3C7AA

A structural basis for substrate and stereo selectivity in octopine dehydrogenase (odh-nadh)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
403
structure length
403
Chain Sequence
b'TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octopine dehydrogenase
publication title A structural basis for substrate selectivity and stereoselectivity in octopine dehydrogenase from Pecten maximus.
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 107
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3c7aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c7aA01
4BB5A 1KEVA 2JHFA 3PJEA 2HDHA 3PWZA 2I99A 3I9MA 3JQBC 2PZLA 4UUNA 4OAQA 3EY4A 3IKTA 4EEZA 3PPIA 4J1NA 1D1SA 3HQ4O 4BHTA 2NU9A 3K2BA 3WGHA 4OJNA 1LUAA 4GSKA 2NLOA 1GPJA 1ISFA 1NR7A 2BGLA 3DHYA 1JAYA 1TLTA 1OI7A 5T57A 1P1HA 2QX7A 3GEDA 2ZB3A 1LQUA 2ZCUA 2YDXA 2XXBA 5B4TA 1DJNA 1M6HA 3OM9A 2NM0A 2PGLA 1O95A 3VZQA 3JV7A 3S1LA 3K73O 4Z3KA 3G3EA 5BSEA 3GDOA 2VZ9A 2IODA 1TVEA 2AQKA 7ADHA 1NHWA 1UAYA 5U4QA 4CMEC 4IGEA 3Q11A 1P1IA 1R4MB 4BNYA 4BGVA 4D79A 3MJSA 1KBZA 1T1RA 4J6FA 4W7IA 5FF9A 4DC1A 4MVJE 1MC4A 3Q2KA 4NBRA 4D3FA 2NTJA 3A4VA 3M1LA 4R69A 4F45A 1HDCA 1HYGA 2WSBA 4NNJA 1IOLA 4A0SA 2JCYA 4NBTA 3F5QA 4AJ2A 5TSDA 1T4DA 2IEDA 1GADO 2HMTA 5KVSA 4HADA 2C7VA 3JQ8A 1YKFA 5DP1A 3WQRA 4YJGA 3H4VA 1IHXA 3WGTA 3P2YA 2EP5A 2ZTMA 4MINA 4S1VA 4DIBA 1R6DA 1MC5A 3DEYX 2DAPA 3P7MA 4CMJA 5KKCA 4BVAA 4L9RA 1E0DA 2GZ1A 1WPQA 2I66A 3ZHZA 1QYVA 5C7LO 2I67A 3HHPA 1I3NA 1RKXA 3M2PA 3WYEA 3H9QA 1DDOA 4Y6PA 3RKRA 5I9LA 2GLXA 3FD8A 5THKA 4MIEA 2OZPA 3L6OO 4ZHSA 1E3WB 1V35A 1PZFA 3GVXA 3KSZO 4OYRA 5B4UA 4H3VA 5COAA 1YB1A 3DBLA 1DFHA 5L4NA 3GLQA 3AWDA 4QX6A 3I9LA 5G0SA 3KYCB 4CV0A 1SAYA 4IS2A 3JD4A 4J2OA 3HE3A 2PLAA 2HMSA 2XF8A 3ONFA 2PGDA 4YT5A 1VI2A 4I1IA 4I9HA 3I9OA 4ONEA 1X15A 4E12A 2Y99A 1HRDA 1ZK3A 4LCJA 4ZQEA 5L40A 2H5LA 3VH1A 5CG1A 1PGQA 1PWZA 3KV3O 4W82A 4CMHA 3WTBA 1KC3A 1X1EA 4AJJA 4B4WA 2FR8A 4GLOA 1V6AA 2X5OA 2GR9A 4ID9A 3H9UA 1XELA 3MOIA 3IJPA 4FB5A 3K31A 5TNXA 4P8RA 4FGWA 2JAPA 5EL0A 3WX0A 2C54A 2VUUA 3EGOA 4RF4A 4HFRA 3L9XA 4NG5A 3GHHA 4CMBA 2DFDA 5L45A 4N5NA 2IXAA 1R16A 2ET6A 2PTGA 3WB9A 4EJ0A 1OAAA 1SOWA 2C0CA 2Y1GA 5FI5A 1P44A 3QVWA 1ULUA 3QWAA 3O8QA 5TJHA 1ADBA 4LGVA 3CMMA 3EZLA 1CYDA 4Q3CA 1E1LA 2CY0A 1PGNA 2J3KA 4CM8A 1C14A 1I30A 4DPKA 4PN3A 2JAHA 2O3QA 3DZBA 3R3SA 1QYXA 3GNTA 1YRLA 3RVDA 4PZEA 3WIDA 3GUCA 5A05A 4EYEA 4L0QA 2NTVA 3ZNPA 2Y05A 3UVEA 2OFPA 5T6BA 3PIDA 1W0CA 3MWEB 4GWKA 3OQ1A 2PD3A 3H9EO 3PGJA 3DAPA 4OGWA 5HA5A 1NFQA 3QVTA 4NZ9A 1FMCA 2HSDA 4AJ1A 3N58A 4PLFA 1ADCA 1ADGA 2RH8A 3D5QA 4R1UA 2J5RA 4ESOA 3NTRA 3D64A 4BMNA 1YOVA 3GOHA 3RUIA 4D0RA 4DQXA 3IUSA 4WLVA 4EDFA 5C7IO 3JQ9C 5ER6A 3FPCA 5KJ6A 1JU9A 2QRLA 4WCFB 3FR7A 3NT5A 2IZ1A 1EDOA 1MFZA 1P33A 4B3JA 4ZQFA 4EGFA 1GAEO 1BXZA 3WLEA 3E18A 1ISGA 3RC9A 4ALLA 4O1MA 1LSOA 3C1AA 4EJMA 4CQLB 5CG2A 1SZJG 2HK9A 1UDAA 4TKMA 1R0SA 4CMEA 1WLYA 4NFSA 2QIOA 1V0JA 4AJKA 4GWGA 3UHAA 1IL0A 5LDGA 5JYEA 3KVOA 5CHEA 4GSLA 2NVUB 3INTA 4X54A 2EJVA 3L77A 3VOSA 5GZ1A 1LLDA 1MG0A 4Y9DA 5DCWA 3DFUA 3JQCA 1VKOA 1E3EA 4IZHA 2HMUA 4J49A 3UW3A 4RZHA 3GN1A 4YACA 5IZCA 5A5EA 4WLEA 3S55A 3NAQA 3WR5A 4ZGWA 3L6EA 5DP2A 2IYOA 2GUGA 3RUEA 4XQCA 2Z1NA 5KCZA 3A9WA 3H9JA 4KDFA 3JQGB 