2EW2A

Crystal structure of the putative 2-dehydropantoate 2-reductase from enterococcus faecalis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MKIAIAGAGAMGSRLGIMLHQGGNDVTLIDQWPAHIEAIRKNGLIADFNGEEVVANLPIFSPEEIDHQNEQVDLIIALTKAQQLDAMFKAIQPMITEKTYVLCLLNGLGHEDVLEKYVPKENILVGITMWTAGLEGPGRVKLLGDGEIELENIDPSGKKFALEVVDVFQKAGLNPSYSSNVRYSIWRKACVNGTLNGLCTILDCNIAEFGALPVSESLVKTLISEFAAVAEKEAIYLDQAEVYTHIVQTYDPNGIGLHYPSMYQDLIKNHRLTEIDYINGAVWRKGQKYNVATPFCAMLTQLVHGKEELLGAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-dehydropantoate 2-reductase, putative
publication title Crystal Structure of the Putative 2-Dehydropantoate 2-Reductase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2ew2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew2A01
3O8QA 5JO9A 4QECA 5ILGA 4B3JA 2V65A 3G0OA 4J90A 4B7CA 5JMWA 3ZWWA 2CY0A 4ZGWA 2CZCA 5CG1A 4FSHA 4FW8A 5CPFA 2C07A 2C54A 4BQPA 1H5QA 3LT0A 3PHHA 4J0EA 3I9MA 4L73A 1XCBA 4P22A 5L4NA 4E5MA 3BMNA 4B7XA 2XAAA 4W9NA 3HWRA 4PLGA 3U4DA 4PLFA 4TMFA 1EVJA 2HLPA 3AI3A 4LRTB 4CMKA 2PNFA 3KSDO 3TZ6A 1OMOA 3C85A 7MDHA 4CM4B 5I7VA 4OKIA 3A28A 1DIAA 4BO1A 2UUOA 3DZKA 3M1LA 5IF3A 4II3A 1B8UA 3WDSA 4I5EA 5H83A 4CQLA 5DZSA 3MWDB 5IDXA 1TLTA 4QFDA 1LQTA 1O8CA 2UAGA 1P45A 1ISIA 3CZRA 3GPIA 1ADGA 4WLUA 4RVSA 4WGGA 3R0IA 5ICSA 1V35A 3DBVO 4OIMA 5IG2A 1EFKA 1E7QA 1SMKA 3VOSA 1Q7GA 1F14A 3CIFA 2BFOA 3H9JA 3WGOA 1M6HA 1I01A 1ZK3A 5A3JA 3I9NA 1ZFNA 4NFHA 2VN8A 3HDJA 3FWZA 4WCFB 1H6AA 4BKPA 4D3SA 4O1MA 2HJRA 1CWUA 2YZ7A 3CKYA 3OIDA 4ZVVA 4GMFA 4Q3AA 3ZZNA 1VSUA 4BNHA 1UR5A 4LISA 3FPCA 4AL4A 5AVOA 1IPEA 3ZW8A 3OQ6A 4O59O 3WG9A 3MJCA 5KJCA 3N74A 2QX7A 2OHXA 3JQBA 4JBIA 5G2OA 2IXBA 4YB8A 1NPDA 2FP4A 3D4OA 3ONEA 1B3BA 3CSDA 3HDYA 4A03A 3JCZA 1N9GA 1T2AA 4AJEA 3GAFA 3T7EA 3GOHA 1DC5A 1H2HA 3BHMA 1PJ3A 1X7DA 3DZGA 1WLYA 1YBAA 5L4LA 1ENZA 3GMSA 1PJ2A 3NT2A 4IDBA 2FPGA 4E2XA 5EN4A 3SXPA 1F17A 4JBHA 3DZFA 4IQ0A 1EBFA 4J91A 1CIVA 3RVDA 4K1LA 4EDFA 1HF3A 1O0SA 2NVBA 3GRPA 1UZLA 3CEAA 3KZVA 4IMPA 4BB5A 5EINA 4E12A 4Q3DA 1NAIA 4QSMA 5TC4A 3ZHXA 1KVTA 2EF1A 3KM0A 2VZ9A 1IUKA 3VH3A 4MPDA 4E31A 1EVZA 2HK9A 1P74A 1SB9A 3GG2A 4Y8VA 1KS9A 3L0DA 4CMEA 3AY3A 5TT0A 3SEFA 1UZMA 2CD9A 4UUPA 2Q2VA 2ZCUA 5L4SA 1H93A 3W4JA 5L45A 5JY6A 1ZW1A 3GF4A 2J3IA 1V0JA 4DQUA 3JQ8B 4NFYA 1GPDG 4JP2A 4YJGA 1N1GA 1Q0QA 4J9UE 4ALMA 3W8EA 4Q39A 3FPLA 4ND5A 4ESOA 2O7QA 2OORA 1Y6JA 1EBUA 4DLBA 1LNQA 1JVBA 3H4VA 5KNLA 2Q2WA 5TGDA 4BGVA 3AOEA 2AEMA 1VE9A 5BT9A 5L3ZA 4PG4A 3RCBA 3VZSA 4EJ6A 1I5RA 2ZB8A 3RD5A 2YHUA 3ZH2A 3GDOA 3JQ7A 3HN2A 3HB5X 3EAGA 3K2BA 4O63O 2FMUA 2Q1WA 1Z74A 4Q3EA 4J9VA 1LTHR 2AXQA 3GZ4A 3GNTA 4IY1A 4N54A 4DYDA 3QWHA 1XKQA 2FZWA 4NJMB 4A0SA 1YQDA 3HZZA 2CSUA 3UUWA 1NFQA 4C7KA 3UICA 2YW9A 4Z3DA 3R3JA 1QYVA 5T8KA 1DEHA 4AJ2A 4S3MA 4W99A 2NLOA 3VKVA 1QV6A 3RJ5A 4R1NA 5IZ4A 1E6UA 3JQFC 4PLZA 2D0IA 5H81A 3DAPA 2RAFA 3DAFA 3JSAA 4BO9A 2EGHA 4JJFA 4RO0A 1SPXA 4INAA 2H1SA 3E48A 1VM6A 2B36A 5CAEA 2HRBA 1N2SA 3DZBA 3WNVA 2B0JA 4MDHA 1VKOA 5A5EA 1Y8RB 3WGQA 4IUYA 5A3VA 1T25A 4GLOA 1A7AA 1P3DA 2VWHA 1NBOA 3BMQA 4NU6A 1Q1NA 3QWIA 2LDXA 3D5QA 4OOEA 2YDXA 4XKJA 1ZO8A 3DBRB 3P19A 4YJFB 2HK8A 3JQDA 4OOFA 3GG9A 2VUUA 1HTBA 3FD8A 4NK5A 1NVMB 4CMBA 3GFGA 3ROQA 5I8WA 1IE3A 4HFMA 5AYVA 1XELA 4MIEA 1DO8A 3OEWA 4IS3A 3ENKA 1C0PA 1JWBB 1PTJA 5JW6A 1YWGO 4D42A 4YYZA 4NDNE 3ZU5A 1HXHA 1ULUA 2AQHA 2Q2QA 2R00A 3H5RA 1Y8QB 4EITA 3WQSB 3HQ4O 1I33A 2VTDA 2J3JA 5K0ZA 4B3IA 2NSDA 3D3WB 2Y1FA 4J0FA 1D1SA 5CPBA 1QG6A 2YYYA 4YAKA 3DZHA 1R0SA 4DMMA 4BNZA 1QYXA 4CMJA 2I9PA 2I66A 2EEZA 3HNPA 4J3FA 4CV1A 4YRBA 3ZN2A 2GZ1A 1I3MA 4CLOA 2O2YA 5I8ZA 5B12A 4PG7A 5JMPA 4CR7A 4MIYA 5ENVA 1FDTA 3NKLA 4E33A 2NWQA 4FFOA 2VTEA 1WDLA 5EPOA 5IJZA 5I7FA 2EGGA 4JQCA 1TB4A 4F46A 3NEPX 3Q2KA 1YB5A 2HRZA 1YONA 3W6UA 4W6ZA 4FFPA 4OKNA 2W2KB 3DEYX 4MVJG 3WYCA 4XIJA 2OOSA 3PJGA 5BNTA 3RUFA 3KLMX 3CMMA 3EZLA 2J5QA 1QXSA 1V6AA 3ZWPA 1XQ1A 2GN9A 2VZ0A 1XDWA 3Q0EA 4B4VA 1ZIDA 1U2DA 4MJLA 4RPLA 1ISGA 1A4IA 4ZRMA 5G0UA 2C20A 4HNGA 2D8AA 3O4RA 3OIFA 1OAAA 5F1KA 1BDBA 3ANMA 3GGPA 3PWSA 4RCVA 1XA0A 2Y1OA 2FR0A 2O50A 1HZJA 3E1KA 1WXDA 2WD7B 3KTDA 1BVRA 5CDSA 2JCYA 3IL2A 2PD3A 2Q1UA 4RL6A 5JLAA 3COSA 4YT8A 4G81A 3H8VA 2X4GA 3IS3A 2QZ9A 3CTVA 2RCYA 3TZCA 5KVSA 4M8SA 1BW9A 1C1DA 4I1IA 1I2ZA 1OI7A 1X1EA 3AFMA 2HCTA 4JP3A 2EW2A 5DT9A 2Q4EA 1E1MA 2A94A 2Y99A 2NU6A 1KOLA 2I6TA 2GF2A 1K3TA 2D5AA 1XLTA 5AOVA 3ROMA 2AMFA 1HKUA 3NJ4A 3QVOA 3HFGA 3QVXA 1WZEA 4IJWA 2ZIZA 2VNAA 1DLIA 5DCYA 1I36A 2ZTUA 3OJFA 1I2CA 4FQ8A 1PS0A 2CMDA 3H6KA 2OP0A 4YAIA 5JYDA 3LT2A 4WCDA 1GR0A 1LSJA 3UCEA 3CZMA 1Q0HA 3KYBA 1E3IA 1HRDA 1U5AA 2QQ5A 3LT4A 4K6FA 3EC7A 3RBVA 4DL9A 4YAEA 3D4NA 4HFNA 4BGIA 2PZMA 4YJDA 1T2EA 1LLQA 5G0WA 1EMDA 4FD3A 3TSCA 1U3VA 3I6IA 2PGLA 2W98A 1NWHA 4IQ8A 2C0CA 4R1TA 3OBBA 2YHIB 3K2EA 2W8ZA 3UXYA 3WWYA 3ZU2A 3U49A 2G82A 1JKIA 5C7IO 3WJAA 1HDXA 4YWJA 1WVGA 3JQBC 4R3NA 3SJ7A 1X13A 1YJQA 3D64A 4GGPA 2DQ4A 4I8XA 4IZIA 3QQPA 4Z9YA 5C37A 4PG6A 2NQTA 1LLCA 1VL8A 2FWMX 1MXFA 4AVYA 3RBXA 3IP3A 4E2ZA 3RFTA 5F5LA 1YS4A 3GUYA 3IDSA 2OFPA 3PJFA 2B4QA 4Y6SA 