2EW2A

Crystal structure of the putative 2-dehydropantoate 2-reductase from enterococcus faecalis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
b'MKIAIAGAGAMGSRLGIMLHQGGNDVTLIDQWPAHIEAIRKNGLIADFNGEEVVANLPIFSPEEIDHQNEQVDLIIALTKAQQLDAMFKAIQPMITEKTYVLCLLNGLGHEDVLEKYVPKENILVGITMWTAGLEGPGRVKLLGDGEIELENIDPSGKKFALEVVDVFQKAGLNPSYSSNVRYSIWRKACVNGTLNGLCTILDCNIAEFGALPVSESLVKTLISEFAAVAEKEAIYLDQAEVYTHIVQTYDPNGIGLHYPSMYQDLIKNHRLTEIDYINGAVWRKGQKYNVATPFCAMLTQLVHGKEELLGAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydropantoate 2-reductase, putative
molecule tags Oxidoreductase
source organism Enterococcus faecalis
publication title Crystal Structure of the Putative 2-Dehydropantoate 2-Reductase from Enterococcus faecalis
rcsb
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2ew2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew2A01
2NQ8A 5TS3A 5BQFA 4QQRA 2W90A 3WBBA 3NGXA 3W1VA 3RUDA 2HMUA 1V3UA 1B3RA 4WLFA 3X2EA 4QFCA 2PD3A 2Y66A 3L6EA 3LDHA 1IPEA 3BHMA 4FC6A 5T8KA 2NVUA 3DBHA 1W73A 3L4SO 3NTQA 2VQ3A 3P5SA 5B37A 4RPGA 2IDZA 3HJAA 3MCVA 5J23A 1RYDA 4HKTA 1PJSA 2EKPA 2WYUA 2GERA 3LC1O 4PLZA 3CUKA 2EWMA 3OFSA 3RIHA 4BS9A 3GVPA 2IODA 1YQDA 4DUPA 4YJHA 2OGUA 3RFXA 1YS4A 1LQTA 2TMDA 3D5QA 3PWKA 3HADA 1SMKA 3WLEA 3WYBA 1XCBA 3OH8A 5JAZA 1LSUA 5A05A 3DBLA 1I36A 3PPIA 2B35A 2EKLA 4BVAA 3RUIA 4J49A 3U4HA 5FEUA 3FBTA 1UXJA 1IL0A 5CDGA 1NVGA 4R68A 5I7FA 4AG3A 3ZWXA 5A02A 4XDZA 4XYBA 3MZ0A 1CIVA 4L8VA 2NU7A 4I08A 4CV2A 3TF5A 2W2KB 1VM6A 3UCXA 3OJLA 4Z6KA 1UDBA 5KJ6A 1XIVA 1X14A 1HYGA 1H2HA 2FSSA 5T64A 2GF2A 3KEOA 2H6EA 1XQ6A 2Q99A 4JGBA 5JYDA 4RPKA 3DO5A 3GNQA 1TB4A 2CMDA 5L4LA 1V9LA 1NVMB 1EMDA 1NASA 1E5LA 4IS2A 4K1LA 2PD4A 4ZQHA 1JVSA 1PJQA 4DVJA 1ZEMA 2PGJA 2G17A 3BZUA 3ANMA 3NDIA 1TT7A 5BT9A 3R3SA 1VL0A 4AJLA 3B20A 4RVDA 3NUGA 3LT1A 5B4UA 3TFOA 1ZJZA 2NVWA 1HDXA 4WLNA 4BO9A 3NDJA 4N5MA 5GY7A 3RAJA 1F14A 1HKUA 2OHXA 3JQ9C 2EGHA 1ZKMA 1PR9A 3JSAA 2FN7A 2D1YA 5DDIP 3WQQA 3MTJA 5KVVA 3PP8A 1ULSA 5C7OO 1NPDA 4GAEA 4E5YA 3CPSA 1E3SA 4OSOA 2VZ0A 3R3JA 1JAYA 3GNTA 4OXNA 3VPGA 4YRDA 3IKTA 4DYDA 3FN4A 3T4XA 4AJPA 2FPPA 4II2A 3F5QA 2VCYA 4NH4A 3WWYA 3ZHBA 4QO7A 1EBUA 1P74A 3PHIA 4MP8A 4RJTA 1E6EA 4Z0TA 3JQFC 2ZJ1A 3ETDA 3CH6A 3KYCB 5I7VA 2BI8A 2XOXA 5CP8A 3DMTC 1NFQA 2QYTA 2O3JA 1XR3A 3GDFA 1O89A 4DIFA 3QW2A 2E82A 4EUEA 2BFAA 2NSDA 4M8SA 2ZYAA 3C3XA 1V3TA 1N9GA 3HB4X 4I9NA 2HK9A 4KTTE 2EG9A 1OOEA 5DF1A 5T8KC 2NACA 3RC7A 3TZKA 3PQDA 5EQFA 4J0FA 4RORA 3PHGA 4B8ZA 3TFQA 4A03A 2PA3A 4NG5A 1LA2A 2POQX 3GOHA 1NXQA 4QXMA 3RUFA 4BKUA 4YAEA 2JCYA 4D0RA 5JCJD 1WXDA 1RJWA 1RWBA 5ER6A 5ITVA 1UR5A 2RH4A 4Z3DA 1VE9A 2O50A 1ID1A 1X0VA 3I52A 3GFGA 5TQVA 1C0KA 1QMGA 2C54A 1EFLA 3TL3A 3H7AA 1LI4A 3RBZA 1CEQA 1DIRA 3V2GA 3AM3A 4MVJP 1HXHA 2HMTA 4P8RA 1DFIA 1P1RA 4GL4A 3UUWA 1A4UA 1QRRA 4P4GA 4CLOB 1LX6A 1PJLA 2ZB4A 3NEPX 2GGSA 1GV1A 1ZEJA 3W6ZA 4WPGA 1I5RA 2G1UA 4L4XA 1U8FO 1JN0A 3IMFA 3PLRA 4E4YA 1J49A 3GUCA 3JQEA 4KUGA 3LLVA 3KSUA 2ZB7A 2YY7A 3IQDB 4O1MA 2Q45A 2E49A 1GAEO 1AUPA 3IP3A 5HBRA 3B70A 2EV9A 5CHEA 4BMSA 1YXMA 2HU2A 5U4QA 4M1QA 3ZU4A 1EUZA 1MB4A 1T2CA 3TN7A 3WIEA 1ZXLA 3KYDA 1UP6A 3H6KA 1T1SA 2ZTLA 4I9UA 4IDCA 1J6UA 1N1EA 2YDXA 4Y6PA 3KVOA 4JIGA 2JD0A 4FFPA 3OEWA 2ZJ0A 3KM0A 1DAPA 2J5RA 3A4VA 1NAHA 4XIYA 3OQBA 3RWBA 5IG2A 2WD7B 5EQDA 3S2EA 5G0VA 3LVFO 1Q1NA 1Y5RA 3K2EA 4WLOA 4LSMA 3HDQA 1ZNQO 3ICCA 3MJCA 4FS3A 2I66A 4Q3EA 3RBVA 4PIVA 3VKVA 1E6WA 4DPLA 4YAJA 5KIAA 1GD1O 5KVSA 4IY1A 5GZ3A 3HZZA 5F5NA 1SB9A 4IUYA 4F45A 3ABIA 4CM5A 1E7QA 1L7DA 4DYVA 1ZK0A 2JD2A 4XWYA 4A26A 1R0LA 4PZEA 3FF4A 2UUOA 2JD1A 5DBFA 4OKNA 3RVDA 2Q1UA 2PR2A 3FNGA 4HFMA 1DDOA 1JLLA 4PLTA 4AJJA 1GZ4A 3JQFA 1E7WA 3WMWA 3ONFA 1NBOA 3WSVA 1TVEA 3VC7A 1D4FA 5L9AA 5JO0A 1BW9B 1NX6A 3DEYX 5HA5A 3WG9A 4J1SA 4NQZA 1WMAA 4NBUA 3MWEB 1NTOA 4XGKA 1L1FA 3DAPA 5IJZA 1E5QA 1ZO8A 4XQCA 4DIOA 1H9BA 3G1TA 4J91A 4LVCA 4R54A 3KOUA 5KVQA 3WS7A 1D7OA 1UH5A 2X0IA 1P31A 4A2CA 4E32A 3GAFA 1UZNA 3HFGA 1AHHA 3RFTA 2O2SA 3NYWA 4Y98A 5C37A 4IQ0A 4XCVA 3K92A 1HSOA 2A9FA 3V5NA 1J4AA 4TZKA 4WLEA 4BUCA 2YHIA 4CM9D 2IYOA 2VWHA 4E3ZA 3B6ZA 3F3SA 2YJZA 3GDOA 3E5MA 2E4AA 3FHLA 1YQXA 4RQUA 3BMCA 4ALKA 4CMBA 2BF7A 1HDOA 1QR6A 5BSFA 1XKQA 1K6IA 4BNXA 1SBYA 2O7SA 4URFA 5BR7A 3M2TA 4BO1A 1NPTO 2E6UX 4PCVA 2ZB3A 5KCZA 3NT5A 1HYEA 1EZ4A 3UAGA 3F46A 4OMUA 4RO0A 2Q2WA 4UEOA 5H82A 3C1AA 1N7GA 2AQHA 4DLBA 1GYRA 2I9PA 4RVFA 1ENZA 2X5KO 2HK7A 4GKVA 4I8XA 3GN2A 4PLYA 3SJUA 1EDOA 3C7AA 3CMCO 5A9RA 1K3TA 3TNLA 4OM8A 4YT2A 1UDCA 3DZHA 3FPLA 4CLEA 3WJ7A 2J3IA 3PZRA 2UUPA 4UUMA 3Q2KA 1TXGA 3O8QA 1DPGA 3I4CA 5F5LA 1PQPA 3AOGA 5JDIC 4MKZA 2HRBA 1LDEA 1U9JA 3DZFA 4YJFB 5HM8A 3E03A 4R1SA 3U4DA 1YDWA 4Y9DA 4XQGA 5G0UA 1G6KA 3PQEA 3UHAA 3PVZA 4L4SA 1A5ZA 1A9YA 1E1MA 1B8PA 2DBQA 1B3BA 3LF2A 2QIOA 4BMNA 1QV6A 1GR0A 3L9XA 1IUKA 4P38A 1BDBA 1QXSA 2HCTA 3LT4A 1E6UA 2AEMA 4CMJA 5IXYA 1PL8A 3DHNA 3SBOA 4E5KA 3TDKA 3QVOA 1WWKA 1KY5A 2GO1A 3AU9A 3GFBA 4BV9A 2YYYA 1ZJYA 3PIIA 1RM4A 1IULA 2HRZA 1PJTA 4RZIA 2VUTA 2R00A 3BTSA 5JDIA 1A72A 3G3EA 1C0PA 2BH9A 4GBJA 4XRRA 5DOZA 5JLAA 1SOWA 