4FGSA 4R41A 4IZIA 3GY0A 3AU9A 3CZMA 1NTOA 1R15A 1KIFA 3C8MA 3OJ0A 4BO3A 4UVIA 5I7SA 3ROKA 1E1KA 5KNLA 3PDUA 1SO8A 3FRJA 1ZFNA 4J4HA 1Q7BA 1SB9A 2IZZA 4FJ0A 4BNGA 1ZVMA 1S7CA 3GDGA 1E3LA 5TT0A 1Y7TA 3PI7A 2EF1A 4BB6A 1W73A 1MG5A 4NFHA 4W6ZA 1I2BA 1UP6A 1ZSVA 2NTNA 3GG9A 4IXTA 4PVCA 4YJFB 2Y0DA 4BGUA 3DOJA 4CLOB 5I8WA 4CMIA 1D3AA 4I9NA 3GQVA 1UP4A 3BYZA 3NX4A 1WZIA 4YTEA 4PZCA 1Z75A 4P38A 4F6CA 4WOJA 1LRLA 2HK7A 3FI9A 5A03A 5C37A 4ND5A 1ZKMA 1U3WA 3JQFC 4XB1A 4E2XA 1QYCA 1Y9AA 4FCCA 4CQMA 4BNUA 2C7GA 1YGYA 1WMAA 2DFVA 3AUTA 1EUZA 1B16A 4MJLA 5L7YA 1JKIA 2P9EA 2Z5LA 4K28A 1QLJA 2GERA 5JLAA 2PZJA 3ITKA 5F1OA 1U28A 4IJUA 5F3RA 2HMWA 1MLDA 2UVDA 4Z3DA 3UFXA 3HFSA 1BXGB 2WEKA 4J4TA 3ICCA 4L8VA 4BGEA 1QP8A 4DL9A 3MOGA 2GN4A 1NVMB 2X1HA 3VZSA 1NQOA 5IDWA 3IL2A 1ONNA 3PJDA 3PQEA 2DQ4A 3W4JA 2DPGA 5KTKA 4ZU3A 3T4EA 2YYYA 3NKLA 2UAGA 5DOZA 2Y0EA 3KYDB 5IN5A 3ETGA 3BZUA 4QFDA 1IUKA 2BGMA 4YVFA 3M6IA 1GQ2A 5L7TA 3UGKA 2O2SA 3KHUA 2O3SA 4WCDA 3KM0A 4R16A 4B4OA 4F46A 3ULKA 1U8XX 2Q46A 5I9MA 2FZEA 3B70A 4BNJA 4DBZA 4XJSA 3GH3A 3JYQA 1FDWA 3WFJA 1SCUA 4XJTA 3EHEA 3COSA 1B8VA 1XQ6A 4E21A 3JQAA 4KMSA 2W2KA 1Z45A 3GEMA 5BQFA 1YVEI 4RVFA 4RZIA 2OOSA 4YJHB 4RDHA 3ASUA 1GEGA 2B4QA 2YFHA 2XPCA 4H7PA 2RH4A 4II3A 2Y68A 4P4GA 5JE8A 5IXSA 3QW2A 1KERA 1XU7A 3U4HA 3FBTA 1OFGA 4MOWA 2D1YA 3PHLA 4N5LA 1GY8A 4XGNA 1HETA 1P3DA 4F3YA 4FSHA 4ALMA 1PTJA 2PKQP 1PU2A 1TB4A 4RDIA 2BI7A 2YFQA 2Q2QA 3GR6A 1HF3A 4MKXA 3B1FA 1DC4A 4XA8A 3VPFA 1Q0QA 5FFFA 5K6AC 4YT4A 4A27A 4DBVO 4WCFC 1B3BA 3TL2A 2ZYAA 1G6KA 3DOOA 3ORFA 3RJ9A 2OP1A 3ZNNA 4MO2A 3E5RA 4CLEA 3CMCO 2NU8A 3GFGA 4J7XA 3OEWA 3MJ4A 2ZKLA 2WWRA 5I7EA 4E2ZA 1JAXA 1MB4A 1CF2O 1LDBA 1R4MA 3PQFA 1O6ZA 3VTZA 4BNTA 3W4KA 5TQVA 1U4SA 4PRKA 1W6UA 4XDZA 2AMFA 5KJEA 1KVRA 4GX1A 1Y5RA 1U7HA 1V9LA 4MP3A 4U5QA 5GY7A 1H2HA 4FS3A 4AICA 4A2CA 1SMKA 4CL8A 4LN1A 3E82A 3Q2IA 3ZU3A 2YQ4A 3PP8A 3WSWA 2HRBA 2PNFA 4DMMA 3OQBA 3HFGA 1LDMA 2X9VA 3DMYA 1J49A 4WNIA 1T24A 1PIWA 2WD8A 5F5LA 2I65A 2DUUA 2XOXA 3LT4A 3L4BC 1U3TA 1RM4A 1B3RA 1HL3A 5F1PA 4A73A 4HKTA 3UUWA 3PYXA 3NV9A 3JTMA 4TROA 3H5AA 5JAQA 3VKUA 3NDRA 4DLBA 4WLFA 3PJGA 1G0NA 3DBVO 2B37A 3RC1A 5H82A 1E3WA 3HNPA 5I7VA 3JQ6A 2VHZA 4J7UA 1UXGA 3D4PA 2C20A 4NR0A 1Y8QB 4CQMD 1JTVA 3U09A 3V2HA 1PL6A 5K0ZA 4L73A 3KYCA 3JQFA 5JDCA 3PXXA 4RVGA 4MVJG 2CVZA 2P68A 2BHLA 2Q3EA 2WMDA 5HS6A 1EVZA 4J1SA 1FDTA 6ADHA 4YAKA 1ENPA 3I9KA 3ZV6A 4B8ZA 1WDLA 2EKQA 4CMCA 1MUUA 1NNUA 1VE9A 2UV8A 2O2YA 1GUYA 1A4IA 4AVYA 4K9DA 1PL8A 1ZXLA 3OF2A 3Q6IA 1Y9EA 3NDJA 1B0AA 5TX7A 5G2OA 3DTYA 2GYYA 3GA0A 1OOEA 3ZV4A 3QE3A 2X9NA 3GNQA 2G5CA 1R37A 3CEAA 4YR9A 1LXCA 1Y5MA 1ZCJA 3OIGA 4RORA 2D59A 1UR5A 2DC1A 4CLRA 4NPCA 3BMNB 3E48A 4OOEA 3LT0A 4LW8A 5ILOA 1ZEMA 2B35A 3AU8A 1DRVA 1R12A 3GZNB 5JMWA 4BL5A 2G82A 3BAZA 4YRAA 1RM5A 2WYUA 3RBXA 1N8KA 4XIYA 2O3JA 2ZYGA 1YL6A 1P1FA 2Y1DA 2ZQYA 2Y1EA 5CDYA 3DZGA 1VSUA 1IB6A 2BMAA 4DYDA 3JQAD 1UXKA 3ZWAA 1WP4A 4EITA 4IGFA 1RPNA 3L6DA 1LI4A 1M66A 3ADOA 1JQBA 2YY7A 1OZAA 3BHMA 3GEGA 4J2HA 1FK8A 4MVJI 5G4KB 5JC1A 1E77A 4XIJA 5BR7A 1D7OA 4FOSA 3I1JA 5KIAA 1ADFA 1DEHA 1E7SA 1LU9A 4PLPA 2J3HA 5IDYA 4BKPA 2GPTA 2PH3A 3WICA 1LA2A 3Q9NA 4QXMA 3HSKA 4JX8A 4GX5A 1DO8A 4GVXA 7MDHA 4RF5A 4O5OA 3PLNA 5HBRA 2TMGA 3HG7A 3GGOA 3EZYA 