2EW2A

Crystal structure of the putative 2-dehydropantoate 2-reductase from enterococcus faecalis
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MKIAIAGAGAMGSRLGIMLHQGGNDVTLIDQWPAHIEAIRKNGLIADFNGEEVVANLPIFSPEEIDHQNEQVDLIIALTKAQQLDAMFKAIQPMITEKTYVLCLLNGLGHEDVLEKYVPKENILVGITMWTAGLEGPGRVKLLGDGEIELENIDPSGKKFALEVVDVFQKAGLNPSYSSNVRYSIWRKACVNGTLNGLCTILDCNIAEFGALPVSESLVKTLISEFAAVAEKEAIYLDQAEVYTHIVQTYDPNGIGLHYPSMYQDLIKNHRLTEIDYINGAVWRKGQKYNVATPFCAMLTQLVHGKEELLGAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative 2-Dehydropantoate 2-Reductase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase
molecule keywords 2-dehydropantoate 2-reductase, putative
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2005-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2ew2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ew2A01
1Y81A 2B4QA 1ENPA 4CMGA 2EJWA 3AUTA 4FN4A 4DVJA 3BMOA 3TFOA 4ZHSA 1UP4A 1FDTA 3RQSA 1Y9AA 1LUAA 3VHRA 1E7SA 4IDGA 3DBLB 4UREA 5ES3A 5KCZA 3OIFA 3AM3A 1FDVA 1DPGA 1E5QA 3DZGA 1PGQA 1I0ZA 1I2ZA 2AQHA 3D1LA 1K6XA 2WYWA 3DBRB 3JQFA 3ZWBA 1EEHA 4IJVA 2JCYA 1DFGA 2PGJA 4E13A 3MWEB 4O6VA 3ZV3A 1B7GO 3GNTA 3C24A 4LVCA 1WLYA 3O9ZA 3P2YA 3WIDA 4A10A 2VHXA 2CDCA 2JD2A 5A02A 1ZXBA 1XCBA 1AXEA 3ROMA 2HRBA 3SX2A 3CE6A 1P44A 2YDYA 2BGLA 2BI8A 4LCJA 1HE4A 1HZZA 3E03A 3FF4A 1OBFO 4WKGA 3JQGA 2QYTA 2I5PO 1JKFA 4ROSA 3I9MA 4XYEA 4CM8B 4HFNA 1N1GA 3B70A 1KBZA 2BHLA 1PWZA 4ZN6A 3ADPA 1KVRA 3FNFA 3GDGA 4AJ2A 1BW9A 1T1RA 4GLLA 3K92A 4D3SA 1QV7A 4D0SA 4ZVVA 1HDZA 1YOVA 1KC1A 4IQ0A 4B3JA 2W2KA 1ZMOA 1DXYA 2PKRA 3JCZA 1FXSA 5JY6A 3VC7A 4YPOA 1BDBA 3IMFA 4XRRA 4ND2A 2XXJA 3F1LA 3Q2KA 1YDWA 1UJMA 1W0CA 2QRKA 4NFHA 3TZCA 1YB5A 1C0KA 2O4CA 3LLSA 4L4RA 3HWRA 2R6JA 4FFPA 1HRDA 5EMHA 4PG7A 4J0FA 1UP7A 4D79A 3CIFA 2CMDA 3UAGA 2QZZA 3ORFA 4MP6A 1TT7A 3K96A 2H6EA 2NADA 3TQHA 3WSWA 4DMMA 4JJIA 2EW2A 1LU9A 3LDHA 1ZCJA 2J3JA 1WWKA 3EUWA 1E3IA 4FOSA 1JN0A 3DOJA 3L9XA 3HHPA 2VYND 5T64A 3HFSA 4YJGA 4ND1A 4YAJA 1JTVA 4GKVA 3VVBA 1XU7A 1YJQA 1E6EA 1UDBA 1B0AA 5EJ2A 3UCXA 1VJ0A 1IB6A 1NFQA 2ZJ1A 3M1LA 1J49A 4J7XA 5IZCA 3LT2A 4GBJA 3RUEA 1YKFA 3DDNA 4YQYA 1B15A 3AI1A 3DAPA 2UUOA 2YFHA 3ASUA 1M6HA 2Y0DA 1N1EA 4D45A 1TT5B 1LDBA 4UVHA 2FR8A 4BNXA 4J43A 4E21A 4YVFA 2YYYA 2JFGA 5TX7A 3LU1A 4DTIA 1NQOA 4AJPA 1DHRA 1SNYA 4CM7A 1K0UA 3JQ7A 3QQPA 4ALKA 4PN3A 3W6ZA 1ZW1A 2CVOA 1T2EA 5JY1A 1SOWA 3CTMA 1DIRA 4FFRA 1M75A 4GMGA 1H94A 3GVPA 2XXBA 3TNLA 1ZXLA 3MJCA 4MVJP 4NR0A 3RBXA 1W8DA 5IDXA 5L4NA 5A9SA 2X9GA 3F5QA 1QYDA 1D8AA 3DZKA 3H9EO 4FD3A 3S1LA 4D3DA 4JBIA 8ADHA 3HNPA 4I9HA 1U5AA 2DLDA 3JQGB 1O5IA 5CG2A 4QXMA 1ZMTA 1CJCA 5JLAA 5CAEA 1PGOA 1GQQA 4ESOA 3AW9A 2CF6A 3KYCA 3PLNA 2WD7A 2GN4A 3OQBA 4U6SA 2ZCUA 4R68A 4ZQFA 4E33A 5H81A 3G17A 3FR7A 1UUFA 2A35A 5CG1A 2EKQA 3U3XA 4BKUA 2EXXA 2C59A 3GA0A 1QORA 1OI7A 3ZWAA 3OH8A 2D3TA 2IEBA 4IZHA 2EG9A 4XIJA 4YJFB 2Z1NA 1N7GA 3AOEA 3U09A 1QRRA 1V3TA 2HMTA 5LDGA 4XRGA 1N9GB 4CMAA 2W98A 1HLPA 3VZQA 4LISA 4KQXA 2X9NA 1GYPA 3L6OO 4XKJA 2TMDA 4U0KA 5F3RA 3I3OA 4KOAA 1IUKA 4OYRA 2C29D 1MLDA 1NTOA 7MDHA 1FDUA 1U28A 3DMYA 1CQJA 3MCVA 2P68A 2YQ4A 4R4JA 1IHXA 5GZ6A 2PFGA 3TOXA 3DTTA 4BMSA 4G81A 5JDIA 2RAFA 4BV9A 6LDHA 1VRWA 2FZWA 4PLZA 2OL4A 1LX6A 3GZNA 4AVYA 2B0JA 3KZVA 4NK5A 1A7KA 3KEQA 4CM6A 4S3MA 1LRLA 3RCBA 5I9NA 4F6CA 5A1TA 3CTVA 4DLAA 1ZH8A 2QX7A 4W82A 4AJ1A 4XGNA 2PZKA 3GDFA 1E0DA 2C7GA 1W6UA 4C7KA 4Y8VA 4L9RA 1VL0A 3PJGA 1P1HA 3JQCA 4RF3A 3BZUA 5G0WA 2AA3A 2YW9A 5TT0A 1GPJA 4N5MA 3ON5A 1I2BA 4DBZA 1QXSA 4Z9FA 4AJEA 1EZ4A 1QLHA 1EQ2A 3SVTA 1ENZA 3JD4A 1BTOA 2ZB8A 3RSHA 2I76A 3QSGA 4EGFA 3G3EA 4PIVA 1GYQA 3PYLA 4M86A 1E7MA 3M1AA 4CM9A 1P31A 3FTPA 2FY8A 4B8WA 1QR6A 3GZ4A 3GQVA 2NU8A 2YUTA 2Y68A 1HL3A 5DCUA 4ZU3A 1G6KA 3QWAA 3PHJA 2EKPA 3CEAA 5T5QA 5G0UA 4UVIA 4WLUA 5CEJA 4KUHA 1HSZA 2EERA 2PKQP 3JYLA 4IJKA 4JBGA 1DFIA 4NFSA 3RKUA 1A71A 1AXGA 1CEQA 4MVJH 1I01A 2D5AA 2DQ4A 4GX2A 2NU9A 1V3UA 1EQUA 1DSSG 4HWKA 3K30A 4D44A 2PWZA 2UDPA 4D7AA 2C82A 3JQFC 1M67A 3A4VA 2Q4EA 4IS3A 1B16A 4E6PA 2O23A 1TVEA 1C1DB 1EFLA 3U4IA 2D0IA 4MJLA 3KUXA 4BGEA 4F45A 3WNVA 3K8ZA 2GUGA 3BIOA 4BNIA 3NJ4A 2BGKA 3QP9A 1PGPA 1GFSA 4A73A 3ZV5A 1NP3A 4U8GA 1WDMA 3LK7A 2NSDA 3GY0A 3JQEA 2IZ1A 2XF8A 4R9RA 2YZ7A 4YTEA 4Y6RA 1UXHA 3DZFA 3VH1A 3JQ8A 4E30A 3OSUA 3KYDA 1LDNA 2PD4A 1NWCA 2E82A 1XKQA 3IP1A 4NJMB 3E82A 1MXHA 3FTNA 2ZQZA 4AJHA 3IL2A 1HE2A 2FSSA 1ULSA 3I23A 1LA2A 4ND5A 4CPDA 4WOKA 2VOJA 3JQ7B 5LC1A 4A27A 2R00A 3EZYA 1H9AA 1P1KA 4L76A 3S55A 3ZU4A 2VCYA 5L95A 3E5RA 3O8QA 1IL0A 3WFJA 4FSHA 2E4AA 4FCCA 4J91A 1EUZA 1D1SA 3NTQA 4MKXA 3TJRA 1P0FA 2G17A 4EUFA 2XPCA 3RJ9A 1E5LA 2VNAA 3D3WB 5A4DA 4R51A 4YAGA 3CMCO 1P0CA 2DTDA 2ET6A 3NGLA 1A9YA 2AEJA 1GUYA 1U4OA 4BNFA 1VKNA 1JKJA 2J8ZA 5DDIP 1UXJA 2GLXA 3VVCA 4D41A 1MUUA 1RWBA 4BQRA 4BO0A 4D42A 4TRNA 4PLVA 4XCVA 4BHTA 3PZRA 1WP4A 5GMOA 5FI3A 5KOIA 3ABIA 1T2AA 3GFBA 3DFUA 3DEYX 3OECA 5DP1A 4UEOA 3RASA 4RF4A 1Y8RB 3WS7A 1YRLA 1B8UA 4B8ZA 2QW8A 4E4YA 5KJ1A 4R1TA 4B4UA 4HFMA 4CQLA 2CZCA 4L0QA 5L4LA 3BTVA 2O4UX 1E7RA 1DJNA 3WGHA 2C07A 3KV3O 4EBFA 