2GF2A

Crystal structure of human hydroxyisobutyrate dehydrogenase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
296
structure length
296
Chain Sequence
MPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human hydroxyisobutyrate dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
total genus 111
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2006-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2gf2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gf2A01
4BV8A 4CL3A 4XB1A 2A9FA 4N18A 1LLUA 5JY1A 1SEVA 2C5EA 1W8DA 5J23A 4A27A 2VYND 3A14A 4H7PA 1ISMA 5IG2A 1BXZA 1CETA 1D3AA 3WMXA 1E1LA 4DC0A 4BMSA 4JCOA 4FOOA 2X1HA 4FBGA 4IUYA 1EVYA 1E0DA 1EVJA 1CDOA 3ONDA 1ISIA 1UXJA 1VSVA 1ZW1A 1KVRA 4BNLA 3D64A 5CPBA 2CVZA 1I36A 2HRZA 3TFQA 4HNGA 2YY7A 1NAIA 3KM0A 1PSDA 5JAQA 1Z6ZA 1GPJA 2WMDA 5DOVA 5JW6A 4YJHA 4YA6A 2POQX 1F14A 3QVWA 3AU9A 2PWZA 4O5OA 1UR5A 3HDJA 5JDCA 1OBFO 3SJ7A 3CEAA 1C0KA 4XRGA 3GHHA 1DRVA 4WGGA 2UDPA 3RFTA 4B3JA 4DGSA 1ENYA 1BXKA 4TZKA 4CM6A 2O48X 4DIBA 1SC6A 1D7OA 5A06A 3OFSA 2YHUA 4GMGA 3H7AA 5L53A 1E7MA 3VZQA 2OOSA 5L4NA 3FR8A 4B4WA 3GFGA 3I5MA 4CLRA 2A94A 1GUYA 3LLVA 3ZWWA 3L07A 4OO3A 4KUEA 1DIRA 1NPDA 3GF4A 1LX6A 2RAFA 3E9MA 4XCVA 1N1EA 5AQ1A 4YJFA 1HTBA 1IPFA 5F3RA 4E5PA 4BL5A 4XGIA 4WEQA 2YV1A 1H6AA 1ONNA 4PRLA 3CE6A 3I1JA 3JYNA 3PWSA 1LI4A 4BB6A 2ZTMA 1QMGA 4RLSA 4DREA 2JHGA 4Z0HO 1KEPA 2Q49A 3ENNA 1GR0A 1QLJA 1ONOA 4B8WA 4BNUA 3F5SA 4KQWA 5FF9A 4JXKA 4HY3A 2BFAA 4IJVA 5EIOA 2OGUA 2JCYA 3DHNA 2VZ8A 3RAJA 1IPEA 4Q3AA 4ZRMA 4K28A 4XDYA 3QV1A 1K0UA 4I5EA 1WZIA 3L77A 1E7QA 5THQA 3TL2A 1I30A 1NWHA 2VYVD 4HX5A 5EINA 2Q3EA 3S2GA 4IQ8A 3FWNA 2FZWA 1IUKA 4K6FA 4WEOA 1E5LA 2VYNA 1EQUA 2ZJ0A 2BLLA 3JYOA 1XA0A 2D1YA 2Q1WA 1AHIA 4I9HA 4YYZA 4JBGA 1N5DA 2C7GA 2EWMA 5CEJA 5HTOA 4GL4A 1M66A 4CMIA 4EUEA 5JC8A 4J0FA 4KQXA 3HFSA 3PFWO 4RF5A 2NUAA 3D1LA 4N54A 4MINA 4EEZA 3ST7A 3TNLA 4ND2A 2X8LA 5DP2A 2G82A 2A92A 4PLTA 1ZKMA 5EQDA 4TSKA 3WTBA 3WTCA 2VOEA 4PLHA 4WLVA 4Z3KA 3PI7A 1VLLA 4ZHSA 1HE5A 2AQKA 3MWDB 4YT2A 2B4QA 1I32A 4NJMB 1Y7TA 3ZWYA 1HDZA 2VHYA 3HDYA 3L4BA 4J9VA 4XIYA 5JBIA 1JVBA 2LDBA 4XEHA 3ZU3A 4E0BA 3GAFA 4D3SA 2F1KA 4MVJA 4CMGA 4BNFA 4QX6A 3GGPA 4LMPA 3JQCA 4AJLA 3PGXA 2DBRA 3NT2A 4IIUA 5AXDA 4BGUA 1XHLA 2EW2A 3D4PA 3M6IA 4TWRA 3ROQA 1WW8A 4GGPA 3KYCA 3JQAD 3HN2A 1FMCA 4ZQGA 2UUOA 4BO5A 1I3NA 4B4VA 4IJUA 4E12A 1ENOA 1GFSA 1P1JA 3NEPX 3FD8A 3OEYA 2NU8A 4OXNA 1OZAA 1YJQA 3PZRA 2CFCA 2R6JA 1OI7A 2NACA 4O0LA 2CDCA 3E9QA 4RPKA 2BMAA 4EBFA 2JKVA 1UXGA 3GEMA 3IQDB 4BIIA 2BI8A 2VZ0A 2BFPA 4R41A 4E13A 3G1UA 1UXKA 1BXGB 4WNCA 3ZHBA 1LDGA 3AM5A 4INAA 3I3OA 2NTNA 2PGLA 3GVPA 1U5CA 4TKMA 4J7UA 2DC1A 3I9MA 3I23A 4H15A 5TC4A 1DHTA 3R6DA 4YB8A 3A1NA 2Q1SA 2XXBA 3AOEC 5FI3A 3WIDA 1FK8A 3ZNQA 4L73A 5T6BA 3HB4X 3NJ4A 3CXRA 5G0TA 4CLOB 3KV3O 3GVXA 5BR7A 2O23A 1B0AA 3L6EA 2V6GA 3ZH2A 1CF2O 2EKPA 5KCZA 2IZ0A 2ZTVA 2DTEA 3ENKA 3C7DB 2VT3A 3PPIA 5L40A 1P74A 2I66A 2Y1GA 3MEQA 3WQSB 1Y6JA 3HWRA 4YAIA 4D0RA 2DBVO 1YBMA 3O8QB 1SZJG 4PG6A 1H5QA 3JQBA 1TEHA 4NBVA 1IL0A 1J0XO 3VPSA 5IDXA 2H9IA 3NTQA 3LSYA 3ZU2A 3WLFA 1NHGA 2FY8A 1DHRA 4ZQBA 1U3TA 1H6BA 2PH5A 1DFIA 3DTTA 4LK3A 4GQAA 4L4XA 3DAPA 1A7KA 3WG9A 2RHCA 2QW8A 2B69A 1NNUA 1E6UA 3ADOA 4FFMA 5IZCC 3E6AA 4E2XA 1YDWA 1RM0A 2YFHA 1ENPA 3GHYA 1P9LA 5AXBA 4ONEA 4U6QA 3W8DA 1JW9B 4BNHA 1MC4A 5I9LA 3PDUA 4NU5A 4Y9DA 3O4RA 4BQPA 2IODA 3FNEA 4E3ZA 5C7IO 3D5TA 2GLXA 3EYWA 4PLCA 1TT5A 4GKVA 3GC6A 1VL8A 4L75A 5JAIA 4PLFA 5L7TA 2HAEA 3O9ZA 2CF6A 3WJAA 5COAA 2Y1DA 3C85A 4U7WA 4PLGA 1FDUA 1E3WB 3WS7A 1PQWA 2GGSA 5ILOA 1U5AA 1GTMA 2FZEA 4EJMA 4HFMA 1D4FA 3AY7A 4PG5A 4J43A 1YQGA 1EDOA 3VKUA 2I5PO 2HO5A 3IJPA 4Z9YA 5KVCA 4ZU3A 3GGGA 4CR8A 4TZTA 5U4QA 2C07A 1ISGA 4X54A 1VRWA 1CYDA 3H6KA 2ZCVA 2YV2A 2V7PA 3PQFA 3AUUA 4OOEA 3QVSA 4KTTE 5COQA 3AI2A 1YB5A 4GH5A 2EW8A 2B5VA 4AJ4A 4OH1A 1C1XB 2DQ4A 3RC9A 4N7RA 1PS9A 2P91A 3DO5A 4CM9D 3E18A 3JQEA 5F1OA 1SPXA 3WB9A 4AG3A 1UDCA 1LSOA 1Z75A 4NBUA 1IY8A 4H3VA 1A72A 4XJSA 1B15A 4RPHA 3EW7A 2YQ5A 3S1LA 3JD4A 3RJ5A 4CJXA 1NVGA 4BMVA 7ADHA 1WVGA 3JYPA 5TRTA 2RBEA 1N7HA 1PJSA 1ML3A 3I9LA 4J49A 4D3FA 4D79A 1I2CA 3DC2A 4J1SA 3ZWVA 3JQAA 4OGWA 4WJZA 4CM8A 4IS2A 2X22A 3BMQB 1IOLA 4OQZA 2WD8A 4QSMA 1XCBA 3FBTA 3HUDA 4YRDA 5C37A 5IF3A 1GADO 3H8VA 2QYTA 3I6IA 4ROSA 4YJDA 1NP3A 2CVQA 3OICA 1PL7A 3NGLA 3RWBA 3D4OA 1P0FA 2WYVA 4LRSB 3DBVO 4JJGA 4KDFA 4ZGWA 1VPDA 1T2FA 1PGPA 1P0CA 1YL5A 4GGOA 4CM9A 1MC5A 1DAPA 1EVZA 1QSGA 2P2SA 1WXDA 4MP8A 3KSZO 4RGBA 3VH2A 4Q3CA 1WDLA 1LSJA 4BKQA 4AJKA 2Y0CA 5DCWA 3QVTA 2JD1A 6LDHA 1G1AA 4RQTA 4E32A 3MJTA 2UYYA 4UEOA 4I8XA 5H83A 3QP9A 1LA2A 4D46A 5BNIA 1VJ0A 3Q1LA 1U3WA 4FFNA 3M2PA 3ANMA 2H5LA 1DIBA 2G5CA 3ROKA 3CMCO 1XDWA 4E5KA 2YQ4A 1PX0A 1CEQA 4EUHA 3F6YA 1F12A 5I7VA 2V6MA 2Q2VA 2FN7A 4J1NA 2E4AA 4A03A 1HKUA 5HRUA 3IMFA 3UICA 4NR0A 2QG4A 1R16A 1AXGA 4W9NC 1PL6A 4AJHA 5CDUA 3P2YA 3KYDB 4BKRA 3ZGYA 3RVDA 1NBOA 1JTVA 1Q7BA 3NGXA 3O03A 3SJUA 1SB9A 4LN1A 3EVTA 1TVEA 2Q99A 2WEKA 2VNSA 1GV1A 2NVUA 3S2FA 4XYEA 4QECA 4FW8A 