3EUWA 3TZKA 2W4QA 2GCGA 2YV1A 4CLRB 1WWKA 4HADA 3I23A 3UVEA 4ID9A 1R4NA 4MVJI 3NV9A 1U9JA 2X8LA 3CXRA 3JYOA 3RUCA 5JDIA 4D0RA 1H94A 4ND2A 2NVUB 5HRUA 5KOIA 4RPGA 4M55A 3VPXA 4CM6A 1HE4A 1NVTA 4OGWA 2AEJA 5DOVA 1R66A 4CODB 2JFHA 3HG7A 1EE2A 4BNLA 3QSGA 4KQXA 4Y98A 4CMEC 4ND3A 2CDAA 3M2TA 5AXDA 2WE7A 4CQMA 3D0OA 1NFFA 1XGKA 5I7SA 1TT5A 4W4TA 4XZ3A 1ISFA 2W90A 1U3WA 4BNWA 1NQ5A 2G76A 3GMDA 1LLUA 1YKFA 4HBGA 2GYYA 4ZICA 1PJBA 1TA4A 3K8ZA 3AM3A 3EVTA 1JN0A 2BLLA 1JW9B 1PQWA 3GEMA 1U8XX 4PVDA 4IM7A 2GN8A 2WDZA 5I9MA 1ZK4A 5BQFA 1HDOA 3M1AA 4GX0A 3SLGA 2RH8A 3DHEA 5THKA 3WGZA 2HJSA 4BNVA 4LCJA 2VHVA 3AOEC 4I5DA 2SCUA 4UUOA 4XA8A 1U4SA 3AFNA 1KVUA 4FC6A 1HETA 1Y81A 2X9VA 3PQFA 2PWZA 1YVEI 1D4FA 3RUIA 5KKAA 5L51A 1XIVA 2YFHA 3O26A 3E8XA 8LDHA 3KV3O 4ZN6A 1NQOA 3DOCA 1GCOA 3WTCA 1BWSA 5CEEA 2EV9A 4OHUA 2C29D 3H5AA 4MOWA 4AJIA 5G0TA 3VHRA 4IZHA 4CLHA 1V9LA 4AJOA 3K96A 1WNTA 3FF4A 1HSZA 1SBYA 4WNCA 3VAZA 4NFSA 5T8KC 1HDYA 2CVQA 2FSVA 4RF3A 2DFDA 3BYZA 5A9RA 2HUNA 3OQ1A 4QTZA 1UP6A 1B8PA 3BMCA 1PJCA 5A02A 1C1XA 3PLRA 2ZK7A 3RU7A 4D44A 1QMGA 3MJTA 4PGFA 2HMUA 3HADA 5T67A 2O7SA 5JSFA 2DBQA 3S2GA 3LZ6A 1TT7A 4P4GA 1CJCA 1BDMA 3DMYA 1PGJA 1DLJA 2CVZA 1KC1A 4MO2A 5A9SA 2AG8A 2E4AA 3E18A 5HBRA 1AN9A 2VQ3A 3PGXA 1Z7BA 4IMRA 1K0UA 4KQWA 5G0SA 4H16A 1VJ1A 4IQGA 5TNXA 1Z7EA 3QVTA 3PYMA 6ADHA 4B8ZA 2B37A 2EHDA 4XQGA 2BFAA 3I6QA 4PRKA 1ZEJA 1JVSA 3L07A 5DULA 3EVNA 3ZU4A 2GUGA 1JU9A 4AJKA 2FR1A 4BVAA 4M54A 1BXGA 4LW8A 3A06A 4XJSA 1M6WA 3C1TA 1ENYA 3GHYA 4Z0HO 3UGKA 3X2EA 3OMLA 4ONEA 4YPOA 5THQA 4BHTA 4YAJA 1J49A 3WQRA 2P2SA 4FGWA 4RORA 1IYZA 3ZCXA 2DBVO 4EEXA 1V8BA 4MP3A 3UKOA 5JO0A 1OBFO 3KB6A 1X14A 2EKQA 3UW3A 3L4BA 1QR6A 4URFA 3PDUA 1NP3A 3VVBA 4DYVA 2E82A 1ZSYA 1N5DA 5JY1A 1S6YA 1V3UA 1U7HA 2D5CA 4OSPA 2WTBA 3JQAB 1DFGA 2PKQP 5DCWA 5IN5A 3ZU3A 2X5OA 2X0JA 3UFXA 1CQIA 5BSFA 1ULSA 4WPGA 1DC6A 1EVIA 3W4KA 5JCXA 4EJMA 4IDGA 4IDCA 4S1VA 4YBZA 3WYEA 5HWSA 4FFNA 3O9ZA 2VNSA 5L7TA 4CLEA 4J6FA 2WSBA 4B3HA 1LJ8A 4B4OA 3ENNA 4E0BA 3I5MA 2DT5A 4R41A 1TEHA 2B5VA 1GZ6A 4J4HA 5EERA 4NMHA 1PWZA 2ZJ0A 3X2FA 5F3RA 1BSVA 1SZJG 4OH1A 5MDHA 2JCVA 1V3VA 3WXBA 1ONOA 3M6IA 3OA0A 1VLLA 3AY6A 1HYEA 3MJVA 4UVDA 2PH3A 4BOYA 2VCYA 1CF2O 3PHGA 5LC1A 2Q49A 1E1KA 4EZBA 3ULKA 1O6ZA 5JAMA 3SVTA 1OZAA 2Y0DA 4ALLA 1H6DA 2JFGA 4E30A 2GZ3A 4Z6KA 3ZWVA 4JJIA 2RHRA 1PSDA 5DBGA 1EQUA 4E3ZA 2X86A 3KETA 3H7AA 1ZNQO 3O03A 1DRWA 1R0KA 3GUCA 2NU9A 1HL3A 1ZSNA 1I3KA 3LLVA 4XGIA 3V2UA 3OH8A 4QXMA 1R6DA 3AUAA 4PLYA 1JAXA 3QVSA 1KBZA 2IEBA 3MJSA 4CM4A 4HNHA 1JKJA 2J3HA 3CINA 2QRLA 3N7UA 2YFQA 2B4TO 1IZ9A 5JE8A 2Q4BA 3DFZA 1Z45A 4P8RA 3RFVA 3F1KA 2RH4A 4FJ0A 4KDFA 4CUJA 3WMWA 1ZEMA 4DQVA 2HQ1A 3Q9UA 3NGXA 4DBVO 1E7SA 1I8TA 1E7MA 1I2BA 2V6FA 4CM7A 2IDZA 4L9RA 4LCEA 4D3DA 5DP1A 4BMSA 5B4VA 4E6PA 4BNYA 3LT1A 2WEKA 3QIVA 1MA0A 3D4PA 3LYLA 4ILKA 5COBA 1NR7A 4PLVA 2PGDA 7ADHA 1KVRA 1SOVA 2PFGA 5EJ2A 3VZPA 1M66A 4GBJA 3QE3A 1R16A 4O5OA 2QRKA 1JLLA 2WYVA 4BO5A 1H9BA 2BD0A 5F1OA 3EHEA 3RU9A 1M75A 3C7CB 2EIHA 4WCFA 3NYWA 2QW8A 4IPTA 1T4BA 3VZRA 1PS9A 1NXQA 3F9IA 5A03A 1ENOA 3ZV3A 4YAGA 1HYGA 4F45A 5JDIC 1KY5A 3NTQA 1ZCJA 2BHLA 5EL0A 4DXHA 4ZQFA 2BGKA 2GZ2A 5CEFA 3QA9A 1RM5A 2P91A 3OETA 1BMDA 4AFNA 3PK0A 1C14A 1QSGA 4NBUA 2Y0CA 4N5NA 4R9SA 4PIVA 4G65A 1DFHA 3SC6A 3JQEA 1JWAB 4HFJA 5F5NA 4GQAA 1UXJA 4FC7A 5CP8A 4CM5A 4W82A 3TDKA 3C7DB 1X15A 2IYOA 3PYLA 4ALJA 4GI2A 1WP4A 5KJFA 3DBLB 2P68A 3KBOA 5ICMA 4ITUA 2DU8A 4FPXA 3ZWCA 1UDBA 4KUGA 3EMKA 4R9RA 1E0DA 3SJUA 4ZA2A 3VC7A 1EDZA 1CETA 1PS8A 3IQDB 1EEHA 3DO5A 3RASA 5CDYA 4E4YA 1HLPA 3JYPA 3JV7A 1BG6A 2EERA 4Q3NA 1HWYA 3LLSA 1SO8A 1OC4A 1X7HA 2VT3A 4J2OA 4MKRA 4R5MA 3MTGA 5IAAA 4FGSA 2FPPA 1ZUD1 3E9NA 3ZWNA 4WLOA 4WECA 3GDGA 4AJLA 1LSUA 3KO8A 1K89A 3PHLA 3ABIA 3GVHA 4ALKA 2HMVA 4HWKA 1Y9EA 5ADHA 2PTGA 3FR7A 3TZHA 1EQ2A 4XRGA 3JQ9C 1RWBA 4N5MA 4NBWA 4E5KA 3NGLA 5DP2A 1DC3A 4CMIB 4A73A 1ORRA 3DBHB 3JQ8A 4HY3A 5I7EA 3ZNOA 2X58A 1ADFA 5IFLA 3LSYA 1BXKA 3AU9A 1PGNA 1IB6A 3R1IA 5KKCA 1T24A 1NWCA 3VZQA 4OQYA 1Y7TA 2A4KA 2XPCA 5KJ6A 3NRCA 4A7PA 3DL2A 4TSKA 1T1RA 1YJ8A 4DMLA 3T7CA 2AE2A 3KYCB 4UEOA 5AXCA 3QVWA 1N9GB 4R5HA 5B1YA 1PGOA 4UAGA 1GDHA 4OXYA 3U4IA 1XYGA 1NHGA 1LDGA 1LLDA 2BKAA 2BF7A 3CMCO 3AUUA 2ZTMA 2DC1A 4J49A 1RYEA 3PWZA 3ETDA 3H3JA 1WMAA 2HMWA 2V6GA 3DZJA 2XXBA 2X5KO 4IJVA 4QEDA 2VHWA 4DQXA 4LN1A 1IHYA 3BTSA 3GFBA 1ID1A 4CMCA 2NTVA 1GU7A 1UAYA 1Y5MA 3K5PA 3BXXA 4KDEA 2P4HX 1NPYA 1PR3A 3QW2A 2GGSA 5CDTA 1N92A 2YJZA 1H0KA 2PK3A 4U5QA 4XD2A 4XQ9A 4IIUA 5DDIP 1Y8RA 3H2ZA 3V1TC 1WDKA 5KVCA 3AW9A 3IOYA 1QORA 3AY7A 3PJDA 1E7RA 3NAQA 3E03A 2Y1CA 3DBRA 1CEQA 1X1TA 3NT5A 4D7AA 1PZFA 4YJFA 3L4BC 4YRAA 2X1HA 5HM8A 4XR4A 3DDNA 3GLQA 2J8ZA 3AM5A 4HFRA 5JBIA 1LDNA 4WJZA 3OF2A 1DC4A 2BRUA 3PTZA 6LDHA 4EUHA 1OFGA 1UUFA 2DTXA 2WWRA 5ER6A 1EDOA 2BH9A 3IP1A 4RJTA 1Y5RA 4JCOA 3NTOA 3NJ8A 4QT0A 4I5FA 1P44A 4AJNA 1GUYA 1LXCA 4A26A 2H6EA 1VJ0A 4XYMA 4DPMA 1Y8QA 2GR9A 4RLSA 2XF8A 4OJNA 3ASVA 3D3WA 4HKTA 3Q1LA 4RPHA 3SBOA 3UAGA 1N8KA 1S7CA 1ML3A 3ITKA 4EBFA 3PHIA 3TL2A 1E7YA 1FDSA 2GRAA 4N7RA 2O3RA 2D2IA 3KSZO 