1Q7GA 5BSEA 1T1SA 4HNHA 3W6UA 4CMHA 3WGOA 4R41A 1RYEA 4B79A 2GCGA 1E6WA 2P5UA 1PR9A 1I3NA 1OFGA 3MJSA 4J49A 3DBVO 5FFFA 4DGSA 1DEHA 3R3JA 3RC7A 3JSAA 4BL5A 1Z73A 1D3AA 1S7CA 4AJNA 5BSFA 4DLBA 1U8FO 3KLMX 3RAJA 4DUPA 1L7EA 2FHSA 4BO7A 2E48A 3K2BA 5HWSA 4WE3A 3PIIA 2VRBA 5CFZA 4RLSA 3DHYA 3HN7A 5TSDA 4DQXA 3KO8A 4NZ9A 3BHJA 3RKRA 1NVGA 1Q1NA 3H5AA 4MKZA 1EVZA 3PYMA 4MVJD 4OM8A 3AY6A 3KYDB 4N18A 5FF9A 2WD7B 4MIOA 1NQ5A 4M49A 3GFGA 2W8ZA 1I2CA 2CSUA 2DBRA 3H7AA 3PHGA 2BFAA 1BGVA 1ZKMA 5EN4A 5K6AA 1RYDA 1W4ZA 2VT2A 1Y7TA 4P4GA 4J1SA 4XYBA 4RVUA 5JPIA 3I6QA 2PLAA 1SC6A 3ICPA 4B3IA 3JYOA 3M6IA 3SLGA 3TRIA 3GAFA 4AL4A 1I24A 1N9GA 4LGVA 4R5HA 3WXBA 4TRMA 4K6CA 4ILKA 4KUEA 1XEAA 1X7HA 3TPCA 1R37A 3K5PA 1ZK2A 2DPGA 5ENDA 1VC2A 1PS0A 2I9PA 1MX3A 4IPTA 3BYZA 1XA0A 4K9DA 2O3QA 4CM3A 1JDJA 1ZFNA 4Q3DA 1NFFA 2CD9A 4GGOA 2DU8A 4E5MA 3PXXA 2CVZA 2Y99A 2VZ9A 5DT9A 5KKCA 3BMNB 4DPKA 2EJVA 2VWQA 3L0DA 3PP8A 3MZ0A 1FDWA 1Z82A 3AFNA 2ILTA 2X5KO 3MJVA 4YRDA 2A92A 4DYVA 3V2HA 3AJRA 2F1KA 2B4RO 3TL2A 3GGOA 1Q7CA 4DIBA 4XR9A 1IHYA 3IS3A 4OKNA 4RO0A 1E3WA 4CM5A 2Q50A 1OC2A 3SEFA 1DBVO 1X13A 5IJZA 3I9JA 3W8DA 3T4XA 1N92A 4GSLA 4DRYA 3A1NA 3H2SA 4J3FA 3C1TA 4OSPA 4D46A 3OQ6A 5JCJA 4BO2A 5GZ1A 1HF3A 2BGMA 3DO5A 3IC5A 4FDAA 2PZMA 1VJ1A 3QWHA 4JGBA 2C7VA 3U49A 1HLDA 4CM1A 3I4CA 1YL6A 2V65A 3Q9UA 4YA6A 3H65A 3FBTA 4L74A 3K31A 1VJTA 2OORA 3VDQA 4W4TA 3O8QB 4NBTA 1DO8A 2AQIA 4NG5A 1UAYA 3D4OA 3HSKA 4IDCA 4CLOB 4PG8A 1GQYA 1KC3A 3JD3A 2BRUA 4BO9A 3OETA 1I30A 4YRAA 5A3JA 4NMHA 2YDXA 1B14A 2D59A 3GEDA 3QY9A 4JNKA 4ALJA 2X5JO 5C7LO 2GZ3A 3JV7A 3VKUA 3LT1A 3I9LA 3PLRA 2BFMA 1EDZA 3G0OA 4ZQHA 2AEMA 4HBGA 1B3RA 3E9NA 2ZQYA 3H5RA 4RDHA 3ETGA 3BHIA 5I8ZA 4C7JA 3WGGA 1ZEJA 1CF2O 2GYYA 3PK0A 3QVWA 1EFKA 3ONDA 4NBWA 3JQ6A 4LSMA 5KIAA 3W8FA 3GEGA 5DBFA 4ZQBA 4XJTA 4CV0A 4WLVA 3GNSA 2X23A 5B4TA 1G0OA 4ZGWA 3EYWA 2Q99A 3HDJA 3SC6A 3VKVA 4KDEA 1TXGA 4BNMA 1NM5A 2VRCA 5H83A 3HFGA 3P2OA 1Y8QB 3DL2A 2ZB4A 3QW2A 1LXCA 1P1IA 1PJ2A 1F8FA 2DT5A 5CDSA 1SBYA 2HQ1A 2FR1A 3SC4A 5JDIC 2YV2A 1V9LA 3K73O 2VN8A 1U9JA 4MKRA 2HK7A 1MP0A 4GH5A 2Y1FA 4EJ0A 2FR0A 2Y66A 5G0VA 2WDZA 1H6BA 2IE0A 3P19A 4E3ZA 4IXTA 4I5EA 4YJHA 1XU9A 1BG6A 1NAIA 1OMOA 5I9MA 3H8VA 2CNBA 4DPMA 1U3VA 4E5KA 1GL3A 3RUHA 1K6IA 5IAAA 4IIUA 4IQGA 2AQKA 3NTOA 3Q1LA 3KSUA 4YT4A 2BLLA 3BMCA 1M2WA 5TLSA 4IGEA 4EW6A 4B7UA 1X0XA 4RF5A 1KY5A 3FPLA 3LF2A 2G76A 3QVSA 5C37A 3BA1A 5CEEA 1R12A 2QHXA 4PRKA 4A5OA 4ONEA 3A06A 3LLVA 2OP1A 1F14A 4ZRMA 3ZWXA 2DFVA 1GDHA 5A5FA 5I7SA 3U5TA 3PGJA 4QO8A 5THKA 3GG2A 4WLFA 4OKIA 4XGIA 4E5NA 1Z75A 4ZD6A 5T8KA 1IZ0A 3PWSA 3LQFA 4NIMA 4WLEA 3B1JA 1E3JA 3PVZA 4E2YA 1N2SA 4UEJA 2GGSA 3KTDA 4PLHA 5GZ3A 2DUUA 2NTVA 3EC7A 2GO1A 4QSMA 3RBVA 5JO0A 4DC0A 3OJOA 4WASA 5HS6A 2YFQA 3WGQA 5IXYA 1VPDA 1XIVA 1DJQA 3QLJA 4XQ9A 1R6DA 1R4MA 4J9UE 3OQ1A 4NPCA 4CLDA 4LK3A 2UYYA 2P4HX 1GZ3A 3D3EA 4BKPA 3WTCA 4AJOA 2YV3A 4XYLA 2FZEA 1HZJA 4J90A 3V1YA 5DF1A 3NT2A 4FFOA 4TKMA 3NDRA 3MJTA 2UV8A 1NPYA 1JU9A 1V0JA 1E1LA 3Q9NA 4MVJM 4XQGA 3DZIA 1H6DA 2WWRA 1ZEMA 3OEWA 3PPIA 4MIEA 1ISIA 4KTVE 1EK5A 3QWFA 3NX4A 3OJLA 3JQAA 1ENOA 4AJLA 5L40A 5I7VA 4S1VA 5TGDA 2J5RA 1WDLA 2D4AA 2DC1A 3GAZA 4R54A 4BNNA 4CLEA 4HADA 3I9KA 5ILGA 3DFZA 4WOJA 4BMNA 1PWXA 3VAZA 5JE8A 1K89A 2ZIZA 2BI7A 2BD0A 1MC4A 5HA5A 1PJBA 2FWMX 1BDMA 3TN7A 1M66A 1B8VA 2PR2A 4L73A 2DTXA 4LCEA 1YQXA 4F46A 4ZQEA 1YO6A 3RU9A 4Z0HO 4CLRB 3D7LA 3HUDA 4RORA 1NQTA 2O2SA 1EVIA 1TI7A 4K1LA 1LDEA 3F47A 3NV9A 1KETA 1YBAA 3AWDA 4NU5A 4UEKA 1NX6A 4RQUA 2JHGA 3L4SO 1KEUA 1M6WA 2Q4BA 5EQDA 3KOUA 2AHRA 2NTJA 2Q2QA 4W7HA 1LRKA 4H15A 1Z7EA 1A4UA 1FK8A 4AJJA 5G4KA 2RHCA 1N8KA 1OAAA 4JLWA 2A4KA 2HLPA 4KP7A 1DC4A 4MOWA 3LYLA 3UHAA 4II3A 2VTEA 3ZV4A 5BT9A 2G1UA 2NQTA 3GGGA 2Y67A 3AY3A 3FR8A 4ID9A 1E3WB 3WMWA 7ADHA 4FJ2A 2Q1UA 4OL9A 4CR6A 1X1EA 4DPLA 1GU7A 2P91A 2JFHA 4J0EA 6ADHA 3ZNOA 5IF3A 2NLOA 2ZATA 4FIZA 1V8BA 4EYEA 4R5MA 4IXWA 1X14A 2R2GA 1O0SA 3MWDB 5I7FA 3Q0EA 1BVRA 1MG5A 1ZSYA 2HSDA 3ZWCA 4I08A 3L4BA 1GD1O 2C2XA 2RH8A 4CV1A 3I6IA 5JAMA 2VWHA 4EJMA 2FMUA 3PQEA 1A27A 4YJHB 2P5YA 4GWKA 5L4SA 4Q3NA 4CL8A 3C7CB 2AXQA 3HDYA 1HE5A 4RVFA 1EE9A 4CMIB 4M87A 4OGWA 3BMCB 2EGGA 2O7QA 1E3EA 1HETA 2C0CA 2PGDA 3FNHA 4N5LA 5JDCC 1RKXA 4GMFA 3OP4A 2QRLA 1WNTA 3AU9A 1PQUA 3DHNA 2VNSA 3A9WA 3B6ZA 3WX0A 1E1NA 4RQTA 3OJFA 2E49A 3QIVA 3D64A 5BQFA 3QA9A 4QEDA 3ZWVA 2VYVD 2HRZA 3RC9A 3UW3A 2I67A 2NVWA 3PFWO 1DIBA 3BAZA 4DIOA 5JYEA 1KEPA 4IMPA 3ZWYA 3K2EA 3Q11A 3EMKA 2GN6A 2JJYA 4O5OA 3MJ4A 4G65A 3GF4A 3ADOA 3W4KA 4Q3CA 4YB8A 3ZHXA 3NYWA 5JO9A 4PRLA 5DOVA 2G82A 3H6KA 4I5FA 3AM4A 4ZA2A 4CMCA 5ICMA 3WOHA 5T57A 3PJDA 5HS4A 1NAHA 5C5IA 3U9LA 4CMEA 4FC7A 5L3ZA 2RH4A 1P9LA 1NVTA 3VH2A 4DXHA 3RFXA 1EVYA 5JAZA 5ER9A 3FN4A 1R4MB 2BKAA 5A3VA 4GLOA 2W2LA 4LMPA 5CDTA 3S2IA 1T24A 3KETA 3O03A 2YHUA 1PEDA 2YHIA 3FD8A 3BTUA 1HYHA 4DC1A 1BSVA 4EEZA 2DFDA 1XR3A 1MFPA 4CV2A 2QZ9A 4NNJA 2FPPA 1D7OA 1X0VA 1T2FA 3ROKA 1ZJZA 5CP8A 5BNTA 1ISMA 5CDUA 3ZNQA 3FHLA 3OFSA 2J6IA 1MA0A 1PGNA 3SBOA 4PVDA 4BO8A 4WCDA 1QV6A 4HX5A 4U5QA 3TWOA 4CMKA 4MP8A 5DOZA 1J4AA 3BMQA 4UAGA 2OBYA 