4GSLA 2B0JA 3RBZA 1I3MA 3OJFA 4Z0PA 2AE2A 4E21A 4Z3DA 5G0UA 3ON5A 2NV6A 1PGNA 1B26A 2OUIA 3KLPX 3GOHA 2ZJ1A 3WGYA 1YL7A 3H9QA 5B4VA 3BMOB 1R37A 2VRCA 2JJYA 4J2OA 4JQCA 3WNQA 4U6SA 4CV2A 4ZN6A 4WCFC 1DC3A 1E3JA 2OMEA 5GZ3A 1AE1A 1Z73A 5LCXA 5L45A 1I0ZA 2DBZA 4FS3A 1RM4A 2VNAA 3K92A 3GQVA 3TL3A 3ZV5A 2P68A 1JDJA 1KOLA 3LT0A 3C3XA 4D45A 1ZMOA 3ZWNA 4K26A 1RM3A 4O63O 4DYDA 4F6CA 4IDEA 3W6UA 4I5FA 4I9NA 1HDRA 3K5PA 1ZJYA 3V5NA 5IZCA 3LDHA 4IJWA 1ZXBA 3OHSX 4NQZA 2VCYA 2PD3A 4JBHA 5I8ZA 3WNVA 1PJBA 4E6PA 1N9GB 5KVVA 3HJAA 3AJRA 3D3WB 3NTOA 4Y98A 4YJGA 4QUKA 3WIEA 2FR8A 1ID1A 4MVJP 5JMPA 4B3IA 5GMOA 3WGQA 1A4UA 2P4HX 2J5QA 2OFPA 4U5QA 3R0IA 1EEHA 4HXYA 4RCVA 1TB4A 2C2XA 1NPYA 1R4MB 2GCGA 4UUMA 3ZWBA 2HMTA 1GU7A 4GWKA 3VH4A 1YOVA 1R6DA 4BKUA 3DZKA 3H3JA 5BQFA 2W8ZA 5U9CA 3SXPA 3GVHA 1QXSA 3JQ7A 3DL2A 3KBOA 4MPDA 4DRYA 1H6DA 3DBHA 3KHUA 4ALNA 3PYLA 1XU9A 1DB3A 1X7HA 3B70A 1B3BA 2XAAA 5A5FA 2C2YA 1V0JA 4OSPA 3IP3A 3AFNA 1SO8A 2NQTA 3K30A 4GBJA 4EW6A 1VI2A 5C7OO 1ADCA 4YXFA 4OM8A 1LLQA 2WSBA 1T4DA 5KKAA 3ZZNA 3BMNA 1MG0A 3AI3A 5C3MA 2YHIA 2GN8A 2F00A 1IZ9A 1XR3A 4K9DA 4W4TA 4GI2A 3VTFA 4BHTA 1A4IA 4IZHA 1U1IA 2GNAA 1RPNA 5AXCA 3W8EA 2PGDA 1EDZA 2HMSA 3I9KA 2R00A 4XRRA 4W82A 1X15A 2VTEA 1EK5A 4J1QA 2ZK7A 4LCEA 4ALIA 4BNWA 1B7GO 3D4NA 1AGNA 2HK8A 1HXHA 1T2EA 5F5LA 4J1TA 1PGJA 1RWBA 2AHRA 1E3IA 2VRCD 5G0VA 3SLKA 2QIOA 3RD5A 1D1TA 2WDZA 3FTNA 1KEWA 1A71A 4YWJA 4YPOA 2BH9A 3GNSA 4YRBA 3EK2A 4FR5A 2VT2A 3D3EA 2GYYA 4XQEA 1MX3A 2VHZA 2HLPA 2OZPA 1JN0A 3D0OA 4FC7A 5G4LA 4DPLA 1LJ8A 4CLOA 3RFVA 1GYRA 1JKJA 4MVJG 3DR3A 2NTJA 3QWAA 4HFRA 4W99A 1EVIA 4IBOA 3PFFA 2GN6A 4OXKA 4RVDA 3TZKA 3ZNOA 5ITVA 4WCFB 4QQRA 5HS6A 3PLRA 3ZHZA 3DBHB 1O6ZA 3E5MA 2PA3A 3I4CA 2AW5A 4LCJA 2AQ8A 4TRNA 1O94A 1TI7A 5ER9A 5CG1A 4GX0A 3AUSA 3TZQA 4I9UA 4B8ZA 2B4RO 2O7SA 4CQMD 2VHXA 4Y6PA 3I4FA 1QP8A 3JQ9A 4BO8A 3OIGA 5ER6A 5AOVA 4TRRA 1KVUA 4LMRA 3I6QA 4TVBA 1KY4A 4UVEA 4XZ3A 3V8BA 3VPFA 3ZNNA 3OETA 1HYGA 4HWKA 1GZ3A 2X5KO 1BTOA 4JJFA 4XGNA 2OBNA 1NQTA 3DOJA 3W1VA 1LUAA 3RUAA 3VH3A 3DZFA 1SCUA 2P9EA 1F8FA 4ND1A 3C8MA 1NVTA 2J3HA 4GPD1 1PU2A 2GZ1A 1YGYA 2JFFA 1LDYA 1VL0A 5TGDA 1UUFA 1E7RA 4CMBA 2W90A 1Q7GA 4PFJA 4UVIA 5JY6A 2IEDA 5A3JA 3JQ6A 3IUPA 4RV9A 3PJGA 3KRTA 2BF7A 1NYTA 2IZZA 4WLUA 1R0KA 4FGWA 3GDGA 3R1IA 3H2SA 2DUWA 2PFGA 3HHPA 4YCAA 1U2GA 4E2ZA 5CDGA 5TIIA 3GG9A 5TLSA 4DPMA 2DTDA 2JCVA 1NFRA 4BMNA 3V1TC 2GRAA 2QRKA 3RI3A 3FSRA 4OMUA 3B1JA 4MJLA 1FDTA 4RVGA 4DBZA 4IXWA 4I08A 4IQGA 1XQ6A 3DZBA 1Z7EA 5L51A 4J16A 1B2LA 1DIHA 1UDAA 2EGGA 1BRMA 3O26A 4CMIB 3KEOA 2CDBA 4YTEA 3UKOA 3CUKA 1NPTO 3CKYA 4ITUA 3QIVA 1GQYA 2FPIA 3D7LA 3HADA 3H4VA 5KJ6A 2EGHA 3H3FA 2PZKA 5KVSA 1DFHA 3KXDA 3KETA 1BVUA 2C59A 2PZLA 3QRWA 4CMJA 1KEUA 4XIJA 1XIVA 1EE2A 2Q50A 4F46A 1M75A 1NR1A 1ZH8A 1MG5A 4CV1A 4D7AA 2DBQA 3NAQA 4NI5A 1HZJA 3LC2O 4PLZA 3SX2A 3OA0A 3PJDA 1C1DB 2OXIA 5B4TA 3G79A 1DC4A 5I7EA 1K89A 1LBEA 2GPTA 3QQPA 4E33A 4MO2A 3MJ4A 1PJLA 2NADA 1Z45A 4WNIA 1XQ1A 4R5MA 1PJ3A 5IXSA 2RHRA 3JD1A 1XKQA 2D5CA 3RROA 4AJNA 3Q2KA 4YAEA 4BNGA 5DN9A 2G1UA 4RORA 4CQMA 4BO1A 1R4NB 4P22A 3C7AA 4BGVA 3ZI0A 3Q2IA 3GDOA 1P77A 3IKTA 2QYSA 5A05A 5JPIA 4GWGA 2BRUA 4YQZA 5T5QA 4ALKA 1H0KA 1V9LA 1B8VA 4PRKA 2GN4A 5JXWA 1LEHA 4J4TA 1KIFA 1ZEJA 1HDGO 1P45A 2FP4A 5L9AA 5JYEA 4JGBA 3OIDA 1KVQA 4WKGA 4PZDA 3WFJA 1HDXA 1K2WA 3STHA 1AXEA 4RO0A 4J6FA 4D0SA 3DZHA 4CM8B 1LDEA 3JQAB 2EJVA 4G2NA 3ZWMA 1SAYA 2BD0A 3DTYA 1ZIDA 4RVFA 1GDHA 3ZV4A 4D43A 2B36A 4ND3A 4WK6A 5TF4A 4JP3A 1QYVA 4NFSA 5TT1A 4CODB 1H6CA 4A2CA 2DU8A 4FDAA 2P9GA 4FPXA 4TQGA 3DONA 1LLDA 1U7HA 5JCJA 1X1TA 1XLTA 1GPDG 1E1KA 3E03A 3UH1A 4L0QA 2I6TA 4BNNA 1FXSA 2Y1FA 2RH8A 1DBVO 3H5RA 3LVFO 3WGHA 3VVBA 5I7FA 3F1LA 4NMHA 1XELA 3TJRA 3L4BC 3DMTA 5U1PA 3TOXA 3E82A 4Q3BA 4WECA 3WGGA 1M6WA 1DC6A 1G0NA 1HDCA 1WPQA 4MOWA 4BUCA 4OYRA 4WPGA 2O7QA 5A02A 1B8PA 3GG2A 4DXHA 4RDIA 3C1OA 1V6AA 2VUTA 4IXTA 2CY0A 1IYZA 4CLHA 3U62A 3N58A 4BNXA 5KJEA 1JWAB 3PJEA 5JAMA 3P5SA 1OOEA 3RSHA 3AUTA 4UVHA 3OJLA 1Y9AA 2PLAA 3V2GA 2O3QA 2D8AA 4R9RA 5CEFA 4AICA 5CAEA 4KTVE 1H94A 1JKFA 2E49A 1H9AA 1E92A 3G17A 3LLSA 1TT5B 2OP1A 4ZQFA 4YAKA 2Q4BA 4NU6A 4CUJA 3JQ9C 4R1SA 1ZK2A 2DFVA 3OQ6A 4HKTA 3TQHA 3IOYA 3QWHA 1YVEI 2UVDA 1X13A 1XGKA 3DOCA 3OSUA 4UREA 2FOIA 4NNJA 5BT9A 2D3TA 3W4JA 2PZJA 2O3RA 3NJ8A 2EG9A 2JFHA 4GMFA 4IPTA 3IAHA 3ICCA 1Y8QB 1DFGA 1QKIA 1MV8A 2C7VA 4M8SA 1OFGA 1R4NA 3CTMA 1GCOA 3EZYA 1UH5A 2DPHA 1CIVA 2HMWA 3FNHA 2O4CA 3FPCA 2DT5A 3D5QA 5ENVA 5G0WA 3W6ZA 1U28A 1U4OA 3O8QA 3VDQA 4OHUA 1FDVA 4MVJI 5T67A 2VWGA 1HLPA 1DAOA 1EBUA 1SMKA 3DZIA 1VL6A 4KWHA 1LU9A 1C1DA 4CLDA 5HS4A 4HBGA 1O89A 2ET6A 3GN1A 1NHWA 2EEZA 1X0XA 5IDQA 3HSKA 2ZKLA 2HK7A 5TJHA 4XDZA 5EQFA 2QQ5A 3ZW8A 4GX1A 2O3UA 3F3SA 4MVJF 3UVEA 2GN9A 1EBFA 2ZTUA 2V6BA 1BW9A 1T2AA 3IS3A 4D44A 4F45A 4WLOA 3L6DA 1GUZA 2AG5A 3C1TA 2D5AA 3JQGA 3GN2A 5KJ1A 2W2LA 2BI7A 3BAZA 5GZ6A 5C5IA 2ZB7A 1IZ0A 3U09A 2OP0A 3DZGA 4BO0A 4A10A 2IE0A 5LC1A 2X5OA 4M86A 1PWXA 3VZPA 3PEFA 4LVUA 2Q45A 1U3VA 1KC3A 3ZWXA 4CM5A 5CDSA 5IFLA 2OO5A 