3C7AA

A structural basis for substrate and stereo selectivity in octopine dehydrogenase (odh-nadh)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
403
structure length
403
Chain Sequence
TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octopine dehydrogenase
publication title A structural basis for substrate selectivity and stereoselectivity in octopine dehydrogenase from Pecten maximus.
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 107
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3c7aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c7aA01
4GLOA 4YQZA 4DWVA 1M6HA 3H2SA 2C54A 4IIUA 3K8ZA 1QYVA 3WQQA 5CP8A 2V65A 1YVEI 1HE5A 1KBZA 1FDTA 1UXGA 1F06A 3U3XA 3FBTA 3NX4A 3QJ5A 4B4VA 1I3KA 3AUSA 2GUGA 5JMWA 1UR5A 5KOIA 3N74A 3ENNA 1TA4A 4IQ0A 1LLDA 3KRTA 3DOJA 1N92A 3WG9A 5IDWA 4QFCA 1QG6A 3QVSA 2EXXA 3DBVO 4ID9A 3FBGA 4XEHA 2EJVA 2CF6A 1L1FA 1E77A 4JBGA 4XZ3A 4BB5A 2OO5A 4R51A 3DXFA 4IJVA 1PJCA 4O5OA 3ZCXA 4CM1A 2I6TA 4RQTA 1YB5A 1EUDA 3F6YA 3ITKA 4LRTB 4PLFA 4CR7A 4J90A 4RLHA 1A9ZA 2G0TA 1N9GB 2HRBA 4XJSA 2UVDA 4U0JA 3FWNA 8LDHA 4E5PA 4CM5A 5TJHA 3WYCA 1JKJA 1XYGA 3GK3A 3NGXA 4NJMA 2A9FA 1HDGO 2P2SA 3CZMA 1TLTA 3RBXA 4LK3A 2XXBA 1K89A 2CVZA 1LDBA 3CH6A 5DBFA 1PGOA 2CVQA 5A1TA 5C5IA 3LLVA 1Q0HA 3DONA 4DRYA 4PLZA 3I6IA 4XGIA 2GO1A 1F0YA 1K3TA 1E1MA 2PY6A 2FMUA 2DLDA 3PK0A 2H5LA 3QWHA 1ONOA 2YQ5A 1RPNA 4CV1A 2Y1DA 4UVIA 1LRJA 1EDZA 4QO8A 2EEZA 2FRDA 4CQLA 4E5KA 4F6LA 2Q1SA 2OXIA 3L4BA 3TOZA 1B0AA 1FJHA 1GL3A 2Y0DA 3WICA 4EJ0A 3VDRA 1AXGA 4MOWA 4Z0PA 1EE2A 3NYWA 4IJKA 3CEAA 1YQGA 3UW3A 3PJDA 4BMVA 4TQGA 1Y8QA 1LRLA 3NKLA 1AHHA 1ZUD1 1YL7A 1NR1A 2IZ0A 2I3AA 4AFNA 2D8AA 3M1AA 2GF2A 3NAQA 3RVDA 2X22A 3U49A 3WQSB 5KIAA 1PS9A 3I6QA 4PRLA 1Y81A 4BO9A 5ITWA 9LDBA 1H93A 3UCXA 2O50A 5EQDA 4ZQHA 5DT9A 2W90A 5A9RA 1ZFNA 5ADHA 5A04A 5L3ZA 3PIIA 5JPIA 3EYWA 2NVWA 4NZ9A 5A02A 1NWHA 5BNIA 3NDIA 3IMFA 2G5CA 3VH4A 5L40A 3WX0A 4PLWA 2NUAA 3GNTA 4WNCA 3WGZA 4DPLA 1E1NA 4BNUA 3ZV6A 4FC7A 2XXJA 4IDAA 2BI8A 4YAGA 5B4TA 4GPD1 3BAZA 3PHGA 1DIGA 1PGQA 4ALIA 4I9NA 3GEDA 4AJKA 5GZ3A 4PZDA 1E5QA 2EP7A 3CIFA 3KZVA 4I5FA 4AJ2A 3A06A 5ER9A 2JKVA 4BO6A 4JP2A 1LDMA 4OIMA 3ROMA 4MP6A 1ZO8A 1PJQA 4D3SA 3OETA 4QTZA 1N9GA 1PIWA 2CDBA 3GC6A 3JQBC 4YJHB 2E6UX 4E12A 3E82A 1VPDA 4BGIA 1H6DA 1I8TA 4O59O 4YAIA 4R1NA 4FJ1A 1NAHA 2C7GA 3NDJA 3SXPA 2IEDA 2QW8A 2W2KB 1VJ0A 2YFHA 2Q49A 1SOWA 3PWKA 3VOSA 4DMLA 4OKIA 4YAKA 1Q7CA 3U4IA 2HUNA 3VZSA 1OMOA 1V8BA 3E03A 4UVGA 5HS6A 4IMPA 4LW8A 1U7HA 3WSWA 1R0KA 2G17A 2ZCUA 5HBRA 1O8CA 2VHXA 2O3TA 1UDBA 2EGHA 2GSDA 4DA9A 4RVUA 1O94A 1YGYA 4U8GA 5DCUA 1R4NA 3VPSA 2YYYA 1QYXA 2OZPA 4L73A 3MJCA 2HJRA 3OIDA 2YJZA 1YDEA 5A03A 1XEAA 3MJSA 3PGJA 4HFMA 4RDIA 4IZIA 5L7YA 3SX2A 3WGHA 4A7PA 3C7DB 3OF2A 5KTKA 3CMMA 4KWIA 2Q99A 1SBYA 1ZH8A 1DIRA 1IB6A 1ORRA 4J9VA 2DBRA 4E4YA 1GQYA 1CYDA 5L53A 5EL0A 2AQ8A 2ZB8A 5BT9A 5F1OA 1YQDA 1ZXBA 2D0IA 1ZEJA 1GYRA 3GG9A 3H9JA 4DBZA 1JAXA 2QZ9A 2V6FA 4A27A 1UP4A 2AEMA 1SOVA 1WMAA 2DPHA 5F1KA 1EQ2A 1Y8RB 1KVQA 1EFLA 2VUUA 3DZIA 4IUYA 3DOCA 3AY6A 3NJ8A 1JTVA 3BTSA 3GGGA 4RF3A 3ZN2A 2QQ5A 2AXQA 4LSMA 4D46A 2DAPA 4LN1A 3DR3A 1HDZA 3MZ0A 4GLLA 2H9IA 4OAQA 1S7CA 3DZJA 4TMFA 4AJIA 4CMKA 5T8KA 4AJLA 4HADA 2VWGA 1J4AA 3UHAA 3KOUA 2C2XA 4WCFA 4J7UA 5IN5A 1E7YA 2NVUB 3WJAA 4W6ZA 3U5TA 1MUUA 4R1UA 3S55A 2I67A 4LMRA 4Z0TA 2UUOA 3OHSX 1B16A 5G0TA 1ZSYA 4H15A 4OOFA 5L4SA 5A5FA 1OC4A 4J2HA 1OBFO 4W7IA 5CDSA 3K31A 4M86A 1E3EA 1SPXA 3ADPA 1ISIA 5I8ZA 2X23A 3BXXA 3OIGA 3HN2A 5TF4A 4QFDA 1L7EA 3QIVA 2GZ1A 4J2OA 5IZCA 2E49A 1U5CA 1EK5A 3P19A 5EN4A 3TQHA 3F1KA 2Y68A 4Z9XA 3RFXA 3QHAA 1HE3A 2B83A 2DFDA 3BHJA 3HSKA 1DDOA 1IHYA 4RCVA 3RUHA 3DQPA 5JDIC 3JQFA 5G0WA 3BMNB 4YBZA 1LLCA 2G82A 3ZW8A 3GGPA 1A71A 1PU2A 1BTOA 5JAIA 2ZYAA 1NTOA 1V0JA 2NACA 4IS2A 1TT5A 1NFQA 3GVXA 4BO8A 1BW9B 3D3WA 3B1KA 3QE3A 4OXNA 4ZQEA 4R01A 1R0LA 5KWEA 2VYVD 2B5WA 4EBFA 2AQIA 4EJMA 3R0IA 3BMCB 4CUJA 4YT5A 1FDSA 1EUCA 1ZMTA 2NTNA 4NR0A 1A5ZA 4TKLA 1C1DB 1K6IA 3NTOA 2VT3A 1SAYA 1W4ZA 4PVDA 1U3TA 1R66A 3I5MA 3UKOA 4BNFA 4YR9A 1XU9A 1B3RA 4R69A 5JMPA 1OOEA 1H9BA 3PIDA 3E9QA 4DBVO 4BB6A 4DXHA 2CFCA 1SZJG 3H3JA 4YJGB 1DAOA 3K5PA 4PCVA 4IDBA 4AJHA 3BHMA 1HYHA 3VTFA 2YQ4A 2B5VA 2XOXA 3MEQA 4JJGA 3FPLA 4EI2A 4BNMA 2GCGA 2J5RA 2JD2A 4JBHA 4U6SA 2C59A 2X0RA 1HRDA 3DEYX 1IE3A 1HE4A 4XB2A 4FIZA 3ZWMA 2BLLA 5BSEA 3U09A 2EKLA 4BMNA 5I7VA 2YUTA 2DC1A 2JL1A 1DJNA 1VM6A 1P1IA 3D4PA 2D2IA 2ZB4A 3Q2IA 1QP8A 1JVBA 1XG5A 2JHGA 4ESOA 5BNTA 3HWRA 2C5EA 1JWBB 3ZHXA 1H6CA 4R5MA 2GNAA 3ZNPA 4I8XA 3VZRA 4Q3DA 1OZAA 1A72A 1PGJA 3PLNA 4O1MA 1MP0A 2J3IA 3KYCB 3W8FA 2OFPA 2NADA 2XF8A 3GLQA 4LGVA 4MINA 3GVIA 4TVOA 1DC3A 3HDYA 3NGLA 2VYNA 3A14A 4MVJH 2B69A 4CMEA 3PYXA 2GR9A 2TMGA 4B3IA 4GKVA 1AXEA 1LBEA 1P33A 1T4DA 2FPGA 4XRRA 4WEQA 4D44A 3OIFA 3TNLA 4BKUA 3ZU4A 5H82A 1TVEA 4M8SA 1DAPA 1HLPA 4BO3A 1KEVA 1W6UA 2PGJA 4J6FA 4JJIA 3K30A 5DZSA 3V2GA 2Y1FA 4MVJG 5GZ6A 1C14A 4DQXA 3PWSA 3GHHA 4WECA 4BNJA 1CQIA 1E1LA 4UVDA 3UGKA 4CQMB 4CM9D 3JYPA 4B4OA 4QXMA 4ALJA 3NUGA 3PQFA 5A3VA 