3VZSA 3HE3A 3DMTC 1H6AA 4K26A 5JAIA 3HZZA 4O59O 5JXWA 1E6UA 2X0RA 3QJ5A 3UCFA 3JQBC 3DBHA 1BXGA 4J1NA 3PWZA 4E5YA 2B36A 4XZ3A 5IG2A 3ANNA 4GL4A 3ZWOA 3ANMA 2AQ8A 1PIWA 1RM4A 4R1SA 4CMJA 1WXDA 2HJRA 5JCJD 3VPXA 5F5LA 2O3TA 1C3VA 3WYCA 5MGBA 4EI2A 5JW6A 1U7HA 3W8EA 3GG9A 4YAEA 4CQMD 4GWGA 1RM5A 4OIMA 2VZ0A 2RCYA 2O3RA 2P9EA 5THQA 3DOOA 3HADA 3GK3A 5DBIA 5F1PA 1ZK4A 3DTYA 2WM3A 4KTTE 4CR8A 1DRWA 4BMVA 3NRCA 3ZHBA 5IN5A 2D1YA 1RM3A 1OOEA 3C3XA 2Q2VA 2NACA 4W6ZA 2VQ3A 5GY7A 1XQ1A 2GNAA 5A5EA 1E3SA 3F6YA 4FS3A 3ZGYA 1P33A 1ZUD1 4JBHA 1GUZA 4BB5A 3RI3A 3TF5A 4XGKA 2Z95A 5COQA 3CZRA 1GTMA 2HO5A 3BMOB 3KRTA 4A2CA 1LDGA 4TROA 1RPNA 4Z3KA 2VHZA 4IINA 3WYBA 4R01A 1YB1A 2J5KA 1NFRA 3P7MA 5TC4A 1O8CA 2VYNA 1JAYA 5IDQA 2GZ2A 1DLJA 2H9IA 4FFNA 3WWYA 3LC2O 2VOEA 3ENNA 1AHHA 1T2CA 1E7YA 1LLUA 4OJNA 4OXNA 4MVJF 1ZSNA 4YR9A 4J4TA 5A04A 3C7DB 1KVQA 1QYWA 4MDHA 3GVIA 4NQZA 1KOLA 1F12A 2ZB3A 2PV7A 4TMFA 1E3LA 1U1IA 4AJKA 3UXYA 1DLIA 1U3UA 1XYGA 5KVCA 2VWGA 3LC1O 4J1TA 1VL6A 2AG8A 1DRUA 2JHFA 2X4GA 5TT1A 2JAPA 2Y1OA 1HTBA 3PYXA 2DAPA 5IDYA 4XYGA 1JVBA 2OUIA 2VHVA 4Q3AA 5CHEA 1SMKA 2Y1EA 4G2NA 5EERA 4CLHA 5K0ZA 5AOVA 4I5GA 4B4OA 3CMMA 4PLFA 2HJSA 3PQFA 3RUAA 4R16A 2FPIA 1XWFA 3R3SA 4YWJA 3WMXA 1UDAA 5FYDA 1UAGA 2VHYA 4XDYA 1TA4A 3H2ZA 3E8XA 1X7DA 5T8KC 3IKTA 5TQVA 4EUHA 3DZHA 2W2KB 1MFZA 5KTKA 2J3IA 3ROQA 3CINA 4OOEA 3M2PA 1BXKA 4TSKA 3ETEA 4D0RA 4PLTA 2I66A 1WDKA 3DZBA 3JYQA 1R4NB 4YXFA 2BELA 4IY1A 4JN6B 2V6GA 4UUPA 1I5RA 5AXBA 3FWZA 2IRWA 5KJCA 2NVUB 1O95A 1R0KA 2B35A 3ONFA 3VDRA 1KS9A 3IOYA 1VE9A 4J2OA 3B1FA 3C85A 1LBEA 1SAYA 4DREA 1XQ6A 1OC4A 2NM0A 4H16A 2J5QA 2O3SA 2NUAA 1EBUA 4RVHA 3VH4A 1CQIA 1LLCA 4LSWA 4W7IA 4RCVA 3X2EA 1EBFA 4MVJG 3GNQA 4XA8A 1XHLA 1MV8A 1P45A 3HDQA 4EEXA 4IDFA 1Z45A 3V5NA 4E31A 4TZTA 4WLOA 4OXYA 3JQ9A 4U7WA 2Z1MA 3HQ4O 4N5NA 4Y98A 1SB9A 1J6UA 1Q7BA 4GX5A 4CM4A 1XELA 2FN7A 4AICA 1ZJYA 2X0JA 1N7HA 4B4VA 3H5NA 3WLFA 1KEWA 3WTBA 5EINA 2ZYGA 2CUKA 3ZWPA 3L77A 1UZNA 4XD2A 2CVQA 3COSA 1LDMA 3RUCA 1YL5A 2QG4A 4OSOA 3OICA 5HTOA 2CDBA 3IJRA 2IDZA 1KYQA 3FSRA 3OJ0A 1OZAA 1LSJA 3GDOA 1JQBA 4YT8A 3O26A 3PIDA 4DLLA 1WAMA 2OOSA 4GKBA 4NBVA 3EHEA 5CPBA 3WQRA 1NHWA 1I8TA 1Q0QA 3UN1A 1D1TA 1HDRA 2BFPA 1M76A 2GZ1A 4XEHA 3DB2A 4L8VA 5B4UA 5BSGA 5DULA 3QWIA 3PTZA 5ER6A 5L7TA 4BKOA 1NPTO 1WVGA 4YAIA 2AEFA 1UH5A 3BMNA 1U2DA 3CH6A 4GX0A 1X7GA 2RIRA 5EQFA 4BNTA 4BNZA 2I6TA 2JFFA 3PRJA 1B8PA 1UXIA 2Z5LA 4A26A 8LDHA 4IJUA 4JIGA 4Y6PA 4WLNA 1H9BA 1WMBA 4OH1A 2DVMA 2Q46A 4QX6A 2P4QA 1MB4A 3C1AA 3JQDA 1PTJA 1Y5MA 2HMUA 3KSZO 4BO3A 2B69A 4KZPA 1CIVA 1PS8A 1C14A 3F4BA 1R4NA 3GRPA 3I9NA 3B20A 5H82A 4MVJE 3O4RA 3CKYA 5DCWA 3NAQA 4CR7A 1PJQA 2NWQA 5FWNA 1PJSA 1PJ3A 3WLEA 1WPQA 2GF2A 1NYTA 1ONOA 1VKOA 3GMDA 3VTZA 2GASA 2OBNA 1SEVA 4YCAA 3TZKA 3QHAA 4PG4A 4HKTA 3KM0A 4OMUA 4JCOA 5IDWA 4WNIA 1PL7A 3WSVA 1U7TA 3ST7A 1GY8A 2ZTUA 3FI9A 5JMWA 4IGFA 2X8LA 3GVHA 2EW8A 1UP6A 1BRMA 1LTHR 2UAGA 3C7AA 2ZKLA 2C5AA 1U2GA 5F1OA 1ZK3A 3CXRA 4YT5A 4YRBA 3IQDB 3MJEA 4MPDA 1SPXA 2O48X 3R0IA 5DZSA 3VPGA 4FGSA 4WGGA 3TL3A 3OEYA 4IMRA 4QT0A 4QQRA 2CF5A 4J4BA 1HYGA 3RBZA 1ML3A 4EDFA 1ONPA 4NBUA 2VHWA 5CDGA 1Q0LA 3KYCB 4HFJA 4X54A 3Q3CA 2LDXA 2NU7A 5KVSA 3E18A 2WJPA 5C7OO 4IDAA 4E12A 4J7CA 2FP4A 1C0LA 3U0BA 5KVVA 1WW8A 5ADHA 1E7WA 1LLQA 2P2SA 3C8MA 1JLLA 2NTNA 3ITDA 4WNCA 2EP5A 1GR0A 4E5PA 3TZ6A 1U3WA 2YQ5A 1QSGA 4IUYA 4PZEA 3GR6A 3L07A 1PQWA 3D3WA 4OQZA 1PSDA 5JDCA 1ONNA 3IAHA 3ITKA 3DAFA 1YVEI 1IYZA 1GQ2A 1F8GA 3WNQA 3BTOA 4H3VA 1O89A 4PG6A 4Z9YA 2HKIA 5AXDA 2VUUA 3WBFA 1E1KA 1H5QA 2PTGA 5ICSA 4YDRA 4OAQA 2Y1CA 3L6DA 3NKLA 4Z9XA 5IZCC 3W1VA 2B37A 3GPIA 3ZN2A 3F5SA 2J3HA 5A9SB 1D4FA 1PJCA 3A14A 4ITUA 2X9VA 3QRWA 3SJ7A 3V2GA 4XWYA 3WGYA 1JW9B 3I5MA 5JNLA 5K9ZA 2WYUA 4P38A 1NBOA 5A03A 4FJ1A 4CM9D 2ZYAA 4R69A 1VM6A 3AI2A 4I9UA 3ZCXA 5ENVA 1EK6A 5JCXA 2FOIA 4IDBA 4CUJA 4U0JA 5AQ1A 4MP3A 4Q9NA 4PZDA 2H5LA 4CLRA 1A9ZA 4ALNA 3FBGA 4WPGA 5ILOA 4YJFA 3Q6IA 2X6TA 5C3MA 4KDFA 3HDHA 5JYDA 2PGLA 5CPFA 1LSOA 4CL3A 4OHUA 1V35A 4YEDA 4QUKA 5COAA 2VYVA 3CPSA 1ARZA 5FI5A 2WEKA 1TB4A 5G2OA 4D43A 1F0YA 1H6CA 2PD6A 4P8RA 3WJ7A 4RPGA 2B5WA 3ZU2A 1SEPA 3TSCA 3RFTA 1K3TA 1V6AA 1LI4A 1ZO8A 1P74A 3RC1A 1DOHA 1QYVA 3FPCA 3GOHA 3KSDO 4WCFC 3WICA 5CEFA 4E2XA 4MINA 3ANLA 3H9GA 4KQWA 5IXSA 4BNWA 3WG9A 3T7EA 4IDDA 1IPEA 1EVJA 1LLDA 4HFRA 3JQBA 1GCUA 4NU6A 3F3SA 1BMDA 1T4BA 1U8XX 2OO5A 4IBOA 5L7YA 4ALIA 3ZNPA 1T2DA 5B1YA 3KHUA 3AOGA 1F06A 3NTRA 4EUEA 3RFVA 4GI2A 5EL0A 1PR3A 1X15A 4O0LA 3UUWA 3E48A 1QYXA 1FJHA 3TZHA 2YJZA 2FRDA 3RUDA 4BO6A 4CV3A 5BSHA 2E6UX 4WK6A 5B12A 2HK9A 2IYOA 2WE7A 2ZB7A 2DTEA 4Z0TA 4LVUA 2HMSA 4UUNA 1I3MA 1YDEA 2IXBA 3GRKA 3DBLA 3IDSA 4NK4A 4YJGB 3S8MA 2Q49A 4NJMA 5BNFA 4J16A 3VTFA 2X5OA 2HCTA 1E77A 5DCYA 1R66A 2X1HA 4A0SA 4B4WA 3GHYA 5JAQA 3EAGA 4UVGA 3PDJA 3IIEA 3LVFO 3TFQA 1YBVA 4RLHA 2BF7A 1YWGO 1LQTA 1ISHA 1CDOA 3UGKA 4DIFA 2Y1DA 1PL6A 2OGUA 3AU8A 2CDAA 4NJOA 5HBRA 2NV6A 2ZTLA 1K6JA 1PX0A 2IZZA 1EDOA 1BHSA 4CMBA 4YAKA 5I9LA 3GC6A 5A05A 1RM0A 1LDYA 4IS2A 1JAXA 1ZK1A 3W4JA 2DBZA 4RPHA 1MXFA 4FC6A 3KBOA 2HK8A 4YT2A 3FNGA 