1ZSNA 4XYGA 5DT9A 3ORFA 4J9UE 4LISA 1ORRA 3EY4A 4EJ0A 1Q0QA 3IJRA 5GZ1A 3G1TA 2AQHA 5K0ZA 3ROPA 4QXMA 4J4BA 3U5TA 1C0PA 1QYDA 3B20A 3CZRA 1ISFA 3MOIA 1LRJA 2ZQYA 4IINA 3BIOA 4B7CA 1T25A 1ADBA 2JAPA 3P19A 3RKRA 1E6EA 1GCUA 3CINA 4PCVA 3UN1A 2X7HA 3OJOA 4OAQA 3VPGA 4PGFA 2VHVA 3NRCA 1P33A 4XYLA 2B37A 3JQ8B 3QY9A 5JMWA 4QTZA 1KERA 1O9BA 2Q2QA 5F1KA 4NJMA 4PLWA 1A9YA 3VPXA 1CRWG 4BNIA 4AVYA 4CLXA 3DHEA 1FF9A 3K31A 3PVZA 1BGVA 3FHLA 2VUUA 1NXQA 1ZSYA 3NT5A 2WYUA 2B5WA 1KVTA 1Z7BA 4URFA 3M1LA 1GEEA 2NTVA 4DYVA 4ZICA 4RVUA 3MZ0A 1YJ8A 4OOFA 4I5GA 2TMDA 3ZW9A 3PWKA 2EP7A 3DXFA 1PTJA 1YDEA 1N2SA 2XPCA 4BV9A 2LDXA 3RC7A 4DWVA 1V35A 4BNTA 4CLEA 4GSKA 1EUDA 4AJIA 5KNLA 3H9GA 2Q2WA 1NQAO 1BW9B 1ZK0A 3PYMA 5H82A 4EUFA 6ADHA 2PY6A 4L9RA 4ALLA 1OMOA 2ZB3A 1HSOA 4A26A 4CMEC 1C0IA 4YAJA 4DBVO 4II3A 1QG6A 3OQBA 1C3VA 1BG6A 1MB4A 3G49A 4FSHA 4WASA 3EC7A 2FHSA 4XGKA 2D0IA 3MJCA 3NDJA 3OMLA 5DBIA 5L4SA 1JLLA 5CG2A 4EGFA 3TSCA 4MIEA 4BO9A 1VKOA 4BO3A 3PHJA 1K5HA 3RC2A 1NVMB 3B1FA 4MIYA 3NDIA 2AMFA 2IRWA 4MKXA 3H9JA 4YJFB 3ADPA 3PGJA 3AOEA 4TROA 1KEVA 4MVJM 3ITKA 5FEUA 4IDAA 1KYQA 1QORA 1B8UA 1Y8QA 4XYBA 4GKBA 4R4JA 3GEDA 3TFOA 4LSMA 1PQUA 1ZZEA 3H65A 2CUKA 2C0CA 5GY7A 2TMGA 3F4BA 3AY3A 2PV7A 1UXIA 1SOWA 2BFOA 1R0SA 1WMBA 1XSEA 2A35A 2CZCA 2YHIB 3Q6IA 3RU7A 1CWUA 3LU1A 4P38A 4UEJA 3UCEA 1DDOA 4FQ8A 4CM3A 4YEDA 2ZTLA 5IDYA 3TN7A 4R1TA 4TVOA 3OP4A 2AEMA 1NAHA 2I3AA 2I9PA 1JQBA 3GNTA 8ADHA 2P4QA 4JIGA 1FJHA 3A06A 5C7LO 3KSDO 1YB4A 4S1VA 5IN4A 4XA8A 1GD1O 4ZD6A 3VPHA 5JO9A 1BVRA 4PG8A 2YJZA 3CSDA 1QV7A 4AFNA 1M6HA 1ISHA 2FPPA 3HZZA 3R3SA 5TJ9A 1Y5MA 1OC4A 1DC5A 5EMHA 4N5MA 5IXYA 1PWZA 1DIAA 4UUOA 5A5EA 1BSVA 4IDCA 2VWQA 3H9EO 1R4MA 3FCOA 1HDOA 2O2YA 1E7SA 4PIVA 3VTZA 4D41A 2H6EA 3K8ZA 3O38A 1A27A 4F3YA 3L6OO 3D3WA 5FWNA 5BSGA 1LSUA 3RUHA 3QWIA 2GO1A 4RLHA 1U8FO 2I65A 3MCVA 4DL9A 4L4RA 2VRBA 1WNTA 4KUHA 2OBYA 3PIIA 3ZDFA 1ZJZA 5EERA 1N92A 1P1HA 2VWPA 4XKJA 2GUGA 1DLJA 3UGKA 3K6JA 3ETGA 4IDDA 5DULA 3L4SO 3A9WA 3FN4A 4AJJA 3IUSA 4IS3A 3UHAA 2YDXA 3E1KA 7MDHA 3DWFA 5A9RA 3PK0A 1IHYA 3WJ7A 4JNKA 4QO8A 1U4SA 3WSWA 1GQ2A 4FIZA 2FSSA 3QHAA 1UP6A 3BHJA 3MTJA 2R2GA 3UCFA 4J90A 3SBOA 5HBRA 2E48A 2B83A 3MOGA 2BKAA 2X9GA 1PZFA 3KOUA 1IULA 1K3TA 3GZ4A 3HDHA 1J6UA 2JFGA 2CSUA 4P4NA 2JL1A 4YR9A 1CQJA 3BTSA 1EE9A 1UJMA 2UUPA 4J0EA 2JD2A 3A28A 1D1SA 4NFHA 1ZSVA 5A03A 4YRAA 3QLJA 1UAGA 5TQVA 3AWDA 4XD2A 2YV3A 1B16A 3RBVA 2PD4A 3KTDA 1LLCA 1PZEA 3L9XA 1R12A 3VVCA 4E4YA 3CIFA 3GPIA 3KYDA 4LSWA 1O95A 3JYQA 1F0YA 3KUXA 2VYVA 3UF0A 1XYGA 5CPFA 1PJTA 1Q7CA 1VJTA 4EI2A 3WWZA 4CQMB 4CV3A 4Y67A 3F46A 1PQPA 4XYMA 4U0KA 5EN4A 3BMCA 4IQ0A 1VKNA 3GEGA 3ONEA 2YYYA 3PXXA 1YO6A 4K6CA 2BGLA 3AUAA 4AJEA 2ZIZA 4ID9A 4Q3DA 3WFIA 2YZ7A 1PJQA 3V1UA 4ALJA 2BFMA 1HYEA 1LQTA 2PK3A 2UAGA 3CH6A 3KZVA 3PRJA 3QVOA 4EEXA 4XJTA 4ZQEA 1N7GA 2OORA 1I5RA 4BS9A 3RUCA 2O3JA 2W2KA 3N7UA 3OEWA 1NQ5A 3ROMA 1UXHA 4RDHA 1NM5A 4L74A 1SB8A 4JX8A 3F9IA 3AW9A 4FJ0A 1M76A 2IYOA 4KOAA 4P4GA 1UZLA 3HQ4O 4IGEA 4AL4A 4C7JA 2WWRA 2EP5A 9LDTA 1E6WA 1N1GA 3AI1A 3F5QA 1KY5A 1A5ZA 4FOSA 3UOGA 2Z5LA 3PHLA 4IDBA 4EITA 1Y5RA 1O8CA 2AEJA 4G81A 4RPJA 1X0VA 1ZCJA 2X86A 4RPGA 1EFLA 5CDTA 4J2HA 1YQXA 3JSAA 3TOZA 5A1TA 2QZZA 5KVQA 1U8XX 1P1IA 2BELA 3GT0A 3OIFA 2QHXA 4YT5A 3TDKA 3DBLB 3ZNPA 2RIRA 3KSUA 4KP7A 3W4IA 4YBZA 1V3TA 1LDNA 1H2BA 3EMKA 2AEFA 4IZIA 4TRJA 4CMKA 3FF4A 1IE3A 2G17A 2D2IA 5F1PA 1GYPA 5MDHA 3GY0A 3QWBA 5DCUA 2PNFA 4B4UA 1C1XA 5L4LA 1V3UA 1ZFNA 3WSVA 2X58A 5ICMA 3DOOA 2GF2A 1HETA 3VC7A 1W0CA 3ZV6A 4BOYA 1ZXLA 4FCCA 3QWFA 2ZB8A 4I1IA 2IEBA 4FD3A 4UULA 3SEFA 2HCTA 5I7SA 2H1SA 2J6IA 3C7CB 3SC4A 1BHSA 4K1LA 1M67A 1HE3A 4MKZA 3JV7A 1V8BA 4PVDA 1NX6A 1OC2A 3DQPA 3PIDA 2PH3A 3GR6A 2PR2A 3AM4A 1YBAA 1I3KA 3LT2A 3W8FA 2Y0DA 3HDQA 1DLIA 1QR6A 2CVOA 2PZMA 5EL0A 4BNKA 3NYWA 3RIHA 1D8AA 5DCYA 3LK7A 3GNQA 4O1MA 1ZVMA 3JYLA 1E7WA 3HG7A 3WX0A 1T2CA 4MVJH 2WTBA 5L3ZA 4WCFA 2JCXA 3ZHXA 2EIHA 4P4LA 2CNBA 3E9NA 3FPLA 5JO0A 3GK3A 5A3VA 3BHMA 3WGIA 3GAZA 2O3SA 1S7CA 5HWSA 3RUFA 2HSDA 1LXCA 1BDBA 3H2ZA 1W6UA 1YL6A 1AUPA 1DRWA 3HB5X 1RYDA 4RF3A 2WD7A 4RVHA 5JE8A 5B4UA 2HJSA 2QRJA 3GPDG 3BYZA 1PIWA 1WDKA 1Y9EA 3FNGA 4ZA2A 2FWMX 4IGFA 4A73A 3MJEA 1GL3A 1R66A 2GZ3A 2DLDA 2NLOA 1TLTA 5JFOA 1E77A 1DEHA 3BXXA 2PGJA 1ZBQA 2E37A 3CTVA 1WZEA 4PG4A 1K6XA 4WLNA 4PG7A 3TWOA 2P5YA 1E3EA 4L4SA 1C14A 3TPCA 1VM6A 1O0SA 3BMNB 3ZWOA 3PHGA 1YRLA 5A9SA 3AOGA 3U4CA 1ZK3A 3PZBA 4NBRA 5TT0A 4GVLA 2IXBA 3WBFA 3B1KA 4ESOA 3V1YA 4JP2A 2EHDA 2Y1EA 4BO2A 2D59A 1KVSA 3OJEA 2Y99A 3OQ1A 1ADGA 1H2HA 3ITDA 4ZQHA 3FR7A 3JQ7B 3VOSA 3H5AA 1T1RA 4PZEA 3T7EA 1YWGO 5JAZA 1AHHA 3GH3A 2Y93A 4IIVA 2CD9A 3JQDA 4NHEA 3GMSA 4CQLA 1ENZA 1YOVB 4NBWA 4BB5A 1XG5A 1K6JA 4R3NA 4GAEA 4NFYA 4N5NA 5JDCC 2PKQP 2DAPA 1JA9A 3A4VA 3IC5A 1GYQA 4NK5A 2ZYGA 4TMFA 3RASA 1YQDA 3GVCA 5BNFA 3VHRA 2QRLA 4FC6A 4WLEA 1E3SA 3I52A 4YJGB 2O4UX 1N9GA 1XEAA 2I76A 1EUZA 4DQUA 3PJFA 1E1MA 1GAEO 1PZGA 2EJWA 3PP8A 3RFXA 4CR6A 3RKUA 3UW3A 3ETDA 3OECA 2HMUA 1ZUD1 3GGOA 4YVFA 1LSSA 3GUYA 5T64A 3ZV3A 5DF1A 1P44A 