5KVQA 4X54A 4JLWA 2V6BA 3RJ9A 3NDRA 2WD8A 5TX7A 4JN6B 3S2EA 4CQMD 3R6DA 1YB4A 4PLHA 2EKLA 4J4BA 1DHTA 3C8MA 1MGOA 4L4SA 4OM8A 2FRDA 4IDFA 4YJHA 5CDGA 3UOGA 3ASUA 1P1HA 3GT0A 3I83A 5KJ1A 4NZ9A 1ZKMA 3OFSA 4BKOA 2NM0A 3DTYA 3Q9NA 3BMQB 1PL7A 1YO6A 4BKRA 3I4CA 4KWIA 2G0TA 3TZQA 4D45A 3IUSA 3NT4A 1GFSA 4BO4A 3PRJA 4IXWA 3FN4A 4XWYA 3QV1A 4W7IA 3NDJA 2IEDA 4PZEA 1YOVB 4TQGA 5B4TA 4LK3A 5A5FA 1WPQA 1ZK1A 2B5WA 3RIHA 1XWFA 4XGKA 2DM6A 2IXAA 5ILOA 1J4AA 5ER9A 3JD0A 3KEOA 4PLTA 2WD7A 5G4KB 1OOEA 4CL8A 4WLNA 2NVWA 3PVZA 1ENPA 4LSWA 4RVGA 3BMOB 4XYBA 5K6AA 3U09A 4YCAA 2EJVA 2VWGA 3W8DA 2G1UA 5BSEA 1C0KA 3U5TA 1HDGO 2EWMA 1RKXA 5A4DA 3E82A 5T64A 3GRKA 3ZWXA 1SCUA 4F6CA 4YA6A 3BTUA 1B3RA 3O38A 2PD6A 4HP8A 5JS6A 2IZZA 1F8FA 2Q46A 3VTZA 3DAGA 3L9XA 3RSHA 3RUDA 2A35A 3ITDA 3OEYA 4DIBA 3FCOA 3L4SO 4PRLA 2QG4A 2AQKA 2VWQA 3IKVA 3SC4A 1U3UA 4QUKA 4DUPA 1CRWG 1HDCA 5GZ3A 3BTVA 4O6VA 1G6KA 2I99A 3HDHA 4DPLA 4ALNA 3NTRA 3S1LA 1XHLA 4WCFC 1NQTA 3ON5A 3WBBA 3B20A 2OUIA 4K9DA 1N1EA 4BNTA 4XYEA 5TJ9A 2OXIA 4GL4A 2UYYA 2BFPA 4CL3A 4CMAA 4E32A 1D1TA 3UH1A 3U9LA 2OL4A 2JJYA 3E5RA 1LI4A 1U4OA 4BGEA 4P4NA 4XB2A 2YHIA 2E6UX 1VKNA 1I24A 3OJOA 3RC9A 4DIFA 3TJRA 1H9AA 3ZNQA 1U5CA 1JAYA 2E37A 2Z1MA 2HDHA 2Q45A 1UH5A 1PJ4A 3V2GA 1NVGA 3W4IA 1P31A 3VH2A 2DAPA 1UXKA 3DXFA 3I9OA 4FDAA 2B83A 4B7UA 2Y0EA 4YEDA 1BGVA 4YTEA 3ZHZA 1YBMA 4RF5A 3DOOA 3WSVA 1G1AA 3EGOA 2OZPA 4XX0A 3CH6A 4IIVA 2AEFA 4FOOA 2O23A 4XIYA 2DUUA 2ZYAA 4IXTA 3GN2A 3VDRA 4CLRA 3ROKA 1PQPA 1I30A 3GVCA 2JL1A 2ET6A 5G4LA 4EYEA 4CM9A 3H9QA 4GGOA 2ZTVA 4BS9A 4KMSA 1ZK0A 2NVUA 1UP4A 2WMDA 1AHIA 3LDHA 4UVGA 3HN7A 3ZNPA 3ANNA 3AUSA 3DFUA 1BTOA 3MWEB 5HS4A 1E3WA 1RM4A 2VOEA 2OGUA 1O95A 3FHLA 4CUKA 3LVFO 2AHRA 1VC2A 3JTMA 1GQYA 2PV7A 3RKRA 4Y67A 1KEWA 4BNIA 3BHIA 2X9GA 4IINA 1E92A 4TRJA 3WSWA 3KSUA 3OJLA 3E5MA 4BMVA 1I32A 3VKUA 4E5YA 1PR9A 1MG0A 1WZIA 4R16A 2GN6A 2VOJA 1P1RA 3FNEA 3OJ0A 1GZ4A 4LVUA 2P9CA 3ZWOA 4H15A 1FDUA 5B37A 4WASA 5C7OO 5JC8A 2D59A 2FR8A 4ALIA 5GZ6A 5JDCA 4NJOA 1UXHA 4WEOA 4CM8B 3RWBA 1G0OA 2H63A 3E6AA 5TJHA 1O9BA 3QHAA 1H6CA 1UZNA 3FBTA 1NTOA 4DC1A 5L95A 3VH1A 1T2FA 1DRUA 4HUJA 3F1LA 3PJEA 1VSVA 1A7KA 2BMAA 3PEFA 1DDOA 4XGNA 4P38A 1P33A 2YUTA 4AJHA 1F12A 2WM3A 4WLEA 3S2FA 2NADA 3FWNA 2JD2A 1WW8A 4ZRNA 3P5SA 4GWGA 1R4NB 4R3WA 1HEUA 1RJWA 1BRMA 4OO3A 4Q9NA 1EUDA 4B4WA 3HHPA 5F1PA 3K30A 4PG5A 4MVJA 4ZQHA 2I67A 1L1FA 2VT2A 3A1NA 2JD1A 5AXBA 2I5PO 1LDYA 1A9YA 2EP5A 4B4UA 4BKUA 2I76A 4TVOA 2P5YA 2PZJA 9LDBA 4L0QA 5TT1A 1PJSA 5GY7A 3JQ9A 3GY0A 4RVDA 2X0NA 2OMEA 3UF0A 1FDVA 3A4VA 4WOKA 1EK6A 3OJEA 4IDEA 2ZKLA 4D46A 1J5PA 1A27A 4BV9A 1PGQA 1ZK2A 4U7WA 1EUZA 1ADCA 3K9QO 4UVHA 2AQ8A 1O5IA 3V2HA 2VRBA 4UEKA 5JC1A 3DR3A 3PPIA 1Z82A 4OL9A 8ADHA 5BSGA 5FI5A 1E3SA 5CG2A 4H7PA 2GLXA 3PYXA 4XDZA 3RQSA 4MVJM 3PLNA 2QYTA 4AICA 4AJPA 3VPSA 3G79A 2G5CA 5DBIA 2X9NA 1YDEA 4I08A 3QLJA 1YDWA 4DA9A 1E5LA 4P4LA 5BSHA 2FOIA 3V1YA 1B15A 1LBEA 2GDZA 5CHEA 4TKMA 1NHWA 4L76A 1E5QA 1GYPA 2VRCA 3F46A 4A27A 2BELA 5T57A 3GC6A 5DNAA 5GMOA 2O4CA 1KIFA 5ENDA 3GZNA 1M76A 3WLFA 4GWKA 1HDZA 4E13A 4LMRA 3KYDA 3BIOA 2VUSA 1VI2A 4Y9DA 4ZQGA 4E2WA 1GEGA 2Y1EA 5I9LA 1U1IA 3JQAA 4KOAA 2VYNA 4YVFA 4CMGA 1F0YA 2POQX 1HLDA 3WFJA 5G0VA 3OM9A 3GDFA 5TSDA 4RDIA 2BI8A 1C0LA 3FNFA 4BV8A 2ZYDA 5B4UA 1W8DA 4JNKA 1GUFA 2NU8A 1LUAA 4DWVA 4R69A 3K73O 4R1UA 5FWNA 3GA0A 5A1TA 3DZIA 4JX8A 3UCXA 4ZHSA 1KEPA 1BXGB 4TKLA 1Y1PA 3NDIA 4YQYA 5K6AC 1IY8A 1BXZA 3HSKA 1LA2A 3ZV4A 3GEGA 2NQ8A 5IXSA 5IZCC 2VYVD 2GO1A 4PN3A 4YACA 4N5LA 3V8BA 3E9MA 4PLCA 3Q11A 3L77A 5CEJA 1KEUA 1N7GA 5IDWA 2Q50A 3WR5A 3GGOA 2YV3A 3GVXA 1SC6A 3ORFA 2AA3A 5IXYA 4K26A 4FFRA 2D1YA 2C2XA 3WGTA 3KVOA 4KP7A 5U9CA 1K2WA 4OXKA 4R1SA 1ZH8A 3H2SA 1IOLA 1GZ3A 4DIOA 1LDMA 3MZ0A 3Q3CA 4A5OA 4QFCA 4YT2A 3BTOA 4DGSA 4TZTA 4MIOA 3TFOA 1TI7A 4AJ4A 1TXGA 4EEZA 2NV6A 4L4RA 1U3TA 3HB4X 4D43A 4KTTE 2NTNA 1PZGA 4MVJF 1XU7A 3OQBA 2GN4A 4YQZA 3H3FA 2Y1DA 4AJJA 2ZTLA 4RF2A 3UHAA 3I9LA 4PLWA 3RBZA 2WJPA 1PQUA 2C5EA 4JIGA 4ND4A 1B7GO 2ZQYA 4BB6A 3F5SA 4KWHA 4OYRA 1ZXBA 1PJTA 2CUKA 3RC1A 5T5QA 1M67A 2AQIA 2B4RO 3CTMA 2VZ8A 4C4OA 1ZMOA 5ES3A 1KY4A 2JAPA 4JGBA 1Q7CA 3QWAA 3WGGA 1OC2A 3OHSX 3VPGA 4KUEA 1ZZEA 3U4HA 3G3EA 4BNFA 4JROA 1K6JA 1PZEA 4MKXA 4RLHA 1T4DA 3U0BA 1GYRA 3PXXA 2W2LA 2GD1O 4IDDA 3NUGA 3F4LA 3QY9A 2WE8A 3JQGB 1LC0A 2IRWA 2VHYA 1VL0A 4CR8A 1XSEA 1Z73A 2O2SA 3QWBA 4DLLA 1PIWA 1KERA 3RKUA 4YXFA 1VJTA 1Q2XA 3CUKA 2QHXA 3GN1A 5FI3A 1MX3A 1E3EA 1I0ZA 4BIIA 3W6ZA 3PZBA 2XOXA 1FF9A 2P9GA 3FSRA 4XJTA 3WIDA 3VPHA 4A2CA 1JTVA 2P5UA 1LRLA 3ZWAA 3DOJA 2EG9A 2O3QA 4Y6RA 2Q1TA 2VHXA 1R4MB 4IBOA 4NU5A 1T2DA 4WKGA 1DAOA 2B35A 3O8QB 1D8AA 2E49A 2OP1A 4I9UA 3WOHA 1N7HA 4GSKA 2NUAA 9LDTA 4ZU3A 1HZZA 2VUTA 4R01A 3EZYA 1PEDA 4NNJA 1EZ4A 4R68A 3ZV5A 4CR6A 2JAHA 1QYWA 4EW6A 5JAIA 2C82A 1P1FA 3DBLA 3GGGA 4EGFA 1IPFA 2E48A 4Y6PA 3IAHA 3WGYA 1QKIA 1CYDA 1GQQA 3BMNB 1VRWA 4WEQA 2AW5A 5JDCC 2EJWA 2DBZA 2YY7A 2PH5A 3B6ZA 1LSOA 2ZATA 4LGVA 4BO2A 2QIOA 2HMTA 1LRJA 5TS3A 3LF1A 3GPDG 4GAEA 2JD0A 4CQLB 1QP8A 4RZIA 2I65A 1QYCA 4F6LA 4OQZA 3B70A 3GHHA 