4DLBA 1PR3A 3LT2A 1PJ2A 4XQCA 5HTOA 2PLAA 5BNFA 1ADBA 1GUYA 2R6JA 3HG7A 1UXKA 3AM3A 5DOZA 3RAJA 3AJRA 1H2BA 4Q3AA 4R41A 4PG6A 5CPFA 3OMLA 4JN6B 4CM7A 1P77A 4NJOA 3AUTA 5TRTA 2WYWA 4R1SA 3H4VA 3ZWBA 2YHIA 2VRCA 2WWRA 2DT5A 4RV9A 3NJ4A 1Q7GA 4DL9A 3VPGA 1YWGO 3F4LA 5TJ9A 4YPOA 3W4JA 4KUGA 5KVSA 1I2ZA 2DQ4A 3D4OA 3OJEA 3GNQA 4F46A 2AE1A 2EP5A 3DBRB 3HDQA 1KVRA 3EK2A 5G4KB 3TRIA 4GL4A 1Y5MA 3RASA 3WGYA 5DNAA 3W4IA 4RORA 4IIVA 2BF7A 4ALKA 3BIOA 5F5LA 3VKUA 4DPMA 3ROPA 4RO0A 4B4WA 1B8PA 3B20A 5A4DA 3ENKA 3EW7A 3EC7A 1HZZA 1VRWA 2IRWA 3GVCA 3BA1A 3HN7A 4OXYA 2DBVO 5FI3A 1U2DA 3HNPA 2IXBA 4PVCA 1PJTA 1GZ3A 4L4XA 4K6FA 4W7HA 4N5LA 4HBGA 3X2FA 4B8WA 3JQAD 2WE8A 2E48A 4FJ0A 1N8KA 2P9CA 2Y1OA 1XKQA 4PIVA 2AW5A 3C7AA 4FFNA 5FWNA 1GAEO 4GX0A 1R37A 1YL6A 3JTMA 3WOHA 2QX7A 1QMGA 3W8EA 5A9TA 3LC7O 3Q9UA 1F8GA 1T4BA 1LI4A 2DPGA 3JQEA 4ALMA 4D43A 2Q1TA 3TZCA 3TOXA 2O2YA 1E7MA 5H83A 5AQ1A 4KDFA 3QWFA 4UEKA 4XWYA 1YJ8A 3RU9A 4DLLA 4A03A 1D1TA 3ZU2A 2OL4A 3A9WA 1D3AA 4EDFA 4PLTA 1LX6A 1RM3A 1C0KA 2ET6A 4XDYA 3O8QB 3ZI0A 1LDNA 1LC0A 2BMAA 4BNYA 3IDSA 2C82A 2PKQP 1SEVA 1I0ZA 3L0DA 3Q1LA 3H2ZA 4RPJA 4J43A 5AYVA 1BSVA 2NM0A 4PFJA 1F14A 2A35A 3UN1A 3WLFA 2PTGA 3OICA 2VQ3A 4IQ8A 1PZHA 4OKNA 3KETA 1PJLA 4MVJP 1YOVA 4WCDA 3WMWA 1E7WA 2HJSA 2W8ZA 2ZTLA 3KVOA 2HMWA 3I9MA 3M6IA 3R3SA 3VVBA 4CV0A 4FQ8A 1ZJZA 2BD0A 2VWHA 5COBA 4IY1A 2X1HA 3I9NA 5G4KA 3IC5A 1K2WA 2PH3A 5IZ4A 4E33A 1E6UA 1WXDA 3RUEA 4XQ9A 3DMTC 3PHIA 1GCUA 3JQ9C 3RBZA 2BFPA 2Q45A 3GPDG 2WTBA 4YWJA 3FNHA 2ZTMA 3MWDB 3VVCA 3CMCO 4LISA 1ZMOA 1W8DA 3EHEA 4HY3A 4Q9NA 4RGBA 3WGTA 1X15A 4JJFA 2P5UA 1DO8A 2C2YA 5JYEA 5IDYA 3TZQA 1XU7A 2FR1A 1UDAA 1SO8A 4TZKA 5MGBA 1HDYA 4K28A 4NJMB 4P8RA 1NVMB 1P31A 3H7AA 2AA3A 1K5HA 4D3DA 1WMBA 4NHEA 6LDHA 3I9KA 4J1QA 3H3FA 1WLYA 5BSFA 3TJRA 3AWDA 3I52A 3WR5A 3T7CA 4MPDA 4E0BA 1EVIA 2QRKA 2YY7A 2IZ1A 3KEQA 3OQ1A 1EE9A 4CL3A 4WJZA 4S1VA 4NU6A 1QYWA 4P38A 4Z3DA 2XAAA 3GQVA 4OYRA 1X14A 1H6AA 1G0OA 3ZWVA 5JC1A 5T6BA 1O95A 2AEJA 2PD4A 3QSGA 1NQAO 4CQLB 2HQ1A 2CF5A 3KUXA 5EESA 3Q9NA 3I9JA 3TSCA 3ZWYA 2DU8A 2VWPA 2I9PA 3VKVA 2NQ8A 4EUEA 3GZ4A 1QV7A 3I1JA 1TXGA 3DBLB 4A10A 4BNVA 1KS9A 2PWZA 4II2A 4M55A 4QO7A 5JBIA 2I76A 2X0JA 2ZQYA 3I3OA 2GPTA 3R6DA 3DAPA 1Y8QB 5TQVA 1ONNA 4RPHA 4E21A 5JY1A 5ITVA 1LSUA 4CMJA 2X86A 2VNSA 1ISFA 3GDOA 4BL5A 1XDWA 3RI3A 2BGLA 1HT0A 3AU8A 3PGXA 4FJ2A 4YT8A 2VUSA 3UF0A 3TF5A 4J1NA 3MJVA 3RSHA 4Q3CA 4DIFA 1VSUA 3OP4A 1QLHA 4GX2A 2X9GA 4JCOA 1IOLA 5DP1A 3GG2A 4Y67A 1Z45A 1FDVA 2WYUA 3OQBA 4U0KA 4DIBA 3TPCA 1U3UA 1E3IA 2PZMA 4Z3KA 2IZZA 4Q39A 1H5QA 1DSSG 5KNLA 1A27A 4ZRMA 1DFHA 3RCBA 2DTEA 2O3SA 3JSAA 4PN3A 5JDIA 1X1EA 4HV4A 1UAGA 4NMHA 1GEEA 2GERA 1KEWA 4XGNA 4FFRA 5AXBA 4DMMA 2NNLD 1BHSA 2P4HX 3C1OA 3ZWCA 4BNKA 1E6WA 1ZK2A 4BNHA 2HRZA 4DQUA 5CHEA 2POQX 1BWSA 2BGKA 4AJJA 4BGEA 4C4OA 1VSVA 3L9XA 2DVMA 2ZKLA 4OH1A 3M1LA 1PEDA 2BFOA 4ZJUA 3FCOA 3ZWXA 5J23A 1I10A 1R12A 4Y8VA 1CIVA 3PYMA 3SC6A 1M6WA 3E1KA 4KZPA 4ND2A 4E13A 1E5LA 2PV7A 1HTBA 1ONPA 2UAGA 5AVOA 1R4NB 1KEPA 2BGMA 2GZ3A 3BMOA 4A5OA 1QSGA 3BTVA 3VPXA 4URFA 4EW6A 2CDCA 4NBVA 2CVOA 3S8MA 2WJPA 1DC6A 5THKA 1SB8A 1ZJYA 3DZKA 1E0DA 1PS0A 3IKTA 1U1IA 2VZ8A 2X5KO 4YAJA 3AFMA 1UZNA 3DBLA 3JQDA 5T57A 4BNWA 1R0SA 3Q2KA 5JNLA 3IAHA 1U7TA 1XIVA 3PWZA 1D4FA 4XQEA 3WGIA 3IP3A 1UAYA 4FB5A 3H5NA 4Y6PA 4R68A 4CM3A 2O3JA 1MXHA 5KJEA 5C7LO 5FEUA 3ZWWA 3GH3A 1J6UA 5KJCA 3QVTA 1MB4A 2QRLA 3MTJA 3ZH2A 1MLDA 3VHRA 2OHXA 5KCZA 4XDZA 3IJRA 3H9EO 1BXGB 1UXHA 4AJNA 5ICSA 5KVVA 3DB2A 5IAAA 1JKFA 1QORA 1EBUA 1BRMA 1DIBA 1YONA 3NTRA 1IYZA 2Z1MA 4W9NC 1A7KA 1E7SA 3NT2A 2P9GA 3N58A 3T4XA 4KOAA 5CDGA 1B15A 1LQTA 1NYTA 2QHXA 3PHHA 4RVSA 1DLIA 1Z6ZA 4WCFB 4DIOA 3JD2A 4XA8A 5BSHA 2JAHA 4W4TA 3E48A 5FYDA 1UUFA 4NBWA 1OI7A 2C20A 5CDUA 2JAPA 3D5QA 5GMOA 3ZV4A 3JV7A 4PRKA 3QWAA 2EF1A 2O3UA 3TZ6A 4AG3A 1PR9A 3LC2O 4ITUA 4M54A 4ZICA 2HO5A 5CG1A 4RDHA 1DRVA 4HFRA 1WWKA 4PLVA 3HZZA 3HE3A 4J9UE 1I32A 5I9MA 4YRDA 4WK6A 2GZ2A 3DFUA 3ZU5A 3LDHA 5FF9A 1SEPA 3OQ6A 4OO3A 5HS4A 3QWBA 1MFPA 1E3SA 2R00C 5LDGA 1LU9A 3DZBA 1T1RA 2PK3A 4EEXA 3FRJA 3UVEA 3KHUA 1PZEA 1Y6JA 1IL0A 2X7HA 1TT5B 4UVHA 2O2SA 4K9DA 2BH9A 3D3WB 5JYDA 2AHRA 1XWFA 4CM8A 2PA3A 1DFGA 3RC9A 3IUSA 3QY9A 1KERA 4HP8A 1D8AA 2J3JA 2EW8A 3PEFA 1BGVA 1I01A 2V6BA 3M2TA 4O6VA 5LCXA 5JAQA 1JU9A 4IMRA 2BRUA 3LU1A 3ZHBA 3ZNQA 1JAYA 1U8XX 1U2GA 1EVYA 4D42A 4PZCA 1LDYA 3OSUA 5C7IO 4Z6KA 5HM8A 1FK8A 1V3UA 3EVTA 1DB3A 3WBBA 1X7GA 3LT4A 3QP9A 1GV0A 4XKJA 4D79A 3S2FA 4L9RA 2VHVA 4CJXA 1YXMA 4R54A 4JBIA 2JJYA 5ICMA 1KEUA 1O9BA 3AUUA 3ZHYA 1EK6A 2VHWA 3GN2A 4H16A 2W4QA 2WYVA 3JCZA 4I5GA 1BXGA 2JD1A 1E3WA 3INGA 5C3MA 4NDNE 5FI5A 1H9AA 3GNSA 2W2LA 4JIGA 3L6OO 4WEOA 3R1IA 3UAGA 4FGSA 1PWXA 5ENVA 1ZW1A 2FN7A 3H5AA 3OJ0A 4N5NA 1PQUA 3CPSA 3PFWO 4F45A 4NFSA 2B4TO 4GSLA 5EPOA 3RJ9A 3D64A 3WDSA 1MXFA 5KVQA 1HDOA 1ISHA 5K6AA 2D59A 3JQ8A 5T67A 2BI7A 1N2SA 3FF4A 4NPCA 4HNHA 1I33A 1T24A 1DRWA 1PTJA 5DULA 4B79A 2B37A 1JVSA 3TL2A 3W4KA 1LSJA 1R15A 3CXRA 3UCFA 3JQ7A 3GF4A 4CLXA 1AGNA 3H6KA 3WWZA 1N5DA 5CDTA 3TDKA 1VL0A 