1LDGA 4YDRA 4G5HA 1NAIA 2EGHA 4IJKA 4L4SA 4BO2A 1PQUA 2PD4A 3QQPA 3MJCA 4M87A 4G65A 4IBOA 3ZU2A 4YA6A 5CPBA 3IDSA 3ZN2A 5DOVA 1GZ6A 3RC2A 1GR0A 4KTTE 3F1LA 3I9NA 3R3JA 2C29D 2QRJA 3DTTA 5BNTA 3UCXA 3D0OA 3FR8A 1DJQA 1E7YA 4NJMB 3C7AA 3ROQA 1HDOA 2AG5A 1I5RA 2EP7A 3UH1A 4WCFA 4A5OA 1PJCA 5A3JA 3H2SA 3GK3A 4W9NC 3UKOA 1PR3A 3SC6A 4AJHA 4BO9A 2PGJA 4XRGA 3QRWA 1Q7CA 4D42A 1HDRA 3TL3A 4A03A 3TJRA 4A26A 5JS6A 1I36A 4PLCA 3JYOA 3NGXA 3V5NA 1H6BA 3VZRA 4CQLA 3LT2A 3SJUA 5BSHA 1V3TA 1GPDG 1FF9A 6LDHA 2NSDA 3WMWA 1DIBA 1I3MA 3I52A 4XGIA 2E49A 4R1NA 3HN2A 1E7WA 1GZ4A 2JCXA 3LK7A 5A02A 3D1LA 5L9AA 3AM4A 5AQ1A 2NVUA 4R5MA 4URFA 3X2FA 4TRMA 1J4AA 2YV2A 3KO8A 9LDTA 1Z7BA 4JK3A 1BTOA 1P45A 2WD7B 1FDVA 3BMOB 3GZ4A 2NU7A 2O3UA 4QECA 5JDIC 4S3MA 3IIEA 3RBVA 1J0XO 3EVTA 2PK3A 3AOEC 3GMDA 4CM4B 3GVIA 4E5NA 4M1QA 4P4NA 5A9SB 4I08A 3V1TC 3JQGA 4BNHA 2OUIA 1KVUA 4D3SA 2X5JO 3ENKA 4MVJH 1VL8A 3GAFA 4U6SA 5JO9A 3W1VA 1GZ3A 3L4BA 2HQ1A 4YPOA 1JDJA 1M2WA 2P91A 3AUAA 3GDFA 3LT1A 3S2EA 3L07A 1C0LA 1KVQA 4CR6A 1ONPA 3GGPA 5JY1A 1RYEA 4WJZA 4J90A 4YJFA 4JQCA 4Y8VA 1ZZEA 4B3IA 4CLOA 3IMFA 3R1IA 1PEDA 5ENVA 3ZWXA 2VWPA 2QZ9A 2C07A 1TT7A 3AUUA 2E82A 4W7HA 3EVNA 3HB4X 1XWFA 1Z74A 1OMOA 3PWSA 4JP3A 1HZJA 3RUFA 4J3FA 4PFJA 4CODB 1JVBA 4FW8A 1I3KA 4PG4A 3BHJA 5CDSA 3S2IA 3VHRA 3VPSA 3ZWYA 4HV4A 3LU1A 2BKAA 2FHSA 4NU6A 5F5NA 2VWHA 1DC3A 3QWIA 4IDAA 3ZCXA 1IY8A 3JYNA 1LDEA 4W99A 3AK4A 3INGA 4IDEA 4QEDA 1WZEA 3WLFA 2FR1A 4QFCA 4Z9FA 4JIGA 2B4TO 2E6UX 4IQ0A 3S8MA 5T67A 4PLTA 2AXQA 4RPJA 3KLPX 3OJEA 1M76A 1H9BA 1Q0LA 1P9LA 4R5HA 5GMOA 1BXGA 5EESA 2CF6A 3LZ6A 5I8ZA 5A3VA 2GSDA 1WW8A 4DQUA 3DZFA 2YW9A 4AJEA 2VTEA 5DF1A 4GMFA 2PY6A 4XX0A 4EI2A 2P4HX 4YAJA 4BGIA 1C3VA 1QKIA 2FN7A 2G1UA 1TT5B 1XA0A 4LISA 3KYDA 5AXCA 3SBOA 1S6YA 4EUFA 2C82A 4M89A 4YXFA 2UDPA 4Z9XA 1NHGA 4H16A 5EERA 1C1DB 4TZKA 1EFLA 2QZZA 1E3SA 4DWVA 4BKUA 4OM8A 5EIOA 1YH3A 3RROA 3QWBA 4GLLA 4D46A 1PZHA 4TRNA 5G4LA 4E33A 1N9GB 3ZNOA 2VRCD 4RVHA 3CKYA 5JO0A 3JSAA 3T7CA 4YJHA 1XDWA 5A9TA 4CM5A 1CJCA 1RM0A 4EJ6A 1UDBA 4DXHA 2B4RO 2HU2A 4M49A 4IQ8A 2NVWA 4Z0HO 2X5KO 5G0VA 3WNVA 1HDGO 1DLJA 1YBVA 3C3XA 4C7JA 2VYVA 3VVBA 1HE3A 3QJ5A 2BFMA 4HX5A 1NVGA 4XYEA 3ROMA 1ZW1A 1K6XA 3DDNA 3OJOA 4CLDA 4PRLA 5CDGA 4BMSA 2GDZA 2J8ZA 3FTPA 1MP0A 2VYNA 5HRUA 2QYSA 2ZIZA 2NNLD 3NYWA 1GFSA 1X7GA 2WJPA 4RL6A 2Y93A 2EEZA 1NVTA 1DC6A 2C2XA 3I23A 3LSYA 2VHXA 3AM3A 1N7HA 2LDBA 2AHRA 2B36A 1LLCA 4J9VA 3JQ7A 1PJTA 2D3TA 1Q0HA 1FDUA 1CDOA 3E5MA 4L4XA 4NK5A 3CTMA 3BA1A 4L74A 5AXBA 4CUJA 1PJQA 4JNKA 3TFQA 2WDZA 4IMRA 4Z6KA 4TQGA 3PFFA 4UVGA 4ZQHA 2I5PO 3MCVA 2EV9A 3X2EA 3F47A 3UF0A 2W90A 4NMHA 4KZPA 3WIEA 3F5SA 4MIYA 2X0IA 1IYZA 4RPGA 5A1TA 2B0JA 3EYWA 5CEJA 1U3VA 5L95A 4NQZA 4MP8A 2BF7A 5IG2A 4MVJP 3WBBA 3TZCA 2BFOA 3HUDA 2GGSA 2ZQZA 4ND4A 3UOGA 5L3ZA 4ND2A 3DMTC 4GX0A 1C0IA 2VRBA 3GN2A 2A9FA 1QYWA 4R3WA 3G17A 4OQZA 4PLYA 1N1EA 5DBGA 4M8SA 4FFMA 2HK8A 3C1TA 4FJ2A 1GYPA 2IYPA 3I9JA 2X58A 2X0NA 2FP4A 2BH9A 4RV9A 3VPXA 3A06A 2JD1A 1A72A 1T2DA 4O59O 2O7SA 4ALIA 3GG2A 1AN9A 1E6WA 2Y66A 4B7XA 3W4IA 4AFNA 3TRIA 2QW8A 3WYBA 1Y8QA 3JQBA 4L75A 1H6DA 3G1TA 3V1UA 3W8DA 1SB8A 1YXMA 2PR2A 4YAGA 1VRWA 4BNKA 2R00C 3DAGA 4YWJA 4DVJA 3JD2A 2C5EA 4R54A 1Y8RB 3SLGA 3GVHA 4KWHA 1ZO8A 2OMEA 3WJ7A 