2Q4BA 1WDKA 3HB5X 4DMMA 4KP7A 4FC7A 4RVGA 4OAQA 4I5FA 4BKRA 1C1DA 2Y99A 4C4OA 2YDYA 1DXYA 1YB5A 5C3MA 2HJSA 4RLHA 4R41A 4RVHA 4ALNA 1DLIA 3E8XA 4KZPA 1HDZA 1NWCA 2AA3A 2Y0CA 4H16A 5TLSA 5EIOA 3OJ0A 3PRJA 4U0KA 4FQ8A 1PGNA 4NJMA 3DMYA 4TVBA 4BKOA 1I01A 4E0BA 8ADHA 2GZ2A 4J2OA 4K6FA 4O0LA 1LDMA 1UZMA 5BNFA 4NFYA 1K6XA 3FTNA 3JQ8A 1HF3A 2O48X 3H65A 5JO9A 2J3HA 3MJTA 3TZ6A 4MVJA 3Q1LA 2B0JA 3K6JA 1SOVA 4OXYA 1HL3A 3VAZA 4EDFA 3ZWYA 3W4KA 4GLOA 3OETA 1C3VA 1ORRA 1CERA 1EUCA 1BRMA 1CJCA 5L53A 4GX5A 1OI7A 3PHHA 2B36A 4YT5A 3VH4A 4CMHA 4ZN6A 2ILTA 1J5PA 3WYEA 1PL6A 4J1QA 1EFKA 3OM9A 5IDWA 2PY6A 3KEQA 3GEGA 2AQIA 1I2BA 3JQ6A 3AM4A 4DPMA 5I7EA 3U62A 4NFSA 1FMCA 5IZ4A 4XKJA 1A9ZA 1UXIA 1YJQA 4ND4A 4YR9A 3G49A 1E92A 2DVMA 4FJ2A 4Q3CA 3I23A 5COQA 5JFOA 4P4NA 3K5PA 3E48A 2QG4A 3CE6A 4IZHA 4BNTA 2OP1A 4R16A 3EK2A 4A7PA 1PZEA 4XR9A 1AN9A 4R5HA 2EXXA 2YHUA 1DIAA 1JAXA 4BNKA 4LVUA 2DC1A 3ZW9A 4BNNA 3B1JA 2Z1NA 5JAQA 5T6BA 2CFCA 1NQOA 4YJFA 4B3IA 2V7PA 1C1XB 3GQVA 5IDQA 1DAOA 2X0RA 1LXCA 1K2WA 1IB6A 4PVDA 1WZEA 1ZVMA 2WEKA 4UUNA 4TZTA 1WAMA 4FD3A 3AOEA 2P5UA 4DGSA 3BA1A 2JFFA 4JJFA 4BO2A 2B37A 3DHYA 1U3WA 5EN4A 1EQUA 3D3WA 1BMDA 1HTBA 1U8XX 3KYBA 2W2LD 3WGTA 5JDCC 4R3WA 4K6CA 1ZK3A 4FFMA 3WX0A 5JSFA 3HDJA 4CUJA 4ZRNA 2J6IA 1M76A 2HDHA 4XB1A 4I5GA 1LC0A 4DREA 1E3WB 3ZN2A 4CMIA 4XEHA 2QRKA 4BNWA 5IDXA 1HWYA 3CKYA 1OBFO 1ISJA 4BMVA 2CNBA 2DKNA 2ZCUA 3PFFA 4L76A 4ZQGA 2DAPA 1KVUA 3TZQA 1H5QA 4BNYA 3EVTA 4KMSA 1P44A 1FJHA 4JJIA 5I9MA 4EJMA 1ADGA 3EUWA 2UDPA 2XXJA 4TRJA 3PGXA 2NTNA 4ZRMA 2D2IA 1QYWA 2DPHA 4ALLA 4OO3A 3KLPX 4OHUA 2C2XA 3DBRB 2WTBA 5FF9A 2WYVA 5B4VA 2PGLA 1SZJG 4KWHA 3P2OA 3IIEA 1EVYA 3WWZA 2FR1A 5DT9A 2C2YA 2HUNA 3C24A 2O4UX 3BMOB 5K6AC 1R37A 4LMRA 1VKOA 1ONNA 4B8WA 1B7GO 4IZIA 5IFLA 4L9RA 1IY8A 3I3OA 2YFHA 1F17A 3WNQA 3IJPA 4PLCA 5F1OA 4B4OA 5IAAA 3NV9A 2CF6A 1NHGA 3FD8A 4L75A 3OJEA 1QORA 4MO2A 1NQ5A 1F8GA 1LDBA 1QLJA 4IDDA 3JYNA 2W98A 4E2YA 2X5OA 4R1UA 4UREA 3VPXA 2OUIA 2BI7A 3OQ1A 9LDTA 4CV1A 1YBMA 3DFUA 1P9LA 3MTGA 2NV6A 2NUAA 3IUPA 3QQPA 5A1TA 3W6UA 3E9MA 4L74A 1YQGA 1YO6A 4FOOA 3GNSA 5U9CA 2YQ5A 1VRWA 2BELA 4NBTA 3VDQA 4IPTA 3PJFA 1XHLA 3GMSA 3INRA 1EDZA 3I6IA 4IXTA 3S2IA 4YPOA 2I76A 4CM8A 1K6JA 4YAKA 4LK3A 3H9QA 4D3DA 3BMCB 2BRUA 4IGEA 2D3TA 5AOVA 1SC6A 3DTYA 3JQ7A 4KUEA 1L7EA 2NTJA 3JQ7B 2OZPA 1BDMA 1PGJA 4AICA 2B4QA 2DBZA 5JW6A 4E2XA 5EESA 4EEXA 5CDYA 5DN9A 2QYSA 4BL5A 4GX0A 3GGPA 4W7IA 5A3VA 1N92A 1H6CA 2W2KA 5TT1A 1YBAA 2RCYA 4GX2A 2H5LA 1GDHA 2A94A 4IJUA 5A03A 3P7MA 3W8EA 4AJIA 1EVZA 1CQJA 1LSJA 3AUUA 3OIDA 3OJOA 3PXXA 4CM3A 3QA9A 1KVRA 4YVFA 1E7SA 3SXPA 2FRDA 5C7IO 4ID9A 5JXWA 1AXGA 1FDUA 2NU9A 3L6OO 5CEFA 4A5OA 2O3QA 4D3FA 3A06A 1YRLA 4OQYA 2A4KA 5L7WA 3PHJA 1R66A 2GD1O 3AW9A 2WD7A 4K26A 4LSWA 3DAFA 1VKNA 4QSMA 4LMPA 3IUSA 2DLDA 4GQAA 1U7HA 3BMQB 3FCOA 1GTMA 3DXFA 4R01A 4Z9FA 4NNJA 1B2LA 3OICA 4GX1A 3KO8A 4PG8A 3I9OA 3L4BA 4Q3DA 4E5NA 4J90A 5JY1A 4FN4A 1DSSG 4TMFA 4I1IA 3WTCA 4WNIA 1Z45A 4BB6A 3CZRA 5GMOA 1I3MA 3D5TA 2GLXA 3C7DB 3PYLA 1SPXA 3KXDA 1NVTA 4TRMA 1BVUA 1YB1A 1YWGO 3JQAD 4MVJD 4OQZA 3DMTA 1BG6A 1V8BA 3VTFA 1BSVA 1FF9A 1E77A 1JW9B 2NNLD 3F4LA 4WECA 4AJHA 4BO0A 2FWMX 2X9GA 4QECA 3PJDA 3LZ6A 2EP7A 1R0SA 3IL2A 3BHJA 4XYLA 1NHWA 5DCUA 5I8ZA 3W4IA 4A73A 4R5MA 1BW9A 3GF4A 2B4RO 2ZATA 1EE9A 5JCJA 4UVGA 2DPGA 4CQLB 1SEPA 4U6QA 1UXGA 1KEUA 1WPQA 5DBIA 3AI3A 1Q7GA 3MJVA 1DIBA 4Q39A 4JNKA 3G0OA 1Q7CA 2P9EA 1GUZA 5TIIA 4Z0PA 3I9MA 4KTVE 4D44A 3WFIA 4AVYA 5H81A 4B3HA 2EGGA 4RPLA 1BGVA 3KYCA 3R1IA 2P91A 3D4PA 5GZ1A 3EGOA 4RDHA 2VUUA 1I8TA 2JFGA 3DFZA 2DM6A 2I3GA 4MINA 1S7CA 3Q2IA 3WDSA 2Y93A 3P19A 3GMDA 4W6ZA 3ZDFA 2LDBA 1JKIA 4KOAA 2HMVA 5FI3A 5A5FA 1HSZA 3AI1A 5FFFA 1M66A 3D4OA 4E2WA 1XWFA 1FXSA 3DL2A 3E9NA 4HWKA 3RUAA 3PQFA 4S3MA 1O6ZA 3N74A 1PR3A 2GUGA 3QE3A 4INAA 1VSUA 4M87A 5THQA 4U8GA 3VOSA 4WCFC 2HAEA 3QWHA 4HXYA 1VSVA 4D3SA 2XXBA 4TVOA 3ZV5A 2QZ9A 5DP1A 3WLFA 3HNPA 1DHTA 5A06A 4QUKA 2O3TA 3LF1A 2Q2QA 1BXGB 1T1RA 9LDBA 4Z0HO 5JAMA 4LCJA 1LRLA 4AL4A 3H5AA 1M6WA 2CD9A 4N7RA 3GVHA 3A28A 1ZUD1 4BNMA 3BYZA 2P2SA 1SEVA 1V35A 3ICPA 1WP4A 3VHRA 3QWAA 4JBGA 1P1HA 4RF3A 3BXXA 4HP8A 4MJLA 4ZJUA 4PZCA 2GNAA 3OSUA 4XYMA 1IHXA 1MFPA 1SB8A 1Y6JA 5C5IA 1ZZEA 3E1KA 4MIEA 2X1HA 1M67A 1ZMOA 1ISFA 1ADFA 2J3KA 3VTZA 3O8QB 4PG4A 3UKOA 3HWRA 4IJVA 4XRGA 4E12A 4R51A 4IJKA 3ONEA 3ROQA 2FP4A 1DIGA 2NU6A 5IF3A 3AJRA 1ISGA 1OAAA 3KBOA 7ADHA 3NJ8A 3L0DA 4BNJA 4JJGA 1CF2O 3ASVA 1HT0A 2Y1FA 4NR0A 3UGKA 5EJ2A 1MXHA 3FR7A 1HE4A 3QIVA 1AE1A 4KDEA 2EJVA 1Q2XA 3I9KA 3GC6A 2VRCD 1T25A 4NDNE 4LW8A 1DB3A 3NGLA 1ONPA 5HWSA 1KERA 2Z95A 1ZK1A 4UEJA 3BTOA 3RCBA 2BFOA 1Z75A 1JQBA 3QVSA 3KZVA 2OORA 2PH3A 4XQEA 2GN9A 3K96A 3RI3A 3QWBA 3ZHYA 4XD2A 3BAZA 3GGOA 3RKRA 2F00A 1E7YA 2VHVA 1ISHA 3IOYA 1O5IA 2VTEA 4W99A 4CLXA 5A9SA 1XQ1A 4DBZA 4YB8A 2VHXA 1X7DA 1D3AA 1YVEI 2BKAA 4JP2A 4C7KA 1SNYA 3V1YA 6LDHA 2O4CA 1RM5A 1SO8A 4MOWA 2V65A 3VH1A 4HFNA 5HS4A 1T4DA 1X13A 1BXGA 3KSZO 3DC2A 4MDHA 3RUCA 1LDGA 2JKVA 3ULKA 1JTVA 2VYND 4ND1A 4R9SA 1JWBB 2C29D 4GGPA 5KVCA 1PJ3A 1S6YA 2G5CA 3HSKA 4CQMD 2O7QA 1LSSA 