1NP3A 2FZWA 4K6CA 4XQGA 4I9UA 3RUAA 4CM4A 3IJPA 4BKPA 2VN8A 1NPDA 4JXKA 3DZHA 4NK4A 3F9IA 3I9LA 1DRUA 3WB9A 1IY8A 2ZB7A 3ST7A 1N7GA 3ASUA 1P74A 1JWAB 1H94A 3F47A 2SCUA 2X9NA 4Q3BA 2G1UA 5A05A 4JQCA 4C7KA 1IZ0A 1HZJA 3WMXA 3PZRA 3PJGA 3H9GA 3ONDA 3ZZNA 2FR8A 4PG5A 3RIHA 1EEHA 2V7PA 3FSRA 3PJEA 4NFHA 3RUIA 3WYBA 4AVYA 2QZZA 1GADO 1QR6A 1XA0A 4J4BA 2OORA 2V6GA 1KVSA 2X5OA 1ML3A 2UV8A 3OJOA 5TX7A 5IG2A 3GMSA 2I3GA 5EINA 4WKGA 1QYDA 3JYQA 1RYDA 1FDUA 5TT1A 4BNTA 3L6DA 1PGPA 3VH1A 1UDCA 1U9JA 4UEJA 1NQ5A 4FFPA 4YT4A 1ULUA 2WM3A 2YHIB 4D0RA 1Z82A 3M2PA 3WJ7A 3S2IA 4RL6A 1YS4A 5EIOA 4CLDA 4YQYA 1R6DA 3HDHA 1NM5A 4IZHA 5F5NA 3VDQA 4WOKA 3GAFA 5TS3A 5LDHA 1NAIA 1T2CA 4ZA2A 2X58A 2DKNA 3E9MA 1NHGA 2WEKA 3RUCA 3L9WA 2HK7A 4GX1A 1B2LA 2HMTA 4M89A 5KJ1A 1ZIDA 1B8UA 5U9CA 3UICA 1LUAA 1YBMA 4KQXA 4BNXA 1T26A 3LVFO 1DFIA 3DHYA 3PI7A 3PZBA 4OXKA 4S3MA 4XYGA 2VYND 2VYVA 4YACA 4BO5A 3G0OA 2VRBA 4XX0A 1NHWA 1DHRA 4B3HA 4RPLA 5TSDA 4CMCA 2GN6A 4MVJM 3ZWNA 4P4NA 3KTDA 3VC7A 4AJ1A 1U28A 3E5RA 2OP1A 1Q7BA 3F5QA 1V3VA 1OAAA 3KV3O 5CFZA 2WSBA 1LLUA 2PZLA 1ZNQO 3FTPA 3AM5A 4WLEA 1NQTA 2Y99A 2PZJA 1ISJA 2ZTUA 1YRLA 3OA2A 1P45A 2EERA 2C7VA 3AI2A 1Y5RA 1NR7A 3PP8A 4BNIA 3P2OA 3PFFA 2Z95A 3DC2A 3EAGA 3A28A 1T2AA 2LDXA 1HSOA 4QECA 5L95A 3EMKA 1JN0A 3GR6A 3IUPA 2I5PO 4JK3A 4U7WA 5IDXA 4GMGA 4HX5A 3S2GA 4IGEA 4F3YA 3GRKA 3EVNA 3GRPA 3WFIA 4Y6RA 1TEHA 2GN8A 4OHUA 1MV8A 4ROSA 3ROKA 1T25A 1BDBA 1JA9A 3GA0A 4CR6A 1EMDA 5A5EA 4D7AA 2VRCD 3AY7A 4R4JA 2VUTA 3STHA 4CR8A 3MCVA 3ZGYA 4IJWA 2FPPA 5IJZA 4ZN6A 2BFAA 1CRWG 4J4HA 1RM5A 1LJ8A 1E3LA 3V2UA 1I2BA 4NQZA 2Y0EA 5MDHA 2RAFA 4B7CA 4CLRA 4YYZA 1LLQA 2P68A 3HHPA 1Q1NA 1WDKA 4XB1A 5JO9A 3GEGA 3WTCA 4E5NA 4ZD6A 1R4MA 1KIFA 1V35A 4B4UA 5A9SA 5AXCA 2H6EA 1DHTA 2PZKA 3OM9A 4G5HA 4XIYA 1GU7A 1YOVB 3MOIA 4QQRA 2Y0CA 3PLRA 2HK9A 3ITDA 2HKIA 1WDLA 3ULKA 2GD1O 1NXQA 3JYLA 3WNVA 4YT2A 3CZRA 4BNZA 3DMYA 5CEJA 5I7EA 1KOLA 5EERA 1ISGA 3ASVA 3ANLA 3AOEC 2A92A 1X13A 4EJ6A 2O3QA 3KSZO 4E2ZA 4BKOA 1AN9A 4A26A 3SVTA 1N1GA 3X2EA 1T1SA 1UP6A 4FGWA 3G17A 2VOEA 4NG5A 5JC8A 3ZHZA 1IPEA 2I66A 4AJOA 3RBVA 3BHIA 4ND4A 2P5YA 1GYPA 3HUDA 5KKAA 4BUCA 1J5PA 1MG5A 2C07A 1I5RA 4HWKA 5A3JA 4CMAA 5IXSA 1PZGA 1ZCJA 4J0FA 4DYDA 2FSSA 3GFGA 4GBJA 4Q3EA 3LSYA 2GYYA 2VCYA 1T2FA 2D3TA 2HK8A 2NV6A 1KYQA 4WGGA 1DLJA 1UXJA 3VH3A 2Q46A 3JD0A 1PJSA 4TRNA 1Y9EA 5CDYA 3B1FA 3FNEA 3KSUA 5B37A 5IFLA 5JCJD 3TZHA 3LK7A 2PD3A 5G0VA 2VHYA 4MVJI 5BSGA 3GUCA 5G4LA 4CQMD 5JDCC 1H2HA 3FN4A 3AUAA 2EKPA 1GZ4A 3ON5A 5KJ6A 1CWUA 4RQUA 1TT7A 1I36A 4N54A 4C7JA 4CMIB 1GTMA 1NVTA 1DJQA 4JGBA 3P2YA 1NNUA 4CM6A 3G1TA 4R16A 3AY3A 2PH5A 4RVFA 3QV1A 4FR5A 4YCAA 1ZEMA 3HB4X 4UUMA 3CE6A 2HMSA 4UEOA 4GH5A 4ND1A 2QYTA 1ZKMA 4J16A 3W8DA 4I5EA 5C37A 4L0QA 3I4CA 3EUWA 4FW8A 2WD8A 4EYEA 3ICCA 2X6TA 3K2EA 1TB4A 2PD6A 3WS7A 3SC4A 4G2NA 3HQ4O 3LQFA 4IXWA 2AE2A 4ZU3A 4PLGA 1E6EA 3RFVA 3KM0A 4E30A 3QA9A 1RM4A 2J8ZA 5G2OA 1HETA 2X9VA 3NEPX 2DUWA 5K0ZA 3F3SA 2AQKA 2JFFA 3ONFA 2O4UX 4NU5A 3EY4A 4RVDA 2NQTA 3OEWA 2W98A 5I8WA 1LTHR 4RLSA 4AJ4A 5JS6A 4FC6A 3JQAA 3NTQA 1ENYA 1C0PA 2J3HA 1YKFA 5JE8A 1PX0A 2IDZA 4BMSA 5IZCC 3LLSA 2J5KA 3DAFA 3T4EA 2WMDA 3K73O 3MJEA 3BTOA 3F4BA 1ADCA 5THQA 3RD5A 1K0UA 4NNJA 1EZ4A 4GQAA 3H9UA 1FDWA 3JQBA 4PLCA 3FNFA 1FF9A 4II3A 4M1QA 4U5QA 5B4VA 1XELA 3PYLA 1EUZA 2D1YA 3E18A 3RQSA 2NTVA 2Q50A 1K6JA 3AFNA 3C7CB 1DEHA 1M75A 1FMCA 4L75A 3CTMA 4DREA 3DTTA 3RKUA 3BMQA 1EQUA 1O0SA 1XCBA 2G76A 3ETDA 1I3MA 1VI2A 1C3VA 3GVHA 2HU2A 3K6JA 4BNGA 2UDPA 1PJ3A 2R00A 3GGOA 4CMHA 3OBBA 2JFHA 4NBTA 4CMBA 2YW9A 2BFMA 3IKVA 2BELA 3GPIA 1NPTO 3Q6IA 1Y9AA 5COQA 3JQGA 3KYDA 4BQRA 1QYCA 2YZ7A 4BO2A 3WQRA 3PVZA 4H3VA 4BVAA 4BOYA 1JQBA 1GZ6A 3C8MA 2Z5LA 1F12A 3H5RA 3DHEA 3PQEA 4M49A 1TI7A 4P22A 4E3ZA 5JO0A 4GI2A 1YBAA 2GN9A 1PSDA 4MVJA 3RUFA 1FXSA 4IQGA 3GAZA 4GVXA 4YTEA 3WLEA 3B70A 4W99A 4E31A 3FR8A 1K6XA 2B4RO 3JQCA 3RWBA 1PGNA 2OP0A 1BVUA 3GN1A 2PKRA 4HXYA 2HDHA 4MDHA 4GSKA 3ZV3A 4CMIA 2Q2VA 4NK5A 5JLAA 5IDQA 4XYEA 3G79A 3HJAA 1NWCA 4OOEA 3BMOB 1VC2A 1LSOA 2EWMA 3KB6A 3WNQA 4GWGA 1ENOA 4GAEA 4RPGA 3DBHB 3JQ6A 4P4GA 5COAA 4IDFA 4PLPA 1I3NA 5C7OO 1B7GO 3MOGA 2Q1UA 2VNAA 2H1SA 2PR2A 4DTIA 1RM0A 3ZNOA 1Z7EA 1IZ9A 3HADA 2Y1CA 3ONEA 1XQ6A 1LDEA 5CEEA 3I83A 4ND5A 4CMEC 4OQZA 3QVWA 1ZSVA 4CV2A 1N7HA 2I65A 2AG5A 1HYEA 1WP4A 4EUHA 3ZW9A 2YV1A 1NVGA 1ZZEA 3ANMA 3V1UA 4PLHA 4MIYA 3WBFA 1C1XA 2Y93A 1IUKA 2AMFA 5TLSA 3C3XA 3U4HA 1ULSA 5HRUA 2QRJA 4PG4A 4WE3A 1EVJA 4PG7A 5JAMA 3ZWPA 5L7WA 3S1LA 3GUYA 4A73A 1I30A 5HA5A 4IDEA 2Y05A 2O7SA 3D1LA 4E5MA 5AXAA 2RIRA 3PXXA 2Y66A 4A0SA 3AK4A 3JD1A 1N1EA 4J7XA 4UAGA 2DM6A 2LDBA 2NU6A 5BR7A 4CPDA 3GY0A 2FOIA 4HFJA 1ADFA 3UXYA 3D5TA 4XRGA 1H6BA 3R3JA 4GGOA 1HDRA 1IULA 1LEHA 2UUPA 3E5MA 4LRSB 2D4AA 1KVUA 4PLYA 4OM8A 3WGGA 3FR7A 2NTJA 4MP8A 3DFZA 2P9EA 5JXWA 5T5QA 4RPKA 3ZWAA 1ENPA 3EZYA 2FHSA 4INAA 5ER6A 3TL3A 3D3EA 2R2GA 2X0NA 1LC3A 1XLTA 4NH4A 4FOOA 2VT2A 1G1AA 4E32A 3NT5A 3GZNA 5CG2A 3TWOA 1ADGA 4FOSA 3O9ZA 4DC0A 3PDJA 4Z0HO 3UUWA 3K9QO 3WGOA 1IHXA 4YXFA 3AI1A 4MO2A 2QYSA 2CNBA 