2GF2A

Crystal structure of human hydroxyisobutyrate dehydrogenase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
296
structure length
296
Chain Sequence
MPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
publication title Crystal structure of human hydroxyisobutyrate dehydrogenase
rcsb
source organism Homo sapiens
total genus 111
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2gf2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gf2A01
3GDGA 1ENYA 1ZXBA 5ER6A 3ABIA 1KVTA 1SEVA 4RORA 1C3VA 5T5QA 3HG7A 2PD6A 4CL8A 1JTVA 1ZVMA 3JYQA 3ORFA 3JQAD 5DOVA 2C7GA 4YJFB 2ZYAA 3VAZA 4YCAA 1XQ1A 1NHGA 5A02A 2BH9A 4WPGA 4TWRA 3WGOA 3D5TA 1GDHA 1J4AA 4MVJM 3L4SO 3VH4A 4U7WA 3PZRA 3QE3A 1ZJYA 3FCOA 4TVBA 4CMBA 4UVDA 4D42A 3EHEA 4GVLA 2NQTA 3HSKA 4BKPA 1HXHA 1EUCA 3PWKA 4RF4A 3OF2A 3WXBA 3DQPA 1YH3A 1KEPA 2CY0A 4WUVA 2O3QA 4BKOA 5G4KA 4ZICA 3QWBA 2C7VA 1NWCA 1PL6A 2DFDA 1SC6A 2H63A 2X4GA 1ZK4A 1UZMA 5F1KA 3V2HA 4E30A 1TB4A 4E31A 3UAGA 2VT2A 4YT5A 1MLDA 4U0KA 3ZHZA 1YQGA 1G6KA 3KZVA 2EXXA 2DTEA 1K3TA 1Z7BA 2GLXA 2W98A 3QA9A 3RC1A 3C1TA 4B7XA 1ULSA 4N54A 2IODA 4JP2A 3TZCA 3ZNOA 1UP7A 2G0TA 2O3SA 1V3TA 4J0EA 4PLHA 1R0SA 1XA0A 1E3EA 4Z9FA 1KEWA 2J6IA 3H2ZA 2Y0DA 3PHLA 2H1SA 1HEUA 3E6AA 3STHA 1HL3A 4J16A 1ZMOA 4MP8A 1GTMA 4R5HA 3HDQA 3FN4A 4J4TA 4AG3A 4Y67A 2IZ1A 2HMWA 4YACA 5G0TA 1PS9A 1DPGA 5TQVA 4GX0A 4JBHA 1Z82A 3DOJA 3ICCA 3WSWA 2EP5A 4Y9DA 3WFJA 4OSPA 3RWBA 1Y6JA 2F1KA 3RU9A 4RLHA 1AUPA 5EJ2A 1R4MB 3BMNA 5LCXA 2C54A 1LLUA 1QLJA 3JYOA 3GC6A 1NAHA 1VKNA 1HWYA 4ALMA 5K6AA 3EY4A 3ZWPA 4ZRNA 2W2LA 4J4BA 4CMCA 4KZPA 1E3IA 1SB9A 1YBMA 4FFNA 5JAZA 4JLWA 5A1TA 4EUEA 4PLTA 4CLRB 3GQVA 1ZO8A 1LI4A 1JU9A 3FBGA 1LLCA 2Y1DA 1NFQA 3JQ8B 4A26A 1W73A 4CQLA 1ISMA 1KERA 2X6TA 3D0OA 2XPCA 4F6CA 3GVIA 1PQUA 4Z6KA 3NRCA 2EEZA 4J9UE 4UVGA 1UXIA 4W7HA 1VSUA 2I3AA 5L9AA 1YWGO 4TZKA 5IZ4A 5I7VA 3F6YA 1BW9B 3DBHA 1BVUA 4IDDA 4XGNA 4OXKA 4M1QA 1P77A 1LDMA 3DHNA 1GYQA 4R3WA 3NDIA 3KBOA 1HZZA 4PVCA 2I76A 4W4TA 2V6GA 2D2IA 3BMOB 1A9YA 1G0NA 5COAA 3OJOA 3PDJA 1EBUA 4GMGA 4ZQEA 5JAIA 4YWJA 3GR6A 4YT8A 2AMFA 1B0AA 2FR8A 2ZTMA 2EG9A 2P2SA 5GMOA 4AJLA 4DWVA 2PZJA 4MIYA 2OP0A 4MKZA 2GZ1A 4G5HA 2WSBA 1QYXA 4WLVA 4BNGA 1LLQA 1LDEA 5MGBA 5H82A 4CM5A 5L3ZA 1GZ3A 2BI8A 3SC6A 1N92A 3ASUA 3C8MA 2Q1UA 3GLQA 3QVXA 2VUSA 2PZLA 1JAXA 2C29D 3JQ7B 3U4DA 1EDOA 3V8BA 1QMGA 1EVZA 3QVSA 2AQHA 3WMXA 3EVTA 3SVTA 3IKTA 4Z0TA 4EJ0A 3FNGA 1E77A 1PJ2A 4QXMA 3AWDA 1HYEA 1WDKA 4AJ2A 3GHHA 3R1IA 1G0OA 1CJCA 2Q4BA 4AJKA 3AFNA 4BNVA 4E5MA 1NQTA 1K0UA 1KEUA 3OICA 1M75A 4I5FA 1C1XA 4Y6PA 3RUIA 5A3JA 5DP1A 3HUDA 3ETDA 1ZK0A 3ONDA 3HN2A 2PD3A 4TQGA 5GZ6A 2JHFA 3EYWA 2EP7A 1E7RA 3OQBA 4NU5A 2JFGA 2HQ1A 4WKGA 1JVBA 3I1JA 3ZV3A 1MV8A 2H6EA 2HJRA 5DT9A 1IB6A 4J0FA 1ZXLA 4DMMA 4WGGA 1ENPA 2VUUA 5JW6A 2Q99A 4PIVA 2Y1FA 3DXFA 2G82A 5K9ZA 1QORA 3ZWYA 3ZHXA 3DBLB 4II2A 1I32A 5B4VA 5HS4A 3LC7O 1P31A 4L73A 1ZZEA 3PLRA 4PLCA 5I7SA 1Y1PA 3UUWA 3PEFA 1DC6A 5TGDA 4ALKA 2VWHA 3TRIA 3D3WB 2G5CA 3WLFA 3DO5A 3K31A 4LN1A 4ND1A 3D4PA 4WE3A 3PHGA 1HYGA 1ORRA 4NBTA 3RCBA 3BAZA 4FC6A 2Y66A 3ENNA 1A4UA 4BNLA 4DIFA 3MWEB 4N5NA 4ILKA 3L77A 5JO0A 4JIGA 4BO1A 1PTJA 3E8XA 3AM4A 4Y98A 1X7GA 5DOZA 2H5LA 4I08A 3OA2A 3Q11A 3GVCA 4DLAA 1EE2A 1HE2A 1GPDG 4PLFA 4URFA 4CMHA 4DVJA 1NVMB 2CDBA 1P1IA 1UXJA 1DC4A 1W8DA 4L4SA 4PZDA 2VHZA 1I3NA 4B8ZA 1LRKA 4N7RA 3UOGA 1PJ3A 1KY5A 4CUKA 4EI2A 5IN4A 4NFYA 2WYUA 5DN9A 1UP4A 2P4QA 2IDZA 3WNQA 3F5QA 5JAQA 2B69A 5IDYA 4FCCA 4HFNA 4BB6A 1MG0A 3QHAA 4L4RA 3TF5A 1EUDA 1OC4A 3H8VA 4Q3NA 3ZDFA 5IFLA 2FPPA 1LSUA 3QSGA 3UF0A 3ETGA 4TKLA 4DQXA 1HDGO 3U3XA 4E5KA 2W8ZA 4XJTA 2C82A 3IC5A 2VZ9A 4OKNA 1BXGB 3B6ZA 5KJ1A 1Z75A 5T64A 3T7CA 5ADHA 3JQAA 5A03A 3PJDA 2E6UX 3DBRB 4D0SA 1M66A 3A9WA 2Q3EA 1PJQA 4FW8A 2EKLA 3DC2A 3DZKA 1Y8RB 4CMKA 3O8QA 3JQFC 4WLOA 4YAJA 1UH5A 4BNUA 3GVXA 1K6IA 3U62A 2UYYA 2BELA 2HSDA 5THKA 1SB8A 4FOSA 4C7JA 3NAQA 3GAFA 5EQFA 3V2GA 4DREA 4HFRA 1Q0LA 4M8SA 3JQ6A 4DA9A 1JKIA 3RC7A 3RUDA 1AHHA 2ZYGA 4MVJD 3M2TA 4ALNA 5HWSA 1KETA 1UP6A 4G81A 1X7DA 1R4NB 1VI2A 3ITDA 3AI2A 4FFMA 3MJSA 4YVFA 4R4JA 4CM4B 2O23A 3WGGA 3DL2A 3LQFA 1U9JA 1SZJG 2OL4A 2HRBA 2P9GA 1Q0QA 4IMRA 3DZIA 4BIIA 1T4DA 1PJTA 3WGYA 3GRKA 2IXBA 4CMGA 2A94A 1K89A 3JV7A 4MDHA 3MJ4A 4OJNA 5JCJA 4PRLA 3H3FA 5BNFA 3ZH2A 2JHGA 3L0DA 1KIFA 3VKVA 4WLFA 5KOIA 2V65A 3H65A 1JDJA 2YDXA 4ZN6A 3EZYA 1LRLA 3ONFA 1T2FA 2GRAA 4IUYA 2W2KA 4WOJA 4XR9A 2W2KB 4RDIA 5ER9A 4XDYA 2ZB4A 3NTQA 5JDCC 3OJ0A 1IYZA 4IQGA 1UXHA 1A4IA 1IPFA 1FDTA 1NYTA 2NVBA 3EMKA 3QIVA 3BTSA 2E48A 1NBOA 1RM4A 2VOJA 5TT0A 3ADPA 3ZHYA 4D46A 1PQWA 5MDHA 1I5RA 3VDRA 2HK7A 1DC3A 3INRA 4IJWA 2POQX 2ZB7A 4CUZA 3WIEA 4D45A 5L7WA 4JCOA 1DIAA 1D3AA 4OM8A 1IL0A 1KYQA 3AY6A 3JD2A 3UVEA 4NBRA 3UKOA 3ENKA 5THQA 1T2AA 4MINA 3VZQA 3IQDB 4O6VA 4P8RA 5F21A 2DPHA 3VPHA 2PV7A 4BGUA 2Y68A 3U49A 3KTDA 4PG6A 3CKYA 1E5QA 4LRTB 3ZZNA 4AJEA 4DIBA 4U6SA 2OHXA 4RJTA 3AM5A 2GDZA 4Z3DA 4A0SA 1F17A 2FWMX 4R54A 4CM7A 2HMUA 4IM7A 2EGGA 4R1TA 3B70A 1VC2A 5IJZA 1BGVA 5FWNA 4QECA 4EUFA 3PRJA 