2V6MA 2EWMA 1C0PA 2DUWA 4NFYA 1DDOA 5G4KB 3X2FA 1YJ8A 2OP0A 3OA2A 1O94A 1EUDA 1NVMB 3E5MA 3EVTA 3JYPA 3WQSB 5DNAA 4AFNA 4ND4A 2X7HA 1YOVB 4OOFA 4B7CA 1H2HA 3VPSA 4W9NC 1PQPA 3JD0A 1JA9A 3A28A 4ZICA 2H63A 2Q1WA 4BNYA 2PK3A 3N7UA 4J9VA 1YS4A 4CQMB 3DXFA 4TQGA 3AUUA 3PWKA 3KEOA 3E9MA 4J4HA 1EUCA 3ZZNA 3ZNNA 1HDOA 3I52A 2Y93A 1JVSA 3GN1A 3INGA 2C20A 4PLWA 5LDHA 1KIFA 2PY6A 4I9NA 2UUPA 3Q2IA 1MG0A 3ICCA 5LCXA 1I10A 4RPLA 3ZW8A 1PU2A 2YHIB 3KLPX 4PLCA 5DN9A 1MC5A 2W4QA 5KJFA 3H3FA 1R0SA 4LRSB 4NBRA 1U3TA 1KEVA 3LT0A 4IZIA 1CYDA 2D5CA 2IXAA 2LDBA 1YQGA 4PZCA 2O7SA 4UUOA 4TRJA 1IZ9A 4N7RA 3RD5A 3DMTA 3JD1A 5IN4A 2HMWA 5U9CA 4U6QA 5IZ4A 4LW8A 4KUGA 3M2TA 5A9TA 2V6FA 4FOOA 4FW8A 4JJFA 3L6EA 1GADO 1H2BA 1DIHA 1YH3A 5JMPA 2BH9A 4B7XA 2FSVA 3MEQA 1XLTA 2O2YA 2VUSA 3WBBA 2H1SA 3EZLA 4WEQA 4JK3A 1QMGA 5KVQA 5L9AA 1T26A 1SB8A 3RU7A 3VPHA 4DBVO 4Q3BA 4XYMA 3DZJA 5KKAA 4CM8A 3TZQA 2I99A 1Y8RA 3V2UA 3AK4A 1PJTA 2ZCVA 1PGJA 4CJXA 1BW9B 5JS6A 2I65A 4F6LA 1C1XA 2I3GA 3RVDA 3WFIA 3OIDA 4PVCA 4TVBA 3LZ6A 1DB3A 1XDWA 1ENYA 4AG3A 1ZBQA 1ZNQO 3ENKA 3ETDA 3FNEA 1Z6ZA 2A9FA 3EVNA 3VOSA 3BHMA 1I36A 1NASA 1HKUA 3PHLA 1QG6A 4NDNE 1DFHA 3DAGA 2B4TO 4ALLA 5MDHA 1QLJA 2X86A 3C1OA 3KB6A 2HMVA 4BV8A 1R15A 2D8AA 5F5NA 3ZW9A 2JD0A 3QE3A 3JQAD 4YQZA 1A7AA 3B1KA 3WB9A 2F00A 4TZKA 3L4BC 3D4PA 1GAEO 2J3KA 2POQX 3ASVA 3L9WA 1HT0A 1CWUA 4FFLA 4CQMA 3GT0A 3GVXA 2XOXA 2QQ5A 4Z6KA 2WMDA 4FR5A 1ID1A 3INTA 1P1FA 1Q0HA 4XQCA 3AI3A 4BKRA 4UVDA 4F3YA 1Y8QA 4BO1A 1X1TA 4M54A 4BNVA 9LDBA 1KVTA 1IOLA 2PNFA 1Z74A 4DA9A 4CLXA 4Y6SA 2B83A 3DR3A 4OO3A 1DC6A 1UXKA 2VT3A 3NJ8A 3N58A 4RL6A 1TT5A 4ZJUA 3OM9A 2EKLA 1HDYA 1SCUA 1IULA 4TRRA 3ZH2A 5L51A 2Q3EA 3AUSA 3DBHB 1DIGA 4XR4A 5B4VA 3FCOA 4PLPA 1R0LA 4EJ6A 1J0XO 4WJZA 1NQAO 1VL8A 1MGOA 3QVOA 4WECA 2Y0EA 2EGHA 4JQCA 3OMLA 5TIIA 2RBEA 2AE2A 1UZLA 2HU2A 1JWAB 4O63O 4FJ0A 3WGTA 1U4SA 1JWBB 2O3UA 1VI2A 4W9NA 5A06A 3JTMA 4PLGA 5KNLA 1F17A 4YJDA 4II2A 1GZ6A 4ALMA 5L7WA 4A7PA 2VUTA 4PFJA 5HM8A 3FWNA 3NT5A 3WDSA 2HDHA 4B3HA 2GR9A 4OXKA 3GHHA 4BVAA 4BOYA 5AVOA 2AE1A 2UVDA 2ZTVA 3ROPA 3MTJA 3GPDG 1UR5A 4RVDA 5U1PA 1G1AA 1PZHA 1JKIA 2VTDA 2X0NA 3LSYA 5EIOA 2AG5A 4BNLA 5I8WA 1IY8A 2HAEA 4QTZA 2RHRA 2EEZA 3UOGA 1EE2A 4O1MA 2Y05A 3DC2A 3VH3A 1AE1A 4GGPA 4FBGA 1LNQA 3H4VA 5C7IO 2JCXA 3ULKA 3PJFA 5DP2A 4GAEA 4MO2A 3EGOA 3HB5X 4QFDA 1LC3A 2IODA 4DQUA 3H9UA 3D4NA 2C2YA 3QWBA 1XGKA 1Y1PA 1NPDA 4ND3A 1G0NA 1GEEA 5TJHA 5AXAA 1XG5A 5U4QA 4XDZA 3DWFA 4DMLA 3TOZA 1B26A 1GCOA 1YXMA 1QKIA 2NVUA 3NT4A 4M1QA 2DBVO 1S6YA 5I7EA 2IYPA 1KERA 1NR1A 3NDJA 4H7PA 4PG5A 5A9RA 1E92A 1UZMA 4EZBA 2GRAA 1NXQA 4PLYA 4RPKA 1LRJA 1ZSVA 1NNUA 1Q2XA 4JX8A 4HP8A 1DHTA 2SCUA 3G49A 1VSUA 4BUCA 3AOEC 5BNIA 3GZNB 2JD1A 2BFOA 3JYNA 2Q1TA 3MOGA 4TVOA 3T4EA 3WQQA 3OA0A 2GD1O 3E1KA 3GEMA 3JQ8B 4K6FA 3AFMA 4DL9A 4BGVA 4HNGA 4CM4B 3WGIA 3E9QA 2HUNA 3VPFA 4L4XA 1YGYA 1QP8A 2AW5A 2CY0A 2PH3A 3PJEA 4ZRNA 3MTGA 1ORRA 3PEFA 2C5EA 3HG7A 4Q3EA 3UICA 2GN8A 4BO4A 1HYEA 5F21A 3S2GA 1GV1A 3KYBA 1UDCA 2VZ8A 3G1TA 1CRWG 2EHDA 3IUPA 5TF4A 1LSUA 2PH5A 2BMAA 1YL7A 1C1XB 2WSBA 4NI5A 4K28A 4OQYA 1A72A 4Z3DA 4E2WA 1GUFA 1PJLA 3K6JA 3RJ5A 5TJ9A 2Y0CA 2EV9A 4RV9A 3AM5A 3AUAA 4HV4A 2R00C 1FMCA 3WGZA 2GN9A 2I3AA 3PHHA 1P3DA 4BQPA 1HWYA 4E32A 4BKQA 5ITVA 4Y67A 4Y9DA 3ZWWA 3RROA 1BXZA 1AGNA 2P9CA 1KVSA 2Q2WA 1PS9A 2VRCD 5AYVA 4YYZA 1ISJA 4P4NA 3R1IA 1UXGA 5BR7A 3ZU5A 4XQEA 3RIHA 1P1RA 4QFCA 4XB2A 4M55A 4E0BA 2IZ0A 2PZLA 1V3VA 2EIHA 3WR5A 4AJIA 3MOIA 1NWHA 1C1DA 2GDZA 4GX1A 4CQLB 1ADGA 1AHIA 1J5PA 4G5HA 4HY3A 3WYEA 1BVUA 1ZK0A 4J6FA 1IE3A 4UVEA 1WZIA 3EY4A 5TS3A 3BTSA 4WEOA 2A94A 3U4HA 5TRTA 3JQ9C 3S2FA 4P22A 4BGUA 4MIYA 4R3WA 3WWZA 5ITWA 1C0IA 2TMGA 4GVXA 5EPOA 3UKOA 2WE8A 2QRJA 4BNHA 3OBBA 2PZJA 2NNLD 5JC1A 1YONA 3KXDA 1DAPA 3BXXA 3LC7O 3I4FA 4IIVA 4RZIA 4J1QA 4CUZA 5DBGA 2DM6A 2OMEA 4WCFA 4KWHA 1PZFA 1BWSA 3PGXA 1K2WA 3QVXA 2GERA 4RF2A 3GH3A 3I9OA 4YBZA 1DIAA 1GZ4A 1L1FA 3SXPA 3S2EA 2OZPA 1A5ZA 5K6AC 4R1UA 1HDCA 1EMDA 4IJWA 4WUVA 5L45A 4INAA 3DONA 4IDEA 1I32A 1NHGA 4W99A 3RUFA 3ZU3A 5FEUA 1RJWA 3HJAA 5J23A 1DC3A 4AJ4A 2OHXA 4CMEC 1K5HA 1U5CA 1GEGA 2X22A 2PD3A 4I8XA 2G5CA 2QIOA 2YV1A 1ISGA 3H9QA 4FGWA 3QVTA 4BNKA 5COBA 1KVUA 4A03A 4XB1A 4JXKA 3NGXA 3UF0A 1AUPA 4LRTB 3PFFA 5IFLA 4R1NA 3DHEA 3PQDA 1LC0A 1YBMA 4I1IA 3AY7A 2Q1SA 3JQAB 1ADBA 1P77A 4ZQGA 3GGPA 2GPTA 1ULUA 1WMAA 3GMSA 2X58A 3U4DA 4BO5A 3RC2A 2V6BA 3ZHYA 3ZI0A 1HXHA 3U62A 5KJEA 1LEHA 2ZK7A 4GVLA 3NEPX 2XAAA 4IQ8A 3CSDA 4LN1A 1LSSA 2IEDA 2AMFA 4KMSA 4L75A 2WD8A 3GN2A 1O6ZA 3OF2A 4J2HA 3CUKA 2C54A 1HSOA 1TLTA 3SJUA 1IPFA 1LJ8A 4BB6A 3IKVA 4I5DA 2Y1GA 1ADCA 2JAHA 4CODB 3D5TA 1E1MA 1HEUA 3K9QO 4CMIA 4BIIA 1Y9EA 5AXCA 5G0TA 3GLQA 3ZWMA 2DBQA 3NUGA 3RWBA 4YACA 1W73A 4URFA 5JBIA 1I33A 3UH1A 4GPD1 2O3JA 1Z7BA 4PGFA 2JL1A 4RJTA 3FRJA 4BNGA 3ONEA 4FB5A 2ZTMA 4JP2A 4RPJA 1QYCA 2GSDA 4N54A 1PL8A 2X0IA 3D0OA 3VZRA 4R3NA 4MVJI 2Q45A 4M89A 2D2IA 1H0KA 4EITA 3PZBA 3WIEA 4BS9A 3DOCA 4QO7A 3VZPA 5JFOA 2ZJ0A 1ZIDA 1BXGB 1GYRA 1L7DA 4TKLA 4DWVA 2DPHA 4RVGA 4BNJA 2V7PA 3N74A 3F4LA 2CFCA 2NVBA 1I3LA 3F9IA 2NU6A 4WCFB 