM9D 4KWIA 3RCBA 4XYLA 5H82A 1NXQA 3EW7A 4XDZA 2ZQZA 4OHUA 3UKOA 2C54A 1WVGA 3KYBA 3GN2A 2EP7A 2C7GA 1WMAA 4O0LA 3K30A 1XLTA 1HXHA 2PZMA 3NV9A 4J2OA 4WCDA 3Q11A 4QUKA 2WE7A 1FMCA 1H6DA 1IB6A 4PLYA 1NAHA 2JHGA 1YBVA 3SBOA 1KVTA 4J4BA 4W82A 3TL3A 4XR4A 4UUOA 1LRJA 4GSKA 4RVHA 5COQA 2HK8A 1E6EA 2NVWA 3NEPX 2NVBA 1BWSA 1X7HA 3DQPA 1R4NA 4KQWA 1DC6A 4YTEA 5AXCA 1JWAB 1F8FA 2P5UA 2E82A 2GSDA 3O03A 3N58A 3WYEA 1GQQA 1XSEA 2DTDA 3MJ4A 3DAPA 3RUHA 5HTOA 2GERA 3ITDA 1GEEA 2NACA 6ADHA 3CUKA 1QRRA 2I76A 1ID1A 4BNTA 4XWYA 3C3XA 4GX5A 3PWKA 1YH3A 5F21A 1YO6A 4CUKA 1F8GA 4CMAA 5CDUA 3SJ7A 1WNTA 3GAFA 3CMMA 3RUCA 1U2DA 4A7PA 1TB4A 3S2FA 1VKNA 3HADA 5BSHA 1I2ZA 4RLHA 3F6YA 4XYGA 4XJTA 2I65A 3TZCA 1N5DA 4OGWA 3LC7O 3TDKA 1P44A 4RDHA 4A27A 1D3AA 3CPSA 4L4SA 4NIMA 3DTTA 2FPPA 3PYMA 4O1MA 2IXBA 1KY4A 4CR6A 1NAIA 2AA3A 5T5QA 3DOCA 1XQ6A 2B4TO 5JSFA 3ZCXA 3PI7A 1KYQA 1EVIA 1JKIA 3GUYA 3WICA 1I3LA 4FGSA 2YQ4A 2AW5A 4NJMB 4U7WA 3WNVA 4YPOA 4M49A 3OETA 4PZCA 1UZNA 2J3JA 1PTJA 3CXRA 3OQBA 4Z9FA 2NADA 3S1LA 4Y8VA 4E13A 1HTBA 5C37A 3RKUA 3GR6A 3K92A 5TF4A 4BNJA 4NBVA 3IKTA 3RC7A 3ZV6A 1E3WB 1GZ4A 2OGUA 4RPHA 2CMDA 2PZKA 1L1FA 4PLPA 4NBUA 3UF0A 2HU2A 3ITKA 3WMWA 4JN6B 4BO1A 3NKLA 2PTGA 4BIIA 2Q4BA 4ZN6A 4WKGA 3RD5A 4IINA 3I1JA 2V6GA 2EKPA 3RUIA 3H8VA 4B4WA 3OF2A 4BS9A 1LSJA 1ZKMA 1F14A 3M2TA 2VWHA 3C1OA 1AXEA 4TKMA 4WLEA 1N1EA 4PLCA 3RUFA 5IZ4A 3PQDA 4WEOA 3AOGA 1T2CA 3MJVA 1J4AA 4YJGA 4DXHA 4NK5A 3E9QA 3GH3A 1I2BA 1NVMB 2RCYA 3GNSA 2Y67A 5TGDA 4CM1A 1FK8A 4NQZA 5TQVA 1HSOA 4BKRA 5KJFA 4QTZA 3DEYX 1VL8A 1YDWA 3QA9A 1OZAA 3JQ8B 2VOJA 5LDHA 1P1FA 4DYVA 3WLEA 3AM5A 2IEDA 1DLJA 3ZNQA 4BMVA 1E5LA 4HFMA 3OEWA 3JQAB 1GUYA 2G0TA 1UDCA 4K9DA 1KEVA 4YRAA 4DLLA 1E3SA 3VPGA 1YB5A 2X9NA 2YQ5A 1P0FA 3GF4A 3IQDB 3D4NA 3DZBA 3GY0A 4XRRA 5EMHA 2Y99A 4ALLA 5JYDA 2J8ZA 5G0WA 5C7IO 1LRLA 4Y98A 2OORA 1H6AA 3ST7A 5JMPA 1U3WA 4PGFA 4XGIA 3D3EA 5HM8A 4EJMA 3FHLA 4IY1A 1TVEA 4NNJA 1HZZA 4CMIA 3FTNA 3KYDB 1VM6A 1UXGA 3GG2A 5JC8A 5CDSA 4CQMD 5BSEA 1X1TA 1RPNA 3UCFA 5DBFA 4YDRA 5T57A 5A1TA 4TRMA 3AUSA 1BVUA 1L7DA 4MIOA 3Q0EA 3A14A 3DBHA 5HA5A 3MWEB 4RVGA 4R3NA 3L9XA 4HBGA 3K96A 3WYBA 1M6WA 3I9JA 3ZNPA 5AXBA 4IGFA 2DPGA 5EPOA 3GHHA 5I7SA 1KVRA 3VDRA 3WTCA 2CNBA 3HFSA 3WXBA 2A4KA 4DTIA 4E4YA 3ZHZA 4II3A 5K6AA 4YAJA 1DAOA 1BDMA 4BHTA 1ULUA 1EZ4A 4NJOA 1LC3A 3I3OA 1KOLA 1V3TA 4LRTB 4D45A 1PQUA 3QWIA 4L8VA 3DOOA 1MX3A 3QP9A 4E2WA 4OSOA 3JQ9A 4R9RA 4BL5A 3HNPA 1QYWA 4CMBA 4CPDA 1MLDA 1FDSA 1SB9A 4JLWA 5I9LA 4YRDA 2FSSA 4HNGA 4BGUA 3IKVA 4GWGA 4GWKA 3EC7A 3DMTA 1FDUA 1X14A 1TI7A 4CLDA 2IYOA 1NYTA 3K9QO 4U5QA 2LDBA 3NYWA 1HE2A 2DBRA 4RF2A 4XGNA 1UXIA 2VHZA 5U1PA 3GZ4A 3PHIA 4RQUA 1IE3A 3BMOB 4G5HA 3TZHA 4J1SA 1P1HA 3D5TA 5A9SB 3ROQA 3L9WA 3WMXA 2ZQYA 5JBIA 4D3SA 4ZQEA 4PZEA 4IBOA 3GFBA 3DAFA 3PHJA 3NT5A 2QRLA 3AY6A 3QVSA 3QE3A 1DFIA 1UZMA 4TZTA 5KVVA 1V35A 3M2PA 3QIVA 5DCWA 5TSDA 1ENPA 1PJLA 2DAPA 1JA9A 2DT5A 4NI5A 3QLJA 1BW9B 4KOAA 4ZQBA 4R5HA 3JSAA 4MIEA 2D2IA 2H5LA 2YJZA 4HX5A 3SC4A 3ETEA 4PG7A 1NVGA 2WYWA 1LJ8A 5I7EA 3JQEA 1U9JA 2I3GA 5TJ9A 2PKQO 1EVZA 2WEKA 1I5RA 2GN9A 1YQDA 1GD1O 1S7CA 4BNFA 4WPGA 4R3WA 4DPKA 2NQTA 3PJDA 1C0KA 2DFVA 3PHGA 4J7XA 4Q3BA 4LMPA 3WGYA 5L4NA 1WDLA 2DUWA 3I5MA 3ROPA 2X0RA 1RM4A 2E4AA 2NVUB 2JHFA 3IUSA 4TZKA 1ZVMA 3CKYA 1TA4A 4J4TA 4GLOA 3TF5A 1JKJA 4BNMA 1LDEA 1IULA 2G82A 2HUNA 3PJEA 4I9HA 5L4LA 2A94A 1EQUA 1FDVA 4YA6A 3RSHA 3NTRA 3JYLA 5CPFA 4CODB 1HDCA 4GQAA 1DRWA 3RU7A 3MJCA 3JQ7B 4C4OA 1ZBQA 3AFNA 2X0JA 4GKVA 5TLSA 4RJTA 4YRBA 4E30A 3F3SA 1SEVA 4LRSB 4OJNA 1T2AA 4M87A 3S2IA 4YQYA 1XELA 1IHXA 1NNUA 2BI8A 1B8VA 2GLXA 4Q3CA 3HUDA 3IC5A 5A4DA 3WSVA 4GPD1 1PR9A 1V8BA 2FWMX 3O9ZA 3PQFA 4RF3A 5IDWA 4FPXA 5JCXA 4CMJA 2GUGA 4NU6A 1O0SA 4UVHA 2UUPA 4DPLA 5MGBA 5A06A 2F00A 4PLZA 3LQFA 4J2HA 4W99A 1CQJA 3C7AA 2E48A 1Y1PA 1O8CA 2VWGA 2Y1FA 3FNHA 4J3FA 1E77A 1R4NB 5IXSA 3V1YA 2WDZA 4FJ1A 3WBBA 5F5LA 4BGEA 2W2LA 3DZJA 4DQVA 4L4XA 3CE6A 2X0NA 3ABIA 2CFCA 3FNEA 2X5JO 2VZ8A 1QR6A 4W6ZA 1DBVO 4UUPA 2H63A 3DR3A 4LGVA 4C7JA 3E03A 2JD0A 5CEFA 3DAGA 4YT4A 1NP3A 3EK2A 3AWDA 4F6CA 3F47A 3H6KA 5H83A 1H2HA 3BIOA 3DHNA 2VYVA 4OXYA 3OP4A 5JO9A 2GN4A 1X1EA 3VTZA 2BRUA 2DTXA 1ZFNA 1LLCA 4XQCA 3ZI0A 1J6UA 5G2OA 4DA9A 4MKRA 2A9FA 1ZW1A 1HEUA 1N8KA 1SO8A 2GD1O 4BV9A 1ISGA 3K6JA 2EGHA 5DP1A 3UAGA 3NT2A 2DBZA 2TMDA 4YAEA 3GT0A 1MXHA 3BTVA 3QVOA 4QFCA 1ENYA 3K31A 5I8WA 1YB1A 3T7CA 4EI2A 3OICA 4MVJD 3PXXA 4D3FA 2Y0EA 3BZUA 4GX0A 3GGGA 3JQBA 4DPMA 5DF1A 1OAAA 4AJ4A 2J3HA 1I3NA 5JMWA 5CAEA 1YB4A 1ONOA 2IDZA 4II2A 4QX6A 2GPTA 3UFXA 3NX4A 5EL0A 2W2KA 4B3HA 3MEQA 4JX8A 4PVDA 3BA1A 2D0IA 3IAHA 2OBNA 2Z1NA 3GVPA 1FDWA 1DFHA 3U4CA 