3ROPA 1LEHA 2AQKA 4BHTA 5JAIA 1GQQA 4J4BA 4AFNA 1Y8QB 5TF4A 1GYPA 1FDVA 3ZV6A 5KKAA 3ZHZA 3TOZA 3N7UA 3QRWA 2W4QA 3BMQA 4XYEA 1NR7A 1KEWA 4FR5A 1UP4A 3DTTA 3QSGA 1J0XO 1PL7A 4Z9XA 4E5MA 2VUSA 4JBHA 4ZD6A 1UXHA 3PTZA 3DBHB 3ZWOA 1X0XA 5ENDA 2VT2A 4EZBA 1DHRA 1JKJA 1R12A 2VN8A 2VWQA 3EHEA 3GVXA 1UDAA 4RF2A 2E37A 2IEDA 6ADHA 5DULA 5AYVA 2AEFA 2W2LA 1LDYA 1U7TA 8LDHA 1MC5A 3AOEC 1Y81A 3MJSA 2ZK7A 4YDRA 4JLWA 4YT8A 4Y67A 2GN8A 2O2YA 4UVIA 4CUZA 1NQTA 1EK5A 1K0UA 3WGQA 1O95A 2JCXA 4CL3A 3T7EA 1N7HA 3PEFA 1T4BA 3GZ4A 3U9LA 3LQFA 4TKMA 2X9VA 4N54A 4B3JA 1B8VA 3VZSA 1FDTA 2GPTA 2ZTMA 4WOJA 5JYEA 2ZYGA 2TMGA 2Y05A 3PFWO 1X1TA 1A71A 4FFNA 3WQRA 4XR4A 4HFRA 4M86A 4PGFA 5DBGA 4YCAA 4Q3BA 4J7UA 3GY0A 3Q9NA 3VPSA 4BKPA 5CG2A 3NJ4A 4NMHA 4D46A 3MOIA 3WGZA 3D3WB 3W4JA 5A3JA 1MFZA 2JHGA 4MKXA 1GL3A 1RM0A 5TGDA 4YJDA 4YACA 2X0NA 3NAQA 3ZNQA 1Z74A 4P4LA 4I5EA 2WD8A 3S2FA 1E3EA 1C14A 1DOHA 3LU1A 2I67A 5KWEA 4QFDA 1P0FA 2ET6A 1NPYA 3BHIA 4CMIB 1U4SA 4HNHA 2O3RA 1A4IA 2OBNA 1M75A 4GLLA 4DBVO 3GT0A 2YW9A 1Q0QA 4CM8B 1B0AA 2EF1A 3OBBA 3UCEA 1MXFA 4ONEA 3MJ4A 4GVLA 2P4HX 4CLRA 3GH3A 2ZB8A 2DTDA 5JCXA 4R1TA 4CLOA 1MUUA 5JC1A 4PG7A 4FFRA 3DZGA 3ZWNA 2A92A 2C07A 4PZDA 4JXKA 1KETA 4YAGA 3WGYA 4DQVA 4YWJA 4M49A 2VZ9A 2J5KA 4XIJA 2X4GA 2P9GA 1PTJA 4L0QA 3MWDB 1QYDA 2FSVA 1P45A 5T67A 2UVDA 3K2BA 5G4KA 2X23A 3WICA 2DTXA 2PTGA 2CVOA 1Q0HA 4CR6A 1O9BA 1YGYA 1EQ2A 1VL8A 1BTOA 4LN1A 4CQMA 1YL6A 2FOIA 2OFPA 3D0OA 1YJ8A 1ENOA 1E3JA 3RQSA 2JAPA 4JQCA 1PS0A 3FNHA 3GK3A 2VYNA 4G81A 4FGWA 1T26A 1AGNA 1ZW1A 3OP4A 4H15A 3DQPA 5DCWA 3F6YA 4TKLA 4A10A 1R4NB 1UUFA 4CM9A 4BO3A 3FWZA 4NPCA 4LCEA 4EGFA 1ZK2A 2HMWA 2YHIB 5F3RA 1GCOA 3I83A 1XLTA 4B7XA 2Y68A 1Y5MA 1VPDA 4AJ2A 3ZU2A 5H83A 1ZFNA 2YQ4A 1PJBA 1U3VA 4GWGA 5FI5A 1HE5A 3EZYA 3R0IA 4TRRA 1E3WA 3V1UA 3GUYA 1B16A 3RROA 2RAFA 4XB2A 1E1LA 3LC2O 1MGOA 1UAYA 1U4OA 1ADBA 3EMKA 3CMMA 4AJ1A 2WMDA 4BO4A 1ARZA 1H9AA 1IE3A 1KC3A 3FNEA 1N5DA 4XDYA 1RKXA 3VVCA 5T57A 4FGSA 1AXEA 2ZYDA 1JA9A 4YA6A 3RASA 2JCVA 2OL4A 3V8BA 4DC0A 4B7CA 3O38A 1UAGA 4BO5A 4CLHA 3F1LA 3DONA 2B4TO 2CDBA 2PD6A 3HFSA 2B5WA 3WGGA 5HTOA 5A4DA 5TJ9A 1UZLA 3GDGA 3SLGA 4BNLA 2NVBA 3ONDA 3CZMA 4RPHA 5G0SA 1GV0A 3DBRA 3RKUA 2O23A 1ENPA 4D79A 3ZZNA 2BHLA 1Q0LA 1R6DA 4MKRA 2ZTVA 1HDCA 4II3A 3AU8A 4EEZA 3IDSA 3L07A 2RH8A 3BTUA 1IOLA 3JD0A 3OECA 4IMPA 3WQSB 2D4AA 1H0KA 3OA0A 3BMOA 4UULA 1OFGA 4XX0A 4AJ4A 4BB5A 4CR8A 1EEHA 4IQ8A 2V6FA 1MLDA 3W8DA 4IMRA 4ZVVA 2DQ4A 5B1YA 5JS6A 1P3DA 4GMGA 5TX7A 4OOEA 4FIZA 3VPHA 4ALJA 4W9NC 1Y9EA 5BNTA 3HN2A 3FBGA 3O4RA 5IDYA 1P77A 1PGQA 1NM5A 1I2ZA 1VC2A 2JAHA 4HX5A 1WDLA 3G79A 4OJNA 4PRLA 3JCZA 1MG0A 3F5SA 3PDUA 4O6VA 1IPFA 3GEDA 4NBRA 4UUOA 3VZQA 4C7JA 3KSDO 2CSUA 3CEAA 3JQBC 1PS8A 3FNFA 3F4BA 3EVNA 3QVXA 4HBGA 1I24A 2BMAA 4F6LA 3DOOA 3I9NA 3O03A 4B4VA 4ITUA 5ENVA 5T5QA 2ZKLA 3NTOA 4UVDA 5JY6A 2X58A 4RL6A 3K9QO 4KDFA 4U6SA 4FSHA 4CQMB 1X1EA 4DLAA 3WJAA 1NFRA 1XEAA 4R9RA 5LCXA 2NVUB 4XYGA 1OMOA 4N5NA 1GQYA 5I7SA 5TRTA 3JYLA 1GADO 2VYVA 4CV0A 2PLAA 1C1DB 1JDJA 1LRKA 1WW8A 2UV8A 4I9HA 3WSWA 1HYHA 2SCUA 1LDNA 3RJ5A 4TRNA 4J3FA 4PVCA 4FFOA 1XU9A 4YBZA 4J43A 3U4IA 4UVEA 2VOEA 4HFJA 4NJOA 2Q4EA 3TL2A 1PIWA 3ANLA 5KJ1A 3L6DA 1E0DA 4W7HA 4MP6A 2HSDA 3ZWWA 2BLLA 4DQXA 2VRCA 3STHA 2UAGA 2Y1DA 4MPDA 4CMAA 3JYOA 1QSGA 1Y8QA 2VYVD 5G0TA 5DOVA 5B12A 5IN4A 1XG5A 1DO8A 1P1FA 1LLQA 3DR3A 1Y9AA 1I32A 1PEDA 4ILKA 3FSRA 1RYEA 1WNTA 3ROMA 3JV7A 3IC5A 4NK5A 4A0SA 3SVTA 4ZGWA 2OBYA 3E82A 5F21A 3AY7A 4Y6RA 3MEQA 1Z7BA 2EW8A 4E30A 4AJNA 4GKBA 3QY9A 3NDRA 1R16A 4CMEC 4IDBA 2FPGA 2EW2A 3KHUA 3TWOA 3JQ9A 2FHSA 1GEEA 2C0CA 5KJEA 3ADPA 3JQGA 3H5NA 2F1KA 4CMGA 4B4UA 2GN6A 3GR6A 4MVJG 1CWUA 2FPIA 3C1OA 4HNGA 3VDRA 1BVRA 5AXCA 5A04A 2DUWA 1DC3A 1G1AA 4UAGA 1EBFA 2G76A 3DZJA 1NNUA 4Z9YA 1MV8A 3LYLA 3DZKA 3AWDA 3ZI0A 1GQ2A 1CDOA 3UVEA 1LLDA 4HV4A 4BNFA 1KVSA 5L7TA 3AM5A 1H93A 1E1NA 1I33A 1ZXBA 3PJEA 4IBOA 4RVUA 5AXBA 4O63O 4DQUA 1FDWA 3COSA 4E21A 2DT5A 2QZZA 1R4NA 1OZAA 2C82A 3H3FA 3PI7A 3PWSA 3CXRA 3WBFA 1EVIA 1WDMA 3GHYA 2EEZA 2RHRA 3DZBA 3I9LA 1X7HA 5BSGA 4QTZA 1ULUA 2NADA 3T7CA 3PIDA 2HQ1A 4PG6A 2JL1A 1U3UA 3LT0A 1UP7A 1Z7EA 1R4MA 2O3UA 3ZNOA 4J16A 4ZICA 1HDYA 3JD2A 4HADA 5FWNA 3JTMA 1KC1A 4OH1A 1O0SA 1HDGO 4M55A 5EL0A 3AUSA 3K30A 2OXIA 2NU8A 5LDHA 1H6AA 3CSDA 3DHEA 2XPCA 4EBFA 3R6DA 1K5HA 4LRTB 3PYMA 4PLGA 3PHLA 1DFGA 4IDAA 1E1KA 4DLLA 1NAIA 4DWVA 3H9UA 3NTRA 4DMLA 3ANNA 3GRKA 3WGIA 2R6JA 2D59A 2IYPA 1TT5A 1I3KA 1LUAA 3IAHA 4R4JA 4YT4A 5L45A 2EJWA 1E3IA 4I5DA 1PGOA 2JHFA 4N18A 5BNIA 5MDHA 1DRWA 4BGUA 3TQHA 2DTEA 2HMSA 1Y8RA 3ZWMA 2QQ5A 5KTKA 3ZWPA 2NM0A 3RUEA 1GZ3A 4CL8A 1PU2A 1H6DA 1P1KA 2CZCA 3GG2A 5A9SB 4FOSA 4K9DA 3L4BC 1GPJA 3G17A 4JK3A 1YONA 1LC3A 4D42A 1E3LA 3AY6A 4WJZA 1HETA 2Q1SA 5KNLA 2I99A 4IINA 4OIMA 2IRWA 4M89A 3D1LA 1LRJA 1XELA 1R0KA 3GZNB 4CM4B 4NJMB 2CF5A 2FY8A 5TT0A 3QWIA 1U5CA 4J4TA 4EITA 3JQ8B 4DRYA 5CG1A 4J6FA 3BIOA 5FYDA 4J9UE 2J3JA 2W8ZA 2A35A 4TWRA 3OQ6A 4W9NA 2GZ1A 4GVXA 3WB9A 1QYCA 3WR5A 4CMCA 1TA4A 4Z3KA 2ZQZA 4EJ0A 1NQAO 3QVTA 2Y1GA 3OEYA 3PLNA 4EUFA 3ZV3A 2HO5A 1PWXA 2DBVO 1BXZA 