1YQDA 3H9JA 4QECA 4RZHA 3V8BA 2W2LD 4FPXA 4DYDA 3EW7A 3KVOA 3EDMA 1SO8A 1DRVA 4RGBA 5F1KA 1DAOA 5CDYA 2B5VA 4D3FA 3CZMA 9LDTA 2WYVA 3E6AA 3OIGA 3G1UA 4FFMA 2P9GA 1NR7A 3F46A 1H93A 1DC5A 2FPGA 4XX0A 2YY7A 3H3JA 1TEHA 5HRUA 1E7QA 4DQVA 2EP7A 2ZYDA 3DBRA 2PKQO 5KJ6A 3ZV6A 3JD2A 3PI7A 4LMRA 3GUYA 5G4LA 3U4CA 1YB4A 1B2LA 3W4IA 2OXIA 4Z0PA 5TNXA 1AN9A 2DKNA 1P1JA 3LF1A 2JCVA 4Q39A 5T67A 1PJ4A 3OHSX 4NH4A 3TDKA 3F1KA 4FQ8A 3INRA 4HXYA 4L4SA 1KY4A 3LT4A 4TWRA 3PHIA 4J7UA 3SLKA 3IUSA 4NHEA 3NDIA 1ADFA 1PZGA 1SOVA 3HB4X 3R6DA 2OFPA 2PA3A 2JKVA 4GQAA 1T25A 4M8SA 3BMQB 1GPDG 4P4LA 3STHA 3DQPA 3IP3A 4BGIA 3ZHZA 4BNUA 1A4IA 1FDSA 1I3KA 4MVJA 4XIYA 4RDIA 5JSFA 1ISFA 3GUCA 3EK2A 1HDGO 1N5DA 2WTBA 2O50A 3WJAA 4HUJA 1HE3A 4CLOA 2VWPA 4UUMA 5KWEA 3GVCA 1FF9A 2W90A 1B3BA 4IM7A 1VSVA 2EF1A 3T7CA 5JC8A 1XSEA 1HDXA 4E2ZA 3UFXA 1GV0A 4JJGA 1O9BA 2QYSA 3O38A 1SZJG 1Y5RA 2NQ8A 4GSKA 4C4OA 3RUIA 4RVSA 3HN2A 5G0SA 3IJPA 1R16A 3OJEA 3QV1A 4PCVA 4JROA 4JP3A 1ZZEA 3ZDFA 3ZWNA 1WZEA 1CETA 1LQUA 1T4DA 1PZEA 3I1JA 3PDUA 3P5SA 1Y6JA 3D5QA 5L53A 4XJSA 3I83A 1VLLA 2G0TA 3G79A 3UCEA 4KWIA 3UVEA 3V1UA 1YE3A 2E37A 5EESA 4UULA 4CUKA 3V1TC 1CERA 1ZVMA 4R9SA 5T6BA 5B37A
chains in the Genus database with same CATH superfamily
1SVKA 4X3OA 3WL5A 1SUFA 3MT8A 3IBCA 1PJAA 2SNIE 1PR1A 3BMOA 4ZHSA 1G21A 3OG9A 3QNWA 1A9OA 1K4YA 1UT5A 1Y9AA 4LE1A 1RE0A 1UT8A 3EA4A 3DBLB 3K53A 4C2BA 3U6BA 1JDNA 1WY5A 3C6BA 3AM3A 3LFHA 3W6PA 4CEHB 5L8VA 4A36A 3C8UA 3FVQA 4KW7A 1IQPA 3JARB 1I2ZA 3AXTA 1O4VA 3FBWA 3V7UA 1E9DA 3DBRB 3RRMA 1Y0BA 2BI4A 3VR4A 1GVHA 1FUYB 2Q4DA 4IIBA 2E21A 3BWBA 2PJRA 1KI9A 2FUG6 1YZLA 2V9ZA 4V0KA 4NLLA 3MWEB 2C4WA 1CJKC 5KU7A 1CY0A 2QR5A 4B6SA 3NVDA 1B7GO 1I6MA 3OZIA 1BFKA 1E99A 2YZNA 4ENSA 2GF0A 4PY2A 1TKBA 2FPLA 2ZRHA 2W6CX 2HN9A 1VLVA 2XUGA 5HE9A 5K2MA 4URYR 2HRBA 1N2EA 2KQUA 3GAAA 3CE6A 3E81A 4W63A 3LLCA 4YUAA 1UBNA 3U61B 1C9YA 2BEKA 2R2AA 2DT8A 1M0SA 3TLEA 3V4FA 5JD6A 1J42A 2QYTA 1FRFS 1JKFA 1UBSB 4ROSA 3I9MA 4WK4B 4I3FA 1X1CA 1XWWA 2VF5X 2DFLA 4XYEA 3S8YA 1L8XA 3F67A 4GRIA 1N1GA 2XT0A 3B70A 3VYUB 1KBZA 1C9EA 1FMTA 1JFFB 1PWZA 1Q12A 1T29A 1KYTA 2NN3C 3O2NA 5HOQA 1ZINA 1MJFA 3IR7A 3K92A 4C7VA 5MN6A 2C2OA 5IAOA 4GOXA 1R9JA 4ZVVA 4IQ0A 4PYNA 2W2KA 3K9LA 3KOWA 4ZD6A 3JCZA 3FXAA 1FXSA 4XEUA 2FN3A 2WK1A 3VC7A 4YPOA 5EJ6A 4JXXA 1BDBA 3IMFA 4ID3A 3ZD9A 4RYDA 1JIKA 2AI1A 2QDKA 2XXJA 3Q2KA 4PR0A 2MCFA 4I2NA 1XTBA 2O14A 5H16A 3TZCA 4OQDA 3VFDA 1C0KA 1N2CA 1WMDA 4P4TA 3HWRA 3I3SR 4FFPA 3E1SA 3MHPA 1ZOIA 2ZWIA 4J0FA 1TYDE 1EKXA 1R10A 1JG7A 1HE1C 2BT4A 1SKYB 4HYYA 4UUAA 3Q41A 4XWOA 3OLZA 3CIFA 3AIMA 4I81A 1RDFA 5H5JA 3RK4A 3U4QA 2AWOA 1UJ4A 3AB8A 4MP6A 2H6EA 1W46A 1OREA 3IRVA 3Q1KA 3OMWA 2XDAA 4JLBA 2IYLD 2W8BB 2IWRA 4D9JA 1Z13A 2JIZA 3PUVA 5DX8A 2Q3FA 1S01A 2ORWA 2RHJA 3LBYA 5HFJA 2BF4A 3X0DA 5IT0A 1A0OA 1E3IA 2XSZD 4FOSA 3L4KA 1VZ3A 3FUVA 3L9XA 4CKWB 2XB2A 3N8IA 1EH5A 4ND1A 2NP7A 2QORA 4M1MA 2EC5A 1XALA 4NOJA 3S29A 3SR3A 2I4OA 1AQYA 4EYOA 3IP9A 3KWMA 4K05A 1KKLA 1FP1D 4TLLB 2YW2A 3ZC3A 1C3JA 1OXUA 1ID8A 1Q1BA 2GLUA 5GPBA 3UHJA 1WU7A 2VRNA 5C1DA 1AZLA 1L8AA 1TYEB 3WL4A 4BKMA 2IH5A 2CJFA 4UASA 5IZCA 1CYEA 1X92A 4GBJA 3CB4A 3DDNA 4UNQA 2RGAA 3ED5A 3HLTA 4YQYA 3DAPA 2YFHA 5TVKA 1N1EA 1YZKA 2AFHE 1LDBA 4B74A 3O1HB 1OFIA 1BRTA 4BNXA 3NC4A 4JJ8A 2QAIA 4AJPA 4CM7A 1SNYA 3VR2D 3KB1A 3H19A 3I76A 3NAGA 4GI7A 4ROTA 1K0UA 2DFKB 3JQ7A 3V3TA 3QQPA 5THXA 3W6ZA 1ZW1A 2ZJAA 1T2EA 5L3VA 1L4EA 4JA2A 4BFXA 4FFRA 2MIIA 1M75A 2ZYUX 1H94A 2FQ1A 3A4TA 3G2PA 3LDGA 4MW5A 2J0EA 1ZXLA 2J08A 2BMWA 2GCIA 5IT9A 1HX7A 2CLIB 4GLBA 4ZAGA 5EXXA 4ZI5A 2VQDA 4A0GA 1SQ6A 4NARA 2FSGA 5KQPA 3FDFA 3NFYA 3LPMA 5B2FA 2VA8A 4RUKA 3RSOA 2CZGA 4IDNA 5AI4A 4D3ZA 2C9DA 1BNCA 1JQEA 2P2ZA 4KIGA 1AKRA 3W8RA 1PR2A 2RHWA 1L4LA 1Z16A 3AXSA 3ESZA 3H2YA 4LX8A 4P92A 5CAEA 5HJ5A 4DILA 2ALJA 3KYCA 2C3UA 2UZ3A 3H0EA 2WD7A 4JOBA 1RZRD 2GN4A 3E8MA 3OIUA 3QXSA 2IU6A 4EABA 2XUPA 4R68A 4ZQFA 5AK3A 5H81A 1XTPA 4MQLA 2X3YA 4MYUA 3O3OB 2YIMA 3LS2A 3U3XA 1L6IA 5FYQA 4YUXA 1TTTA 1KPHA 2FPOA 4A0QA 2PKCA 1OYOA 4KPFC 2B5OA 1L4UA 3OH8A 3ZHRA 1KRWA 2PUVA 2D0OB 3TDMA 5FO1A 4Q9AA 1IEWA 1M1UA 3AOEA 3ZCTA 3U09A 1OXMA 5JHGB 3CVWA 4CMAA 2QW1A 3GRRA 2W98A 4WCVA 1VCMA 2V7UA 3GH1A 3VTAA 2P2LA 4YJKA 1QDUA 3VZQA 1YDFA 4MZXA 4P81A 4G4SP 4KQXA 4Z7JA 2D0PB 2XJ9A 3BRWD 3DFFA 3WB1A 5JFTA 3OTOB 4XKJA 3TW4A 3I3OA 4KOAA 3ZHTA 5KNBA 4DGQA 3ZCQA 5H0IA 2ZSIA 7MDHA 1U28A 1Y3AA 4OQFA 5ADUS 3ZGXA 4JWTA 4R4JA 3BSWA 1IHXA 3BD6A 7ABPA 3SY8A 4RVCA 5JDIA 2A58A 3HCPA 4I14A 5C81A 4Z1MD 2I22A 3BQMB 5FWAA 4CEIB 1QFSA 5ARBA 2INGX 1K7SN 1LX6A 4Q5IA 1Z6TA 4NK5A 2JVKA 1YB7A 3K9CA 1GZHB 2QENA 3T4UA 3GLIB 4CM6A 4X7MA 4F9GA 1ZRSA 2SECE 1ZGGA 1XRNA 3RCBA 1Q1QA 1TW2A 2RAVA 4FE3A 5JLJA 4FFBA 4QGGA 4DLAA 1RMTA 4BP3A 3NH9A 4CCWA 2O8DA 3EY9A 4M9CA 4JLMA 1EFUA 2PZKA 3NHBA 2GKSA 1E0DA 2C7GA 3GDFA 4M0DA 4MA4A 4Y8VA 1R64A 1CY8A 2E18A 3HNRA 3WI7A 2IFTA 2VHUA 2EFJA 1NIPA 3HU3A 3D6TB 5KQSA 3ROXA 4LDQA 2AA3A 3OCYA 2OFXA 2QD1A 2YW9A 3ZTTA 3K9NA 2VQSA 4BECA 1AMOA 4Y2SA 1M1NB 1N7JA 2VDMB 1KSHA 1J8MF 2X13A 1EQ2A 3I64A 2F3PA 4G01B 2WSSA 1L0BA 