2GF2A

Crystal structure of human hydroxyisobutyrate dehydrogenase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
296
structure length
296
Chain Sequence
MPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human hydroxyisobutyrate dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
total genus 111
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2gf2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gf2A01
3WYEA 1BRMA 3HB5X 1YVEI 2D2IA 2D1YA 3DMTC 4Q3CA 2BD0A 3NDJA 1N1EA 5FF9A 1E1MA 3QWBA 2EW8A 4MVJH 1DEHA 1RPNA 3PGXA 3SLKA 1VE9A 4BL5A 5T67A 4XQ9A 1N8KA 3ZNPA 5CHEA 4LMPA 1LI4A 1EDZA 3ROPA 3GH3A 1AHHA 3C1AA 3ZHYA 5I9LA 3NTRA 2PD6A 4NHEA 3UXYA 4EUEA 1M66A 1EUZA 5HS4A 3GVPA 4CMCA 4QX6A 4AJHA 5EN4A 3WNVA 5IZ4A 4I5EA 3ZHBA 3JYPA 3PRJA 3DAGA 1IUKA 3JQAA 1OFGA 1LDNA 3QJ5A 2UAGA 2ZCVA 1DIGA 3DTYA 3KB6A 2Z95A 4ZU3A 8ADHA 1GV1A 1GQYA 4Q3BA 4A27A 1A72A 1R0LA 4OOFA 2G82A 2VZ8A 4NU6A 4QXMA 1XR3A 1DJNA 5TSDA 4CMIB 3S55A 4ESOA 5BSFA 1JKIA 3PFFA 4JCOA 4I9UA 3VHRA 4E2XA 4IJVA 3I9LA 4WLUA 5L7TA 3KETA 3FPLA 3RUHA 3F3SA 3LLVA 4YJGA 5EL0A 3U3XA 1ULUA 4KTVE 1NFRA 3WGQA 5T57A 2I76A 1UUFA 3DHYA 3OP4A 5B1YA 1YBMA 1PJ2A 4NBWA 1LSUA 3M1LA 1ZSVA 3N7UA 3QIVA 1NYTA 4HUJA 1J4AA 3K73O 1O9BA 2ZCUA 5I9MA 4EDFA 5A03A 1CIVA 1QXSA 3OQ6A 4U7WA 3PQDA 1P1FA 4I9HA 2JFFA 2WYVA 4NBRA 3KUXA 2F00A 3E5MA 3I9NA 5KWEA 4NDNE 1C1XB 1ZXBA 4LISA 5A06A 5A4DA 3S2EA 3HDJA 4FDAA 3C24A 4MINA 1U2DA 4C7KA 4CM5A 1XG5A 4F6LA 1ZZEA 2YYYA 4B8WA 3CMMA 1KVQA 3KZVA 5KJEA 1I36A 2I66A 2OP1A 3LT1A 3OA2A 4BV8A 4DLAA 4YJHA 4AICA 2H9IA 4NIMA 4IIUA 3STHA 1T2DA 3SVTA 1GD1O 1BXGA 4PIVA 1DC6A 4RPKA 5I8WA 3Q6IA 1GFSA 3ZWNA 3ZWAA 4FJ0A 3S2IA 3NX4A 1DIAA 1I5RA 3H5NA 2BFOA 4HBGA 3ETGA 4JK3A 3CINA 2DQ4A 3D3WB 3W4JA 3QWHA 3W6ZA 4NJOA 5A3JA 3LU1A 1C3VA 1LC0A 1Y9EA 2C7GA 3GMDA 3DAPA 2G0TA 1K5HA 1SOWA 4H3VA 4PFJA 5JDCC 3K9QO 4XYEA 5C7IO 3A1NA 1DJQA 3RBXA 3ASUA 4MP6A 1YL6A 1GZ4A 1E0DA 2A35A 3EDMA 3NTOA 3TZCA 3MCVA 4DPKA 4IPTA 4FR5A 5THKA 5U4QA 4R68A 4ALKA 1FXSA 2EXXA 2QYTA 2EJVA 2BI8A 4CR8A 1R0SA 3FI9A 2DVMA 3RSHA 4BO5A 2BH9A 3A9WA 1YO6A 1LDYA 3OEWA 3GPIA 3ZU5A 3ONFA 2D4AA 1LXCA 3WFIA 2JKVA 2DTDA 3DEYX 3U9LA 4IDCA 1Y8QB 1NTOA 1PJLA 2JFHA 2X5OA 1DHRA 3VOSA 2J3JA 4BO7A 5L53A 4WLEA 2VNSA 2XOXA 4J90A 4JBIA 3Q9NA 4BO9A 3KYDA 4E0BA 1NAIA 2Q2QA 2A4KA 1DAOA 1CJCA 2FP4A 3MTJA 1H6CA 5JAIA 1HZJA 4BNJA 3JYNA 3CXRA 5L51A 3GHHA 3OJ0A 3U4HA 4WLOA 3WGZA 4ALLA 4CM4B 1ZUD1 3VH4A 3KYBA 4I9NA 2GZ2A 1YE3A 4R54A 1U5AA 1BW9B 5CDUA 2NU8A 4BNGA 2IXBA 5A04A 1XU9A 4J43A 4KUEA 1ZJYA 3MWEB 1GL3A 2I6TA 3PEFA 1YB4A 1LLUA 1PZGA 1YQDA 2X0JA 5THQA 3ZCXA 4PG4A 3HADA 4HFRA 3IIEA 3RROA 5ER6A 5L4NA 1UZLA 2JAHA 2VRCD 3I23A 3R3SA 1FF9A 3G1TA 1PWZA 3A4VA 3RI3A 3RVDA 5CFZA 2Y0EA 4XJSA 1VSVA 1X15A 5KJFA 3PGJA 1QYWA 1R4NA 4YA6A 4J9UE 2YFHA 1DIHA 2PKQO 1UXJA 3C7AA 1F17A 4RF2A 3PHIA 5FFFA 5IXSA 4ONEA 4XR9A 2IODA 1MG5A 3FWZA 4RPJA 1Y9AA 5F5NA 4BNVA 1C0KA 1IULA 4EW6A 1ISFA 3OSUA 3PHGA 4U6QA 3ZV6A 1NX6A 1Y8RA 4PLVA 3RJ9A 3KRTA 5DF1A 4I5DA 3CH6A 1I3NA 2HUNA 4YT4A 3VTZA 1P3DA 4L73A 2H1SA 1WMAA 5A9SB 3D5QA 4TWRA 1A9YA 3ANLA 3LC7O 4FFNA 1TVEA 3TL3A 1PSDA 4UUPA 1ULSA 1QV6A 2PLAA 3IP1A 1PIWA 2HJSA 3F4LA 4CMBA 2R6JA 1HZZA 4DBVO 1PEDA 5JY6A 1QYCA 1PR3A 1M2WA 3L6DA 4R9SA 4OQZA 4ZGWA 4QTZA 3V1UA 5TIIA 1PS8A 4DVJA 1R4NB 4FCCA 4PVDA 1JWBB 2HLPA 2JD0A 2DLDA 3EW7A 1F0YA 4XYGA 4MDHA 2ZYAA 2Q3EA 4ND3A 4MP8A 4TKLA 1G6KA 1MG0A 2I5PO 4BNHA 5BSHA 1TXGA 4UEJA 3RC7A 3LC1O 1X0VA 2PNFA 4B4WA 1ZW1A 3IP3A 3O03A 4ALNA 3AU9A 4E5MA 1P33A 1PR9A 2I3GA 3INRA 2PA3A 3FR8A 1VLLA 2Q1UA 1ORRA 5CG1A 3PZRA 1T1SA 4Y6RA 2PGDA 4A0SA 3D7LA 4XDZA 1R16A 4ZA2A 3ANNA 1M75A 2DKNA 4E31A 3OMLA 3F47A 2CUKA 4ZICA 5JYDA 3BZUA 1BWSA 1P1KA 3L4BC 4AJ1A 4E6PA 4HNHA 3ROMA 4PG7A 4YWJA 3JTMA 4RF5A 1NXQA 1E7RA 1PX0A 1QLHA 1O0SA 4IY1A 1DC4A 4L0QA 4DC1A 1YH3A 1I3LA 1B14A 1P74A 4D41A 3AU8A 3M1AA 1NAHA 1P31A 4WECA 2JHFA 3GNQA 5AYVA 3M2TA 3EK2A 3JQ9A 3EGOA 5TT1A 1DFHA 4WCFA 3V8BA 5CPFA 5IDYA 4MPDA 3UFXA 4YTEA 4FBGA 1O94A 3VPFA 4AFNA 2PZKA 3T7CA 3D0OA 1ONOA 3AUTA 4RF3A 3L4SO 4O0LA 2IEDA 5CG2A 1F8GA 3I6QA 2Y1GA 3VH3A 3TZHA 4LRSB 1TEHA 4PN3A 2C59A 3L0DA 3WGHA 3JQ8A 5T5QA 3DO5A 4PG6A 2CF6A 5U1PA 1JA9A 4IINA 4N5NA 3LLSA 3ST7A 1NNUA 5G4LA 3H5RA 3JQBA 4U8GA 5JS6A 4EJ6A 3AY6A 3V2UA 4CLXA 5CAEA 4NFSA 1ISMA 5IN5A 3L6EA 1GCUA 1A71A 1CERA 2HKIA 3ROQA 5CEEA 5KOIA 4UVHA 2H5LA 4MOWA 3FD8A 7MDHA 9LDBA 1UDCA 5COBA 3FWNA 4J16A 1HDYA 2YDYA 1DSSG 2WWRA 3FPCA 2HO5A 3LC2O 3KSZO 3WBFA 5B4VA 2W8ZA 1T2FA 2O7QA 3E18A 3RC9A 2QIOA 5TRTA 2OP0A 1U7HA 3KM0A 3ABIA 2VTDA 1P1IA 2HMUA 3QV1A 5TC4A 4NZ9A 4M1QA 4DGSA 1K0UA 2NQ8A 3GFGA 3NT2A 1JVBA 4H16A 5K9ZA 1HRDA 3OIFA 2PKQP 3O38A 1N92A 4GWKA 4N7RA 3SXPA 1U8XX 1FMCA 4DA9A 3LK7A 5TX7A 4K6FA 2AG8A 3KSDO 2A92A 3PDJA 4U5QA 2IXAA 5COQA 5JAMA 4XQCA 3WWYA 5GZ1A 2AE1A 3GMSA 2J3IA 5JBIA 3M6IA 3L9XA 6LDHA 3DBLA 1EVJA 4L74A 4QQRA 3GN2A 2QRKA 3RAJA 5KCZA 4BNMA 4E5PA 3IJRA 1U8FO 2J3KA 3CE6A 4YT2A 1D3AA 5F21A 4JJFA 4YYZA 1GDHA 1PTJA 3RFTA 2IRWA 4BKOA 1KBZA 3PWZA 4RQUA 5IFLA 1HETA 1R6DA 