2OMEA 4FPXA 1ML3A 3EW7A 4BNZA 4AJEA 1RM3A 1ADCA 5K0ZA 2PFGA 5A5EA 1H94A 2X6TA 3E9QA 1JKFA 4IDFA 4W82A 4DL9A 1QV7A 1ZIDA 3PDJA 4WK6A 4OL9A 1E7RA 2AEJA 3V1TC 1LBEA 2V6BA 3C85A 1F8FA 1SAYA 3H2SA 4Q3AA 3Q9UA 4DPKA 2X8LA 1LLCA 1NP3A 1X15A 4XJTA 3ZWBA 4J7CA 1LTHR 1W6UA 2PZJA 4YQYA 4BQPA 4TSKA 3UF0A 2HK8A 3H5RA 3QWFA 1V3VA 4WASA 1YOVA 2PKQO 3O9ZA 4J9VA 2V6GA 2IZ1A 4IDEA 1U2DA 3AUAA 1QYXA 3UH1A 1PSDA 3Q0EA 3WTBA 2GN4A 3TRIA 3VPFA 2OO5A 2D5AA 2WDZA 4GGOA 4IXWA 1LU9A 1H2BA 2I3AA 4X54A 4P22A 4O5OA 2EP5A 3EY4A 3OJFA 1X7GA 1T2DA 3PGJA 1DRUA 3S55A 1PJCA 4CM6A 2WSBA 5CAEA 1ZSYA 1IZ9A 4A27A 4GWKA 4YTEA 1N8KA 3INTA 4IIVA 4OXKA 4E2ZA 3K8ZA 2X22A 3SLKA 5K9ZA 2GYYA 2IXAA 3JQCA 5EINA 2DUUA 4F46A 4UVHA 4JCOA 5IZCA 5JBIA 4OKIA 4Q3NA 2BGMA 2RBEA 2DFVA 3VH2A 4Y6SA 5EPOA 2VT3A 1DBVO 2AHRA 2IXBA 2FZWA 2PWZA 1EE2A 1IHYA 3HG7A 1QP8A 2PZMA 1IYZA 1EUDA 4K28A 1ZK4A 4NIMA 3M1AA 4PN3A 1A27A 1JVBA 3TZHA 4CODB 4R3NA 4WEOA 1LNQA 4D45A 2AQ8A 1WMBA 4PFJA 4QEDA 3EYWA 1U2GA 3DBVO 3F1KA 5AQ1A 1I30A 4GMFA 5I9LA 3X2FA 2PH5A 1NYTA 2Y1EA 1MC4A 1FK8A 2Q2VA 5ILGA 1YBVA 3INGA 1HEUA 3NKLA 2VOJA 1DEHA 1HRDA 2VHWA 1PZGA 1QKIA 1V6AA 4ND3A 1GUFA 2Q46A 3ENKA 4E6PA 4CR7A 1ENYA 1B14A 1B15A 4ZA2A 2UYYA 1C0IA 1F06A 3EC7A 2IEBA 4J7XA 1ONOA 4F6CA 3VZPA 1YOVB 4J4HA 1C1XA 1LSOA 1GY8A 3SX2A 3PYXA 3RFVA 2Z5LA 3BTVA 3U0BA 5CFZA 3WFJA 3IKVA 4U0JA 3CTVA 1D1TA 4ZHSA 4J0EA 5HRUA 1XYGA 3Q3CA 3I5MA 3L9WA 2Y1CA 3I9JA 3PK0A 4MVJE 3U3XA 3KTDA 2NLOA 3SC6A 5ITWA 4OOFA 5MGBA 1D8AA 2HKIA 4RV9A 3ZNPA 4LGVA 1QLHA 3CTMA 3UOGA 4BO7A 5B4TA 3VVBA 1U28A 3OMLA 4RCVA 5HS6A 1GFSA 5L95A 1Q7BA 1KVTA 2QHXA 3RD5A 3RC1A 3U49A 3ST7A 1I3NA 3NT2A 1DJNA 5CDUA 1PX0A 3A9WA 4WE3A 1WVGA 2CVQA 4NI5A 4GSLA 2B83A 4UUPA 4CPDA 1ISIA 3PZBA 3NT4A 1GPDG 4RPJA 1HZJA 4QO8A 4NU6A 1ZMTA 5F1KA 2DU8A 4WGGA 2BGKA 2Q49A 1E7MA 3AI2A 3FTPA 2DFDA 3I4FA 3KB6A 3VH3A 3AUTA 3KETA 1T2EA 2WM3A 2H63A 3M6IA 1ZH8A 4KWIA 1H6BA 4R1NA 1KS9A 1TT5B 2OP0A 3B1FA 3DBLB 4OYRA 4NBWA 1I10A 4EW6A 1NFFA 4YQZA 1PZFA 4WKGA 2CY0A 3L77A 4WLUA 5L40A 3ZHXA 2IE0A 2QRLA 4EYEA 3V2UA 2B69A 1YB4A 1K89A 2ZIZA 4RVSA 2X5JO 1KOLA 1JWAB 4MIYA 1F12A 2X9NA 3JD4A 5DP2A 4ZQFA 4BNGA 2JFHA 4IIUA 2C5EA 2QW8A 3DB2A 3U5TA 4JX8A 3KUXA 1LLUA 2I65A 5L7YA 4EI2A 3HUDA 4DA9A 1DC5A 4Y8VA 2AE2A 1EK6A 4RF5A 5KJCA 5BSHA 2GDZA 5TC4A 2AW5A 1GZ6A 3I6QA 1ZBQA 2G82A 2YZ7A 2VZ8A 3OHSX 1U1IA 4M54A 3S1LA 3QHAA 2XAAA 1GU7A 5JNLA 3ITKA 3UFXA 3JYQA 1UJMA 5G2OA 4BQRA 4NZ9A 4CLRB 2C7VA 4FB5A 2FZEA 4ND5A 1P1IA 2EKQA 2P4QA 4MVJM 5ICMA 3V2HA 3DAGA 4F3YA 1P1JA 2VWPA 1YH3A 3FWNA 1Z82A 1MA0A 1DC6A 4DXHA 3HDHA 4ALMA 5DCYA 2D0IA 3PJGA 3UXYA 3HDYA 3NX4A 2HJRA 5AXDA 5CDSA 3H4VA 4DTIA 1T2AA 1XA0A 1AHIA 3E18A 3SEFA 5CPBA 3ZCXA 4CJXA 4WCFA 1M6HA 4E5PA 1V0JA 4YJGA 1SCUA 1FDSA 2H9IA 3GGGA 5F1PA 3ZU3A 4FJ1A 3QJ5A 3A1NA 3ZWCA 4WLVA 4ROSA 4D41A 2VWGA 3P2YA 4GH5A 4RQTA 3WGHA 1TEHA 4LISA 1NWHA 3S2GA 5JMWA 3G1UA 3U4CA 4BNHA 4GSKA 4BOYA 4CM7A 1HE2A 1Z73A 1CETA 3ORFA 4J1NA 4FBGA 4N5LA 4DIBA 3T4EA 5ER9A 5K6AA 1P0CA 3LK7A 3QLJA 3ASUA 1GUYA 4JN6B 2C7GA 2PZKA 5COAA 4YRBA 2WE7A 1XSEA 1D1SA 4E31A 2GASA 3Q6IA 1O94A 1KEPA 3GVIA 5AVOA 3UN1A 2QX7A 2X86A 3HHPA 2BFMA 1YE3A 1ISMA 2CUKA 1XGKA 4S1VA 3B1KA 4RZHA 3HQ4O 2VTDA 3W8FA 2NTVA 3JQAB 1I3LA 3EAGA 3Q11A 5I8WA 3ETEA 3N58A 4MVJI 3TSCA 1TI7A 1WLYA 3RBXA 4IGFA 3AY3A 4PG5A 4IM7A 4J2HA 5IXSA 3GN1A 3RU7A 2BFPA 5EERA 5BSEA 1PZHA 3BMNB 3M2PA 3C8MA 5G0WA 3JD1A 3LC7O 5I9NA 3VZRA 5C7LO 3DOCA 4XQ9A 1GCUA 4MVJF 3WMXA 2H1SA 3OIGA 1G0OA 1DIHA 2D8AA 4G2NA 4IJWA 5DNAA 1C0LA 3RC9A 4XGNA 3SJ7A 1WZIA 2V6MA 4H3VA 1U3TA 2I6TA 4L73A 4IDGA 4YYZA 1IZ0A 3QP9A 2YUTA 2I5PO 2P9CA 2PK3A 1ZSNA 2VNSA 1QG6A 1DRVA 2Y67A 3GLQA 3AK4A 4NHEA 1Z6ZA 3D4NA 4E13A 4PLFA 4PLVA 3KLMX 2CDAA 2GSDA 4NU5A 1BHSA 4BIIA 5ILOA 1DLJA 3MJEA 3TOXA 4NBVA 3KV3O 4EJ6A 3H8VA 4CLDA 3U09A 2Q50A 3JYPA 4G65A 2GCGA 2Y0DA 4XGIA 2GR9A 1KY4A 2ZTUA 4IQGA 5IN5A 5A9TA 1PWZA 3JQDA 4AJKA 4WUVA 4Q9NA 1I2CA 2BGLA 2PNFA 5JE8A 4R69A 5CPFA 3H2ZA 3MOGA 5JPIA 4BNUA 1PQUA 2C20A 3LLSA 2P68A 2QRJA 2LDXA 5JDCA 3WNVA 5L3ZA 3H9EO 1KIFA 2O3SA 2Q3EA 2NQTA 4JBIA 4GI2A 2E48A 1XDWA 2GZ3A 2XF8A 4WCFB 4BNVA 1EVJA 2WE8A 3OF2A 4D7AA 3AFNA 1A7AA 4D0SA 2WJPA 5KJFA 4KQXA 1YL5A 4PLWA 1LQUA 3ZWVA 4YJHB 2NWQA 1VL6A 3UW3A 1Y8RB 1PGPA 3DOJA 4FDAA 4ZQBA 2J8ZA 4FCCA 3C1TA 4UEKA 2CVZA 3ON5A 3JQGB 5LDGA 5THKA 5CDTA 2C59A 3WIDA 4BGVA 2RHCA 4CV3A 3DDNA 3S8MA 2WWRA 3ZW8A 3RSHA 7MDHA 3FR8A 2EERA 1KVQA 3KYDB 1B26A 5CEJA 4QX6A 4KUHA 2D5CA 3EZLA 2DBRA 4XA8A 3CIFA 2R2GA 4RLSA 5IZCC 4CM1A 3UCFA 2R00C 4BV8A 4CMEA 4YEDA 2VRBA 3GHHA 1OC4A 1ZSVA 3GZNA 3K73O 3LT2A 1B8UA 4CM4A 2PKRA 4JP3A 1NR1A 5ICSA 3D7LA 1M2WA 4MIOA 1HDRA 1UXKA 4PLPA 1W8DA 4IS3A 3LSYA 5KOIA 2ZCVA 3TZCA 4E33A 3A14A 3ZH2A 3GA0A 3VKUA 2AMFA 3CINA 3QVWA 1KYQA 2IZ0A 1F0YA 1N9GB 1W0CA 1Y1PA 3D64A 3F9IA 4O59O 4U5QA 3WXBA 4D43A 2Y0EA 4FFLA 5GZ6A 1PJ2A 1G0NA 4H7PA 2B5VA 1PS9A 2CDCA 4GPD1 4WEQA 4ZQEA 3H9JA 2AXQA 4B7UA 1W4ZA 2BD0A 4FJ0A 3HE3A 5ES3A 1GYQA 1VJ1A 2RIRA 3RJ9A 2JJYA 2VNAA 1DFHA 5G4KB 3E6AA 2FR0A 1LJ8A 1A7KA 2IZZA 2P5YA 2AG8A 3ZV4A 5L4SA 4YJGB 2WYWA 2J5QA 3M1LA 5AXAA 5TSDA 4ZU3A 