1DHRA 4AJOA 1YONA 3HJAA 5FI5A 2D5AA 2GZ1A 4URFA 3ICCA 1A9ZA 2EG9A 3DB2A 5JLAA 1QV7A 1NM5A 4BO2A 4OMUA 1ULSA 3VZPA 5DBIA 1I33A 3VOSA 5CP8A 4BMNA 1HE3A 2AEJA 3GG9A 1YQXA 3ZN2A 1WDKA 4J1QA 3E48A 3H5AA 1NASA 5L9AA 3MJTA 5JDIA 3L6OO 2PGLA 1CIVA 2BGKA 4I1IA 1DIRA 3ONFA 4XR9A 2CDCA 1KVSA 2QQ5A 3KYCB 4BO3A 5CDGA 4QT0A 3WGTA 2AQIA 2O3TA 4GX1A 1EFLA 1U4OA 4LN1A 3TNLA 2D5CA 4BNVA 2EW2A 3CMCO 1ZJYA 3PIIA 3RJ9A 4MPDA 5JW6A 3GEDA 1JN0A 1HWYA 4G2NA 4B7XA 3GDGA 3JQ8A 4UUNA 3PYXA 3KHUA 2OP1A 3U5TA 2D3TA 3VZSA 3ONDA 1K6JA 3RC9A 1P9LA 3JQAA 3ZV3A 5DCUA 1SNYA 4WNIA 4B8WA 2W8ZA 2V6FA 3SEFA 2JCXA 3EMKA 3KRTA 1R0KA 1I30A 2Y0DA 4NG5A 1Z45A 3DHYA 1GZ3A 3QWBA 3UHAA 4ZHSA 3RC1A 2EWMA 1KEUA 1V0JA 4YAKA 2D1YA 3WGIA 4FFLA 3WIEA 3B1FA 4E31A 2Z1MA 4J49A 2VHVA 4HXYA 3NJ4A 3KYDA 1HETA 1HLDA 2YZ7A 4CMKA 3V1TC 2VNAA 3TOXA 1UXKA 3BMCA 2QRKA 2NV6A 4XYEA 5BSFA 7MDHA 4UVEA 1YGYA 1PL7A 4RZHA 2B5WA 4DVJA 1B8PA 1EMDA 3W4JA 3L6DA 3PP8A 5G4KA 2DLDA 3AU9A 5HRUA 3WGQA 1QYDA 1NWHA 4XKJA 4DBVO 3VDQA 3DBHB 5AYVA 4OOFA 4J7UA 2J5RA 4CM6A 4PN3A 1GCUA 4RORA 1A7KA 2DU8A 2PFGA 1C0LA 4CV1A 1JVSA 3RROA 3K8ZA 1PGOA 1ADBA 2NTVA 2QRJA 6LDHA 5U9CA 2QG4A 3GMDA 2VUTA 3EZLA 2GASA 3JD3A 5AOVA 4DGSA 1E7YA 3CTMA 1VSVA 2NTNA 4D41A 4BNWA 2AMFA 3O8QA 1CRWG 1DFGA 3QRWA 4FC7A 4N5MA 4ALNA 1XU9A 2P5YA 2X9GA 4DL9A 1DXYA 3ADOA 3ZWCA 1Z82A 3RWBA 1O94A 3MJEA 1E7QA 4J0EA 1VLLA 2Q1WA 1PJSA 2BGMA 4HNHA 3PVZA 5KCZA 2P9GA 1JQBA 4HFJA 4GKBA 3KVOA 1WZIA 5JCJA 5K6AC 4RPLA 5IG2A 3BMOA 1B16A 4ND4A 1VPDA 4R41A 3OHSX 1XA0A 1ZMOA 3H2SA 3O38A 5DP2A 1E1LA 3U4IA 3ULKA 1IPEA 3JQ9C 1LDGA 1LEHA 2P4HX 4R69A 2H9IA 1P1RA 1YOVA 2RHCA 3EHEA 4N5LA 4R1SA 4KUGA 2ZYDA 3RFXA 5EQDA 5EERA 3DMTC 3KBOA 2HSDA 3IJPA 3QVWA 4J43A 4BO4A 3OFSA 5DULA 2PGDA 3DONA 4JQCA 1J49A 5IZCA 5F1OA 5IJZA 5KIAA 3OIFA 3BMQB 4OSPA 3AI3A 5ADHA 1ZK3A 2B4QA 2AE2A 2VRBA 1ZXBA 4PLTA 2PZLA 2Z95A 4WASA 3V5NA 4B7UA 4FCCA 4KDFA 4CL3A 4EUEA 1P31A 3JD2A 2RH4A 4XIYA 4YQZA 2I6TA 4R54A 1YVEI 1IY8A 2NVUA 1IZ9A 1N2SA 4ZA2A 3BXXA 4RPJA 4J7CA 1IHYA 4YAIA 3U4DA 1QG6A 1A4IA 1EK6A 2VWPA 3AU8A 4W4TA 4F6LA 2FY8A 1PJ2A 2NU9A 1K89A 4QXMA 2O48X 5IN5A 3KLPX 1KIFA 3JQ7A 5IAAA 4FSHA 1T1SA 4JBIA 4FBGA 5JS6A 2AQ8A 4OQYA 4ZQGA 4Q9NA 1T25A 1E92A 4BO6A 3VH1A 1CEQA 4RQTA 1EBUA 3OJOA 4UEJA 3ANMA 4IJWA 1YBAA 4XIJA 4ZGWA 1E1MA 2ZB8A 2X4GA 2ZTMA 3V1UA 3TOZA 2HMWA 1YL6A 3LC2O 1P33A 1EE2A 3BTOA 3EVNA 1JWBB 2O2YA 4IDDA 1ZUD1 3OQ6A 3ZH2A 5G0TA 4EYEA 3WQSB 1E5QA 4FQ8A 4K26A 1U3VA 1WWKA 1NWCA 1W8DA 2GO1A 3GA0A 1NFFA 1SB8A 1DIGA 2X22A 3I9NA 3LT2A 1U5AA 3FPLA 1DDOA 1RM5A 3H9JA 3WYCA 4G65A 1WZEA 1X0VA 4NMHA 1LDBA 1NPDA 4NFHA 3WSWA 1X13A 1U7TA 3IS3A 1Y81A 3B1KA 4NHEA 4WLFA 2ZIZA 1E7MA 1TT5B 4EBFA 1ZCJA 4WE3A 4CV2A 2X1HA 4EUFA 4ALMA 4LMRA 3TSCA 1LSOA 2E49A 3GHYA 1PJCA 1FJHA 1F06A 5CEEA 5C7LO 3QHAA 3IMFA 3N7UA 2NM0A 5JFOA 4A03A 1RM3A 1B3RA 4NBTA 1GYRA 2NSDA 1BXKA 1LI4A 2PY6A 5LCXA 1HZJA 2AG8A 2WMDA 5KNLA 1ZK4A 1NX6A 5G4LA 3SX2A 4E2YA 1ZIDA 5B1YA 3BHIA 4YJDA 1Y9AA 2O4UX 5IN4A 1GCOA 3D64A 3S2GA 3VPSA 1HDOA 4Z0TA 4FGWA 5A5EA 5F1KA 3RUAA 3GDOA 3OSUA 4BNZA 1ZK0A 3D4OA 1U1IA 1HDXA 3RAJA 2W2KB 3UGKA 3D3WA 4M1QA 1M67A 3GFGA 3W6UA 3U4HA 1SC6A 4FJ2A 2CDBA 1EK5A 4GAEA 3LDHA 4BMSA 3UCXA 4PRLA 4WNCA 3GQVA 4HFNA 2QHXA 2YHIA 2OP0A 3JQBC 5HWSA 3OIDA 2ZTLA 1SPXA 5HBRA 3P5SA 1JLLA 2ZB4A 3FBGA 4RGBA 4CJXA 2AQHA 1EFKA 4WLNA 5MDHA 2VQ3A 1PU2A 2YUTA 1DC3A 1N7GA 2WJPA 1V3VA 1ZSYA 2CZCA 2ZJ0A 4E2XA 3VPHA 1DRVA 2Y1EA 3GVIA 3ORFA 3KYCA 3ZWNA 3C1AA 3WNQA 3RBXA 2DQ4A 3M6IA 5JNLA 1T2FA 4L73A 4TRRA 1C1DA 1CQIA 4PVCA 4RPKA 2Q50A 3VC7A 3FWNA 4H15A 1T4DA 2VRCA 5A5FA 1QLJA 4PG5A 5FWNA 4CLEA 3STHA 4TVOA 4A10A 2XPCA 1EUDA 1XEAA 3VKUA 1GPJA 2HMVA 5IDYA 4DQXA 3DDNA 3F4LA 4J4HA 1Z6ZA 5TIIA 2PGJA 2O3QA 4E5KA 5ENDA 5JDIC 1K5HA 2VWQA 1H94A 1LQTA 1YQGA 3EZYA 2DFDA 1QYCA 4F3YA 3NAQA 1R12A 3MZ0A 4GGPA 5TNXA 2EEZA 3HE3A 1LUAA 1UJMA 3OJ0A 4I5FA 4R1UA 5G0VA 4Y6RA 4MINA 4OKIA 3EVTA 4IPTA 5TT0A 2PD4A 2I3AA 2PKRA 4XYMA 1TLTA 3T7EA 1HYGA 4BB5A 3PDUA 3HHPA 3ENKA 5KVSA 1YJQA 1C0IA 3QV1A 4ESOA 3DHEA 4BNIA 3HDQA 4C7KA 3SLKA 2C5EA 5IF3A 4WOJA 2GF2A 1D1SA 1E0DA 3GGOA 2VNSA 3IDSA 3ANNA 5GZ1A 2AE1A 4IZHA 1MC5A 3BMCB 3QVTA 3CSDA 1B7GO 3GEGA 1YWGO 1T2DA 3RUEA 1MP0A 1R0LA 3AI2A 2RIRA 4J90A 4JP3A 4BB6A 1R15A 4FFNA 4AJIA 3ZW8A 4AJ1A 1NHWA 3L0DA 3ZV4A 5G4KB 3UN1A 4RLSA 4DIFA 4RL6A 3WWYA 5L51A 3ENNA 3TPCA 3ZWXA 1N7HA 2G1UA 4S1VA 3H4VA 1KC1A 5A9RA 3AUAA 4GMFA 4TROA 2ET6A 1JU9A 1XYGA 4RVUA 3WLFA 2BFMA 2ZATA 3ZNOA 4AVYA 3HDHA 2D8AA 2OO5A 3K5PA 3S55A 4MVJM 2IZ0A 4GBJA 4B4UA 1EVJA 3G0OA 1K0UA 2G76A 2Q1TA 4M89A 1MC4A 3ZU3A 3O8QB 1N9GA 1HDZA 1O5IA 4F45A 3NTQA 3MOIA 1P0CA 4JJFA 3LC1O 3F1KA 4IGEA 3ON5A 3ZWAA 