3NEPX 1WW8A 1FDUA 1KVSA 1QORA 5I9NA 4J7UA 3PJGA 1JQBA 5C37A 4DPLA 5DCWA 3VZPA 2AEMA 1LQTA 4PLHA 4JJIA 2VT3A 1YL5A 2LDBA 3Q2IA 5JSFA 5HBRA 2X6TA 1R4MA 3ON5A 2XF8A 2VZ9A 4OGWA 3GOHA 3DBHA 1GY8A 4CM7A 2PR2A 2X9GA 4UEKA 4J1QA 4IXTA 3QLJA 2PGLA 5ITVA 5JC8A 1PU2A 2OL4A 2YV1A 3U62A 4OYRA 4CMEA 4BMVA 4XEHA 4BNUA 1IY8A 1P1HA 2CZCA 1DLIA 3FNFA 3ZNNA 3GZ4A 2CVZA 4R4JA 3WLEA 4IQ8A 4ZQBA 4YAGA 1N7HA 1QMGA 2HCTA 4GPD1 2J3HA 1JDJA 3Q3CA 2PTGA 1X7HA 3JQGA 4XR4A 3NTQA 4Z9FA 4QECA 1EK6A 4YBZA 1SB8A 4J7XA 1VC2A 5TGDA 5CDYA 3E82A 1P9LA 4CR7A 1H9BA 3OICA 3P7MA 4XYLA 3GGPA 1JWAB 4XB2A 1B8PA 2VUUA 3FF4A 4ITUA 5G4KB 4OKIA 2GN6A 3EUWA 2R2GA 4PZDA 3ASVA 1ZSNA 4Y6SA 5IF3A 5TJHA 1SB9A 4IJUA 4D7AA 3PIIA 2BFMA 2CNBA 3HJAA 3IS3A 1O89A 1T2CA 4XDYA 1ZFNA 5DBFA 3PLNA 4YT8A 3U09A 4NK5A 2DPHA 2I3AA 2POQX 4BOYA 2Y1EA 3EZLA 3NUGA 4R51A 1W6UA 5IAAA 2P4HX 1YOVA 4OXYA 4RO0A 4A03A 2PD3A 4WLFA 2WD7B 1R12A 1XKQA 5ENVA 1UP4A 2YQ4A 2YQ5A 1EQ2A 3I4FA 2TMDA 2GERA 2NLOA 4JLWA 5EQDA 4YR9A 5KVSA 2A94A 3GG2A 4P4LA 2B5WA 1E5QA 3F1KA 3OQ1A 5IZCA 1YRLA 3HDHA 2Q99A 3PJDA 3VH2A 2I99A 2P68A 1XU7A 5F1KA 1OAAA 4YQZA 3C7DB 3E03A 3HFSA 4CM9A 4R69A 1JKJA 1GEGA 1PJSA 3DFUA 3LYLA 4B3IA 4E13A 2Q4EA 1UDBA 1DIBA 2X9NA 3JD0A 4XJTA 1EK5A 1NVTA 3GAFA 5C7LO 2D5AA 3ZV5A 2O3TA 1NVGA 4PLFA 3AK4A 2EJWA 4LCJA 1R15A 1M6WA 5LCXA 3GEDA 1B7GO 3BXXA 1T24A 3EC7A 5DDIP 4YAEA 3RU7A 3H2SA 3H5AA 1LTHR 3H9UA 5FWNA 2Q1TA 4H7PA 2PZMA 5JYEA 3Q1LA 1K6XA 1RWBA 3I52A 5L4SA 3QWFA 1F14A 3Q9UA 1PGNA 2QW8A 1LUAA 2FR0A 1ISGA 1MFZA 1Z7EA 3KLMX 1PZFA 4Y8VA 1RYDA 2G17A 3I83A 2EERA 2J5KA 3BMCB 5KVCA 5ENDA 5L95A 1DXYA 4ALJA 2XXBA 1YDWA 3AOGA 4GLLA 5BNFA 2EW2A 1T1RA 3P19A 2NVWA 1BG6A 2ET6A 2HSDA 1EVZA 3RUEA 3AY7A 1U2GA 1M67A 3W4IA 4BGEA 3DZJA 3KYCA 4WE3A 2NSDA 3A14A 4AJOA 4E5YA 2DBRA 2C0CA 1NPYA 4QO7A 4RLSA 4Y98A 3IQDB 1GCOA 4UVIA 2JJYA 4UUMA 4ZHSA 2QZZA 3BHJA 1U7TA 4EZBA 3N74A 1SO8A 1C0LA 3OJOA 3UVEA 3KYDB 2NNLD 2P9GA 5KKAA 2P9EA 2AXQA 5CPBA 5CP8A 1HE3A 2J5RA 3W8DA 4B7XA 2O23A 3WTCA 4XZ3A 3SC4A 3RD5A 3ZHZA 1IHYA 3HWRA 2P91A 2CDAA 2WTBA 2BHLA 1UDAA 3PWSA 2VN8A 5BNIA 3RUAA 4F46A 4W7IA 2JCYA 3QA9A 5F3RA 3KXDA 5KVVA 1B0AA 1U1IA 3GZNB 1HTBA 3PK0A 4G81A 1PJCA 2WEKA 2DFVA 4M54A 3GG9A 5JDIA 1Q7CA 3O8QA 5IN4A 2PZJA 4NBTA 5B4UA 4ROSA 3OBBA 4R5MA 2QZ9A 1PQPA 4PZEA 5LDGA 2AG5A 4IM7A 4CQMA 1ENZA 1GPJA 1DRUA 3SBOA 1QR6A 5I8ZA 1BSVA 1AXGA 1H2HA 4L4RA 4CUJA 1KYQA 3DTTA 5HRUA 2OMEA 1LX6A 2FPPA 3F5QA 4BKQA 2FZWA 3B1KA 3OETA 1BDBA 1LA2A 1VM6A 2VWQA 5EIOA 4AVYA 4EBFA 1OI7A 4JJGA 2GGSA 2QYSA 4B3JA 2RHCA 1L7DA 4J49A 4JP3A 4MVJA 1Q0HA 5TS3A 2Y05A 4B7CA 1MLDA 2BGLA 2ZTUA 3IKTA 1MC4A 4R1TA 3QRWA 5DBIA 2FRDA 2WD7A 2NU6A 3RBZA 4XGKA 1E77A 2X9VA 2V6GA 5KJ1A 3GK3A 1W0CA 2YHIB 1ENPA 3FNGA 4CV0A 3GUYA 1Q7GA 1LNQA 3ZV3A 1JN0A 3BAZA 3R1IA 1I33A 4Z3KA 1R66A 2ZB8A 1LEHA 3AUUA 4ZN6A 1DRWA 3RFVA 3CMCO 1X1TA 3E1KA 3V1TC 1KY5A 4U0JA 1CETA 1O8CA 4FN4A 3WYCA 1C1XA 2I9PA 4CLOA 3DXFA 4UVGA 3JD1A 3WYBA 4RDIA 3WWZA 5EJ2A 2BRUA 1GUZA 2W2KA 4Y67A 4DL9A 1D1TA 2NTNA 1JU9A 3FNHA 3PIDA 3B20A 2QRJA 4BO6A 5IG2A 2A9FA 1DBVO 1V3TA 1HKUA 1VL0A 1I0ZA 1YB1A 1P44A 5G0VA 5G0UA 1KY4A 1BTOA 2ZQYA 5ITWA 1I32A 4NU5A 2PH3A 3SLGA 4IGFA 4JBHA 1ADFA 2SCUA 4E32A 1E7WA 2OZPA 1K3TA 4AL4A 1GQQA 1MP0A 4IQ0A 1VSUA 3EY4A 2AMFA 3AUAA 3JCZA 3D3EA 1TT5A 3C1TA 1N7GA 4PCVA 3WJ7A 1Q1NA 1Y1PA 1Z6ZA 4NBVA 1LDMA 4UVEA 1J0XO 4E21A 4W4TA 4A2CA 3OECA 1EFKA 1IYZA 1PL8A 1E92A 3DZBA 2VUTA 2V6BA 1KERA 1H6AA 3ZNQA 3QHAA 3GN1A 3RQSA 3JD2A 4W6ZA 5EPOA 1I2BA 2O48X 3EVNA 5TT0A 2Y1FA 4UULA 4CMJA 4KP7A 1H9AA 1UAYA 2JCXA 2FY8A 1NFFA 2UV8A 4DRYA 2GR9A 4D3SA 3Q2KA 4W9NA 1ZO8A 4J91A 1LJ8A 4R1NA 1D1SA 1QKIA 2C20A 1T25A 2O4CA 4WNIA 1EBUA 1GU7A 4GX2A 4IUYA 2ZTVA 3QVXA 3DZFA 1EUCA 4JP2A 4RZHA 2Y93A 5JXWA 2Z1NA 4TMFA 1PS0A 2W90A 4D43A 2C2YA 3S2GA 2FHSA 3GQVA 1L7EA 1JAXA 3LSYA 4I5FA 4FPXA 3K31A 3U49A 1OC2A 4XKJA 1LU9A 2NVBA 5EMHA 4RVSA 4BMSA 1G0NA 1KEUA 2Q50A 3FSRA 4FW8A 4LGVA 5AXCA 4URFA 2AE2A 1U4OA 1LDEA 3WMXA 4GMFA 2X0NA 1ISIA 1HDRA 2OFPA 1YDEA 5JFOA 5JE8A 1KOLA 5TJ9A 4ND5A 1GUYA 2EP5A 1U9JA 2O3UA 4ND2A 4YB8A 4BS9A 4AJNA 4HV4A 1HDCA 4FOSA 1XELA 1W73A 5B12A 3PLRA 1E1LA 1V0JA 1WNTA 3KEOA 4BKRA 2YW9A 4FFLA 4W9NC 2HK8A 8LDHA 4RV9A 3HQ4O 1AGNA 2FMUA 1LDGA 4TVBA 2E6UX 4OQYA 4N5LA 3OIDA 3HHPA 3V2GA 3X2EA 5F1OA 1IB6A 3N58A 4OSOA 4R3WA 3SJUA 4BGIA 3TQHA 4M55A 4IS3A 2W2LA 3HNPA 4CODB 3O9ZA 3WQSB 3BA1A 1H5QA 4Y6PA 2E48A 2GO1A 3U4IA 4C4OA 4XIJA 4GGOA 5DCYA 2X4GA 4IDFA 4OIMA 1YOVB 4YT5A 3ZWCA 1IE3A 5JO0A 4O6VA 1SMKA 3C85A 4FC6A 4JBGA 2G5CA 1HE5A 5I7VA 1B16A 3G49A 2WE7A 2O3SA 4K6CA 1P45A 2Y68A 3WSVA 4B4UA 3I1JA 1FDTA 3TZQA 2NWQA 2GYYA 2TMGA 1EVIA 2Q2VA 2Q4BA 4ALMA 3H9GA 3CZRA 2E82A 3UW3A 3FCOA 4GX0A 3RKUA 4MVJI 2Q1SA 3DHEA 3INTA 4QUKA 2PV7A 1DOHA 1PL6A 1OBFO 2C07A 2GLXA 2X7HA 1NASA 2NADA 3LF1A 4WPGA 1EE9A 6ADHA 5CDTA 4B3HA 2G1UA 4IDGA 5FI5A 4BNKA 4TROA 3D4PA 4ID9A 1H94A 2OO5A 4KWIA 2O50A 3ZW8A 4WCFC 4ZQGA 1YKFA 2GZ3A 2W2LD 2X5JO 4KQXA 4S1VA 4TZTA 2XAAA 2VRBA 3E9NA 3AM3A 3H4VA 2VHWA 5T6BA 1M6HA 3F9IA 4IBOA 1AE1A 5T8KC 2DBZA 4K28A 