3WGZA 3CPSA 3DZJA 2FMUA 2ZCUA 4XQCA 3GLQA 2IXAA 4DLLA 3NUGA 1I2BA 3Q0EA 2P9CA 1TXGA 4FJ1A 9LDBA 5MGBA 1DIGA 1ZO8A 2B35A 2ZATA 2DVMA 1XU7A 5G4KA 1U3UA 2PD6A 2GDZA 3TZ6A 3QW2A 2B4TO 4NK4A 3G0OA 2GERA 1YS4A 3GMDA 3BMOA 3MJVA 1DJQA 1AN9A 2BHLA 4R9SA 4Z9FA 3K73O 2PKQO 5CDYA 1ZK4A 1KC1A 4BKPA 1A9ZA 2DKNA 1DSSG 3NDRA 4MVJD 2X9NA 3RBXA 4MIOA 2FR1A 3S2EA 2P5UA 1JU9A 1DPGA 1LC3A 3HFGA 2NVUB 3LT1A 1JWBB 4IM7A 2YDYA 3EZLA 3MJSA 1R15A 5A9SB 5JNLA 4KUGA 4R69A 5KTKA 1SNYA 1S6YA 4OIMA 4TKLA 1DOHA 2SCUA 4FFPA 1BMDA 5I9NA 1ZNQO 1UZMA 3ZCXA 3LC1O 3IDSA 3EDMA 4LGVA 5KJCA 3INRA 1VSUA 2E6UX 1YONA 4HADA 3WLEA 3DMTC 1UP4A 3MWEB 5HM8A 1YKFA 2NNLD 4E5MA 1ZMTA 4S3MA 2YUTA 1MA0A 3QA9A 1TA4A 4UUNA 5B12A 3X2EA 2J3IA 4MP3A 5G0SA 4KWIA 4KDEA 3WWYA 4DPKA 1PJ4A 4NZ9A 1WP4A 3UCXA 3DEYX 1VJ1A 4QO7A 1C0LA 2Y67A 2XF8A 2GZ2A 4NG5A 2WD7B 3WQQA 1LTHR 2NU6A 1JVSA 2RH4A 1HWYA 2HMVA 4A7PA 3LT4A 4CLRB 4Q9NA 3VZRA 1JAYA 1HL3A 3Q9UA 4BO7A 3JQFA 1T2DA 4L76A 4M54A 1NFQA 4NH4A 3QSGA 4E31A 4AJOA 1F06A 4BO6A 1P1RA 5JLAA 5DBGA 4M55A 4DLBA 1PL8A 3NX4A 3BMQA 3VKVA 2G76A 1T24A 2J5RA 1IB6A 1LNQA 2X0IA 3OBBA 5FFFA 5IDWA 1P31A 4GLLA 1NTOA 3JD0A 2BGKA 2OL4A 2Q4EA 3WYEA 2QZ9A 1ULUA 3PQEA 4YQYA 4YJHB 3DFUA 5KJFA 1HEUA 1UDBA 4GX5A 4PLYA 1U2DA 3PQDA 1CQIA 4M1QA 4XX0A 3INTA 5TNXA 3P2OA 1HLDA 2BGMA 3T4EA 4R1NA 3ULKA 3HNPA 4B7UA 4HNHA 5ILGA 2FRDA 3S2IA 3AK4A 3ASVA 1Y81A 3WBBA 3T4XA 1PGQA 1XWFA 4CM1A 3AFMA 3S8MA 5I8WA 4OL9A 4ALMA 3RUIA 4CL8A 4M49A 2IDZA 1GUFA 5DP1A 3OJ0A 4M87A 5A9TA 3I83A 4G65A 3FBGA 3RQSA 4B79A 3F1KA 2A4KA 1U9JA 3OH8A 3ANNA 3HN7A 5EESA 5BNTA 4NJOA 3I9OA 1LRKA 2NU7A 1LDBA 3SC6A 4D42A 1QV6A 4CPDA 1KS9A 4MP6A 3F4LA 5T8KA 4AJ1A 4WE3A 2W98A 4J4HA 1IHXA 1WMAA 2CF5A 4UAGA 2PKRA 3W4KA 3SLGA 4W6ZA 4DQXA 4RF4A 2CDAA 4HUJA 5DBFA 4RQUA 2O2SA 3ZHYA 5ES3A 5JC1A 1SEPA 1T1SA 4UVGA 1E3WA 4PZCA 4EYEA 1L7DA 4R3WA 4RPLA 1ARZA 1MUUA 1EMDA 3LC7O 1LQUA 1EFKA 4G5HA 4R1UA 5JDIC 4O6VA 5K9ZA 3KLMX 3ZWPA 1I24A 1MLDA 3GRPA 4IJKA 4FB5A 3C24A 5BSEA 2Z95A 4HFJA 3QVXA 1X14A 3B6ZA 3AY6A 4P8RA 2I3GA 4Y6RA 3U0BA 2NQ8A 4KMSA 2X23A 3WR5A 5JYDA 2J3KA 1CERA 3QE3A 4OQYA 4DMLA 1PJ2A 5IZ4A 1HRDA 4DA9A 5JCXA 4W7HA 2HKIA 4A5OA 1BDMA 1HE2A 4N5LA 3WMWA 3FNFA 3FWZA 3VH1A 4FFRA 3U3XA 2VHWA 1KETA 2W2LD 2YFQA 4R68A 1P1KA 4C4OA 2HQ1A 5TX7A 4BVAA 2EERA 3GFBA 2FSVA 4XQGA 3JCZA 3EUWA 3LYLA 3BMCB 5K6AA 4TRMA 5A4DA 2E82A 1H9BA 3AM3A 1P3DA 2Y68A 3PHHA 2XOXA 2X0JA 1B3RA 1EK6A 3FTPA 4ZVVA 2HK9A 3V2UA 4FN4A 3E5RA 4FFLA 1EUCA 3BTOA 5H81A 2HUNA 4OKNA 5COBA 4B4OA 3C1AA 3T7CA 3ZN2A 5JDIA 4RVSA 4GVXA 2O50A 2Y1OA 1Q0LA 3GZNA 4AJ2A 5KIAA 2NSDA 1MXHA 4R5HA 1M2WA 4B7XA 8LDHA 1YB1A 4E5NA 5CHEA 2HJRA 4J7XA 3PLNA 1I33A 2AQIA 3PDJA 4CM7A 3S55A 3MTGA 3K2BA 3KYBA 5T8KC 5ENDA 1ULSA 4MDHA 4BGEA 4IMRA 1R0LA 1BXGA 3RUDA 4IMPA 5ADHA 5AXAA 3TRIA 3GA0A 4O59O 5G4KB 4L8VA 3ASUA 2D4AA 4R16A 2W4QA 3BHIA 3GVIA 1YBVA 4RZHA 2GASA 3PTZA 3IKVA 3RJ9A 4J3FA 5B1YA 3LF1A 1P1FA 4BO4A 4CUKA 2RCYA 3JQBC 3I9NA 1H93A 1RKXA 4GX2A 2IZ1A 5AYVA 3TF5A 4A0SA 1HZZA 2Q46A 3ETEA 1QRRA 1Y8RB 2FR0A 2H63A 5LDGA 1DXYA 3F47A 3KYCB 2QX7A 3KEQA 4LRTB 4R54A 2AA3A 2EKLA 4DUPA 4NBTA 2NWQA 5KWEA 4BNVA 1J49A 3H9UA 2Q1TA 3RCBA 3PWZA 2DPGA 2JD0A 3U4IA 1DO8A 3EAGA 1Q0HA 5EPOA 1LRLA 2J8ZA 4QEDA 3DMYA 5CEEA 4DC1A 2X5JO 3LZ6A 3OM9A 3ZU4A 4YT4A 4M89A 5DZSA 2EXXA 5T57A 4ND4A 5I9MA 4XB2A 3ANLA 4PLVA 4DMMA 4CQLB 2G0TA 3KVOA 1T26A 2AG8A 4CR7A 4FJ2A 4HFNA 1E7YA 2GD1O 2ZYDA 1Y1PA 1RM5A 3CZMA 4XQ9A 3WICA 2VN8A 5CFZA 4XR9A 3ZU5A 4OSOA 1X7DA 4MVJE 2HDHA 5L7WA 3BTVA 4YAGA 4JROA 3PYXA 1F17A 2VWHA 1GZ6A 1VC2A 1N8KA 2EKQA 1HE4A 2X9VA 4IY1A 4U0JA 4BQRA 2OHXA 4Z6KA 1BWSA 1J5PA 1VE9A 4UEKA 1F8GA 2YW9A 2CMDA 5FI5A 4EDFA 3HE3A 5THKA 3LQFA 4Z9XA 2DTXA 1Q2XA 5L95A 3GRKA 1MFZA 2GR9A 5KOIA 5AVOA 4WOKA 5F21A 2WE7A 1CJCA 3DBRA 5TS3A 5L7YA 4BKOA 3Q11A 4YT8A 1ONPA 5HA5A 2V65A 4JJIA 3UAGA 3E48A 4XR4A 4DVJA 1E1NA 1OAAA 1UAYA 3K96A 1X1EA 4FFOA 5BSHA 4QFCA 5IAAA 3RU9A 2PTGA 3K2EA 4YACA 1UP7A 4RZIA 2C54A 5EJ2A 3EHEA 1LDMA 3ABIA 4BNZA 4HV4A 1RJWA 3N74A 3WQRA 3U9LA 3WGTA 1EZ4A 1SOVA 4CMHA 4BNYA 2Y66A 1GQQA 2NVBA 3GUCA 3ZWAA 3PHIA 3VAZA 3OF2A 5KKCA 1QYCA 5TSDA 1WWKA 5B37A 4R51A 2DM6A 3DAGA 4ZJUA 5K6AC 4U8GA 5JCJD 3E8XA 2IYPA 1PS8A 2DFDA 1GY8A 3WXBA 4E30A 3DBRB 3Q3CA 4Q39A 4OKIA 2VOJA 5BSFA 5G2OA 2AXQA 3WOHA 3AU8A 4Q3EA 4CUZA 4Y6SA 4EJ6A 1PJCA 2NU9A 3K9QO 2Y1CA 1GEGA 4W9NA 3WYBA 2C29D 1G0OA 3SVTA 3WYCA 4CMAA 1L7EA 1J4AA 2V6FA 2Y0EA 4C7KA 4PVCA 3IIEA 3RUEA 5IN5A 1MP0A 3RC1A 5IJZA 5DDIP 5JSFA 4JN6B 1NFFA 4NDNE 1A7AA 1T4BA 3UUWA 3NV9A 1K6IA 1ZK1A 4Y8VA 3DHYA 3G3EA 2X0RA 1EQ2A 4BGIA 3DAFA 1W73A 4MKRA 4EZBA 4DTIA 2VTDA 3JQ8A 5ICSA 3JD2A 4ILKA 1SBYA 2NM0A 1PEDA 2WM3A 3DFZA 4JLWA 4DQVA 3TZCA 2WYWA 4W7IA 4J7CA 1TT7A 1PGOA 1GV0A 2WE8A 2J5KA 3M2TA 3GDFA 5CP8A 3IP1A 4CMCA 3EGOA 1E5QA 1LC0A 1QYWA 2FPGA 3JD3A 3P7MA 4GLOA 4ND5A 4CV0A 4DIOA 5ITWA 3WDSA 1Z82A 2X0NA 3U4DA 4ZRNA 1Z74A 2Z1NA 1HDYA 1FDSA 1Q1NA 1Y8RA 1I10A 3DBLA 4B3HA 4Q3NA 4BNJA 4RJTA 2DUUA 1HT0A 3Q9NA 1DJNA 2J3JA 3DDNA 1YH3A 3FI9A 2VZ9A 3BA1A 2JHFA 1E3LA 3KO8A 4FGSA 4II2A 3U49A 