2VTDA 2Y1OA 2AQIA 1X0XA 1M75A 4RVDA 1DBVO 3H3FA 3TOZA 2X22A 5KJ1A 1ENYA 4O63O 4DREA 4MKRA 3V1YA 8LDHA 3GF4A 1BW9B 2B5VA 3PIIA 3DHNA 2B69A 3WGOA 4UAGA 4JBIA 4M55A 4OIMA 2ZYDA 2YHIB 3FNHA 1A7KA 3PDJA 4ROSA 2EW8A 3OSUA 2A92A 4E13A 3LLVA 1F0YA 3BMNA 3VH4A 1H6CA 3P19A 4RLHA 3O38A 5H81A 1YB4A 4OHUA 3GZNA 4Q3NA 2WTBA 3NJ4A 4RVSA 1KEUA 1BVRA 1WMBA 1EDZA 1BGVA 3LYLA 4OXYA 4BV8A 4YCAA 1E1MA 4CUZA 4E4YA 2AW5A 3TFOA 4IDFA 1ZIDA 3T4XA 5IZ4A 3KOUA 2ZTUA 3M2TA 2EHDA 4RF2A 4E3ZA 3ASVA 4OXNA 4I5DA 5G4KA 2VCYA 4TVBA 1N5DA 2VNSA 3ZU4A 1BWSA 5MDHA 1SEPA 3ANLA 4XEHA 1AE1A 4HXYA 5DZSA 3PHJA 4IDDA 3RBZA 4ND3A 4YAIA 4IPTA 4NHEA 1NPDA 2VYVD 4ZD6A 4UEOA 3BMQA 1BXKA 1T25A 3GRPA 4PG7A 2OL4A 4PG8A 2FPPA 3SX2A 2VYND 2OP0A 3QLJA 4PLVA 1O8CA 2NU6A 4UREA 2VUSA 3OA0A 5JCJA 3W8FA 1GD1O 2JL1A 1B7GO 1LBEA 1T4BA 4E32A 3WNQA 2W2LD 3B1KA 1F12A 4NJMA 2O23A 3VVCA 3TZQA 3RUAA 2VHWA 4LSMA 4CV3A 3ZWBA 1EMDA 1A9ZA 3ZWOA 2VQ3A 3Q3CA 1ZSNA 5IXYA 1OC2A 3IS3A 4RJTA 5TJ9A 1NAHA 4CL3A 2FMUA 1PS9A 2X23A 4J0EA 1UXIA 1YDEA 3I6IA 3TNLA 1SPXA 3QVOA 1GDHA 1I01A 1R4NB 2J6IA 2UUPA 3F6YA 3GRKA 5TGDA 1VJ0A 1ZSYA 3E9QA 5IFLA 3V8BA 5TF4A 4YRBA 4XRRA 1KEWA 2CF5A 1HE4A 4DQVA 1DXYA 5IDQA 2ZATA 1FJHA 2PKRA 1Y6JA 1MFPA 1PJBA 5A5FA 2WD7A 3LC2O 3BMOA 3P2OA 3QA9A 4UEJA 1CERA 1U1IA 1ZNQO 3H5RA 4CM3A 2JFFA 4PG5A 4CM4A 1LC3A 5KWEA 5A9SA 3DMTA 2V6GA 2JFGA 2NQ8A 2ZB4A 3RCBA 4BUCA 4QT0A 2GO1A 3PK0A 4YRDA 2HJRA 1I33A 3D5TA 4ZRNA 1YB5A 2GZ2A 1BG6A 1VJ1A 2FWMX 3WXBA 3P5SA 3Q0EA 5KJFA 3SC4A 2HAEA 4WLUA 4WPGA 2YV1A 4CMAA 1O89A 4ZA2A 2Q2VA 1YJ8A 3O9ZA 4KQWA 4MP6A 2AQHA 3PTZA 4TWRA 1ULSA 4IJWA 4XDYA 4K6CA 1E6UA 3BIOA 2VWGA 2QQ5A 1VC2A 2O7QA 2I9PA 3ON5A 3JD1A 2HLPA 3B6ZA 4Q3AA 4JXKA 4GGOA 1IHYA 1PGJA 2J5QA 5CDTA 1DOHA 1ISMA 3D3WB 3DO5A 3JQ9A 2C59A 4PLZA 1X0VA 1GTMA 2QG4A 3OICA 2EJWA 2Q49A 1E5QA 2P9GA 3DBRB 4J1QA 1H2BA 3I4CA 1CEQA 3MTGA 4MPDA 4MVJF 4YAEA 1JWAB 5EQFA 3M1AA 2DTEA 2W98A 3HZZA 1E3JA 1V3VA 1B14A 1QORA 4FD3A 4MVJA 5AXDA 1DB3A 5FEUA 4A7PA 4Z0TA 3GPIA 1BRMA 5MGBA 4DMLA 3RJ5A 4XZ3A 5BSFA 1UXJA 1Z82A 1LRJA 3Q9UA 3I5MA 3LC1O 1CETA 1TT5A 1E92A 4Z0PA 3HDHA 1EZ4A 4DGSA 1ZMTA 5JAIA 4P22A 4C4OA 1C1DA 3MJTA 5JAZA 4D3DA 1F17A 4M54A 3V2UA 5GZ3A 5CEFA 1DFIA 3AI1A 4HNHA 1P1JA 3EAGA 2BELA 2CUKA 2G76A 1E7MA 4D45A 3RQSA 3VPHA 4UUOA 1N9GA 1LQTA 1D8AA 1JA9A 3K8ZA 5B12A 1CQJA 3T7EA 4KP7A 3EMKA 1PX0A 4WECA 1X13A 4WEOA 3L0DA 4LMRA 4FIZA 5AOVA 3CXRA 3BTOA 3ZZNA 5JCJD 5CP8A 3AI3A 2AG8A 3IAHA 1DRUA 2OORA 1A5ZA 1ML3A 1H9AA 4CR8A 2YQ5A 4OMUA 3VH3A 5DCYA 4DPMA 2DLDA 1VL6A 3JD0A 4XR4A 3ST7A 2G17A 3WSVA 4IMPA 4W4TA 3VH2A 3ENNA 5CAEA 1P1KA 1PQPA 1D1TA 5TC4A 4QO7A 5ICSA 1DAOA 3VDRA 1I2CA 5IJZA 2QHXA 2FSSA 1JKJA 3F3SA 3KSDO 2FOIA 4ALJA 2D5AA 1W4ZA 2ZB8A 4I5EA 4YYZA 2DBQA 4UULA 5T8KC 4D7AA 2ZK7A 4BV9A 3PYLA 2O4CA 4UUMA 2GNAA 4WLOA 1G0OA 2YZ7A 4R4JA 5KVQA 3CZRA 5L7WA 4I8XA 5JNLA 1NX6A 5TS3A 4LK3A 1PS8A 2JKVA 5ITWA 2E37A 2GD1O 3INRA 4GKVA 1V8BA 2HUNA 3LQFA 2GN6A 4QSMA 2X9GA 3ITDA 1DAPA 1MV8A 4H15A 3HADA 2PH5A 1P0FA 1XG5A 4OH1A 1DSSG 3U4DA 3OMLA 2PKQO 1ORRA 1HYHA 4KDEA 5T64A 3KXDA 3IKVA 1EFKA 2X6TA 3PZRA 1M67A 2A94A 4GAEA 3WBFA 2AE2A 1P31A 3TPCA 1PJ4A 2AEJA 4AG3A 5B1YA 3DC2A 1PSDA 1HT0A 4RO0A 3RFVA 3OIDA 1ID1A 5CPFA 1HZZA 4IM7A 2Q99A 3F1KA 3RU7A 4OQYA 1ISJA 1GQYA 1KETA 2E4AA 