2R00C 3D3WA 5AOVA 1IOLA 5J23A 3ZNOA 1PJTA 2JL1A 3JYQA 5IXYA 1UXGA 4Z9XA 3H3JA 1MFPA 3NGXA 1NP3A 2WMDA 3JQ7A 2Y1CA 2VUSA 3K2EA 2NM0A 3JQ7B 3UHAA 3AI3A 2GRAA 4W82A 1Z7BA 3NJ8A 2WD8A 5MGBA 3AJRA 2O2YA 3GRPA 4FS3A 1T2AA 2WDZA 4WGGA 4DC0A 2B4RO 3E9QA 5DBGA 4EGFA 5DZSA 1V9LA 4CM6A 1E6UA 1HDGO 3TWOA 4PLYA 2OBYA 3O26A 4RGBA 5L40A 2O3RA 2ZK7A 4HNGA 1U5CA 4BNTA 3C1OA 2YDXA 5AQ1A 3HFGA 2HJRA 3D4NA 3BTOA 4TSKA 1P0CA 1GTMA 5L3ZA 2DUUA 4YPOA 4MVJP 4K1LA 3ZWMA 3AUSA 5ILOA 2B0JA 5EINA 4RLHA 5JNLA 2QQ5A 3WS7A 4I1IA 5KNLA 1RM5A 3ZWPA 2X0IA 4IQGA 4WCFB 2OGUA 2YJZA 1PGQA 2DBVO 3HDQA 4CUKA 1B2LA 4PRLA 5KKCA 1I2ZA 2JHGA 2WJPA 3EAGA 3NYWA 4J4BA 3QWAA 3RFXA 1LRLA 4BNZA 4HXYA 3JQ9C 3WTBA 4W99A 1A9ZA 4KWHA 1PQUA 1E1KA 1RJWA 1YONA 4GI2A 4FFOA 3K6JA 1PWXA 2HMTA 4F45A 3GVCA 2ZTLA 1I01A 1KVRA 3GF4A 1QYDA 5ICSA 4A5OA 4DLLA 2NV6A 1DPGA 1GPDG 2EF1A 3FTPA 2HAEA 1SEPA 3UF0A 2NU9A 3CEAA 4KMSA 4X54A 3KV3O 4BGVA 4RDHA 2IDZA 3QSGA 1LC3A 4IDEA 4N5MA 4MJLA 4RVDA 4F6CA 5GZ3A 5HM8A 2H63A 3JQBC 3QVOA 2X58A 4KOAA 5F1PA 4OXKA 4DIOA 3OM9A 5HWSA 4RPLA 1N1GA 5IDXA 1E3JA 3VH1A 2RAFA 4K9DA 4RL6A 1R4MB 3VVBA 4XRRA 3RUDA 2GPTA 1YBVA 4CLDA 1T4DA 4GVXA 2UVDA 3MJSA 1SAYA 2C82A 1HEUA 2B36A 4YJFB 4JIGA 1Y7TA 4DREA 1V8BA 1YS4A 3WIEA 2FPGA 5B4TA 3OJLA 4MVJE 2Y67A 1KS9A 4JGBA 3VKVA 3GVXA 3G17A 3ZZNA 1WWKA 3IUSA 3BHIA 3I9JA 1U28A 3F6YA 3ZW9A 2VTEA 2BFPA 3NRCA 2Y99A 4CMHA 2BGMA 3MZ0A 1GYPA 4WOJA 4XQEA 3H9EO 2P5YA 2Y0DA 2VWHA 3JQ6A 3E48A 4O5OA 3RU9A 3VPXA 4E2YA 2W2KB 3EHEA 2FZEA 3I5MA 1A4IA 1VJTA 3PXXA 2ZQZA 1TLTA 2RBEA 1DRVA 1SPXA 1E3SA 5A1TA 2WM3A 4QFCA 2VHZA 5AXDA 1JVSA 4WLNA 4D3FA 2I67A 2Z1MA 3UH1A 2VRCA 3RASA 4LVCA 4D79A 1GYRA 4CJXA 3WICA 4CR6A 2ZB4A 4B7UA 4GAEA 1VKNA 2DM6A 3R0IA 1BHSA 7ADHA 1PS9A 3F1LA 4TRRA 4FGWA 3WJAA 2VHVA 3UCXA 2D8AA 4R1UA 1WZEA 1CEQA 1DDOA 2UUPA 1H6DA 3DZKA 3F46A 4E2WA 3P2YA 3ADOA 4A73A 2QHXA 4R16A 5H83A 5BR7A 2X1HA 2YZ7A 2ZATA 3I3OA 3OFSA 2O4UX 1QP8A 3DHNA 4MP3A 2O7SA 4NFHA 4II2A 3WGOA 2BMAA 4XYBA 1B3RA 4OAQA 1DC3A 2GZ1A 3EVTA 4B8ZA 4NMHA 3SX2A 4RF4A 1EQUA 3W1VA 3UCEA 1UZNA 4QSMA 5BSGA 4GVLA 3WGYA 3QQPA 2JFGA 4RPHA 4XWYA 1UP7A 4I08A 2NACA 2DUWA 4AJJA 2HK7A 4PLTA 2CFCA 2V6FA 4IDAA 2FSVA 5DOVA 2PK3A 3UN1A 1LSOA 3Q0EA 4WLVA 1EUDA 1KEWA 4YDRA 5B37A 3SEFA 1TT7A 1GEEA 1HYHA 2GN8A 2NTJA 1DFGA 5IZCC 3GNTA 4YRAA 5U9CA 1V35A 3LT2A 2CDCA 3PVZA 2OHXA 4LW8A 3PJFA 1XWFA 4BO1A 1LLQA 1W8DA 4OKNA 5G0SA 4YXFA 4GKVA 4H15A 4IS2A 4KQWA 5AVOA 3JYOA 2GUGA 4Q3NA 3WMWA 2V65A 3QE3A 2HMWA 3PYMA 2VZ0A 1C14A 1I2CA 3TRIA 3TZKA 3OA0A 3RUIA 4JN6B 4NH4A 5DOZA 3DBHB 3WNQA 2I65A 1BMDA 1ZEMA 1WMBA 3JQFC 3BHMA 1HYEA 3AFNA 5DCUA 1CWUA 3CSDA 4Q39A 1U3UA 4DQVA 4GH5A 4FFMA 5K0ZA 1X7GA 3GY0A 1XQ1A 3WLFA 3ZGYA 3NAQA 3IAHA 4C7JA 3EYWA 4EYEA 3ETEA 4YJDA 4PLCA 4YAKA 4UVDA 5JDIC 4BQPA 4AG3A 3V5NA 2W4QA 4BVAA 2GN4A 4RVUA 2D59A 4JX8A 4PG8A 1E3LA 5A02A 3AI1A 1EFLA 3C3XA 1ZNQO 2BFAA 4ND4A 1PGJA 2YHUA 2NVUA 4R5HA 2O3JA 3PQEA 2B69A 3JD3A 2B37A 4II3A 3I9OA 3RUFA 1E3IA 2IZ1A 4LK3A 2Y1DA 1KETA 3TSCA 1B8UA 1Y6JA 5C5IA 5JPIA 2DPGA 2B83A 4FFPA 3I9MA 4DXHA 1I30A 1EBFA 4IJWA 2BF7A 2PGJA 5EQFA 5TQVA 5TNXA 1ZK2A 4CMKA 2VOJA 2OORA 3PI7A 1K6IA 5ES3A 1QSGA 1SZJG 3H8VA 1AN9A 3BMNB 4J7CA 5G2OA 4XA8A 1WXDA 4RORA 1F06A 4U0KA 1IZ0A 2GF2A 5JAZA 3WG9A 5GY7A 1WVGA 4BIIA 4LMRA 4N54A 3ZI0A 2X22A 4ND1A 3UKOA 3WGGA 4DWVA 3S8MA 3GNSA 1ONPA 3CUKA 4MIEA 3JQAB 3U4CA 2X0RA 2BELA 4CM1A 5CEJA 4L76A 3WR5A 1LSJA 4BB5A 1H6BA 3A06A 3W6UA 1BVUA 4P4GA 2CVOA 4BO0A 2P5UA 5JMPA 3UGKA 4GBJA 1V3UA 2E4AA 1YBAA 4PVCA 3K96A 4A7PA 3CTMA 4XD2A 1Y5MA 4OXNA 2QRLA 4EJ0A 2PZLA 5DP2A 4U6SA 2P4QA 5JLAA 3VDQA 2X23A 3DOJA 3BMNA 1YJQA 3P5SA 2XPCA 4K26A 1MB4A 5DNAA 3HN2A 2B4TO 4AJKA 1HXHA 4D45A 3FRJA 4S3MA 3UICA 1LLDA 2FWMX 3DDNA 1C1DA 2IYPA 3PP8A 1NQAO 5T8KA 1Z73A 5KJ6A 4G65A 1IL0A 3FR7A 4PLWA 2OBNA 1PL7A 3G79A 3ORFA 4CV3A 3E5RA 4EUHA 2CY0A 3F5SA 4JXKA 3GHYA 2YFQA 1U3WA 3ENKA 5A05A 1I8TA 1U3TA 1Z45A 1FDVA 3FBTA 3L4BA 3PHLA 4OOEA 1IPFA 1XGKA 4O1MA 3GT0A 4RCVA 5EERA 3T4XA 3WQQA 3KLPX 4L8VA 4WUVA 3S2FA 2GSDA 1ISJA 3HE3A 1ADCA 1D4FA 4TVOA 4CV1A 1PJ3A 3ZU2A 1XHLA 3DAFA 2Q46A 4MVJD 4B4OA 3OJEA 4XQGA 2F1KA 3GLQA 4CMAA 4J1NA 5JC1A 1ADGA 3GVHA 1YQXA 2EKPA 3AOEA 5I7EA 4PGFA 4CQLB 1DO8A 3MOIA 1KEPA 2AQKA 5T64A 2LDXA 4GMGA 4CLHA 1BXZA 3VVCA 4NJMA 1OMOA 3JQAD 4CQMD 4J0FA 4E30A 2AQIA 1ZK3A 2BLLA 4TZKA 1EVYA 1ISHA 1VL6A 2HMVA 1X13A 2WYUA 3PZBA 4QFDA 4NBUA 4YQYA 5GZ6A 1S7CA 3BTSA 2HDHA 1NR1A 4INAA 4IMPA 4WOKA 4R01A 4EI2A 1PQWA 2BGKA 2J5QA 1E3WB 3L9WA 3TL2A 1VRWA 4KTTE 4RQTA 1NQOA 1WDLA 3BMCA 3KEQA 3ZU4A 1PGOA 1J6UA 5JMWA 3LVFO 2GN9A 1GUFA 4J3FA 2ZYDA 2EEZA 4KUHA 3T7EA 3JV7A 4J6FA 4AJEA 3C8MA 3ONEA 5L45A 1GZ3A 3HB4X 2PD4A 2ZYGA 1HYGA 3HUDA 2ZB7A 4CM8A 1XCBA 4A26A 5K6AA 1Y8RB 3E6AA 2Y1OA 1EZ4A 3RBVA 3HZZA 2HMSA 4FGSA 4NFYA 2ZJ0A 4QT0A 4WNCA 4IJKA 4ZRMA 2CMDA 1ZMOA 3DWFA 3T4EA 2NQTA 3VTFA 4E5KA 1GADO 4MKXA 3RUCA 3NKLA 3ZU3A 1ZK4A 2Q49A 4NR0A 1UJMA 1HLPA 4BO2A 2O3QA 4J4TA 1TI7A 1GQ2A 2JD2A 3ICPA 5JW6A 3I4CA 3QW2A 2YV3A 3GDOA 3L6OO 5HA5A 5C7OO 2C5AA 4WK6A 2ZTMA 3KBOA 1QG6A 