4CM8B 1C0LA 2O7QA 1BDMA 3IOYA 3PDUA 4UUPA 4YB8A 3DHNA 5TIIA 5I7SA 1GPJA 3DBHA 4KWHA 3ADOA 1PQWA 4OQYA 4YVFA 3V5NA 2YHUA 4YJFA 3FTNA 1Q0QA 1P0FA 2WD7A 5DOVA 4OJNA 3DZFA 1MFZA 3G1UA 4CMGA 1X0VA 1R16A 4BQPA 3LF1A 1WW8A 1DIAA 2H63A 2AQHA 2X0IA 7MDHA 1E3JA 3OFSA 4W82A 3KSDO 3UFXA 2RH4A 4YAEA 4G65A 4HNGA 5AXDA 2VHZA 3SEFA 3D7LA 1GQ2A 1YL5A 2VZ9A 4FFOA 2PKQO 1Y7TA 3WTBA 5DCYA 4L4RA 3ETEA 3DTYA 4CLHA 1LNQA 3JYOA 3I4FA 2AEFA 3E8XA 4DUPA 1O5IA 4NFYA 1E3WB 5K9ZA 1A7AA 2ZJ1A 4ONEA 1WZEA 3GOHA 3O03A 5KKCA 3K92A 4YRBA 3A1NA 4M87A 4J1TA 3RC2A 3O4RA 1YE3A 1U3VA 4MIEA 2YFQA 2BKAA 4KTVE 1B14A 4MKZA 1ZK4A 1IPFA 3DAGA 4RVHA 4E2WA 2UYYA 5DBGA 4OMUA 4RJTA 4KDEA 1NPYA 4DVJA 3JQ8B 2NU9A 5TC4A 1NFRA 4IPTA 2HLPA 5ILOA 1SCUA 2ZYDA 4WLOA 4ZQBA 4DPKA 1UH5A 1QKIA 1VL6A 4BGVA 1I2CA 3G3EA 3L77A 2ZQZA 1O6ZA 2XPCA 1Q2XA 4JLWA 3JQ7B 2HCTA 2Q4BA 4I1IA 1Z75A 4HUJA 2EJWA 4K26A 3K96A 4L8VA 1Z73A 3U4DA 4QX6A 4CM4B 1DOHA 1I3LA 1DC4A 1WZIA 1UJMA 2CUKA 4YJDA 4WLFA 4E2XA 8ADHA 2RBEA 3GMDA 1ZSNA 3F5SA 1EVZA 1U3WA 4CLEA 1PWZA 1F8FA 5G0SA 2PGLA 2ZK7A 5CEFA 3CSDA 2EG9A 1HE2A 3JYNA 4DGSA 2O4CA 1YQXA 3OJLA 1P1FA 1RYEA 1GPDG 2IYPA 2J3KA 3ORFA 1GFSA 3PTZA 4KUHA 1WVGA 3BTUA 2ZJ0A 2B4QA 2Z1NA 4HFNA 4I08A 3WSVA 2O3RA 2EW2A 5TNXA 6ADHA 4IXTA 3KLMX 5ILGA 1PL7A 1X0XA 3C24A 3L07A 3L4SO 1W0CA 1BG6A 5LC1A 5IN4A 4YA6A 1HKUA 5EMHA 3AOEA 1GD1O 3QVXA 5KJFA 1U5AA 4FCCA 3WFJA 2RHRA 4BKRA 5FFFA 4J49A 4FN4A 4K1LA 3W6ZA 1E1KA 2W2LD 4MP3A 9LDTA 1X1TA 3IQDB 3RC1A 2EHDA 2EGGA 2ILTA 4L4SA 4KUEA 3KEOA 3SJUA 4NI5A 3B1JA 1ISMA 2ZB3A 3V8BA 4XJTA 2X4GA 4JNKA 1CETA 2NSDA 3F46A 4YRAA 1QV6A 2RCYA 1T2DA 1HYGA 3PRJA 5JAZA 3TFOA 2WE7A 2ZCVA 1CERA 1LSSA 1MGOA 2B35A 3RUDA 4PGFA 3W1VA 4CODB 4R1TA 3D4NA 1GCOA 5I9LA 1KY5A 3TFQA 2FPIA 4ALLA 5JCXA 3FD8A 1X7DA 4N18A 5JDCA 3JD3A 4UVEA 1A4IA 2C0CA 1GY8A 4XD2A 4CL8A 4J91A 4LCEA 4BIIA 1RJWA 3DOOA 2DTDA 2F00A 4KQWA 1S6YA 5I7FA 4G81A 3KBOA 1GUZA 1VJTA 3ZNNA 1YB1A 4J3FA 3ZDFA 4BS9A 2Q3EA 1U8FO 4LVUA 3DDNA 1NBOA 4FBGA 1LDGA 4OGWA 2NU8A 5U4QA 4TKMA 2BHLA 4WLNA 1A9YA 5HWSA 1P0CA 3AM4A 3LT0A 3PJFA 3QVOA 4UULA 5ENDA 3ETGA 4ZVVA 1ENZA 2FR0A 2OOSA 3V2HA 1G0NA 2OGUA 4R5HA 4YJHA 5EJ2A 1U4SA 1CF2O 4RZIA 2PGDA 4F6CA 3KLPX 3KYBA 4PG8A 5L45A 4E6PA 4AJPA 3L6EA 4N7RA 4J1SA 3H9QA 2PNFA 2E4AA 1F17A 1CJCA 1M66A 4GGPA 2W2KA 3VPFA 2EV9A 4XGKA 1LXCA 3QW2A 2JD0A 3C85A 3COSA 1YB4A 1L7DA 3PQDA 1MG0A 5G0UA 2Q1WA 2OBNA 1V6AA 2FZEA 2O23A 4GVLA 3NT4A 4ZQGA 2EKQA 4CLRB 7ADHA 3PPIA 4BNLA 1GDHA 3DMTA 1DPGA 1P9LA 1R4MB 2VZ0A 3JQ9A 5A9SB 3ANNA 3KO8A 4IDDA 1GR0A 2IXAA 2HAEA 3INTA 4TRRA 4YEDA 5DF1A 3S2EA 3U62A 1B3BA 2RHCA 1ID1A 2CSUA 4AL4A 3I23A 3ZU3A 5L7TA 1I24A 3B6ZA 2NU7A 4LCJA 1PJBA 5I9NA 4L74A 4R9RA 4Y6SA 3CUKA 2X5JO 5JY6A 4CLOB 4NIMA 1HL3A 4KP7A 5AOVA 4JX8A 4WPGA 2P4QA 2GDZA 4R3WA 3AOGA 3OJFA 2NWQA 4WLUA 1V9LA 1UZMA 4MIOA 4ALNA 2JCVA 2YDYA 3QQPA 3L4BC 4LMPA 4MJLA 1NASA 4E5YA 1RKXA 1GQQA 5CPBA 3TZKA 3O26A 1Y8RA 1YDWA 2GRAA 1KC3A 4IINA 1DC5A 2YV3A 3T7EA 2VTDA 3OH8A 4J4TA 4FDAA 5GZ1A 4LSWA 4IJUA 1HF3A 4J7CA 2Q2WA 4NBRA 3EZLA 4EGFA 2Y1GA 4LVCA 4ZHSA 2O48X 4O0LA 1UXIA 3O38A 1LQUA 1VJ1A 4IBOA 2CMDA 1SNYA 2YDXA 4XR4A 5DBIA 3DO5A 5DP2A 1EFKA 2NVUA 4TSKA 3U0BA 2DTXA 3DZGA 4IDGA 1NQOA 1VE9A 5IF3A 2F1KA 3BZUA 2DBZA 3FPCA 4B7XA 3HDJA 5L4NA 3AU9A 4I9HA 2WDZA 1EBFA 3WIEA 4FFLA 1ZK1A 4HKTA 1P3DA 2C29D 3Q0EA 4XIJA 3QRWA 5B4UA 2D5CA 2RH8A 1HDCA 2HMVA 2GGSA 5L4LA 2V6MA 1CDOA 4CV3A 2A94A 4UUOA 4DYVA 4TRMA 1DXYA 3NDRA 2IODA 4Q3NA 3BMNA 4GWKA 4L76A 4IS3A 2CD9A 3E6AA 1MC5A 3GVPA 3JQAB 4GX5A 1HWYA 3IL2A 3TN7A 4B7UA 4WNIA 4BNNA 2HMUA 2QG4A 5TT0A 3RJ5A 4PZEA 1BW9A 5F3RA 1G6KA 1E7RA 1GEGA 5DN9A 4RVGA 4BHTA 5B12A 2VTEA 3BMCA 3OA0A 1SMKA 1X7HA 4WOJA 1C1DA 3LYLA 4RF2A 1QRRA 2EIHA 2QIOA 1ZVMA 5B1YA 1UP7A 4D0SA 3LT1A 3WGQA 3ABIA 4XCVA 2FY8A 2VOJA 1D1SA 3Q11A 4BO7A 4CLOA 2ZTVA 2X8LA 3VTZA 1GUFA 4KTTE 4YJGA 1ZK0A 4UUNA 4AJEA 2JFGA 4J0EA 4CM9A 1MA0A 2J5QA 1PJ4A 1KC1A 2P91A 1Y1PA 3BMQB 3RU7A 3SLKA 1HLDA 3PHJA 3EGOA 1SC6A 1W73A 4O63O 1WDMA 2AG8A 2J6IA 1WPQA 5IXYA 2GLXA 3RKRA 1E7QA 2ZIZA 4ND3A 1LA2A 1BXKA 1VKNA 2PFGA 2Q4EA 3FWZA 3JQGB 3KYDB 1JDJA 4N5MA 1V3TA 3RROA 3Q3CA 4QT0A 5F21A 4U6QA 3PHLA 3VZPA 1P1RA 1CEQA 3OEYA 4NBUA 4XYLA 3NRCA 3LZ6A 4GKBA 4QSMA 3MWEB 1PQPA 4TVBA 5JW6A 1J0XO 3RFTA 4FPXA 3W6UA 4RF4A 3ICPA 3RC7A 4D41A 3KYCA 4ZQFA 1P44A 3GEMA 3GDFA 3H65A 4R9SA 3V1YA 5U1PA 4GMFA 1NFFA 4BKQA 4WLVA 4P4LA 1LRKA 1OFGA 4FS3A 4DLAA 1HDXA 1M67A 4ILKA 3UOGA 2Y1EA 1ARZA 4CUZA 2TMDA 2NLOA 2JCXA 3G49A 3K2BA 3FHLA 5T8KC 2GN4A 3IS3A 5H81A 4BV9A 1JLLA 3WYEA 3SBOA 4B8ZA 1SB9A 3LF2A 4WCFC 3NV9A 4OSPA 1DBVO 2DFVA 4AICA 2B36A 1C0IA 5K6AC 4MKXA 3HFSA 4RZHA 4MVJE 1Z74A 4I5DA 3INRA 3CKYA 5EQFA 2ZATA 3MJTA 3ROQA 4B3JA 4JROA 4IDCA 2DBQA 5JCJA 4W9NA 1GV1A 3MJ4A 3CINA 1JW9B 1A4UA 3KXDA 1Z7BA 4IM7A 5JFOA 4FFMA 5CAEA 4CQMA 3CTVA 4H7PA 4UREA 2IE0A 1E92A 1XHLA 2E82A 2IEBA 5T64A 3ZV5A 4FSHA 1XQ1A 5L51A 2I99A 4XYBA 1YJQA 4TZTA 4MKRA 4OSOA 3N7UA 2VWQA 3IIEA 3JQFC 3OECA 4FD3A 1C1XB 1DIHA 1QXSA 3GHYA 4YDRA 3ZWOA 1JKIA 1HEUA 1WNTA 4EEZA 3FI9A 1BXZA 1P1HA 4OL9A 2JCYA 3H8VA 