2WD7A 3OETA 4NFSA 1BTOA 2OP1A 3TZHA 3JSAA 3G79A 2FSSA 2X0IA 4LVUA 2YFHA 2O50A 1PJ4A 1F12A 1O9BA 2FZEA 1YONA 4WCFC 2CF6A 1BVRA 4N5MA 1GEEA 4NZ9A 4OKIA 5F3RA 1SOWA 1HLPA 1A27A 3QP9A 4J1NA 2CUKA 4RPKA 1DFIA 2VZ8A 3AFMA 1UZLA 3ZU2A 2DBVO 1LRJA 1WDLA 4YAIA 3V1TC 4CQMD 2DC1A 3NX4A 2X22A 2X5JO 2Q1SA 1YOVA 2FPGA 1WMAA 3CZMA 1P33A 2YHIA 3PHIA 4FPXA 4E21A 1U5CA 2NV6A 2GERA 3CMMA 4N5LA 1PL7A 4A27A 5KKAA 4YAEA 1XSEA 5C7IO 1WVGA 1EMDA 1QR6A 2FR0A 2B37A 3MJEA 3PIDA 4PLPA 5JY6A 5EERA 4QQRA 2HMTA 5TSDA 1Q7CA 4IIVA 1XU7A 5I8ZA 4AFNA 1U4SA 4JX8A 3Q2KA 3SBOA 4K26A 3UHAA 2GCGA 1KVRA 4JROA 2D5CA 4CM9D 3BHJA 4BOYA 1AXGA 4AJHA 4XYLA 2X7HA 4IDBA 4YQYA 5G0VA 4E2WA 1Q7GA 3RROA 4AJ4A 3ROQA 1GYRA 3ZWVA 5CDSA 1HE3A 4K6FA 5FFFA 4BO4A 2VWPA 3WTCA 4KUHA 3QWAA 4FBGA 1MP0A 3WJ7A 1E5LA 4WNCA 3MZ0A 4YQZA 4EEXA 5L4LA 5C37A 2HKIA 1RM3A 3FRJA 1RYEA 3HJAA 2DM6A 5DDIP 4AJIA 2A92A 4Z9YA 1N7GA 4WLNA 3AY3A 1CWUA 5T6BA 3E9MA 5CDTA 1VSVA 1LC0A 1B8UA 4YR9A 3I52A 4QFDA 3G0OA 4BNIA 2E4AA 3LLVA 1HE4A 2BKAA 1NPTO 1HLDA 3IUSA 3NYWA 1CERA 1B3BA 1LUAA 4H3VA 1IZ0A 4LSMA 4DUPA 5I7FA 4ZQGA 2X9VA 3BZUA 2EHDA 3GZ4A 4NBUA 3FF4A 5IAAA 2P68A 2I9PA 1D8AA 1MB4A 2EW2A 5B1YA 1TEHA 5AXAA 4ZQBA 5KVCA 4BB5A 4UUMA 3CXRA 1LQUA 4TSKA 4MVJF 4GSLA 1NTOA 3WR5A 4INAA 4J7CA 1ISIA 1BSVA 3I4FA 1A72A 1HYHA 4UEJA 4WOKA 1CRWG 1OBFO 3LYLA 4AVYA 1LQTA 5JMPA 1Y8QB 4Q3DA 2AHRA 1NXQA 3CTMA 3GGGA 3JQGA 1EUZA 2EW8A 1A71A 2IE0A 4XA8A 5A5EA 3OM9A 3L4BC 1S6YA 4HX5A 1VJ1A 1I2ZA 3ST7A 5JSFA 2HK8A 1K6XA 3K8ZA 2O2SA 3IJRA 4YJHA 1WNTA 2IZ0A 3GT0A 4WASA 3OMLA 2DFVA 1D1SA 1E3WB 1LTHR 3SEFA 1V0JA 4CR6A 4UEKA 3I9LA 1YB4A 4NU6A 3GOHA 4L8VA 4Q9NA 2NU9A 5AOVA 3VH1A 2GGSA 3RJ5A 5IF3A 2FN7A 4L4XA 1DAPA 3OQ6A 1F8FA 1P0FA 4BNMA 5CFZA 1ZFNA 3A1NA 1C1DA 2PGDA 3B20A 1C1DB 3PJFA 3WLEA 3H9QA 4CM1A 1ZK2A 1MC4A 1E7YA 1N1EA 3BMCB 2J5RA 2O4UX 2D5AA 4YDRA 4EUHA 1P3DA 2PTGA 4CMEC 3GMSA 2CSUA 5I8WA 1QYCA 2AQIA 3A4VA 1N7HA 3BMQA 2BGMA 3BMQB 3GZNB 2O3JA 2VN8A 5L4SA 1HE5A 3GAZA 3DZGA 2O3TA 4R5MA 5KJCA 5TLSA 4TROA 1I24A 3JQ9C 2EIHA 4Q3AA 1RM5A 1WW8A 1KEVA 1MA0A 2BFPA 3A14A 4BNWA 4P4LA 2Q2QA 5A9SA 2AEMA 4QT0A 5CDUA 2BFAA 3V1UA 2D8AA 3W8DA 3N74A 4RVDA 1BRMA 4RVHA 3U4HA 4ALLA 1MXHA 1EK5A 3GNQA 1D4FA 4QO7A 4DL9A 5F5NA 1P1RA 1Z45A 4RDHA 2Y67A 4KUEA 3U0BA 4D44A 3F9IA 1YGYA 5IZCA 1EZ4A 2ZATA 3JD0A 1GL3A 2OUIA 2YFQA 1H6CA 4MOWA 3KLPX 5TX7A 3OECA 3MJVA 1YQXA 3UCFA 4BO9A 2X58A 4OQYA 2DBRA 4Y6SA 1ZJZA 2CVOA 3IMFA 3GN1A 3COSA 3WX0A 3GN2A 3OSUA 1ADBA 2C5AA 2ZTUA 4JQCA 2PH5A 5LDGA 3TPCA 1E1NA 3H3JA 4AICA 4B4WA 4AJPA 1LU9A 4BNJA 1GR0A 1NP3A 1TXGA 3QRWA 4B4OA 2RH4A 3FSRA 2D3TA 4P4NA 2PH3A 1L7EA 1H0KA 1O89A 5T57A 2JD1A 3AU8A 3BYZA 3BIOA 2NADA 1R37A 1E1KA 1EVYA 4CLHA 2G1UA 4H15A 2HJSA 3ZWMA 5TJ9A 2FRDA 1F8GA 3KVOA 5G4KB 2ZJ1A 2GZ3A 3DAGA 1I8TA 3RUEA 5HRUA 1R16A 3HHPA 1VLLA 2VNAA 3ZU4A 5BR7A 5JDCA 3DBVO 3QWIA 2VRCD 3NDRA 4Y6RA 4K28A 5HS6A 3FBTA 3IJPA 4TRMA 4I5EA 4W9NC 5T8KC 4OQZA 5H83A 2QX7A 3ON5A 1JLLA 1BXZA 5JCJD 3E18A 4PGFA 3HDJA 2IRWA 2F00A 5IXSA 1VJ0A 4IDGA 4TRRA 4Z3KA 2PGLA 1HDYA 3ASVA 5AQ1A 5JDIA 4L0QA 4KWIA 1E1LA 4NNJA 3GA0A 5AVOA 1JWAB 1MGOA 2J5QA 1QG6A 3MTGA 4M54A 3ANLA 1ZK3A 2UUOA 1E7MA 4PG7A 5HM8A 1V6AA 1WLYA 1ID1A 3WMWA 3RJ9A 1PS8A 1ISHA 4CQMA 4NH4A 3BMNB 1PGOA 1D1TA 1V9LA 2PKQP 3KO8A 3OIGA 3X2FA 4ZQFA 5G2OA 1X7HA 1EVJA 4IMPA 1PR9A 2VWGA 3WGHA 3CINA 3OIDA 1P9LA 3ANMA 4RV9A 2Z95A 3DZJA 4NK4A 2I3GA 3KETA 1EBFA 3UN1A 3B1KA 3PDUA 1LX6A 4IJKA 3RI3A 1T25A 1O94A 3H6KA 4WCFA 4FJ0A 1IE3A 3RIHA 4CQLB 4I9NA 1I3MA 3MTJA 3OH8A 1B7GO 5EN4A 2W90A 1YL7A 1ARZA 4U0JA 5A3VA 4Q39A 2C5EA 4RZHA 3EC7A 3QLJA 3DBHB 2OXIA 4ND3A 5GZ1A 4FC7A 4TZTA 5A05A 4CM9A 1C0LA 1TA4A 3PHHA 1XIVA 4M89A 4XGIA 4E33A 2EJVA 1QKIA 4P4GA 2TMDA 5KVQA 4RGBA 3F4BA 3ZU5A 1R12A 4CMIA 1K6JA 2EJWA 1H6BA 3CSDA 3E48A 3G1UA 5L7TA 4DYDA 3H5NA 4J9VA 4D3FA 3WBBA 1U28A 1R66A 1UXKA 4XIJA 3DZHA 4LISA 2FY8A 1SEPA 4HWKA 4YT4A 2AQ8A 4R51A 4YB8A 4YBZA 4J2HA 4XB2A 2DVMA 3LT0A 1H2BA 1NQ5A 4FQ8A 1FJHA 3U9LA 1U3WA 1YB5A 4PG5A 1I0ZA 3LDHA 3DB2A 2O7SA 3N7UA 2I65A 1HSZA 5IXYA 4RQUA 5F1PA 4OO3A 3WNVA 1EDZA 2WWRA 4R1UA 3DHYA 1GV0A 2JL1A 1WZIA 3BHIA 2JCXA 4BQPA 1I3KA 2QRJA 4ID9A 4UEOA 3R3SA 3C7DB 1DBVO 3AOGA 2IYOA 2GN4A 3PZBA 4NIMA 4R9SA 2P5YA 4QTZA 3KRTA 2VYVD 1C1XB 1P0CA 4CODB 2PZMA 1WMBA 1U7HA 5EINA 2DQ4A 3QWHA 3PPIA 2HRZA 3B1FA 4OXNA 4BMVA 1AXEA 4XYMA 4ZJUA 1X15A 1ADCA 3S2FA 4XB1A 1LJ8A 4DGSA 1TT5A 1G1AA 1TT5B 3CE6A 3WYCA 3ZW9A 1O95A 2X9GA 3KHUA 1GQYA 1QV6A 4CMAA 3O38A 4J91A 3LC1O 1HDXA 1ZMTA 2I99A 1YKFA 1QRRA 4XEHA 2Q1WA 4UUNA 4FD3A 2CMDA 3WBFA 4EYEA 2WEKA 3PGXA 3IS3A 5TJHA 3GH3A 1X0XA 5JLAA 5KKCA 4NHEA 1DAOA 4NJMA 4BNYA 4NJMB 4H7PA 1T2DA 1ZEJA 1U3UA 4UVHA 4LCJA 4XJSA 2C07A 3TFOA 4TKMA 3PIIA 3DAPA 1IULA 5IN5A 2CFCA 1I33A 1O5IA 2J3IA 2QW8A 1BXKA 5JO9A 4D7AA 4GKVA 4A10A 2X86A 1VPDA 1PZGA 1ZIDA 4O1MA 5JYEA 1MFZA 2I67A 3INTA 1GPJA 2E82A 2V6FA 3K5PA 3T4XA 1GCUA 1BDBA 3UH1A 1F0YA 3ZV5A 3QY9A 4AJNA 1E3LA 1Y5MA 3U5TA 1WP4A 2A35A 1FDWA 2WYVA 5JY1A 5HA5A 5JNLA 3JCZA 2AE1A 2DT5A 3DAFA 4EEZA 2VRBA 2GUGA 3ITKA 1HZJA 3V2UA 