2ZJ6A 4EGFA 3G3EA 1W9HA 2FW0A 5A3RA 5CJJA 3PYLA 2VJNA 1L2TA 1VQ1A 2EP8A 1RXIA 1Z07A 1P2DA 4BC0A 2NZXA 5FOSA 1FA9A 4WZZA 2QMQA 4H59A 3WVNA 1CNFA 2VSFA 5ALKA 3KSBC 4QOHA 4BZQA 3G9TA 2NU8A 2QN6A 2Y68A 1YUMA 4ZU3A 5MF6A 4EHAA 3QWAA 2FNAA 3QLTA 3OT4A 4Z4IA 4OU4A 3C6XA 1IPHA 2BLNA 3GJXC 3Q3IA 5G0UA 4UVIA 1QTQA 4YMIA 2HC9A 5CEJA 4KUHA 4DWOA 1IOZA 3KXKA 3MTIA 1GAJA 4RKWA 3GLGB 1VPLA 1YNOA 1NVBA 4AWAA 3S1AA 3U3ZA 5LBUA 1KO8A 3WMEA 3RKUA 5K8UA 1H1LA 2CHGA 4QRDA 3DLPX 4GX2A 1VECA 3AHEA 5ICFA 1EX1A 1V3UA 1I7QB 4HZUB 5SY4A 4MW6A 1H66A 1DSSG 4MRMA 3LKBA 4OATA 4TYPA 1GRQA 4JP1A 2OD7A 1XLUA 4HEHA 4KCGA 4R8KA 1FU4A 5ES4B 3EEQA 1WV1A 2C82A 2V6JA 3I9FA 3QUBA 3A4VA 3DTNA 3E0XA 5JQGF 4N9WA 4BUJA 4UATA 1BD4A 2JRCA 3JSXA 2JI4A 4LYFA 4MJLA 3A0RB 3CB2A 4YAWA 3NJ4A 2H07A 3QP9A 1PGPA 1QE3A 5AJXA 1GFSA 4NCJA 1Z0ZA 3QEOA 4EGAA 5KTMA 3SNKA 2IX3A 3TGLA 3JQEA 4QDZA 1XE3A 2YZ7A 4WJKB 1RT9A 1UXHA 2N75A 3DZFA 3JQ8A 1KTIA 4QELA 2WINI 3IBGA 2NAFA 2IH4A 3A9VA 3F7TA 3KUDA 5K51A 1XTKA 3B3GA 3RYIB 1QIGA 1XKQA 1HYQA 2H3HA 2ZIFA 3I8OA 3P9XA 1MXHA 1VIMA 1Z4QA 2FJPA 3P0HA 4AJHA 4RULA 2FSSA 3SBDA 5KMGA 1DMRA 4KLAA 5C9ZA 1JWLA 2OSBA 4WOKA 4URUR 3F8SA 4F91B 2W6ZA 4RETA 3G2NA 3PPXA 4G97A 1VA5A 4L5BA 5LC1A 4A27A 2PZEA 4IF6A 1H9AA 3UFBA 1ZD8A 4L76A 2HD4A 3NIBA 3ZU4A 1FIUA 1MT0A 3Q8LA 1V8DA 4MVWA 1JG6A 3DE7X 4LGCA 1O9HA 5H3CA 2R1ZA 2RCNA 3FM9A 1NLMA 3E5RA 4LJLA 2BKUA 2D3WA 5EQJB 2HI0A 4FSHA 1BKSB 1CY4A 2V5VA 3BKWA 3K6KA 4FCCA 1CUZA 4KQCA 4RIHA 1DWOA 1P0FA 2G17A 3AKDA 3RJ9A 3A4MA 3GAMA 3RDPA 3RTGA 1OX5A 4QHTA 1QHFA 2A14A 2VJQA 4L50A 2OHVA 2ORYA 1A9YA 2AEJA 5EEHA 2NO9A 1UMBA 1JKJA 3OO0A 3VVCA 1UXJA 1MUUA 1F2UB 2BVNA 1RWBA 2HA6A 4PYLA 1P6QA 3ZZ0A 2FW8A 4TRNA 1E3QA 2AXEA 4K9LA 4KHZA 2PKXA 4XCVA 3DT8A 4BAZA 1L6RA 5I9IA 2Y2UA 3GV0A 4BTVA 1RQNA 2V7VA 1X8JA 3DZDA 3WOVA 5DP1A 1UIMA 3RASA 4BQNA 3W05A 3QVJA 3D6MA 2X0KA 1NUAA 2ETVA 4TWBA 1DQZA 4B8ZA 5JH7A 2HYIC 5EIFA 3EH2A 4EPVA 4Q7QA 4AI6A 2B92A 5JJIA 1DGQA 1WR8A 5DJ5A 5H70A 1NBAA 5SICE 3ZBTA 1J2UA 1IFXA 4RJLA 3SM9A 3KV3O 4OI1A 4DABA 3NDPA 1STOA 1T1SA 5KINB 1M54A 3HYRA 4NZOA 3WGOA 2DFPA 3DVQX 5CBKA 4R6XA 3BDAA 3KXPA 2QXTA 3NFRA 2RB5A 3CJQA 3NI2A 3IDZA 3IUYA 2H2DA 2O2ZA 3TXAA 4DGSA 5BP7A 5FOVA 3EXHB 5EE1A 4RABA 1W85B 3RC7A 1ZJ6A 1F60A 2IX9A 5FBZA 5U4XA 3GLFB 1TZMA 2YY5A 5JJBA 3HVRA 2P67A 1Z73A 1E9BA 1RIIA 3UJAA 3EOAI 3R75A 4AQ7A 3WJ2A 4GXRA 2BL4A 4KXUA 3IAM6 4ZEOA 2QGFA 3SMQA 3KLMX 4P7KA 1THZA 4ZO4A 1E96A 2OG1A 1XPJA 1X9IA 1YSCA 1B0UA 3OFNA 5D84A 3L46A 5JVDF 4QODA 5LQAA 2YXBA 4WESB 1FLDA 1MO6A 4UHCA 4WVFA 5DTQA 3UPTA 4GT1A 4M46A 5FBRB 4DDUA 2GWRA 3HFJA 2FE4A 3SM3A 1GPH1 4C04A 3KO8A 3CR8A 3UMVA 3H5AA 4MKZA 2JJ1D 1EVZA 2VIIA 4MVJD 4OM8A 3H5VA 3KYDB 4ZHQF 5FF9A 4DA4A 2QV0A 2GJ4A 1XWIA 2ZBVA 4MAMA 1JQKA 3C3MA 4MIOA 4MCIA 1A50B 5EWLA 2BFAA 1ZKMA 1C4KA 1JILA 3UGQA 4D0NA 1W4ZA 2VT2A 2V5UA 2XMZA 1FJ2A 3R5FA 4R0VA 4AYWA 1DQYA 4FR0A 1J8QA 3BJEA 1FXWF 3M83A 4RVUA 2GCOB 3UHOA 4GMHA 4WA8A 2R4UA 1E1YA 4JXJA 4JQYA 5HUJA 1SBNE 4B3IA 2QN2A 3LWDA 3SYNA 3SLGA 4XVUA 4Q9HA 3PX7A 4CFYA 1GXSA 1P4HA 2PHZA 1WSAA 4KUEA 1XEAA 2I1LA 2H92A 1IQRA 3TPCA 4ND8A 4GOKA 1ETUA 1U2SA 1ECLA 2HYDA 3WNDA 1SXGA 1T9DA 4OSEA 2I9PA 1YRWA 1K68A 2Y8EA 3BYZA 4K9DA 4B6PA 4KV9A 4MMXB 5HXAA 2O3QA 2QF7A 4CM3A 1R5JA 3BORA 2QPLA 3FPEA 5J2UF 5LOVB 1NX9A 2CD9A 3OLQA 4E5MA 3P8ZA 3EGDB 5ALIA 2YN0A 3QFTA 2WM8A 3AVQA 3AYZB 1NMYA 3BMNB 3BXPA 2EJVA 2WLSA 4KN9S 4NICA 3RYHA 4C6SA 3O2SB 2VWQA 3O6VA 4BRUA 3L0DA 3O8CA 1YCHA 2CLDX 4II7A 1FDWA 1OX4B 3AFNA 3KNZA 3R7SA 3RS3A 1E9EA 3JRNA 4YRDA 4V1CB 3V2HA 4RC9A 5D00A 2YCBA 4GYKA 5EZ5A 1UPTA 4PE5B 1GAXA 1JQ5A 3TQFA 1MCZA 1TRKA 4G8BA 3CC8A 4X45A 4NU0A 2CNDA 1FBNA 3ZCUA 1HT2E 2B4AA 4MAAA 2ZSUA 2FPMA 2O0KA 4O2RA 5LZ5A 4HH3C 3RS2A 1JH9A 2VHCA 4RO0A 3B1WA 1S89A 4QM7A 2CFSA 3IGFA 3FGZA 3Q15C 3N2NA 5BV8A 1X13A 4JI7B 2JANA 1LVUA 1TTPB 4H6WA 3GLKA 3T4XA 3DKKA 2Z2IA 4QXQA 1H2RS 4CEJB 3RG2A 3IT0A 4D9FA 4QPNA 2G40A 3ELUA 2H5IA 1HF3A 2BGMA 2O9JA 3FKQA 1PDOA 2IP2A 3OURA 4NEQA 3I9V1 4OBXA 3RARA 2C7VA 5LQRA 2IGTA 3I4CA 1NI4B 3WK8A 3ME5A 3CO5A 2R7AA 2DSTA 3D8TA 3HU5A 5CTJA 1YE5A 3OE7A 1XL1A 2AOTA 3H65A 4L74A 4CG2A 3L7MA 1TUBA 2OORA 1ATZA 1RXSA 1NF9A 4W4TA 2WJJA 5CLIA 3VDQA 3HSKA 3WE7A 1AN0A 1BGXT 3QUSA 5E1DA 4GE3A 3CUWA 2X7JA 1GQYA 5GJBA 3B9QA 4TOIA 4BO9A 3OETA 1K92A 1I30A 2YH2A 3ASYA 3IMCA 4TMVA 4WNAA 3TVYA 1UK7A 4DDVA 2XX3A 2FA9A 4ALJA 1N57A 2A5GA 4WOPA 5CGQB 5HF5A 2ZBRA 3VZDA 3RF6A 2OGTA 4LHWA 1Q0PA 5CT4A 4M8KA 3HTXA 3GJ4A 3G0OA 4ZQHA 1LZLA 2F1RA 4L6AA 1V1RB 4HBGA 1Q0SA 1LBHA 1MOSA 1W4CA 5DXFA 1ISPA 5FULA 3RHZA 1NUSA 2GN2A 2ZQYA 1ODJA 5CR9A 3ETGA 4UHDA 2W93A 1PDWA 3GCDA 2ONYA 4LQDA 3WHIA 5DLPA 4C7JA 1DKUA 1WSBA 1G9XA 5CMLA 1P75A 1PCXA 1TCUA 1CJTC 3ONDA 1IK4A 2FF5A 4KIWA 4RHYA 3RW9A 2VSYA 1QWSA 1MJHA 4KQKA 3W8FA 4XFDA 2WUEA 1E58A 4JKYA 3GNSA 4KYVA 3EQ9A 1PFWA 2CHVA 3CRZA 3SC6A 3HDJA 4WKPA 5D7NA 5IDVA 3MT7A 5JYBA 4J1TC 3O90A 4BE4A 1NRJB 2C4VA 3D2AA 3DMPA 4KO2S 1JZTA 1VKRA 3CPJB 3HFGA 4RU1A 1G8YA 4UW9A 5H83A 1Y8QB 4BFLA 3QW2A 1WLSA 4M8NE 2IS6A 1F8FA 3CSUA 1PT7A 4S1NA 2CNWA 5GWXA 8GPBA 5CDSA 2QVYX 3RTEA 1CR6A 