2Q4EA 2XXBA 2FRDA 2WWRA 5DBGA 4A2CA 3H9QA 2BH9A 3RJ5A 2I9PA 4RDIA 1LA2A 1YBMA 2NU7A 4GVXA 4O59O 4EJ6A 1VC2A 3ZHYA 2FOIA 1SZJG 4LSWA 3KSZO 4IUYA 4XDYA 1IOLA 1Y8QA 4EGFA 3HDJA 3UXYA 4RVFA 2XXJA 1ONNA 3L4SO 4TRJA 3ZWBA 3JQGB 4UREA 3GVXA 3Q2KA 3RVDA 5JAZA 1I2CA 1G6KA 3ZWYA 1HYEA 2QW8A 2VHWA 5L7TA 1H9BA 1RYDA 1Y9EA 3JV7A 1YOVB 2J6IA 2WTBA 3U49A 1I10A 3L6EA 5JAIA 3OA2A 2CF6A 4RO0A 5CFZA 4BO5A 1JAYA 3BMQA 1F17A 5L3ZA 3JCZA 4QECA 2B5VA 1U2GA 1ZSNA 4EUHA 1SEPA 1X7DA 1X15A 3U62A 3ZU5A 1RKXA 1PZHA 3JYPA 2QZZA 3TRIA 4BO0A 4LW8A 5COBA 2X7HA 1NQAO 3WQQA 3UVEA 3WFIA 4H7PA 1PIWA 5IDXA 2EERA 3BAZA 1I3KA 2Y1CA 1UDAA 1GUZA 5IFLA 1DB3A 4MKXA 3RUDA 4GL4A 2VHXA 5KKCA 1ZEJA 1LTHR 1ISJA 1P77A 2C29D 1E3LA 1UP4A 4R5MA 5JAMA 4DMLA 1ENOA 4ZQFA 5IZCC 1JKFA 3DOJA 2W90A 2Q46A 4YBZA 1BXGA 1OC2A 2OZPA 1TXGA 2UDPA 4QO7A 4I08A 2YFHA 3V2UA 3L77A 4BNGA 3K73O 4J0FA 1LC0A 1LLDA 1U5CA 2DTEA 4XYBA 4EITA 5DOZA 4XB2A 1GR0A 3ZHBA 4X54A 1MG0A 5I8ZA 3BHMA 3F5SA 5CG2A 2VUUA 3TFQA 5CEJA 4E21A 5CHEA 1UDBA 1L7EA 2O2SA 3NT4A 1LRKA 3ZWMA 2CF5A 5F5NA 4GI2A 3COSA 5HS4A 5THKA 4P4LA 3ZWWA 2PK3A 5ENVA 5KTKA 2VYNA 1VRWA 2EW8A 1PL8A 2GZ3A 2GN6A 3WIDA 1PJ3A 3F1LA 1E6WA 3W8DA 1E1NA 2BMAA 4QFDA 2PV7A 3GNQA 2Q3EA 2V65A 3ZWVA 3SVTA 5KWEA 4MP3A 5T8KA 4HADA 2CUKA 1SCUA 4FC6A 3ZWOA 3DMYA 1WW8A 4MVJI 1QLHA 1MA0A 3D5QA 2DKNA 2E6UX 3ZGYA 2OL4A 3EYWA 5DNAA 2EKLA 4LCEA 1P1KA 1BDBA 1NFRA 2Q2WA 1TT5A 5H81A 5KJCA 3RASA 1JTVA 3FWZA 1J5PA 4WLVA 3RFTA 2UAGA 1I0ZA 1ONPA 4P4NA 4YB8A 3DZIA 3LVFO 2HO5A 3GZNA 2YV3A 4IZIA 1KEWA 5DCYA 4J9UE 2C82A 3RU9A 1CJCA 4L76A 3AI1A 1ISHA 4BUCA 2Q2QA 3FRJA 2EJVA 4ONEA 3MTJA 1JVBA 4K6CA 2JFGA 4ILKA 3PGJA 1A27A 4R68A 1CYDA 4KTVE 2PWZA 2YW9A 4NBWA 2HJSA 5C3MA 2G5CA 4L74A 5THQA 1R16A 2ILTA 1E3EA 1BRMA 2Q45A 4PG6A 4R9SA 3TFOA 1D7OA 3TQHA 5HS6A 2ZCUA 2OBYA 3KM0A 3WTBA 3U09A 1I3MA 4NDNE 4OM8A 1CETA 3WJ7A 3GLQA 4LISA 4OXKA 1MFZA 3G3EA 4TMFA 4N7RA 4YT5A 3BHJA 4R1TA 5EESA 5B12A 1PQPA 1UXHA 4JNKA 2Y1OA 2HRBA 4AG3A 2PH5A 3LLVA 5FEUA 3D3WB 1B15A 3AUUA 3WGZA 4WCFA 3W6ZA 2QYTA 3KEOA 1XR3A 3Q9UA 1ZH8A 3EAGA 3OIGA 2YDYA 4HP8A 4OH1A 4J16A 4QEDA 2X9VA 3QSGA 2YHIB 4KMSA 3Q9NA 3U0BA 5KVCA 3H9GA 5A02A 2B4RO 4ND1A 5BT9A 1KERA 4KWHA 1LDNA 4Q3DA 4CMGA 5K9ZA 5L7YA 3VAZA 2JD2A 5CG1A 1BXZA 4WK6A 3LF2A 1T26A 2W98A 1UP7A 2P68A 4BNXA 3GMSA 2J5KA 2EP5A 3WBFA 1JDJA 3FD8A 4EJ0A 2RH8A 1C1DB 2C7VA 2PD3A 3I83A 2WYUA 4HFRA 4P38A 1GV1A 5I7FA 3WQRA 4YWJA 1V9LA 2JKVA 1EVYA 1NPYA 1E1KA 4D42A 3HQ4O 2Z5LA 1ML3A 2ZJ1A 4NBRA 2AQKA 5KJ6A 3PHHA 4BNUA 1WLYA 2FHSA 2QIOA 1HE4A 3WB9A 1GQ2A 5IXYA 4GVLA 1NR1A 4RZIA 1T24A 3INTA 4R4JA 4BV8A 4ZICA 1H5QA 2HMUA 3OM9A 4IQGA 2EF1A 4PIVA 4B4VA 4IM7A 4J91A 4YAGA 4KTTE 1Z7EA 1ZO8A 4Z6KA 2D4AA 3Q1LA 4CL8A 4HY3A 2Y1GA 4CM9A 2YV2A 3E1KA 4KP7A 1IZ0A 3ADPA 5JDCA 1ZEMA 1OBFO 1XWFA 3AJRA 2ZKLA 2A35A 1UUFA 3LSYA 3B6ZA 1N92A 4BNYA 5ER6A 2YDXA 2FSVA 3JTMA 4XGKA 4F46A 3H3FA 3DO5A 5KJ1A 2WYVA 2EJWA 3VH2A 3AFMA 3QWAA 5ILOA 4DBZA 1KVUA 2IE0A 4Z3DA 4CR8A 4ALJA 1U8XX 2PZJA 3OEYA 1OC4A 1M6HA 4DRYA 1YKFA 5G0SA 4FDAA 3T4XA 3RIHA 3NDRA 1GZ6A 4D43A 4XRGA 1EDZA 1GV0A 4RVSA 4W7IA 4CM7A 3H2ZA 3KSUA 1PR3A 4CMEA 3LF1A 4RV9A 2ZTVA 2FR8A 4UVDA 1PJBA 4EEXA 1VL0A 2JFHA 4CM3A 3LT4A 4PZDA 5ITVA 1XCBA 5G0UA 2QYSA 3PLRA 3M1LA 1R6DA 3IIEA 5FFFA 5T64A 5L45A 2OFPA 2YYYA 4NR0A 1Q7GA 2P4QA 1DLIA 1A5ZA 2I99A 1PL6A 1GY8A 2VYVD 1H93A 1MUUA 2IZZA 3LK7A 4U0JA 1O95A 1HDRA 4UEKA 4P8RA 3MCVA 4TVBA 2GYYA 3FBTA 3C24A 1ZJZA 3PDJA 5JAQA 3JD4A 4XQGA 4YEDA 1N9GB 4PLGA 4MIYA 4LVUA 4AJPA 1JW9B 4E5PA 5ICSA 5BNIA 2O7QA 3N74A 4DC1A 1GYQA 1YL5A 1DJQA 4DYDA 2YHUA 4EDFA 3V8BA 3QW2A 2HAEA 4OXNA 1DC4A 4IQ8A 4MVJH 4R01A 3G17A 2H1SA 1HRDA 3GUCA 4CQLA 3FF4A 1YS4A 2OHXA 2WD8A 2XF8A 4TQGA 1I36A 2HRZA 2ZTUA 2UYYA 3WOHA 1GL3A 5B4VA 4W7HA 3JQGA 3KOUA 1Y8QB 2QZ9A 1PGNA 1K2WA 1UXJA 5ILGA 4IQ0A 4MOWA 5EINA 4DC0A 1TT7A 2PH3A 4ITUA 4JBHA 2O50A 2R6JA 4XJSA 1WP4A 1DO8A 4A73A 4DQUA 4OYRA 3TL2A 3KEQA 3R0IA 3NDJA 3BMNB 4OKNA 1B14A 4RCVA 3RKRA 3PQEA 9LDTA 2YFQA 3QY9A 2HJRA 1HSZA 4GLLA 5BNFA 3V2HA 4B79A 4I9NA 1FF9A 3G1UA 4XEHA 3AUTA 1A7AA 1A72A 4IJKA 2CVZA 1E6UA 5A05A 4BVAA 4TKLA 4U0KA 2GGSA 5TS3A 4E3ZA 2JAHA 3PRJA 1NR7A 3WGHA 5GZ3A 3OMLA 5JE8A 2RBEA 3HN7A 1B2LA 4D7AA 4N18A 4WJZA 3C7CB 1PJTA 3B1JA 4J1TA 4FFOA 4Q3AA 3NTOA 4ROSA 1NTOA 5ES3A 2NUAA 2ZB7A 4ALIA 5B4UA 1P45A 3ANLA 1HYHA 4RF5A 1Y5MA 4GSLA 1AHHA 4BNKA 1I8TA 4CLOA 4LSMA 1XU7A 4D79A 4IXWA 1VI2A 1BXGB 4I5DA 2EV9A 3CZMA 4PRKA 4E5NA 3RBVA 3P19A 3FPCA 4PG4A 1RJWA 1XIVA 3JQAD 5L4SA 3P2YA 4ND3A 1G0NA 1H0KA 2HDHA 1T2EA 2Q1SA 2HK9A 3ETGA 4QSMA 2AEMA 4L75A 1DIBA 1BGVA 3JD0A 1DRUA 2B0JA 3AOEA 3H7AA 4BGIA 1AN9A 2GN8A 1D1TA 5C7OO 4YVFA 2FZEA 8ADHA 