3D1LA 3DMTC 4CMEA 5KVVA 4A2CA 1DIHA 2NUAA 2RHCA 2ZB3A 1CYDA 3K73O 5DP2A 3GGOA 1Y9EA 1LSSA 2HUNA 1BG6A 3F46A 4I9HA 1T2CA 4LMPA 3DZFA 4EJ6A 1F06A 4XQGA 3PK0A 3PFWO 1NASA 4AJOA 4BUCA 4RPHA 5LDHA 5FF9A 2QHXA 1EK6A 4KUGA 1LA2A 2R00C 3ICPA 4JBGA 5CG1A 3WQSB 5C7LO 1ISGA 1W6UA 4GVXA 3RKRA 2P4HX 3ZWXA 3JQBC 3RASA 4E2YA 3K9QO 3KLMX 4BVAA 6ADHA 4KTTE 3FTPA 3G17A 1WXDA 1ZK1A 1VL0A 3JQAB 1PGJA 3ZN2A 3GPIA 2FR1A 1VE9A 3PWSA 4UVIA 3NJ4A 1LSJA 3RFVA 1HF3A 1U3VA 3JYPA 5CPFA 3O8QB 3PJEA 3R0IA 2GN9A 3DZBA 2CF5A 1RM0A 1A7KA 1SO8A 2J5KA 4PLZA 1GADO 1UXGA 1XEAA 4RF2A 1GV1A 5IDXA 3WDSA 4OHUA 5G0WA 4RCVA 1VM6A 4MVJP 1LBEA 3FNFA 3NTRA 4XCVA 2J8ZA 3HN7A 4LK3A 3FR8A 3VVCA 2PR2A 4TMFA 1UUFA 3TFQA 4IIUA 1KBZA 3H2SA 2NTNA 3LT4A 3M1AA 3AJRA 3R3JA 3UFXA 3W8EA 1NQAO 3W4KA 3PXXA 3PVZA 2DUUA 3M2PA 2BD0A 8LDHA 4JXKA 3JQEA 1QYDA 4D43A 1E6UA 2BFOA 2EGHA 1ZBQA 2FOIA 2IEDA 5JBIA 4IS2A 2ZQYA 2VRCA 3TZKA 5BSGA 4OGWA 2XXBA 2PK3A 4LMRA 3I3OA 4HBGA 2XXJA 1ISJA 3L9XA 4NBVA 5CP8A 2AE2A 1WDMA 4LSWA 3S2EA 2CZCA 2EF1A 1B2LA 4GPD1 4YRBA 2X0JA 4MIOA 4GBJA 4ALIA 2UV8A 2DTXA 1KY4A 2VTDA 3UXYA 1EEHA 3MOIA 3D7LA 4PRKA 2B35A 3DONA 3UICA 1R15A 2X23A 3CEAA 4RPJA 3TDKA 3WB9A 5T8KA 4BV8A 4W9NA 4IQ8A 5CPBA 2HU2A 2NTJA 3Q2IA 3HFSA 4L75A 4B7UA 2EKPA 1U5AA 4BO0A 1HETA 5C3MA 3P7MA 1ISFA 2IZZA 2ZTLA 4B3IA 4HFJA 3ZHBA 4RPLA 3W8FA 1N9GA 3VHRA 4XRRA 1N9GB 3PYMA 4R1SA 1T24A 4FFPA 5U1PA 2VUTA 2NU6A 3C7CB 4WLUA 1L1FA 3WTBA 3I9KA 4E12A 1XKQA 3KEQA 4J1QA 1I2CA 4PLVA 1V3VA 2CVZA 2ZKLA 3D4NA 5K0ZA 1IUKA 1YQDA 4PG8A 2BHLA 2DTDA 3PYXA 3GUYA 3LK7A 3OJEA 5DCWA 3TL3A 2XAAA 5EL0A 2YUTA 4UUPA 5A04A 2NTVA 1BMDA 2WD7B 4GMFA 1PS0A 4YXFA 5TIIA 3LT1A 3GVPA 1DOHA 4JNKA 2EWMA 3VPXA 3HQ4O 4IDFA 5ITWA 2DUWA 4FFRA 4XQEA 1EFLA 1PR3A 5L51A 2YQ4A 1KVQA 5I9LA 1GUZA 4YJDA 2AG8A 1NR7A 1IHXA 3H4VA 1DC5A 3GY0A 4IZHA 2ZCVA 3C24A 3JTMA 4P38A 3VDQA 1CETA 3UCXA 5U9CA 3I6QA 3OHSX 1R0LA 2DAPA 2P5UA 3OFSA 1K5HA 2BLLA 1NM5A 1VL6A 4BNNA 2GD1O 4E6PA 3GEMA 2NSDA 3D3EA 3PTZA 1XLTA 1YOVB 1QLHA 3AI3A 3CIFA 4MPDA 2YHIB 3VTZA 3W6ZA 3HB5X 1OFGA 2PZKA 4CV1A 3WS7A 3WYBA 3WOHA 1SPXA 4PZEA 1B14A 3G1TA 3NKLA 4KQXA 2H9IA 1H6AA 4D79A 2Q50A 2Q46A 2Y0EA 2EKQA 1QV7A 2YYYA 4CLEA 2DPGA 3RFTA 5JPIA 3Q0EA 5CDGA 4GX2A 4DBVO 1DRWA 4EW6A 3I9JA 4DLLA 2FZWA 2VYVA 2GR9A 1E92A 1N1GA 3BA1A 2NU8A 2D4AA 3JD1A 4J4HA 5CEFA 2O7QA 3VKUA 1GYPA 1PZHA 5ICSA 3VZRA 2G76A 4GX1A 1LNQA 1NQOA 4R3NA 2PKQO 4CM8A 3WGZA 1PSDA 2O3RA 2QYSA 1VJTA 2O4CA 3TOXA 2E37A 5KWEA 4CL3A 5IG2A 2SCUA 4RPGA 3GNSA 4DQVA 1P1JA 4JN6B 4KDFA 4F45A 4CV0A 4E2ZA 2LDBA 1JQBA 3GG2A 2QYTA 3HNPA 3PFFA 4FOOA 2X1HA 4E3ZA 2UDPA 2D1YA 2JD2A 3VPFA 5BT9A 4AL4A 2PY6A 3H5RA 3TSCA 4ZQHA 3KV3O 5KCZA 1IHYA 2XF8A 1XG5A 3BTOA 3F5SA 3LVFO 3RBVA 3RBZA 4N18A 4WK6A 2WTBA 1U4OA 5BSFA 4D3SA 2B83A 2VQ3A 4S3MA 4GGPA 4FR5A 5JAMA 2OZPA 1UDAA 3JD3A 3HDYA 3E03A 5JE8A 4XX0A 4BKQA 2JCYA 3P2YA 5DBGA 4IZIA 3S2GA 3EDMA 3I4CA 1ZCJA 1PWZA 3VH2A 2UUPA 1JN0A 4H16A 3UW3A 2ET6A 1YDWA 5JFOA 3OA0A 5KJ6A 3EK2A 3EZLA 2VHVA 2HMSA 2P9CA 5ILOA 2HO5A 1DFGA 4NK5A 2AA3A 2C0CA 1WPQA 1HRDA 2B4QA 4E2XA 5L45A 1DDOA 2IYPA 5CDYA 5DCYA 4BV9A 1B8VA 3JQGB 4EDFA 4GAEA 1P44A 1RYDA 3FNEA 4BMNA 4XD2A 5I7EA 1HTBA 4M87A 5FI3A 4J6FA 4CM6A 2NVUA 4DPLA 2WYWA 4WNIA 1FXSA 4GLOA 4B79A 4YJHB 2BGKA 1UAGA 4BNTA 4HNGA 5L95A 4IY1A 1E1MA 3CPSA 4LCEA 4C4OA 4CUJA 4G2NA 2OFPA 1E7WA 3MOGA 1W0CA 2R2GA 4XKJA 4CV2A 2FSVA 4GL4A 5JC8A 4ROSA 9LDBA 3SJUA 4J43A 4XWYA 1DSSG 5AYVA 5JMWA 3DDNA 3GEDA 2B0JA 3P5SA 5COQA 5T67A 1PJSA 4BNFA 3PWZA 3ZU3A 4GH5A 1EQ2A 4GI2A 4IDAA 3H9EO 1PJLA 3DOCA 1A9ZA 1DEHA 1GZ6A 1N2SA 5G4LA 4DBZA 1XR3A 1ONOA 1SAYA 2I66A 1N5DA 3PGJA 3QVTA 2WDZA 1LXCA 2Q4EA 4IGEA 3TN7A 1EVIA 3RKUA 4YRAA 1OAAA 3GFBA 3PYLA 3ZW8A 3HE3A 4FS3A 1Z7EA 2OBYA 4BGIA 2NVWA 1NVTA 2VOEA 2O2YA 4NPCA 4I8XA 2YV3A 4BNXA 3RFXA 3A06A 3RBXA 3GUCA 3JQBA 1J0XO 3H9UA 1BHSA 2DKNA 5A9SB 3AI1A 1UDCA 3AY7A 4DXHA 1CF2O 1XELA 2CDCA 4OAQA 3NUGA 5B4UA 1U8FO 1XYGA 2CD9A 2C2XA 2DBQA 4QX6A 3ZCXA 2AXQA 2DBZA 4BL5A 2Q2WA 3TZQA 1DRVA 3JQFA 4DTIA 4OSOA 1SCUA 3EVNA 3OEWA 3PQEA 4A7PA 2OOSA 3O26A 1P1FA 2BRUA 2OGUA 5TF4A 3DWFA 2WMDA 4FSHA 3A28A 3KYCA 4PFJA 3E1KA 2FMUA 2NU7A 4BO7A 4QSMA 1RJWA 4YA6A 9LDTA 3Q1LA 4QFCA 3QWFA 4XDZA 3GDFA 3LLSA 1HT0A 2HCTA 4KDEA 1Q7BA 3LZ6A 3D64A 3QW2A 4L76A 4MP6A 2P9EA 3M6IA 4CJXA 4DPKA 4W6ZA 1I30A 3E5MA 1K2WA 4YRDA 3Q3CA 1PJBA 2NQ8A 1DXYA 2VT3A 4E5PA 4BNHA 4E0BA 3DFUA 3NTOA 3LF1A 3Q9UA 4BS9A 3OBBA 1TI7A 4YEDA 1O8CA 1ZH8A 2BFMA 1A5ZA 3W1VA 5B12A 5BNIA 2Y1GA 3NT4A 3PHJA 1LDNA 2HAEA 4XYBA 1ENOA 1E0DA 1GFSA 1J6UA 4YJFA 4IDEA 5KJEA 3BXXA 3E9NA 3UGKA 1OZAA 3OIFA 4IGFA 4I5DA 4NDNE 3EAGA 2I6TA 3CMCO 8ADHA 1HSOA 1YL6A 1PL8A 3RUHA 3DFZA 3HB4X 2C59A 4ZD6A 1HDRA 2EERA 3I5MA 1J49A 3F1KA 4KQWA 4NG5A 5DCUA 4B4UA 3DR3A 3GGPA 3B1JA 5EQDA 2R6JA 5DF1A 3VOSA 3I83A 1DHTA 3L6OO 1U7TA 4BKRA 4PLYA 1DLJA 2Y93A 1OI7A 1PJCA 3RUFA 3C1AA 4QO8A 1GUFA 4FGWA 4MIEA 3OP4A 3IIEA 5I9NA 2YV2A 4D3DA 1E6WA 3GPDG 1GY8A 4FFOA 7ADHA 2WJPA 2FHSA 3GVHA 4JP3A 1YJ8A 5HTOA 1GZ4A 1B16A 1BWSA 4DQUA 5IDWA 4WJZA 3T4EA 1AGNA 1PWXA 1CQIA 4ESOA 