3UCEA 3QWIA 3D0OA 2ZYGA 4KMSA 5KVCA 4ZGWA 1H0KA 2E37A 3DL2A 2A4KA 4MVJD 3GDGA 3C1AA 3AI3A 4CUKA 3WWYA 1PS8A 4QEDA 4BGUA 1MC4A 3VH2A 3VPHA 1WAMA 1CQJA 2DUUA 1VKOA 5TGDA 1O89A 1UZLA 4WASA 2OMEA 3DBRA 1EDOA 1RWBA 4ZRNA 3QLJA 3WXBA 2NVBA 4DQVA 2Y67A 1ZXLA 1QLJA 3P7MA 3U4CA 4RF5A 4EITA 2Q2QA 3JD4A 3BYZA 4BO0A 1PL6A 1PL8A 4Y98A 3VZQA 2FWMX 4Z9YA 4EUFA 3UH1A 4E2YA 3DWFA 2GASA 2CDAA 4XYMA 1YBVA 1T2EA 1XGKA 4QUKA 4IGFA 1P1KA 1KVTA 2CZCA 3A4VA 1D7OA 2D5AA 3WIDA 1AE1A 2B0JA 4XR9A 1HXHA 1J49A 1VLLA 1MX3A 3C1TA 4BO1A 4BV8A 3GZNB 1M76A 1VL8A 4D45A 1YO6A 1M2WA 3FNGA 3I9OA 4EZBA 1ZBQA 4JP3A 4TRJA 5ES3A 5L9AA 1BMDA 1ZK3A 3F1LA 3SJ7A 3GT0A 2IYOA 1AUPA 3U9LA 3P5SA 5JSFA 5DDIP 2OUIA 3E9NA 3HFGA 3V1TC 4X54A 3MTGA 1NX6A 1YH3A 5A06A 2OBYA 1AHIA 3IP1A 4MVJF 4D3FA 4TROA 4YJFB 1GYQA 1PZFA 3VAZA 4BO4A 1XR3A 2WD7B 4Y9DA 2FSVA 3HB5X 1B8VA 2YV2A 3EDMA 1KY4A 5GY7A 1Q0LA 1HSZA 2JHFA 5BQFA 1B26A 1BVRA 5F1PA 1KETA 3LC1O 2HSDA 4Z9FA 4DC1A 4TWRA 1OC2A 1XSEA 2CY0A 3AW9A 3O8QA 3SLGA 5DCWA 4A2CA 1U4OA 2FP4A 2C5AA 4WUVA 4R3NA 3GFBA 1P1JA
chains in the Genus database with same CATH superfamily
1RHMA 2M32A 3O1JC 4BDTA 2H00A 2O54A 3H87A 2GOYA 2Q3JA 1PWYE 2FFAA 3F9RA 3P4XA 2C94A 1QP4A 5DPMA 3HCBA 2CFIA 3H2SA 3IJ5A 4CFSA 1G6OA 1QMPA 2FSHA 2J59A 2IS6A 4DEYA 1YVEI 1TKCA 1WDWB 1ZGJA 2V7VA 1G291 1A95A 3BWBA 2GBPA 5T41A 1HE5A 1WZ2A 4K86A 4EB0A 2XYGA 5DX0A 3EMDA 2XA2A 4B6EA 4YH1A 1NMQA 2PEZA 3DHWC 2AN5A 3H05A 3FBTA 5DHTA 3NX4A 5FUQA 4G0WA 4OQMA 3L0SA 2GUGA 5KOIA 2D06A 4EYGA 2RGRA 3NWPA 4JLJA 5EAIA 4ER6A 5HJ2A 4A15A 2YWDA 4M9SA 4Q4HB 3LP8A 3QVSA 3DBVO 4UBKA 4QOGA 1RXYA 2P67A 3I2HA 3TUJC 5EIEA 2RHLA 1NIPA 2VJDA 2YXBA 1OT5A 3JAWB 3FBGA 3LGXA 3ONNA 5K0ZA 1F0KA 2HHHB 2EJVA 1NYLA 2CF6A 1L1FA 1E77A 1RWVA 4PX9A 4WBNA 4XZ3A 2J6BA 3DE1X 2H5JA 4H4DA 1PJCA 1ZVVA 4QVGA 4O5OA 3ZCXA 2I6TA 1YB5A 3IQWA 4TWZA 4US2R 3PD0A 4PLFA 4CR7A 1USKA 1VJRA 2HLDD 3DXZA 2CEAA 1VBKA 1L7PA 1ZN9A 1ZM7A 2Z57A 3L92A 4J90A 3THWB 1L1EA 2G9NA 4NJEB 4GNRA 2GJSA 4L4ZA 2UVDA 4Q6WA 4YDHB 5FORA 4P0PB 5B7QA 5BN3B 3E53A 3HSSA 5C51B 3O5AA 2ALJA 5JCOC 1NZFA 2EZ4A 2FZVA 2FEPA 2YFKA 3HSYA 3U37A 3PGKA 1NJ5A 1N6OA 5HCIA 4CF3A 4WMLA 1PR4A 2PLNA 4YRGA 2CVZA 1AKQA 1H4TA 3CH6A 3MELA 5DHAA 1L8QA 3FFBA 1JYFA 1JIIA 2FPSA 2RDMA 1H2EA 2OV4A 3DULA 2DKOA 3IV7A 1O0CA 1L7MA 1MX5A 3V34A 2R6DA 2RHOA 2GD6A 1M2KA 1ISRA 4YQEA 4L50A 5K0GA 4N47A 1MO5A 4X91A 3Q3EA 4KKXB 3GXOA 2E7ZA 4WA7A 2OB1A 1PVOA 1GL7A 3FPBA 3GJRA 2H4ZA 4RD3A 5M04A 3IAS1 5DU2A 4AW9A 1BA3A 1LRJA 4DQKA 1XXHA 3P9KA 2QAJA 3NBAA 3VNUA 3VR4A 5DO9A 1EB8A 1TA9A 3LUDA 1RABA 1AURA 2GH1A 5FA6A 1Y7IA 1SC3A 1BYIA 1FJHA 1GL3A 2Y0DA 3GFQA 1L3CA 3IBSA 2V58A 4P3KA 3GGCA 3REQA 3TRDA 3BA6A 3U4QB 2GK3A 3GPCA 4GM0A 1P19A 2RK6A 3UV7A 3UHOA 3E22A 1GR1A 1EE2A 3FPSA 3MGKA 5LQNA 4WBSA 4JL8A 1QHSA 4XPIB 3R09A 3AERB 3LXUX 3AGPA 1A7JA 4IJKA 3CNOA 2GK6A 4K40A 3WRXC 3NKLA 1LRLA 1PG5A 1T6ZA 5IEJA 1YL7A 2XA9A 2KQUA 2IZ0A 1WXFA 2YVQA 4A9AA 1TMGE 3NAQA 3RVDA 1Y3FE 5KIAA 1CY0A 1QTIA 1PS9A 4LNUB 4ACBA 1L9KA 3ZJUA 3SE0A 2R68A 5ITWA 5I7WA 1O6GA 5EQDA 3RIEA 2F3TA 3ZUGA 1DX9A 5IAOA 1JLRA 2ABWA 2O2DA 2XKAA 4XM1A 1ELOA 5ADHA 1MDBA 5L3ZA 2V54A 4Q1VA 4DRXB 5JPIA 2EX4A 3EYWA 4FEYA 4R40A 3TAHA 5A02A 4EABA 3EG9B 2G25A 2ETXA 2XTZA 4HEHA 2FPLA 4RV5A 4YONB 1C7FA 4L85A 4C87A 4UPEA 4E1BA 4YCSA 3VH4A 4YRTA 2Z9DA 2O2GA 2PUJA 1FS4A 1O77A 4JA0A 3TVYA 1K5PA 4BNUA 4F7DA 3JAWA 2OV2A 2BI8A 3VAAA 1OQAA 5EPUA 3ROFA 2Q41A 4FD2A 2YMLA 1SXHA 2AI3A 1TECE 4I9NA 1MH1A 1SKUA 2PRZA 1ECCA 2V59A 3HZOA 3I28A 4QYWA 1E96A 1JIUA 1A82A 1Q1BA 1E5QA 2H1CA 2QU7A 2R8BA 3AP3A 3C3MA 3D1JA 4I5FA 3CLTC 5MGNA 1GPUA 3HFJA 4WKOA 3KZ1E 3EGCA 4RLQA 4HZIA 1J0AA 3V1KA 1NMSA 3RC3A 3OETA 3R9XA 4EY6A 4WZ6A 3UMSA 1TZMA 1PIWA 2CDBA 4MPJA 2GD2A 4ZYVA 5J3JA 3B48A 1T5TA 2B2NA 4KQFA 2NXWA 4YAIA 1I2AA 4DTCA 2SHKA 1E0JA 1K5DA 1GGJA 2QT9A 1U1CA 3BIWA 1PT7A 3R3WA 4Q1FA 1JTEA 1NAHA 3RSLA 1MNQA 2IEDA 2QRNA 2JGNA 2QW8A 1E2GA 3PWKA 5B1SA 3PT9A 4UBLA 3MCZA 1MIOB 4OKIA 4YNBA 5K3EA 3DV0B 3TRKA 1DKUA 4RY9A 4NCAA 1HT1E 2BGWA 4PTZA 3E03A 1ZUIA 3SYKA 5K3FA 4OY3A 3WSWA 3GU3A 4I50F 1U04A 1FJ2A 2HT6A 1O8CA 1UDBA 1OBHA 4U8GA 1EVEA 3OCYA 5DCUA 3TQQA 4Z86A 3TTYA 4HB2A 5EGNA 1JIVA 3WSTA 3VPSA 5LQKA 1Z34A 1P2BA 3ITEA 1Z6QA 4EYQA 1T9HA 3LCRA 1XEAA 4FNAA 5KPJA 4BY9E 2QENA 1ND6A 2WWYA 1OWNA 1P9RA 3K4QA 1HV8A 1WU8A 2IY9A 4MV0A 4URHA 1Z22A 2BAGA 3H99A 2IYFA 1FPMA 3RW9A 2ZIGA 4CGYA 3C7DB 4DSZA 3IKLA 3AF2A 3A70A 2WTXA 3S7ZA 1C7JA 5HK9A 4CEJB 1BCRA 2DERA 5KC8A 1AQUA 1Q5PA 2HGZA 1THGA 4IJ6A 4O4IB 1UPTA 4S1TA 1U3FA 4E4YA 1NP6A 1CYDA 3O6VA 5BSWA 4YLGA 4JGIA 1KZYC 1YQDA 1ZXBA 5GAJA 2PU7A 4JI5B 5HKOA 3AZPA 4EJ2A 3H9JA 5LZ7A 3KQOA 5JNVA 2V6FA 1FUYB 1G98A 1N6NA 1OH6A 2DPHA 3K8QA 2AJ8A 3R9XB 3GEPA 1KVQA 3DZIA 5DWDA 3I1FA 4IUYA 2G06A 2ZVDA 1ORVA 5J2UA 1CNFA 4GOMD 2PO7A 3PEUA 1D6JA 3HM2A 3A2MA 4AF7A 5A5DA 3IUQA 4U2CA 1J07A 4HTAA 1T3ZA 4D46A 1EM8B 2BDTA 1V8ZA 3AG6A 2OQRA 5FL7A 3SZRA 2WSIA 3N3BC 3VHXA 3DR3A 4GLLA 4OAQA 2H9IA 5DLPA 3CW9A 1JFFB 4BX0A 4ZZ3A 3DZJA 4Q0MA 5AHWA 3TVTA 5T8KA 3R0QA 4HADA 1MKYA 4LNAA 4FDUA 1W2GA 1P7ZA 