1MG5A 2FMUA 2YV3A 3NRCA 3C7CB 1Y7TA 3RUHA 1KEVA 3IS3A 1YDEA 3E5RA 4RF4A 1VI2A 3ZWAA 1ZCJA 4DC1A 5EMHA 3OA2A 5G4LA 3AFMA 1MX3A 2PKQP 3IJRA 4NFHA 3ENNA 5LC1A 1DC4A 3JQBA 4OGWA 3OIFA 1GEGA 2C5AA 3GEMA 4EUHA 3IP1A 3ZNNA 3H3JA 4AJOA 3GG9A 2OOSA 1VJ0A 1HZZA 3K31A 3GRPA 3SC4A 4RGBA 1T2FA 1HLDA 3ETGA 3GAZA 3I1JA 4CUKA 2GRAA 2PGDA 1KBZA 1QYVA 2FR8A 2PZLA 3FRJA 1N2SA 1JU9A 3ITDA 5ADHA 4G5HA 2VHZA 5JC8A 4ESOA 4YRAA 2X0JA 3EDMA 2HLPA 3ZGYA 1PJ4A 3O26A 3H9GA 2AG5A 3BMNA 2PV7A 2YV1A 2YV2A 4L4RA 1CRWG 1VLLA 4YXFA 3WYCA 4BKQA 2AE1A 3JQAA 4PRKA 3RC2A 1OC2A 4QT0A 3RU9A 2Q1WA 4HY3A 1O8CA 4OSPA 2Y1OA 4BNIA 2ZQYA 5JMPA 3GVCA 2Z1MA 4U7WA 4WCDA 3PWZA 4XJSA 3GPIA 4B79A 1TLTA 3TJRA 3QV1A 4BO6A 3DZIA 1P33A 4HUJA 1MP0A 4RDIA 4BGIA 4WNCA 3GPDG 4B4WA 5CEEA 1YKFA 1CYDA 1VJTA 5L4NA 3TPCA 1T24A 3UICA 3KRTA 4PLHA 4ALIA 5KKCA 4CQLA 1BXKA 4TROA 4JROA 2G0TA 1HLPA 4NK4A 3D3EA 2EIHA 4MVJH 2EHDA 2X7HA 5U1PA 1HE3A 1PQWA 2YFQA 4LRSB 4TQGA 3HN7A 3FPCA 5TJHA 3F47A 3JD3A 3ZU5A 1I0ZA 3FI9A 4FW8A 5COBA 4CMKA 3DWFA 3ROKA 1XU7A 5TNXA 1R4MB 5DZSA 4BGEA 4W4TA 2Q1TA 1BWSA 1N1GA 4KQWA 4XZ3A 4MP3A 5L51A 3WOHA 1U5AA 2VHYA 4J1TA 4BO8A 1R15A 1CQIA 4WOKA 3ADOA 4YAIA 1RPNA 1DJQA 4ND2A 3WGOA 1YL7A
chains in the Genus database with same CATH superfamily
2NQ8A 4EWLA 2LIVA 2XBUA 1DEKA 2XITA 3NHRA 1TF5A 4RLQA 1TO6A 3RUDA 1WCXA 2HMUA 4KAXA 3W2EA 5BN3B 2VSYA 4NJEB 4QFCA 2Y66A 4E1AA 5DHUA 4IOLA 2Q1XA 3BHMA 4FC6A 4KFTA 3FFWA 3ET5A 1W73A 2J1LA 2VQ3A 4FMPA 5IEBA 1Q92A 5B37A 4QHYA 1W0JD 4JJAA 4D98A 3HJAA 2CFSA 5IAKA 3KZ1E 1RYDA 5JFGA 5CH3A 4OB7A 1SCBA 3W1WA 3HR4A 4G6ZA 1ESDA 2VEDA 5E2AA 4OHZA 3H5WA 3LUBA 1P3Y1 3G8CA 5CRIA 3RIHA 3PNYA 3L01A 4C4PA 4V0SA 4CG0A 3N9IA 1GNQA 1K3FA 1NI5A 3RFXA 1NW7A 3GLHE 2A9JA 1TZJA 3AP2A 4UNQA 3HADA 4L57A 3NWEA 5H3LA 1XCBA 4R1PA 2KPOA 4IUCS 2XYGA 2XB6A 4AIRA 4B9EA 2R7KA 3A4IA 1ND6A 5FADA 2B35A 2Y27A 1E4EB 4QPPA 2FI1A 4X94A 3U7FB 1WOYA 4J49A 3RUIA 3LTNC 2O8EA 1E66A 1ORIA 4RYDA 1E0AA 3FTCA 3ABSB 5CM2Z 1I9CA 3L02A 2ATXA 2W00A 4R2HA 2OC9A 4NYIQ 4XYBA 4EHHA 2NU7A 1EP9A 4I08A 2F1OA 1XEWY 3BJIC 3F2VA 2EX0A 1VCMA 5LP6F 3MCZA 3PEYA 2WJYA 2P0EA 4NCIA 5EZSA 4INJA 4AKIA 5GJBA 3UK0A 1P2TA 1UDBA 3SZRA 3UK7A 1XIVA 1NNLA 1E9CA 3JVIA 4GLFA 3SY8A 3K15A 3FYDA 1FFXB 3LKZA 2JZNA 4GP7A 3TM4A 3RR2A 4BB9A 1YU9A 2FSSA 1C8KA 3IPAA 4KE9A 4LZNA 5IJ0A 3FPKA 5T64A 5A6VA 4PAWA 1GHTA 2V5VA 4D96A 2QN6A 3A4LA 1U9YA 1T9GR 2EJUA 4CI9A 3KQUA 4DMCA 2YYZA 5JYDA 1ZWKA 3DO5A 1MR3F 3THOA 2CMDA 5ALEA 2RI1A 5FLEX 2WJJA 2Z3WA 1V9LA 3W5CA 5HM6A 3UZUA 2WYHA 1EMDA 1NASA 2REXB 3B5IA 3IGFA 1KHHA 4IS2A 4HEJA 1ZA2A 1FC0A 2ISSD 2RAPA 1PJQA 1K9VF 3NDIA 2G17A 3BZUA 3ANMA 3ETLA 1TT7A 3PC7A 5F9MA 1VL0A 4F3NA 3PRHA 2K7FA 3QY0A 2YXPX 3LT1A 2O7VA 3OO1A 2V0GA 1O08A 3GAMA 2GPWA 1R10A 1W59A 3SC2B 2O19A 2BGRA 1HDXA 5E1BA 4BO9A 3UB4A 2AOWA 2WA1A 1QJ4A 2ZT8A 3U7RA 3CZQA 2QMOA 3PUIA 4N5MA 3N2YA 5GY7A 3RAJA 1HKUA 1OFVA 2C7PA 3AZOA 2PPLA 1BDHA 2WQ7A 3AETB 1F0PA 1PR9A 2BFEA 4IX1A 5J43A 2QJOA 5FNVF 2FN7A 4W5QA 4C0AC 2QM7A 2FEWB 4N7JA 4RJLA 3SZ3A 3PP8A 1GZDA 4MTCA 4RZQA 3RYTC 5C7OO 2OMKA 3N07A 3EXHB 3CPSA 5EE5B 1UFVA 5AR1A 5IP5A 2VZ0A 3P0EA 3FH0A 2A2ZA 4OXNA 1W35A 2CGEA 3RV4A 1NXOA 2VDRB 4WXRA 4MWEA 3R5JA 3E2MA 3UT5B 3CVOA 3F5QA 3N2ZB 1WZNA 2QRUA 3WWYA 4M8NE 1HR0B 2YWHA 2ACWA 1YSCA 1ZNYA 2CXRA 2JH9A 4YP5A 4RJTA 2FMTA 3JQFC 4E7PA 1HY3A 4ARSA 3W7VA 3UEOA 2FN9A 5NULA 5C51B 1U9IC 3H3XA 3KYCB 5FFMA 5I7VA 5CFMA 4URXR 3HM2A 2A1TS 1F20A 3T7AA 1OR8A 3W9SA 2QYTA 2GETA 4GLBA 4YLEA 1JH9A 1TYBE 3ENQA 4EUEA 5B1SA 2BFAA 2W4IA 2W42A 3QPUA 5EP4A 2XV1A 4RETA 3TQIA 2BEWA 1V3TA 1G5QA 4PRZA 1VKRA 3A1EA 1ZC3A 4FGKA 4L8LA 4I9NA 2NZWA 4N0EA 4NYMR 2HK9A 4BKMA 3IDAA 4B40A 2C7RA 1T3TA 5IKXA 2EG9A 4KPEC 4B5LA 1KI8A 1GAXA 3RC7A 2VNIA 3TZKA 1CZNA 1PZXA 1KZ4A 3NBKA 3PQDA 4G25A 3E53A 2R68A 3K0FA 3PHGA 4UATA 2ZSJA 2I7DA 1WUJS 5DK6A 2PA3A 4NG5A 2B7LA 2WICA 4MW0A 4DV3B 1F2TB 1E9DA 5FNVB 1WXDA 1RJWA 1RWBA 5ER6A 2B4AA 3VFDA 2RH4A 3BVPA 2CHFA 3V4LA 5CVCA 4G0MA 4LKOA 2G9NA 1CUAA 3KTFA 3OFND 2H48A 4ZV4A 1X0VA 1QK3A 3I52A 5IS2A 1SD2A 2JGNA 2H4WA 4ZTUB 2JFQA 1C0KA 3H87A 521PA 3UK1A 4KQKA 2RD2A 3C8HA 1UQTA 3K6SB 4AIIA 1PRYA 2FPXA 3RBZA 1DIRA 3IKMB 1NX9A 1DT5A 2IXEA 4MVJP 1NKTA 4HH1A 3PBKA 4RTLA 1M34E 4XD7D 1P1RA 1XZIA 3N39C 3UUWA 1EIWA 1N9KA 4P4GA 1NUPA 1PJLA 1XK6A 2ZB4A 3RS8A 1NDQA 1M6VB 4MV6A 4F1JA 2GGSA 3VNBA 1A69A 1T3SA 4WPGA 4V1CA 4L4XA 3RARA 3I9V6 3A6DA 3KHSA 5K8JB 3CNOA 4YO7A 4K6HA 5ARCA 3SU8A 3IUNA 3S1AB 3GH1A 1J49A 3GQBB 3LLVA 2FX2A 3KSUA 4OQMA 1VE6A 3O75A 4WXYB 2SNIE 4O1MA 3RG2A 4WZ6A 1JA0A 1UBNA 3IP3A 3CT4A 5LOVF 2ZUSA 4LYAA 2QL9A 3FVWA 1NG9A 2A7XA 2GWHA 3BKWA 5U4QA 3C8DA 1DAKA 4BAUA 2XRFA 1EUZA 3QPCA 4GICA 4NCNA 3GX1A 2COEA 2WDPA 1CQIB 1QH1A 3WIEA 5CNIA 3H9BA 3WL5A 1UP6A 4KN5A 2XYQA 3MILA 1Q17A 1PK7A 1QBKC 3ND9A 4MYCA 1JR3A 2XSZA 4U7FA 5CVEA 1MNAA 2QE7D 2GI4A 1DXOA 3KQQA 3QMWA 4JIGA 3OEWA 3DZ8A 4MKFA 3K2QA 4Q48A 3VR0A 4GM0A 1VE3A 4QD3A 2J5RA 3R44A 4HNAA 5E6UA 2O0MA 3Q7IA 3H19A 2NUPB 1MW9X 1IEXA 1YS1X 3P9QA 4KI7A 5EQDA 1KH2A 4BE4A 1Y4AE 5G0VA 4ZZ1A 1Q44A 5KU7A 3IEIA 3TLAA 3KVVA 1ZJ6A 3LX8A 4LZZA 1W76A 