4HY3A 4CQMB 3TQHA 3AOEC 4J49A 4RQTA 3S55A 4JJFA 1JAYA 1MC5A 4MO2A 4GWGA 5BQFA 1WZEA 1ONNA 4PZCA 1QYVA 2BGLA 2YW9A 4D41A 2QG4A 1YDEA 3K6JA 4YPOA 5F5LA 4WCFB 4RVFA 2PKRA 3AUSA 4IDCA 1TT7A 3MWDB 3GMDA 3W4JA 4FGSA 5A06A 5J23A 2DLDA 1R4MA 1SNYA 1TLTA 2Q49A 3H9JA 3NGXA 4R69A 4XGKA 1C14A 1MUUA 4IPTA 1DIBA 3IAHA 3IUPA 3WYEA 1T1SA 4ZRMA 3DOOA 4L9RA 2HMVA 2QZ9A 3GK3A 4YYZA 3V1YA 1HKUA 3AUAA 2VZ0A 3WQRA 4ITUA 4CLRA 3SXPA 3FPCA 3GF4A 3JQ8A 3O4RA 3WGQA 1Y9AA 4CMIB 3ZWWA 5TRTA 3TJRA 4ND4A 1NVGA 1T2EA 3CTVA 3AK4A 2B5WA 4JBIA 3VZPA 1YE3A 4U5QA 2Y0CA 3ZWBA 4E5NA 3PQFA 5BNTA 3DEYX 1DFHA 2YJZA 1BW9A 3Q9NA 4IQ0A 4IBOA 3RSHA 3DTYA 1HDOA 3KM0A 5EIOA 3QVOA 3WG9A 2FPIA 3KEOA 4CR8A 3WGIA 4DPMA 1WWKA 1YO6A 1QYWA 1N8KA 3BMOA 4XYGA 4BO3A 3RUCA 2C20A 5EPOA 2AQKA 2GPTA 5B37A 2J3JA 1PGNA 1KVSA 3SC4A 3FWZA 1DLIA 4W99A 5EMHA 3WWZA 4O5OA 1NAIA 1NX6A 4KP7A 5CEEA 3T7EA 1YRLA 2GZ2A 1ML3A 3TNLA 5ILGA 2OORA 4LRSB 1T26A 4HP8A 3TZ6A 2P91A 1NHWA 2QRLA 1XQ6A 1NPYA 1H2HA 3E9QA 4NQZA 2X5OA 4Q3BA 2AEFA 3SLKA 1QSGA 4B7CA 1ADFA 2ZK7A 3KOUA 3NT5A 5FYDA 5KTKA 3C85A 1M6WA 3K2BA 4R16A 3JQ7A 5CEJA 1H5QA 3VZSA 5TS3A 5A9TA 5ICMA 1TVEA 2J3HA 2BI7A 4E32A 3CZRA 3FPLA 3JQDA 3MCVA 2RH8A 3QVWA 4ZU3A 1V8BA 4O63O 2VYND 1ZEMA 2GNAA 1Y5RA 1GAEO 4WECA 3NGLA 3ANNA 3D4OA 3G3EA 4MVJH 4O0LA 4P22A 1I36A 3S1LA 3IOYA 3KYBA 4HFMA 3JYLA 3BTUA 1M6HA 1Y7TA 2B4TO 2QIOA 2YHUA 3L07A 4KOAA 4R01A 3GFGA 4TVOA 1PU2A 4YAKA 1E3JA 4DMLA 3C3XA 2V6BA 2QQ5A 1FDUA 3N58A 3PP8A 2VTEA 5JC1A 1DIGA 3GDOA 4I9UA 4PG4A 3VH3A 5DBFA 3W4IA 4BO6A 2LDXA 3F1LA 3DHEA 3L4BA 1ZNQO 3ZWOA 4XRGA 2YZ7A 3C7AA 3PQDA 4WCDA 4F6LA 4DLBA 2OMEA 4CPDA 1I3LA 4FIZA 1FDSA 1GUYA 2VNSA 5FEUA 2X5KO 3DBLA 1JVSA 1B15A 2X0RA 2ZIZA 3LT2A 4II3A 3H7AA 4R9RA 4DIOA 1AHIA 1VRWA 4J1SA 2CVQA 3AM3A 4CV3A 4UULA 1ZUD1 1Q1NA 1JW9B 3D3WA 3FI9A 4MKXA 4QEDA 5DZSA 3OJFA 1YS4A 5KNLA 2WE7A 2O3UA 2Q1TA 4E4YA 5DULA 1MG5A 1OMOA 1SOVA 2CDAA 2JJYA 2QRKA 4OXYA 2OBNA 5ENVA 1XU9A 5COBA 5JCXA 3DMYA 3JD4A 3KXDA 1E3SA 1X13A 5AXDA 1C0IA 1X0VA 3GEGA 3FD8A 4HXYA 4PN3A 4IXWA 2NWQA 4X54A 2AEJA 1H9AA 4XIYA 3LC2O 1LSOA 3I9OA 4FN4A 4MVJE 1XCBA 3RU7A 3JQ9A 3K2EA 5G0UA 2HLPA 3EUWA 3K30A 4OOEA 1OC2A 3PJGA 2FP4A 3E5RA 3FWNA 1GU7A 1MX3A 4W82A 3RQSA 1BDMA 1QP8A 1DO8A 1H94A 1P1HA 2V6MA 4K1LA 1ENZA 1CQJA 3ETEA 3F47A 1PIWA 2HK9A 2JFHA 4ONEA 2WM3A 1YXMA 4FB5A 3HADA 4BQRA 5FI5A 2Q2VA 1DJQA 4O59O 3ZWAA 4JGBA 3U4CA 4NR0A 4BNKA 5CHEA 3RAJA 5KJFA 1C0PA 4B8WA 3O03A 4D0RA 1PX0A 1LLDA 2B4RO 4DYVA 5F1OA 3IKVA 2GO1A 3FTNA 3TOZA 1BXGA 3FNHA 4EBFA 1ZW1A 3IDSA 1KOLA 2D0IA 4BGEA 4PLWA 1M76A 3KYDA 3L6EA 3I9NA 3KYDB 4F3YA 5JS6A 1DRUA 3RC9A 1YB1A 2PNFA 4JK3A 5A5FA 1J5PA 3DBRA 4AJ1A 3D5QA 4DRYA 3VTFA 2RIRA 1MXFA 3IP1A 2UVDA 1PEDA 3ZNNA 1Y8RA 4TRJA 2VHWA 2Y99A 4E5YA 4J1TA 3FR7A 1ZSNA 2O48X 2PA3A 4CLXA 1GCOA 1D7OA 4CMJA 2GN6A 1JWBB 3INGA 4RF5A 3TL2A 2NACA 5IZCC 1Q2XA 1P74A 3WICA 4LGVA 3SLGA 3IP3A 1NPDA 5JXWA 2Z1NA 3WSVA 2JKVA 3F3SA 1ZSVA 5CAEA 2ZCUA 4CLOA 1F14A 4CLOB 2GN8A 1E7QA 2VHYA 3EGOA 1R4NA 4YTEA 1T4BA 3P19A 4BNZA 1DB3A 4EJMA 4CM4A 2Y1OA 4ZA2A 4CR7A 3K96A 1H9BA 1W4ZA 1IY8A 2NNLD 4RO0A 5AXCA 4BGVA 2PWZA 1YJQA 4B3JA 3L9WA 2Q45A 3AUUA 1XGKA 2HDHA 4M49A 4PCVA 3ZV4A 5EESA 2XOXA 1RPNA 4IJUA 3TWOA 4ZHSA 4RVUA 3GG9A 2A4KA 1AE1A 1CDOA 2JAHA 1ULUA 1CIVA 2GF2A 3V5NA 2J3KA 3CH6A 4DC1A 2QZZA 2X9NA 4J2OA 3KSUA 3PI7A 1QXSA 4ND2A 3VVBA 1I2BA 4A73A 1JA9A 2BF7A 2GASA 4RLSA 4WEOA 4C7KA 5IDQA 1P45A 4K9DA 2BMAA 4MKRA 1LDYA 1RKXA 3WWYA 1PGQA 4A03A 4MVJI 3NT2A 3PLNA 1DJNA 5GZ3A 3AOEA 5BSEA 3NV9A 3IL2A 1L7DA 1O0SA 1U8XX 5ES3A 4PVDA 1O6ZA 3F4LA 3ZWCA 3H5AA 3HDHA 3E82A 5DBIA 1X1TA 4E13A 4IS3A 4Q3CA 4HV4A 2Y1CA 5JDIC 2JCVA 1A7AA 3MJTA 4EZBA 1B26A 2VHXA 3UCEA 4DC0A 4U8GA 1Y81A 1I01A 1OOEA 4NI5A 3NJ8A 2ZJ0A 3HZZA 4KTVE 1XHLA 2I5PO 4BMSA 1R6DA 4IINA 5HBRA 4BHTA 3ROKA 3WIDA 5K6AC 3S2IA 4J7XA 1IPEA 4FFLA 2WD8A 3FHLA 3W6UA 1C0KA 1IZ9A 4OMUA 1X14A 1UR5A 2DU8A 1NR1A 2NM0A 7MDHA 4GWKA 3ULKA 5B4TA 1B3RA 2E49A 4I5GA 3QV1A 5TT1A 5H81A 3C1OA 2X8LA 1GQQA 2ZTVA 2B36A 4AJJA 4XZ3A 1M67A 2PFGA 4YT2A 1FF9A 1LC3A 1SMKA 4QUKA 1NWHA 1NNUA 1LDGA 5LC1A 1P1KA 4NMHA 4UUOA 4KMSA 3VPGA 1V35A 1YBAA 2W2LD 3ADOA 2ZB8A 3AU9A 4JJGA 4CM8B 3OEYA 4XYEA 3MEQA 3WGTA 2OO5A 1U2DA 5ITVA 3QQPA 3NDJA 5A9RA 4M55A 5U4QA 3BHMA 5TNXA 2VYNA 3WQQA 3ZI0A 2RCYA 4WLEA 1KC1A 1H6DA 3ZNPA 1FMCA 3VC7A 3DTTA 4FDAA 4UVEA 5JYDA 2IEBA 3CUKA 4OL9A 1ZSYA 1FK8A 5AXBA 5C7OO 2YQ5A 4JJIA 1WAMA 4R1NA 2PGJA 4G65A 4BO2A 4CM3A 1CEQA 1UDBA 2JAPA 4F46A 4Z0PA 2CNBA 1FDVA 2EV9A 3JYNA 1GEGA 3AW9A 5GY7A 2ZYDA 3GHYA 4A5OA 5A4DA 1GD1O 4ND5A 1E7SA 3KUXA 2G17A 2GYYA 1AN9A 2VCYA 3LSYA 2YDYA 4IXTA 1X1EA 1HDZA 3ROMA 4MVJG 4XR4A 2NLOA 5L7YA 3NEPX 4B4VA 3AUTA 5C5IA 4B3HA 1EQUA 4KWHA 4NJOA 2D59A 1PGPA 2YY7A 2IXAA 5TC4A 3G49A 4FJ1A 3I6IA 4RL6A 5G0SA 3GNTA 2TMGA 3LF2A 1MFPA 2ZQZA 3KB6A 4Y8VA 1VL8A 2PD4A 4L74A 2RBEA 4GQAA 4HNHA 1PQPA 4HADA 3I23A 1XDWA 4ZVVA 4GGOA 2C2YA 4GLLA 2NVUB 2UAGA 2W4QA 3JQCA 1E6EA 2Z5LA 1VKOA 4R41A 5ENDA 4OH1A 1DIRA 5L40A 1PZEA 3SJ7A 2PLAA 3U4IA 4TRNA 3SX2A 2JD0A 3S8MA 3WJAA 4RF3A 4XQ9A 