3TOZA 1HSOA 2O4UX 2EP7A 3INRA 4IDAA 4BKQA 3U62A 3A9WA 5L40A 2PGJA 4BNNA 1AE1A 1RM3A 5DN9A 4CMIA 2RHCA 3DBHA 4GKBA 1Z75A 1ONNA 3H65A 3JD1A 1LU9A 2UUPA 5TRTA 4RVFA 1KVQA 2C7GA 4BNGA 4PG8A 1NQAO 4U0KA 2GPTA 3L6EA 1B8VA 2Q1SA 1XG5A 1PJLA 3AUTA 5ITVA 2C2YA 4FR5A 4QO7A 2YV2A 5FF9A 3KYCA 3KHUA 1CDOA 2R6JA 4A10A 1PZHA 1DIBA 2TMGA 3DMTA 4RDHA 2X5JO 4BMNA 2VYVA 5JFOA 4Z0PA 2LDBA 1E77A 2EW8A 1UDCA 2X7HA 4TVBA 5LCXA 5J23A 4ZQEA 2Z95A 4RPKA 1DJQA 1K6IA 4LVCA 2PD4A 1RYDA 3W1VA 4CUZA 3B1KA 3B1JA 3BAZA 4FOSA 1AUPA 4E5NA 4CLXA 3HUDA 2FSSA 2XXJA 1I3NA 3HDQA 1P0CA 3PZRA 2OO5A 4HV4A 3FNGA 1FK8A 4WOJA 1YE3A 3RROA 1DAPA 4NJMA 3G49A 1JKFA 2F1KA 1SAYA 3H9GA 3C7AA 2R2GA 1GUZA 3F4BA 1B2LA 4RPJA 4QQRA 3I9KA 4GLLA 3KUXA 1DHRA 1PL8A 2C59A 1R15A 2HK7A 1T1SA 4NHEA 2CFCA 2WYWA 4UUMA 5K9ZA 4KUHA 1NFRA 4DLAA 1ZVMA 1YL5A 3ZWYA 4CJXA 4WUVA 1P9LA 1X7GA 1ZXLA 3PGJA 2JKVA 1L7DA 1XU9A 2IE0A 3JD3A 2PKRA 2H9IA 2V6MA 1GPJA 3GR6A 5JCJA 3LU1A 4WK6A 4OSOA 3KRTA 1WDMA 1GEEA 2JFFA 3Q2IA 4GSLA 4E21A 2I3GA 5KIAA 4CV3A 1E3JA 1QLJA 3RUAA 4DREA 3FTPA 4YJGB 3V1UA 2X0IA 4CM9D 3OA2A 4PFJA 2FY8A 3ZNNA 1H6BA 3EK2A 1ZMTA 4GX2A 4CLDA 3G17A 1HDRA 1U7TA 3H5NA 5KTKA 1G0NA 1LSSA 5ITWA 4KTVE 3NX4A 1I10A 1BVUA 4YT5A 5A9TA 5DOZA 2P4QA 1DXYA 5LDHA 3JQ7B 4F3YA 2OBNA 1NYTA 3EYWA 4GVLA 2AE1A 4UULA 1MP0A 3WIEA 1LX6A 4JXKA 4M1QA 4MKZA 3PIIA 4I9HA 4NG5A 1HE5A 4XQEA 3ICCA 1HE3A 1H2BA 3D5TA 4J4TA 5CDUA 3OIGA 1B0AA 1X0VA 1DFIA 1SEVA 2VHZA 3D1LA 3SX2A 1PX0A 1Q0LA 4FS3A 4LRSB 5FEUA 2DPGA 1X0XA 2BGMA 3ADPA 3FBGA 1P77A 3EW7A 4E5PA 4XYLA 4TWRA 2JCXA 4BGUA 2Y1GA 2ZB7A 4IGFA 4D41A 5TQVA 4BNXA 3LK7A 1DSSG 1I3LA 4U6QA 5A04A 3WBFA 3WGIA 2IZ1A 3ZHYA 4BO0A 1FJHA 1GYQA 2EXXA 1TVEA 2J6IA 4GMGA 1NAHA 1YOVA 3LC7O 2CF5A 4HX5A 2H5LA 4RGBA 2DPHA 1F06A 1XEAA 5LDGA 3JQ6A 3MTJA 2BFMA 5H82A 2W2KA 4NK4A 5L9AA 1MV8A 3F5QA 3OP4A 2P9EA 4YRDA 5G4KA 1B16A 4BL5A 2Z5LA 3MOGA 1MG5A 4DBZA 3N58A 1ARZA 3BMOA 2GNAA 3ZI0A 3SLKA 4CPDA 1DIRA 1C3VA 4MVJD 3IC5A 4J1SA 3WB9A 3G1TA 4BO3A 4PCVA 4OMUA 1P1IA 5JYEA 1RPNA 1UJMA 4DTIA 1E3LA 1MUUA 1QV7A 1GV1A 2DTEA 4D3FA 1E1NA 4EUEA 1U8FO 4DPKA 5U1PA 4PLPA 3PHJA 3TOXA 1MXHA 5IN4A 1WAMA 2CF6A 2CVOA 4YJHB 4E2YA 5IZCA 3F6YA 3P7MA 1EUCA 1YH3A 1YGYA 3QWFA 4J1QA 5C3MA 3QRWA 4B79A 3OECA 4KZPA 2Y05A 1Q7BA 4CLOB 3OICA 1GADO 4GVXA 5U4QA 3IUPA 3TNLA 3V5NA 4MVJP 1NASA 1O89A 1YL7A 3K6JA 2PA3A 4NBVA 4MP8A 2X22A 5AXAA 3WQQA 4CM3A 1SEPA 5COQA 3PIDA 4ROSA 4O0LA 2IZ0A 2RIRA 4PVCA 2ZQZA 4IJKA 3FNHA 4DRYA 1PL6A 3AK4A 4W9NC 5DBFA 3PFWO 4HXYA 4G5HA 4J7XA 3TQHA 4BO8A 2HAEA 3PDJA 4ZD6A 4NPCA 2FZEA 2VRCD 1YXMA 5L7WA 1DRVA 4XCVA 1K6XA 4BUCA 5MGBA 5HA5A 3AI1A 3JD4A 3MJEA 4R4JA 3RUHA 4MP6A 3FTNA 2YQ4A 4NBTA 4J43A 3IKTA 5DF1A 1B14A 1Y9AA 3PP8A 4I5GA 4RZHA 1A4UA 2NNLD 4NIMA 2ZB3A 3VTFA 5JAQA 3WS7A 2Z1NA 1QLHA 1P1KA 3RUEA 2D4AA 4FJ1A 5L53A 2PLAA 3RC2A 4RQTA 3T4XA 1XQ6A 3JQAD 2VYND 5IDYA 3LQFA 4J7UA 1U2GA 4K28A 3ST7A 2B69A 4IS2A 2IYPA 3C24A 4OXNA 4B8WA 2ZCVA 1BW9B 1AXGA 1C1DB 4ZJUA 2NU7A 4Q3CA 1A9ZA 1QRRA 2Y93A 1A71A 4IJUA 3UN1A 5TIIA 1SNYA 1YL6A 3TN7A 4EJ0A 3ONDA 4QO8A 4D0SA 1EK5A 2J3KA 5F21A 3GAZA 1UP7A 3W8FA 5A06A 3AOGA 2YQ5A 1E6WA 3C1AA 3MEQA 4ND1A 3LC2O 1NR1A 2PKQO 2A9FA 1U28A 1MB4A 2C7VA 4R51A 3PQEA 3RFXA 3INGA 1ZJZA 3ZV6A 1MC5A 5IDQA 3KEQA 3BA1A 4L75A 2JHFA 4J16A 2DVMA 4XQCA 1ISJA 3CPSA 4CM8A 3DB2A 3GVPA 3AM4A 1AGNA 3WGHA 4Q3BA 4GPD1 1L7EA 2DFVA 2V7PA 3ADOA 3VPFA 4BNMA 3DMTC 1IL0A 1F8GA 3U4CA 4MVJH 3R3SA 1MFPA 1RM0A 5EQFA 4RV9A 4XEHA 4CMHA 3QP9A 1D3AA 3S55A 2J5KA 3I3OA 1IHXA 1LQUA 2DBRA 3GNSA 3JQCA 3VH4A 5JPIA 2WYUA 3M2PA 3TPCA 3ANLA 1EVYA 1KC3A 2CNBA 1GQ2A 1PJQA 3AI2A 1HT0A 3MCVA 1JA9A 1DPGA 2ZJ1A 4TZKA 5KVVA 4MVJE 3K31A 1YRLA 4RVHA 2HSDA 2ZYGA 2X0RA 1LDBA 3KXDA 4L4XA 4BNKA 1E3WB 3L9WA 2FHSA 1GL3A 2GERA 5I9NA 3GVIA 2IODA 4XYGA 4DC0A 1PGPA 5EIOA 4BNUA 5T6BA 1CQJA 2C5AA 3U3XA 3HE3A 4J2HA 1R37A 4R54A 2Q3EA 3C1OA 3GK3A 3L6OO 2DLDA 3MJ4A 1DIGA 3WLEA 1YBVA 4L8VA 2PZKA 3WWZA 4Z9XA 3CE6A 3A14A 3AWDA 3ONFA 3S8MA 4Z3KA 1FDWA 1GD1O 2DTDA 2HMSA 3TL3A 1QYDA 4UUNA 4XB1A 3AU8A 3WICA 2ILTA 3ICPA 3Q6IA 4TRNA 1IZ0A 1NPTO 4CQMB 1BHSA 2D3TA 2Y66A 1YQGA 5EQDA 3PFFA 4PZDA 1TT5B 2Q99A 2OBYA 5FYDA 1GV0A 2I3AA 1ONPA 2O3TA 2JHGA 3F47A 4BO7A 3ETGA 3HFSA 1HYHA 2W2LD 3D7LA 1M2WA 3S2IA 3B1FA 4DVJA 3ETEA 3UCFA 1YB1A 3ZHBA 1A5ZA 3WMXA 3EY4A 3KLPX 4BQRA 3IIEA 4WLFA 4AJ1A 3C3XA 1KETA 3GEDA 1UXIA 4AG3A 3WJ7A 1E1LA 4U6SA 4CV2A 5C7LO 4FJ2A 4JK3A 1LC3A 2FPIA 4TROA 4WNIA 3RAJA 1NX6A 2O3UA 1ZBQA 3LC1O 4IGEA 5DCUA 3ROPA 3K92A 4FFLA 2TMDA 1ISHA 2QZZA 1VPDA 5HTOA 1W0CA 4CV0A 4Z0TA 4NI5A 1GY8A 3QJ5A 4BO6A 4FN4A 1PWXA 4N18A 3IJPA 4Z9FA 4MINA 4I9NA 3T4EA 1VL6A 2HU2A 4U0JA 3I1JA 1EE9A 2GSDA 4ZQBA 4TRMA 1UDAA 3PI7A 4JJGA 2Y68A 3BMCB 1CERA 2NTJA 1C1XB 3FR8A 1T26A 1KEVA 1E6EA 3ZWMA 1IULA 4OAQA 2Y67A 5KWEA 5TF4A 4EI2A 3H9EO 5A05A 4EUFA 1D7OA 3JD2A 1C0IA 1DBVO 3TWOA 1ISMA 2FN7A 3DONA 3ZW9A 1DOHA 3IMFA 1ZJYA 4FB5A 5BNFA 3RC7A 3ZDFA 1AXEA 2UV8A 4W7HA 5L7YA 2R00C 4XRRA 4M87A 3DQPA 3VVCA 3PQDA 3DWFA 4D79A 5BNIA 5A9SB 2O3SA 2ZB4A 3OSUA 4GKVA 3H9UA 2YDYA 1T2CA 3G1UA 4UREA 3PWKA 4YR9A 2HKIA 1W4ZA 5KCZA 