4FOOA 5JSFA 3AFNA 4YQZA 3H65A 4PVDA 3RFTA 3F4BA 1GUFA 3SXPA 1GYQA 2VWQA 4AJNA 3RUCA 4U8GA 4E2WA 2YV3A 3PHIA 5ES3A 3G49A 3OQ6A 3ZHYA 1QG6A 1TA4A 5TRTA 1DIAA 1PS0A 2R6JA 3DZKA 1YBAA 5C3MA 5JCXA 4AJLA 2VRCA 4J43A 1PZGA 4PGFA 3AFMA 4JN6B 2WM3A 1ZBQA 4ALKA 5KKAA 5DN9A 3QY9A 3VPGA 1LSUA 4WK6A 4WUVA 2GN8A 2I6TA 3LC7O 1GEEA 2DPHA 3H9GA 4CM6A 3ZHBA 3ADPA 5IF3A 1VJTA 5K6AA 2FSVA 3FF4A 3ROPA 4AJPA 1BW9A 1QXSA 3PHHA 5AXAA 1I0ZA 4R9RA 3R6DA 1JW9B 1I32A 1NP3A 2DBRA 4MVJD 5LDHA 1BDBA 3WYCA 4XWYA 4D44A 4O6VA 2JHGA 3FCOA 4TSKA 4CLHA 1A4UA 1CIVA 4DIFA 2P5YA 5K9ZA 1EK5A 3LLSA 3UCEA 1T2CA 1I2ZA 1PWXA 5FWNA 3LF2A 5CFZA 2ZB7A 3NJ8A 3U9LA 3NDIA 5IAAA 3E9MA 2VN8A 1T2AA 4E6PA 3BTSA 4HBGA 2VUTA 1BDMA 2CDCA 1PGPA 1YONA 2AA3A 4XYGA 3H6KA 4IIUA 4YB8A 3A28A 2X8LA 5HS4A 4B8WA 2X0RA 1TEHA 3WWYA 1Q1NA 1YBMA 4JP2A 1UUFA 4D43A 5BNIA 1X7HA 1KYQA 4ND1A 2JJYA 1LLQA 2CDAA 3HB5X 4KTVE 2O3RA 1EE2A 1UDCA 2P2SA 4QQRA 2BI8A 3UCFA 4CV2A 1VSVA 3HDJA 2NQTA 2AE1A 4YT8A 2YJZA 4PLGA 2J5KA 4R1TA 3WQQA 4NFYA 1QR6A 3ETDA 1GUZA 5DCUA 9LDBA 1VLLA 4J91A 4FFRA 4NH4A 3I6QA 3WMXA 5J23A 4CPDA 1YL7A 3EC7A 1OBFO 1IE3A 1K6JA 3ZHXA 4R9SA 4BO1A 3IP3A 3KSUA 2SCUA 1H93A 2IE0A 3NUGA 2D8AA 2NWQA 1XU9A 2O4UX 4D41A 5CDUA 4RLSA 4TRRA 2Q1TA 2Z1MA 5H83A 2X4GA 1IULA 2X7HA 4OO3A 2BFPA 2W2KB 3VKVA 1PJ3A 4K1LA 1YQDA 1CRWG 1O0SA 1Z7EA 3KB6A 4WGGA 4BO4A 1ZUD1 4DTIA 2Q1WA 1MXHA 2UUOA 1HDXA 2V6MA 4IJVA 2DU8A 2DKNA 1PL7A 3UICA 4DPLA 4DRYA 4JGBA 4OOFA 5LC1A 3C1OA 4P4LA 5DT9A 4II2A 1R4NA 3ZWVA 2DVMA 1IZ9A 3RAJA 4XB2A 1QSGA 3N74A 3IC5A 4BQPA 1NASA 4XYBA 4ILKA 1JN0A 1NQTA 3OHSX 4DYVA 5T5QA 2WE7A 4YJDA 4RF3A 5B37A 1HXHA 1U2DA 2H9IA 1QLHA 4BS9A 2EG9A 3DZHA 5A4DA 1U5AA 1XKQA 1E7QA 1AHHA 3EDMA 2NACA 4GQAA 4BO7A 1JVSA 1ZH8A 2QYTA 1DLIA 1U9JA 2GN9A 1UXHA 3QWFA 1C1XB 2CDBA 1QRRA 4J4BA 3OA2A 1EVJA 3H7AA 3QSGA 3K92A 3OH8A 3W6UA 3GNSA 1WNTA 3FBGA 4GMGA 1KOLA 3KRTA 1LEHA 5ER9A 2NUAA 4FBGA 1EQ2A 3DBHB 1PR9A 4J9UE 5JAMA 3GUYA 3DOCA 1ZXBA 1MA0A 3F4LA 3AY6A 1RM3A 5EPOA 1B15A 2PFGA 1GU7A 4IQGA 1UZLA 1V3UA 3E03A 5U1PA 3KETA 5IZCC 4FC6A 1EQUA 4N5MA 3TN7A 4FC7A 3TSCA 5JW6A 3L4SO 2JCVA 4G2NA 4XR9A 3QP9A 4N18A 1HKUA 3PLRA 1ZMOA 3PYMA 4E2YA 2VNAA 1KY5A 2JD0A 3PWKA 3OECA 3PEFA 4N7RA 3D3WA 2LDXA 1DIGA 4YBZA 4BNFA 3I4FA 4WLNA 1U2GA 4BNZA 1A27A 2B5WA 1MX3A 2VZ0A 3H2ZA 3DBRA 3KEQA 4OSOA 2FRDA 2W8ZA 1R0KA 4NIMA 4W9NA 1I24A 3D4OA 2FZWA 4Q39A 1MXFA 4GPD1 4IDGA 2W2LA 3HN7A 4R1SA 1WAMA 3U5TA 3WWZA 1NFRA 5A06A 3JQDA 3OP4A 1KVSA 4BNXA 1AXGA 1RWBA 3LF1A 3IJRA 3A1NA 1OC4A 1R66A 2GCGA 4J16A 1CQIA 4R68A 5ITVA 3RU9A 1R0LA 4BNWA 1K2WA 1GL3A 1U3UA 1VPDA 3OIFA 1ZJYA 2ZJ1A 4ZICA 4KOAA 3ZWMA 5COBA 1QMGA 2PWZA 2P9CA 3AJRA 3GVPA 2RIRA 2IDZA 3E6AA 4GL4A 3WGIA 5JDIA 4HWKA 3WGGA 3ZV3A 1QYDA 4RQUA 3AOEA 4UEKA 4ZVVA 2OO5A 1DPGA 3U3XA 1YL5A 5AYVA 5G0WA 4CR7A 2J3IA 3CIFA 3NEPX 5JPIA 4JBGA 3H3JA 2CSUA 4GH5A 5DBIA 4J0FA 2D0IA 3PGXA 3U4IA 1B2LA 4CLRB 4JROA 3K5PA 2O48X 2C5AA 2Q45A 3SLKA 5I7FA 1GV1A 2H6EA 1T2FA 4U0KA 3CSDA 3OEYA 1EK6A 4HY3A 3EK2A 3RD5A 4JJFA 5FI3A 4D0SA 3RFXA 2EERA 1VKNA 1KEPA 2YHUA 5KOIA 4UUPA 1G1AA 4RPKA 3WS7A 4TKLA 2POQX 5KVCA 1WXDA 4JJIA 4U6QA 3GAZA 4L76A 4NBVA 4K6FA 3DZIA 3WGYA 1HE5A 2FPIA 4LCEA 3AW9A 3IQDB 4AJ4A 2WE8A 4CMKA 1GQQA 4FFOA 4NI5A 3MWDB 1LSSA 2GF2A 1HYEA 2HO5A 2OGUA 2Z95A 