1ZXLA 2J6IA 4XCVA 4D0SA 3TN7A 5FI3A 3AW9A 4CQLA 5CDSA 3E9MA 4NQZA 4R1SA 3ITKA 1J49A 1B8VA 4LVUA 4Z9YA 5JY1A 1OZAA 2ILTA 3FNEA 4B79A 4FJ1A 3EMKA 3WGIA 3RCBA 4OO3A 1Q0QA 1DIRA 1P0FA 1MXHA 3PJEA 4GGPA 4M86A 1R37A 4ZQFA 3CIFA 3VPHA 2CSUA 3H9QA 4DMMA 1GZ6A 2RIRA 3RJ5A 4M49A 1E1NA 3RWBA 5EESA 2C29D 4JQCA 3GEMA 1T2EA 2VNAA 1O5IA 1NQ5A 2B5VA 5GMOA 4W7HA 5DULA 4CM9D 4L9RA 2CD9A 1Z75A 4ZQHA 1NR7A 3GFBA 1KC1A 3IL2A 1DHTA 4AJIA 1Y5RA 1MUUA 3VPGA 2OXIA 5CDGA 3NGLA 2JCVA 1O95A 1HWYA 5G0TA 4OL9A 1A7KA 3VDRA 1Q0LA 5JDCA 5L4LA 3PWKA 1WLYA 4DYVA 5G0WA 3WQRA 4HKTA 4XX0A 5JCJA 1YQGA 3MOGA 3HSKA 4NNJA 3CPSA 3NV9A 1DLJA 3PTZA 2EKQA 3LZ6A 2CF5A 4CQMB 3KOUA 4FFRA 3W4KA 4DPMA 3KVOA 4YCAA 3INGA 5ILGA 4CL3A 3O4RA 4EITA 2HK9A 1X14A 1CYDA 4DMLA 3RKRA 1NHGA 1EE2A 3I9KA 1CF2O 1E6EA 3OIGA 3GDFA 4RVGA 1CQIA 3TFQA 2UYYA 3ZDFA 4Q9NA 4FC7A 4GSLA 2CVQA 1NQTA 2D0IA 3ZWWA 4FD3A 4IDDA 5ER9A 4BB6A 4R9RA 1C0IA 1PJBA 3MJCA 3C7CB 3TOXA 2FOIA 3PYLA 3ANMA 4MVJF 1K89A 4HWKA 5C3MA 2RCYA 4CMIA 5I7SA 3NDRA 1AXEA 3S1LA 2EIHA 3H7AA 3WGTA 1HDOA 2HRZA 1EEHA 1YL7A 5LC1A 1J5PA 1Z74A 2C2XA 2EHDA 4UEOA 2P2SA 1RYEA 3ZWOA 4D46A 3JYLA 1HL3A 5F5LA 4HP8A 1KVTA 1UH5A 1UXKA 1KIFA 4D0RA 1DAPA 3H65A 3TOZA 1I10A 1XLTA 1SOVA 3U4DA 1JKFA 4TQGA 1YJ8A 4M8SA 1BVRA 1QYXA 1AHIA 1UR5A 2AEFA 1GYQA 3DL2A 4D3DA 3O8QB 1ONNA 3AM4A 2OOSA 3KSUA 3U0BA 5IDQA 4J4HA 3AFMA 1HE2A 3BTVA 3D64A 4WEQA 5DP1A 3ICCA 4RJTA 3RC2A 2VCYA 1YXMA 3B1FA 4I5GA 4P38A 4PLZA 4FSHA 3DFZA 1I3KA 3DR3A 4LSWA 4XB1A 5JAQA 1M76A 3BMQB 3B1JA 4HFMA 1E7QA 4ALIA 4MKZA 1PZHA 4CUZA 3JQEA 3GRKA 2RH8A 3X2FA 2GASA 3GAZA 3HG7A 3L07A 4BO8A 2DT5A 1SBYA 1ZJZA 2GDZA 3SJ7A 1MV8A 4G2NA 2UUOA 2X8LA 4WEOA 1N9GA 3DB2A 3DOOA 4HADA 4DIBA 5K6AC 1RKXA 5BSEA 4O63O 2V7PA 1Z82A 4GQAA 4GLOA 4MIYA 3D1LA 2Q45A 1LRJA 2YHIA 3K5PA 3GUCA 4A10A 1P1RA 4FQ8A 4CM3A 1PJQA 3ZWXA 2VOEA 4YACA 3ZHXA 4YJHB 2DAPA 4Z0HO 3WSWA 1B3BA 2C7VA 4F3YA 1ENOA 2Q2WA 3QY9A 4XGNA 3VC7A 1H0KA 4PLGA 1ZCJA 5CEFA 4PRKA 2EGHA 3VPSA 3TJRA 1MXFA 3ZH2A 3VZRA 1BDMA 4P22A 2Z5LA 3K92A 3EZYA 4E3ZA 1PGPA 4BHTA 1NPTO 4J2OA 4J9VA 4EEZA 3DBLB 4OM8A 4MKRA 1E5LA 2GNAA 3ULKA 3AWDA 4E5NA 3PQFA 4AJPA 3AI2A 3Q11A 2DC1A 1XIVA 1KVUA 2NTVA 1EMDA 1EDOA 3FTNA 3WX0A 5H82A 1NFQA 3DOCA 4YRDA 2GD1O 2PY6A 5TLSA 2EGGA 3U5TA 2FSSA 4RPGA 1XA0A 2VYVA 3NT4A 2B4QA 4GX1A 1BXKA 2NVUB 3GC6A 3BMOA 1MA0A 1FK8A 2V6MA 2X5KO 5A9SA 4DUPA 3WDSA 3MJVA 2ZKLA 3TNLA 2IZZA 1NM5A 1SC6A 5AXBA 1SNYA 4OMUA 4Y9DA 2WYWA 4UUOA 3P2OA 1ZK1A 1JLLA 2Q1WA 1D7OA 4CLOB 1F8FA 1T4BA 1PJ4A 3GGGA 4G5HA 2QG4A 3CKYA 1NHWA 2R00A 4LSMA 4RZIA 3GEGA 2EKLA 3TPCA 1D8AA 3I6IA 5IDWA 4BO3A 3OF2A 4BNFA 3VZSA 3ZWBA 1ADBA 3UUWA 3CTVA 1WDKA 1HSZA 2Y0CA 3B70A 3LT0A 1ZKMA 4PG5A 3ENNA 2IZ0A 4CM4A 1BXGB 1VJ0A 5LDHA 3D4OA 1YWGO 4OJNA 4DBZA 4HFNA 3ONDA 4IXWA 3SC6A 1UP6A 3GA0A 3GGOA 3UAGA 1IPEA 4NJMB 4CV2A 3KO8A 3VAZA 1UZMA 4MVJG 1IHXA 3ETDA 1U4SA 4GKBA 5KVQA 4JNKA 1GR0A 4XIYA 3FN4A 4M89A 1Y8QA 3B6ZA 2CDBA 4FIZA 1HT0A 1FJHA 5A9RA 3QVWA 5ADHA 4Z6KA 5G4KA 1QYVA 3D5TA 4R3NA 3JQCA 3H3FA 4MVJM 4BMNA 5TF4A 1VPDA 4IZHA 4BV9A 4CLRA 2VT2A 1NWHA 1HF3A 3IMFA 3ZWVA 1RM3A 1KEVA 3OH8A 3BMOB 3QP9A 2P9CA 1ZH8A 4IMRA 4IZIA 4DQXA 4CL8A 5L7YA 2H6EA 1MX3A 3KHUA 3A28A 1LQUA 2BKAA 2YUTA 3IUPA 1UXIA 3NT5A 4YJGB 1X1EA 1K2WA 3DZHA 1XDWA 2D3TA 5KJCA 1CRWG 2PFGA 3AM5A 3BTUA 3DMTA 1ENYA 1DFIA 1WDMA 4LRTB 3TZ6A 4B4VA 3FHLA 2ZB3A 1R0KA 1ZEJA 4BQRA 3DQPA 2IE0A 1L1FA 2DFDA 5HS6A 4FB5A 1E3EA 3PHHA 4GSKA 3UCFA 1W4ZA 2AHRA 2RHRA 2AQ8A 4L75A 3WFJA 1NVMB 3FBGA 4J1TA 4ZVVA 3WXBA 3GDGA 1B15A 1BW9A 4BNLA 1WZIA 1I24A 1ZVMA 4NK4A 5I7FA 4CMGA 2ZJ1A 1E6WA 1G1AA 1WAMA 4BO4A 4TRNA 3PYXA 3TFOA 3AY3A 2W98A 1RM0A 4WJZA 5FYDA 5A5FA 3MWDB 1X7DA 3LF2A 4XYMA 5COAA 4BNYA 1KC3A 1ZBQA 4RVFA 1CDOA 5AXAA 3L77A 3ZN2A 4PZCA 3ZV4A 4ZRNA 3HDYA 2VHYA 2D5CA 5A3VA 3PHJA 3BYZA 4UUNA 1TT5B 4IGEA 3V1YA 2GCGA 3W8EA 4DQUA 1QV7A 3H6KA 4DTIA 1XEAA 1G0OA 1B26A 2PKRA 3NJ4A 1JW9B 3KTDA 3LT4A 2UDPA 5A5EA 2RH4A 4TRMA 3AOEC 4P4NA 4BKUA 1Q7BA 1N5DA 1XSEA 2VQ3A 4EJMA 2C5EA 2QX7A 2VWPA 4Z0TA 2FN7A 3OHSX 4YAIA 1HSOA 1Q2XA 5JCJD 4YVFA 2VHXA 4ZJUA 2IEBA 3R3JA 3ITDA 3WBBA 1V6AA 1N2SA 4AJLA 5BNTA 1LBEA 4I8XA 3MJEA 3H9JA 3QVTA 3IKVA 3F4BA 3K2BA 3JQGB 3VZQA 3GPDG 3MJ4A 3DONA 3WIDA 5ICMA 1VL8A 1TA4A 2HQ1A 1DB3A 4O59O 1E7MA 3QWIA 3DZGA 9LDTA 3LDHA 1K6JA 3IOYA 4N18A 3IJPA 4L4SA 4CMEC 1E3WA 4WKGA 1YGYA 4WCDA 1WPQA 3ROKA 1VI2A 4AJ2A 2PH5A 4YJFA 4RVHA 1UXHA 4HY3A 3ZWYA 4NG5A 4BUCA 5MDHA 1ZMTA 4ZD6A 4Z0PA 3NDIA 4D42A 4GL4A 2HRBA 3JQ8B 4J2HA 5H81A 3W8FA 4J0EA 4TKMA 4P8RA 1X0XA 4XGIA 1BGVA 4BNNA 1FDWA 3DC2A 4ZQEA 4UREA 1P77A 3PDUA 3COSA 1ZIDA 3VKUA 2XXJA 1WP4A 4J1SA 1ARZA 1LRKA 5DN9A 2VYNA 3M2PA 3RC1A 5JO9A 1H93A 1OC4A 1P1JA 2VYVD 3G1UA 1QRRA 1IZ9A 1NBOA 4IDBA 4PLPA 2BI7A 1SCUA 4BNXA 1S6YA 2EP7A 4FJ2A 4NI5A 2EWMA 5IJZA 2ZIZA 2G76A 3K8ZA 4EUFA 4HX5A 4HFJA 3DBRB 1JAYA 1A7AA 4E2ZA 3ADPA 2FR8A 1O6ZA 4CLEA 3GZNA 2VYND 5DT9A 4OHUA 1GAEO 4GX5A 4KZPA 2DU8A 1F12A 5L9AA 4KDFA 3MJTA 1I3MA 1C0PA 5HTOA 1XYGA 4YEDA 2DTEA 2B35A 1MGOA 2X86A 3GR6A 3LQFA 4KDEA 4UAGA 1C1DB 1V3VA 3JSAA 