4S1NA 3CISA 3MJCA 1O6CA 2BUAA 2I66A 5CLQA 3ZIAD 4DPLA 5KIAA 4YAJA 3KQTA 4G9BA 3WRYC 4X7BA 5EIAA 3C1UA 1PW7A 1DAGA 1GRRA 5BV7A 2H1LA 4IUYA 4OCZA 3K35A 1RJ9A 3ZY3A 1E3TA 4CM5A 3KUCA 4JLKA 4DYVA 3AR9A 2FPIB 5F76A 5BWMA 1N9ZA 4W63A 2JD2A 1IZZA 2W58A 1PNOA 1U63A 4P54A 1COWA 3T52A 3EISA 2FWRA 2QRHA 1GCGA 3JARA 3NDBB 2IQIA 2ROQA 2JIDA 2QENA 1JX6A 2YMLA 4B3RB 1Y6QA 4AJJA 5BV2P 3ZY4A 1G21E 4EFLA 4QHSA 4WK2B 3EH1A 4UBIA 1M0WA 3WSVA 2F6RA 1T6YA 1KAGA 5JO0A 5L9AA 1MQ8B 3VSDA 1NX6A 1BCRA 3A36A 3VYVA 2CFOA 1NNEA 4AJIA 1WMAA 4NBUA 4QGAA 2BKUA 1NTOA 1L1FA 4KGZA 4UM8B 2R79A 2BGGA 2J85A 4J91A 2NPFA 5A3RA 1M73E 3KOUA 3WLMA 5KWSA 2GVZC 4Y0VA 3IE0A 4YRKA 1VHWA 5EUCA 5KVQA 4AQ7A 3WS7A 3RIGA 4AECA 1P31A 2XJ9A 4BZXA 4E32A 4ZYWA 1NVFA 1UMBA 5GONF 2VPXA 3RFTA 3NYWA 2E9SA 4YRTA 4E3WA 2EC5A 4Q37A 2FN4A 4AMYA 5KYGA 2P0AA 5CD9A 4TKUA 1UBEA 1J4AA 2XMCA 3EZ7A 3BZBA 3M3DA 3X43A 1FRVA 1V39A 1SUEA 2EFYA 2I4MA 3WIUA 2HR1A 1RXCA 4AD8A 3DCJA 1PQYA 1U8EA 4LC0A 1J7KA 2V55B 3STYA 1Y1QA 2YJZA 3UUEA 4AS3A 2XADA 3DGEC 1ODCA 3FPFA 4AUNA 3BMCA 4QYIA 2GJ9A 1OLXA 1D04A 4J0DA 4CMBA 3CNBA 2BF7A 3ZS9A 1QE0A 1JUDA 2IYAA 3VSBA 2F1HA 4FZRA 3ZLBA 5H1YA 3GP3A 4C14A 1LFDB 3WJ2A 1MTZA 1O96B 1EB8A 1NPTO 2E6UX 3V80A 3WRXC 1G5PA 2PUHA 3T5PA 3WDLA 3K0FB 2FOXA 3ENVA 3JAWA 3RS7A 4OMUA 4RO0A 1BKYA 1JHRA 1GOTA 2Q2WA 3NH6A 1II8A 4WXMA 1M2VA 1ORWA 2A14A 2XNHA 4EI9A 1CLEA 4ZCRA 4DLBA 4CQNA 1GYRA 5J5VA 5AVYA 1VYTA 3KCQA 1MKYA 2QNRA 4G2TA 4RVFA 5E4TA 5E9AA 2MYNA 2VJYA 4GKVA 5AICA 5HJ7A 1WB9A 3QELA 2DQSA 1EDOA 3C7AA 3FX2A 5LMUB 2JASA 3ZR4B 4ASUD 1ABBA 1E6KA 3IERA 1SBIA 4FCWA 1UDCA 2IY9A 3RSLA 3A6KA 1DCFA 3LW8A 3VA7A 3D8UA 4RKWA 4BPBA 3I4CA 4IW3B 4QJIA 5F5LA 4OUDA 2FG5A 2C3UA 3CIOA 2AF3C 2EF0A 2GWRA 5IJ9B 1AVTA 2VH5R 4ENWA 4DLTA 5EWMA 1GPUA 3GLGB 3BMXA 4R1SA 4JFRA 1YDWA 1J0CA 2GPJA 3AH8A 4TWJA 5D86A 3U4DA 1UOQA 4LC1A 2CFIA 4RKRA 5SZKB 2WW8A 2XVZA 3DW1X 1T6BY 3FYSA 3G6KA 3MLEA 3B2NA 4GXQA 5ECWA 1JTEA 4L4SA 4C7XA 1A5ZA 3FVTA 4REQA 4C0QC 4S12A 4TXNA 1A9YA 3JRXA 4IXMA 3V97A 3BB1A 4FN5A 1JHVA 1KEEA 3KB8A 3NKFA 1B3BA 1K6MA 3HJUA 4JBWA 4BMNA 2GLUA 2XWQA 2PGOA 1V7PC 3F71A 3O4VA 2QTFA 3T3OA 5JD6A 2ZYWX 2HCTA 1U7DA 1T15A 1PE0A 4CF7A 1LGYA 2AEMA 1VHQA 4CMJA 5JXHA 1YK0A 4HX2A 4LMBA 1LX7A 4EJSA 3QVOA 1ZJ5A 1KFCB 3KIPA 2BDEA 3AVUA 3EVDA 4ND8A 4OF4A 4LOHA 2YYYA 1W87A 2HRZA 2BJWA 4LQ4A 4RZIA 2VUTA 1DJLA 2R00A 1COZA 1WBDA 1VXOA 2ZI9A 5I4KA 3FB1A 4XRRA 5DOZA 1SOWA 4Y30A 2Q4BA 1L5ZA 1YS7A 1VLVA 1IY1A 2CCKA 4JL5A 4B1FA 4F9FA 5K2OA 4D3ZA 1QF9A 4QAJA 4OAQA 1ESMA 4BKRA 1C1DA 1YB2A 3GELA 3HN6A 1H05A 2BEUB 4YN3A 1QGUB 2WFLA 4O02B 1SOUA 3SQMA 2PX4A 4EY7A 1NOIA 4MV7A 5DWQA 2EZTA 1Y98A 2MU1A 1IJEA 4V0ME 1ZN8A 3E8XA 1DOZA 4QTUB 2E5FA 2AFIE 4KZPA 1IATA 3TZLA 1DWUA 3QUQA 4F2HA 3UOWA 3FAZA 3WE7A 3PRJA 4U0KA 3RYFB 3HJBA 4A8JB 3MHTA 1ZGJA 3N2GA 1QRDA 2CDRA 3HDVA 4FQ8A 3GPBA 4R9VA 1VIAA 2PQ0A 1JKMA 3DMYA 1EXWA 4TVBA 3LKDA 2QTHA 3DEAA 1HI9A 3DZDA 1H2FA 1P80A 4K6FA 3PC8C 3FTNA 2Z3VA 4M0EA 2O48X 3H65A 5TPZD 3VR4A 2J3HA 3TZ6A 1QCCA 1O94C 1EXNA 2RGWA 4C6TB 1JMKC 4RVOA 2ILVA 3Q1LA 2B0JA 1JZQA 4PHTA 2BPOA 2HO4A 6CHYA 2V1XA 2JIMA 5ED4A 1C3VA 1DV1A 3FUXA 3UHOA 5FD8A 4GX5A 1WP9A 1EWYA 1WY7A 2B36A 4YT5A 2ZUEA 2GJ8A 4G4JA 4RK6A 4GI7A 4UW9A 4C0KA 2VDQB 2WAXA 5KYYB 1HPLA 3TI7A 1KRWA 1JHQA 5ALMA 5C8YA 4CG1A 1WCIB 3AJ9A 2C2WA 2JLBA 5EJFA 2KX7A 4LCBA 1MC1A 5TMEA 1T10A 2WMOB 4P6VF 4TTAA 2ZSHA 1VECA 2QWXA 4F4JA 1XQ9A 3AM4A 3RREA 1L3BA 3O8DA 5IK2D 1EFVA 3I6YA 4Q66C 3SR3A 3DFIA 4EUNA 4LGYA 1S3GA 5IZ4A 5LMNB 5A3QA 2BLNA 4ND4A 4PC6A 5DHTA 5FTLA 2G6BA 4CT0A 4YAWA 1E92A 3OZVA 4M7OA 4UTNA 4ZYUA 4R7GA 1VLZA 5COQA 4P4NA 2J59A 3UJHA 3K5PA 3WLJA 4DQ0A 1IOWA 3E48A 3WLPA 2QG4A 3CE6A 4BTEA 4DJDC 3N0WA 4BNTA 1E69A 4MW2A 1SKBA 2DY0A 1JMYA 2LGJA 4A7PA 3F7TA 2YV4A 1JSCA 4F5DA 1PZEA 5FTWA 1AN9A 3PXCX 3ZK7A 2EXXA 2HQSA 2YHUA 1R0BA 1DIAA 2XA9A 2OKGA 3ET4A 1QK5A 3PNOA 4WMLA 3GJSA 2ZWIA 5EQJB 5FPHA 5IJAA 3HJGA 3FDZB 4LVUA 4Y6QA 5A62A 3R9XB 2O8DA 3N3BC 2BGJA 2Z1NA 5JAQA 1YT5A 1UXOA 2GZAA 2OCLA 4Q7KA 4U9UA 3V2IA 5B3LA 1GKIA 4Z1MA 4D02A 1L7VC 5K1ZA 3UWOA 3X1JA 1YNOA 5IDQA 4X1IA 2CV0A 2PGNA 1OJ7A 2X0RA 9MHTA 3PDHA 1ZVMA 2WEKA 1SIUA 3C8ZA 3DEIA 2H4ZA 3EXEB 4FD3A 1TD1A 4N3CA 5HIMA 3DA8A 3ZTYA 1E9AA 4DGSA 3EPHA 4QBFA 3IVCA 1VHTA 3DHYA 1U3WA 3F97A 4EZIA 4K3VA 1EQUA 1E9BA 1X19A 1T0IA 3E4CA 1HTBA 4TLLB 3AG6A 1I0LA 1U8XX 4UU8A 3MWGA 1TD9A 3DE5X 3HV2A 4M99A 5KAMA 1PDOA 3OVMA 4K6CA 1ZK3A 3Q72A 4FFMA 5JSFA 1J5XA 2BT4A 1CQWA 3VJKA 4UCQA 1Y7IA 2P9FA 2B4YA 1YQTA 2ZRBA 3AJDA 3PL5A 3L7IA 3ZN2A 4CMIA 5K99A 2IUYA 1D9XA 3R3YA 4AROA 1QHGA 2HMYB 3AGQA 1ZRHA 5E3HA 2UXBB 1ISJA 4G0QA 1A77A 4L22A 2CNBA 4L6AA 2FDCA 1I9GA 3OC6A 4I1UA 4ZDIA 2DAPA 3TZQA 1QHIA 1N8TA 1SCJA 1H5QA 1XRMA 3BWXA 3SYTA 3EVTA 4DR6B 2CYAA 1ZG3A 2IYTA 3FLMA 1KDYA 4JJIA 3RT7A 1QX3A 1XCLA 3R9KA 1U7PA 3WWPA 2FQQA 3HKDB 4PZLA 4R7ZA 4TRJA 1USKA 3UB2A 1RQPA 3UJ3X 4ZEMA 3EXFA 4U8HA 4ALLA 3KLPX 2VLBA 2C2XA 2WQ6A 5LXTF 2V7UA 2GHTA 4BFLA 1C7IA 1GQOA 2VJCA 3VO8A 2PGLA 1JTFA 1ZI9A 2IZ6A 4WBNF 1LWNA 1UC4B 3FGOA 3ROZA 5LJLA 3P2OA 3DDZX 1E2EA 2RMKA 3UC9A 1KE1A 1TUBA 2H2GA 1J56A 1EVYA 