3RI3A 4CM1A 4XR9A 4PZCA 4J7CA 1NNUA 3WX0A 3JYQA 2EKPA 3DHNA 5BR7A 1MFZA 3JQFA 4RF4A 3HJAA 3GZNB 5HS6A 4NBRA 4M49A 1R12A 4UVEA 2G17A 1KYQA 1FXSA 2A92A 2AG5A 2X6TA 4U8GA 3KYDB 5C5IA 3STHA 1MC4A 4H3VA 4GX5A 4G2NA 3I4FA 3AJRA 2CDCA 1UXGA 1E7WA 1DIHA 3BHJA 3I9JA 5CFZA 2UVDA 5TLSA 4UVIA 1GCUA 5EESA 3WYBA 4C7JA 2DKNA 2X23A 4RQUA 3DTTA 4K6CA 4JBGA 5COAA 1B26A 4TRRA 3D3EA 3DHYA 3P2YA 2PY6A 1UAGA 3I52A 4FIZA 4UEJA 4WE3A 3F3SA 3P2OA 3TF5A 1GAEO 2BGLA 1AHHA 1DB3A 2NACA 3GQVA 4II2A 3WFIA 2GASA 1KVSA 2VWPA 3EDMA 4FBGA 2O48X 3GH3A 4GX1A 4NR0A 3FI9A 5JAZA 1V3TA 2DUWA 3L6DA 3KOUA 3BZUA 1JQBA 1EFLA 4J1TA 5AQ1A 1HE2A 5KJEA 1SB8A 3INTA 3WTBA 2QRJA 1P0FA 4M89A 1O94A 3JYNA 1W6UA 4YDRA 3IJRA 5GZ1A 3GNQA 1J0XO 4LMPA 1LDEA 2O3JA 4NH4A 5JXWA 4QX6A 3ZWBA 3TFQA 2J5RA 1ZSVA 1NM5A 3JYLA 1J6UA 3DC2A 4XDYA 1XR3A 2UDPA 5FFFA 1A72A 2PZLA 2BI7A 4BNJA 1FMCA 3JQGA 2CDBA 1JDJA 1K5HA 3VDQA 1GTMA 1P1JA 2RBEA 3E9QA 5JCJD 3WNQA 4GH5A 1WMBA 4RVUA 1SOWA 2QYSA 2HO5A 3LF2A 4L74A 2F00A 4M86A 4LSMA 4FFMA 1LRKA 1W73A 3FRJA 1DJNA 1R0LA 3MOIA 3TRIA 4YT4A 1ADBA 3ZGYA 5EMHA 1MLDA 1LEHA 5JNLA 4FCCA 2PR2A 4J1NA 4WLVA 1Z6ZA 4NQZA 1R4MA 1PU2A 1YQXA
chains in the Genus database with same CATH superfamily
4B3JA 4QECA 5ILGA 5IKPA 3HO1A 3G0OA 4LOLA 2VHJA 4HQKA 2CWWA 1MH9A 2FMFA 3RBAA 2PMBA 5I4CA 3EPKA 2IHTA 2CUNA 4K1XA 5HOEA 4UUQA 1YSCA 4OP2A 1M7BA 1W47A 1H5QA 2CLLB 2J9ZB 2WJAA 1QOPB 2PX2A 2JGFA 2GLTA 4WERA 5L4NA 2FN9A 5FWYA 3BMNA 4PC7A 4B7XA 4V0KA 3HWRA 4KIGA 4IIXA 4PLFA 3HBJA 3FDZA 3HJUA 1YDMA 2W2VA 3M33A 1JBKA 1J8VA 2PNFA 4J16C 4NQRA 4FFSA 4TXJA 4CM4B 1KKMA 4NBKA 5CA1A 5LP6A 3MT0A 1DIAA 3ZK8A 2NO7A 2UUOA 4WY8A 4U7DA 4NYMQ 2ATXA 1L9XA 4I99A 3TM4A 2FF5A 4II3A 1FBNA 3AP1A 1DAFA 3ICVA 4CQLA 1JG4A 3WIOA 1A8HA 1LQTA 2HLHA 2AFHE 3CUTA 1NATA 4ESHA 2A8YA 3I1IA 4OY3A 1XNQB 4EKIA 3NMUF 3IP7A 5FO0A 3ORYA 4UMFA 3A1WA 1P6QA 3HBNA 2VXYA 4RVSA 4MW2A 1QH9A 2K6GA 3R0IA 1TU0A 4OIMA 1U7WA 3MWGA 3CVXA 3BD6A 4TZ6A 5BN5B 4OM7A 4KLNA 1QU2A 4P32A 1HTTA 1V8OA 3H9JA 3UOAB 3VSCA 3LFTA 3HXQA 5DGIA 2XMBA 8GPBA 1ZK3A 3I9NA 1SH7A 4PFKA 3HDJA 1DARA 3FWZA 1L7VC 1XB2A 3KALA 1H6AA 5AOCA 1HG1A 2WUFA 2XCTB 1Q1GA 3V97A 4GYKA 1GKKA 3CKYA 3L7AA 1SUAA 2V7UA 2JLCA 3O1IC 4NEGA 4Q3AA 4US0R 3HB9A 1VSUA 2P41A 3L01A 4KJXA 4LISA 1TYEB 3ZZNA 4P5EA 4RY0A 2LWIA 4EHHA 3MG9A 4Q3OA 2JCBA 3CH4B 1ST3A 3FLAA 3W5CA 4KQIA 4N03A 4MI3A 2EDCA 3H11A 5KJCA 1TUIA 3N74A 3OIUA 4ZOLA 2VPTA 3QE0A 3JQBA 4ZZ3A 4ZODA 3JAKB 2JPDA 5I01A 1IEQA 3CSDA 3O8NA 2GPBA 1Z56C 1YJBA 2WJ6A 1CUEA 2ZWAA 4M53A 4PO3X 5HJEA 1DKLA 3T3EA 4E4TA 4BXOA 3DXYA 3Q7EA 3EZ6A 1H2HA 2JI6A 4RFVA 1ZGHA 1X7DA 1SVKA 2G88A 4JEHA 3DZGA 5FD8A 1WLYA 4P0PB 3NT2A 4JR1A 5FADA 2OKCA 4Q03A 1G3UA 1F17A 2YVAA 3P0FA 3SEQA 3OIWA 1DINA 4HEQA 3B3GA 3JTEA 4J91A 2IUYA 1YUNA 3F67A 4EDFA 1O0SA 2MR5A 3KZVA 5EC8A 3WRXA 1JHAA 1XDUA 3MWYW 3GRYA 4XASA 4PANA 5A6VA 3O4IA 4Q3DA 2YXBA 1H0HA 1WE2A 1NC3A 2EVWX 2XE7A 3ZQUA 3HVRA 1F9AA 3AZQA 4U63A 2CCKA 3VQTA 2EF1A 3BZBA 3O91A 3VH3A 2AKYA 4PCLA 1EVZA 4IDHA 4LHEA 1P74A 1OFCX 3GUVA 4Y8VA 7ABPA 5KQLA 2R6GA 1VA5A 1U1DA 2VAVA 4GOMD 1UZMA 1REQA 5KCMA 4DCPA 1U65A 1ZDMA 1DAMA 1B8NA 1L8XA 1UQTA 4AX8A 2ZJ7A 2Q3CA 3WXMA 5JY6A 1Q1ZA 3ZZ0A 3D6TB 2W6CX 1V0JA 2V7GA 3JQ8B 2ZUUA 3OVMA 1EP2B 1YD7A 3B52X 3EQ6A 3L8MA 4HNAB 4U00A 1NN0A 4WZBA 2WG1A 3OFKA 3UAYA 5BMVB 4D2IA 4BTLA 2Y6VA 3TO5A 3UGJA 1Z6TA 3KKNA 4ND5A 3TB4A 5BUZA 1IRIA 1EBUA 2JVJA 4DLBA 5JCOC 3FOFC 3MS2A 5HBGA 2PMEA 4FYPA 1YFJA 2GBLC 5FPKA 3IQHX 2I6FA 1YULA 5DYWA 2AEMA 4IDQA 3OFVA 4IF4A 3KVRA 4PG4A 3RCBA 4BGVA 2VIIA 4ON9A 3B89A 5AKZA 2IOQA 4G1EB 4KDCA 4TS4A 4MW1A 4X3PA 4A4DA 4AWAA 1QPZA 1JFRA 3HN2A 2YRWA 3R0VA 2FMUA 2PJUA 1D2CA 4P2BA 2HSJA 4QD3A 1Z74A 1TIPA 3CX4A 2LGJA 1FZTA 3O1HB 1QONA 2CHVA 2AXQA 3TRDA 1S8NA 3IR7A 5I3CA 2YWEA 3LRTA 4Y2GA 1SKMA 1E5DA 2FW6A 3EVZA 2COKA 3G2NA 3OOSA 4KV7A 4OP1A 4NCIA 1OX4B 3SQLA 1YQDA 4TZ0A 1IQRA 2CSUA 1NFQA 2WJHA 4RL4A 1KAQA 1IMJA 3TLXA 1HTWA 2YW9A 5BOSA 4R6XA 1ZC4A 3FWHA 3SPXA 3IALA 4BVFA 4MSUA 1K75A 3H1TA 2ONCA 4YDHB 3ILYA 4W99A 4TTQA 4Y1EA 4R1NA 3OPYI 1E6UA 1G63A 2ZJ2A 5ALKA 4EJFA 2R1VA 2JFQA 3DAFA 3IOMA 5F4ZA 5CA1F 4CL2A 1R6BX 2EGHA 2XV1A 4M8NE 4PRYA 2R1ZA 4V0NA 4BO9A 1FVOA 1Q3TA 1SPXA 1OA1A 5E1OA 4IVPA 2B36A 3R9KA 4L5CA 2DWQA 3K35A 3AF5A 2CXXA 3DZBA 4L2IB 4ACAA 5K0JA 2B0JA 2I80A 1VKOA 2JHPA 3ZX5A 4P6VF 4UHKA 4E4RA 3BIWA 1UMCB 5A5EA 1HT3A 3RJTA 1RQPA 2FP3A 1KK0A 1MW9X 3OD1A 1A7AA 2YMLA 2ZYVX 1K8ZB 1DU4A 1GU1A 3P4YA 2X1LA 1Q1NA 1Y4AE 1JHPA 2AKAB 2PKCA 2F43A 1LWOA 2O57A 3PDHA 4LE0A 4UCQA 4XKJA 2X15A 2B34A 4HRXA 4QQFA 3ZIDA 5K09A 1UT8A 2VYFA 2C7PA 2C7QA 1RQ7A 4RHCA 2VUUA 1HTBA 4UE3S 4IEIA 4NK5A 4TTJA 1RU3A 4DMKA 1NTRA 1N3IA 3MOSA 1TVKA 3GFGA 5I8WA 3G88A 4PE5B 1XELA 3E7WA 5ALQA 1MJGA 4EHNA 4DHEA 3SR3A 3URKA 1DO8A 3AIMA 1C0PA 3D81A 3MB8A 1JWBB 3GLUA 3J7AC 1DTSA 2R48A 4V0LA 1YWGO 4BECA 2XVXA 3C97A 1Q0ZA 3FSEA 4NDNE 2IP2A 2PQ2A 2EIXA 1US8A 3DE1X 1DBRA 1FLDA 4J76A 3REQA 1TCBA 2A9JA 3FLMA 1XCJA 2ZJ6A 3MSXA 3W2EA 4EY7A 3L7MA 1I33A 5CNJA 3R9XB 4JVLA 4B3IA 3HEAA 1W30A 1K0FA 1ODLA 4J0FA 1D1SA 1SXHA 1NN3A 4H4CA 1QG6A 2YYYA 1X7YB 3JPWA 