4EGFA 5L53A 1Y8QA 5KIAA 4RVSA 4OIMA 1UJMA 3HWRA 4J7UA 2Z1MA 1KVUA 1Z6ZA 5BSHA 3RVDA 2AW5A 3LU1A 1IOLA 1I10A 3OJLA 4GX5A 3GRPA 3KSDO 4Q3EA 1M2WA 4UAGA 1GQ2A 1RWBA 4RVGA 3ZNQA 1R0KA 3EW7A 1E3WA 4NBWA 1Z73A 3DMTA 5I9MA 1LEHA 1T1RA 3O9ZA 4Z9XA 1YL5A 5L4NA 1DHRA 4K6CA 1B8PA 1JKFA 3RUAA 4PLGA 2V7PA 3QJ5A 4W7IA 4Z0HO 3Q6IA 3R6DA 1LDBA 4I1IA 3X2EA 4J90A 1YVEI 3L6DA 4IJVA 1Z74A 3RC2A 2Y05A 2R00A 3BMCA 2JFFA 2RHRA 3M1LA 4J3FA 4OYRA 4BKUA 3P2OA 3K92A 3ZWNA 3U09A 2RAFA 2X0NA 3OQ1A 1EE9A 4BO5A 3ROPA 1UZNA 2A9FA 3RD5A 4LVCA 1UAYA 2YV1A 4WEQA 4YAGA 1S7CA 1NFRA 4NFHA 4RZIA 4ZGWA 3GZNA 4BO8A 1KC3A 3ZV6A 4GSKA 3H9GA 1H93A 1Q0HA 2ILTA 1ZKMA 1ADGA 2GSDA 3HFGA 3MJCA 4HUJA 3BTVA 1U1IA 1KS9A 4CLDA 4MP3A 4LW8A 1U2GA 3VPSA 2Y1EA 3ONEA 4YJGA 5KVSA 4YJGB 4U6QA 2AG5A 1HDCA 3KSZO 4MVJA 3KYCB 4UREA 3I9MA 1NFFA 1V3UA 4GKBA 1PZFA 1XWFA 2B5VA 1ONPA 1JKJA 4ALJA 6LDHA 4HKTA 1YBVA 2WE8A 4M86A 4MJLA 1SBYA 4EITA 1U3TA 5CG2A 1EFKA 4OOFA 4S1VA 5DNAA 3ZGYA 3WFIA 4FJ2A 4R68A 2VWQA 4XQCA
chains in the Genus database with same CATH superfamily
1ZXBA 1H1TA 3DP9A 1SKAA 1C3VA 4O3FA 1UC4B 2IPOA 4K46A 3SP1A 3T99A 1K7CA 4QIHA 2PD6A 3EPJA 5EEHA 4X71A 1QRTA 3BBPA 3IUQA 5LBTA 4X41A 3I6ZA 3W5HA 2PRIA 5GV8A 1NU6A 1UEXC 2OCDA 3QX8A 1RWQA 4KYTA 5K51A 4DMRA 5FO0A 3U3MA 2YVLA 1V1MB 1XXLA 1ZUHA 2QZPA 3EF0A 3WP0A 3UV3A 5I4KA 4W63A 3DKRA 5EE3A 1CR6A 1NHGA 1ORIA 5A02A 2WSYB 2BEVA 3HVRA 1P5HA 3TRFA 3IVAA 3GLIA 3D5TA 4HLDA 4IKEA 1XPRA 2CN1A 1J4AA 3JATB 4Z1OA 2FQYA 2WKSA 4UCXA 1IHDA 4UEWA 1GOTA 1CE8A 4BLSA 2ZS8A 3FCOA 4HL6A 4CMBA 1TM5E 4UVDA 1ZC3A 1NJ8A 2NQTA 5AM2A 1IOWA 2D1QA 4O8CA 4BKPA 1EUCA 5DT2A 2EBHX 3KPUA 3KR9A 3BJZA 5JQGF 1L4NA 1JHVA 2W2VA 1W2GA 3DC7A 1AGXA 3CEMA 1LVHA 1L5GB 4ZICA 2IYAA 3NHUA 2GRUA 3QWBA 5KYXB 4LYFA 1IM5A 1SCAA 2CHGA 2H63A 2HTFA 5F1KA 5EUCA 1TL7C 3OIWA 5IM4A 1G3RA 3ZIAA 1M2VA 1VG9B 2I2DA 4FMPA 5SZIA 5ISMA 10MHA 1XTSA 1YQGA 4RD3A 4YASA 4ENTA 2EXXA 2DTEA 1K3TA 4GOND 2I54A 3C8HA 2IYZA 2YCBA 3A0UA 3C1TA 4QQKA 4B7XA 2IODA 2CNDA 2UYGA 3ZNOA 3QOXA 2J7PA 1HG0A 2W2PA 4D6YA 4KVGA 2A57A 4E88A 4KE7A 4DMHA 4RKWA 3NM5A 4CIBA 5L3VA 1TYEB 4LOLA 1ZHFA 3H4MA 1RAHA 3HH8A 3K8QA 4NOJA 4NQRA 1GTMA 1VCNA 4Y67A 5E9QA 3ZGXA 1E98A 4OA5A 2HMWA 1CY4A 5B2EA 2WM8A 4C6TB 2AD1A 2V4ZA 1Z82A 2REBA 1EWKA 1GGEA 1QOPB 4C1BA 4EBBA 3BORA 5J1SB 3PV0A 4G1BA 4OSPA 2D2XA 1A4XA 1SOMA 1Y6JA 3QKSA 1YCHA 2WMOB 4GRAA 4RLHA 3DGFC 1R4MB 1WOMA 3A1VA 1LLUA 2W0SA 1OPXA 9ATCA 2APJA 3DNFA 3WMRA 2JGEA 4UAVA 4WGFA 3JASA 1THMA 2FUG1 1I7NA 5CVCA 4ZRNA 2DHCA 3G5LA 3TZBA 3ZE6A 2FW6A 4KZPA 2B6NA 3CX7A 4M22A 3F49S 1LCIA 4QYSA 1YS2X 3WIUA 2WYOA 4ON9A 4EUEA 4PLTA 1EWRA 5K3AA 3AJ8A 1ULZA 1ZO8A 1NV8A 1JU9A 4EW3A 1L4MA 2Y1DA 3JQ8B 4TOIA 1W73A 3CJTA 3FZYA 1ISMA 3LXUX 2XY4A 4CR6A 2QMZA 4F6CA 1VBMA 2XPCA 3GVIA 2VA9A 4Z6KA 3NRCA 4GIBA 5FLYA 4ARCA 1X74A 4UVGA 4QSHA 4G4JA 1VSUA 2V7TA 1YWGO 3G0IA 3CNQS 5I7VA 1CK4A 3PRYA 5FLKA 4AURA 3DV0A 4BVBA 2VPWA 4C76A 3IQIX 4D9EA 4UTOA 3TGPA 2LPMA 4LJ4A 4M1QA 1P77A 2I29A 1LDMA 4D6PA 1SQGA 3DHNA 1F48A 5KX5A 3NDIA 4OKSA 2X1LA 3KBOA 1HZZA 3WISA 3LWNA 1P4SA 2ZRNA 2I76A 3QU2A 4W4TA 4YQZA 1A9YA 4GPAA 4RK5A 4QPNA 1F2UA 4ZQEA 1EBUA 4GMGA 3TM4A 4B3DA 4YWJA 1G3UA 4EA8A 1QC5B 5ARBA 2P4UA 4MW0A 3SQDA 5L45A 2ZTMA 3S27A 2EZTA 4QUEA 1TVMA 2P2SA 2GA8A 2WM9B 4AJLA 1UODA 4MWBA 2C7BA 5CD1A 3ZXYA 5LNK6 1RXYA 2OP0A 4A0QA 1EUQA 4G5HA 2NUBA 2WSBA 2Q5QA 2HRDA 2IYQA 5F7ZA 2E4YA 4BNGA 2M32A 3BWVA 5JS2A 2W0MA 1I1HA 2Q5IA 4LDQA 1W36C 1ZD8A 2CLMB 3A11A 1KYTA 2HA7A 5L3ZA 2BI8A 3WVNA 2HCBA 1N5RA 4REOA 1N92A 3ASUA 3AHEA 2GI4A 2JAQA 2Q1UA 3DDZX 3GLQA 3E5HA 3I4LA 4KMOA 4MWDA 4BRZA 5TQ0A 2FEWB 2FP3A 4PQGA 3KB8A 3MJHA 3K6SA 3F0TA 4TTSA 1JAXA 2C29D 2F48A 1Z33A 1BDHA 4OBBA 1EDOA 2I33A 2XUDA 3V8BA 1N6KA 4KN8A 2AQHA 3UJBA 3IE1A 2GN1A 5HCNA 3IKTA 2YJ6A 1MU0A 1E77A 5J5VA 1SKMA 2BFWA 4OXXA 3PUJA 1WDKA 2J0VA 2ST1A 2OZVA 3EZ9A 3IP8A 3AFNA 4QDJA 4C89A 4CU5A 1XEXB 1BA3A 1KEUA 3HKEB 5AI5A 5ITZB 3GZJA 3HB0A 1JDZA 2ACKA 2M6KA 4HYEA 3C98A 5EUQB 4EQ6B 1JR3E 5DP1A 2V0GA 3EVZA 3HUDA 5JJKA 1SZPA 1J9EA 1ZK0A 3N2YA 1IEVA 4QA9A 4E14A 4ZANA 3HN2A 1CRLA 1S01A 3BIJA 1HURA 5IAOA 3TKAA 2ODNA 4K2AA 4PPFA 3U9SA 1O3YA 3GEHA 5B6JA 3T15A 4OMDA 3FWYA 5F51A 2JFGA 2HQ1A 4UATA 4LE1A 2H06A 1JVBA 3B1WA 2HJRA 4EO4A 2JFWA 4JP5A 3AHHA 2YOFA 4FDTA 4BEWA 1W4CA 2H48A 3EWIA 5BMVF 4LNUB 4NDZA 4Z9BA 5T4EA 5I9IA 5M29A 2TECE 3WL6A 3OE5A 5K9ZA 3DXFA 2G82A 3WGKA 4H60A 1F3OA 3ZWYA 3SHVA 6PFKA 3V3KA 3O5AA 4UFNA 3CRMA 1N34B 1ZZEA 1DRKA 3AERA 1M5UA 2WIBA 4WVLA 1FQOA 1NKTA 3LP8A 5LYJA 3RJTA 4EDHA 3QENA 3PTAA 1U0OC 2DUNA 1M8JA 4QDKA 4Q03A 5TGDA 4ALKA 2YOHA 3D3WB 2J7KA 3MIZA 3VVMA 1HLGA 3DO5A 4MCJA 3D4PA 1PJ8A 2CL5A 1DXHA 4G9GA 4ND1A 3K9HA 1KK2A 4F91B 2BAGA 2CEKA 4PBRA 4NBTA 4TL8A 5BSVA 1GZVA 3GLFB 3WLJA 1GL9B 2RB4A 4NTZA 4L16A 4BNLA 2QTFA 3MWEB 2P9BA 3VAAA 4FHFA 3ZHCA 3L77A 4NENB 1J99A 1PTJA 1WRBA 5JZMA 1CRPA 1WSWA 4I6GA 1NMSA 4OQNA 3UJ9A 2CZGA 1Y4ZA 4KLAA 3N7AA 1SFRA 3S40A 5K3CA 4AKGA 1GSAA 4DLAA 2XRFA 2N0SA 5DNWA 1Z63A 2HPZA 4B2IA 1M2HA 1NVMB 4DVJA 3FOAA 1DBWA 3UA3A 1P1IA 2HMAA 