4R16A 2GCGA 4RF4A 2CD9A 3D1LA 1YRLA 5JPIA 2DBVO 3E82A 4PFJA 3TZKA 1LLQA 3H3JA 1VL6A 5L95A 2EIHA 1GQYA 4CM4A 4L9RA 4EW6A 3EUWA 1Q1NA 4WLUA 2ZB3A 1PJ4A 4XA8A 1SOWA 3VZRA 1RWBA 2C59A 1U3TA 1K6IA 4ND5A 4BO7A 3KUXA 4XD2A 3GPIA 2X6TA 3H9EO 2ZK7A 5BQFA 5AXAA 3PYLA 2V7PA 1Y7TA 3CIFA 1Y5RA 4AFNA 4QQRA 4KUHA 4AJ2A 1XQ1A 2X0IA 3ICPA 1BHSA 1M2WA 2B35A 4UUMA 3RFVA 1NFQA 4LVCA 4DWVA 4CQMA 4AJKA 2AEFA 1A9YA 3A06A 4JK3A 3RC2A 4PLFA 5KVQA 3IP1A 2GRAA 4BO8A 1DIHA 1Y8RA 3EGOA 1R66A 2PD6A 4IDCA 4IJVA 3FI9A 3GZNB 4KDEA 1PS8A 2R00A 4JBGA 5T8KC 1EUZA 3L4BA 1KEPA 1QV6A 2VZ0A 3O26A 4NH4A 1VJTA 5BSGA 1GFSA 2W4QA 1LSSA 3JD1A 3OBBA 4ALKA 2PA3A 1Q2XA 2CVOA 1V3UA 2XOXA 2Y0CA 2X8LA 2VTEA 3JQFA 3PIDA 3WGGA 2EKQA 3VTFA 1PGPA 3GVHA 1P3DA 4YYZA 4AJJA 2OOSA 3IJRA 1AXGA 5JCJD 1XKQA 2HK7A 4YJFB 3UUWA 1PZFA 1PGQA 3A4VA 2C07A 1UAYA 4LK3A 4D0SA 1YL7A 3WJAA 2X86A 4L4RA 4D44A 5AQ1A 1Z7BA 2FR0A 4BQRA 1CF2O 1U28A 3FCOA 1B0AA 3PK0A 1S6YA 2Y05A 2CDAA 1GAEO 4HUJA 3SLGA 3DFUA 2WSBA 4WCFB 1LDYA 3GN1A 1R4MA 5DT9A 5B37A 3SXPA 1Q0HA 4XCVA 2GZ2A 3I6QA 3E8XA 3W8FA 3R6DA 4MVJG 4OOEA 2NNLD 4E5MA 4CV0A 4FW8A 4IDBA 4Q39A 4U6QA 1X0XA 1PWXA 2O23A 4XB1A 1HDYA 2A92A 3KZVA 1QP8A 5C5IA 2FP4A 4EZBA 1ORRA 3JQCA 4W9NA 1H2BA 5KKAA 2C5AA 4BOYA 4IDGA 3ONEA 3AY7A 1ARZA 3PWSA 3TWOA 1PWZA 4WCFC 4B3JA 3I9OA 2JCVA 1KS9A 1B8UA 3NRCA 2GR9A 4ZRNA 2DPHA 4UEOA 1W4ZA 4R51A 2V6MA 5CDYA 1D8AA 3QWHA 1BG6A 2RHRA 3GGPA 4PLHA 3G49A 3QJ5A 2NQ8A 3E5MA 5DDIP 1U7HA 1GU7A 4IDEA 1IPFA 5EQFA 1ZSVA 3G79A 4ND2A 3NDIA 4GH5A 4BKOA 5BR7A 5A03A 1GDHA 1Z74A 5ER9A 4IIUA 2FMUA 3WDSA 1IYZA 1J0XO 1E3IA 3I9LA 3PWZA 4IJUA 1MFPA 3E6AA 1YE3A 2X23A 4CLRA 2B37A 2PKQP 1BMDA 2B36A 3E9MA 1Z73A 2BD0A 3FR7A 3LLSA 4E0BA 1KVQA 1SOVA 2H6EA 3AY3A 2J3KA 3P2OA 3VH4A 2NTJA 5F1PA 4XZ3A 5DZSA 5CPBA 2NLOA 3JYQA 3GDFA 3DBRA 4DLBA 4BGVA 1GPDG 4MVJF 2C0CA 3HZZA 3I4FA 4JGBA 5L40A 4FS3A 4WEQA 1PZEA 4YJHB 4Q3NA 4CM5A 2Y68A 3ASUA 3DBVO 3PTZA 3INGA 5L7WA 1PJQA 3JYOA 2E37A 1DSSG 5JDCC 4L0QA 3ZHXA 4M55A 3AW9A 1E7WA 3DZHA 4AICA 1M76A 3DL2A 3UCEA 1ZK1A 3WGOA 2C20A 2BFAA 2QX7A 3R3SA 1C1XA 2OXIA 3CH6A 4MKZA 1KY5A 2UVDA 4H3VA 3DTYA 5I7VA 3CINA 4GX2A 4WLOA 3WG9A 3TN7A 3F9IA 4M54A 1H9AA 2BHLA 1ZXLA 1M75A 3KV3O 5K0ZA 3PFFA 2BFOA 4M86A 4MP6A 3DBLA 4PLVA 1LNQA 1NQ5A 1G0OA 2Q49A 2CVQA 3D0OA 1Q7CA 3A28A 2NU6A 4CMEC 4FOSA 1UP6A 5FF9A 1UAGA 1QYXA 4DIBA 2EGGA 2OMEA 3JQDA 2HQ1A 1QXSA 3LU1A 3ZW9A 2VOEA 4Z3KA 3V2GA 1LBEA 1H6BA 4DLAA 4A26A 4FB5A 1NBOA 3H65A 3KETA 4CQLB 5A04A 1MGOA 1PZGA 1DAPA 1QORA 4E33A 4CM8B 5GY7A 1VJ1A 2O3JA 2IXAA 1I24A 2DUUA 3HG7A 2CY0A 4MVJA 2BLLA 4CLHA 4YT8A 4IXTA 1YDEA 1FXSA 1SBYA 2GNAA 5TRTA 3DFZA 3WX0A 2UUOA 3BMNA 3NGXA 3BYZA 1AE1A 3I4CA 1KETA 1G1AA 4GGOA 1XDWA 2LDXA 1UZLA 3WS7A 2VCYA 3K2EA 2SCUA 3PJFA 4TWRA 4LCJA 4Z9XA 3LT0A 1GYPA 4B8ZA 1N1GA 4J1NA 4CLXA 3A9WA 2JD1A 3BTSA 3TZQA 3WFJA 3UH1A 3JYNA 2X58A 4FFMA 4Z9YA 2AXQA 5I9MA 4B7CA 4I9UA 3GEMA 4HKTA 3OH8A 1LXCA 2AG5A 3ASVA 2DC1A 2NU8A 1A4UA 2B69A 4N5NA 5LC1A 3UOGA 2VRCD 4FIZA 1GTMA 4E5YA 1O6ZA 3NJ8A 4JCOA 4CLOB 2JAPA 2DM6A 1Y6JA 1QKIA 2YV1A 4OQZA 3HB4X 1UR5A 2O7SA 5A3VA 5FYDA 1ZZEA 1DOHA 4Z0PA 1LLUA 2WD7A 5GZ6A 1ZK2A 4Y67A 1QMGA 2JFFA 4GMGA 3DZFA 3ROKA 5T6BA 1DC5A 2HLPA 3S2EA 1BSVA 4S3MA 3ZV5A 1QSGA 1R0SA 4QO8A 4U6SA 3Q6IA 4RPGA 4A5OA 5KOIA 1VE9A 1ZNQO 1M66A 3QWFA 2UV8A 2EHDA 2O4CA 3GVCA 3GNTA 4CV3A 4I8XA 4NK4A 1F12A 2FZWA 4CM4B 4BQPA 3Q3CA 1DHTA 3MTGA 4YXFA 4H16A 3AK4A 4ZJUA 4MVJE 3ZU2A 1I32A 2BF7A 1GEGA 1MXFA 3EDMA 4KZPA 1WPQA 4XX0A 4IS2A 1PS9A 5FI3A 3GRKA 2IEBA 1QYVA 1ISFA 4FR5A 1HDGO 1EQ2A 3D7LA 1BTOA 2P9EA 3QQPA 3DC2A 3AOEC 4HWKA 3S8MA 3PJGA 1AGNA 1T1RA 4D0RA 1LDMA 5T67A 5JYEA 4A0SA 1CDOA 3I9KA 3L07A 2D59A 5JC1A 4YCAA 5DOVA 4ZD6A 1O89A 3AM3A 4P4GA 4CMHA 5J23A 4WGGA 2HKIA 1U4SA 4CQMB 4J6FA 1E3JA 4IIVA 1HF3A 2BELA 2Y66A 1HLPA 3OJFA 5AXDA 1A71A 1FDTA 1RM0A 1X7GA 4KUEA 2OUIA 5JY6A 4NPCA 3P7MA 1Y8RB 2POQX 4NFYA 1VSUA 4Z0HO 3QVXA 1F0YA 3F5QA 2IYPA 3DWFA 4XQEA 3KTDA 5BNTA 4E32A 2I5PO 1B26A 1EUCA 5TT1A 3W4KA 2VT3A 1UH5A 4AJHA 4AJNA 4AJEA 2X5OA 3Q2IA 5TC4A 1P1JA 3KXDA 2Q2VA 3AM4A 3C85A 3T4EA 5U4QA 4CUZA 4HV4A 3VPFA 3VHRA 2JCYA 4ZVVA 3FN4A
chains in the Genus database with same CATH superfamily