4F6LA 3U4HA 2ILTA 2VUSA 3CMMA 3V2HA 2R00C 1G6KA 4J91A 4E5YA 1I2ZA 1PS0A 3NT4A 1PR3A 4OXYA 1QYXA 2Y05A 1PZHA 3UFXA 1L1FA 4QT0A 1NASA 3JQGB 2EF1A 1WAMA 2EV9A 3UXYA 3VDRA 4JK3A 1DRUA 2X4GA 4CM4B 4IDGA 1JKIA 4NIMA 4LVCA 4YDRA 3GZNB 3BZUA 2W2KB 1I3LA 3LF2A 5JS6A 1I8TA 2JAHA 1X7GA 2XXJA 4H16A 1ADFA 3X2FA 1UZNA 3DB2A 4WOJA 2HU2A 3BTUA 3JTMA 4OJNA 4JBIA 1QLHA 4HP8A 1YXMA 4Z0TA 3JQFC 1HYHA 4DLAA 1I01A 4LW8A 4AJPA 1GZ4A 3QJ5A 3I9JA 2Q1UA 5DNAA 2C5AA 2WJPA 3L0DA 1NWCA 1WLYA 5FYDA 4E2WA 5LDHA 1MGOA 4UVDA 4RL6A 4CMEA 4IDFA 4DIFA 3EVNA 1MFPA 2Z1MA 2X6TA 4E2YA 4PLPA 4KZPA 4QFDA 4XWYA 2UV8A 5F5NA 3ICPA 4PN3A 1HSZA 1RYEA 1FDWA 2I99A 2ZYAA 1NQOA 1YE3A 1B14A 2GSDA 4R01A 3R3JA 4UUPA 2O3TA 4BNMA 5A04A 2VQ3A 1V3VA 3IL2A 1NR7A 3OA2A 1MXFA 3COSA 4CM4A 1HF3A 4D3DA 1O5IA 1ZEMA 3L9WA 3TZHA 1KBZA 1U7TA 1WDMA 3KB6A 4WCDA 4RF2A 2C20A 1W4ZA 1JAXA 2AE1A 3M1AA 3FRJA 3H5NA 3NTRA 3INGA 2HRBA 2ZQZA 1ISJA 4I5DA 3ZWCA 4NPCA 2C82A 2NVWA 3ONFA 4WLFA 1PR9A 3WGOA 3VZSA 4WUVA 3NKLA 5DOZA 2I67A 2ZB4A
chains in the Genus database with same CATH superfamily
4EW2A 1SVNA 4XB1A 1U0FA 2A9FA 1C2YA 3DW3X 4N18A 1ZH0A 3AVWA 4CFYA 5JY1A 2J48A 2IY9A 2C0QA 1NJ2A 4NE7A 2JBAB 2WQ7A 1M2NA 1LF5A 5IX8A 4QYSA 2VYND 5CGZA 2O1WA 1D2RA 1Y5LA 5IG2A 1A82A 1BXZA 1YACA 4G9BA 3NKFA 1EHIA 4H7JA 3WMXA 4R2WA 1M6EX 3KSRA 4JLAA 4X24A 4DC0A 4F4CA 5BV8A 3OZUA 3ZTYA 3UBMA 4FBGA 2I03A 4JR1A 3MB5A 4UZEA 1E0DA 3ONDA 3I45A 1CDOA 1WCIB 1ISIA 3BD7A 4HQOA 1G8JA 1Z6TA 2XOKD 2J46A 2JJ1A 3DUFB 3GI1A 4BNLA 3J7AC 4FDMA 1JDNA 1XMOB 4U2CA 2AB0A 2J7PA 1UAAA 1YF3A 4BVJA 1PVDA 3L8GA 1JDUA 4HTAA 4X1OA 1QIEA 1NAIA 1AHPA 1JEYA 2IYXA 4ZRDA 5CCEA 1HO3A 3MYYA 2OV6A 1TKCA 1SCBA 2J3DA 3N8IA 3BUSA 4UXIA 1V37A 1DAKA 2WHPA 3FHOA 5ETJA 5ESXA 2YV5A 3AU9A 1MAUA 4IV5A 3E2IA 2FSGA 4ACBA 4IDHA 4O5OA 4DW8A 1W75A 1OBFO 2CGEA 2BFFB 2ZIXA 1KO7A 4FDUA 4XRGA 3CNNA 3UWKA 3MPUA 1Y3DE 1X70A 4M1MA 1BXKA 1H8HD 1W29A 5DNCA 1BKYA 1XKTA 3VI3B 1OI4A 2P6OA 2BP7A 4B3SB 1XRJA 3KFXA 3ROGA 4D9GA 4MYDA 4W5OA 2E4ZA 4CTKA 1R00A 1TJ3A 5L53A 3TRJA 3LYHA 2JI7A 3QXGA 2PLRA 5DIFA 3EVCA 1S96A 3OOWA 3W9UA 3MTIA 5L4NA 2GM4A 2HEGA 3AEUA 3I5MA 1OLSB 1DJOA 2A94A 4RKQA 4BLPA 3LY8A 5NULA 4V1CI 1E1QD 2ZANA 1CNFA 4DCMA 2XZLA 4F7DA 3ZWWA 3G13A 4OO3A 1NPDA 3BDIA 3GF4A 3Q1KA 3V42A 4V0KA 5C8ZA 1XPRA 4JI7B 4YJFA 2MMCA 5BPFA 3D2AA 3DE7X 3A58B 1GZ7A 3IE1A 3OQHA 3TAUA 4XGIA 4YAUA 1H6AA 3T7SA 1YDGA 4EB6B 4P3KA 3REQB 4MCJA 4C2AA 2G9ZA 5AJVB 2JHGA 2RONA 1JLLB 2CVHA 1GR0A 1QLJA 3SLRA 4BNUA 3ETCA 1Y5IA 5M29A 4JXKA 4U6NA 4QBFA 4DB4A 1IUPA 1PD0A 5CA1F 1RI3A 1R0WA 4YDQA 2JVJA 4IH9A 1AQYA 3HRHA 4RIIA 5EIOA 3DHNA 2JCYA 2JHAA 2VZ8A 5KYUA 2IQIA 3GJ4A 2JG3A 3B3FA 4Q12A 5AJXA 5ALDA 4FN5A 1GXSA 1RD4A 1QTIA 2NXJA 1AM4D 5JISA 2ROQA 2VC2B 2ZWAA 3L77A 5LBIA 4Z4FA 1G17A 4LXXA 1CULC 3L84A 2P9FA 3TM4A 3VR5A 4FNMA 4WEOA 1NXWA 2HF7A 2BLLA 2C03A 3JYOA 1D0SA 4HRAA 3AONB 2OXEA 1VPLA 4I9HA 4UXJA 4JBGA 1OGJA 4V2UA 1BFKA 1FRNA 1T35A 5LQUA 2H1LA 3IQHX 2C7GA 3EC1A 1QC5B 5FB3A 5CEJA 5HTOA 4QTXA 3G8YA 2BM0A 2WRZA 4KPGA 3FAZA 4R2XA 2NUAA 4OA8A 2QEQA 4F97A 4RFSB 4WZAE 3ST7A 4BQEA 4H6XA 2X8LA 2G82A 1N33B 3BIXA 4TTIA 3WTBA 2IK8A 2J9FA 3WTCA 3WAKA 1AX9A 1AQJA 3RRNA 2AQKA 2B4QA 2QN6A 4NJMB 13PKA 2GRJA 4KQIA 3KVYA 2VHYA 3HDYA 4LNHA 2N9UA 4RK4A 4YP9A 4X91A 3EWSA 1SBHA 3RNOA 3TE7A 4LMAA 5CA1B 2QX4A 4LJ9A 3ZU3A 4E0BA 2B6NA 3GAFA 2PXXA 3R3YA 2O6LA 1RZRA 4QX6A 1UDXA 1QG2A 3VC1A 2WU8A 1MB9A 2UUBB 1K7YA 1O54A 2RFLA 4EABA 2WSIA 2CFTA 4P4UA 3NT2A 1LNZA 4P9NA 5J43A 4OBXA 3D3KA 1TIKA 2YJ4A 2I71A 4EYKA 2ZT6A 2IGBA 4ARSA 1WXHA 2XQKA 3D4PA 3OT1A 4DF3A 2J30A 2NV2B 2ZRJA 1Q84A 3BC1A 3KYCA 1RU3A 1G63A 2UUOA 3HCEA 4B4VA 2JI9A 3A6ZA 4IJUA 2GXAA 4HB4A 3TTTA 3OEYA 1WMFA 2GX6A 1DWPA 2I80A 1OZAA 1PEYA 2UYGA 4OXNA 1MOPA 1V11A 3PZRA 4GZLA 2CFCA 4BECA 1TQ6A 2WVAA 1C9YA 2CJYA 3C6MA 4RE6A 2CDCA 4BEWA 1M73E 4CKBB 3GEMA 1DEOA 2NZXA 5IXJA 2ZJ2A 1IG3A 2R4TA 3AYZB 2PTHA 3DBOB 2ZAYA 3DC7A 2BEUB 4UOZA 2MYNA 3A7DA 5LJLA 1R0XA 3UJ6A 4JB8A 4WNCA 4INAA 5BO5A 3ZDRA 3ZEAA 1U2DC 3CC8A 3SQDA 1VKHA 4KKXB 5KWVA 4TTAA 1WV0A 3I23A 4PPQA 2YJNA 4M0EA 3RS5A 2PGNA 3NTLA 4F5WA 1K7FB 3OHMA 3HU2A 3VR3D 2OEPA 1JFTA 2V7QD 2XXBA 3AOEC 5ELXA 1C7QA 3WDLA 1N6RA 1TL7C 1VMEA 4U7HA 3WIDA 4C3ZA 3K1ZA 3ZNQA 4L73A 1Q50A 5T6BA 3VUEA 3ABQB 2GHRA 3NJ4A 1Y9JA 1NUPA 1RKQA 2E2WA 4DR4B 3KV3O 1OZ0A 3ZHUA 2DCMA 3F74A 2DWQA 4BX3A 3W3AH 4D81A 4X45A 1J20A 3B3GA 5IYZF 1IN8A 4KAJA 1ZAKA 2BKEA 4YCNA 3AILA 1XXHA 2ZTVA 4QBTA 3FYCA 2Y3IA 2MYPA 4DZZA 1W35A 4ZANA 2HD4A 4UEQA 3VV2A 2O54A 3MOSA 3CPJB 3GLRA 4G9GA 1DO2A 3WQSB 4Q4DA 2DBVO 3UJPA 2REXB 5FUMA 3O8QB 1PI3A 1NN0A 3IA7A 1M2HA 1N5LA 1CUJA 3IPYA 4K88A 2LKDA 3LUKA 4PG6A 2PBZA 3CLKA 5D3ZA 1JPUA 1IHUA 5CCDA 4B47A 3O93A 1O2DA 1J0XO 3A70A 4MAAA 5CK4A 5FFMA 5IDXA 1JIQA 2R8YA 3ICWA 1VG1A 3TIVA 4HNQA 2FY8A 3H4TA 4YO7A 4OHYA 4ZQBA 3ICQB 3GEEA 3IAFA 1SUBA 4YCLA 1XZCA 2A14A 3CM0A 2ID4A 1EFPB 4PZAA 5BN4A 5LU8A 4DCOA 1CR6A 3DAPA 5FTKA 2XVAA 1G7SA 1ONBA 2R1VA 2RHCA 1NNUA 1E6UA 3ADOA 4KAXA 4FFMA 3PDIA 4E2XA 3TGWA 4GXNA 1XYYA 4JFAA 1ENPA 4J8PA 3V1KA 5AXBA 1U90A 