3O21A 1DC4A 1XDZA 2X1VA 2ZFUA 3JZMA 1CULC 1PO7A 3R5JA 5JISA 5D6NA 4JQZA 1LRKA 1QH8B 5FH9A 2XGGA 1YDFA 4C03A 2Q5JA 1HOTA 1N6HA 3A04A 4G8CA 4TT3A 2V6IA 1MV5A 3IJ5A 5F7JA 3ZVNA 2HGZA 4HG2A 2EX4A 2Z5FA 4NFYA 3AJ9A 3F8SA 3OLQA 4X94A 4LTMA 1CQJB 4M21A 1VXRA 3D2AA 5LOVF 1O57A 1WB4A 3CW8X 1WETA 2QN8A 3QUBA 2IIQA 3QHAA 2W9XA 2PG3A 1RJ9B 2Z09A 3Q1KA 1JNXX 2BI4A 3BFKA 1MRSA 3DT9A 3Q41A 4GR4A 3RGGA 4EEKA 5FPKA 1VPEA 5IFLA 1VYUA 2FPPA 3MTDA 1FYWA 2GCOB 4AP9A 3ICQB 2XA1A 2PT6A 3ETGA 4TKLA 2ODBA 5TPWB 1L5WA 4EPTA 3RS2A 4UCWA 1SUWA 2W8ZA 3GW8A 1YRBA 1LK0A 3BE6A 1C3OB 3K2QA 1GILA 4OKNA 1BXGB 4M46A 1YIOA 1OYOA 4GFDA 2PVPA 1KQ3A 4YP0A 4YXWA 4I4TA 1IJFA 3KFVA 1DT5A 1R8XA 3BREA 3IQXA 5DGIA 1GARA 4OLBA 5E3HA 4GKKB 1PK8A 2P6OA 2VDKB 4MQ6A 4L4UA 3DBRB 4TTJA 3VJLA 1QVRA 4IOMA 3IIJA 1PJQA 4EX7A 1GNTA 4ITRC 4X3OA 1YE5A 3AHJA 3L0BA 2QTBA 4CMKA 5KKNB 1L7XA 1ZH0A 1EFVA 5ALSA 2FN8A 1K6IA 3U62A 2UYYA 4BNDB 1RBQA 2BELA 2BPOA 1SUDA 4IHJA 4M7WA 4UE3S 1ZGBA 2BRUC 3LLUA 4FOSA 4JITA 4WADA 3NAQA 5THKA 3MGCA 4L0DA 3V2GA 4DREA 4XASA 3B9BA 2Z6UA 2HFKA 1IQRA 3CLVA 3QF4B 3RRBA 3FWHA 4M8SA 3K0SA 1JKIA 2EYQA 3RC7A 4FMBB 5ETJA 1AHHA 2O7VA 2YBEA 3M2TA 2PLRA 1ZNYA 2WNSA 4AG6A 2ONZA 1UPFA 2HA2A 2JGKA 2VHUA 4KJXA 4C0AC 4PICA 3I12A 4ZZ2A 5JSZA 1APBA 1CX9B 2H1WA 1UP6A 4MIKA 1X7DA 2B20A 4QBIA 4EIWA 4W5TA 1XTPA 2E21A 1VZ3A 5FTJA 1Y9ZA 2G8LA 4LI3X 1Q0TA 1G5TA 4LJRA 2I2WA 3DLIA 4ODIA 2C03A 2XWBF 5A6SB 1TNDA 3CLHA 3IT2A 1U9JA 1VIVA 5CX1B 2F43A 2H51A 1VDMA 4RAOA 2HRBA 1SUFA 5DX1A 3T95A 1Q0QA 4IMRA 3ZWDA 3DZIA 5E6UA 4JBXA 5KAMA 5JHHB 3EBLA 3WGYA 4DM3A 3EIHA 3ZQJA 4CCYA 2ZR7A 3ZDEA 3T3IA 3IKJA 4PX9A 1CLUA 1K89A 4MJXA 5ESDA 1Y3FE 5TVKA 5LM3A 5JCJA 4Z4FA 1Y3AA 3R41A 5BNFA 3BWDD 5FUVA 1LI5A 2AMLA 1KIFA 3TW6A 1N2IA 5I7WA 3H65A 4YRMA 3LGXA 2GARA 3E9YA 2IZ7A 3EZYA 1E2UA 1LRLA 3HP7A 3Q0IA 4WOJA 2YIVX 2W2KB 5I01A 3REOA 1J24A 2O7RA 4ZYLA 1W85B 5HW0A 1E1QA 1VJDA 2ZB4A 3IEIA 3JVVA 4RVNA 4IQGA 3FWPA 4LEIA 4YDSA 3AF3A 1OFTA 2XB6A 3VVLA 3PRKE 2NVBA 3QIVA 1ZU5A 5I3ZA 3EXFB 1NBOA 3QLUC 1Z5GA 2VOJA 5TT0A 3ZHTA 3W0LB 1KZ1A 2B2NA 1I5RA 3VDRA 1AKYA 4IJWA 1QH1B 2VJMB 4M8LA 2Y2UA 4ZT2A 1Y8ZA 5L7WA 3MPUA 3NHWA 4OM8A 2PGIA 2IXFA 2HH9A 1M6EX 4NBRA 3UVEA 3L04A 1UOPA 1T2AA 1N77A 4JHLA 2XA9A 4L5CA 5FRDA 3BH7A 1X2EA 4O6VA 3K4HA 4P8RA 1RSZA 4KQIA 4R6XA 2PV7A 4BGUA 1JFTA 2Y68A 1L5KA 3KTDA 3B7WA 2G1AA 4PG6A 3RAGA 2GZAA 1QP7A 1RLUA 1BYUA 4TXJA 1XDUA 5DHQA 2WUGA 1NBHA 2YINC 3DAOA 4RJTA 5BSMA 5JHGB 4JC0A 3IVRA 1O0CA 2BZ1A 2FWMX 2WU1A 2HMUA 5BV1A 4UTPA 2RGCA 5IJZA 3T6KA 1BGVA 3EZNA 4EUFA 1UBUS 3NCTA 2WD7A 1SVOA 5SZJA 1HTTA 1STOA 3ZEAA 2JLSA 4HZUB 4AY4A 4ZI7F 4J0QA 4AZ3B 3JSAA 2Q6TA 4JGGA 1GRNA 3NETA 1CZKA 2WBLC 1BYIA 4UM5A 4LOHA 1QONA 2XZOA 3FHTA 4AY5A 4MI1A 1AKWA 3EBPA 3ZGOA 3OC0A 3KUUA 2FZEA 3AQIA 2CF6A 3FE2A 3NOVA 4N5MA 4WZAA 4DGQA 1LNZA 4KLZA 4NZ9A 2AJBA 1SOWA 3D7SA 3H2IA 1A27A 1RXEA 3NTVA 3QP9A 4XSGA 3WYAA 5JBQA 1FNDA 1FY2A 2OR3A 4G2TA 1NSYA 1SUSA 1XZIA 1DFIA 5CLLA 5AI6A 3FUWA 4IRXA 2PZBA 3A9RA 4KI0A 2P9FA 3KXPA 2AZ4A 1G7RA 3FJYA 4KI7A 1FVOA 2EARA 1XAHA 2DC1A 2H9AA 3GFSA 4G0VA 3NX4A 2X22A 2UXDB 1H66A 2CNWD 2X5JO 4DDVA 2Q1SA 3EPPA 5I5GA 3ZHOA 1Z4IA 2AFHB 2AR7A 1LPPA 4DCTA 1PN3A 2WDPA 1XMIA 4UM9B 3IAFA 3T0GA 1WVIA 2EW1A 2QG9A 1TRKA 4WVFA 3N0TA 3SBXA 5KKAA 4YAEA 3ZTTA 4D92A 2I1WA 3OTWA 1O94D 2VAXA 1XMXA 2XOKD 2FR0A 5AH0A 3T1QA 1PX2A 4XDGA 2KMLA 2PMDA 5CRIA 3DE6X 2JASA 3ABQB 2VJKA 4Q4LA 2BEKA 1GKLA 1S2NA 4IICA 1JIQA 1NBMA 1YZTA 2HPVA 3I76A 3RS3A 5FAKA 2OZLA 3P4YA 4IIVA 5I8ZA 4Q6BA 2IKQA 3W5CA 3UHAA 4ETNA 2EZ4A 2ZWMA 4L3VA 3R9XA 2O0KA 2FK7A 5KOJA 1QQ5A 3GZTB 4JROA 4QM6A 2Y4OA 1J97A 2ZUUA 3ONNA 2YRXA 4MHOA 3JARA 4IDBA 2XQJA 1ZOIA 4Q4HA 1QVAA 1DKLA 3AESB 3RNOA 5FFFA 1WV1A 4G8DA 2DUJA 3CO0S 4NLLA 1RWXA 2J9ZB 3PXDA 4U3JB 4D9FA 2AJTA 4Y1RB 3G8DA 3H3XA 5C37A 3A9SA 1P1BA 1CS0B 4LX8A 1XCJA 3T3EA 3PD0A 1RYEA 3MBOA 2DJ5A 4V02A 3I6MA 1JNYA 2A92A 2HQRA 4Z9YA 4XX1A 4H1WA 3TB6A 4R2HA 2POCA 3O4HA 3ODPA 3I04A 1VSVA 4OG2A 1LC0A 3IQWA 3HKBA 2VC2B 4YR9A 4V0KA 2C2HA 4QFDA 3GAMA 2YHSA 1QO0A 1HLDA 1X3LA 2FI1A 3LA6A 5MN5A 3EGWA 4U2DA 1RRFA 3TMYA 4H3VA 4Q7MB 2HRQA 1IZ0A 1K7XB 4JMPA 4JQSA 3UO8B 3OIUA 4DUPA 2BM0A 4ZQGA 3GZ4A 3GGCA 1NN0A 5KSOA 4NCNA 1U3CA 4IQ4A 3R9KA 1ZJ5A 2JA2A 1MB4A 2N3ZA 4II7A 5KVCA 4BB5A 1LBHA 4ZVNA 3BQNB 1GZDA 4E08A 4MVJF 2ZYTX 5AVZA 4GSLA 2PRJA 2I4OA 3GEBA 4J7CA 5LN1A 1KOJA 2GNOA 4FSDA 4AVYA 4F60A 5A7HA 2R68A 4CQJA 2AFIB 5JMPA 4JEMA 4QNMA 4Q3DA 1CY0A 2AHRA 5DN6A 1PVDA 5F64A 4MWOA 4PN7A 2EW8A 1A71A 2JLAA 4DDHA 3KQNA 1D07A 4US0R 5JJLA 1JEYA 4HX5A 1KDTA 2Q9UA 4DA0A 1VJ1A 5DTQA 4YMVA 2XB8A 1XXHB 2O2SA 3UTDA 4YJHA 2IZ0A 1SVKA 1NXSA 3GT0A 1VL1A 4WASA 3OMLA 5B7QA 1E3WB 2BMFA 1V0JA 4UEKA 3VX4A 1WKVA 3H5LA 3WHKA 2HCRA 4NU6A 4AJ9A 1VYHA 2NU9A 3VR1A 4DDMA 5AOVA 2QVBA 1GXSB 4FMCF 2C2BA 2PXAA 3QYAA 3NBKA 3SXJA 3VH1A 1JB9A 3VTAA 5KDOA 5DWVA 5IF3A 4L4XA 1DAPA 2QVZX 4BVLA 4JLMA 2C3OA 5DIFA 1H85A 3M9WA 5JROA 2PGDA 4O4IA 3WLEA 3D54D 5EXTA 4C1NA 5KYVA 2DWOA 2P78A 2Q7XA 4DWWA 4YAOA 1E0SA 1QYIA 1PFYA 4M88A 4RK7A 3TUZC 1RI5A 4I3HA 2UZ0A 