4HR7A 1LV8A 4KE6A 1J4AA 4ER5A 2Z6UA 3FWPA 2C2XA 1P0MA 1HRKA 1Y7PA 2RHJA 4W6ZA 3A58B 4H1WA 3FCUB 3TKLA 4CXMA 3PE3A 3S55A 1EHCA 2I67A 3CSSA 2OHOA 3PVCA 5DK6A 4Z0TA 3QUCA 3E3LA 3WHLA 2IYTA 3H5IA 4IGKA 4JELA 2FWIA 4TT3A 3OHSX 2JAXA 1B16A 3LY9A 721PA 1ZSYA 2V6JA 1P62B 1VZ3A 1BDIA 3HBMA 3OT1A 4LQDA 2PL3A 3T3MB 4KFUA 3AP1A 1R5NA 3G1WA 5FO1A 1XBTA 5CDSA 1IBCA 1SPXA 1JHZA 2WFMA 3MGBA 1ISIA 1O7JA 1W75A 2OVBA 1JIKA 3L4EA 3HLYA 3BXXA 3QYFA 4R8LA 2BP7B 4X1KA 4XVHA 3VYTB 3ZCRA 1GTZA 1F51E 5TF4A 3WADA 4EPXA 3HZRA 3QIVA 2I2FA 3ER9A 1H23A 4R7TA 2ZDQA 4J2OA 3PIRA 3ZZTA 2E49A 4JL5A 4BMOB 5J1TB 1MIOA 1L8XA 1SCBA 3E70C 4V1CB 3DPSA 4Z9XA 3RFXA 5IMBA 2NIPA 5EWJB 2B83A 1IHPA 3HSKA 3LQYA 1IHYA 4EHDA 1NBMD 1L6RA 1NXXA 3BMNB 3OOYA 4OD0A 7AT1A 3NXKA 2E87A 2QTMA 4Z7QB 1A96A 1RJ9A 1BTOA 3LXXA 3NAGA 2UZAA 1NMXA 4PZ0A 5JSUA 3BGWA 1V0JA 3DZDA 4R9NA 3AVTA 3QFHA 3ORSA 4LBVA 3VHLB 3EULA 4XTRA 1PJ8A 1SZPA 1U9IC 3D3WA 3QE3A 3B1KA 1P4AA 1NQWA 2FPKA 4LXIA 5KNDD 5KWEA 4E6EA 5BUSA 4I4TA 1SVSA 4AZWA 2JZNA 1B1AA 3BMCB 2UUCB 1ZMTA 4JEUA 2ZJYA 1ZMXA 4K9SA 4OYLA 4TKLA 5M7EA 3VC2A 1K6IA 4PVDA 5AKLA 2IYXA 4ZC8A 5AI6A 1A9QA 1HMYA 1B42A 5IXJA 3R0JA 2IEGA 3BCSA 2VP3A 3AINA 2J3EA 4ATNA 2E85A 1WNFA 3ZK7A 3X1KA 1A88A 1OOEA 4NESA 4GHWA 3TD6A 3PIDA 2CFCA 1XD9A 4ENUA 4YJGB 3W9BA 3FGZA 4TTQA 4U7PB 4LWQA 3VO1A 3R5TA 3PVSA 4GLFA 4MUGA 4GP7A 3FF1A 4JJZA 5FPKA 1GNVA 2YQ4A 4JBNA 3MEQA 4UNNA 2MTBA 3FPLA 3NAMA 1UBRS 4N9QA 4N8EA 4EHNA 4C9BA 4EI2A 1FSZA 1GSOA 2VT7A 2JD2A 1CUGA 4JBHA 2WICA 1FRQA 1WULS 4U6SA 4EDFA 3IR6A 1K7SN 3JATA 3USES 2ONYA 3W5DA 4FIZA 3DGFC 2WUGA 2A7QA 3DMDA 3TK1A 2LRHA 5HFJA 4AZVA 3REFA 2GEVA 3C39A 3CLHA 4JEHA 4B0PA 1VA5A 2WFAA 1P1IA 1ORDA 2BM0A 2C8LA 4IUDS 5H59A 1A9XA 2NZUG 3T3IA 4X61A 1HURA 3M5WA 1JVBA 1N3BA 1XG5A 1GZUA 3BRCA 1FU8A 2QR3A 3AWIA 3E35A 1FPQA 2BCEA 1VGRA 2XDYA 3HWRA 2C5EA 1E59A 1KDTA 1W5EA 1DEOA 2E4XA 3EE6A 4NOLA 4QXRA 2OXCA 2XIJA 4D9KA 3K1YA 4YMHA 3VZRA 4Q3DA 2KLBA 2MSDB 1OZAA 4RVOA 3PLNA 5EYPB 5EXPA 2RHDA 1M2HA 2J3IA 1CRPA 4NLLA 3FPFA 5FV7A 2B6HA 4JU8A 2XF8A 1WS6A 2FQXA 4GI1A 1WXXA 3L6UA 5K3SA 3DD1A 3SXUA 4EMBA 1KO1A 3GLQA 4JMLA 4LGVA 3KKMA 3O8OB 5DTJA 4B84A 3DVAA 4TVOA 5JT1A 1W93A 1PVVA 3NGLA 2VYNA 3NRJA 4MVJH 1XI2A 2LTAA 2IX3A 4CMEA 2EX1A 4D0LB 1CJTC 2GR9A 4PYOA 5KNCH 4B3IA 1J2TA 1A04A 1ODLA 3IPXA 1L4LA 4UZFA 3FOEC 5CH5A 1E0AA 1NMEA 4DR1B 4X92A 1P33A 2FPGA 3VI3B 2ZI6A 1ORWA 4WEQA 5KQGA 4LVOA 3EPKA 2XE7A 1GM5A 1T8YA 1WPGA 2FJPA 3A6JA 5REQA 3OQIA 3TGLA 3HU1A 4Y1GA 4AN0A 4M8SA 3W8NA 3FTFA 3TI9A 4PPYA 1RRPA 4BO3A 3U1VA 4UXJA 5DZSA 1VBFA 3QKRA 3C6YA 4X64B 5GZ6A 3BK1A 2D0DA 4DQXA 4HRAA 3CBGA 2Q5QA 1ACJA 3GHHA 4XUGB 2JEYA 1CQIA 4HQNA 5CDFA 4YQFA 2CXNA 3SSOA 3SJAA 2ECPA 2WKPA 1VCHA 3KWFA 3ISVA 4GE0A 3AVXA 1QKJA 1RFLA 3HCAA 3B3GA 3PQFA 3PXEA 3Q2OA 2C3UA 3ROTA 4F3CA 1L5MA 5K8LA 4L0CA 1PR3A 1IJBA 1OX4A 1PJ2A 2P8JA 3DNFA 4OFWA 4QQNA 2FAXA 2IUYA 2R6JA 5HTOA 3DV9A 1UPFA 4I55A 3ERCA 2B8EA 3IAFA 4D4HA 4Q15A 2MDTA 1H2BA 4R41A 2DWOA 1CY8A 2QTVA 4RH0A 5NULA 1XTRA 2J48A 2NYUA 5CPFA 4CM7A 3FX2A 3O0TA 3OOSA 2ZI7A 1UWCA 4R1SA 5TRTA 4EG8A 3CWCA 3ZWBA 1UZAA 3WK5A 2BZ1A 4RV9A 2RH5A 4MKFA 3TXXA 4DL9A 5KNDH 4CKCA 1YWGO 2XB9A 1QQ6A 3F4LA 3E7XA 5C80A 1EFRD 2BSAA 4TLCA 2VXCA 4XDGA 2GKSA 1G3MA 1Y5NA 3D7MA 1I2ZA 3GGSA 3QLUA 3UUFA 3EC2A 5I4BA 1TCCA 3OKPA 2C78A 3GV0A 1MO4A 5HE8A 5JJ5A 5AJYA 3BIOA 4JAVC 1NLZA 2HN9A 2QUIA 3ZX5A 4DPMA 1KZ9A 4EYKA 5AKZA 1IC6A 1NYRA 1T9GR 5A5GA 1HA3A 3EVFA 4QWWA 1NZDA 5A4DA 5KHLB 2IWHA 3ENVA 3WKCA 1MD9A 1HZZA 3HS3A 1G7RA 5JPCA 3HN7A 4L28A 4IV8A 4M1EA 1U2DA 2WF9A 4A0HA 1S3GA 2VA9A 4B47A 4F11A 1RP7A 1EYZA 4GECA 3D6MA 1GZ3A 4L4XA 4W7HA 2W2OA 2R8EA 4N5LA 5JXJA 2H4WA 1BJRE 2QT1A 2R7LA 4I7EA 2ZJ8A 4B3TB 3JQAD 4RMGA 1F48A 2E48A 1K7YA 1N8KA 2VSNA 1XP8A 4FJ0A 2P9CA 4F4HA 4DHEA 4X9XA 5JASA 4FFNA 2I33A 2FDCA 1ATZA 1ZD4A 2A5JA 3DT9A 5AJHA 4BMZA 4A6EA 3M6MD 1J90A 3EYAA 4GX0A 2A5YB 2BEVB 1YL6A 3WO0A 3SWWA 3PDCA 3W8EA 4MB0A 2PWAA 3Q9UA 1F8GA 3N5CA 4URVR 1LI4A 2FMKA 1K97A 5DSTA 1P6QA 4OI0A 4QPNA 5GGYA 4ALMA 4D43A 1NXWA 1UOPA 5CYGA 5KKNB 4WRRA 2Q1TA 2QN1A 4KDFA 4R8RA 5A6VA 5ADWA 1NVWQ 5HXAA 3QW2A 5HBGA 4XWYA 2B8NA 2VHTA 1VRCA 3ZU2A 1BGXT 2Y4OA 1DQNA 3SZLA 4LF6B 2H8GA 5AOAA 4HH3C 1QO0A 3T7IA 4TXJA 1QRTA 1CZKA 1QGUA 2C2MA 1KQNA 1EJ2A 1ZDMA 1V5WA 2A0UA 2ET6A 2LIPA 4RFSB 3LPCA 4DANA 1WBBA 1LDNA 2C8VA 2GYVA 3CVJA 3HUUA 2PKQP 3QUSA 4FILA 5AQEA 2GNPA 4I81A 2O0MA 2FP4B 2I2WA 3RKSA 5GJWC 3M9XA 3H2ZA 4X7BA 2HPAA 1R0YA 3EXAA 2FSIA 3SF8A 4ZJZA 1P60A 4HGQA 3UN1A 4JJKA 3VBCA 3ZOZA 1VKHA 1VPVA 2VQ3A 4DA6A 1PZHA 1ZUNA 3SBDA 4DT1B 1AGPA 1KJIA 4C14A 1I4WA 4MKHA 1PJLA 2H06A 1JX6A 2IXFA 2IUSA 4MVJP 1E7WA 1NI3A 4WDQA 1B6TA 1I80A 4JHXA 4PC6A 3IXMA 5BQ5A 5CLJA 2ZTLA 2GZRA 1J22A 2V7BA 4UBMA 5EJ4A 1P0PA 3ZS9A 4A6XA 3KIPA 1FY2A 3FKJA 1KBOA 2OORC 3LUAA 3Q3IA 4LHZA 4QARA 4RGVA 4X3PA 4ND7A 2X8BA 1K2WA 5IZ4A 3B1XA 5ALZA 5BV7A 1E6UA 1WXDA 2GEFA 5LZ4A 3THXB 1N6PA 1S01A 3ZCTA 1Q7EA 1MB3A 1SZDA 1O3YA 1C4OA 1W2WB 1GCUA 3DMTC 3UJCA 3IE2A 4QOIA 4HT3B 5FUYA 2BFPA 1RC1A 4YRMA 2Q45A 2XWPA 2P6NA 3DC7A 2WTBA 1EFTA 2I34A 