3W8DA 3GCZA 2P2ZA 4W5TA 3DDSA 4QU5A 1SBQA 3P2MA 3OO0A 3AJAA 4P7FA 1FS4A 4Y9DA 3O4RA 4DWJA 2C4KA 3A1DA 1S2NA 5C7IO 3WI7A 1P2UA 2D06A 2GLXA 3EYWA 5CVJA 3ZZMA 1C4OA 1S8NA 1DJLA 1TT5A 4IWXA 3BE4A 4BMYA 3TMKA 4NF2A 2QRVB 2XGOA 4JKYA 3O9ZA 4HSGA 3R4VA 3JTEA 3RWOA 2Y1DA 5KQSA 4HVAA 1ESNA 4OCZA 2AUMA 4U7WA 1D09A 5ALPA 4C6TB 4KIJA 5HZKA 1FDUA 1NN5A 4UW9A 1WZNA 3WS7A 4Q3LA 2GGSA 5K03A 2C8LA 5ULLA 1QZTA 1GTMA 4EJMA 1Z39A 1QOQB 4G5SA 4BE7B 3N2ZB 3TLZA 5BWLA 4QAQA 4C0XA 4G01B 5ESDA 1QP7A 3BA6A 3DULA 4ATNA 5AKZA 2FB9A 1SC4A 2BR3A 2HO5A 2QVBA 3H2YA 3IJPA 3JARA 5KVCA 3PJRA 2DERA 1ETHA 2QTVA 1RKUA 5HIAA 1DAMA 4CR8A 5JAUA 3CZCA 2HBYA 2H17A 4X54A 2FUNB 4U5XA 1CYDA 2QS9A 3A31A 1KR5A 2YV2A 3OTOB 5L3QB 5LZ5A 2IX3A 1EIWA 1XTUA 2BSXA 3F6EX 1PW5A 3FH0A 4TTVA 2NV0A 4BU1A 2IW1A 3AI2A 1SPBS 5I9IA 2IPAB 4Q34A 5H3HA 5LA6F 2DQ4A 4M8IA 1W19A 1J09A 4HJXA 2P91A 3ML1A 5FJJA 3SBXA 2XCRB 4CM9D 3THXA 1D6JA 2JFPA 5JBNA 3ED1A 3E18A 4AG3A 1U4NA 2XR1A 1UMDB 4UARA 4Z7QB 4AIIA 3PQ2A 3GGSA 3DE0X 2IUTA 5DK6A 1JHMA 5HP4A 4RLFA 2ORVA 1YZHA 2CHEA 1A72A 4Q21A 2ZKIA 4U2EA 1B15A 3E70C 1MIOA 3MWYW 3D4BA 3RJ5A 3SD7A 3W9BA 4CJXA 1NVGA 3SYRA 2PUFA 1U98A 5DLDA 4YC7A 1CFJA 1GPAA 3GRZA 4F04A 3G5LA 4B6JA 1X86B 2AHOA 5ALIA 2OHOA 821PA 2B21A 3NHRA 3WRWA 1H0HA 3DPSA 4R9NA 4D3FA 1UK7A 4P3OA 1I2CA 1KDOA 2ZUDA 3M3HA 4B4DA 4GL2A 5AKYA 4HGRA 1NBMA 3V4OA 3O3OB 3BMQB 4RFLA 2I4TA 1LTQA 4OQZA 4QSMA 5A4IS 3KYJB 3C6QA 3HUDA 4LKRA 1GADO 3H8VA 2C1XA 4V0NA 1JEEA 4NOLA 4ES6A 1G38A 1AS0A 1CUVA 1NP3A 2CVQA 4YJDA 3QU9A 1SIWA 3L7KA 3D4OA 3EH1A 2Z2IA 3IFSA 2QQEA 3DBVO 3Q6NA 1T2FA 1YL5A 3VDXA 4N41A 4CM9A 3ZTWA 1AV6A 1EVZA 2P2SA 4MP8A 3VH2A 3KSZO 1I2DA 3AHFA 2NOGA 1YZGA 2AI3A 1LSJA 4Q3CA 4UASA 5CVVA 3UV6A 5DNDA 2ZBDA 5DCWA 5AVJA 1FJGB 2JD1A 2C3MA 1HG1A 3OOYA 2F6RA 4OB6A 4RSRA 1KZ4A 3MJTA 3WLOA 1LI7A 1HA3A 2QXYA 3A05A 4I8XA 1WD7A 1JDVA 1I9GA 3TS1A 2VJCA 3G89A 4R0MA 3REFA 4U2GA 2A78A 4FUQA 1CVRA 5EIBC 4F85A 3M2PA 3NM5A 1T0IA 1MZPA 1XP5A 2PXHA 1T9KA 3VHQA 4QBIA 5HKLA 1UFOA 2G5CA 3ROKA 5BQOA 3CMCO 3COZA 3T3GA 2GXSA 4B9EA 4JB3A 4EUHA 3M1YA 4N5IX 2BEWB 2XQVA 2V6MA 1BDHA 4KACA 3ZCQA 1ZX1A 4I4NA 1ZVQA 3UICA 2DGDA 2I2FA 3TBFA 4Q48A 2I7XA 1OJLA 1PL6A 2VJMA 2ZWVA 3CLHA 5DLQC 2QD5A 1NBOA 3ZKWB 3LBAA 5FL7D 5KREA 4LF5B 1IJEA 2C57A 3U7QA 1JTVA 1Z0ZA 1TJPB 1XVAA 4G5XA 3EEYA 3QOYA 2SCUB 3NGXA 3K6RA 3KBBA 3WNCA 1W2WB 1XRNA 1ZH4A 5E9AA 1SB9A 3H8WA 3HK2A 1TVEA 3L0ZA 3BL5A 4QULA 3C41J 3QMMA 1XMIA 1UBNA 2JI8A 5KC9A 4GSLA 1OXMA 1T9DA 2WLSA 1W4AA 3BFJA 1OX4B 3F6PA 3CWQA 4D4IA 1Z2EA 1C50A 1II8A 1JH8A 5CB8A 2NV6A 2PA0A 3FUUA 2HK6A 3KLPX 5E6RA 3GOHA 1XAGA 3O9MA 2DH5A 4LWZA 2Z3VA 3WGYA 3D4IA 1R37A 4DA8A 1IUOA 4JQCA 1FQJA 5KTNA 4JLJA 3FB1A 4BLRA 4OHZA 2HWWA 2HTFA 1F3LA 1H42A 3SJAA 1DC3A 3EULA 1E3JA 1E20A 5HCUA 2WK1A 4X8MA 1I0ZA 3L02A 1RM4A 4FS3A 4CN9A 5LSAA 4DR3B 5JHGB 1E9SA 1RAEA 3I01M 5IBCA 3WE7A 1E89A 1K7EB 3PPXA 1JDJA 5JTTA 4EW3A 3C3XA 1QKJA 3TD9A 3ZWNA 4O63O 4QODA 4WRRA 4DYDA 1MPTA 3U7HB 3V8VA 4D6PA 3EFEA 1HDRA 4ZO6A 1RWWA 3OPYB 1G8PA 2LZ0A 2F64A 2HMAA 3MS7A 4Q4JB 4HJRA 1QHYA 2PD3A 4JBHA 1P18A 4JV5B 1D7AA 1NBEA 3ROZA 1DKRA 3G0BA 3S5UA 1AQLA 3AJRA 1XE3A 4NENA 5KVVA 3I6YA 3SYLA 4AKEA 1Y42X 4RZSA 3G2PA 5HFJA 3E2MA 4B3IA 2OZLA 3ZXYA 4M9XA 1HQCA 1IONA 3RLIA 1Y3BE 4RCVA 3ZJ5A 2HMTA 1GU7A 2P4EA 2PXCA 4GWKA 2Y27A 4OP3A 4U3JB 5KQMA 1R6DA 4BKUA 1M33A 2GPJA 1MGPA 4UUAA 3R9WA 2QMQA 2W8ZA 2WPDD 1TLFA 1VP3A 3I34X 1JQEA 3OURA 5JD6A 4TM7A 4BCCA 1MKYA 4MPDA 2QN1A 2ZS7A 4TVKA 3ZE0B 4DRYA 3KHUA 4GMDA 4DIDA 1RTTA 4MGZR 1XU9A 1ZL2A 1Z0SA 1LB1B 4DV4B 2DR2A 3RABA 4JOCA 3B70A 3UANA 3DEJA 2C7QA 3TCNA 4DB2A 1FTYA 2W6QA 3KB2A 3IP3A 5DX0A 5C35A 1JR6A 2G5GX 4AUKA 4F4IA 5F3DA 4GBJA 5AESA 4YJ2F 1W34A 3IGFA 4BN5A 4XUCA 2HRRA 1ADCA 5C7OO 2AKAB 3C3CA 5KSZA 1LLQA 3GJ6A 3V6MA 4DRXB 2FSUA 2OUKA 1ZISA 3LI2A 3PFCA 1FZTA 3HCPA 2J7KA 1MG0A 1A95A 3AI3A 5LD2C 4MCHA 4BAGA 3IUQA 1CX9B 2GN8A 3EMVA 3F7OA 5E6SA 2O06A 1K8QA 4K9DA 4W4TA 3SQMA 4KFSA 3LP8A 2BE7A 3RYHA 3TFWA 3K9LA 1T9GR 5B3KA 5K2MA 1RPNA 2D0OB 2DE0X 2JLWA 1EDZA 4AURA 2X19A 3HWWA 3LHSA 2HMSA 3DKVA 3NCHA 4U2FA 2VP0A 2PV0A 2R00A 4XRRA 4QM6A 4LOHA 1EFTA 1Z4LA 4G25A 1BC5A 1T6BY 3ZY5A 2YNMA 3QE4A 3D4NA 4PPGA 3NHKA 2I1LA 2PT7A 4HH4A 5F5LA 4J1TA 3EVBA 5FI0B 1RWBA 1FFSA 2AHRA 1E3IA 5G0VA 1N9KA 2YWXA 2OQVA 2GM9A 2RGNC 3CZ9A 3OX1A 1Z37A 3UH0A 3MMPA 1KFCB 1KEWA 3KK0A 1V4VA 3ABZA 2G4VA 1KU6A 4FR5A 4ZO9A 5FBKA 3D3EA 3PFIA 1MX3A 3O74A 3D59A 2R8RA 1JV2B 4FC7A 1LJ8A 1XCPA 2J9YB 5A6SB 4CZ2A 4DE5A 4CLOA 1UPCA 2Q07A 2YIMA 3RFVA 1JKJA 3FFAA 4QDOA 1N3YA 1HDEA 1TA9A 4LZZA 3K70D 3BWCA 1JLMA 3TO5A 3UK0A 4UC0A 1RVV1 3KQYA 2FNAA 2A2ZA 4KLAA 3MELA 1V41E 3IBSA 1G4HA 4MLDA 4GQBA 3WYGA 4Q1EA 2XMPA 3P0FA 1S89A 4WCFB 4IIYA 1TYAE 3WGLA 3PLRA 5DISB 3MAGA 2WICA 2HBRA 3I4CA 4WMLA 1QFSA 1TJ5A 4A15A 1FPMA 1TI7A 5ER9A 1VKRA 3W5SA 2H0QA 4NAVA 3RAPR 3U7EB 1OFIA 1ZNXA 1C9JA 2RG1A 3K4QA 3O92A 2GSWA 3BFKA 2VHXA 4Y6PA 1YE5A 4CQMD 1RYHA 4BO8A 2WYHA 3OIGA 1ZH6A 2P79A 1QV9A 3I9V6 4FHDA 2BFWA 4TRRA 4XVCA 4KQ9A 5AI6A 5JVDB 5CH3A 4YWHA 4XLZA 3NBZC 3F2IA 1M6VB 