4YDRA 5F3WB 5DI3B 5EHZA 3NPAA 5I8WA 1QYCA 3LCCA 2QUZA 5EHIA 1LS1A 3GZNB 5L3SA 3BKXA 2AL7A 5KX5B 1NN5A 1X80A 2BGUA 4LJAA 1XROA 3MYYA 4HS4A 4R5MA 2VDLB 3V4PB 4JI1B 4TROA 1B43A 3IERA 3T4PA 2R3SA 4WJLA 1L4GA 2V3VA 3VDXA 1SHJA 3JQ9C 1G3MA 4OLJA 4KVAA 4BPRA 1LK7A 2GJ8A 3PR1A 4OJTA 1WW8A 3MINA 4PWYA 4D8TA 3H9CA 3G89A 4HAOA 1GTVA 3TLCA 4C04A 1FS5A 1FSGA 3PBKA 3ZLVA 2CE2X 4EMBA 2W48A 5D5HA 2O07A 1OBHA 4QT0A 3ZXXA 4GU5A 4JXXA 3H1EA 2XTZA 4AF6A 4R0MA 2LE0A 3GU3A 1FUKA 2C98A 2R1VA 1X7YB 1L9XA 3C6ZA 4DG8A 1BRMA 1CVLA 1KI1A 3ZQ6A 1Y34E 1JSLA 2XEDA 3AKCA 1D4FA 2BMWA 1Y4SA 3AUKA 3FLBA 5F5NA 1P1RA 2IZOA 1NC1A 3OESA 4Y30A 4EL0A 221PA 3DJFA 4TLMB 4D44A 2ADMA 4L6IA 4PO1A 3RS4A 1H1DA 1A7JA 3FPKA 1DJMA 3K0CA 1UMDB 2JFOA 2BM8A 2BFEB 4NCXA 3KLPX 3OECA 1D2GA 4BQEA 1FUEA 4N39A 3NBUA 4QM7A 4Y6SA 2PLWA 1DWPA 4H17A 2CVOA 2A67A 4QBTA 1JG4A 4JQCA 3L8CA 5DCLA 3TIVA 2ZTUA 3EIEA 3TPCA 1JG2A 2C3YA 4IYJA 1LU9A 4AJPA 4KV9A 4J1TC 4WOPA 4JEUA 3FSRA 1H4QA 4P3NA 5DFAA 3WKBA 2F1HA 5FL3A 4QT4A 4GT1A 3SJCA 1SK8A 4P4TA 4EPXA 1MKYA 3HI4A 4QQNA 3RYIB 1R37A 4BLRA 3ZJ4A 2YH2A 3F5MA 4CLHA 5CA0F 2G1UA 4XI9A 4I50F 3ZD8A 3GJ0A 2GFQA 4Q3OA 2YV5A 1HKHA 4RVCA 5TJ9A 2FRDA 3OLXA 2VKQA 4IIJF 4JMLA 1NG1A 2ZU0C 4ZT5A 1ZISA 2ZJ1A 2GTHA 2GZ3A 3LH5A 5IX8A 1MO5A 1J7KA 1YS1X 1I8TA 3DAGA 1JYSA 3M6AA 4NYJR 1KTIA 2GUWA 3ROXA 1D09A 5HRUA 5A4AA 4YDQA 1FVXA 1R16A 3HHPA 1VLLA 1TOAA 2P11A 2VNAA 4DR4B 1E2MA 4IF4A 4NBLA 4IP0A 5BOVA 2D2FA 1V8DA 2FHPA 3PITA 3VAYA 1NUTA 5KOHB 1MJGA 3FBTA 1ECCA 1ZOLA 1ZUNB 4H1HA 5GONF 5T8KC 1XKXA 2WQ7A 4OQZA 2QX7A 2BEUB 4BX3A 3LT5A 3UGJA 1Z5PA 3RRYA 4MRSA 1ST2A 3AP2A 1FP4B 2Q3DA 4EB6A 4OF4A 1T3ZA 3R2JA 1M3SA 1JYEA 1H4SA 2FZVA 1Q92A 2KW5A 2CLHB 2PFKA 4IDGA 4LZOA 4TS3A 3AEYA 4K88A 5C51B 2PGLA 1OLXB 2Q6LA 1S2OA 4Q9HA 4KSCA 1DEOA 4KWIA 1WUTA 2V97A 1J0EA 1XNQB 5AVOA 1AK9A 2W2MA 3CRW1 5EJ5A 2ZBPA 2IY7A 3U4QA 3U7JA 3MTGA 4OYLA 3ANLA 5HBGA 2BUBA 2ZSEA 3MRSA 4RANA 3TCKA 4Z3OA 1WLYA 1PYOA 4F0JA 1ID1A 4RY2A 3FFAA 1TZMA 4GPIB 3MD9A 3MMZA 4W1SA 3BAFA 2YXBA 3BMNB 4NSNA 5SICE 1QHHB 1V9LA 3OIGA 3UAYA 4Z7JA 2W58A 2WU3A 5CDHA 5KNDH 4IMPA 3QPCA 1MPTA 1SCBA 4FEYA 4QXQA 5EWJB 4CYMA 1K97A 7MHTA 1TM2A 3I1YA 3DZJA 4FCTA 3VSEA 4YRGA 5EP1A 3SEZA 3KETA 1EDDA 5JJIA 3UN1A 1R9MA 4AU1A 3A6FA 3FMIA 3ZC3A 4QYIB 1UBSB 1MJGM 3TECE 4N0PA 4JJEA 3RI3A 3H6KA 3R5XA 3EEOA 3OAAA 4NV1A 3TKLA 5IM5A 5TQ2A 1EXMA 3MWDA 2CKMA 1UBRS 5FUYA 2C2GA 1I3MA 2COEA 3MTJA 3D1VA 2W90A 1Q74A 3JR7A 3I01M 3OQJA 4W5RA 5FHRA 2GA9A 4UNNA 3IPYA 4I14A 4RZHA 5A3VA 3ZVLA 1EP1B 2GHRA 2PUWA 2OXIA 2QG6A 5GZ1A 4UHDA 3NH9A 4KNYA 2IELA 3ZU6A 3WK7A 4HGNA 4TL9A 2PT5A 3OZDA 4M89A 1PR4A 2OOKA 4XGIA 3UBTA 1RU3A 1G6OA 2IYSA 3R5SA 4DUGA 1U0TA 3U7RA 1GA6A 4PAOA 4C5BA 4ZJPA 4CMIA 3GFRA 4PGHA 1Q57A 1H6BA 1VIDA 5GONA 3SFTA 4M7OA 4C21A 4EGCB 3H5NA 5L7TA 4D3FA 3WBBA 3P9PA 1U28A 4XIJA 2BEWB 1E79A 2AN9A 2KBFA 1EX9A 4FW9A 1X1AA 2PL3A 3MSCA 4FEEA 1NVBA 3DMNA 4E07A 4W8HA 4R51A 4YBZA 2IBSA 3QUQA 2OQ2A 4FQ8A 1YSCA 3UK7A 4D6XA 5JD6A 1U3WA 3DOFA 2A9VA 4XIIA 3LIIA 4JAVC 3WWCA 1I0ZA 4BV2A 2PH7A 4FI3F 2K7FA 1A77A 2Z83A 2GBIA 5E4FA 1ZI6A 4ZEMA 5JWRA 2BGTA 3N7UA 4QPPA 2YMQA 4S1TA 4UNPA 3FTFA 1XL0A 5A1JA 2IV3A 5IXYA 3PX3A 5K8IA 5F1PA 4OO3A 4MDYA 1KTVA 3G9TA 1X1CA 4A16A 3SZMA 1MIHA 2BR4A 2YZMA 2AK2A 2GAOA 4P0TA 3MW8A 4JXJA 1JPJA 4ZDIA 1Y63A 1C7EA 1Q1GA 3TYXA 4DRZA 4KH1A 2JCXA 2P1DA 3I2KA 3NYRA 4NCKA 2WSSA 2F3QA 4RY0A 3VC2A 3E27A 4BJHB 2E9SA 2Q0QA 2I9KA 4UEOA 3ZTYA 2ZIVB 5KOYA 4Y2VA 3DDHA 1A0OA 3L92A 1FRQA 1CQZA 1XJ5A 4GKAA 2X2PA 2GN4A 3UJDA 3VU3A 3QKRA 3PZBA 3UIEA 2QK4A 3BEDA 1QOZA 1XD8A 4R9SA 4QTZA 1YBFA 2X7JA 3Q7TA 1KEEA 4YCCA 3CWQA 3DQQA 2EFEB 2QMQA 4ZK6A 1JF8A 4K9OA 1MVLA 1U7PA 1TKRA 1JTEA 1PT9A 2UVQA 1LK5A 3QWHA 1J09A 1NVVR 1J42A 3PPIA 4XTRA 1UPXA 2WZQA 4XE5A 2VHTA 4BMVA 5BWBA 1AXEA 2HRRA 2RGNC 2YN4A 2ZJ7A 3A8TA 3EGIA 1ZQ1A 3CX6A 1ADCA 1JHYA 3HGMA 4XB1A 2GESA 1I7SB 4Z4IA 1LJ8A 5REQA 3C5VA 1SG6A 3D0QA 3RO7A 1TT5B 4LBVA 3WYCA 1O95A 1Y7HA 1JIIA 4X8MA 4YQEA 4DDWA 5K0TA 3KHUA 2HYIC 4KNWA 3HEMA 4J91A 3FFXA 3DXZA 2GPNA 3K5WA 3R0VA 3EG9B 3UUFA 5HOQA 1KYVA 4K9KA 4NBKA 5ITSA 4QXOA 1QRRA 2Q1WA 2GJ9A 4DDKA 4HQRA 3PD1A 1IUNA 2XMZA 4XWAA 1XOIA 1L1QA 4DCSA 2WEKA 5IJXA 4EYEA 5JARA 1U0FA 4N03A 5TJHA 3FFTA 3THOA 2OLJA 4AO7A 1J0BA 1T5BA 5CFPA 4Q6WA 1E89A 2PRYA 3M70A 1RQLA 4NJMB 1L5VA 3VSAA 1YB7A 3G2HA 4MR8B 3T1TA 3MB8A 1C2YA 1A8UA 3QKIA 2I55A 5CYOA 3RSCA 3RARA 2HBRA 4LCJA 4XJSA 2C07A 5EWLB 3TFOA 3MT7A 3TLGA 5CFQA 4PO9A 2YYAA 3NNNA 4B9EA 3TLJA 3PIIA 4BBPA 2CHEA 4C4XA 1O5IA 2J3IA 1EWTA 5JO9A 4GKVA 4CI0B 1VPDA 4IRUB 5L51A 2QU8A 2PRKA 2X4DA 2FSUA 3HY4A 4KRYA 1MO3A 3PHBE 2BKUA 3WKDA 4C0LA 2XWJI 4GGMX 1E2GA 2LXNA 2GCPA 2I2BA 3QW4B 4F85A 5BN3B 3ZV5A 3QY9A 4JX9A 4EOGA 2G63A 1L1RA 1XYVA 2G40A 2Q3HA 3M7IA 4LXYA 2BUCA 1MOPA 1E3LA 1Y5MA 3TG8A 1V7ZA 2BCEA 3O8RA 2HRCA 4TYWA 1G20E 1WP4A 2A35A 2RK4A 5ECYA 2LCQA 5JY1A 3ZJVA 5HA5A 3EPLA 2V7QA 3KQMA 3RAFC 1W5FA 2XLCA 3A36A 2NXNA 5KTOA 1QK4A 2VRBA 2GUGA 1RQ2A 2G08A 2RI0A 3ITKA 4GM4A 4C7VA 1N57A 5I7RA 2V3CC 2SICE 1PVVA 4UHKA 5AIAA 3V2UA 4Q4JB 