4OHFA 4OHPA 4H0FA 1NYRA 2BEWB 2PRSA 4DUPA 4YR9A 1XJ5A 3FDZB 4YT2A 1N33B 3JTEA 3C7KA 4GPTA 1G5QA 3VVBA 4WV3A 4GOLD 3PXEA 3CRNA 2IUSA 3JRNA 4QTTB 1PNQA 1JPJA 4Z7JA 4FYXA 2QAGB 1NQOA 4JENA 1Z2AA 1A97A 1B8OA 5J4HA 1ZU5A 2V55B 4X91A 1MJNA 1V95A 2R00C 3U5ZB 4AO7A 1E9BA 1RQPA 4FMCB 4HAOA 2C7OA 3L4BC 2PR7A 2AF3C 5FUXA 3WL3A 4EFDA 3C7DB 3H5NA 5HK8A 2XY4A 4DB2A 4JJIA 4WBSA 1CUBA 2O3RA 1I2DA 2FI1A 3SHTA 2LTAA 3T5CA 3OPQA 3SZGA 3VJKA 5LB2A 1HL3A 1N4DA 1SAYA 4XQ9A 2Q7XA 1R4MB 1XFAA 2WPNA 3QVGB 2R6AA 4PLWA 4YGXB 4HN9A 5IJ9B 3U61B 1B3BA 3IQGX 3OZRA 1X74A 5GWXA 1E3WA 3L7KA 3E58A 3ELWA 1LZLA 5ALUA 2G9QA 3PE4A 1KZYC 3INRA 4HO1X 4O2AA 5C2JB 5HZGA 2A78A 4FTWA 4G9GA 3EHDA 3TSAA 1NPTO 3AL3A 4ID3A 4Q1CA 5D86A 3ZY5A 1ADJA 3UJ9A 1E79D 1C14A 3Q7SA 3X2FA 2UVQA 2FEXA 1ADGA 1OYWA 1BVRA 1W0CA 1XMVA 2OV4A 3DVQX 3G9ZA 2HD4A 1X8XA 1U0HC 3N2EA 4JQYA 1NU6A 1ESCA 1R6XA 1MX1A 1E9SA 3ELDA 5HUJA 3EFOB 3JR3A 5CLLA 4E12A 3EY4A 3V48A 4W5OA 4I1SA 1JFRA 3HVJA 4L5IA 5DM60 1BKYA 2CCGA 2ZSHA 1U6KA 1NU8A 3FMPB 4MQLA 4E6PA 4LNUA 3AYZB 3MAJA 3KSDO 3G5MA 1EBFA 4G4GA 4EHKA 2ASVA 3M3PA 1L5FA 4QA9A 3O4RA 3RVRA 4UASA 3PEFA 3N07A 2VSQA 5E8RA 1OI3A 3NGLA 4ZRMA 3G02A 2RGAA 4O02B 3UPDA 4TRNA 4RPIA 1ONSA 3RQSA 4QVKA 5DW0A 5CDTA 4NBSA 1AN0A 2RAFA 3R3VA 4MS1A 4DV7B 4XM0A 4L8WB 4YP7A 3ITNA 1DCKA 2CNKA 2G3YA 5HDQA 3E9NA 1JHDA 5DTMA 1AHIA 1UZAA 4DLWA 4KBFA 3OO0A 2PH1A 1W46A 3Q98A 3PNYA 1IXZA 4MP8A 4QIHA 2CLOB 2HMSA 1NVDA 1Q95A 3GPDG 4DREA 4TXLA 4Q1VA 2F1JA 2VG8A 2VJMA 1AUPA 3K0BA 4G81A 2VYND 5AK3A 5CJ2A 2DFLA 1EDOA 3LT1A 2C1EA 4G5XA 4N54A 3ED1A 1EEHA 1SXIA 4NXMB 3GLKA 4KO3S 2J6CA 3DBRB 1N6IA 2H2DA 5FA6A 3PPIA 1N75A 4XTRA 2PRYA 2VL7A 2CXXA 3KDPA 4ZU3A 1C4WA 3HDYA 1Y82A 3NHJA 1ISMA 4RSGA 4WQMA 5KKNB 2FSPA 4REQB 2CKMA 2QW1A 3PHCA 4RXUA 3I23A 2HZ7A 4WI1A 2ZPUA 3U4GA 3P5BA 5LWQA 1U0SY 1CJBA 5IF9A 3V6LA 4RIFA 1S3IA 3GC6A 1C4XA 2CE2X 3G8BA 2O5VA 5EIOA 2P6UA 2E85A 3EWNA 4O2LA 4Y3UA 1IMOA 1RLTA 1I1OA 2FW8A 1F0NA 1VP9A 3OA0A 4X71A 2D2FA 3NUQA 1MRNA 3CU5A 5GOTA 4D9IA 4BEBA 2WPDA 2FPGA 2IY8A 4I9FA 4EY7A 4X62B 2NSYA 3OM0A 3QBJA 3PGXA 5A4MS 4EG4A 4QYWA 4ZI3A 1KC3A 3AF6A 2ZYUX 2JFYA 4Z99A 1MQ8B 4JIMA 4UMDA 5HF6A 1DPGA 3DOHA 3OWOA 1C50A 4JLNA 2VYQA 2ZJ8A 3VYVA 2QTAA 4OREX 3TIFA 2P7IA 3D2AA 1NW7A 3S2YA 5JSHA 1M2OB 2P2SA 5AHRA 5A3JA 5JO0A 3HMKA 3PNPA 4NKRA 1D4OA 4A4DA 4CT4B 1C0PA 3K8QA 1LJUA 2XGSA 4TT3A 2FPKA 2XEXA 4NFSA 1G4UR 4N3AA 3T99A 5ICMA 4G5RA 3DL4A 4BKPA 3IOYA 4FWTA 3T9EA 2D00A 4WJLA 1QZUA 3DV9A 1D2RA 1J22A 2EP8A 2P6NA 1GRNA 4H9GA 2X5KO 4Y6PA 5F3RA 2W11A 4BO9A 4L95C 1D5WA 5LQMA 3FOBA 2HSWA 1Z7WA 3AKDA 5BRAA 2Q7OE 3FDXA 3NAMA 2QJWA 1HYQA 1M6EX 5AT1A 1ZGJA 3A1NA 4UATA 3VR6D 1PX0A 1IOZA 1WOYA 3G1WA 4O6VA 4CM8A 3FZNA 2M6RA 3IHLA 2XHEA 2AJCA 5BN5A 4EM6A 1K9VF 4KHZA 2I33A 4IS3A 5JXWA 1Q3KA 2QD2A 1X1CA 1MB4A 3F46A 3GXOA 2P9TA 1D6NA 1TW3A 1X70A 2IPLA 2VTDA 1DJPA 2OV6A 3CZRA 5JANA 4LXUA 2A3RA 4BLSA 3J81A 1QIKA 2P9JA 4OAQA 1D2GA 4RU1A 5JY1A 1UK6A 2Y93A 1QHYA 3A26A 2PMFA 2P2ZA 3E05A 2G4VA 4R1OA 1VRVA 4KQXA 4HDCA 3IIKA 1M8GA 3D02A 2BSXA 3OTOB 1BXRA 1KDRA 3ZWPA 1YJXA 2OD2A 4JROA 1JJAA 1NV8A 1W5AA 4LGCA 5KEIA 1HRKA 1OLSA 3OTGA 1FSFA 1AQYA 2B9EA 1XZJA 3C70A 4UQPA 4BTEA 4WOKA 4CR7A 3IOEA 4DG5A 5BNWA 2JIDA 4QPJC 1K6XA 2OB1A 3I58A 4DA6A 3E18A 4X7RA 4FFRA 1QBGA 1QQ6A 1G4HA 4DRZA 2Z1DA 4K1LA 4WSOA 4ASUD 1USGA 1IEWA 3PR3A 4L07A 4IDAA 4QOIA 3RLFA 3L8GA 2AL7A 3FSGA 2XUHA 4A0HA 1PS0A 3GLUA 4F2GA 2XCLA 1Q3HA 3ZU4A 3TDNA 4G41A 2AWOA 3GUUA 3HB5X 1TK9A 3MNFA 5HOQA 1EJ2A 1DL5A 1NUTA 1BFKA 3C4QA 2RMKA 3EG9B 4BKUA 3NS7A 3H9UA 1U2GC 1XNGA 2V6BA 2IIPA 5K2OA 2A4MA 1TLFA 2P90A 4KYUA 2C2XA 1NG1A 2J6BA 2XD9A 4RYLA 3ABZA 3V4FA 1XRNA 3IEUA 5SYNA 8ATCA 4KN5A 2WD7B 2W7TA 4Y2SA 3OECA 3EVBA 4MO2A 3A9RA 1VLHA 4IMRA 4ES6A 1FP4A 1ADFA 1YJ8A 5AW0A 2A9OA 1OVGA 1P4GA 2J3LA 1GTJ1 1EUQA 1RR6A 3A1FA 4C0WA 4EO4A 2PKEA 4P5PA 5ECYA 4KWIA 1KOJA 2YJ6A 3KHKA 4OQNA 1QZXA 1ZUWA 3EW7A 4NMMA 4RZQA 4XDZA 5TMEA 4DCMA 4C07A 4OHUA 3EISA 2OFWA 4GLBA 1XJCA 4B45A 2FG7C 3ZHTA 1S96A 2CXPA 4U2FA 2EP7A 3D6AA 2JFOA 4CF5A 4O0LA 3K30A 3B52X 4D8WA 2PZMA 5IK2D 3EEIA 2CGEA 2CUZA 2WE7A 1O9HA 1JG4A 1VIMA 1VZ2A 2L69A 4LHWA 3WIOA 1KVTA 1LK7A 1QVVA 1FMLA 3BKWA 4IIDA 1G7TA 4H7DA 5AHKA 4DYHA 3TL3A 4YR7A 4C2UA 1KO7A 4XR4A 1N3IA 2V98A 4UUOA 2KYRA 2JFWA 3H1FA 3L79A 4PSDA 4ZZIA 3L06A 2JGIA 4RVHA 4CETA 3QE4A 1EA7A 2AYZA 2C5GA 2OZKA 1DO0A 3MCWA 4OJYA 1GP2A 5COQA 3RARA 2VPIA 4V38A 3CUWA 3NEPX 3OE4A 1D6SA 4RBNA 2QWXA 3IB3A 5AQEA 1JNXX 3SFTA 1RAFA 3ND9A 1W36D 3QYFA 3TNFA 3GI1A 1XD2A 1P0PA 3BIWA 3Q6NA 4PC3A 1XPRA 3AVXA 1R4NA 4WNAA 1WZUA 4OEHA 4YTEA 5EZ6B 4EHJA 5TQ0B 1F8FA 3GEEA 2J5XA 3TFWA 2B3TA 3ZD8A 4G86A 1JFFA 3WYEA 1LLFA 2DTDA 4DOMA 3G2LA 2C03A 1SVOA 4N03A 1KRXA 1RYZA 3A2NA 1GAXA 3FMIA 5U4XA 3T06B 4HT3B 1QRRA 4P98A 3AL2A 3S4YA 4XWYA 3L7LA 2ON6A 2YIVX 5EWMB 4GX5A 1IDN1 4DAEA 1WMSA 1JKXA 1YH3A 5KYXA 3OQMA 4CUKA 1LPSA 2DHEA 5H02A 1CFZA 3DKRA 3GAFA 1YCFA 3H2HA 2PUBA 4RK0A 4A7PA 3U3KA 3QI7A 4QDOA 3RRBA 4L5YA 3RIXA 3A70A 2VZEA 2H9YA 4AWAA 1UEXC 1ZJJA 4XYGA 2G40A 2HM7A 4QGBA 3FOFC 3COJA 4D80A 3IOBA 3FCYA 1KMHB 4Z1MA 8MHTA 1UKAA 4FOLA 5K0SA 3KWJA 3ZE2B 1VHTA 2P4EA 