3TDKA 3D7LA 3FHLA 4E0BA 4IXWA 3AI2A 1QV6A 3STHA 4OL9A 1AGNA 3DHEA 1ENOA 4GX2A 5C5IA 2BFAA 2TMDA 4BKRA 4EW6A 1EEHA 3QHAA 4CV1A 1WDKA 4J1TA 2Q2WA 1B8UA 2CNBA 3GHYA 1HE2A 4G81A 4MKZA 3FSRA 5HM8A 2Q1SA 3H8VA 4UVDA 3DWFA 3RI3A 4AJOA 2D5CA 3BMCB 4HNGA 1K89A 1XLTA 2JFHA 4B79A 4Y98A 4HP8A 3CPSA 4WE3A 1GYRA 5EMHA 3MJEA 1EBUA 4ZRMA 3DL2A 2CD9A 3E9NA 3I3OA 4CJXA 3K6JA 2ZTVA 1A71A 2PZKA 3U0BA 5C7OO 8ADHA 3ZW9A 4Q9NA 1HDZA 3ONEA 2VZ8A 5JYDA 1E7RA 2OXIA 2FR0A 2GRAA 3TZ6A 4RPLA 1LDNA 3TZHA 2E48A 2HJSA 3CE6A 4E5PA 1NM5A 5A04A 1U4OA 2BD0A 3PVZA 5I9NA 2HRZA 3WGQA 4B4VA 1XCBA 4BO6A 4GGPA 1DHTA 1UZMA 3OFSA 3RKUA 1KVTA 2YDYA 4LVUA 1PZEA 1NFFA 3N7UA 4RPHA 1BMDA 4XD2A 1U7TA 1U8FO 3NRCA 4XYLA 1KS9A 4C7KA 2AQ8A 2BGKA 4XCVA 1Y81A 4KQXA 1I3LA 3DFZA 4IUYA 4BO8A 3ZI0A 3MZ0A 4FFPA 1F8FA 2ZCVA 4TZTA 1LX6A 4HFJA 4JJGA 4RVUA 2XAAA 3FNFA 2DUWA 4FQ8A 1N92A 1A7AA 4PIVA 4U0JA 4YQYA 3RIHA 1EUCA 4WASA 1D4FA 1UP7A 1H0KA 1EBFA 4I9UA 4DA9A 1LLUA 4BO5A 5CEEA 2RAFA 3FWZA 3RUHA 4OXKA 3DXFA 3ZWWA 4BNLA 2Y1CA 2CZCA 1DIHA 1EVYA 3AOGA 3HWRA 4BNVA 5DBFA 3KEOA 4QO8A 1J6UA 5DNAA 3RASA 4AJIA 4ZJUA 3OJFA 3NTOA 2AEFA 3DAFA 2NADA 5EJ2A 3BHIA 1C0KA 4I5GA 5JDCC 2V6BA 3WDSA 3PHGA 4BIIA 2HKIA 1T1SA 4TVOA 3A14A 1L1FA 4F6LA 1FXSA 1K5HA 3FNEA 4QTZA 2V6FA 3GMSA 4N54A 3OETA 3O4RA 4MIOA 4Q3DA 4ZQBA 1ZK4A 2X86A 2CFCA 1XQ1A 2VT2A 3E8XA 1ISIA 4BQRA 1VL0A 3FN4A 4CMGA 1PJ2A 4OSPA 5IDXA 4IINA 4Z9YA 4EBFA 3VTFA 1SEVA 4UVHA 1ZK2A 1O94A 5G0TA 1NR1A 5KVVA 4U7WA 5GZ6A 3ZV5A 3ETEA 3GVCA 1T2EA 2VHVA 4CM1A 5KJCA 1I10A 3CH6A 1XR3A 4RGBA 1XGKA 2F1KA 4UVEA 3VAZA 3VDQA 2IXBA 4TMFA 1IZ0A 4EUEA 3OJLA 4CM7A 3BTVA 4DLAA 4XQEA 1NQAO 3RUDA 1K3TA 5AVOA 4FR5A 1PJLA 1B26A 2ILTA 2H1SA 2RHCA 2YUTA 2A35A 3K30A 4ITUA 1W8DA 1RYDA 3JQ8B 5TT1A 1QV7A 4Y6SA 1P77A 4YJGB 2I76A 1HEUA 2WYVA 1N2SA 2R00A 4IDCA 1LSJA 4KUHA 2J3JA 4E30A 1HLPA 1YQGA 4FPXA 3U4CA 1LNQA 1P74A 2PZMA 3NT2A 4CM9A 3ZGYA 1CWUA 3QV1A 3WJAA 2G0TA 3AM5A 3KZVA 1B8PA 2VHYA 4EZBA 4JBHA 1SBYA 5COQA 1UAGA 3I83A 4PZDA 3DB2A 2NVBA 2Y1FA 3PJFA 4HFNA 4XQ9A 3KTDA 3TZKA 2EXXA 1BHSA 5BNFA 2GASA 4PLWA 1EVIA 3DBLB 2EKPA 2ZJ0A 2UYYA 3K2EA 1UZNA 3NTQA 2EIHA 3TOXA 4EEXA 3MJVA 3QVSA 3ONDA 2Y67A 4Y6RA 3F46A 2V65A 1HLDA 1K0UA 1ZEJA 2EKLA 1NXQA 5EQDA 2C2YA 3CTVA 3V2GA 1N7GA 4I5FA 2DBZA 2HMVA 3ZWNA 5G0UA 3O26A 3W8EA 4FN4A 4B7UA 4WKGA 1M6WA 3B1JA 4AL4A 1L7DA 1MGOA 1VM6A 1C1XA 4NU5A 4MVJM 3JQ7B 2EWMA 4NBUA 1PQWA 1DIRA 1ZK1A 4WOKA 1HTBA 3AY7A 2IRWA 3EW7A 4GVLA 4BOYA 1KC1A 3PZBA 1IPFA 1E5LA 3E1KA 4EUHA 1ISHA 5ENDA 3O03A 4BKQA 3UN1A 1C0PA 4NDNE 3DBHA 3CINA 3IUPA 3LVFO 3GPDG 1YQXA 4XYMA 4FFLA 1NQ5A 2NV6A 4CLXA 1DFGA 4ZQGA 2P4QA 4IS3A 5HTOA 1GV0A 4BO0A 5TLSA 2RCYA 1H94A 2I3AA 3G79A 3WTCA 4E5YA 4Q3BA 4ZN6A 1IPEA 2DT5A 3ZU5A 3O8QB 1WDMA 1Y1PA 4LVCA 1AUPA 2OBYA 5EN4A 1A9YA 3HDQA 3SVTA 4CM8B 3D3EA 2I3GA 5F21A 1WVGA 3RWBA 5EINA 3FWNA 2OHXA 1YWGO 3ZH2A 1WWKA 3OBBA 3TF5A 4KWIA 4WNCA 3H5NA 4FDAA 4XKJA 2Q4EA 4LRSB 4CUKA 2BRUA 2O3TA 3ZDFA 2FPGA 2Q1UA 4JCOA 4DUPA 1YDWA 2X0JA 5DULA 3HJAA 1ZJZA 4BNNA 1HDYA 3RC7A 4K26A 2P5UA 2EW2A 3DQPA 1HSZA 1XYGA 1H6AA 3C7CB 1UJMA 3UXYA 1DRWA 5BSGA 1JWBB 1XHLA 3TWOA 1UH5A 2A4KA 2EGGA 1BSVA 1X7DA 1SC6A 1YOVB 1E6EA 1Q2XA 4DIOA 4GI2A 2Y0CA 4L4RA 1E3IA 4XQGA 1AXEA 4DC0A 3JCZA 1YS4A 4KUGA 3FNGA 3UAGA 5BT9A 3QIVA 