1ULZA 2VVTA 3DS8A 4RK1A 5FRDA 4R2HA 4LF5B 4HGOA 5JISA 1W8DA 4FINA 4MUXA 4M7WA 3TH5A 1JUDA 1KAOA 2P5UA 3H19A 4RJIA 4FGLA 5IW8A 1W88A 2C2YA 1LPSA 3G9QA 3TZQA 4C0LA 2GFHA 1XU7A 2BGTA 1XRMA 2VT6A 2VYQA 3OLXA 4IIBA 4HNVA 2FR1A 3L0OA 1OREA 4HDCA 4RMHA 1SO8A 2RGBA 1JKJB 1UJBA 2EBWA 1DU4A 3K0KA 4NJMB 4TYQA 1F3OA 1Z3CA 3L7MA 3MSCA 1BVYF 1C3EA 1XTUA 1U4NA 1OE0A 5HDQA 3DYBA 1ZGHA 3AESB 3VR3A 1F6DA 2YWCA 3O8NA 4TYWA 5BSFA 3VGJA 1XAJA 4MPDA 5CB4B 2R86A 1EVIA 2QRKA 2WM2A 2IZ1A 3KEQA 3ZY6A 5DI9A 4CL3A 2OK8A 3CKLA 1Z33A 4FMDB 4WJZA 5D7BA 3TTSA 3A37A 4F3NA 1U28C 1XCLA 1ZUHA 2AF4C 2B3DA 2HXGA 2ZM6B 4NU6A 3V8VA 4G5GA 4OKSA 2QGNA 4OYRA 2G1JA 1CW2B 3QI7A 4A16A 4R6XA 1P0IA 1T8WA 2IS2A 1RCUA 3IQXA 3ZWVA 3RABA 5JC1A 1SGWA 2BFBB 4EY8A 2O8EB 2PD4A 3FMVA 4EA7A 5CDHA 3QSGA 2D3WA 2X3YA 4CQLB 5ITZA 2HQ1A 5M2QA 3I32A 3EAFA 2CXRA 1ODTC 1W5SA 4Y2RA 3DMFA 5IBRA 4PEVA 3VR6A 2VWPA 3LI2A 3RAGA 4PRYA 1OX6A 2OZLB 3I1JA 1QV7A 4RFSA 5ALSA 4EUEA 3PEWA 3DAOA 2PS3A 1P4HA 1FBNA 1Q92A 3B5EA 5LIPA 5TQVA 1ONNA 4RHCA 3OU6A 4RPHA 5JY1A 3A3PA 3OY7A 4CMJA 5IH3A 1J00A 2WFLA 4ARBA 2ODEA 3IBYA 4ZYWA 4PZUA 2BGLA 1HT0A 1YCGA 3PPVA 1N4AA 3O7MA 1K6MA 4IFBA 3S5UA 2MSWA 2JZOA 4V0MA 3EPJA 1G5QA 3SS8A 3GEHA 4JR1A 5BWLA 4DIFA 3AF3A 4ZKEA 3CZ5A 4CCWA 2XGJA 5CB6A 2WOOA 4RVNA 2P6PA 3R3YA 3OLQA 3UQYS 1OLSB 5FBZA 1R6UA 5LQDA 1CY1A 4GOJA 4JCOA 4X1IB 3C3PA 4KKVA 2NUTA 1PLLA 3UYLA 1PNRA 4I4LA 4DM3A 4N41A 4JR0A 2CB0A 3H1EA 2B4YA 1FCJA 1Q6ZA 3K6KA 1GWNA 4IG4A 1BJTA 1OI4A 2P9BA 4GYWA 5CX4A 3ZE7A 4LC9A 3NYRA 1WTAA 4Z3KA 1QFYA 1P91A 4BFCA 4LJYA 3T1YB 3H2YA 3UMGA 4DILA 5B7NA 5J4LA 1V37A 3D0RA 3HL0A 2CLMB 1NQVA 2OPBA 1H0SA 2FKNA 3AL2A 4QFBA 1B4DA 2DTEA 1CP2A 3A4NA 3JSAA 5EMMA 5EZ5A 4S12A 4HV4A 4ZZIA 1VG9B 3QELB 2Z9BA 4BAUA 4XGNA 4XX1A 1GRRA 5ED0A 4DMMA 4MYHA 5F98A 4J29A 5SICE 2BTEA 1N6HA 3DDOA 4G0VA 1ZK2A 3AILA 1EFVA 4YJ2F 3UWPA 3TMAA 1KEZA 1WMDA 4FCVA 4F3KA 2POQX 1CHNA 5DBEX 4C4OA 4JOSA 1LTKA 1UDWA 3P2MA 3VR4D 2HDNB 4OH1A 1DARA 1P4JA 2IHBA 4QNRA 1WHTB 4C30A 3ETHA 1RT9A 4MVWA 1KO4A 2YASA 3N6XA 4K6HA 4GWLA 4AD8A 4DABA 1WKBA 4DWJA 4UEQA 1V7ZA 1VMDA 2ZS8A 3FCOA 3ZWXA 1R12A 5CB4A 5T4EA 1Y63A 1PT8A 4BLOA 5JVDA 3I1IA 4F9FA 3PYMA 3SC6A 2Z3ZA 4Q66C 1N33B 2VJKA 3E1KA 3C6ZA 1R3DA 4E13A 1E5LA 4KZPA 4RK4A 4UPDA 1EDEA 4D56A 1HTBA 5AVOA 5E1DA 4HQ0A 2C3YA 5GOZA 1R4NB 3D8RA 3PF9A 1X74A 4RS3A 1WZNA 1JHOA 2L18A 4J8PA 1GTSA 1TNDA 3ZYZA 3IGFA 2IHZA 2JJ1A 1MT3A 2CDCA 4LAFA 3Q3HA 2NO6A 1BHO1 3BF7A 3BGOS 1CUXA 1E0DA 3NIWA 1BFKA 1M73E 1S1MA 4UMVA 3W5UA 4ECAA 5AKYA 1UZNA 4EFDA 5T57A 2CNNA 5CMLA 5K45A 1SVLA 4A8HA 2JK1A 3X1WA 2HXYA 3IAHA 3RC8A 1P0QA 1QE5A 5M5BA 3SEQA 4IHJB 1UAYA 4JJ7A 4O4JB 1J97A 1YR7A 1WXHA 1E94E 1KSHA 4OXIA 2BY4A 4Y6PA 3HKBA 4MCJA 2PLFA 4CIWA 5JFGA 2H59A 3COPA 3GAMA 4Q47A 3ZWWA 3KTAB 4TV9B 1CY7A 3GH3A 1JZSA 2YS7A 3WYDA 1MB4A 3K1AA 2WUFA 2Z6AA 5LDDC 3DDHA 1XTBA 5EA2A 1XQXA 2OHXA 4Y7CA 5JSHA 1OLSA 3VPBA 2PGNA 2DWPA 2QRUA 4G0NA 2GF9A 3H9EO 4X1IA 4HBZA 3UAZA 2TMYA 4AYWA 1S4QA 4KQHA 5JBQA 1P3Y1 3NHKA 2J30A 4RNDB 5D3MB 1KHHA 1NW7A 3STUA 1X1AA 3WZ2A 4CETA 2VDKB 1CR2A 3WVNA 4DSNA 3WXMA 1Z88A 1AGXA 1T36B 1IYZA 2R6GA 3A6EA 3C6MA 4XWAA 4BWGA 4ZT3A 3B1ZA 2A3RA 1A1VA 3NT2A 5LLSA 1R4ZA 3IMGA 1KMNA 3WYGA 2ISQA 3QXSA 1LQTA 1UOOA 2ORIA 5BSHA 4EFLA 1Z6ZA 2HSZA 1J0DA 3H16A 4Q7JB 4W4TA 5F35A 3IPAA 3E1GA 1GAXA 1GG2A 5E6UB 2I6UA 4X71A 1GU1A 2C20A 3ZV4A 1FP7A 3MOSA 4FOLA 3QELA 1VHJA 2JGDA 2O3UA 2AOUA 2VDJA 1PR9A 3LC2O 4FMCB 4ITUA 5C7YA 2OV1A 5MFZA 2HO5A 3N0VA 2YZMA 3QVKA 3EUAA 1FLAA 2PPLA 5ELMA 1WWKA 1YR2A 5CB8A 5JNTA 4XIIA 2H16A 2XD4A 2XOKD 4J9UE 2FGKA 1D2MA 1V16B 4RHFA 3A1CA 4WK6A 4YRDA 3HXMA 3DFUA 1V47A 1RI3A 1EFDN 1XRQA 4KMRA 1SEPA 3OQ6A 1KRHA 2Z98A 1IQUA 3TTTA 5HS4A 1NGSA 2YTZA 3CLSD 2V0GA 4D81A 2XRFA 1M2GA 4PSDA 1H22A 1LU9A 3NEJA 1T1RA 3NYQA 1NT4A 3WBKA 4DMCA 5KWSA 4D3ZA 1Q1QA 4GR4A 4IG9A 1T9ZA 3AHCA 4YUXA 2O2SA 5CCBA 4EUKA 4DA8A 2VDWA 5JYDA 4BCCA 2W6JA 4UUAA 3UJ7A 3BFKA 4CM8A 4FYVA 5LYYA 3KOWA 4LGMA 1HNZB 2A9PA 4REQA 1EUCB 1SKYE 3QY9A 3NVKI 3EUEA 3EBLA 4YCBA 2YBDA 4G5RA 4HAUA 4BVFA 2EW8A 2A67A 2BT4A 2V6BA 3M2TA 4Q93A 2EZ8A 3BQNB 4JJ6A 5JAQA 2P7HA 1E2UA 3RVMA 4D9GA 5B30A 1BU8A 3LL4A 3W6OA 3JX9A 2KSQA 1KAEA 3H9BA 1ESCA 1LI7A 3EXHB 3ZE0B 3ZNQA 1J21A 1FX1A 1KEKA 3IOBA 2IS4A 5FL7D 3A4MA 3MRVA 3FCXA 4JEMA 2J46A 1LPMA 1CDEA 1RMQA 3IT2A 1DB3A 2ZSKA 4F1WA 3QP9A 1KK2A 1KAQA 3LNCA 2O8DB 4AYTA 2V5UA 4IL5A 1NJGA 3KTAA 5AIAA 3SKVA 5JJCA 4R54A 3KDPA 2XWJI 3OE4A 4W1PA 5SYAA 5ICMA 1HOTA 3CNLA 2FVYA 3OLCX 1D4AA 5F51A 1EK6A 2ATXA 5KI6A 4O5AA 1DVRA 1E2EA 2QP9X 2UZ0A 4H16A 2BM8A 1QTNA 2GK7A 2W4QA 3A6PC 4TT3D 2JD1A 1N2GA 4TLBA 3B6EA 1E3WA 1NBEA 3INGA 4NDNE 3HGTA 2GLUA 1QP0A 2FUG1 5FI5A 3GNSA 4JIGA 5EMJA 1NQXA 2ZUWA 3R1IA 5I3ZA 3RSSA 5DTQA 4UXHA 2FN7A 2IOQA 4PX5A 1IUNA 4Z7NB 4UE3S 3CPSA 1FRZA 4IUBS 4ZEXA 4NFSA 2B4TO 4F3RA 1Z08A 3FDZA 3D64A 3DLTA 1M2OB 2ZRLA 4HS4A 2V7QA 3QLVA 5CUQA 5FP0A 3UJ3X 1COWA 2PMDA 1VI6A 4N49A 3LW7A 5AOBA 1RYMA 3EVBA 2D59A 3KQPA 3LPAA 5DLYA 4HLCA 4ABYA 1SK8A 5E4TA 3A26A 1SKAA 2CBXA 1PJRA 2F9MA 2BI7A 1SUIA 2VA8A 2VUHB 3FF4A 4GPBA 