2ZSIA 4LVNA 3NG1A 5L6MB 3NTUA 3CZQA 4LQCA 2RHCA 2R86A 4I55A 1UBGA 4NULA 3SX0A 5KNBH 2VZEA 1NNEA 1DBPA 3H2GA 1GPMA 3OZFA 4IXMA 4V0LA 4LMPA 1X38A 2ASVA 4AZWA 2ZBUA 1H2ZA 1KFKB 3DZFA 4WNAB 4PZ0A 3JY6A 3PK0A 2RGRA 4HXEB 2ZWVA 4KKXB 4G9EA 4OHCA 1G7SA 5FF9A 1ZNZA 1TZCA 2R00C 3ICPA 4RH1A 5AJUA 2XMRA 5DTEA 1CFJA 1SQ6A 5C7LO 1ISGA 3A1EA 3G68A 2A9JA 2P4HX 1JXOA 3UY4A 5KHOC 3TQIA 3V97A 1YA6A 2JH9A 2VJLA 2X3UA 3KLMX 3QK7A 4BVAA 4JDPA 4C0JA 3G7SA 4MRVA 3QE9Y 3FTPA 3OZRA 3SX4A 1X8XA 1PG2A 3LCUA 3UMCA 3RNLA 3QMWA 2YFYA 1Z16A 2Y1XA 3V80A 1C9DB 2FB9A 2ZBQA 3LD9A 3IMEA 3L7AA 3NJ4A 3MTIA 4X85A 4AZ0B 3A3PA 3RFVA 5KYWA 1HF3A 3OZEA 5HG0A 4KGDA 4O2AA 3R0IA 2GN9A 5K8TA 2OHVA 2QLTA 5J2UF 3KAJA 4X45A 5KWVA 1A8QA 2NXEA 4BTVA 1Z35A 4ARIA 3IV9A 4RF2A 5DHSA 1CHNA 1NOKA 1XZBA 2ZRAA 4FFSA 5G0WA 1VM6A 3O92A 1LBEA 3D6JA 3FNFA 1N7JA 2RGDA 1J2JA 3AEUA 3NTRA 3FR8A 3EVCA 1EP2B 2QTMA 1A04A 4LK3A 2PR2A 3VVCA 3FM9A 1ELOA 1XWWA 1CJUC 5L3QB 2X3FA 2FFAA 1UJ6A 4LXTA 2ZCJA 1QO9A 2XDQA 3LX5A 1WSBA 4L5YA 3PXXA 3Q8MA 2DUUA 4BFZA 1G16A 3P5BA 4U4AA 4AXXA 4BX8A 1KRWA 1IVYA 2R6DA 2WJVA 2FWRA 3JQEA 4TWZA 1QHFA 5FB3A 1L4KA 2XKAA 2HNBA 3M1IA 4Q7LA 1E6UA 4UPEA 2DWCA 1ZBQA 2RHBA 3IV7A 1Y7LA 4XPZA 5AVSA 2VYCA 4QICA 3UB4A 2FPUA 2WYIA 2YASA 1AUXA 4XQ0A 5JYCA 1D2NA 5LKAA 2UZ1B 2PK3A 2Q0HA 4ZOQI 3T9CA 5J5AA 2FOLA 4D4GA 2JW5A 4Q4AA 2Y9ZA 2X4LA 3QNMA 4RHUA 4B81A 3H2HA 4X8LA 3PEYA 3OLZA 4HGPA 4ZCMA 5A4MS 3BXFA 1EUYA 3WNDA 4RY9A 2C4NA 1G8GA 4LYDA 2WP8J 1RWVA 2JRLA 4GPD1 3QGMA 3HRHA 3RTGA 1D0IA 1G8AA 3V1LA 3TZLA 1U7XA 2VTDA 1I1NA 2OFXA 4LOKA 3MOIA 4IIXA 4KQCA 4ZVMA 1XRLA 3RC8A 1XL1A 3AKDA 1R15A 4FILA 2O8EB 4KPGA 3TDKA 2NQ2C 4BV8A 2G5TA 2HU2A 1G7TA 1EVEA 2NTJA 3Q2IA 5LKRA 4KQHA 2VNIA 1LBTA 4B7UA 3LGSA 5ANRB 3UUGA 2PUTA 4FEAA 3HMQA 2BDTA 3OCUA 3P7MA 4BFVA 1ISFA 4AUKA 3FOWA 4UMEA 3UXEA 4B3IA 1W76A 1RD4A 1KDOA 2ZSKA 4BB0A 3EEBA 1Z2CA 1N9GB 4EY8A 1RPZA 4JVSB 4ZVPA 5K0GA 2QY9A 4FFPA 2Q9CA 2VUTA 2XGJA 3ISVA 1NI4A 4E12A 2ZYVX 4J1QA 1I2CA 2Y1KA 5KWIA 3I5YA 1OX4A 1A4RA 3CLTD 3F7MA 4JUCA 4HB4A 5K0ZA 2UU9B 1X7XA 1GCIA 5BR4A 4PYQA 3UC9A 4TKVB 1NDQA 2BHLA 1Y5LA 1HG1A 2YJNA 3GUYA 4ERNA 1A7UA 3GWZA 3LK7A 4GL2A 4BPBA 2DF8A 4Z7NB 3OJEA 2TMKA 3DDOA 4KIWA 2YUTA 1QHXA 1FW8A 3HCPA 3I9V1 4GYJA 4XOIA 4Y18A 5DK6A 1XJWA 2FFBA 4DT1A 1C3LA 2G80A 3LT1A 1DOHA 4GG1A 3QEBZ 2I87A 2EWMA 2XODA 3K70D 2VCHA 1HNXB 1DKRA 4G26A 4J0JA 3ZZUA 5ITWA 5SV2A 1U99A 3M4YA 2PX5A 3RSQA 2PBFA 3LX6A 4HH0A 3A25A 1EZ1A 1J8FA 1KVQA 1WMEA 5JNVA 3FYDA 3NHYA 3LIPA 2ODTX 1UFQA 2O8NA 2OBMA 3MGGA 2I6SA 2ZCVA 3VDQA 5BSWA 4LMBA 2V7BA 2QJTA 1CETA 3VYSB 2I4IA 3NP7A 1EWYA 5DVZA 2ZZNA 1WM1A 4G4SO 3OHSX 4KEAA 4KODA 4KPYA 3DTVD 3THWA 3V7UA 1K5HA 1N2BA 1NJ6A 3N2KA 2BLLA 1NM5A 3O7MA 4BNNA 5HIMA 4H4CA 1QAMA 1M1UA 4AMVA 1TQ2A 2DQSA 1UOEA 4E6PA 1DBIA 3S2UA 2DX7A 2ANBA 1H0SA 1VIAA 1DDIA 1YOVB 2FPGB 1Y7PA 2YHIB 3AI3A 2JAXA 3CIFA 3MNFA 4KQ6A 3W6ZA 3AEKB 1FTNA 4ZAYA 4LE0A 1ZICA 1FFWA 5P21A 2BZ0A 4HWTA 5ALJA 3WOHA 4D9CA 1SPXA 3G1TA 4XAQA 2BSXA 3NKLA 3SR4A 1XMJA 3HJNA 1RWPA 5AW3A 5EI5A 3T3DA 2Q46A 1L8QA 2EKQA 3KKKA 3UKJA 5CXUA 1C8KA 1Y1SA 1NUHA 4C4RA 1C3JA 3GO4A 3P9NA 1QQ7A 4GX2A 4DBVO 1ACMA 4EW6A 2VXCA 1FDRA 1Y1QA 3T5CA 3LQ1A 1RQXA 4GYKA 5FFNA 4D2IA 2NYVA 1GYPA 3VZRA 4UHJA 1LNQA 1NQOA 2GWRA 2PKQO 3NHKA 4MB0A 4R3NA 4WBSA 4WFKA 4ZVUA 3S7ZA 4CM8A 5KDDA 2J3QA 2AUNA 1Z2AA 2MYTA 5H9WA 2QYSA 4L15A 4P93A 4BMPB 1JDVA 1VJTA 5JZVA 3FUVA 5DHUA 4OMFG 2XQGA 3TOXA 2F3PA 2JFNA 3LG2A 3RVJA 3GV0A 4XIGS 1R00A 4DQVA 5BXQC 3BCRA 1Q83A 5EZYF 1P1JA 1J25A 3DH0A 3HA2A 5FOWA 4KDFA 1YR1A 2BTQA 4IEEA 1YK1A 3FCYA 2WJ6A 3K05A 2RHWA 5KC8A 4YFYA 1JQBA 3DVSX 5KC9A 3NMUF 3LXMA 4MICA 1TIBA 4D8WA 3AP3A 1K88A 4QKQA 2D1YA 2O54A 3IUBA 1GTZA 2OD9A 3H5RA 3S99A 4DIMA 2BVNA 3VX3A 3WRVA 1OA1A 3OOSA 4XVQA 1IHYA 3LVFO 3BTOA 1JRLA 4NYIR 3RBVA 4B3XA 4DMGA 3CPJB 5J4LA 3WL4A 4G25A 2P9JA 4OX9B 1CQWA 2B6HA 5BSFA 1GPYA 1LI7A 3PGLA 4L8FA 1XN1A 1CJVC 1L5MA 4XX0A 1XZKA 4KQ2A 5FT9A 3WRYC 4H9GA 1O9GA 6NULA 4F84A 1U5BB 2R48A 2JCYA 4ARZB 3VR5D 3P2YA 3S2GA 4IZIA 1T36B 2J9YB 4R8MA 5JD4A 5EIBD 4TL7A 4JENA 1PWZA 4LRQA 1BS9A 3NGMA 4BJ3A 2UUPA 4HUQA 3UW3A 1CIPA 1YDWA 1KJYA 5TGZA 3O90A 3SSOA 2EBUA 4I4CA 2Z6QA 1W6RA 4BEVA 1SUAA 3VR4D 2AA3A 2C78A 4X93A 1BVHA 1UPCA 5H7XA 4J3NA 3TTTA 4E2XA 1E2IA 4IIYA 3OWHA 1I7PA 3NHAA 1NIJA 4X60A 2R8PA 4D02A 3WK6A 3FTCA 5C3UA 3KJFA 1DDOA 2IYPA 5CDYA 4BV9A 4MW5A 3KU4A 3OQOA 4QUAA 4EDFA 4NYMR 1P44A 4D9MA 2R6GA 5EXSA 1Z6YA 3OZWA 4XD2A 5FI3A 4J6FA 5DLDA 2O5EA 2KB0A 4RJLA 1ZN9A 4WNIA 5K8JB 4GLOA 4B79A 1DTEA 4CFSA 3G8CA 2ADOA 4X97A 5L95A 2II6A 5DLPA 4LCEA 2QZSA 2ZUCA 4C4OA 4EW2A 2V5AA 3R0QA 4EHFA 5J2TA 4L08A 2VP2A 1CUDA 2M6RA 2Q41A 3TO5A 3N0RA 1FVHA 1W0CA 4U63A 1TGYA 2ZIFA 5DMXA 1PNRA 3HFRA 4CV2A 4AULA 1CLEA 2YJ3A 3WGNA 3KPVA 4I3FA 4ROSA 5IKPA 2CXOA 2F4VB 4XWYA 2QE6A 5AYVA 2Q4DA 4HAXA 2FG6C 1RWKA 2FQWA 5ARCA 1Z13A 4MMXB 3T38A 2NSJA 2B0JA 1LZLA 1SU4A 2B5OA 5T67A 1PJSA 4XVUA 5JTTA 4C2UA 4X62B 4KR2A 2QWXA 2EFHB 2G9ZA 4L5BA 3H9EO 5CITA 2JLCA 4IEFB 1SIBE 1XEWY 4DBZA 1XR3A 4HNSA 4TYNA 4GPTA 3EFHA 3QVTA 4KGV