1NPYA 5L53A 4OKNA 1L7EA 2JD2A 3BTUA 2FY8A 2D4AA 3U62A 3U49A 3NGLA 2RHRA 4ALNA 4LRTB 1NPTO 3JQEA 2Q4BA 5IN4A 1NBOA 2B83A 3MTJA 4XGKA 1Z6ZA 4FJ1A 1X1TA 3FPLA 3C24A 1PGOA 4JLWA 3S2GA 5TIIA 1LC0A 1LDYA 3VC7A 4BMVA 4KUEA 3IOYA 4MDHA 1F14A 1X14A 1Z73A 2BLLA 4RQTA 3ANMA 5ILGA 1H5QA 1XSEA 3QVXA 3RSHA 4QUKA 1PJSA 4E5KA 3QWHA 2GZ3A 5DDIP 2IZ0A 1NYTA 3ZNQA 3KLMX 4NBWA 4B7CA 2F00A 3EUWA 2R2GA 1RJWA 1I8TA 3SEFA 4LSWA 3KUXA 5FYDA 4CM9D 4HFMA 4R01A 3W6ZA 3G1UA 4GKBA 3ICPA 1O5IA 3SJ7A 1TXGA 2OBNA 5HWSA 1AHIA 2HCTA 1Y8RA 3B20A 3NT4A 4PG6A 5L51A 1P0CA 1T26A 5F1KA 1DC5A 3VZPA 1YO6A 3PRJA 4FFNA 5JXWA 5L4LA 3DONA 3DR3A 3LDHA 2PD6A 3BMQB 5JBIA 1LTHR 4BNMA 5JC8A 3ZWPA 3C85A 5JY6A 1P1RA 1E1NA 4TRJA 3BXXA 1ZK0A 4CMIB 3WOHA 5U9CA 2AEMA 1F06A 2VOEA 5ADHA 1ARZA 3C7DB 3JYLA 1U5CA 1TI7A 2YHIA 4R51A 4PCVA 1SOVA 3IP1A 3K9QO 3BMCA 3D4NA 1EUDA 4NJOA 2DBVO 3AY3A 1JLLA 5JFOA 3ANNA 2WYWA 3JYPA 1XEAA 3WQSB 3KBOA 4Q3EA 4CQMB 2CMDA 2VOJA 2DTXA 3Q1LA 1NWCA 4NK4A 4E5MA 2H63A 3GGGA 3ABIA 4YT2A 2QRKA 1EE9A 1Q7GA 4INAA 1YE3A 2IEBA 4E31A 4DLLA 4WEQA 1LRKA 1SNYA 2XXJA 1JKFA 4LMPA 4IY1A 1N1GA 5A9RA 5THQA 1GCOA 1ENZA 3GFBA 3AUSA 4IIVA 4OKIA 1DHRA 2V7PA 4PLHA 2VT3A 1F8GA 3L9WA 3G0OA 5LCXA 2PV7A 4GBJA 1KY4A 5ICMA 3WFIA 2PA3A 2RBEA 3WG9A 3TQHA 3PQDA 3S2FA 2D2IA 3JD3A 4BKOA 1K6IA 3GT0A 3ZWCA 3F9IA 4Y67A 4R3NA 2W4QA 5B4VA 5JMPA 4M86A 1HSOA 4O0LA 1J5PA 2Q50A 4BNIA 3HDYA 4IDBA 2DTDA 4HUJA 4RCVA 2DM6A 1YJQA 4B4UA 3DZJA 1HWYA 2CVQA 4YEDA 1GCUA 2O50A 3GC6A 3MEQA 3WGZA 1LJ8A 3JQAB 3PFWO 4J7CA 4B3HA 1XIVA 1NWHA 5T8KA 3K96A 1O9BA 1FDSA 2CVOA 1BVUA 3ZW8A 2ZTLA 3R0IA 4A10A 5L4SA 3CUKA 3KYBA 1ONOA 3FTNA
chains in the Genus database with same CATH superfamily
2XVYA 2C0PA 4TS9A 3ZJTA 1GGKA 3MMZA 4GD3Q 4EX6A 2Z9CA 3E9ZA 2HDHA 1K6MA 4UUNA 5F35A 4I4TF 4O5AA 4L3OA 2XNDD 2VAXA 2ZYUX 3PPIA 5D1NA 2GK4A 1DC8A 2JFUA 4BHTA 1YUMA 3HO8A 3TW8B 3K2BA 1LUAA 1NI4B 4GSKA 1QHHB 3L1UA 4N7MA 4V2IA 4ZI7F 3QE0A 3HU5A 2BGLA 3OZGA 4BDTA 2K7FA 1ZN9A 1FJ2A 1DKRA 1MX5A 1LWNA 3GEDA 1AKVA 2XXBA 1DJNA 2E5LB 5IJ9A 1VKZA 2ZJ4A 4XCQA 2NM0A 3F8WA 4ZDWA 3TM4A 4D96A 1TJ5A 3MJFA 4NLLA 3ZZUA 2OTCA 1KZYC 1SUFA 1P4GA 3E84A 3QYPA 3K73O 2JI8A 3ESAA 4Z3KA 1Y8ZA 3G3EA 4QAJA 5BSEA 1SY7A 1WZ2A 3HB7A 1JP7A 3QH4A 5TVKA 3BICA 4E22A 1TVEA 2AQKA 3GQBB 5U4QA 2CB0A 4RGVA 1V6SA 4IGEA 2WF6A 1R6TA 1R4MB 4GBGA 4FW9A 4CKCA 3FVQA 5EZYF 4BGVA 4R7TA 4D79A 2JDIA 2YZ2A 3G88A 1F2VA 2R87A 3BEDA 4F2DA 2EJUA 3Q2KA 3Q9LA 4DLNA 4D3FA 3CZCA 3B1ZA 3BK7A 4HQOA 4G5XA 3TQIA 4EFLA 2WSBA 3PUJA 4AJ2A 4IP0A 4FYKA 1GADO 3VYRB 1LJUA 3BB4A 5PNTA 1IM2A 1Z4NA 3KWFA 5DP1A 2R86A 4Q4HB 4KR9A 3N76A 4TT3A 5AW9A 2ZI3A 1ZLXA 4S1VA 5K0TA 4ZOBA 1VYHA 1R6DA 3GLUA 3S7TA 1NVVR 3ZE8A 7YASA 2YJGA 3OCZA 1XTJA 4U5XA 4GM0A 3TO5A 3MWYW 5CT9A 3WK7A 2PQ6A 4IIJA 4L9RA 1WXEA 1WPQA 1T2VA 2Z58A 3ED5A 1ZNYA 3MUNA 4I9FA 3ETLA 5H1YA 5C7LO 3VR6D 1WEKA 4LRYA 4Y7DA 3W9YA 2DWCA 4HRVA 1I3NA 3JAWA 3PL5A 4D4HA 1ZIYA 1DDOA 1YE8A 4TLCA 3RKRA 2IHUA 4CFYA 2A0WA 2D7DA 2GLXA 2IPNA 5THKA 5AUNB 4YV0A 1ILEA 4QBHA 3GBPA 4DT1B 4Q00A 3GVXA 1PZFA 1N7JA 3KSZO 5HKKA 3R8CA 1YB1A 2OVFA 3NKVA 1DFHA 4UQOA 1ZOIA 2O1XA 3GLQA 4MI9A 2H2HA 2ZEJA 1SCKA 1JJVA 1SAYA 1Q15A 4IS2A 4ARVA 4R8VA 2X3FA 4U7PB 1SBCA 3W5IA 1BA3A 2ATVA 1V5WA 1VP9A 2BFFA 2HMSA 2ORED 2VDWA 3E81A 