4QO8A 4CLRB 2NU7A 4LN1A 2J8ZA 1XQ6A 1ZSYA 2O2SA 4DYDA 4Z3DA 4YAJA 1YB5A 3RIHA 4BNWA 5FEUA 1NPDA 1ZK0A 4R41A 1LLCA 2FR1A 4FOOA 2JAPA 3PPIA 3TDKA 3OQBA 5KTKA 1HE4A 4CPDA 1ID1A 1HDZA 1MC5A 1DC5A 4GWGA 2IYOA 3IDSA 4D44A 4ILKA 3H2ZA 2AQHA 2HU2A 4QEDA 4Q3DA 1N9GB 4TRJA 1NWCA 2FPIA 1U3VA 4JROA 4KUGA 1FDSA 5BQFA 4EEXA 2DTXA 3KYCB 2JD1A 1TB4A 4DLBA 2AW5A 1A27A 3CZMA 4OH1A 3DMYA 1E7YA 1LSSA 2C54A 2AA3A 3DZIA 5BT9A 1OOEA 3JD4A 4OSPA 3JQFA 1RM4A 1A4UA 1CQJA 2E37A 1PZEA 4MIOA 3BMQA 1E7SA 2EG9A 1SEVA 2DBQA 2E49A 1JTVA 1GV0A 1QLJA 4E4YA 2WSBA 3JQDA 5KIAA 2EV9A 5A9TA 4L4XA 2PWZA 5JCXA 1AUPA 3BIOA 4BNIA 4YRBA 1HLDA 1A5ZA 3IC5A 1LDBA 4M87A 1VJ1A 3HN7A 4Q3AA 1VKOA 3K30A 4WASA 1H2BA 3PFWO 5L7WA 1T26A 4LCEA 3R6DA 2NUAA 4E33A 4E12A 2YY7A 3MTGA 4NPCA 3V2HA 1Y81A 2OUIA 4BKPA 4AJ4A 3DBRA 3GVIA 4CM8B 3TF5A 4XRGA 4DIFA 3OJFA 1UAGA 2WE8A 2Y66A 3WOHA 4BGUA 4MO2A 3OEYA 1ML3A 3UOGA 4Q3EA 3QVSA 3G0OA 2VWGA 3G3EA 2YV2A 3DBVO 1HDXA 3MEQA 4IIVA 3E8XA 3WB9A 2AEJA
chains in the Genus database with same CATH superfamily
1JXQA 3WYEA 4DIDA 3I9FA 3R9XB 1YVEI 4B40A 3NU1A 2P79A 4LVOA 3TNDA 2DJIA 1O08A 2PV0A 4M7PA 1U7DA 4TMWA 3U7IA 2O2CA 4KDCA 3LIPA 3WRXC 2YWDA 3PGXA 4HCJA 1NYQA 3GAMA 3B9PA 4BFCA 5C8DA 5FULA 3VKFA 5BXQC 4LZLA 3CLUD 4D9BA 3L0SA 1IVNA 5HNKA 2H3EA 5B3AA 1JAIA 2QV7A 5AW2A 1DKLA 3A36A 4ZOLF 1ZJ5A 3HKBB 3ZQUA 1EVKA 1FRNA 3ZHYA 1L5SA 4NHEA 3LIIA 4EUEA 3U7JA 3IOMA 3NNNA 1IDN1 3N9IA 4CMCA 5EJ4A 2D0OB 2OWEA 3I72A 4AJHA 1E1DA 1ZM9A 3SKYA 4GE3A 1IUKA 1JZQA 1NRIA 1E4VA 1UC5B 1LDNA 1GP2A 1EESA 1Z62A 2UAGA 2ZCVA 2BCEA 1XT6A 1P5RA 2HDWA 4K9OA 5LBUA 5KWIA 5CFPA 4V38A 4C2UA 4IYRA 4E46A 2Z95A 2REXB 5AVWA 4ZU3A 2L82A 1DZ3A 4NOJA 2HRDA 4PPNA 5IHPA 4A27A 1GGKA 2V4UA 2ZUBA 2G82A 4OL0A 2CXUA 3R3WA 5JFGA 1ES9A 1NUUA 3AHJA 1V8ZA 2PX2A 3OKPA 4NU6A 2BGNA 2VHCA 3G2MA 5FPSA 3FNRA 2VF5X 4RANA 5EJ6A 1YK0A 4UXIA 1JP7A 1PVVA 3UV6A 1CS0B 3KXKA 3IVXA 4BE9A 4E2XA 4Q4HA 4IJVA 2MCFA 2OC4A 3FPLA 3OPQA 3F3SA 5EL0A 1G66A 5CK4A 4WJLA 3U3XA 5E2IA 2H7CA 2WY2D 4KTVE 4LOKA 3BWBA 5T57A 3WGQA 3CGWA 3CA8A 1XZQA 3L8ZA 4C07A 4XFKA 1WSBA 1N3YA 3ONVA 3O4HA 4B4DA 1EX6A 4HEQA 1SVUA 4HUJA 1R27A 4KAXA 3TAHA 4CG1A 4EDFA 5A03A 2Z2XA 1FFEA 4U7WA 3OQ6A 4GYYA 1S2MA 3UYKA 3PQDA 4L15A 1KQGA 3QKSA 1M74A 2JFFA 1G42A 2WYVA 1PDOA 4NBRA 2R6HA 3PGVA 3E5MA 1XV5A 4YIKA 3NYQA 5KWEA 4C2AA 3CVYA 3VPBA 1YRAA 3ED1A 5A06A 3LHIA 3HMKA 3IULA 3F3YA 1PJAA 3BGDA 1U2DA 3FNQA 4MINA 3D3KA 3EGDB 2QD2A 2YYYA 1EB9A 3G0IA 2YFYA 3BRSA 3OA2A 4DLAA 4IF4A 4CF6A 4JCCA 4OP1A 1WRBA 3Q7PA 1AK1A 1ZGGA 1RDFA 4P92A 4WOBA 4NWIA 3LL7A 5BN5A 3HKDA 4GQBA 3ORYA 4M7WA 5I8WA 4PIVA 4RPKA 1DC6A 3CWZA 5KOHB 3ZWAA 2XXAB 4FJ0A 4HWOA 2XDYA 3RSFA 1W36B 1A04A 3ENQA 3NX4A 5I7WA 1I5RA 1ULTA 4NZYA 1GNPA 2BFOA 4A8JC 3SR4A 1B73A 2BGTA 1CR1A 1MO4A 2JPDA 2DQ4A 1E9RA 1SN7A 5B36A 4NRDA 1L8XA 3NORA 1W25A 4PZYA 3PEEA 4IJMA 2Z58A 1C3VA 4RZXA 3X1YA 4JLDA 2FSGA 5GADl 2XKKA 2G6BA 1S3FA 1QX3A 3E9CA 5FPKA 3RC8A 4D8YA 2CLKB 1UANA 2GVDC 3RM3A 4DXDA 1SKBA 5LNK6 3X1XA 1RC0A 3A1NA 3L7JA 5AJTA 5LP6C 3GLGE 3RLIA 5KDDA 4OI4A 2FW7A 1X9GA 3A1WA 5JPCA 2WVJA 1KIAA 2W6JA 2D00A 2WHEA 4ISCA 4WERA 5T3YA 1E20A 5DXJA 2ODWA 3PXGA 5A4IS 2CJWB 2Z9BA 5LQMA 1RZVA 4BO5A 4YP9A 2P3OA 4ZAXA 3ZPXA 1WZUA 2NTYC 3FIJA 3E35A 4P32A 4Y6OA 5FRDA 3ONFA 2D4AA 2P4EA 1MORA 1RJ9B 1XVVA 1EA5A 3OURA 1DJOA 4JOQA 5DM4A 3ZLTA 4C4SA 2G06A 3AF3A 3LHSA 2WZCA 1NTOA 2E3JA 2GBLC 3E1GA 4BO7A 5A5GA 1XVTA 2ZUDA 3F8TA 3TOCA 4WLEA 3EIFA 2OGSA 4J90A 4D8TA 3Q9NA 4QOEA 3EQ7A 1USIA 4FKBA 2I87A 5IJ0A 4BZZA 4W5QA 1ULHA 5DBEX 4GFDA 2JIRA 4M4SA 3FNBA 3QE2A 2UZ1A 1U7OA 3TW6A 4LWZA 4KXFB 1SXJC 4Q93A 5DNUA 2ENWA 2Z3ZA 5L51A 3GLFB 2QR5A 4WLOA 5ALNA 5TV2A 1IN7A 4I9NA 1Z47A 2C9ZA 2GZ2A 4JI1B 4LV6A 3KOMA 4I1PA 3BJZA 1CY0A 2D0PB 4ED9A 4TKZA 1JAZA 1XU9A 4BBAA 3MGBA 1EX1A 1HE1C 2X0JA 3WNZA 2XRFA 2LKCA 1ORTA 5KX5A 1IY0A 1TVKA 2Q3LA 3BIFA 1VE7A 4HFRA 1D4ZA 2VRCD 2Q0XA 1O96B 2KB0A 2ZW9A 1PR4A 3I23A 3P45A 5IFKA 1JXMA 2J08A 3RVDA 2Q3FA 1Y4SA 3EZ2A 3MB5A 2Y0EA 4YV7A 4U39A 4XJSA 2J33A 1I1HA 4GWLA 2QWXA 5EJEA 2O8EB 2XBMA 2QTFA 1QYWA 1R4NA 1WVIA 3PGJA 2FMIA 4YA6A 5EMJA 5C4IA 4DUZB 5LD2C 3ZIDA 1GAWA 1DIHA 3V8NA 4E7PA 1SUSA 4YMSA 3SR3A 4NY1A 1BMFD 1UXJA 4M1OA 4V1CA 4MQ6A 2ZYUX 4X20A 2AYYA 2OEPA 3CUVA 1R0BA 1YK1A 1M2HA 3QYJA 5KSYA 4BNVA 1GDDA 3OTOB 3EG9B 4DKJA 1T8YA 4HGRA 5BO5A 2DQZA 3ZV6A 4KGVA 2X1VA 2P5SA 3DDZX 4PLVA 1FU7A 2QU8A 4YCDA 5BR4A 4MV4A 1KYWA 4MMYB 3OQPA 5M34A 3NDBB 3QUBA 2CFTA 1KPIA 1I3NA 2F43B 2HUNA 2TMYA 3ZV7A 2FFQA 3VTZA 3JVUA 3EWIA 1WMAA 1H0RA 5A9SB 1DQSA 2YWRA 1A9YA 1JBEA 2KJQA 4J0KA 4NG4A 4QGBA 3P52A 3RWOA 4EKDA 1ZWLA 1JQAA 4E88A 1PSDA 5DM70 1D2RA 1OLXB 1FB5A 1QV6A 1M1YB 1WX1A 3MLEA 3UKJA 1AHPA 4B71A 4CMBA 1M7HA 1Q19A 1FXUA 1O9HA 5KU7A 1M2WA 3L6DA 4R6XA 4ZGWA 5IVPA 2FZ5A 2INGX 4F9GA 1YRBA 4GKAA 3AETB 1KDYA 1JWBB 2QL7A 4PAWA 1YB6A 2BRUC 3EW7A 2VP2A 1Q0SA 3B2NA 4MDHA 4G23A 2BEKA 2VP3A 4LYDA 1E1QA 3DXYA 1EGMB 3LS2A 5HXAA 4LFAB 2ZSHA 1WABA 4BNHA 3AP3A 2WJJA 3LC1O 3RC7A 3V4VB 3MWDA 5FIUA 2ZXEA 2O2EA 3N8IA 4GNKA 3IP3A 3O03A 4B4WA 1IU9A 