4YCBA 4IF6A 3U7FB 4ZOLF 5DNUA 1OXUA 1WHSB 2IDJA 5CH8A 4TTAA 2I9PA 2I66A 3L1JA 4CV1A 5DX8A 4A23A 4KBGA 4WESB 3SICE 1GPMA 2GZ1A 2P27A 5HF6A 4EA7A 2HW8A 2IITA 5CJPA 4PZPA 3OMXA 2QTFA 1AHNA 2VJBA 1QG2A 3EVDA 4FOTA 4PG7A 5ENVA 5JMPA 2CCJA 3M82A 2GRUA 1FDTA 1POXA 5LA6A 3SN6A 4AM8A 3QBEA 4BP1A 3O74A 5JANA 1WDLA 2BGJA 5EPOA 2RCNA 5IJZA 4N3AA 2VP3A 5AK6A 3W8RA 2UYGA 1Z39A 1GAQA 2PUEA 3M3HA 3PUKA 4RD2A 1ESNA 1C7IA 4DV1B 1PT5A 2F64A 5DU2A 2O05A 2HRZA 2ZR7A 4AMYA 1YONA 2H2AA 3AEXA 1I7SB 1JZTA 1J5EB 4V38A 1JH8A 1DCTA 3GQBA 3MCAA 4MWOA 1UQRA 2XMPA 4DR1B 1AKMA 3FWKA 1GPWB 4XIJA 3D02A 3PJGA 1LZKA 1RACA 2A9OA 1L7OA 2W00A 3TLJA 2BM9A 3E3AA 4B82A 5BNTA 3SVLA 1G5HA 1XLWA 2J5QA 1ZM4A 4G41A 1XQ1A 2GN9A 2OE2A 1XDWA 2LZ0A 2QRHA 1Z83A 2Q9CA 2XNJA 1X74A 3B85A 3PRHA 4C14A 2VF2A 4BLWA 2R97A 2C20A 4F96A 1KY3A 2GEUA 1HE8B 5B5SA 1OAAA 1XO1A 4TXNA 5K0SA 1F2UB 4MR8B 1XDSA 4TSFA 3ZXXA 4M0DA 3MNFA 2Y1OA 5HKLA 2ZETA 3T9FA 5DM4A 3E1KA 5DH9A 2HD4A 5DYGA 2O1XA 2WD7B 2SKEA 4X93A 3L05A 1H4SA 2D5BA 1U9ZA 3IL2A 1SUIA 2A30A 4MUJA 2WFZA 4RL6A 1JQ3A 3T15A 3H8VA 5BXYA 3CTVA 5I9BA 2GX6A 1ABBA 1SG9A 4HWRA 4JUIA 4YCJA 5D3ZA 1C1DA 2FUNB 3MGKA 4NPHA 1EUCB 1FYVA 1OI7A 4KPFC 2M6LA 3GLFE 1ZRNA 3K5HA 2Q4EA 1EIZA 5DKFA 3UEOA 4WNYA 2GKSA 3M6LA 1K3TA 4G0OA 5DGXA 1Y3FE 3ROMA 2OVBA 1DT3A 5T4BA 2RGCA 1WZEA 3NI2A 3ZHRA 3LTNC 2AL7A 2VNAA 2XSZA 1P4HA 1AJEA 1DLIA 1MQ9A 2ZTUA 3PD1A 5GADl 3FYUB 2NGRA 3H6KA 3CH7A 3G2IA 3N28A 4WY5A 2Q29A 4YAFA 2O0HA 4YAIA 5GIPE 2O8EA 3FAZA 3M83A 3E53A 4MKFA 1GR0A 2CB0A 1LSJA 3MILA 1Q50A 1K7CA 1L4FA 2VT6A 1JB1A 3EA0A 1HRDA 3KYBA 3WP1B 2QQ5A 4XQGA 2H54A 1QRSA 4Q4HB 4G25A 5E8JA 2LVBA 3RBVA 4IKPA 1DQSA 2ONZA 1Y98A 2CKDA 3T61A 2BHRA 2CZQA 3HP7A 2VEOA 3RTCA 4HYYA 2K87A 3FF1A 3FW1A 4FD3A 2DFNA 1WRBA 2AZTA 3KV1A 5JJ5A 1U3VA 4DAEA 3MS4A 2PGLA 2PLNA 3VZBA 3GEIA 1UF9A 2NT3A 3TEJA 3ZU2A 3U49A 1AQYA 4BZPA 4ZGGA 4GXTA 1G8HA 4QUEA 4OQEA 1SCQA 2VH1A 5IT0A 1Y3IA 1SC9A 1KI3A 1WUIS 2V4MA 1E9BA 1YJQA 2EATA 2QU7A 4O4LB 1KO5A 2R4QA 1EX1A 5HMMA 2PRJA 4AWXA 3W04A 3EISA 3QQPA 4PG6A 2FWMX 4CI9A 4TUYB 1MH1A 2ZSKA 1UOEA 4JENA 4KR7A 4LY9A 1D2RA 1FQJA 1RZVA 4KH1A 5F5LA 4CRWB 5KOHA 2QB5A 1KU0A 2DXIA 4MUAA 1KZHA 3ROTA 3O4VA 1NJ6A 3TMAA 3RWOA 2JGAA 1XNHA 2JLZA 2GCGA 4PQFA 4M22A 4NCHA 1RJDA 5F2OA 3Q88A 4MYCA 2Q6KA 3R6LA 4XOIA 3ROFA 2FB9A 4Z4IA 1H1LA 1U9JA 5EGSA 2X8LA 3CXRA 2YVLA 3DOHA 2P0YA 3JYOA 1ID8A 4ZT3A 1QCZA 4QAJA 5FQNA 5I51A 1ZR2A 1FMTA 2ZR0A 1FX1A 3LYHA 2C2HA 4CM6A 3GFSA 2NTEA 4UXIA 1VJ5A 1NVTA 3B6EA 3FM9A 3LTEA 1CLEA 4M0LA 3S1AB 4KQJA 1Y7IA 5DOVA 2SECE 1KAHA 4BNLA 4K9OA 1YU6A 2X6RA 1MRZA 2X3FA 3BWCA 4LWPA 3TQCA 3D0OA 5I7SA 1K7EB 5IWCA 1EUYA 3NIDB 5B7QA 2AOWA 2ERXA 1SKYB 1U3WA 2BSAA 2G5GX 3GMDA 1N2JA 5GJCA 2Q21A 4D9FA 3DEHA 3WSTA 2B99A 4FUQA 1STOA 5LA6F 4OHVA 1OFIA 4P7JA 2WAYA 5DMXA 1R0BA 5EA2A 3M1AA 4OHXA 1CS0B 4HAOA 1VI5A 2QN2A 3GLGA 3DHEA 1WA5A 4RKFA 3GH1A 4BNVA 2DWOA 1NUHA 4LRWA 4M1TA 3WGUA 1I5EA 4DLRA 4LCJA 3KOYA 3AOEC 1Y1TA 4XA8A 2HR1A 1RHJA 1JDSA 2HTEA 3DKKA 3GIWA 2A84A 1QUFA 1N6PA 3AFNA 3DL7A 3R3VA 4FC6A 1TVCA 2I9KA 4F86A 4RPCA 2PWZA 4X7BA 4PPGA 2CNNA 1N2BA 3W77A 2XYQA 2WP8J 4RESA 1YZNA 5JQGA 8LDHA 1R5JA 3KV3O 2B8WA 1NU8A 2DUJA 3DOCA 3DHVA 1Z5ZA 2PMCA 3Q7IA 4OHUA 2C29D 1F0PA 2E5FA 4PNPA 1JAZA 1JV2B 3NYIA 1JA1A 3QV2A 4RS4A 4JDPA 2DJ5A 1PEKE 2ECPA 3QMPA 4C3OB 4NF2A 2QBYB 1C80A 3FMPB 1BMQA 3FF4A 4A8TA 1SBYA 3VAZA 1KJJA 3AVOA 5T8KC 4C7MA 1HDYA 2N46A 1PR5A 2FSVA 3EMDA 2IS1A 1XZCA 1UP6A 3A6GA 3ZHSA 2JS7A 1SOUA 3T54A 3RU7A 1BWRA 4CG1A 4PGFA 2HMUA 1BQEA 4TTSA 1UFKA 5EKXA 1QFMA 2OGWA 2O7SA 4L15A 5HF5A 5T67A 3B53X 1AS0A 3SQXA 4O2BF 3ZHCA 2IPLA 1E2EA 1TT7A 2Z3VA 4P4GA 2QV7A 1E3TA 4Q93A 4UC0A 5JT1A 5M29A 3FYHA 2WHXA 2VQSA 3TG8A 1QHIA 1H4TA 1WD7A 4I0WB 3OO1A 1E9EA 4RHTA 1DUVG 3DEAA 5E6RB 3E4CA 2IHVA 3TRFA 1DLJA 2ISSD 2C00A 5F23A 5HBRA 4LE1A 2ZSDA 3HR7A 3NXSA 3VV2A 1ACMA 1Z7BA 4E88A 3V4LA 3ZWDA 4KQWA 5MGNA 3D7SA 3OZEA 2APJA 2H11A 4ERXA 3QVTA 2QMYA 2A9KA 2WHPB 4PRKA 4JJ4A 1JVSA 1ZA1A 1UZAA 3FY4A 2GUGA 3D31A 1TJYA 2NN3C 3LM8A 4GD3Q 5HRCA 3DT6A 1PLKA 4KEAA 4KQFA 3KWLA 4K9MA 4RCZA 5F2KA 4Z1MA 3SDZA 2I3ZA 3B9BA 2KLBA 1V9SA 3RRNA 4BMCA 1Q17A 4XJSA 2P40A 3IE0A 3TTYA 1SD1A 1UPFA 3PC8C 3OMLA 1I14A 4ONEA 4MUBA 4RGVA 5A3RA 1EFRD 1ILEA 3U39A 4BHTA 3NHMA 3QH4A 4UM9D 4FGWA 3PPXA 4RORA 4V0QA 4E5DA 4EEXA 3D6UA 1OWLA 5FTKA 4PW0A 3E2IA 3OIVA 1OBFO 2J6CA 4PPQA 4ZWNA 1W93A 1VHWA 1RAHA 2EKQA 1R6XA 3GJ0A 5CXXA 4OPMA 4QQ8A 3UB2A 1FP6A 4N47A 3UHJA 1NP3A 4LV5B 3VVBA 3PJRA 4DYVA 1D9ZA 1CJUC 1CZHA 1Y3AA 2BP7B 4QYSA 4LNUA 1E66A 5LKRA 2QM0A 2RK4A 1S6YA 3TEMA 3A36A 1UK8A 2G0NA 2CLCX 3ANYB 4R71A 1NUSA 4GWLA 3E7XA 4M8IA 1DFGA 2WINI 4OQPA 1UPCA 2X8AA 3DW1X 4KO3S 4GMKA 2X0JA 2YIDA 4KH0A 2HPAA 2OCIA 4PYIA 1NVVR 1SZPA 2W2TA 3VYSB 5JCXA 4IDGA 4JQOA 1Z29A 2H7VA 1LBSA 3QU7A 4M1WA 1TC1A 5HWSA 3RYFA 3WYEA 1FNDA 1IAQA 4F1WA 3NKVA 1P80A 4OU5A 1FQKA 1NXWA 1WMFA 2PANA 4MJXA 3WL4A 2WSBA 1PTKA 3UB4A 4B3HA 1KR2A 2I2CA 3ENNA 5GM2A 4E0BA 5EXSA 4DLKA 1JGTA 2ZPTX 1JSZA 2DT5A 3IT1A 1TEHA 2NSJA 2ZU0C 1ZL0A 4R41A 4UHHA 3F9RA 5DGTA 5LB4A 3HCNA 2GK6A 4R2HA 3ZXSA 1V4VA 