1N57A 5HFJA 1XDDA 3X0DA 2WU4A 3C24A 3P9YA 4BX8A 3EY9A 1NJGA 1OAOC 2LKCA 4EPTA 1VKOA 2QUHA 3OM8A 2XF2A 2ZOSA 3SOPA 4EB3A 4IKEA 5IFLA 5IJ9A 1IMJA 2OE2A 3I3OA 3FZQA 2HQBA 4OEHA 2RBKA 1M8GA 3LI2A 3KXPA 5WRFA 4EJ2A 3VNVA 4PLCA 3OWOA 3AEUA 2FN3A 2CF6A 2C8LA 1DEAA 3DJFA 1QTIA 2A33A 2P1RA 4Q93A 5ICFA 3RVLA 4QREA 2VHEA 4ZZ2A 3Q3HA 2AN3A 4DZRA 4IWNA 3QOXA 8ABPA 4UC0A 2NZVG 2W98A 4I2VA 3E7DA 4JR0A 2VP5A 5ALPA 4E2YA 4WI1A 3K8OE 5KTTA 4WZAE 1YCHA 4HYQA 4FDLA 3ZVKA 4MDFA 3N2GB 1NF8A 3AI7A 3AB3A 4OLAA 1YBMA 4OQDA 2UXDB 2HOQA 3K6RA 2NV6A 4NC9A 3QQPA 1L4FA 2GRUA 3EEQA 3SZOA 1YQGA 4MQ6A 1R0YA 1VLHA 4TL7A 4EMBA 1T5IA 1GNVA 1CUWA 4MCAA 1OYYA 5HIAA 4MS4B 4D5GA 1Q0SA 5KSZA 1H1DA 1OZHA 3U44A 1U9ZA 4KLNA 3T38A 1ZLYA 2I76A 5AW8A 4NU0A 1KNXA 2W6JD 3UK6A 1SHKA 3BMCB 3H9QA 2BRUA 3F6EX 3FPBA 1BE8A 3JWJA 2O0KA 4KQMA 4QYIB 2GJ4A 3DTYA 3MMNA 2BHSA 3IMKA 1QE3A 2H18A 5F12A 3RVOA 1EXDA 2W0MA 1E79D 1GFZA 1J7JA 2YW2A 5EESA 3F7OA 3NYIA 4WXHA 4BFSA 1O03A 3GGPA 3HJRA 3LUPA 3PUVA 2P78A 4W7IA 1H6CA 5TT1A 2VP3A 3TSWA 2GILA 1YBAA 3PD1A 4Z53A 1ND5A 2IYWA 2RCYA 5D3ZA 1PEYA 4RIIA 3Q8MA 5A03A 4IJUA 3P7MA 3W5BA 2H0QA 3WMEA 4V1CB 1EVZA 3E7WA 3PXXA 1ZUNB 4TTQA 4A15A 2WG0A 5K6RA 3UXMA 2IYUA 3KKKA 1D2HA 1UKBA 4IX9A 1KVRA 4G0ZA 3ZDEA 4ACAA 4YVFA 5TQ2A 3SXPA 1RAFA 1V37A 1Z88A 1O6BA 5D7BA 2LZ0A 3EQ7A 3GRZA 2FFQA 3GLUA 5ABPA 4MICA 2VTBB 1J20A 2VSQA 2Q9UA 2ZJ3A 4QNMA 1LV8A 3KZOA 3RRNA 4O2AA 4EY6A 2HA6A 1OX5A 3L6OO 5B2EA 3FPAA 3FDZA 2REQB 3B3FA 4A5OA 5K8CA 3T3HA 4IVPA 4X3PA 1XZHA 4OBXA 2D1RA 2DLDA 2FUNB 2B98A 2HCRA 1U7HA 3BGSA 4GP9A 1CVRA 2YIMA 3RRYA 3ZQJA 5JH7B 4DR7B 2AN4A 2ZRQA 2FUEA 2WVHA 1JB1A 2PR7A 3KQMA 4UJ3A 3CE9A 4Q9JA 5FFNA 2YCBA 5IZCA 1N34B 2I55A 4NNJA 1B2LA 3WWCA 1TFUA 4LF8B 4BZPA 2I8LA 5I7UA 5JD4A 2A5DA 3IPCA 4FN4A 1DSSG 5JWHA 2ONCA 4I1IA 3WTCA 3AINA 1DCTA 2PX2A 2K6GA 1I3MA 3D5TA 3Q7SA 1QH0A 2ZRCA 2AZXA 1G5RA 4I9GA 4WHMA 3QU4A 1N5RA 1NVTA 1X7XB 2JPDA 1JT9A 1XRSB 3FVQA 1YB1A 5HKBA 4XD7A 2I6SA 3GLTA 4L9AA 5K2MA 4OQZA 1KSJA 1RQLA 4XLLA 1FF9A 1E77A 2IQ5A 3DEFA 4BO0A 4ZI3A 1ZIOA 3PJDA 4BQOA 2FE1A 1RMTA 1GKLA 1BU5A 4LXGA 1WG8A 5LZ9A 3BHJA 4QVGA 3Q7EA 4MAAA 1L2TA 5DCUA 2F43B 1FB5A 2OCKA 1GNSA 2PBZA 2X3UA 1BW9A 2CXNA 3AF0A 5TMBA 4YUYA 3DOEA 4F5WA 1HEYA 1RW4A 1N2XA 3D6VA 3RHSA 3TAUA 4CQLB 3FRIA 5KZMB 1EG7A 4U6QA 1YI8A 4BC0A 5DBIA 3REQB 3QFHA 4Q4AB 3G0OA 2X76A 1BCRB 1Q7CA 2P9EA 2JNWA 4ZOLF 3C5VA 3V4PB 3JZMA 1XA3A 4WFJA 3EA5A 1Z2NX 2HGZA 1IMOA 3C48A 1X8XA 3Q98A 4GEKA 2HC9A 2P6PA 4YRSA 4LZAA 5IAGA 4RPLA 2JLWA 4A36A 1SKYE 2OQ2A 3M3HA 3MMZA 2V3CC 3R1IA 1C9NA 5KB3A 1BQ4A 1Z8DA 3G9UA 3NBYC 4RDHA 1A5AB 1I8TA 3EDOA 3DFZA 3IVMA 4EHIA 3R6GA 3Q2IA 4R2XA 4Y9TA 2ZQ5A 5ETJA 4GNRA 3RM3A 3GMDA 1YJBA 4PX5A 3DOHA 4W6ZA 3ZDFA 3E22A 4TS9A 1CHNA 4KOAA 5CB0A 1KI2A 3F74A 1AKVA 3E2PA 3IQGX 5DI3B 4FT4A 3D4OA 4TMXA 3RUAA 4S3MA 3N74A 3R7BA 3V42A 2V7EA 3FAKA 1N2CB 4RWEA 1CHDA 1V5IA 3DP9A 4INAA 4BMCA 5E7JA 4HL6A 3V4SA 3GD7A 1K3UB 1SC3A 4HXYA 4QUAA 1VSVA 3ABZA 3TEMA 1T8YA 1BVHA 1U2SA 1I4WA 1DHTA 1GO2A 3M1YA 3HH8A 1N25A 4W1PA 1G3RA 2KSQA 4KACA 4AURA 1T1RA 3L7MA 4Z0HO 4BP1A 5JAMA 2WSYB 1A9SA 1LRLA 5DM4A 3LD9A 4N7RA 3DUFA 3E9DA 3EQ9A 1JDNA 2NU7B 2OO7A 2W6ZA 3I39X 2AR7A 4IIGA 5FQNA 4ZGBA 4OK3A 1WP4A 4X64B 3U7GA 4JGGA 3NKVA 4JBGA 2EEPA 4MEBA 4OJYA 2GYWA 4B4KA 1RAGA 3BXXA 4ID3A 2M6KA 1GPNA 2VRNA 5FHQA 3OUTA 3OSUA 1AQLA 4RZUA 1SB8A 1MFPA 4AMUA 6NULA 5IX8A 1Y6JA 3OCXA 4GMDA 1HURA 1LPBB 1UEJA 4ZKEA 4PYRA 4P3KA 2PAFA 2HA0A 3BSYA 1ZMOA 2XMGA 1ADFA 3BD9A 4JU9A 3VTZA 5DJ5A 1ZLXA 2IHTA 4RMJA 3RRMA 1FDRA 1TRHA 2Y92A 4XRGA 4JVNA 2HZBA 4GRDA 4L4ZA 4E12A 2O2HA 4LSGA 1GKKA 4UTRA 5B7PA 1XMIA 5EWMB 5E9JA 4KEAA 1YS9A 2NU6A 4RACA 1DTEA 5IF3A 2R87A 4R0MA 3MBIA 5CCBA 3KVYA 1NNSA 3M81A 2A5JA 3QF4B 1E3QA 3NJ8A 3ICEA 3L0DA 1EIZA 4B6PA 1CF2O 3VPBA 1ONSA 2R1UA 3OM0A 3UGKA 1PT8A 3QIVA 4AXBA 4CF3A 5CXSA 1Q2XA 5AOBA 2AHOA 3F8SA 3AESA 3DYVA 5K0NA 3BPSA 3KLBA 1DB3A 3A04A 3DE7X 3U16A 5HWSA 2YS7A 1M5UA 5E1OA 2J9GA 2Y9YA 4L5CA 4PC2A 1KERA 3VJLA 2Z95A 1D07A 3VBCA 1WCYA 5LXTA 1W2GA 4FWIB 4JYZA 1JQBA 2JIZD 3QVSA 4GT1A 3NHSA 4TQAA 5E8JA 1D03A 2OHGA 3CSUA 2D5BA 1Y1SA 3QWBA 3TEJA 4XD2A 2H3EA 3L05A 3KFLA 4TMYA 4LX8A 1J2UA 2R8RA 3O1IC 2BFBA 1ISHA 3IOYA 1O5IA 3PPWA 4DBZA 1SG9A 3R3XA 4YB8A 5BN5B 1U3DA 3DDOA 4A3SA 2ZB2A 1RLJA 4DMFA 6REQA 1D3AA 3M7IA 3JR3A 4Q3LA 5DGXA 3C0KA 2DWUA 2O4CA 3W8NA 1N6OA 4K9OA 4PC7A 4URZR 2B7CA 3KTAA 2Q0XA 4NYJR 2F59A 3P27A 1YZKA 4RADA 2AOTB 3WGUA 2G63A 2QLMA 3KE9A 4YUVA 1L5NA 2AR0A 3RUCA 4AY5A 2JKVA 1JTVA 1Z7WA 3EUEA 4NP6A 4OQFA 3W06A 3UAYA 5D5PA 4R9SA 5DEOA 3TE6A 4Q47A 3GV0A 5H5JA 4IGKA 4GGPA 5AI0A 2WSLA 1PJ3A 1S6YA 1AB6A 1JXQA 3IDOA 3L0ZA 4KYIB 5GM2A 4CQMD 4D5EA 2XYPA 5BYAA 4EO7A 1LEHA 1QOQB 5KYXB 5BSWA 1JFVA 1Z25A 4N9WA 2ZBGA 4O2BA 4UEWA 1AMOA 5C1BA 1NGSA 5HK8A 1CDZA 5IW8A 2AB0A 4AF6A 4CKXA 1FDVA 1JIXA 3ADKA 3X1XA 4OQNA 2ZUTA 5M2QA 2DSTA 1RHJA 3TOZA 5LSAA 4XYEA 4JQYA 5LBTA 3FHCB 4EY5A 4JUFA 4FR5A 3DTTA 2CJXA 3ZK8A 3ZCTA 1M10A 1PL7A 4Z9XA 1U0FA 4Z2YA 2OGTA 1XEFA 2WUWE 4E5MA 4RSGA 4JBHA 4BVHA 3LP5A 3RTAA 5LQCA 1NQWA 3ENZA 3G9QA 2B5OA 1TYEB 2YC2C 4XWGA 5FBKA 1PD0A 