4M98A 4NPCA 2P6UA 1I33A 4GR5A 5AW2A 2IV2X 2XXAA 4ZVLA 4WZAB 1T24A 1L8OA 4O8CA 1DRWA 2Q9AA 3OO1A 4LV6A 2R7KA 1PTJA 1XQYA 3LCVB 4NICA 5FTNA 1GPKA 2K7ZA 4WW0A 2I80A 3TL2A 3HCNA 3A31A 2CHGA 3CXRA 4PYJA 3UCFA 5A3SA 2HNKA 1TQHA 3UEOA 3HPQA 5KU1A 2JGEA 5IM4A 4N12A 4LSZA 1CZLA 3FB4A 4HVLA 1NP3A 1EP3B 1AKVA 4XVCA 4XQGA 3GRUA 1XTJA 2BOVA 1JR4A 3IJPA 4U7JA 3FHCB 5EUMA 4RE6A 1E2IA 1RPTA 4PYNA 2IPOA 2VH2A 3NFYA 5FBLB 5IH7A 1EG2A 1G21E 2HA2A 2OCLA 3IDOA 1EINA 3VC3A 1X1DA 3ASUA 4FYYA 3ED5A 4HQLA 4NXNB 1M8GA 2X9NA 3VOAA 1PN3A 3QVVA 5A05A 3EB9A 5AVUA 4JQCA 3M6XA 2W2TA 1GVHA 2I1LA 3DMHA 4C7KA 1A5BB 4Q03A 4A0GA 3ONDA 1XVUA 1Q91A 3T5CA 2Z8YA 4O4LF 2UYGA 3GA5A 1UJ6A 2UZ1B 2PVSA 4WOCA 2E1RA 3N2KB 4OX9Y 2FJ0A 3BREA 2L69A 1RZ3A 2V6GA 3D4LA 2FYTA 1ML3A 3OJOA 5B3KA 1NVFA 5TX7A 1QVRA 3W0LB 3NYIA 4WKGA 5TT1A 4KFRA 4BNTA 3O2NA 2PSHA 4NCBA 1PGPA 4AM8A 3JR7A 1TYDE 2D8MA 4FFPA 2AOWA 1L4UA 2HQSA 2QM0A 3CA8A 3IBTA 1C3LA 3EGXA 1PBNA 3M2PA 2ZG6A 3S2IA 3TB4A 1NVVR 1XZQA 3WIOA 4PN7A 4CLDA 2YMMA 4YQYA 1HR0B 4AKIA 4IZHA 1RVDA 3BEDA 4QXPA 5FULA 1XYYA 4S24A 4WOKA 1JFVA 4PZAA 2RFLA 4ZDJA 2QUAA 5JROA 3QX3A 1P9WA 4X62B 2AFHE 2HU5A 3E9MA 4GDMA 4JMPA 3CX3A 4MUFA 2GXSA 2ADOA 4G86A 2ROQA 5A4FS 2OEPA 4M89A 2OBFA 3AT1A 1M34B 1B8UA 5U9CA 3KG2A 2GWRA 4I3HA 2J3LA 2ZSDA 4KQXA 4J2TA 3L5OA 4Q7QA 1SH7A 5LP1A 2A58A 2ZBFA 2FRDC 4EK9A 2BUCA 3PZBA 4S3MA 5B2ZA 2GAAA 2VYND 1QHEA 3KQKA 1C30B 4U2BA 3G0OA 3ESRA 2VRBA 4D98A 2R6R1 3DPUA 1T8TA 4F9TA 2IBTA 3QFCA 1VB3A 2O8NA 4DMGA 2QXUA 3MBKA 4JA2A 4NYMQ 3GI1A 4UBIA 4BJ5A 3QU5A 4P4NA 3H4TA 1IY2A 2HH9A 1Z5GA 5AM5A 2H1OA 4X6XA 2C3OA 1P2UA 2VRWA 1ZN8A 1HG0A 3OZUA 1IJKA 4NPAA 1YASA 1NNEA 4QDUA 4DC9A 3FKSA 3KLBA 2CBGA 4TTSA 4WLEA 2ZBUA 5TDHA 3A8TA 1UC4B 3WDKA 2PZJA 3JQQA 1SBCA 1I4DD 3LIIA 4WX2B 3ED1A 2XQGA 4A0QA 1B8NA 2EERA 4J1TC 2A8YA 4PO8A 5C8VA 5JSQA 1GITA 1JI0A 3PFFA 2Z95A 4HDQB 5EJFA 4ZARA 2ASEA 3UTCA 1GFZA 1GL6A 3D2AA 3EAGA 3NBZC 3L1KA 3RT9A 3TIXB 3UY4A 2WVHA 2LDXA 3ONWA 1W1UA 4XFDA 1EFCA 1UWLA 3EMKA 3I92A 1J8DA 1JN0A 2HPHA 5E6SB 2C7RA 3WLKX 4RK7A 5EGSA 1VIAA 1FXWA 5EMNA 3OCUA 2XT0A 3GT3A 1XEXA 3RRYA 4F3YA 3EVNA 4CVNA 3WFIA 1H65A 2AZMA 4ZMSA 5E3HA 4G1CA 4M83A 5K2MA 1MV8A 1GRQA 1O96B 1UPBA 2HCRA 1D0IA 3BE6A 1U1EA 4V3BA 4OHVA 3KP1A 1DKMA 1BDBA 1JA9A 3B5JA 2NPIA 1GPBA 1XEFA 2GSWA 1V2GA 1NONA 1XA3A 1DELA 2NYRA 4R4JA 1CY2A 1M6YA 2QRMA 2VUTA 3ZUPA 4BN5A 3DMGA 4U2GA 4RGQA 2IHNA 3AEQA 4HGNA 2QU8A 1Q7RA 1WB9A 5CW1A 5IJZA 1RMYA 3ASZA 1RM5A 1E3LA 2HJHA 2CKDA 3N2KA 2X8WA 3OY2A 3SHFA 4ENWA 2G9VA 1A9RA 3A3YA 4QDZA 3THYB 4BJ1A 1DKPA 4MQ6A 2NX2A 1EU1A 3H5WA 4B7CA 4WXMA 1CDDA 1X38A 2MU1A 2P68A 3TNJA 3T9BA 1KYWA 2CVFA 2ZRAA 4XB1A 5JO9A 2B6NA 4B4UA 1V35A 3CSUA 3DVQX 5A9SA 1QQAA 4ZI5A 5AXCA 5BOSA 1ECLA 2H6EA 1CQZA 4G5HA 4O2BA 3C48A 3QY0A 2D2FA 4EVRA 5KTRA 3M6UA 3PLRA 4FFBA 1ZN2A 1YAJA 3ITDA 2HKIA 1AVTA 2NZWA 3LBNA 4MR9B 3PUHA 1FNDA 3JYLA 5E2BA 3U7JA 3WNVA 1E9SA 4BNZA 3DMYA 4ZOLF 4GLJA 5IUNC 4JXXA 1IBMB 3ASVA 1XDGA 1C8VB 4OJTA 3S2UA 3ZEIA 5G1PA 3LLUA 4E2ZA 3OZDA 1T3HA 5HZKA 3X2EA 3JYHA 2Z6QA 3O91A 3NWEA 3J80A 2NAPA 1AHNA 2X7JA 1HY3A 1T1SA 3TEJA 3G17A 4AKHA 4NG5A 3ZHZA 3CR8A 4HPWA 1FFGA 3UA3A 3BHIA 4JLAA 4KU4A 4P4SB 5J59A 4FYPA 4KL8S 1JA0A 2XWQA 4IOMA 2B2CA 3O83A 1GG5A 2ZWOA 5AW5A 1MG5A 1V95A 2ZE8A 2CXXA 4EG4A 3SD7A 4K05A 4CMAA 1NV9A 5L6MB 1ZCJA 1W35A 3TE7A 1DT5A 4LOHA 2FWJA 1EWRA 5DISB 3ETLA 2PDAA 4M9RA 1YR3A 4OJQA 1UMCA 3WE7A 2NV6A 2D3TA 4JUAA 4ZYUA 1KYQA 5I3CA 1E20A 1DLJA 3N2GA 2D2VA 2WUVA 3HBLA 5KTPA 1E1RA 4EB6B 3KJFA 1PJSA 2IPNA 2ZRDA 1Y9EA 5CDYA 1W87A 4JB2A 1LF0A 4RVCA 3OT5A 3FH0A 1UKBA 2Q1YA 3K72B 4QDKA 2WWFA 1NUTA 3KE8A 4D4JA 5BSGA 5JDCC 1ORTA 2WPNA 1KXJA 3CF4G 2JJQA 2WBLC 3TLYA 1JLMA 2FEOA 1CWUA 2P3OA 3ON5A 2XX3A 5C8YA 3WDLA 1TT7A 1I3CA 5KJ6A 4BFVA 2KE5A 1QUFA 1I36A 1QE3A 5CLGA 2D1RA 5JOQA 4X94A 5HILA 1GTMA 2H2FA 5H1YA 4BLWA 3QPCA 3IEXA 1BQEA 1NNUA 3VRHA 3G1TA 1TCUA 1Y7LA 3K1TA 3NG1A 2O5RA 4C7MA 1LK7A 2BCJQ 2FB9A 4Q4JA 2EQAA 2QJFA 3EUWA 5BN5B 3NDBB 2O59A 3RIGA 3TOCA 4EYEA 2MSEB 1TB4A 3Q1KA 3ONVA 2GKOA 1WBJB 4G2NA 3BJMA 1JILA 4YCMA 2AE2A 3EXFA 4ZU3A 3A27A 1E6EA 3BGVA 3KM0A 3WL3A 4ENVA 1E2BA 2J8ZA 1G8HA 2G4CA 4MRMA 4DNFA 3PICA 2X9VA 1QS0B 3G0BA 1AUQA 3F3SA 3CNHA 3DT8A 4IFTA 4OGGA 1ODKA 1GFIA 2GYWA 1UIRA 2O4UX 3EY4A 2WHQA 3OEWA 4IX9A 1LTHR 5H0IA 5JS6A 4BMNA 4FC6A 3SSAA 2YRXA 3Q41A 3WMEA 4G09A 1T1EA 2FMIA 2HHJA 2WKRA 1D6MA 4GYYA 4YCJA 5DGTA 1YKFA 4M53A 1SBNE 5AW9A 1VHDA 3QPWA 3S7TA 4BMSA 1GAWA 5IZCC 3VX4A 3AIMA 2HWUA 2CJWA 4MR9A 4QFMA 2WJAA 1SVMA 1LI5A 2QTWB 2WMDA 3RVSA 1J1IA 1YR1A 1UEXC 2OY0A 3D5EA 3KPWA 1QOQB 4RD2A 4W1SA 3RVLA 3H9UA 5BR4A 1DBPA 4KQ1A 4FEAA 1FYFA 5D01A 2P9TA 1X9IA 2F1OA 4II3A 1UF9A 1E9CA 4M1QA 4QQFA 4N0PA 1PP4A 4DKJA 1EUZA 3G6KA 3ZLBA 4QDXA 1WRBA 3C7CB 1DEHA 1M75A 1E63A 3I30X 4HXGA 3O4JA 4L75A 1FYVA 5CJ2A 3DTTA 4DREA 4ZFNA 1U63A 2VDLB 3LPLA 1E89A 2F1IA 3VR3D 1OI3A 4U8HA 1EWTA 4O4HA 2E89A 4OLFA 1I3MA 2XZOA 4K03A 3P9NA 2GJ8A 5DXFA 3TRJA 3LBIA 1AGRA 4CMHA 3AI7A 1HQDA 2WHPB 2BFMA 4BRUA 2BYTA 4XXHA 3Q6IA 1NPTO 2J6CA 3JQGA 3JVVA 3KYDA 4BQRA 4BX8A 2Z2YA