5K3FA 1HUQA 3LPCA 3M4YA 1JFFB 1XTKA 2IIQA 4X8LA 5FWYB 5MDHA 2W6MA 1K5GA 4PTYA 1Z63A 4ZVKA 2CV0A 1T8YA 2ZRCA 2RMKA 1NOIA 3D3QA 4BWFB 5FNVB 3AY6A 3MJVA 1ATZA 3N86A 3T5AA 1WABA 4TYPA 4XSGA 2B21A 5CCEA 1EXVA 1L6IA 4BOYA 3W0LB 3VDMA 3H84A 1UOOA 1XPJA 3I2HA 1G6Q1 4A8HA 3LH5A 2ZDGA 4DNFA 2FUG1 3RK1A 3F5DA 3PGLA 4F8JA 5KNBD 4EZBA 3RSFA 4D98A 4TVKA 2Y0DA 4ALLA 1WXWA 2JFGA 3C3EA 4PC1A 4QHSA 2HFJA 2JLQA 4KQ6A 1D5CA 5JQGF 2AH5A 3KETA 1B00A 3AJ9A 5AM0A 2ID4A 3HYTA 1R0KA 1RAGA 3GUCA 4WCVA 1KWGA 2PXHA 3B2QA 2GN1A 3MT8A 3OUUA 1ZSNA 3K1YA 2VG8A 3R0JA 4I4IA 3F9CA 3WWOA 1A9SA 3HJHA 5HKAA 3F4KA 1U2SA 2OV3A 4HGYA 1HY3A 1CFJA 2CXTA 3PB3A 4H7HA 2ISCA 2I6QA 3HKEB 4QJ5A 3LY5A 2GD2A 3LUGA 3K8YA 3O47A 4DDKA 4QODA 2XZTA 4A15A 5AJXA 2IEBA 3I6YA 1NNI1 1Y4UA 5JU6A 3TCNA 2BCJQ 5KTTA 4CM4A 3BEDA 2ZJ3A 1D07A 1R8SA 1EBBA 2XOKA 3PBKA 3CINA 3JQPA 4OK3A 1CNEA 1SULA 2IP4A 3UT5B 2P2LA 2QRLA 3HYSA 4QUBA 2YFQA 5DT2A 1ZWKA 5REQB 5CBPA 5HP4A 1P4SA 1Z45A 3DFZA 3DOFA 2XA1A 4P3KA 4P8RA 3WRYA 4CFZA 2RH4A 3HJCA 4GEKA 4DOMA 1M2JA 1GVHA 2VP4A 2ZUCA 1ZEMA 4XCXA 2F17A 4FLEA 5L6MB 3FTEA 2YMQA 4POAA 4DBVO 3ETJA 4HAUA 1U80A 4ZTZB 2ZSUA 3B7GA 1G5TA 5B4VA 2PBZA 2PX0A 2W48A 1W36C 4HD8A 1FEZA 2Q8PA 1D2AA 3KD3A 4GOJA 4A0FA 2Z57A 1XCGB 4KYUA 2B1IA 4RHFA 4ECAA 1IATA 3SI7A 5BN5A 1SOVA 3RANA 3PE3A 2CHQA 4RTLA 2FDCA 2AWNA 1ORIA 1R16A 2FUG6 1KEKA 1WUTA 2QRKA 4GZ5A 4JV5B 4BO5A 2Y92A 2CJFA 4II7A 1UJNA 3DVAB 2YL2A 2P77A 421PA 1M72A 2ZJ8A 3FWPA 2QW8A 4IPTA 2G63A 3RV4A 4NYMR 4RK1A 1NXQA 2HF8A 2J6HA 3O4HA 4J0IA 2GVDC 4QLOA 2R6FA 3AWIA 4HNSA 5BWCA 1ENOA 1S4MA 3ZV3A 3C3CA 2YRXA 4YAGA 2IUSA 3NTQA 4KLAA 1GGKA 1GPLA 2Z6VA 1CUGA 3N2KA 4JB2A 3OZDA 5FUMA 2J32A 3DYIA 4RV4A 4P34A 4IX9A 4D4HA 3Q3VA 1RM5A 3QA9A 4REOA 4CKYA 3D8SA 4F21A 2P91A 4IO1A 3SIRA 4OTZA 3T3GA 4B73A 2BGWA 2Z6UA 4P0QB 2JDIA 5MN6A 1RAEA 1K4KA 2Y0CA 4N5NA 4R9SA 3GP3A 4OJQA 1DFHA 3JAKA 5GV8A 4MV6A 3JQEA 3TNFA 4D9JA 2HMAA 4LJRA 3T1OA 2MSWA 1AUVA 5CTAA 1I3CA 1UXJA 4RZUA 4NMXB 1NF3A 3LX5A 1ND6A 1OWNA 2GTPA 3QE4A 4C4YA 2IYOA 3Q6MA 5BRJA 4ALJA 1WP4A 1E18A 3QZUA 4LQLA 5TR9A 4BFXA 1GP2A 3KBOA 2WM2A 1CUUA 3I2IA 2C83A 2PUDA 3ZWCA 4FPXA 3H0CA 1NT2A 2EU8A 1A3CA 1Z37A 3DVSX 1L7MA 3I45A 2FMKA 3SJUA 1CETA 2YUIA 3DO5A 3RHFA 4ZZIA 4QLBA 4FZRA 4K6KA 1UK9A 2EERA 3WLAA 3HGQA 2VT3A 4XAQA 1NI4B 5IT4A 4R9VA 5LMCA 2O8CB 3KAKA 1M83A 1QNLA 2GLUA 2ODBA 3BFPA 4OQ4A 4ZMSA 3GDGA 3QEMB 1LSUA 2UVPB 3GLVA 3KO8A 4IHQA 4OJMX 2WKQA 2R4UA 2D1FA 3ABIA 4MGEA 5KNBH 2ODQA 1BJKA 1O3YA 4HWKA 1K1EA 1ZM9A 2C9DA 1U7OA 3BE4A 1QDUA 2DUNA 4IL5A 4EJSC 4XRGA 5IANA 3JQ9C 4NV3A 4LOHA 4YV2A 2CUTA 3N8HA 4LQ4A 3RT9A 2XTMA 4CIBA 5DM0A 2D2XA 4E5KA 5KPDA 4QDUA 1CEXA 4ZZ2A 1DC3A 4OSEA 2ZBRA 1MAAA 1N3LA 3JQ8A 4FUTA 4Q1CA 4TT3D 2QU8A 1MIHA 1FVHA 4WZBE 2UZ3A 3AU9A 1CZKA 3QTTA 4HNAA 4H1UA 3RK0A 4MTCA 3O3OB 2AV6A 3R1IA 2EL9A 4OREX 4A7PA 3HBLA 3PNSA 4NX2A 4TSKA 3FOBA 4D9MA 1YJ8A 4NOJA 2ORWA 2H8GA 2Q5CA 2JIZD 4G5YA 5F77A 4DMLA 3T7CA 3DCJA 3EFOB 3TI9A 1KO7A 4H3SA 5AXCA 3N7TA 3EPHA 1TQ6A 4RA6B 3AB3A 2JAUA 4GKAA 1EJBA 4G0YA 1XYGA 1PJZA 4A8JC 3ODPA 4N48A 1LLDA 1Q7TA 2BKAA 2BF7A 1PBTA 4D8UA 1Z5UA 2ZTMA 2CXUA 4GP7A 4J3JA 1XRPA 4NCKA 5LQSA 1OX4A 3RS7A 4CCYB 3W5AA 5GWXA 1NMZA 3ETDA 3H3JA 4I1RA 1JHMA 2Q3JA 3DZJA 1COZA 1IY9A 2FEXA 2I3DA 2X5KO 2VHWA 3AKDA 2GKOA 4Q4DA 4LN1A 3DQZA 1QMPA 3LV8A 3BTSA 1KS2A 1P5HA 1AQLA 3C4JA 3Q5GA 4F2HA 2DJIA 5BV8A 5CFOA 2J1LA 3SHTA 4CMCA 5BT8A 1S3SA 4L28A 4JC5A 2H9YA 3P96A 1Y5MA 2REOA 1E5XA 2K7ZA 4KDEA 4UMDA 1D2HA 1NPYA 1Z18A 2P4HX 3TNYA 3TLCA 1BEUB 2VF4X 3VR3A 2R79A 1N92A 3EZXA 4L2IA 5DHFA 4LGYA 2HU8A 4RSHA 3OTHA 4U5QA 1UMCA 2YNMD 3V1TC 1U8YA 3P0IA 2J7KA 1JJFA 2AI2A 3AQ4A 4GSYA 4UHBA 1H8HD 1QORA 3H8WA 3AY7A 3PHBE 3PJDA 2AJCA 2VQEB 1KSHA 5M2QA 1Z15A 3NAQA 3E03A 1TX4B 2JIMA 3BD8A 4G89A 4OXIA 1XK6A 1E59A 1MV5A 3C6KA 4DCGA 2OEPA 2W43A 1W5EA 1NG9A 2I2AA 2CJXA 1E2FA 1XAHA 2X9QA 3DB1A 2BFFA 3DDNA 3FRIA 4XR4A 1G5PA 3AM5A 3RKSA 5KB3A 2RJ3A 2MCFA 1IG0A 1RYHA 4WJZA 4XJVA 1DC4A 4TWJA 4XTRA 2XLBA 4HBZA 4X6XA 2JIPA 3WKEA 3WP0A 4EUHA 9ABPA 1OFGA 2FZCA 3AL3A 3KJQA 4W5NA 3WVNA 2WWRA 2DTXA 4MQMA 1U1GA 1GAWA 5D3QA 2FFJA 4HLQB 4EY5A 1PR1A 2Z2XA 1OIXA 4HX2A 5B6JA 5ALZA 4QT0A 3R0QA 4EH1A 4UD6A 5ALTA 1KHTA 5AW9A 2H6EA 3ND7A 3HVJA 4XYMA 4B43A 4YMIA 4CEIB 1O5TA 2W42A 3R9XA 2XF8A 1UPBA 4WBSA 4HKTA 3RYHB 3WO0A 4ZO8A 1K08A 4NZMA 5FOWA 1L2TA 1QNFA 1W1WA 4K9QA 1N8KA 1QLWA 4RIEA 1S7CA 2W2NA 1X7YA 3DLCA 1PCXA 4KXYA 5AI8A 4HDQB 4RIHA 1ANKA 1E7YA 2Z2ZA 4JUCA 4N7RA 3TL2A 3YASA 5KVQA 4X54A 1CU1A 2WJWA 2V6BA 3OKAA 1WHSA 3NDRA 3QBDA 2AYYA 4JXZA 2OQ2A 2NSLA 1G60A 3CE9A 4DM4A 1DGQA 2R8ZA 4WESA 3K70D 2WOOA 3MHTA 4NMMA 2BL4A 5TX7A 1L6RA 1ZCBA 2BR5A 1J0CA 2OD9A 3RW9A 2WTAA 4B3DA 1OHHA 2JK0A 4PLHA 3CR7A 4C4PA 2B9VA 2LXNA 3C8MA 1K98A 5FOTA 4ZARA 4OM8A 4YJHA 5CDGA 4R2MA 3GIDA 4NV0A 5IS2A 4FOLA 4F1JA 4R40A 1UWLA 4I3GA 3GEBA 1SVLA 4MUHA 5IVPA 3ZGNA 2BJWA 1BWQA 2P0EA 2AT1A 1OGIA 1YZYA 2QSZA 1NXOA 2QRZA 3NHKA 2GM3A 3Q9NA 4D9CA 3TZQA 2OCXA 4HAVA 3WLOA 3SE7A 3UMRA 2XQJA 2A1IA 4BO4A 1GFZA 5KS2A 4PEVA 2V03A 2IOYA 4B75A 2I87A 2P6OA 3ECCA 3WDKA 3I12A 1YOVB 2OC9A 