3B3FA 3EOBI 3W5HA 2ODTX 3M33A 1FMJA 2IXBA 1BCRB 1DADA 2QN2A 4MJ3A 1NAIA 2AA3A 4B3DA 1CDEA 3DOCA 1I7QB 1RC8A 2EJBA 3Q41A 5E4JA 3CH7A 2QQ0A 4NYIQ 4DCJA 4FGSA 1DTSA 2AW5A 3DJFA 4M22A 4KXUA 5ALZA 4ERNA 1LD3A 4YPOA 1RKUA 1XZQA 1CRPA 1N5RA 3VU9B 1UZNA 4HK4A 1PTJA 1W30A 3ZTYA 1M1NA 1PSWA 2YV4A 4HDNA 3HB9A 4OD0A 4Z9FA 2YWCA 5DNYB 3SYMA 5HP4A 3WLLA 5KPJA 3FYUA 1AGRA 4HH3C 5C37A 5JS8A 1P2GA 3QMMA 5P21A 5TF4A 4G9EA 1KRHA 5BQ5A 1JG3A 4KN6A 4OYLA 3I2HA 5E7MA 1SOUA 3RC7A 3ZV6A 1GZ4A 3UAYA 5CXSA 1CJTC 3UFXB 2MYNA 2C2ZA 5KSOA 4N1AA 4UHBA 4NBUA 1FJ2A 3C41J 3HN6A 3ITKA 3N8IA 4E5DA 1RQRA 1USWA 5HMMA 1AKVA 5AHOA 3U16A 3SSNA 3M4XA 3Q7QA 4JLJA 4K9LA 4B32A 4NVRA 3I61A 1CBUA 3EULA 3KU4A 1XL0A 4BFVA 2XRMA 1T5IA 2FKNA 1GNSA 1X19A 1UFKA 2JS7A 2AI2A 3KG2A 3O8BA 5IAJA 1LSJA 1ZKMA 4MQMA 3MG9A 3FPHA 3M2TA 1O5OA 2F1RA 3GEHA 3H7IA 2RGXA 3C1OA 3I05A 1JR4A 4AI6A 4H1HA 2HF2A 2VSYA 5DX8A 5A3SA 2RJOA 2WMNB 4FYVA 3AR7A 1WKCA 4RH0A 3GH3A 5AK5A 4B6OA 2CB9A 2HSGA 4CN8A 1WUIS 1IQUA 1XJ0A 3IQWA 1QH1B 3Q40A 2Y67A 4XPIA 1FK8A 3D4LA 1G42A 5HZKA 1PDOA 2JIQA 1KKMA 1UPCA 4QTZA 2PT6A 3DEYX 1VL8A 1YDWA 1CKEA 1OWNA 1Z2DA 3GGSA 4KH1A 2AEEA 4NYJQ 2AC7A 3REFA 3JQ8B 3GARA 4JQSA 4IOJA 3PNBA 2JLSA 2FX2A 2FGKA 2RC6A 4LYYA 4NDZA 3UHOA 1QIIA 2PZFA 1T8SA 4Y6OA 3WK4A 3ZNQA 3HKCB 3HR4A 1VG1A 4YRAA 4K9DA 1YUNA 2BM1A 3HEMA 4Q1AA 1X87A 4LZPA 2JJ2A 5AW9A 4XARA 3KQKA 2HT1A 4PXSA 3JX9A 1P0FA 1GQFA 3CLRD 3GF4A 4L8GA 3OE7D 4TVSA 2DEUA 2CLMB 1RHJA 3GY0A 5JYDA 2EZUA 4RANA 4CVNA 4NBNA 3PXBA 4JCCA 4Y98A 2CKDA 3B8EA 3QLVA 2OORA 1H6AA 1Y9JA 3EXAA 5JADA 2FOLA 1FX1A 2R66A 5JMPA 3STUA 3U80A 5LP6B 1NOJA 2RGDA 5FLKA 4IY1A 3SFZA 2Y6UA 4EHHA 4IUBS 5EZYB 4CMIA 4EPVA 4BB5A 2REOA 4M8IA 3KYDB 3LPCA 4R1QA 1GSOA 4X90A 1JF8A 3GFFA 3KBBA 1T9DA 4NOMA 4BIMA 5ED4A 3N2KB 1GGJA 1QHHB 1GPAA 2R1ZA 4QYSA 4ZO9A 5ESRA 5F2NA 1KBQA 4JI0B 4CQMD 1NIPA 4ZHQB 2O54A 2XZTA 3WNZA 4PRZA 4DDMA 2J67A 1A4XA 4KXWA 4H6PA 4YDRA 5T57A 1PR1A 3IDFA 3B5EA 4EQ6B 1R0ZA 1Z6PA 3AO0B 3AUSA 5A4KA 4QDUA 1VDMA 1RJEA 4MIOA 4FCTA 4N6OA 2OCDA 3DBHA 1V1RB 4MRAA 1G8HA 3WLSA 5CA0F 2YMMA 5DU2A 1ODIA 4V2IA 4LQ4A 1TO1E 3VTKA 5KYNA 1X3SA 4HQRA 4X60A 1GGVA 1GCIA 1KF0A 4PXAA 5FWXB 2IHVA 4BDSA 4IGFA 4Z54A 2R4QA 1ZLXA 2ZRCA 4K3VA 4REOA 3FUXA 5MN4A 3N86A 3GJ7A 4E4YA 4QOEA 5UKDA 1U0RA 2MYPA 3ISTA 2GN0A 4YAJA 1NSFA 1V4BA 1ANKA 4HUQA 4IYJA 2TMYA 3NWBA 2FUEA 3I3OA 4NJEB 4COOA 3HXQA 4QAJA 5G53C 2GZDA 1PQUA 1AV7A 4P9NA 3IVXA 5KI6A 2OLKA 5A2QA 2VBFA 2GZSA 4OSOA 5EZ5A 3CO5A 1AD2A 3UHPA 3UPUA 2BISA 4CMBA 1IZ8A 3YASA 1MLDA 1P2BA 1FDSA 1O96A 2XUFA 1L8LA 4YRDA 4IRXA 1L4LA 2FSSA 4OGKA 2QL9A 5JI2E 1XE3A 1Y1TA 3KJEA 1WKVA 3EC7A 3NIDB 2R96A 2DUJA 1X14A 3JAKA 1XVTA 5DI9A 2XDWA 2ARKA 2GTIA 1ZJ5A 3FY4A 3V7UA 3LA8A 3NOXA 2QJTA 5K05A 2WT4A 1ZUNA 1VSBA 1KZGB 2DBRA 2FPIB 4XGNA 1D0SA 3C8HA 3RS5A 4XWOA 4GEGA 4MW4A 4AXBA 3PHIA 2VAXA 4M0CA 3WL8A 4ZKDA 5ICEA 3BMOB 4PCUA 2JBWA 3PE3A 4G5HA 2QAJA 1P1HA 1OB5A 3D5TA 4IF4A 5C8XA 5KWIA 3ROQA 2ZZKA 2WQ6A 3WMXA 1ORTA 2WTMA 2YX1A 2AFHA 2YOFA 1XTVA 1VYVA 4IBOA 4PGHA 4ZAWA 2RKBA 3GFBA 1U7UA 1XQWA 3SPXA 1YS2X 2HSZA 2RH9B 2QRLA 3AY6A 3I6BA 3QE3A 2DQSA 4TLAA 3ZXIA 5HIAA 2X19A 3TOCA 5FOXA 3M2PA 3QIVA 2D0OB 3L6UA 1ODJA 1FUYB 3CCBA 3MVEA 5DCWA 3IDZA 1ENPA 1W0KA 2YR0A 5CNKA 1VIDA 2DT5A 2EF0A 4FLEA 4GYYA 4RDCA 5CA0A 5TB5A 4BJ3A 3V1LA 3SLRA 5KC9A 3SP1A 3V1MA 1DZ3A 4CU2A 4PG7A 5LLTA 1P3JA 2WYWA 3HU1A 3RVPA 5I7EA 5J43A 1F7VA 1U9JA 2F3TA 2GFQA 5EZSA 2RONA 1AXRA 1T9BA 5TJ9A 2R79A 2GN9A 4MS3B 4TWJA 2EFCB 4GNRA 1EFHA 1Z34A 4BNFA 2IYFA 1L7VC 4WPGA 4DPKA 3WQHA 2NQTA 4J94A 1B0ZA 1C0KA 4G6ZA 3FROA 5AHXA 3SYRA 1YTLA 2DLNA 4Q3BA 4IGKA 4LMPA 3LFHA 3ROPA 2ATVA 2X0RA 4KDRA 2W42A 2BYTA 3LUAA 4HGYA 1ZVMA 3OQIB 4XE5A 3HABA 4FQ7A 4KFUA 3K9BA 2VDOB 3UZUA 1LDEA 5KPDA 1X1QA 2G82A 5D3KA 1SBTA 3H84A 3KX2A 5DGHA 4EUNA 2QUIA 4YHBA 1EQUA 1FDVA 4EGQA 2FQXA 1F9AA 1QPGA 4N9WA 1GAJA 1WJGA 4DR1B 1G60A 3MM4A 1GNTA 2QX4A 1MORA 1E66A 3RU7A 3HGTA 4ZTUB 3ROFA 3KPWA 1XYVA 1ZBQA 3AFNA 3DL7A 1RFGE 5DWVA 1QF6A 1LF5A 4RJTA 4YRBA 3F3SA 1A95A 3LL4A 5BUQA 1XELA 3MTQA 2JIPA 1IHXA 2C3OA 1V9CA 1I4EB 3IC5A 3LGSA 5JYCA 4C89A 4GPD1 3LUPA 1PR9A 1V8BA 2HWKA 2PQ0A 3A3OA 3O9ZA 3P27A 4FI3F 4LG1A 1U0LA 4WW0A 1NW3A 3WK7A 1II8A 2UUPA 5FJIA 3VJLA 1Z8NA 2F00A 3ISJA 1QVRA 3LQFA 3EPLA 1XLTC 4BBPA 2BTQA 3K5WA 2CSXA 1CQJA 3TZLA 1X42A 1Y1PA 1K97A 4GDMA 4W5RA 1A5TA 2HRRA 2I4LA 4J3FA 5KSYA 2EKBA 2WWYA 1JH9A 4U7GA 4FNAA 1PUIA 2FE4A 2WDZA 3V1YA 2QQEA 1E5XA 1E5VA 1C9JA 4BGEA 1FDRA 3OD5A 4DA7A 5F2EA 4OK5A 2QTWB 3F9RA 3BKXA 4AIIA 3VYTB 3I01M 2DXIA 3TCXB 1VIYA 1JHPA 2ODNA 3RHFA 2CFCA 3FNEA 2X5JO 2VZ8A 3TD6A 1QR6A 2GNOA 4UUPA 1T0PA 3ZWDA 5EAIA 4BXOA 4LGVA 1PWYE 1SKMA 