4ALNA 1IWBB 1ZA1A 5BN3A 4GBED 1NBEA 1C3LA 4PZPA 5HZKA 2QTVA 2VJBA 1SKMA 5ALXA 4JJEA 3K94A 1X3LA 3O47A 2R7NA 4JC5A 1THTA 4C0KA 3JS5A 3OJCA 4G1BA 3PZRA 1OLXA 4A0SA 1A8SA 4BJ3A 4ZA2A 1R16A 2OMKA 1QH9A 3ANNA 2V45A 3EH2A 3IDQA 5DEOA 5HIMA 5BWLA 5ESRA 1PT9A 1ID8A 1FS5A 2P11A 2YMLA 4H0NA 3L4BC 2JFNA 4C6HA 3GMIA 1N1MA 3Q40A 1V71A 4ENQA 2FZKA 1QLHA 4GOMD 1O0SA 4IY1A 1JQEA 5KNCA 2OFWA 4L0QA 1YH3A 1I3LA 4D41A 2ZWOA 4YGXB 4D5GA 4BRSA 4R9NA 1HT1E 2J9YB 2XYGA 5AW5A 1P31A 3EXHA 1FE8A 4EYOA 3MT7A 3FDJA 1SWWA 2JHFA 3FTCA 3GNQA 1K86A 2WG0A 4JC8A 5AYVA 4CG0A 5DU2A 2B2CA 3LSTA 5DTJA 5K3SA 2VLIA 2OQVA 3WISA 4K86A 4MAMA 3WLAA 3HDTA 3V8BA 2R79A 5CPFA 5IDYA 3IAS6 2QL5A 1U98A 3RSCA 3UZUA 1O94A 2OZLA 4G0PA 5A0FA 3IV6A 2H52A 2QT1A 1H65A 4TX1A 2DY1A 1M34E 2ZAIA 3D0OA 1S8AA 1GLVA 2X3FA 1FFBA 4LF7B 9MHTA 3L4SO 4HRAA 1ORHA 2GJKA 1C81A 4IJ5A 5EHXA 1ZUIA 4GR9A 1JHQA 1VXOA 2R66A 1XCOA 2IEDA 3OI7A 1E61A 2R25B 4Q82A 3ZY3A 5CG2A 1R74A 1F8GA 2B1QA 1Y1LA 4KK4A 1OFIA 1UKEA 5K3BA 2WKPA 4Q7JB 5ALOA 1PD1A 1T5BA 2X8AA 2P9HA 2LP4Y 4MW7A 3TZHA 3VH3A 4PN3A 4NDAA 2JNWA 1UJBA 1ACJA 3MJRA 2C4NA 2J5XA 3KQSA 1QHNA 4Z0NA 1QIGA 1XWIA 4PG6A 3C3WA 3OIUA 1XZ8A 1Z22A 3HYSA 4IINA 4N5NA 3LLSA 4CDRA 2CWWA 4YPVA 1R6AA 5EP3A 1A97A 1FP2A 3AY6A 3V2UA 5JJ5A 3VR3D 4BY9E 4L07A 5IN5A 1ISMA 2XQVA 3L6EA 3O1LA 3HBNA 1UBLS 4KH0A 2K2WA 4PAOA 4ZAVA 4BATA 3U5ZB 1XZAA 3JQRA 1CERA 2HKIA 4KL8S 1FUUA 5IAJA 3SYTA 2CV1A 5EWJA 4A6DA 3FD8A 2ES4A 2WYHA 4I36A 3AR7A 4L3WA 1KE2A 4D6XA 1UDCA 4AJ9A 3I5UA 1VE6A 3OPYI 2HBYA 2W6MA 3FPCA 1A2OA 3NHRA 4V2UA 3SYLA 2W2MA 4YLGA 1NONA 1VKZA 3THYB 1JF8A 2F9FA 2O7QA 3TPFA 4LF8B 1FMLA 1SKAA 2QIOA 3LQ2A 3KM0A 1Q2UA 1U7HA 2NGRA 3ABIA 1L4LA 3GXOA 3P0JA 2VPTA 2QVZX 1QWSA 2W6QA 5FA5A 5TC4A 2NQ8A 3GFGA 2HA0A 2RGXA 3QELA 4MR8A 4EB6B 1FNCA 1JVBA 2WDPA 2VK1A 1CUBA 1V2HE 2JGLA 5DM1A 2CV0A 3AF5A 1P9NA 3DWIA 4XQ0A 3K0AA 4N7RA 4GWKA 2XMZA 3VC2A 4PRZA 4H1WA 4Q3LA 1CFZA 5IKXA 4UBKA 2AN1A 5TX7A 3GWGA 5DTRA 3OQNA 3PKIA 5DWDA 1KI2A 4DABA 4XQCA 5GZ1A 2JIBA 1AURA 2AE1A 2F8SA 1QPBA 4G63A 2RIPA 4RULA 3GMSA 3M6IA 5H7XA 1HM5A 6LDHA 2FI1A 3QW4B 1JKXA 1UCFA 4OQEA 1K9SA 1UBTS 3M4XA 2XXAA 2QRKA 3FPKA 1WUYA 1J1IA 2F4NA 4BNMA 4JJAA 1U8FO 3CE6A 1C3XA 1D3AA 3ZU6A 4LJYA 1EFRD 2CUTA 2EC5A 1AF7A 1FW8A 1L5ZA 3OOSA 2NUBA 2ZS7A 1D6JA 2IRWA 4YYZA 4OLBA 3AVYA 1IN8A 4RTMA 1UIMA 4EKIA 4F3TA 1HETA 3A6FA 5EZYF 3EGDA 4AI6A 1V37A 4F1KA 2C2HA 4DPLA 4NNPA 2NXEA 1EP3B 3RYTC 4OF4A 1D6MA 3IE2A 2WU8A 3M49A 4KN6A 2PUFA 3Q2IA 3VOAA 3KVVA 1DKQA 3MOSA 4B2PA 5L3SB 3ON5A 1OYVA 1SBCA 5FUBA 3TXXA 4D0NA 2BFBA 2PSFA 2DPXA 1OB2A 2X9GA 2RGNC 3WXMA 4KE6A 5ALRA 5H1YA 4IXTA 5JSZA 3QLJA 2PGLA 5I9IA 3WADA 4NYIR 5JC8A 1HDEA 1PU2A 3PC8A 2YV1A 3OZGA 4X84A 5KOJB 5DJ5A 4ENTA 2XUQA 3VJKA 2AOUA 1GPKA 4V1CI 2G40A 2GM3A 3ZNNA 4DSTA 3RE1A 3VO1A 1ZVVA 3IEVA 5L3QA 4P58A 4IQ8A 3NQ41 1IK6A 5LKRA 4D99A 4B6PA 4U2DA 1ATZA 1L4NA 4JJKA 4HTAA 4LE2A 4M0PA 4P33A 4RMNA 3PENA 1TAUA 3I2GA 2XLBA 2DCUA 3MELA 4XR4A 3HJFA 2JJ2D 1TF2A 2A0KA 5E4JA 1SB8A 2VPIA 3LKVA 5TGDA 3IFSA 1TTHA 3TD9A 3A31A 2QBYB 3RYIB 4MS1B 5LQDA 4XB2A 1OXTA 5LU9A 1JEQA 3CLTD 3RVPA 3QVUA 4OKIA 1KFCB 4G3XA 2R2GA 3O8LA 4PZDA 3ASVA 3VYWA 4Q24A 2WPNA 3NOVA 4QDZA 2V1XA 2AOWA 1TCAA 2C84A 2E18A 2PGIA 4Y6SA 1A95A 2G5GX 3DYBA 4UJ5A 4D7AA 2FN3A 1NOKA 1M2JA 2RI1A 3HJAA 2WFLA 4I4NA 2VAVA 4JA2A 2JFPA 3OC0A 3VR2A 5K0FA 2EG5A 5DBFA 5HBGA 2LCIA 1U65A 4YT8A 4NK5A 4IKOA 2I3AA 2ZVPX 2Z2IA 1ZCBA 3BD9A 4ZODA 1E59A 3UJCA 2DXIA 3P0RA 4KFRA 3UAXA 2RB5A 5EGNA 4UTZA 2V98A 4OXYA 2ACKA 1C9JA 4N3CA 4QUJA 3ROTA 3X1DA 2YZKA 4D1YA 5K8VA 1YB2A 5KB3A 3R3HA 3CR7A 3E2MA 2ACEA 1QMPA 1XKQA 2FPLA 2DT8A 4B46A 3NXSA 5ED0A 3E3MA 5HM6A 2YQ4A 1BWPA 3OE7A 3HVRA 1BOFA 3ZTWA 2ZZMA 2TMDA 2HU5A 2JW5A 1WW3A 2NLOA 5K6AA 2OOKA 1GZHB 3C8HA 3OU6A 3D8SA 3HO8A 1E5QA 3ROGA 1F1BA 3F1KA 3OQ1A 2F59A 4K6MA 5IZCA 1YRLA 2QJWA 1U2SA 3GFSA 3PJDA 4HVTA 2WTEA 2B94A 5HEKA 2P68A 3CLKA 2BGWA 5HZHA 4HEJA 2IS1A 1OAAA 1XZBA 2GAIA 5FFNA 3WL4A 3A6JA 5BMVA 2M6LA 5C53B 3BK7A 5AKKA 4OLJA 1L7RA 2CD7A 3UMGA 1PCXA 1REQB 3A32A 5K5EA 4KI7A 1EWQA 3NC1C 5IEBA 1DIBA 4WIAA 4YMUA 4XJTA 1EK5A 3GAFA 4QSHA 2ZUFA 1RNLA 2D5AA 2QT9A 3E1SA 3VU0A 2OFOA 1G18A 4PLFA 8AT1A 5E7MA 3HJTA 1BU8A 4LCJA 4TYWA 3SOZA 4EA6A 2W2VA 1FQKA 3GEDA 4UDNA 3BXXA 3EC7A 1J23A 2HPAA 4PPGA 2Q3DA 1N6NA 5F2KA 3QBDA 4HI0E 2ANBA 1ESEA 5AK4A 5C3UA 3UAOA 4ZMRA 3QEBZ 5JNTA 1LTHR 1FFDA 3L04A 1DJLA 4H7PA 2Q1TA 5E9JA 3WZ2A 4OLAA 3SZLA 4GOND 3ZDBA 6PFKA 1DT3A 1RWBA 1GUAA 1F14A 1UBKS 3EXIA 3IQZA 3Q9UA 4XE5A 1C4KA 3H75A 1TE2A 5K6RA 1LUAA 1RW4A 3DLIA 1C3EA 1ST2A 1I80A 1MFZA 1QLWA 2FWRA 4URWR 4F2GA 5ERXA 4ZK2A 4L6IA 4L3VA 1T6ZA 5K0LA 1ZS9A 2NYRA 4TKVB 3I83A 2J5KA 3IBFA 2B8TA 4ITVA 2YJTD 3ESQA 3E81A 2R5NA 2XXBA 4ALJA 3AOGA 4M8IA 3PT5A 4DTCA 2GEBA 2YRXA 2EW2A 4LRUA 3KJZA 3SS8A 3WJ2A 2G36A 2HYDA 5FO1A 1Q3HA 3DFKA 3T3PB 4BGEA 1F4LA 3RT1A 1U2GA 4F1WA 2MYUA 5E9WA 1PSZA 1UPXA 4WE3A 8MHTA 1RI3A 1OYWA 3FLAA 3G2QA 4ETIA 3OUZA 1P1CA 1YZUA 4HYYA 4PCLA 1QBKC 2DBRA 4QBGB 1A9QA 5CB0A 2C0CA 4M60A 3ZWDA 4ZYLA 4RLSA 4BLSA 1UJ2A 3DSRA 3M9XA 