4JJFA 4PO8A 1KTIA 2Q2NA 2OZLB 2G7MC 4DR5B 4MITA 3W1VA 1KE1A 1Z4MA 5KTOA 4GOKA 3W6PA 1F8FA 4M1TA 3B38A 3V4ZA 1RC8A 2ZSIA 1PU2A 4D2IA 3EDRA 4TYQA 3O4VA 4OMFG 4Q9IA 4A4DA 1FQWA 1VL0A 3B2NA 3DKPA 3OT5A 1UUFA 4MI6A 5TGDA 4AQYB 2PUJA 3ZS9A 5A2QA 1FFEA 2IYEA 4XUDA 5BOVA 4CI0B 2YWHA 1MA3A 1QTQA 2OAQ1 4GOOD 3QXJA 4JVMA 2MHCA 2O2XA 3B1WA 4WLUA 1KZ7B 1AV7A 4YP7A 4JC5A 1ESMA 3D7RA 1R0KA 4JEMA 4EO9A 3I9V1 1L5QA 1OH5A 1GQOA 4LGMA 4X8LA 3H19A 3H2SA 3PIRA 2PFGA 2OCPA 4YCAA 4E2ZA 3B48A 4W9MC 2ODQA 3OLWA 1SXJA 5IT0A 4BMNA 1JFSA 1NR5A 3ZQ4A 2SKDA 4H0NA 1LBQA 1LD3A 4MJLA 3R9XB 4PR0A 2II6A 2YZ2A 2FOLA 1AZSC 5C1BA 1RKBA 2OYSA 1KO8A 3UT5A 4KBFA 1KP3A 1OX4A 1Z38A 2GB4A 2Z3ZA 4CMIB 1L4KA 3KEOA 3PX7A 3ESDA 4YTEA 5JJKA 3GDHA 5CT9A 2FPIA 4Z8XA 3D7LA 3TOVA 1VG0B 4KN5A 4O4LF 3LLMA 1QZXA 1T9GS 2W4IA 3H3FA 3AVUA 1DFHA 5DHSA 2GK4A 3LUPA 4FYKA 3TG2A 2QM7A 2YV4A 3L41A 2VQFB 1CT9A 1IY1A 4CIXA 1URPA 5EHGA 1O97D 2BE9A 1EE2A 3C5EA 4KGZA 4F46A 1PF7E 4JQSA 4LEIA 4OYHA 3UENA 1M8KA 5C51B 1AF4A 1BEEA 2NGRA 1THZA 2IXTA 2VJMB 2XNSA 2EJBA 5AI0A 3VXKA 4CV1A 1SFRA 4DILA 5B7NA 2COEA 1M1UA 4H35A 4EKEA 2G7ZA 3C7TA 3RYTC 2BEWA 2W8BB 3R3WA 2OFXA 3KEFA 1DC4A 1KO4A 4ZC1A 5B4TA 2YFKA 3ZW7A 4MO2A 1PJLA 3I72A 1MD9A 1R10A 3L8EA 4X3PA 2KB0A 1LGYA 3USZA 2RHRA 3JD1A 1XKQA 5AVWA 2OHVA 5C4GB 2PX5A 3RROA 4A2QA 2G88A 5AK3A 5DN6A 2FH5B 3P4YA 1Z0FA 2QP4A 5IVIA 1ZD8A 1REQA 3H2GA 4OQQA 4M60A 1R4NB 3C0KA 1NTRA 2V6IA 3LKZA 4PC7A 4OYYA 4BGVA 1SOMA 5BV0A 1CIPA 3GJ8A 3WWDA 4DLUA 3R75A 4GWGA 1FRFS 1S5PA 1NF9A 1G7RA 1Z12A 1H0KA 2BRUA 2E89A 2J08A 4KLRA 5FPTA 4AN0A 3BBLA 4PRKA 1N78A 5JXWA 4HNAA 4RVNA 1OPXA 3PNOA 3TAHA 1G2PA 1H85A 1ZEJA 4Z86A 5T4BA 2YYSA 3H1AA 3I2HA 5JYEA 4JGBA 2WU0A 1RAIA 2XQJA 1HDXA 3A1TA 2BJHA 3S2ZA 4B43A 2QN3A 1JDTA 4LDJA 4QOIA 2LPMA 2R6ZA 3BK1A 2EJVA 1SVKA 4MB6A 4G2NA 5FTJA 3QF4A 2OOKA 2BD0A 3DTYA 3GLIA 1MQAA 1YB2A 3RFCA 1A3CA 2MYUA 3HL0A 3KJEA 3UA3A 4K5QA 4WK6A 1J07A 2LKCA 4NFSA 1M1YB 2JGFA 3H5LA 1LK0A 2V7VA 1TMOA 1PQ4A 2JA1A 4L57A 1QOZA 4FPXA 1E2MA 2R11A 4LWQA 4PS0A 1U3FA 4LJAA 2VQEB 4JQZA 3H1PA 2YN2A 3DONA 5KOHA 1JSCA 5JSZB 3R5SA 3MQFA 3MTDA 3QFFA 1GKIA 2WIJA 4GOMD 3QNWA 1YA8A 3R7BA 1Z13A 3FYSA 3M4XA 1E1KA 4R8RA 1JR2A 3ZYCA 1HNWB 1L7PA 1TAGA 2I6TA 1DG1G 2VPZA 3KL2A 4DV6B 5CRIA 3BIWA 3RAGA 3H5RA 3HKDA 2XADA 4QNRA 3HUEA 3MMSA 1A7JA 5FLYA 1TPYA 1KKMA 1FNBA 1XRMA 3ZDQA 1BS2A 2C9ZA 3IHKA 3QLUA 1YI1A 4FTWA 5IAKA 1M6WA 1SR8A 1UXOA 2AOXA 2Z9CA 4WQMA 1XDUA 4Z4QA 3VKHA 4XCXA 1I4LD 2EFDB 4K0RA 1SURA 4WPGA 2O7QA 3EIUA 5D1HA 3WY9A 2GPNA 4RDIA 5K3AA 3FTQA 4HGNA 1IYZA 4CLHA 4Z51A 2QMEA 1V95A 3N58A 2P9TA 3PJEA 3DW1X 4K9MA 4ZAZA 4B17A 3OEHA 4RDCA 5KYNA 2P8SA 3P5SA 1PNVA 2I78A 1OOEA 4ZK6A 4DNQA 1ZC3A 3AUTA 4N3BA 1RLIA 4ZVRA 5LQNA 3EPJA 2PZFA 2FX5A 3H4IA 4W1SA 1TA0A 4C6TA 5CEFA 3RPEA 3SDBA 3FPKA 5CAEA 2QP3A 4N4AA 1L1QA 1VIAA 5T41A 5D7NA 2IS4A 1H94A 3QVLA 5A6VA 3G17A 3LLSA 4JA0A 4TQ9A 1TT5B 4TWIA 4ZQFA 4Q9KA 2Q4BA 4BLWA 4EUNA 1W5BA 3N6RA 1IBCA 1GNLA 1Z0UA 4MQFA 3U7GA 1NBAA 1O6CA 2FK7A 3FROA 2QJWA 5AVRA 1G3RA 1ZK2A 4R1SA 5JNSA 2YWRA 3BWVA 4HKTA 2W48A 3SJCA 1C7EA 2UYQA 4CDMA 5KMGA 4XUGB 1E2EA 2FP4B 3DOCA 3O90A 1GTJ1 3PDIB 2Y9ZA 4OG2A 4E7OA 8AT1A 4FYXA 1UC8A 1S3FA 1WY7A 4DJEC 3TUZC 2VT6A 3ILSA 4WL0A 1H69A 4UUBA 1R74A 2O3RA 2ZJAA 3H83A 3R3UA 5BN4B 2EG9A 5HVNA 3IAHA 4L9WA 4RM3A 3EGEA 3OEHD 4UNNA 4N1AA 4X3OA 1OFGA 2ACWA 1R4AA 1ZRMA 5DMHA 1JLSA 3HYTA 1J7JA 2DH6A 3AHGA 1OFCX 3EZYA 2DPHA 5EUMA 1AGXA 3T7RA 3ONVA 2CD7A 5AVQA 3D5QA 1BS1A 2R4UA 3W6ZA 1NNI1 1U28A 3O8QA 4MGIR 1QQ7A 4RD4A 4MVJI 3R74A 4MI3A 3FBWA 4NPHA 3NIDB 2OZVA 2GN2A 3ANSA 5ALGA 4F72A 3GBVA 3LT5A 2PYZA 2EJCA 3GCGA 3ILHA 3PPVA 2OT3B 4KWHA 1C1DA 2C94A 4HBGA 4F0JA 2ZYSA 3I2FA 3WWPA 3ZLBA 4LFAB 2VPQA 3N39C 4IZOA 2ORED 1ZD3A 1ORHA 3F8WA 1JHUA 1SKQA 2NT3A 3D4LA 3A6FA 4ZCMA 3HSKA 2ZKLA 3EGIA 1MVNA 5TJHA 4NBLA 3ZW8A 4NYMQ 2O3UA 5IUKC 1EJBA 3HXKA 4P3YA 4V39A 5ALWA 3W7BA 2Q3HA 2X1LA 1BW9A 1T2AA 1Y6GA 4BQSA 3RRZA 2FRDC 3N76A 4WLOA 3RT1A 4RPCA 2XXAB 1EUDB 2NOAA 3PT5A 3JQGA 4LK2A 3D2CA 3EXEA 1IZ8A 3GN2A 3F73A 1YR1A 5KJ1A 1ES9A 2W2LA 5C5IA 1D6MA 2NNWB 4RVOA 2ZB7A 3HJTA 4LDNA 4TL6A 4CM6A 4JNCA 1A1SA 2AR0A 5LC1A 1Q74A 4L8WB 2HU8A 1YFKA 1Z8DA 5KAMA 4M86A 1E2NA 4LVUA 4OBWA 2Q45A 4ZALA 3QXXA 4N3AA 3KPWA 1D2HA 2RGDA 2IYUA 3U37A 4DEVA 1DV2A 2FE4A 8ATCA 3RHZA 2JLYA 2VTBB 4RTRA 4KXFB 3NEYA 4PX9A 5FWYA 4I4TA 4JLBA 4AY4A 1UEXC 3IJRA 3U3OA 3V4PB 1HG0A 4TLBA 3U7FB 1CQPA 1SK9A 3UG7A 1Z0KA 4FK8A 4J4BA 4C3VA 3U5TA 3ZDAA 3RIGA 3B20A 3T9CA 3FRIA 3B3JA 3PL1A 2X41A 2Z3WA 1WCYA 2JAPA 3GJTA 3WO1A 1AKRA 3R2JA 3ENZA 4TSFA 1H4TA 3RKRA 3RV4A 4BIMA 4EYOA 1CJSA 1WY5A 2AH5A 4FKZA 1OX6A 3DBIA 1R3UA 4WFQA 5G41A 5BUCA 1RRVA 2WMYA 4U2BA 1G20A 3A27A 5KSPA 5CA1A 1KU0A 3JQ8B 3E7XA 1F5NA 4IJQA 3A0RB 4Q3KA 3VKFA 2M98A 2IYLD 4WXMA 6REQB 4NJMA 1SHZA 2V7TA 2AJTA 2W2MA 3DHEA 1ORDA 5AM2A 1BE6A 4BQNA 2EFHB 2CNWD 1MN6A 2KQUA 3JQRA 4Y6OA 1ECGA 4Y2HA 1BGVA 1DELA 1IEQA 5K45A 1XFDA 1SXHA 1A7UA 4I50B 1U2TA 1YMUA 4DWWA 3HPQA 5BVHA 3LLUA 1EINA 1JFFB 2B4KA 2WYUA 2W6ZA 1Z7BA 2WT8A 4LJ7A 1TKAA 3TLGB 2RHHA 