3DBHB 1X0XA 4WT7A 5ENDA 1JKJA 2VN8A 4TWBA 2IX9A 1DE0A 3N2KB 1ZR2A 4KO8A 1W46A 5AK3A 3Q6MA 4FMCB 5B1IA 1RD4A 1T91A 1ECPA 4QPNA 6ADHA 3O91A 5DULA 5KKNB 3AM1A 4YRZA 2WJVA 2ECKA 1LDYA 1U7TA 3QNUA 1M34B 1MC5A 1Y81A 4P36A 1EFRD 3EFOA 3MJSA 3EPPA 4I1OA 4YDRA 3T0IA 4YT8A 3M6AA 2YWXA 1NQTA 2XE6A 1NE2A 3SBEA 1K0UA 3IAAA 3PUYA 3WGQA 1O95A 8ATCA 3STXA 5BP7A 3PEFA 1IG3A 3GLHA 3H2HA 4JOQA 2HF7A 4NMXB 1C3JA 1MPTA 1E9FA 2QE7A 2WIGA 1W1WA 4UM5A 4N54A 3DE4X 4OFBA 3PQ6A 4P31A 2WV7A 5ESDA 5CT6A 4QKQA 3VZSA 4MQ5A 2IS1A 3G0BA 3TZBA 3BE8A 4OVKA 4Q7JB 3HFJA 2ZYGA 2TMGA 2Y05A 5AHXA 1KK0A 1Y3FE 1DOAA 2SKCA 2XQFA 4HYYA 1ZGZA 1W0JA 5G3ZA 2WWXA 3COYA 4H08A 4Q16A 4P4UA 1SXIA 4HFRA 5ISMA 1NN5A 5FA6A 4CU2A 4NCKA 1JZSA 4Q3BA 2IXTA 4O33A 1O4WA 3VPSA 1VDZA 3B9BA 1NE7A 3NJ4A 3VTKA 1G18A 2ATEA 4IIJA 3EZ6A 3EGWA 5A3JA 5E8RA 4MKXA 1GL3A 5B3KA 1T9GS 4QU8A 2GN1A 2A0KA 3PFBA 1UT5A 1YD7A 2PSJA 3I4LA 2VAXA 3ZNQA 4D57A 1ORTA 1SXJC 3JS5A 3LDFA 3BXPA 3IR5A 1Z74A 3LCRA 4Q03A 4EA6A 4B32A 4G26A 1FFEA 3IUYA 3S2FA 3ZDQA 4DB2A 1JEQB 1DOHA 1P7ZA 4TUYA 5DKFA 1CUJA 5G53C 5JHHB 3BHIA 2OECA 1XTZA 2OBNA 4GLLA 1M75A 4DBVO 1OAOA 4LXHA 4QM7A 4B3MB 1HQDA 1ZIYA 4IUBS 2BTQB 1G21A 2D2VA 1XDGA 3CCCA 2HHCA 2JCBA 4PYKA 4CLRA 4XARA 2O52A 4OQPA 4KXQA 2ZB8A 3IMGA 5C1IA 4CLOA 3NIFB 1G5IA 5JC1A 2HMAA 1L7BA 1RDFA 4LDJA 3ZWNA 4G86A 1J1ZA 3E5HA 4AM8A 1KETA 1M0TA 4B84A 4C0WA 4DQVA 1FU7A 4P2BA 4QPDA 4YWJA 3VGJA 3F49S 5IYZF 3L1HA 5DHSA 4DLKA 4ES6A 4ZDKA 2J5KA 3B8EA 3T5DA 5I8PA 2F3UA 2AMJA 4L0QA 4IJ5A 5I5GA 3ZZUA 5MGNA 2O8BA 3G2HA 2PMDA 3LHFA 5JNVA 2UVDA 4OHOA 5EGNA 2X23A 3LLCA 4OY3A 1DPFA 4JLVA 3EXFB 5ARDA 3IP6A 3SEZA 5B6PA 2W6JA 1OWMA 5LR6A 1O9BA 1YGYA 4KO1S 4LN1A 4REOA 1OZGA 3I0NA 2XDAA 1ENOA 2EBWA 2FJUA 3JZAA 3N6XA 4G4SP 2P3LA 4XCQA 3QMPA 1PUXA 5ELMA 3ZI4A 1QYIA 1PS0A 2D2XA 3DMHA 1RQXA 4EARA 4FGWA 3ER6A 3B9RA 4GI3A 1Z6QA 3CR7A 4RW0A 3OP4A 3WLSA 4EYKA 3KQHA 2DH6A 4YP0A 1TVCA 3QOYA 3F6YA 4A10A 2PMWB 1R3DA 3LY8A 2WPDD 1C3XA 2I87A 3HFRA 3HSYA 5BMVA 4HDCA 4P81A 2BTOA 3FWZA 1XZFA 2ZANA 4URWR 2ZVPX 3MTEA 2GPSA 3NBZC 4ZT3A 4EGFA 3RK0A 1ZK2A 3REGA 2H2IA 4J75A 3VHLB 1GCOA 3I83A 3KOOA 2Y68A 1VPDA 3EAFA 3DNMA 3N5CA 3EPKA 2DFTA 4AJ2A 3ZU2A 5H83A 5HQJA 4JSRA 5J40A 5K0LA 3ZGLA 4UTOA 1Y33E 2R25B 2ZTSA 3EZYA 1UBMS 3GCGA 1E3WA 1UBUS 1US8A 2B1GA 3IAEA 4TRRA 4UTZA 3V1UA 2X6RA 3LX4A 3RROA 2Z58A 1UAYA 3F5FA 3NCHA 4IRXA 4KI0A 3WIBA 4V0KA 4AQYB 1XEXB 4BO4A 1ES9A 2WMDA 4C0HA 3ZDCA 4JKIA 5LXTB 1KC3A 5C9ZA 1BVYF 3FNEA 1GNPA 3WBJA 2Q3DA 1RKXA 5EMNA 2AS0A 3LRXA 5EXDA 3ZLVA 2CV2A 4L0CA 2ZYDA 1JA9A 1OBOA 1W4AA 1YUMA 3IVAA 1NVDA 4YA6A 3RASA 2ZWAA 4DC9A 4HAZA 3SJZA 4B7CA 4KIWA 2G9VA 1TA0A 1RRGA 4P7BA 2ORVA 2PD6A 4Y2RA 1NMYA 2B5WA 4N6NA 1UZLA 1RBZA 4QPJC 5JSUA 2PWYA 2DB3A 1U0LA 1YR3A 3C39A 3N8IA 3ONDA 4B3XA 3CZMA 3QIAA 1GV0A 4Q0MA 3QXGA 1ENPA 4KPUA 5AP9A 3H1GA 4OP3A 2VS1A 2BHLA 5DWVA 3NONA 3E23A 5DW3A 1R6DA 1HDCA 4Q1CA 3MM4A 3L04A 4D92A 3DD1A 2O8FA 1SIOA 2H4HA 1ZGAA 4NONA 1ID8A 2UKDA 3PG5A 1DTSA 2D4AA 2R44A 3B1ZA 2O9JA 5ICCA 4M9XA 5JD5A 3OA0A 1O6GA 4X00A 5FOQA 2QPLA 3HCCA 1H0SA 2Y6VA 4UULA 2IYYA 3JU3A 5LBUA 3TTUA 4WGFA 1RAEA 3QBVA 4ZI7A 5JT1A 1TU4A 4HXGA 1M83A 3RFUA 1MHPA 1M7BA 3I5UA 1OI4A 1MLDA 2V6FA 5ECDA 2D7CA 3IELA 5JS6A 1G42A 3VNRA 3NBQA 4GMGA 2LBPA 3DQQA 1MO4A 4FIZA 4DMMA 4I6EA 4ALJA 3DM5A 4MJXA 5BNTA 1JG6A 2IDMA 4EOGA 3FBGA 1VC2A 1PGQA 1GAWA 1G8MA 3MBKA 1B8OA 4XFDA 1AQYA 1Q14A 3GRCA 3CEJA 1WDLA 3LBYA 1JIIA 5DYNA 4CF6A 4EJSB 1U94A 4O6VA 4NBRA 3BZWA 4EG0A 2BM0A 3OQNA 3GXBA 3KSDO 2CSUA 3CEAA 1YF3A 3D6HA 3FNFA 1NU6A 2DR3A 1J2RA 3CUSA 5EYPA 4LZPA 3ELBA 1EA5A 2OGZA 1TK2A 1CR4A 4B5KA 2R97A 3PE6A 4ITUA 5ENVA 4UVDA 1BX0A 1SBQA 4MTLA 1FRFS 1L5HA 1X1SA 4DCMA 4DNPA 4DLAA 2JI4A 3CWQA 4KQJA 4IICA 4TL8A 1XN1A 1QIEA 4LHWA 5K8LA 4MWBA 5KDDA 2ODBA 3K32A 3PFIA 4PXSA 2BFDB 4RIFA 4QWMA 3CG4A 4ZCMA 2H2HA 3JYLA 4MKIA 4U3JA 5K4HA 1GADO 2P7IA 3U4QA 2VAMA 2Q4TA 1JDJA 4MW4A 1WW8A 2UV8A 4BGDA 1HYHA 1XMSA 4G5SA 2WFAA 2J41A 4K7JA 5IT9A 2DH5A 4LJKA 3BFVA 4PVCA 5KVAA 3BWBA 3K0CC 1QS0B 4MULA 2Q9BA 4NJOA 4UMEA 2HL6A 3KTAB 3I5YA 1DU4A 2WD9A 5KJ1A 2F3TA 3AF6A 2CJPA 3N70A 4W7HA 1XYYA 1DELA 3RUPA 5I9IA 2Y0BA 1S0UA 1W88B 4ZQCB 5AVWA 2VRCA 1G38A 4MPDA 4WBSA 2QSZA 3DPIA 1QSGA 1Y8QA 3AEQB 5G0TA 5HUJA 1SRRA 3E15A 5ALGA 4EECA 3T9CA 3U4AA 1Y9AA 1J8FA 1I32A 1SVMA 1SA0B 4BMZA 4BUJA 2AWOA 4IHKA 3VRHA 1NUQA 3TTTA 2G70A 1OILA 1KZGB 2XEXA 3JV7A 4FEGA 4MUGA 2D00A 4B7AA 4ZGWA 4S04A 1EUQA 3E82A 5B36A 5KOHB 2J7PA 2PIDA 2FG6C 2C5LA 2G36A 2QK4A 2C5BA 3LX6A 3CH7A 1Z7BA 2EW8A 3KR9A 3LYAA 1E1YA 5IC5A 2NV2B 3V4VB 3F67A 4NVRA 3QGMA 3NDRA 3AL2A 4MRMB 3BH7A 4QUHA 1PBTA 2ACKA 1QGYA 3GA5A 3KHUA 3T5GA 4GBGA 3KOYA 1Y4ZA 3E9YA 4PONA 1YDMA 1UJCA 1E5VA 4KJXA 3TWOA 4D56A 3CUWA 3JQ9A 2JGAA 4MKHA 2H2DA 1HNZB 1GEEA 1QUEA 1CRZA 1N2CA 2AZDA 4IVNA 5BN5A 3C3WA 3PUJA 3H5NA 5HF9A 2I62A 3IVRA 2VYFA 4B4UA 3GR6A 4HDRB 1UPUA 4EQ6B 1CWUA 2GBLA 4HQ0A 4PYNA 5LDDC 3NB0A 1HZZC 3H2GA 5D85A 4W5NA 3O4IA 5DEIA 1M34A 4JI8B 2L17A 5FL7A 3A1VA 3IHTA 3EN0A 1LS6A 1BN7A 1LPMA 2QW1A 4TX1A 4ZZ0A 1EBFA 2A0UA 4UBMA 3DZJA 3FFXA 4Z9YA 3VUEA 3QBEA 1MV8A 4B34A 2NYVA 2X2OA