3SU8A 3ZWKA 3HCWA 2WSSA 4LK3A 4B3MB 5LOVB 1JTEA 1WPQA 1TO1E 3BJIC 3ZE9A 4PO9A 1SOAA 1KFJB 1KNQA 2DM6A 4MS1B 2ZJAA 3CPJB 4QOFA 3ZBUA 5B3KA 1F2UA 4MR8A 2J0EA 4V2UA 5FBHA 4EO7A 3FOZA 3JD0A 2GTIA 4M0UA 4BCCA 2RAVA 3KHSA 3BK7A 2A2ZA 4AT1A 2WD7A 5KYYB 1KJ9A 3QKWA 3UA3A 4EPWA 3LNCA 2NVWA 5ELLA 3BMOB 3FJOA 2EJVA 2VWGA 3IBGA 4RK7A 5BSEA 2YYZA 2V9ZA 1Z26A 2FPLA 3BF8A 3U6BA 1RSZA 2IZOA 4PYOA 4X65B 1YA4A 1YNOA 3ZWXA 1N6IA 2MYNA 4L4ZA 4YA6A 4HP8A 3FOCA 3MFYA 5JS6A 3ND8A 3QMVA 4NARA 1KL7A 1X87A 2Q46A 3M6WA 4LJSA 4K8RB 4QNRA 1K97A 2OGZA 3JQQA 2BEUB 5FOUA 1P9WA 3RSHA 2JC3A 4DIBA 3NR2A 2WV7A 1LBTA 1SIOA 1HLGA 3E05A 3IBTA 4B71A 5TB5A 5JH7B 4EFLA 4MGHA 2WR8A 5F9FA 4KE9A 5GIOE 5C1BA 2J9FB 2OKGA 3SZ3A 4DUPA 1X1RA 2OBLA 3QVKA 3FXAA 2A1TS 1XN4A 2R6R1 3KPWA 1VE7A 4ALNA 4DPLA 4DV0B 3RYIB 3HH8A 1OJLA 4A6PA 5DVZA 3HXMA 1QS0B 1XA4A 2CHEA 1LVGA 4K9DA 3LE8A 4LZNA 4Q4HA 5HE8A 5TVKA 3UJAA 1Q0TA 5A5GA 3ZTYA 4Y30A 4NNOA 4ZKEA 1ZVKA 3VR4A 1D1TA 2IXDA 4Y1GA 3BB1A 3U9LA 1KFBB 1NVUQ 1GZDA 3N8IA 3UNXA 1TQ2A 2JJYA 3NHZA 4NECA 5TQ2B 3E5RA 2QUIA 2XLCA 3SIXA 4K2HA 3T6KA 2E6UX 1YS7A 1OI3A 1SUWA 5D84A 3OJOA 1QGDA 4AWBA 4DIFA 2F55A 3F8TA 2UXBB 4LQCA 1SQ0A 3DNFA 3X1XA 4PNHA 1U5CA 2IUUA 4L50A 2HDHA 1TKCA 4WQMA 4YCDA 2C9BA 2Q45A 1BCSB 3DOUA 3Q0IA 4O4LA 3WJ1A 4NXMB 1NVGA 3KJIA 4JYZA 3LAWA 3ESYA 4WOCA 3VH2A 1A2KC 3EZ2A 1FW6A 4B7UA 3K7EA 3L2OB 2PXAA 1L5GB 3K5WA 3WA6A 1R6UA 1YBMA 3G2JA 4BP3A 3EWNA 3CH6A 4AP5A 4FOOA 3IXMA 2AJ8A 3GA7A 4D3YA 3PC7A 4GLJA 4FMCB 3BXOA 1QQAA 1XRNA 2P9YA 3GN2A 3NS7A 1WM1A 4QTTB 3ROKA 1I30A 3GVCA 4JBNA 4LJYA 5FULA 2JL1A 4A1FA 3FH0A 3C0KA 3GT3A 4MAFA 2DKOA 4LA4A 1KE1A 2Z6AA 5L3RA 3H9QA 4UDNA 2WKRA 4B8YA 2XB2A 3MD9A 1ZK0A 2IKQA 3I30X 3PICA 4AMGA 5EZYB 1H3EA 1D5WA 4UD2A 4WAUA 2V1XA 1GA4A 1Z4MA 3SYTA 2QGZA 2FQYA 3ZNPA 2BV3A 4LCBA 3CB2A 1UBHS 5HS4A 4LQDA 2AGVA 2MOKA 3GPBA 4UXHA 2VOEA 4KXQA 4LRXA 4AZ3B 1O95A 5LFAA 4C7XA 5TDHA 4HB4A 3MQ2A 4R1QA 3HMKA 3PC4A 1KEWA 1YJXA 4Y67A 1UZUA 2AVNA 2WWIA 4IINA 4XUEA 3ZPXA 4QM7A 3P26A 2I6SA 4C7VA 4RTOA 3E5MA 1MOPA 1RBZA 4R83A 3SMQA 2PS3A 2GEBA 2NZUG 3FHJA 1I32A 3B1ZA 3RS4A 3VKUA 4BMVA 3FMVA 2HEIA 2PWBA 3D3NA 3G5LA 2JI8A 4KFSA 5EUMA 3K4QA 4AKEA 2GN6A 2VOJA 2PDAA 4TGLA 5JAPA 4AF8A 4AYWA 2RHMA 1CS0A 2P9CA 1IN7A 3LRPA 2Q3HA 4NY1A 3GLGE 2YFKA 3GJ8A 3LQ4A 1AKWA 2Z4SA 3ZJUA 5D8DA 1RKQA 4V0OA 1EP3B 1Y5NA 3G6WA 5BUCA 3UB3A 2FR8A 5C7OO 1GQSA 3M70A 3FTCA 1UPUA 3A4MA 4P58A 4YMUA 1KZGB 3EULA 4RK6A 1G0OA 1OTYA 3E6AA 4EI8A 1NDQA 1BVHA 5A71A 5BYJA 1T8PA 3IV9A 4I19A 4TYMA 5FR1A 4WFQA 3K72B 3M5WA 5K0FA 3F1LA 3B36A 3IEPA 4CIVA 2CBXA 1NXPA 2A9RA 5DYIA 2GCEA 2VT7A 2F9MA 5TPWB 1AUQA 1N2GA 3F6SA 3S2FA 2VP9A 2NADA 3ONWA 3OU7A 3QLVA 2R7MA 3KWJA 4RW0A 3K8OE 1QFYA 5AKJA 4C1BA 3QF7A 2R25B 2NOAA 3R6GA 1T0BA 1HEYA 3P5SA 4V3BA 3FYTA 2VSOA 2QBYA 2JIOA 4R3WA 2FJPA 1RWVA 2VPWA 3AH8A 1AU9A 4KREA 1UDRA 2AYXA 4O8ZA 5EHNA 1RJGA 2IY9A 5F1PA 3MAGA 2PUWA 4MVJA 1EEXB 2C5HA 3O31A 1QQ7A 3P9QA 4Y2YA 4F5ZA 4JI7B 4I1OA 5AXBA 4JKIA 1IBKB 4PM4A 1A9YA 1I4LD 3BB3A 2DFLA 3IDAA 2EYUA 4FYIA 3OCCA 4H1VA 4TLCA 4OLJA 5DGCA 3SJBA 4F93B 1R5NA 1TO2E 3AMVA 5K3OA 3S2UA 2W6PA 4OI2A 1MT0A 5GY7A 1TA0A 1QR2A 3GY0A 4QFMA 4RH0A 3V7NA 1IJEA 1B2RA 3A4VA 2CK3D 5LQKA 1J42A 3GFQA 1OCEA 2PYIA 3L7IA 4IDEA 4MULA 4B33A 5LJLA 4M8KA 2BUCA 3ZXUB 3X1ZA 2J4DA 3A6JA 1H1TA 2FKAA 3LPAA 5E6RA 4BV9A 4DQDA 2QVCA 4RJLA 4UCWA 1X70A 1BKDR 2Q3DA 1A88A 4D4IA 4UEKA 1AXRA 3AHJA 3AVXA 5C4GB 1NU6A 5JC1A 4BEBA 3WGJA 2CYCA 3AYXB 1Z82A 4OL9A 5BWLA 2O8FB 1R4AA 1JDVA 2VTBB 5JXGA 5ERYA 1BDHA 1FS6A 3PEVA 4WNAA 1VE3A 3PEWA 3U44A 2VKQA 4MKHA 4YRGA 4MVJM 4J0QA 3PLNA 4KIFA 1PKEA 2HQSA 4RA9B 4RELA 3T4PA 2J67A 4ANFA 4DCTA 1QO7A 1UXOA 2H2HA 1JQ5A 3K09C 4I08A 4DA9A 2GJ9A 2OCKA 1E5LA 4P4LA 2I6GA 4QYMA 1SBNE 3EIFA 2GKGA 5LDDC 4GKKB 2GDZA 5CHEA 4BY9E 2VJLA 4M9XA 1SXGA 1E5QA 3L8GA 5IMSA 2XWSA 3RYCA 5CGZA 2RGRA 2CYBA 3JRNA 4K6OA 4OI4A 3DF7A 1PNTA 4RD1A 1SXJD 2WA2A 1F1JA 3HXPA 1Z22A 4WWHA 1EUQA 4O4LF 5LLSA 2P5TB 5A2QA 3JYHA 5IAKA 1VSQA 3GA5A 5DNAA 5GMOA 3UT6A 4BBAA 1DPFA 5ENDA 4L85A 1KZ7B 1MX9A 1OYOA 5H68A 5IHPA 1WOYA 4Z4CA 2ZGVA 2IS4A 1TDJA 2YV4A 4KKXB 1FLNA 1BJRE 4QBFA 2BP7A 4LMRA 4E13A 1GTL1 5DM2A 2QZPA 5JASA 3BIOA 5JMOA 2X3UA 3DGFC 2VUSA 3AZOA 4EG1A 1VI2A 3HDTA 1ZGJA 2Y1EA 4MV7A 3GRRA 2GBGA 5B36A 4D8XA 2HADA 1U1IA 1UC5B 2Q6LA 1MX1A 2C1XA 2HJWA 2QTMA 2C92A 1IXZA 2I7VA 4CMGA 3BCSA 3CQ9A 3CX3A 2DULA 2OQIA 2YVUA 3IA7A 3W7BA 3GDFA 3KQMA 4BCDA 4BIMA 3L46A 1KFEB 3HKCA 3IRUA 3QKRA 2Y1KA 2BI8A 2BW0A 3K1AB 5J59A 5INTA 5KYGA 4G9BA 3THYB 4BV8A 5IM4A 2DKFA 4Y6QA 3FTDA 4MS4B 4LUCA 1WL8A 3ZG6A 3V1NA 1KJQA 2X2EA 2OFFA 2CL6X 4CI0B 5KUTA 3CNEA 4EYKA 2CLSA 2W37A 1PT8A 2ZVDA 3H0KA 1ISPA 1WPGA 2QUKA 5HIMA 2B78A 1S01A 3ACBA 3K15A 5FWNA 3K94A 1COWD 1T8RA 1RIFA 4KLRA 2OK8A 4XLLA 4MW5A 3KQPA 4CW7A 2B8EA 1VJCA 3ZI7A 1XZAA 3ORRA 4JX8A 3UCXA 3AZPA 1JFFA 2Z8YA 3CNNA 1OFUX 4H0FA 1KEPA 1O9GA 4ZHSA 4K3UA 3R3WA 1EZZA 3AF1A 4TKLA 3RABA 2AR0A 3BD7A 4YQYA 1CUDA 3VSBA 3TR5A 1HL7A 5FNVA 5K6AC 1NSFA 1ZJ5A 3MMNA 4M1ZA 1LA2A 1RPJA 3ZV4A 4AKTA 1YS1X 1DAHA 1N0WA 3O2SB 4F2PA 4BC0A 5AVTA 1IONA 3WHIA 1ORTA