4WA7A 3SSNA 2Q62A 3ZH9B 2FR1A 2B98A 3SC4A 2J3QA 2P6NA 1P19A 3GJ5A 3UMRA 2YCLA 4MV8A 3QU5A 4E70A 4JUFA 2VN8A 3EWIA 4F5YA 2HK7A 1B93A 2PRIA 2RJOA 2Y1FA 3SDZA 2OCKA 4AYTA 1I7PA 5FLEX 1J0AA 4IGKA 1NNEA 3DHVA 4DV5B 1XVVA 4IXTA 3B3JA 4XUDA 4YJHA 4QU9A 3ZCVA 4C2AA 4F60A 2AS0A 3NEJA 5F12A 4CIAA 4RVOA 4WZBB 1I94B 4E5KA 2AJBA 1K6IA 2XOKA 3GWZA 3KSUA 4ZJYA 2VPQA 3LBHA 1I9GA 5TLSA 2LXNA 1N2GA 2PGXA 3M6UA 2ZI3A 2VEDA 2EARA 4EI7A 1P2UA 4RF5A 4AT1A 4DR5B 1KY5A 4MWOA 3LF2A 2G76A 1C41A 1FX0A 1TOAA 2BBWA 2FSIA 4K6GA 2YS7A 4XWTA 4KYTA 1R12A 2XKAA 1H2YA 2QHXA 3C15C 4PFQA 4PRKA 3ISTA 3QYAA 3A06A 3N53A 4QFMA 2EZ8A 4IIGA 4BB9A 4M36A 2R1UA 3OWHA 4Q1CA 4ZRMA 1MB9A 5FOWA 2DFVA 4HF7A 3A58B 2OV8A 5THKA 2IXEA 3GG2A 4MB6A 4WLFA 1T5HX 1TZJA 4QGAA 4XGIA 3PE6A 4F2PA 1WEHA 2XXAA 1FFYA 3TRHA 4WLEA 1V16A 1N3YA 3FYTA 5TGTA 5AFSA 1EP1B 1O5TA 3CRVA 3FZGA 3IAS1 2F3QA 5GZ3A 4ME6A 3GEIA 4X1KB 2GO1A 4QSMA 3RBVA 1XLTC 3H2KA 3AHHA 4JLOA 1E1DA 4OUDA 4WASA 3KJGA 3LDFA 2WJAA 3DWGA 4MUJA 2AG6A 2QTAA 2YFQA 3WGQA 1VPDA 2RHDA 1TK2A 4PCAA 4KYUA 2J85A 2J0UA 4J9UE 2OK7A 4UFOA 2W00A 2UYYA 5NULA 4BCBA 2P4HX 1H0HA 1XZIA 4BKPA 2EX1A 2QXUA 5LBIA 3FSGD 1XMVA 1FE8A 1K98A 1Y3BE 3GGDA 4JJ6A 2PR7A 3UZUA 3ZLBA 2DQZA 1X77A 5B3JA 1RWMA 4QL3A 2QUAA 3SVZA 4ZI2A 3MN1A 4COKA 1RRVA 4MS4B 2ADFA 3KSRA 3V1YA 3EAQA 3BULA 2CYCA 3CVUA 3LHDA 1W8IA 1Z63A 5A5DA 4KWEA 4EEKA 4TKMA 1KJ9A 3HYLA 3NDRA 1KZ6A 2YIDA 2I7CA 5KYUB 3CWQA 5D85A 2L18A 4KXMA 3SJZA 3V1NA 1NPYA 1YMVA 4XQGA 1V1MB 3Q9NA 1ZEMA 1MPXA 3PPIA 5FPTA 5F3DA 1P2TA 1Q74A 2QTBA 1SZPA 3OJLA 3ET5A 3KOMA 1ENOA 4IJMA 4DV3B 1A9SA 2AXNA 3KVRA 5C18A 4US2R 4EY4A 1Z22A 1V9SA 2J5RA 1A77A 2BHNA 3FGNA 4RELA 2H2FA 3ZHQA 4EYQA 5HRCA 3T7KA 4DV7B 2P1DA 1IATA 3ND9A 1WBDA 1Y7PA 2ISSD 5KO2A 3HR4A 4AZ3B 1IXYA 3TE7A 4MPJA 2XCQA 3VAZA 1GA6A 4XSGA 1EG2A 3N6XA 4E15A 4KO1S 1DMSA 1Z6GA 3BWEA 3C6ZA 1PJBA 1QUEA 2QVLA 2FWMX 3DKRA 3NOVA 3F2IA 3NBUA 4ASUA 3EC2A 9ATCA 2ZM6B 1M66A 1B8VA 1KA9H 4PPQA 1THTA 2VHEA 3WWCA 2YWCA 1USUA 2ID4A 1QNLA 4OPMA 3R3VA 4UDYX 4ZQEA 1XTIA 3JS5A 1CU1A 1JR3E 4K9RA 1K27A 1T5TA 4Z0HO 1TYAE 3ETHA 3CVXA 1YJAA 4AIRA 3KAKA 4N65A 3FUXA 1EVIA 1MB2A 1PD1A 4M8LA 3JX9A 1YBAA 4YMSA 5JHHB 1XDZA 1TKRA 4QZVA 1DCTA 4NU5A 3TEJA 4NATA 3L4SO 1ADJA 1ISRA 1KEUA 3BFXA 3BRSA 3GARA 3GMTA 5E4TA 5EQDA 3TUIC 4GOND 2AHRA 2NTJA 2P3QA 1VFPA 3GLHA 4W7HA 2WSSD 3FPHA 1A4UA 1RWVA 1FL9A 4AJJA 2DECA 2VPPA 2QU8A 1RC1A 4HAYA 4DLKA 3AL2A 4GPEA 2BBOA 2CHUA 2FSVC 4RXMA 1FTYA 2BFDA 2XUAA 2GEUA 2A4KA 2GBLA 2ZANA 2BSXA 4GZ6A 5F3WB 3SHVA 4MOWA 3T1TA 4X62B 2OXFA 5EIBC 4B4KA 5HZKA 3UHAA 2VJCA 1PFVA 1VLHA 2OGZA 3O2JA 3AKEA 2C2ZA 4GNRA 3UV6A 3U7FB 3AY3A 5EQTA 2YZKA 1E3WB 2BMEA 3IQZA 4FJ2A 4HLUA 4JB3A 5ECYA 4PWZA 4BRWA 1RP7A 4R0MA 1AO0A 4OL9A 3LA6A 4CR6A 4JX9A 5LQSA 4OLFA 4Y2VA 5AVVA 1AB5A 1NULA 1BHO1 5C2JB 1R0BA 4UQOA 5ED0A 4YMGA 2ADOA 3FCYA 3H3XA 2YINC 3HKDA 3MIZA 4I4TB 4ZPXA 3EUAA 1X14A 2IU0A 3WLAA 1NW7A 3MWDB 2MR5A 4EFKA 3ZWCA 1ZSYA 1LS6A 1YACA 3L7LA 4I08A 4HEA6 2F3SA 3ZJTA 1T6NA 4AUNA 5JAMA 2B6NA 2VF8A 2VWHA 3E1GA 3C5VA 4CIXA 2P5YA 4Q3NA 4CL8A 4Z4QA 3NXSA 1L5FA 2IC5A 1WUJS 4YYEA 5AVSA 2E89A 4YRIA 1L4BA 1LD3A 5IANA 4B82A 2H7YA 1K5GA 2EGGA 2O7QA 1E3EA 1B1AA 1E0JA 4QYXA 4U7FA 3COVA 4WIAA 5JDCC 2Q5OA 2QRLA 1BOFA 5AJWA 1Y4SA 2LPMA 4QNRA 3WX0A 4ZEVA 1CW2B 3SZLA 4RQTA 1WJGA 3VQTA 4RQBA 3DKPA 3SYRA 1S2DA 1YZNA 3DDHA 3QA9A 1K2VN 1IJKA 1SBHA 1P29A 4QEDA 3FHTA 2HU8A 1CQXA 3AP2A 2QUKA 2I67A 2OGSA 3PFWO 1DIBA 4K9QA 2PSJA 1KEPA 1Z3CA 5J43A 3ZWYA 1G20A 4C0HA 3QYPA 2VDLB 1XDGA 2AHOA 3K2EA 4H17A 1DG9A 1SHJA 3EMKA 4ARZA 2GN6A 4TZ6A 4O5OA 1TD1A 5D5HA 1X2EA 1JV2B 2PS0A 2QSJA 4OFBA 3KQHA 4D02A 1G60A 2R66A 3NAZA 5SV2A 4EMBA 2MINA 4TS4A 1TADA 2NQ2C 2W9XA 4RHUA 5JO9A 3MIIA 3UG7A 5DXJA 1MKYA 1SZDA 4YGXB 4FZRA 1SU8A 2R6HA 2NU6B 2HHCA 4RK4A 2MDTA 5IVDA 3K20A 3FA2A 4ZA2A 1DZIA 5T57A 4ON9A 1TF5A 3W2EA 5HS4A 1XJQA 4AZSA 2C5HA 3HV2A 1H1LB 5JSKA 1MO5A 1PUJA 3I92A 3OZ7A 1MRZA 2GF9A 2RH4A 4FC7A 4JGGA 3VSAA 4F1KA 1XPUA 1NVTA 4TPKA 5A3VA 5CLJA 2BKAA 1YCDA 4GLOA 3GGSA 5SYAA 1U6JA 3D5EA 1R3UA 3IA2A 1PG0A 1SUEA 1EYZA 3LCCA 3LC0A 3L4JA 2VEOA 4OK6A 3O4HA 4RZ2A 4XX0B 3ZWQA 4KPUA 1PEDA 2II6A 2RIPA 2YHIA 4C7XA 4PQFA 4XFJA 4D9GA 4DC1A 3X3HA 3BXOA 4BVFA 4IDPA 4TXNA 4X6XA 5LN1A 1XR3A 5IARA 4CG3A 3HUEA 3RLIA 4DR4B 4BN5A 3MUOA 2QZ9A 1KFBB 4KXYA 2H0RA 5AKJA 2ZE5A 1JIJA 1ZJZA 2KMLA 5GONF 1QDEA 5IULC 4PFSA 1SCDA 2QY9A 2SHKA 3KVVA 1ISMA 1PR6A 3A2KA 1ZUNB 2IHUA 4B7AA 3QVVA 4OYHA 4H3HB 1MA0A 5DWDA 2J09A 2A4MA 3SBOA 5IJWA 4IG4A 1LY1A 2ARKA 2H1OA 3R20A 1NNSA 4G4SO 1UAAA 4PZZA 1QV6A 5C8VA 3RTDA 1AKQA 2HQSA 1QG4A 5DOZA 2OBYA 2KB0A 2YQZA 1AZSC 3BCHA 4P3OA 5JAIA 1H6AA 4B6FA 1UBGA 2W0SA 1JHAA 5JXWA 1Q57A 3EIQA 5KWSA 4S1TA 4D8WA 4EJSA 3ECSA 4WKCA 3N8DA 4RTPA 1GFWA 1XNHA 4TN1A 4LFAB 1V48A 1C7JA 3AGQA 3IEUA 4US0R 4ETIA 2VJBA 1L8QA 1E9CA 1PWEA 5ECWA 4D9KA 2JB9A 2ASEA 4XZ3A 2Z2JA 1SK8A 4GL4A 3TOVA 1R8SA 2OV6A 2QUZA 3VSBA 2AQ8A 2AYXA 4MICA 2YJ5A 3NIFB 4C6HA 2ZIAA 5JROA 1F51E 2J9GA 4PRYA 4ZQCB 3UG6A 2OB1A 4KN8A 3WA7A 4C07A 3D8NA 3PRJA 1M2VA 2RAPA 5AVZA 3QKSA 3WYCA 4EI2A 4KGZA 4EJSC 2KLBA 1ZQ1A 3GG9A 2CZQA 