5A0TA 1GIAA 1Q3TA 4ADSG 1H8EA 4PYLA 2JFNA 3A8TA 4C43A 1A50B 5JIBA 3F47A 4QQNA 2OUKA 3C4VA 3VI3B 1AKUA 4CWAA 3ZVRA 1IHOA 1NURA 2GSWA 5CA1B 2E5WA 1MQAA 2NO5A 3MB5A 4RA6A 5JO9A 5TS2A 1YJCA 1HFEL 3MSXA 3JVVA 1TTHA 4QPPA 4YXWA 1I5OA 5HIMA 5HE8A 5B3JA 1ZFNA 5CT4A 1UCFA 3ENVA 1XZAA 3B1YA 4DA9A 4MKRA 4L4ZA 1K3FA 1ZW1A 1SRRA 1CUZA 1SO8A 3KZKA 1VGRA 4GGMX 4JELA 4XGRA 3RHSA 4HDKB 3OM8A 4OFBA 2YFYA 1YZTA 4PPGA 1MDFA 1TUGA 4WVLA 2HRCA 5DP1A 3UAGA 1M5TA 5EE0A 1EX1A 1X9IA 3WB1A 4NPAA 1MXHA 4K05A 2PG3A 3RREA 1BA3A 1U2DC 4QNNA 1YMQA 4BUZA 3D54D 2WJIA 4UTOA 4AT1A 4V1CI 1RRVA 5G1NA 4WFIA 5F33A 3ZXXA 3LWZA 2LRHA 2GCOA 3OICA 3VR2D 4EI2A 3K05A 5F9FA 1BVHA 1RKQA 4I6EA 3GGGA 3W3AH 4DPMA 5F1YA 1YB4A 5D87A 2IXGA 1FVFA 4QYIB 4RUKA 4M9SA 4YIHA 1UM9A 5IAGA 2F8MA 3E5HA 4QX6A 2ZUSA 3PX7A 1NKSA 2B8WA 4NULA 4UXJA 4W5JA 1GGHA 5JCZA 1VRCA 2W2KA 3DMFA 1R50A 1TW2A 1T9GS 3BA1A 4PVDA 5AMXA 1BWQA 2DHQA 3GVPA 4PAGA 1DDGA 1DFHA 1LX7A 3P2EA 4AJOA 2ORVA 4KK3A 2D5AA 3RT7A 3V33A 3ICCA 2EG9A 5JLAA 3V4SA 4D6YA 3NFRA 1NM5A 1QOQB 5F64A 4OMUA 1ULSA 3UT5B 2ES4A 4CTJA 1FP2A 4ZALA 3VOSA 4OQPA 5DN6A 4FS8A 4BMNA 3JAWA 3A7DA 1YQXA 3ZN2A 5BOSA 2A9RA 3E48A 4HL6A 5FBQB 4S1NA 4MICA 3QZUA 5JDIA 3L6OO 4Q4JA 4CKWA 5AK4A 5EVJA 4XR9A 3C43A 2X1MA 2F67A 2CDCA 3ESYA 1UDXA 3KPYA 4QT0A 4GZ3A 1R6BX 1F3OA 3DW3X 1P4JA 1U4OA 4LN1A 2W48A 7REQB 5KMGB 4GBGA 4ZCQA 3PIIA 5TY0A 4ZC1A 4MV6A 4Y6LA 3RJ9A 3U44B 3KT8A 2B6NA 1HWYA 3Q7PA 1EXNA 3D2LA 4G2NA 4K5QA 4CQNA 4HAZA 3V8QA 3U7JA 3BWCA 1QWOA 2JFQA 2N0SA 4FE7A 1NSYA 3STVA 3KHUA 3TW6A 2OP1A 1UJ2A 2VDKB 3WAGA 3E15A 5CT8A 5EIBD 3G9QA 4FGZA 4AXXA 3IELA 3OFKA 3SBEA 1TK2A 1YZKA 2NOAA 1PNTA 5DCUA 1STOA 5FXMA 2QR3A 2VDUE 4WNIA 3HUFA 2W8ZA 4FSXA 1TVCA 5GONF 2DHCA 5FBHA 4YRTA 4CW7A 1ZHFA 2AD5A 4I2VA 1SIWA 1K4MA 3KL4A 1PN3A 1LTKA 1Z45A 1FBTA 3NIFB 5GGYA 3ZQUA 4YAUA 2FWNA 1WCYA 3EGDA 4D02A 2QLJA 4ZHSA 3C6QA 1ZGHA 1JPUA 4K8RB 3L7MA 3Q1KA 2EWMA 1LJLA 1UBOS 4FHEA 1EB9A 2IQ5A 2IF2A 3CF2A 1RTTA 2D1YA 2H1IA 5CM9C 2R1VB 4C0AC 2IIQA 4FFLA 3B38A 3B1FA 3LRXA 4E31A 2PWBA 1THZA 2VHVA 4HXYA 4J49A 1YR1A 2Q3MA 2WWIA 4NCHA 1KYIA 1HETA 1HLDA 1PFGA 4L2IA 5IBQA 1AKWA 3V1TC 1F2DA 3JZFA 2VCEA 3GLGA 2A0FA 1E2PA 4ABYA 4B0OA 1BOFA 3TLMA 1ORVA 1P7PA 3H1GA 4H08A 1MB0A 1ZCAA 2WTXA 1KYTA 3AHEA 3MT0A 2G8NA 4XYEA 1WKBA 4RZHA 2H8GA 3AR8A 3R8XA 3VC1A 4BMDA 3IMCA 10MHA 1B8PA 1EMDA 1SUCA 4DDTA 2C4NA 4MTCA 1JB9A 2QRHA 3SEZA 2Q21A 5KTRA 5KYUB 3GV0A 4IVNA 5K6RA 3SZMA 2PL9A 3G9TA 2EQ5A 5CX4A 2J5RA 4Q0MA 3FVQA 3WLPA 2V0GA 5A71A 1B0UA 1Y5NA 1U0TA 4LC9A 4RORA 3ENQA 1HZZC 1N6PA 4XVHA 1IVNA 1C0LA 2QT0A 3HV0A 4N3NA 1IUNA 3UG7A 1F5SA 1IVSA 1OKKA 3G5LA 5LXTA 3TG8A 1CY7A 4KBYA 1AGYA 3RROA 4F7WA 4PZUA 1JSXA 1MHTA 1PGOA 1ADBA 2NTVA 2PX6A 3PGLA 5E6RA 1DKPA 5CB4A 3B9BA 3UW1A 2FXVA 1DQRA 3EZLA 2VA9A 4F4DA 5I4BA 4DGSA 2B30A 3LCUA 2ZTHA 2H4XA 4Y1EA 3NC1C 1DOZA 1KL7A 3PEVA 4BBZA 2OAGA 6AT1A 3K9HA 3AVOA 2AMFA 3O8QA 3JWGA 1CRWG 1DFGA 1KIMA 3IPLA 1JU4A 1XU9A 4BZZA 5GONA 1C2TA 2X9GA 2HPAA 1DXYA 3DM5A 1JS1X 4NFLA 2FSIA 1W9HA 1PNOA 1NYLA 5L8VA 2OQRA 1PAUA 3K9GA 3WB0A 3WRXA 1RW4A 1WTAA 2R87A 1VLLA 2BZSA 3T9BA 2BGMA 4HNHA 2A6PA 2EZTA 3U81A 4HFJA 3PUHA 3NGMA 3SF0A 4GPBA 1PJ8A 2XUOA 2P7HA 4DV3B 2GRJA 5TDHA 4EFMA 1E2BA 4ND4A 1C3XA 4QZVA 4B1FA 1XN1A 2JASA 1K63A 4OFXA 2JFPA 2VT7A 2ACWA 4B7AA 4WDRA 4B4KA 4FMBB 2V0CA 1IC6A 2J6HA 3FMOB 1LEHA 2XZOA 3EX7C 5BORA 2WUEA 4R69A 3DDWA 4MHOA 1J5EB 4NOLA 3GGDA 2P9HA 2RHCA 5AI5A 4RTNA 2IUTA 4KUGA 3DSRA 1Q22A 3EC1A 1HUQA 3JASA 4B80A 3QMVA 4O4IF 5EERA 1XAHA 1QRUA 3A0UA 2HSDA 4PGMA 2R5WA 3C98A 3EXIB 3G0CA 4RD0A 4J0IA 3OM1A 4B5KA 4JQCA 2OPHA 1A8QA 4P3OA 5F1OA 4C0JA 4C01A 5FX2A 2BKLA 3A4IA 3S2SA 4BZQA 1UM8A 5JG7A 1SOMA 3M70A 2ZYVX 1VG8A 5E9WA 5ADHA 4FOPA 5IJAA 3CTPA 4I6JA 3GGJA 4H7JA 2VRBA 2Z95A 4ISBA 5DHUA 2G77B 2YZMA 5SZJA 3VC2A 4EUEA 7AT1A 4WY2A 1X38A 1LWOA 1PKEA 1L4HA 2W2XA 4XVRA 4YQZA 5ALPA 1Z7GA 2I6TA 1YVEI 3I72A 5LQCA 2QMUA 1DINA 1ESZA 1PYGA 4UBKA 5IHXA 4D26A 1X80B 5DYGA 4F38A 3HJNA 3LDGA 4BPRA 4ZA2A 1QE0A 1SHJA 4WESB 2PEYA 4V1CB 4ABTA 3ECAA 1FXWF 5IVKA 4YAIA 2FW9A 4B84A 5E4TA 1UBFA 4KRXA 1F20A 1XZIA 4ZK2A 1ZGCA 2FY8A 3E9CA 3KLOA 1PJ2A 3NCHA 1K89A 3KXLA 2HR1A 1JAHA 3E22A 4IWYA 2ZBQA 5AKGA 4QXMA 3RU2A 1XZGA 3KLPX 4ER6A 3NWJA 2YHBA 1PP4A 3M6AA 4FSHA 2G72A 4X8HA 4NP6A 3S68A 1N25A 4KITB 3VR1A 2AQ8A 2R7MA 4L16A 4BPBA 4Q9NA 3MRVA 1ZY2A 4UHKA 1T25A 2IYTA 9MHTA 2H52A 3ID6C 1CR0A 4DSNA 2PBRA 1CEQA 1OZ0A 4Q3KA 5JSKA 2CHVA 3NHZA 3VSDA 1CF4A 2G9NA 3MMNA 2JJQA 2CMHA 5ALVA 3JZMA 4PNHA 3EGVA 3GPLA 4LXGA 2AFIE 2ZTMA 4HGPA 2OTCA 3TOZA 2GEBA 5BYJA 4K0RA 3KKQA 3LC2O 1VCMA 3HDVA 1WPXA 1U94A 5DK4A 3V32A 3BTOA 4GPAA 3EVNA 3I28A 1TIKA 3K5IA 2WABA 2W2NA 