4NBSA 2GFQA 1XEFA 2J31A 4KZKA 1C9KA 3MZ0A 5A4FS 4MQ6A 4DJAA 3D6HA 2X0KA 3GJQA 4RENA 3SY8A 5JJCA 2FN8A 4FU0A 3ZW9A 1OROA 5F51A 3PWKA 1P7ZA 5CB0A 5A4KA 1IIRA 4H6PA 4HK4A 2XPCA 3DDOA 4BV9A 2LDXA 3GJZA 1OU4A 4GSKA 1JDPA 3A37A 2HLHA 2CV1A 2JJ1D 4MQLA 4OHVA 1HTTA 4RTJA 2CYCA 5DGHA 1ODTC 2BL4A 4MLPA 1V26A 2ZB3A 4L51A 3TW8A 4FLMA 3NYQA 5IMSA 2ICAA 1C0IA 4YAJA 1CJVC 1FW8A 3OCYA 3VGJA 5A5DA 1HK7A 2PL3A 2SKEA 1OYYA 3LUJA 1E2DA 1C3VA 2Y71A 1BG6A 2F1IA 3G49A 3MB8A 4DAEA 5I7WA 4FSHA 5KHLB 1EG7A 4AM8A 4DNOA 3U3MA 4FZRA 4POOA 4NSNA 3Q2OA 1WZ2A 3M6WA 5DEIA 2H0RA 3MJCA 3OMLA 1EFVB 2YKGA 1JLLA 1MQ9A 2YZMA 3UPDA 3TSCA 4FFWA 4WVLA 4HDSA 2GBLA 2PUTA 3K9NA 1GM5A 2ORWA 2HWXA 1K5HA 2DY0A 3HCBA 1OXVA 2QGNA 3B1FA 2VP9A 1M1XB 4HTFB 1U9IA 3IUYA 2QRGA 4LVNA 1UKBA 3WLQA 2HPZA 3H9JA 3M7IA 1EDDA 4YJFB 5YASA 5AW0A 4L4UA 4G09A 4TQAA 3T94A 5KNBA 2J6CA 4MVJM 5BQ3A 5KNCA 1JG4A 3A1WA 3OBIA 1E8DA 1QORA 3JYHA 3QVMA 5GGXA 3TFOA 2V45A 1R0CA 3DE1X 1KZYC 3H65A 5GY7A 3L5KA 4DQDA 3AETA 3PC2A 3D3NA 4UPDA 1G98A 4ZV4A 3NP9A 1GVNB 3G02A 4HEA6 1ZM4A 1ST3A 1E2FA 3M5PA 1CEEA 3WJ1A 4C01A 3KFVA 4OLHA 1O58A 3VJLA 3UCEA 2ZSAA 4EBBA 4TTQA 4BX2A 1W4BA 2BGJA 3AVTA 4QGBA 2ONZA 3NOOA 1KYYA 1V25A 3T8YA 3SK0A 2E5WA 3ZY6A 4C7VA 1NAHA 2XW6A 2I9PA 2BM9A 4HLUC 5BYBA 2EYUA 4IOMA 2QJRA 1FJHA 1MO3A 1NRXA 4S1VA 4S35A 5AK4A 4FHGA 3A3NA 1GD1O 6YASA 3OZTA 2WHPB 1BVRA 3VJMA 4C06A 5BV7A 2VPTA 5JXIA 1M6HA 1ISHA 3O0TA 2HZ7A 1EK1A 3PFKA 2HIAA 1OKKD 1WA5A 2VDQB 3IODA 1SXPA 3CLUD 5JV5A 4MUIA 1PWZA 2P2GA 4JYCA 1XZQA 3CLRD 7ABPA 4U7FA 1LV8A 3MCTA 1R4MA 2AC7A 4KJXA 2O2YA 2I2BA 3I6MA 5CJ2A 1MX1A 3VNVA 1ICEA 3L7CA 1SIBE 3DCNA 3O38A 2ID8A 3D6FA 3O4IA 1GVHA 4P34A 2MJLA 4H27A 4B3XA 1LSUA 3LFTA 1KI7A 3QWIA 5HF9A 2AKEA 4AO7A 5DGDA 4GPIB 4KBGA 4RLHA 2RGCA 2VSFA 4DL9A 5BP7A 2KE5A 4MARA 2JAXA 3OFND 4JLDA 3PIIA 2OBYA 3L7YA 4HH1A 3TXXA 3UAVA 1GGMA 3GIDA 4UCQA 3ZDFA 5EERA 4BUZA 5FPPA 4S1TA 2VWPA 2WUGA 1FU4A 1OBHA 4KN6A 2GUGA 4QOSA 3T3DA 3UAOA 2WWYA 3RSCA 3HN6A 4MB0A 2UZ4A 2GNOA 2GPWA 4HQ0A 2YWFA 1U9YA 3L4SO 1NXTA 4IMJB 3MN1A 4B46A 4P0PB 1FLVA 2MINB 3FPSA 3HRKA 5A3QA 1YZQA 3DWFA 3EQ8A 4QGHA 4JNKA 2VP4A 1U4SA 3WSWA 1GQ2A 2FU5C 3SE7A 1J8VA 2C9OA 4FIZA 1TEXA 5KB3A 5F3WB 3M5CA 1W0JA 3NBAA 1TUBA 3EEBA 2PR7A 1P2FA 3KV1A 1OFVA 3MCAA 4UM5A 3FPJA 5K6RA 3MUEA 1KF0A 3AMVA 4HWTA 2QQGA 2BKAA 3ZZTA 1OIXA 1PZFA 1UPTA 4S1OA 3LCCA 1DRKA 4LIPD 4IHJB 3GZ4A 5CA0A 4OY3A 3ZCRA 3UOAB 3HDHA 1CG6A 2JFGA 2YR0A 4MDEA 2EYQA 1VE1A 3I58A 5HKKA 4MUFA 2X3YA 2F8MA 3L0OA 3ESAA 4J0EA 3TSZA 1RI5A 2JD2A 3RLFA 1D1SA 3L0BA 2QAIA 4K05A 4NECA 2DOKA 3G59A 4R05A 3QLJA 1FRQA 5TQVA 2VPWA 3KPYA 4RSHA 1XRSB 4ENSA 5JNTA 4BXOA 1B16A 4V0MA 3AIOA 3C7KA 5IHPA 3KTDA 4MRPA 4N9QA 4A8JB 1D2GA 3L1VA 4PIPA 3OIUA 3LX6A 5EUBA 1KH2A 4MICA 3UJNA 4LSWA 1O95A 3JYQA 4CDNA 3BCSA 2VYVA 3UF0A 5IT5A 3CRZA 3UMBA 1Q7CA 2H4JA 4HQNA 1GCIA 1KYWA 4EI2A 4R6WA 3WWZA 3JALA 2QNBA 3F46A 5EN4A 4QXQA 1YCHA 4J76A 2RGUA 2PKWA 3PG5A 3DF7A 3ONEA 2YYYA 2GXQA 1NJ8A 3PXXA 3KQSA 4GXTA 4UOQA 2ZIZA 3KIPA 4F06A 1NMSA 2YZ7A 1CY0A 3LQ4A 4ISBA 3V1UA 4PINA 1TCVA 4ALJA 2NSLA 3SN6A 3NP7A 5L6LB 2BBWA 3KSAC 2R1UA 2R6R1 3LXMA 4LC1A 4C89A 4A6PA 1TZKA 1XZPA 4XX1A 1QIJA 5BYJA 2UAGA 4ZDWA 1WSDA 3QE2A 4ABYA 1XAIA 4ASUD 2C9BA 1BE8A 2OORA 3D0RA 3NNDA 3SE0A 1NBWB 4DFDA 3ZBQA 4ESVA 3BE5A 3QUAA 3RUCA 1U8UA 4UD2A 4E03A 3E9CA 2H48A 1XLUA 3I42A 3JZDA 4AYTA 2SHKA 3O75A 3DJFA 4UHFA 4J75A 3OZIA 4UU1A 2C2GA 5H70A 1GIAA 1J8QA 2AF4C 4L74A 2OCAA 1SB8A 4NZOA 2AFHB 3F9IA 4BX0A 1M76A 1YQTA 1Z6AA 5AM1A 4KOAA 4P4GA 3K71B 4Y6QA 2HYIC 1MOZA 1NLYA 1WLSA 2PIDA 5LL6P 2QSUA 1AS3A 1SVIA 2GH1A 2EBFX 2XJ9A 3SC3A 3ZLTA 4C7JA 3E53A 5FPKA 3VR2A 5JD4A 5F9HA 2O59A 1MJHA 1J90A 5BN3B 4EYGA 1Y33E 1U7UA 3F5QA 3Q98A 1H0SA 4C29A 4AMUA 1O0BA 3WKDA 4AYWA 1S9HA 2RKBA 4H7KA 1A5ZA 1R6BX 1RT9A 1VZ3A 1UEIA 2Z5LA 1FFYA 1Q57A 2H2FA 1AKWA 3I73A 4BFVA 2Y9MB 3UMGA 1CXZA 1O8CA 1RJDA 1A8QA 2IJGX 2OR3A 1ZDMA 2QNIA 4RPGA 1WV1A 3F6CA 2P1ZA 1NF3A 3B8HA 5G1PA 1YQXA 3UK6A 5LZ9A 4MQ4A 4MR8A 2QZZA 1PZNA 1GAQA 1PFKA 1U8XX 2QZJA 3OIFA 5KVQA 1VP9A 2QHXA 3STWA 5BMVF 5HF8A 3I2JA 1QPGA 1RYNA 4FBLA 5LB2A 1L7XA 2I62A 4KP7A 4LAFA 3W4IA 4YBZA 2Q0XA 2LNDA 3BX1A 2PJDA 1AK9A 3UMVA 4TLCA 1J00A 2LWIA 3GFVA 1LPMA 2G17A 3MYRA 4GR4A 3WRYA 4CBVA 5JMOA 4MR7A 5DCUA 4HMQA 2PNFA 1JE0A 4JJEA 1UQTA 3A1SA 4B4UA 1XQXA 1C1XA 4FQ5A 2HN9A 2Z57A 1IK4A 4X8HA 3CONA 1OT5A 1R64A 1A4RA 1LVUA 1OAOC 4JXJA 1A9XA 2GF2A 1OXKB 2VS1A 3QJYA 1HETA 3EZ9A 3NM6B 3WGKA 4D0NA 1ZXLA 1GGNA 1T0BA 1WKCA 2YWDA 3FDIA 3KQUA 3U4QA 1COWA 2EJUA 1SCUB 2E1PA 5BQXA 1H2YA 2UZ0A 4PNHA 1E6KA 2PMBA 1B23P 4FD3A 4B7ZA 2H1SA 2D2XA 4OB8A 2C83A 2GTIA 1I1HA 4NE9A 4PVDA 2PDAA 2WG2A 4KWTA 1TCUA 2PH3A 1QO0A 1T5BA 4G07A 1SZPA 4RK0A 1TGYA 2OESA 4IGKA 4A1FA 2FCAA 5FUXA 5FEMA 2V55B 1KGSA 1KJ8A 1JSRA 4U7PB 1E79A 2PZMA 1ACJA 2O5CA 2J85A 3BCRA 4FSDA 3N05A 5DCYA 4EGJA 3VPDA 4KVZA 1CU1A 2H16A 4MK4A 1UK6A 3HUTA 1EGAA 3G1WA 3FVTA 3GNQA 4BBAA 3AZPA 1T2CA 1IPHA 1P0PA 2WTBA 4FYIA 2A1UB 5L3ZA 5BY2A 3F96A 3ZHXA 2ZPTX 3MRTA 2BKXA 3UB2A 4CCYA 3KE9A 3FPLA 5CX1A 4FBMA 2GLTA