2RGBA 2SKCA 4YAEA 5TF0A 3RS9A 4PX9A 3NHUA 2FF7A 4MYTA 2O3RA 5THQA 2WHQA 1DJOA 1HMYA 3L0PA 4QHYA 4CR8A 2C2BA 2QLNA 1M7HA 2PUJA 4BMVA 4I5IA 4MR8B 3NRCA 5ALZA 3FVWA 2VBGA 1G6Q1 3VKHA 5BUQA 1OOEA 3THOA 3KQWA 2XYRA 2IJGX 2EWWA 3C3XA 4BMOB 1GDTA 4JT8A 2NACA 3H4IA 3PXDA 3TUZC 2VQ3A 3A37A 5GY7A 1LJUA 1XQ1A 3OD1A 3S2YA 3ZGYA 1NBME 4WTOA 5DNVA 1P33A 3DL0A 4JBHA 3OESA 1NKVA 1NU8A 1T4CA 1V9CA 4BB5A 2QVZX 4EKGA 5CFQA 1FQJA 2K7FA 4LC1A 4XGKA 4RHEA 2HJHA 3SFZA 5HQ3B 3EVGA 1H2WA 1N2IA 4KOEC 4OHCA 4WXMA 2VP9A 1ZJ4A 1QH1B 1UMKA 1Z2EA 3KZ1E 4TYNA 3EGXB 1L7NA 1RPNA 1QBKC 4URXR 3WHKA 5AKZA 2Q7OE 2REOA 3PDIA 5FBLB 1L5KA 2J5KA 1NFRA 3QF4A 4DNXA 4REQB 3AEQB 5BQ5A 1U7PA 3BD9A 2H9IA 2I6FA 3NR2A 1M74A 1U2ZA 1W5EA 4MLZA 1JBKA 1IUNA 1QIHA 1Z7WA 3NCTA 1T2CA 4RTJA 1EU1A 2JK1A 3HEBA 2RGNC 1LLUA 4OJNA 5EE0A 4MVJF 3T0GA 4YR9A 1RD4A 4J4TA 3C7DB 2WJWA 1MAWA 4FX5A 3USES 4Q01A 2CNWD 4MDHA 2C0QA 4QQKA 4MI1A 2PV7A 2NUBA 4TMFA 1E3LA 1U1IA 1U9IA 1XYGA 2ZJ8A 2JHFA 2G7MC 3HV0A 3W0LB 2BKVA 3JWGA 4TS3A 3QKTA 5ALLA 4ZVKA 1D6JA 4RD2A 1WDWB 4OX9B 2VF4X 2J3EA 1T1IA 4XYGA 3A1CA 2VHJA 2O8CB 1EXWA 1ZMBA 2IYSA 1WOYA 2Y1EA 4G2NA 2ZR9A 2OKGA 2FGKA 4JT9A 4X85A 4GW3A 4OMDA 5LYYA 2UZ1B 3SG0A 1RHJA 5IABA 3I4LA 3NBXX 3TR5A 3PQFA 4EFLA 2QL7A 3SFVA 4B87A 2GRJA 1UAGA 3L8FA 1L4HA 4ZOAA 4ZWNA 1RRFA 4JI5B 4DC9A 2Z2YA 4XGQA 3MSCA 1U3CA 1BDIA 3BWDD 3H2ZA 2FRXA 5D8DA 3CZ9A 1QFMA 2FTKE 4MW4A 2CFOA 2WAAA 1FQOA 3CINA 2VJMA 5AMXA 4AF6A 2XB4A 2I66A 1YCGA 1Y6ZA 1ANKA 1FNMA 2P6MA 4C6TB 5IYZF 4DWJA 2LGJA 3P5BA 2CXQA 2VYQA 4MGIR 2PNJA 4UUPA 1I5RA 3LVRE 5AXBA 3N1UA 5KJCA 3T1VA 2IHZA 3HSSA 2ATIA 1UJNA 2QTLA 3VDRA 2OC4A 4Z4CA 5IKEA 1MVLA 4R71A 1MTOA 2GYUA 4J2OA 3ASZA 5J1TB 6REQA 2QPAA 3MK31 1LBEA 1XFDA 2J07A 4FI3C 4G5FA 5E3JA 2NW6A 4DREA 2QUBA 1D04A 2WU4A 2PT5A 1D2NA 5D51S 1K9SA 4G3XA 3EMVA 2O3SA 1G5QA 1D2AA 2VATA 4L3VA 1GTVA 4FDTA 1CQIA 3QX7A 4LSWA 1B73A 3GUVA 3VSEA 1GKUB 2FK8A 3X2EA 4B2LA 1II0A 4LOHA 3KB8A 4MVJG 2BR3A 3KCNA 5AUNB 1LI5A 1P45A 1G8PA 2HDOA 3HDQA 3TSOA 4POOA 3WMRA 4WESA 3LBFA 3AJDA 5C8YF 4O3MA 1JXOA 4JEHA 1KKMA 4JJ7A 3V5NA 2WHYA 3C3EA 4TS9A 1AUQA 4NV3A 4E31A 4OXIA 4PBTA 3HQ4O 5DGXA 2R1VB 3R09A 4C7OB 5AKIA 1SB9A 1GFZA 2HBQA 1Q7BA 4CM4A 4ZI7F 3D7RA 4PZ0A 1XELA 1R4AA 1SCKA 4AICA 3TMYA 4BRSA 3IQEA 5HUQA 1L7XA 5FX2A 4IKEA 3QOYA 1DCMA 3P9PA 4C2UA 3DM9B 4YCBA 2NP6A 3LDUA 3E5NA 3PCRB 5EJ5A 3L7OA 1FSSA 1LX7A 3LUPA 3VHXA 1UZNA 4LF7B 1LH0A 2BONA 2CMGA 3PF9A 2FP4B 3HEAA 2DR3A 4M6WB 5HX7A 5HTOA 3QE9Y 3GJZA 5GJWC 4B17A 1QH8A 3H5OA 4AP9A 2M98A 3OJ0A 4C3ZA 2QGNA 1GXSB 2A30A 3HDGA 1MAUA 4A8TA 1JQBA 1TUBB 1CFJA 4YT8A 3HYNA 4GKBA 3RAEC 3EHEA 1JNXX 3A31A 2C04A 3KLNA 3QV2A 5DSTA 5ESWA 4W1RA 1ZI9A 1RXVA 4EG1A 1O0CA 1G41A 2QRNA 1YJXA 1D1TA 2JGNA 3OUUA 3WZ2A 3M6MD 1KXJA 4RESA 1X42A 2GBIA 3KVNA 4FGUA 5CFMA 4MVXA 1E2LA 5ESDA 2QN9A 1WBJB 3QWIA 1AA6A 2V3WA 3W5UA 1WZUA 1E4VA 1NPTO 3ZE1B 3BMNA 1T36B 3RYHB 4AECA 3TGWA 4LI0A 1KU0A 5EQFA 1PG5A 1G3RA 2I6TA 1BDHA 1RWXA 4Y9RA 1JQDA 3W34A 4V1CA 3NTUA 4JIGA 4WLNA 2O6HA 1WMBA 2TMYA 2WIBA 3A3PA 4GHWA 4NZZA 4OH1A 3K6SB 2Q46A 3WISA 2P4QA 4BBPA 4O02B 2QTFA 3PL5A 4ZVPA 3KQUA 3C1AA 4ZDWA 1PTJA 3PXUA 2VDPB 1V2HE 1PS8A 2J32A 2P6RA 1R4NA 3LXMA 3E7PA 2WP0A 5DHUA 3REQB 4ECEA 4BMZA 3NAQA 1JBQA 1PJQA 1GNPA 2CJPA 2W2OA 1DARA 4OBWA 3TD9A 1Z0UA 4Y6QA 4O8CA 4YCAA 3TZKA 1CRLA 4HXFB 5ERGB 2GO7A 4WXYB 4PG4A 3KUCA 4ENPA 3VC2A 3QY0A 3QELB 2WHPB 1PEAA 2UXDB 4DIFA 3WSVA 5I3ZA 3FKSA 5KTRA 1E2QA 1GKLA 2QT0A 3AJ8A 4KXWA 4PZUA 4WZAE 3VDMA 4KK3A 4IGFA 3WJ1A 5JMWA 2QE6A 4JHXA 1GITA 3VUEA 1BRMA 3Q3HA 3EGVA 2BP7A 1LTHR 1YKSA 3O21A 3D2BA 1J97A 2JGKA 1PW7A 2W0MA 3ABRB 3OCZA 4I55F 4ZAXA 2F48A 3R8XA 4WDRA 4DUGA 2IS1A 3OT1A 5JD5A 2EZUA 2FFBA 3P9ZA 1TJ4A 2BEUA 2CB9A 4P35A 4YT5A 2FMFA 3IQDB 3MJEA 5AICA 2NX2A 5FBQB 4WZBA 3X1DA 1F1BA 2WP8J 1FTWA 1L4KA 5K0BA 1PUXA 2O2EA 1HG1A 3HJGA 3OEYA 4IMRA 1U5BA 1W5AA 4QQRA 3TL3A 2GESA 4DQ0A 3DH0A 1DQSA 4CTKA 4OJYA 4NL4H 4EY3A 1ML3A 5GIPE 2PVSA 1W36B 1H3FA 4G23A 1GVNB 2IKSA 3RANA 1Q0LA 1VJCA 2RHMA 4HFJA 4OHFA 5DLYA 3W3AH 4JFRA 3WGLA 4JAVC 2IUTA 1YC5A 2PAFA 3UTCA 2VP3A 4F56A 1RBQA 3LKZA 3R0XA 4QUDA 4WAUA 5C7OO 2WJHA 1Y1SA 1OXKB 1RAEA 1SUWA 3OPXA 4DCSA 1CEXA 3BFJA 2PJZA 2O2CA 2WJZB 3T3PB 3VHQA 4YCDA 3U0BA 8OHMA 4BX0A 2ZRGA 2H16A 1E7WA 5E2IA 2F4NA 1S9HA 1JLLA 3CR3C 1KJZA 3T5BA 1P0PA 2Y9PB 4CI0B 2XXAB 2PMWB 1R9MA 1SU6A 4E5PA 1QMPA 2GPWA 2P6PA 3G88A 1UBJS 1YHNA 3BCUA 4WKOA 4WKNA 3CT4A 4JLKA 4HWSA 4RWZA 3VDNB 4LAFA 3KL4A 1UF9A 3O4VA 1BYIA 4HDNA 4ER6A 3D3WA 1S5PA 1D0IA 1PSDA 1ONNA 5EWMB 3H5WA 2NSYA 1OFVA 1IYZA 1GQ2A 1UINA 3SR4A 2ID8A 2B9VA 4LOKA 4Q1VA 1F8GA 3KZNA 2ZSJA 3GEHA 4EF6A 5BWCA 2DPXA 1Z0FA 4MCHA 5ALVA 3LPNA 2IZ7A 5AXDA 3QVLA 3CM0A 2VUUA 1G3QA 1E1KA 2HY7A 3GFTA 4E94A 1SVUA 2PTGA 3PX3A 3QUQA 3WRVA 5FWXA 5ICSA 4YDRA 4GGMX 4TTSA 2OQ2A 3FYUB 4H6VA 2GM5A 4BLVA 3CISA 5TQ0A 1JEEA 2B37A 2SICE 2R8OA 2QZ4A 3KYIB 4B4DA 5DYGA 621PA 1DOAA 2BKEA 1D4FA 1DWUA 1PJCA 2DPYA 4BQSA 1AVTA 5BMVB 4XCXA 2HBRA 5A6VA 3V2GA 3LK6A 4WN3A 5LQMA 4MWBA 2Q3HA 4TKZA 4RMIA 2B25A 1X1RA 1E4YA 2PQ0A 3I5MA 3SYKA 1D4AA 4AZ3A 4P38A 4WBNB 2O0HA 4B3RB 1NDUA </