4M1MA 4UUMA 2H18A 3BHJA 1U7TA 3OJOA 1OTXA 3H5OA 2PWYA 3TQRA 3V3TA 3B9RA 3KYDB 3L7IA 4RLQA 3RSQA 3BE4A 4BZPA 1NJFA 2RONA 2JIDA 3OIWA 2P9EA 2AXQA 3TLYA 1T8TA 1U63A 4KO1S 4L8FA 2JEZA 2J5RA 3Q7EA 3W8DA 1OSNA 4KIUA 1IQUA 4OUDB 4YRIA 4O2AB 1IHOA 3HWRA 1O87A 3TBKA 2TRSB 3OUUA 3DLHA 4HAVA 3DXXA 4P9NA 2VN8A 3TKAA 3RUAA 2K4MA 3O3CA 3QA9A 3T3NA 3K6RA 3T41A 3D2BA 2LTAA 1TYCA 3ESCA 3F8WA 1U0TA 2CXHA 1DADA 2CL7X 1LBIA 3RO7A 3WWCA 1J09A 2WEKA 1ZM2A 2DFVA 2AKEA 3SX4A 5GWXA 2FGJA 3GG9A 4ZTZB 1Q7CA 1I51A 1AGYA 3I1FA 1RCTE 4FWIB 3BWCA 4GRDA 4NBTA 1WY7A 4X45A 4PZEA 4WXPA 2QQ0A 3CKKA 3TK1A 3GJ8A 1RWOA 1R0YA 2ZBUA 4OVKA 4Q4AB 1CUHA 1MEEA 1I1NA 1KJIA 1BSVA 3GCXA 4JLJA 1AXGA 4FOLA 3CZAA 1SXHA 1KYQA 4CUJA 3M5DA 1KGSA 4IKEA 2O2GA 3FROA 2E21A 4X95A 1S2NA 4U7GA 1QS0A 1PP4A 3D6AA 5LQSA 4PRYA 1BDBA 1LA2A 4GMKA 4AZWA 5ERYA 3G1WA 2NPFA 2IELA 1VCIA 2PRIA 5AHOA 4ZAZA 3RAEC 1XEXA 1P9WA 4RTQA 1Y3DE 1N6OA 5F98A 2QMEA 1QR2A 1MLDA 4NBNA 4B7CA 3FOFC 4EAAA 3IKTA 1LTKA 4Z2YA 1CR2A 2DHCA 4R1TA 3S3TA 4MMZB 2OLEA 4PYLA 1AQLA 2FRDA 3O9MA 1RYZA 3EEIA 2NU6A 3BSYA 2AMYA 1IOVA 4Y1GA 1SUAA 2QEQA 5ALTA 4F4JA 4MUFA 2C03A 2WT4A 2QRPA 4QOSA 1FQWA 4ZV9A 3HLYA 3DLBA 1G1MA 3R4CA 1E3MA 5ALVA 4MQBA 1KP9A 3EDYA 1Q7GA 1LNQA 1TQ6A 1XKTA 3EGCA 2B34A 1ZVKA 2VDOB 2VNJA 3O3OB 2A8YA 3ZD8A 5JARA 3BAZA 2A14A 4Z3KA 1R66A 1K7CA 1M2NA 4TYYA 3TIGA 3QG5A 4JLAA 5A2GA 3RFVA 3CMCO 1X1TA 3E1KA 1FBTA 4AURA 3KDPA 3T5CA 3N53A 3WYCA 3MG9A 2F1OA 3OZXA 1U1CA 4TV9A 4CLOA 2I2AA 3WYBA 3JD1A 3FIUA 4GRIA 4RDIA 3H2GA 3WWZA 4MPPA 4D02A 4LYHA 1DBIA 4HF7A 1GUZA 1SU7A 2W2KA 5CT6A 5KNDD 4Y67A 5D86A 3FHOA 4YWHA 2WILA 5GIOE 2OAP1 4IUBS 3WIOA 1WM1A 3RVBA 2J6CA 2NTNA 4EPWA 3FNHA 4QPCA 1ZRSA 3NWEA 4G8JA 3KB1A 2A84A 3KL2A 4D3ZA 1RI1A 5LKAA 3DPUA 4EG4A 1I0ZA 3ZCTA 2PPVA 4KH1A 1XL1A 2CZGA 4N5HX 5CT4A 1FLAA 2BI4A 2ZQYA 3ABSB 1EFDN 1OU4A 3TG2A 5CT8A 1UBHS 1BU5A 2WMYA 2X6QA 4JBHA 4F6RB 5IAOA 3PE4A 4POAA 2ZE8A 2CYCA 2DH6A 1UFOA 2R6FA 5E4TA 1AC5A 3L6CA 3PNKA 1YAHA 1T1EA 3R0VA 1S01A 4UFOA 5TB5A 3AUAA 2IY9A 3TJMA 1TT5A 1JB9A 4QJIA 1Y1PA 2LCQA 1MV5A 3JAWA 1KZ6A 4NICA 3SIPA 4FLMA 4A2CA 1IYZA 1WTCA 1PL8A 4AYTA 5HKKD 4DCJA 2XCOA 1E92A 3DZBA 2JC3A 3GJXC 3OZAA 4CEIA 2RGGA 3K5HA 1R4ZA 4R2MA 5FTLA 4QVKA 1JH9A 2X76A 3R8CA 3KSBC 4KQ9A 5ES4B 3NXKA 5IASA 1AUQA 3GN1A 3RQSA 1G9XA 2D1TA 2IYAA 1G20B 4W6ZA 5EMLA 1IJKA 3IXMA 3TQCA 1Q22A 3NUQA 4A82A 1A9SA 2GYWA 1A3CA 3Q0IA 3I6ZA 4MW5A 3Q2KA 3EFOA 2QQFA 2JH8A 5C34B 4C89A 2JKZA 3AFGA 1Y7IA 1JJFA 4J91A 2XOEA 1CZLA 3E3LA 2EKDA 4JB2A 3KSRA 4HDRA 1XTKA 2GK4A 2ZIFA 2ZTVA 5K0EA 3ZZTA 5FOQA 1CT9A 1NVDA 4JP2A 1U6KA 4RZHA 1I6MA 2Y93A 5ALFA 2GAAA 3SQWA 2RBGA 1R8SA 1V6SA 2VF4X 3DE0X 4G56A 3PUKA 4JLPA 4ZEXA 3TQTA 1DI0A 2OQ2A 1FEZA 4JR0A 3T0IA 3COVA 2QUIA 5HK9A 2YJ6A 1COZA 2ZUSA 3KCQA 1PFGA 3KKMA 3TFWA 5CFRA 1JAXA 3QI2A 3EF3A 5DX1A 2P75A 2N75A 1FNBA 3K31A 3U49A 1KI6B 1PFKA 4KYUA 4S1TA 4B6GA 4AKIA 2Z98A 1MVOA 4JIMA 4F4IA 5BN1A 4XKJA 1LU9A 2NVBA 4RVSA 1G0NA 3A05A 3VPDA 1GILA 1CSEE 2GD2A 3DHVA 3K9WA 1K88A 1MDFA 5AXCA 5BPHA 1OT5A 1WOMA 2IBMA 2MHCA 1XJCA 3CVXA 2A9OA 4Q03A 4GMFA 2WLTA 2X0NA 2Z3WA 3MSCA 2NUTB 2VF2A 2VSXA 1WJGA 5C4MA 2QUHA 2X13A 3PV0A 5B5SA 3FWYA 1IZZA 4OBWA 3UXHA 2EP5A 3D7MA 4DGQA 3CLHA 4BS9A 1K2VN 5C1DA 5B2ZA 1N77A 4AZVA 4TS9A 1GSAA 2BUAA 4ODIA 1RMTA 1GZ5A 3N6VA 1ZI8A 1I4LD 3NAZA 5J2TF 1UQTA 5L8VA 1GCAA 3PLRA 1V0JA 3BDVA 3JWGA 2H00A 2I7VA 4KFCA 2RC6A 3C43A 2YW9A 2CK3A 1K8XB 2HK8A 4OB8A 4LRYA 2C31A 1FUYB 3GRAA 1V8PA 2OK8A 3RVRA 3HHPA 3V2GA 1JNYA 4M9ZA 1GHTA 4B83A 4J76A 1DIOB 1K8YB 3N58A 1NMEA 4OSOA 4EVIA 2XUOA 4BGIA 1LPBB 3C4VA 4M55A 1E2NA 2OZEA 3OHMA 2EJBA 2RKOA 3BA1A 1EK2A 2VYFA 3E84A 5CDFA 4RCYA 3U4IA 3NRBA 1QFMA 1ZH2A 4F71A 2X4GA 3KVYA 3ISVA 2C42A 3FJ1A 1II8A 3B2EA 4IDFA 2Q0HA 3UJ8A 4YT5A 3ZWCA 3SFVA 3INYA 3L49A 3ZYZA 2YNMD 1MB0A 1V1JA 3IE0A 5AVVA 4G2TA 3DH0A 2E2WA 4K6CA 2QM7A 3B5EA 2A4MA 3IQXA 5EMKA 4XCQA 3MBKA 3TZQA 3MINB 4RA9B 2VBFA 4H7HA 2E82A 3UW3A 3W7VA 4PC3A 3EFEA 2HFKA 1N25A 3JZIA 3K8OE 1TCUA 4AMGA 3ERCA 3O73A 3DHEA 3DLAA 3G68A 4B7ZA 5AKXA 3INTA 2XQKA 4AMZA 2DETA 3SM3A 2XUIA 2ZI3A 2Q6LA 3FNIA 4Z86A 4TTSA 4FT2A 4PFSA 5B3KA 2HN9A 1EE9A 4COKA 4B0PA 4HNVA 4EO9A 2BWJA 4ZI7A 5B2FA 1AV6A 3B8EA 4L5BA 2C61A 4P7KA 4D8XA 2YNMA 2IHKA 2N1BA 2OD9A 3ICWA 5HP4A 4K9RA 2NUTA 3P32A 2GETA 2XX3A 3D4PA 3DLTA 3NWJA 5EHQA 1H94A 1O95C 1US8B 1QHHA 1T8PA 1CUEA 4J0DA 4WCFC 1YKFA 2JI7A 1H1DA 2X5JO 1FMFA 1O1YA 4KQXA 3KFVA 2XAAA 2VRBA 3E9NA 3H4VA 5K3FB 3LQYA 2PRKA 1RAFA 5TQJA 3B1XA 3WO1A 2N47A 5KEIA 1ESCA 4OFWA 2G70A 3U3ZA 1QQ7A 3FDIA 1C8VB 3CZ9A 4K28A 1T0HB 4TV8F 5T8KC 1G8PA 3B48A 3S7ZA 3LBFA 4JASB 4PICA 5AOVA 3ZG6A 5J23A 1YTUA 3OESA 5AJXA 1PJTA 3SMVA 4NJEB 4NTZA 4WOCA 3UNXA 4PZLA 2PL9A 3PNBA 3TNYA 1MFPA 3U16A 2CZQA 4US1R 2DOKA 3QVGA 3M6MD 2FSVC 3M4NA 1Z4KA 3JQ7B 3OKAA 3DC7A 1O96A 4N49A 2GRAA 4G4SP 1K5PA 3CISA 4HDRB 2EZ9A 1K0FA 1DUSA 2O2YA 1JIIA 1ZD4A 2ZRBA 4FS3A 3HKCA 4DC0A 5AW1A 3NANA 2WR8A 3AIKA 5DZSA 3GO4A 1V9LA 1X1RA 3JSXA 3G2HA 1HDGO 2FWIA 3TWOA 3WY9A 2V7EA 4GOOD 1K63A 2OBYA 3ILXA 4PLYA 3TNFA 3ZE9A 4EUKA 