3OUZA 1Q1BA 1OH6A 5G0TA 4EYEA 2PMCA 4XVUA 1E5QA 4ZARA 3GNLA 1WWKA 3R74A 4G5YA 3NDPA 4Y2RA 4ZVQA 1NFFA 1QS0B 3KFVA 4JYPA 2WPDD 3WGJA 1QVWA 2ZJYA 3CVOA 1VHQA 2YN4A 4UBOA 1WG8A 4P34A 1WZEA 3VO9A 4NMHA 4LBYA 1LDBA 3M7IA 3CRW1 4NSNA 3EC2A 1N2HA 3NM4A 3SF8A 1BFUA 2Z8XA 1X77A 3N2LA 2YWFA 4EG5A 3ZKWA 4D97A 2PS0A 1X13A 2Q29A 2WUWE 3KKMA 1TO6A 2QGFA 4Q21A 5AK6A 5ALTA 5JXGA 1JI3A 1Q20A 4UCQA 4WLFA 1L5HA 4S1PA 1O4WA 4ZYZA 4DT1B 2ZIZA 5BMVF 1TT5B 3S1AB 3CBQA 4OLFA 1FXWA 4TT3D 2DFPA 3L0BA 3ZVLA 1WB4A 1C9YA 5F7JA 3H2IA 2OCIA 5KOJB 2IHZA 1XPOA 4LMRA 4LMAA 5EMJA 1G8PA 3AONB 2W0MA 2E49A 1PJCA 4P31A 2BFFB 1Z0JA 3KALA 2GWRA 3H4TA 2Z9BA 3NIWA 2FMHA 1CS0A 3BAFA 2NM0A 1KI4A 2XMGA 4B47A 3UAWA 5JFOA 4A03A 4Q1BA 1B3RA 1J5XA 4NBTA 1BXKA 1LI4A 2EQAA 3NAZA 3PC2A 2EBFX 3GLHA 4GZ5A 4Z4FA 1WO8A 2BCGY 2AG8A 2WMDA 5L3SB 1B1AA 2REQA 3SZUA 2X6RA 4BRWA 2B99A 1ZK4A 2HU8A 1NX6A 3LTEA 4HEHA 1F48A 3SX2A 1ZIDA 4V03A 5B1YA 3BHIA 1SUEA 3MXOA 1X1RA 1E9EA 4F84A 5K01A 3G8DA 5TXGA 1YULA 1Z2CA 1RWKA 1HDOA 2A5LA 3EMVA 4Z0TA 1KKUA 5F1KA 3RUAA 1CUHA 3OZTA 3SQXA 2W2MA 4BNZA 2H8KA 3WIBA 5JJ5A 4U7JA 2YWXA 2O06A 1HDXA 3RAJA 2RHWA 4BECA 5D7BA 3AF1A 3UGKA 3D3WA 1KP3A 2BBSA 1Z38A 5F3WB 4IEFB 3L92A 4W8HA 4AZWA 2VP4A 1SC6A 3QHQA 3EB9A 3PRYA 3W3AA 1GPH1 5I7OA 4CEHA 3LDHA 3CPJB 2VP0A 5JD5A 4PRLA 2EQBA 1LVUA 3AJ8A 1V71A 2VF2A 3N5KA 4TMWA 1N2BA 2G70A 4ME6A 2C78A 1F6BA 3JQBC 4G5OA 5LIPA 4PYRA 3PC8C 5HBRA 4X1KA 1QR2A 3FBGA 4EGJA 1SVWA 3FSGD 4JKYA 2K5UA 3F67A 3IQZA 4V0ME 2ZJ0A 2CZCA 2PZBA 5IARA 4CQJA 1LTQA 3ORFA 3FFAA 3KYCA 3ZWNA 2XB6A 1A5BB 4C6RA 1ZD9A 2I2AA 1WVIA 4KV9A 5BMVA 3EOAI 3A27A 5JNLA 5GV8A 2FG6C 4GZLA 4TRRA 2WWFA 2CYAA 4IYRA 1J0BA 1CQIA 4H18A 4PVCA 2R4UA 4XASA 3FWNA 1JUDA 1QCZA 1QZZA 4H15A 4K6MA 3TLGA 1WUHS 1HOXA 1PRYA 2VP6A 5FNVF 4B2LA 3RS9A 3N2ZB 5IAOA 3JS5A 5D85A 4JJ4A 4RW0A 2EZ8A 1PEKE 2Z9CA 3A3PA 1ZM3A 3SX0A 4YRFA 2IYQA 2LCIA 4CN9A 4EHFA 2CNNA 2GCEA 3DDNA 4LEIA 4AX8A 1TVKB 3UGQA 5DTEA 4E5KA 1NJ6A 4J0DA 2VWQA 2GM4A 1M1YA 2GK3A 2VHQA 3BXPA 3D81A 1FYEA 1H94A 5J2UB 1Z08A 1XCOA 3ML1A 3TI7A 4A6XA 4OUDB 4AG5A 2D6FA 1LPBB 3QW4B 2BHTA 3QEJA 5LQDA 3OPYI 4UM9B 1VMAA 4B3MB 4D8VA 2EEZA 5G0VA 1UJMA 5HKLA 3O6VA 4PHGA 2EVWX 5JVDF 2BONA 3SAJA 1FNCA 2KLHA 3EVTA 1IUOA 1Z8HA 4X6UA 1T3LA 2ZRFA 1ADYA 1L8OA 1NBEA 1P9WA 2I3AA 4MR9A 4PIMA 5DMXA 4EBBA 4YRIA 2EGUA 1E2DA 3PDUA 3PITA 4AMZA 5HCIA 1JEYB 2OGSA 5FJJA 4IFEA 1BD3A 2C5HA 2J5BA 1YRQA 4BNIA 2AN4A 3R7BA 4DWJA 2C5EA 1K98A 4G07A 1OBVA 2I4IA 2J9ZB 4FEAA 2VNSA 5GZ1A 2R6ZA 1LGYA 2JGDA 1H4VB 2HUPA 2XQGA 3BMCB 4F4HA 2HYIC 1XTRA 1GNQA 1NXXA 2ZRMA 2OBMA 4BB6A 2RIRA 2PMWB 3N8HA 1A98A 3OUUA 4J90A 4Z5XA 4AJIA 3ZW8A 3R6WA 4AJ1A 2OK7A 1MB3A 1TPZA 2OZLB 1F2TA 5G4KB 2MHCA 2JLYA 2QYOA 2C94A 2LV8A 4IIFA 1W36B 3M5DA 3ENNA 2RG1A 1H5NA 5FLEX 4GPIB 2ECOA 2ZJ6A 4K9RA 1Y7LA 1TOAA 4QT4A 5CD9A 4MR8B 1JVNA 2QE6A 1NKTA 1KC1A 3H4VA 3LS2A 1OXMA 4GMFA 3EVGA 4NBKA 5FNVA 4DA0A 1SU4A 3CLTC 2L19A 4BWGA 1XZBA 1KI6B 4O25A 1B74A 1VCIA 3AVYA 2YHSA 4INPA 4C4PA 3K5PA 1SM4A 2IGTA 5EHZA 1Q19A 3H2KA 4QBGB 3QELB 4YHHB 1JYSA 2YWHA 4B4UA 4Z1MD 1GLNA 1Z2OX 1YI0A 3G0OA 4QFBA 2G76A 4WA8A 2QP4A 4JZYA 3FGNA 3IAXA 1N9GA 1E20A 3I2FA 1QFSA 4F45A 1XVLA 2ZJAA 5KOHA 1K92A 1J42A 4IGIA 4X9XA 5TE9A 1MEOA 2OQ2A 3AYXB 2ZXEA 3LC1O 3ON5A 5E1OA 3U7FB 3GWZA 3DEFA 4OYHA 4PICA 2XXBA 1U0FA 3RAGA 3K9WA 2A57A 3H5VA 1QO7A 2WAXA 4OB6A 3MPUA 2QLFA 2ZBEA 3E9RA 3TSZA 2O1WA 4MV5A 4EEKA 3DLBA 1AX9A 3R3YA 1YBMA 1YAJA 3CY6A 1HH4A 3GW8A 3MK31 5T4HA 5B64A 1Y1KE 2EC5A 3Q10A 4QPCA 1D6MA 4RNCA 3IVAA 2I9KA 3MMPA 3DD1A 3VUFA 3ZHYA 2FOIA 1ZJ4A 4IV0A 3KSZO 4XDYA 2A1UB 1IOLA 2EYQA 3KS9A 4P4SB 2AFIB 2AR0A 4R8SA 3P9QA 3E3OA 1RYFA 2FUCA 1ONNA 2HDWA 2XXJA 2XUKA 4FM9A 1QRTA 5JAZA 2ECFA 1G6KA 4LDQA 2QW8A 3AF3A 5L7TA 3RSLA 1O94C 4H6VA 1H9BA 4BC1A 3F71A 2VPTA 1M2KA 3R7FA 3JV7A 4XWTA 1YOVB 2NO1A 2IWHA 4B6PA 1A1SA 5IH7A 4D9CA 2WTBA 3U49A 4RVNA 4B87A 4H31A 3U3OA 4UU8A 3WQBA 1J56A 3GJ6A 4MAFA 1Q6ZA 4BO5A 4LYHA 3BMQA 4AULA 2OHVA 4XI9A 4AKSA 2B5VA 1NNLA 1ZN7A 4DMGA 2WNHA 4BVLA 4YONB 4R6WA 4BO0A 2DMRA 5BV1A 4RIHA 4ER5A 2X7HA 1CYEA 1VE5A 3HCAA 2JLBA 2QSJA 1PIWA 4JP1A 5AH0A 1Z5VA 1K7XB 1YD7A 2EERA 5FOVA 2Y1CA 4ZEWA 1UDAA 3MELA 1GUZA 2WKSA 5JH7B 3V34A 3RUDA 1JQKA 1X1AA 1W35A 3AEKB 3E9EA 2I1WA 4ND7A 3SR0A 3M1YA 1MX9A 3Q72A 5DLYA 4DM3A 2MWMA 2PDAA 5IZCC 1JKFA 4ZCLA 2H2FA 1Q15A 4RKYA 5FTWA 4ZCIA 3FIUA 1VJCA 3HZOA 2ACEA 2QG9A 4R2LA 1Z13A 2JBAA 2YFHA 3VHXA 4BYMA 3A1EA 3K73O 4R2WA 1E69A 5D6NA 3FZGA 2ODAA 4JU9A 4XYBA 4DDKA 4OJKA 4EITA 4ZYVA 1TAUA 1GR0A 3ZCQA 3ZHBA 4X54A 4RTLA 4RELA 2A0YA 4URWR 4F5YA 2JJ2D 3K9NA 5JFTA 3UIEA 4AF7A 4DNQA 1IY9A 3W6NA 1CUJA 1CU1A 1R8XA 2PKXA 4KYVA 5CHEA 1M0SA