4DR2B 3C1OA 1JLLB 4AZ3B 1QONA 3JAMA 2J0QA 3D4NA 1J5XA 3MCTA 1GTMA 3P1JA 5L3ZA 1VLJA 1K9VF 1YT5A 4C3ZA 3H9CA 5IYZA 3I9V6 4UCQA 2B0JA 1GQSA 4JUIA 4KMMA 3SXUB 2B1JA 4E03A 3ANSA 2I3ZA 1CVLA 4X71A 2GMWA 4IQGA 2H31A 4NMLA 1EE1A 4O4IA 4DADA 3HDQA 4CUKA 3VYSB 2ECOA 1CZNA 2C9OA 3ROFA 3V4SA 1B2LA 2QP9X 2Z8YA 3ETNA 5KKCA 4QBIA 2H1OA 1HZZC 1NOJA 1R0ZA 3OFND 1YQTA 3QWAA 1XDSA 3REFA 2AKYA 2XNDD 3MGKA 4EO7A 2PUTA 1YVUA 3ZK9A 4CWAA 1A9ZA 1VHTA 4KACA 2BTOA 2O1EA 4PGGA 3FSGA 4MR7A 1ZMRA 4DLUA 4BLVA 4F45A 3GVCA 4I6EA 2C57A 2MSLA 1XDBA 3KOWA 4FX5A 3O21A 4QBKA 4QLOA 4WN9B 4AY5A 4DLLA 2BUCA 2E4YA 4J0HA 3I62A 5DGTA 3FTPA 1SBQA 4G4IA 1CB0A 4DKXA 4H60A 2FXVA 1VKHA 1WV1A 2NU9A 3CEAA 4JI8B 2QUKA 4EFMA 3FSGD 2DUNA 1IOWA 1AF4A 3F5DA 4O4HB 2IDZA 3QSGA 1NUTA 3KQOA 4RVDA 4MJLA 5J2UB 4F6CA 3Q8LA 3ZJUA 3QGMA 2H63A 1J2YA 3ZOKA 3PEVA 2X58A 1T0IA 1T34A 2HCRA 4URXR 4DIOA 4F3NA 2WJHA 1L4EA 1MQ9A 3REQB 1I7SB 1E3JA 1E89A 1PW7A 3HVHA 3KD2A 1TM3E 3NHUA 1Z0FA 4ITRC 1YZFA 2CLMB 2RAFA 2QLNA 3MSXA 1R4MB 4AM8A 2GEJA 4XRRA 5CU7A 3TR0A 3SCZA 2GPTA 4BQIA 2W6CX 4CLDA 2EWWA 1Z8HA 3BAFA 2Q6VA 5A0TA 1G2IA 3UWKA 2VDRB 2XQJA 4NYMQ 3TUZC 3AWIA 1V8BA 3SEQA 4BVGA 4PN7A 5CB8A 3OJLA 4MVJE 4PR3A 2BV3A 4JGBA 3GGDA 5ESXA 5F9MA 1WXIA 2VPPA 2ASEA 2OGTA 1QE0A 1M8PA 1PL0A 1U28A 2WK1A 2X8JB 5CVTA 3CB4A 2FQWA 4UQLA 4RIHA 1ZH0A 2HW8A 3IUMA 5ECGC 2WOJA 2UZ4A 1ZJ6A 2PAFA 2P5YA 4IWYA 2PH7A 1ZA2A 4H1UA 3JQ6A 3K09A 3GPCA 1GPH1 3GJ4A 4I46A 2YIVX 4TWBA 4DMRA 1YIDA 3VPXA 1WB9A 4LGYA 5DSTA 4RE6A 2OO3A 2HRRA 2I1VB 2JIZA 2ZWAA 1NI4B 3EHEA 2PUJA 1E1RA 2RBEA 3H8JA 5JXHA 3U13A 4DR6B 1NVUQ 1SPXA 2B3TA 2QVYX 2HT1A 4YJ2B 5A1TA 3FMFA 3OOYA 3VU9B 3PA8A 4QFCA 4QGGA 4WLNA 3T3HA 1I6WA 1YZLA 1ZM3A 2Z1MA 2H65A 3KZXA 2VRCA 3QFSA 4H7EA 1RMYA 1Z0UA 4D79A 4HVLA 3OTHA 4QGHA 1QVAA 4ZCMA 4QRDA 3L8CA 3PRKE 4GAEA 3W3AD 1WSAA 3LLUA 1IQ0A 1J97A 3I1YA 4A6EA 2DM6A 2HWWA 3R0IA 1U0BB 3TLGA 4ZI5A 3F1LA 1UK9A 3WJAA 1MHPA 1V1RA 1TF5A 3UCXA 2AKAB 2D8AA 1WZEA 1CEQA 3RARA 2XR1A 3FLMA 5B3JC 3HDGA 2GEDA 4DLYA 3GRUA 9ABPA 3GOQA 2C4KA 3DZKA 2HJVA 3F46A 4E2WA 1U0GA 3MJHA 2JIMA 3IDAA 2HEIA 4IMIB 2ZSBA 1HV8A 5IBPA 5IKEA 1G6Q1 3AQIA 1JHRA 3ER6A 4BAGA 1E2KA 3MYRA 3MD9A 2WJ3A 3KCNA 3EZ6A 4KRGA 4R16A 3S5JA 2X1HA 1CNFA 5CX1B 5LQAA 1CY8A 4MP3A 4X3PA 3E4DA 5D7NA 1YQQA 4NFHA 4II2A 1SULA 3IO5A 3LXXA 2P65A 3MIIA 2NO1A 3WIBA 3EFOB 1WZ2A 1L5QA 3NV7A 3SQDA 3UCEA 5BSGA 3SYNA 1MNQA 4H6VA 4OA8A 3QQPA 1XHFA 2XUJA 1A7UA 4KKXB 2PO7A 1TPYA 3H1GA 3P4UA 4MR9A 4RPHA 4XWYA 4YRCA 4F60A 1AO0A 3LX8A 1ZR2A 4RGVA 4PLTA 4O4LB 2OFFA 1LLFA 2ZYWX 2V6FA 3CEHA 5EE3A 3S29A 1DAFA 1HX7A 5DOVA 1WE2A 2IX3A 1JE0A 1EUDA 1U8YA 2JLSA 3LO8A 4RY9A 5B37A 4O4JF 2PUBA 3MWGA 2AOTA 1XAJA 2JGFA 4PTLA 2QE7A 3LZCA 2YC4C 1DFGA 5IZCC 1Z5PA 2DBYA 2CHVA 3V4ZA 3CNHA 2R60A 3RU2A 2PMDA 4LYYA 5SY9A 4NV0A 2XTAA 5JNUA 1EP2B 4LW8A 1LLQA 1W8DA 5G0SA 4N8DA 4H15A 4H6PA 3RKSA 5I45A 4HR7A 4IIXA 2GJ4A 5FNZA 5AVOA 1AKUA 3ZQKA 2DMRA 1RXSA 2AGVA 4X94A 3WYGA 4JGIA 5F77A 2CK3D 2QLJA 4R8LA 5IXJA 4MR9B 4AWXA 1W36C 4RHUA 3LXUX 4ZT3A 3H2YA 2J30A 3BF8A 1BDIA 4AROA 4CZ2A 5BW8A 2WBLC 3K9NA 3PA6A 4PSDA 5B7GA 4QGAA 4RSMA 3K9BA 2Z8YM 4ABTA 4Y2UA 1SXPA 1G8HA 3RDPA 1JA1A 5BMVB 1L5HB 2B7CA 2IW1A 3CT4A 4LIPD 1ZEMA 1T29A 1QP7A 5CX1A 1E5DA 4RMIA 1H2FA 3RWMB 4XM2A 1QUFA 3WKAA 5HUHA 2J4DA 5JRZA 1XLUA 3UJ3X 3SQXA 2AHOA 3A3YA 2HF7A 4Q39A 3RTDA 1XI2A 1IQRA 2PDAA 4FHGA 4DQVA 1XTSA 1X7GA 1PX2A 2KE5A 5C1OA 1W48A 3IAHA 4IDPA 1N6HA 3ZEIA 1BKDR 1G5FA 1VG9B 4QYIB 3ORQA 3URMA 4YJDA 3ZWQA 3AR6A 4GD3Q 1AUVA 2JK1A 5JDIC 2PRJA 5CTAA 4DARA 3OCCA 2AUNA 5K1ZA 2VG8A 1QH8A 4DDVA 2QDKA 4CIWA 5FX2A 2B7LA 2QF7A 1E1CB 3PXAA 4U7TB 1UWLA 1EFLA 1V1MA 1VOTA 1ZNQO 2BFAA 4OQXA 3BT7A 2IOFA 2CMFA 3QFRA 4B6OA 1GPLA 3D3JA 2JJ1A 2NVUA 4X8LA 5T4EA 3WLRA 3GJSA 4M6WB 5AKHA 2VFAA 1GPNA 3PQEA 1C29B 2B37A 3G2IA 3R6WA 2Q7DA 1QE5A 3T0GA 5CIYA 1B8UA 3AJ8A 5JPIA 2ZJYA 3O95A 2A0WA 4EHAA 3KQNA 1OD6A 5H3HA 3E4CA 4FFPA 3QKIA 3CG4A 2FPWA 2ZYTX 2I7XA 3AEKB 3JWHA 4CMKA 2PGJA 5TQVA 4YV0A 4Y2PA 1Y34E 3O84A 3L4KA 2VOJA 1XALA 2HLDD 4Q4AA 1GLNA 3EIHA 3BMNB 3UTDA 1KJ8A 1WXDA 4XTCS 1F06A 3ONNA 4U0KA 2W71A 5JI2E 4C0XA 3N2NA 4BQFA 4WXEA 5HZGA 5JAZA 3WG9A 3CH5A 4GS5A 4HQOA 4ZAGA 1TPZA 4BIIA 2QRVA 5FAXA 3FPAA 2WNSA 1CY7A 1MU0A 1FJXA 1EWRA 1H8HD 5FD8A 1E5TA 1R0WA 2YINC 1ONPA 2HI0A 3CUKA 3I8XA 3VNRA 4JZKA 3AR9A 3R7NA 5CW1A 5FL7A 1H6BA 1Z8DA 4OHOA 4HB3A 4TVSA 1BVUA 1UKAA 4MWCA 4F97A 3ITNA 5E38A 1DAEA 4BO0A 1AA9A 4MQ4A 3UGKA 3ZK8A 4W9MC 1MOPA 1GPUA 2QB5A 1V3UA 2C4UA 4PC2A 2OHIA 3URKA 4A8JB 4PVCA 3K96A 1W47A 2OWDA 5E0OA 3CTMA 3JAKB 4MS3B 4XD2A 3GLIE 1WB5A 3LVRE 2QRLA 1U31A 3AILA 4JT4A 4MYTA 5ENZA 3SBDA 4CE6A 4PS0A 4ETMA 4L9WA 1NVVQ 1QCCA 1QGUB 2JDID 2YR0A 3O91A 3R41A 5JLAA 2X23A 3S6JA 3MHTA 1DQPA 2UXDB 2V3CC 3DOJA 3A0UA 3LCRA 4K2AA 1YJQA 6REQA 1D0VA 2NU9B 2JBWA 2JH9A 4ARSA 3M5PA 1HXHA 1OLSA 2JGJA 3T1HB 1RBZA 1LKZA 3T3DA 5JASA 4B84A 1Z35A 2H1IA 1C1DA 1AMOA 2XVAA 1Q92A 1U2TA 2WUEA 4YJKA 1JILA 1Z73A 2WKQA 5DGXA 5KJ6A 1RZUA 3N0WA 5A3RA 1YKSA 1VA5A 4MZXA 1IL0A 3TCXB 2C83A 4UOEA 4PLWA 1XYVA 3FZYA