3EJ6A 5LLSA 5K6RA 1OTHA 4WUTA 2PGDA 4LVOA 1FCJA 1YI0A 4W1SA 4QG3A 3IH5A 1YR6A 4OQMA 1HRDA 4BLQA 1NOJA 2H5LA 3CF4G 4WX2B 2OD9A 3F6CA 1Z2DA 2VK8A 3ESDA 4LHEA 3VH1A 5GTDA 2HQSA 3GLRA 4W82A 4CMHA 1CSEE 3C4VA 3O3NB 3WTBA 1X1EA 2FR8A 1OX4A 1E5VA 4O4HA 2GR9A 2CNKA 2R11A 3ETNA 2M1XA 4MR9B 3HO1A 1FVFA 1XELA 2OQIA 5M29A 4F5YA 4FB5A 4RYDA 2JAPA 3F96A 5C4GB 1P3JA 1RI1A 2C54A 3HR4A 3WX0A 2ST1A 5KDLA 5CA1F 1L9XA 2BKLA 2VUUA 1MCZA 4FVTA 5CFPA 3LKVA 3OO1A 4HFRA 4HI0E 2GRUA 2ZREA 3L9XA 4N5NA 1SH7A 4BV2A 1CF9A 3JR3A 3EDCA 1QUEA 3CXUA 1C7FA 3CYFA 4F56A 2C0CA 4LMAA 4TV9A 1P44A 3TI7A 2CVHA 4D6PA 5HQTA 5EFOA 3QX8A 2C4VA 2CV2A 1WXXA 2WNHA 1ADBA 3OKFA 4NPAA 3P9YA 4OB7A 4Q1CA 3CMMA 5EYPA 1OVGA 3J7TA 4EO7A 4CM8A 5K0CA 4DPKA 5K8JB 3O94A 2ADMA 5DMXA 1FLAA 2C9BA 2W11A 3HYLA 1YD7A 4OHWA 1T15A 1VBNA 1X70A 3CWQA 3NTXA 4AK9A 2PMCA 4MQ6A 4PF1A 1YRLA 1BEZA 5GIOE 4PZEA 2CJXA 3C3PA 1P60A 3GUCA 4EYEA 1WB9A 3HL4A 1YS1X 1IBRA 3VVMA 4PCLA 1JKXA 2Y05A 3BQ9A 1JLHA 2R79A 3UVEA 2NT4A 2OFPA 1E2BA 1W0CA 3OCUA 3O8OA 2PUFA 3LBNA 5HA5A 1P7ZA 1J8QA 1NFQA 4KHZA 4RVOA 4IOKA 4ZDJA 2RJNA 1W7AA 1EFVA 1GN9A 3GLHE 3PXGA 1W0JA 3WK8A 4PLFA 3T7IA 1MIOB 3FUXA 3AFHA 5A7HA 3UMBA 2PRYA 3ER6A 3ZDDA 4J76A 3TLAA 1UJ6A 2WVGA 3NTRA 3CIOA 3D64A 5B7QA 4FIDA 4TXMA 1NXPA 3DUFB 3IUSA 3B52X 4EP1A 1YRAA 2O1SA 3ZBTA 1VI6A 3WRXA 4Q3LA 3HVJA 3SHFA 4K7JA 4Q1FA 4WCFB 3FR7A 2WYHA 3IUNA 4DSUA 2IH5A 1P2VA 1MFZA 3FE2A 4WZBB 2WFLB 4EGFA 3M4ZA 4DR4B 1GAEO 4FHEA 1CFJA 3KKQA 4HAXA 3HXKA 4QBTA 2C4KA 2RHOA 2QVXX 3ZE9A 4EJMA 4ZV4A 1CUEA 1JEDA 2AD5A 1ABEA 2Z43A 1CUCA 2G63A 3FYCA 4CMEA 1HQKA 1AX9A 4H0FA 1DBQA 1WNFA 1IL0A 2GZSA 2NQ2C 5C3UA 2ATEA 4UCQA 1E2EA 5H3CA 1AQJA 3S1AA 2NPFA 4X54A 3U4AA 4HMPA 1MG0A 2UUAB 1FYEA 1L4EA 4G41A 4DCPA 1OHHD 2E2WA 1VKOA 3T38A 1T3LA 4Z9BA 2VDPB 3SIWA 3S5JA 5GAJA 5IZCA 4YAUA 3OZRA 3Q2OA 4ZGWA 3SIPA 5K3EA 5DP2A 3RUEA 2GTIA 3UJAA 4QDXA 3C15C 1P5FA 2YR0A 2H7VA 4FGSA 3IKMB 1TUBB 3EGWA 2J3DA 2JC3A 3BXEA 3AU9A 1R5BA 2IYQA 3GY0A 3O21A 4HPWA 5DX8A 1E0SA 1R15A 2WLTA 1W1WA 2W9XA 1E4EA 3AR6A 4UVIA 4XM1A 2P1ZA 3EVGA 2H16A 3U17A 4ER3A 3FRHA 3PDUA 1NVBA 2P6UA 4Q05A 3ROTA 1ZFNA 2Y2VA 1SB9A 3B5EA 1NUQA 2IUTA 1BXRA 3ZCPA 3B9RA 1ORWA 5HBGA 5L8VA 4Z53A 2NYAA 3OT1A 1QHGA 1TC2A 1Y7TA 2B6HA 3PI7A 4Y6GB 2Z9DA 1QQTA 1XTBA 1ZSVA 4RU1A 4V0ME 2NTNA 3BJZA 2VSXA 5ECYA 4CLOB 1R50A 1S3SA 2ZW9A 4QPJC 3W5HA 1A8HA 4I9NA 3ZY4A 4DV1B 4XGQA 4HJRA 4ZT2A 5KO2A 1MW8X 3T1HB 4GI3A 1Y4UA 4Y1RA 2VJDA 3CZ4A 3LUJA 4COOA 4KITB 2PJZA 4IHJB 5A4AA 4D3XA 2PUGA 4G67A 4YRZA 1LRLA 2HK7A 3ID6C 4Z8YA 3NV7A 5C37A 5LQMA 5BVGA 4QZVA 1UXOA 1V9CA 4LZJA 1L8OA 4XB1A 4E2XA 4MS1B 1RJEA 2QPOA 5JS8A 4CIWA 5JLJA 1WMAA 2AR0A 1BMFD 1T8PA 1TZKA 4KQGA 4JT8A 2XD4A 3FH0A 1V1MA 3P0EA 4JITA 1NJGA 3FFXA 4K28A 3SDBA 1QLJA 3V00A 1JDBC 2O05A 3ITKA 5DM60 2EZ4A 1U28A 3BWBA 4IJUA 5BR8B 2FEAA 2P8JA 4Z3DA 3VC1A 2NAPA 1BXGB 1WR8A 1F3LA 3KPYA 1UK6A 2ZRJA 2H51A 4Q5IA 3O7MA 4X7RA 2OHGA 5DNVA 3ICCA 4BGEA 1QP8A 3QKSB 5TPWA 4KH1A 1FQWA 3VZSA 4FI3C 1NQOA 1UAAA 3IL2A 2HJWA 3M5CA 3W4JA 1YZTA 3NZEA 2XTAA 5E9WA 1IEXA 3LE8A 3RHFA 1KMMA 4KXMA 3U81A 2NAFA 3NKLA 4WY2A 4C6HA 1UOPA 5HF9A 4D9HA 3MWLA 5FOSA 5BWOA 3MINA 4YPVA 1K7XB 1ZIXA 3WIBA 1IUKA 1XRMA 4HRAA 1KFCB 3EZFA 2RHGB 3OPYB 2X40A 3KM0A 4WCDA 4J8PA 2C9MA 4FZ5A 5D3QA 1U8XX 3KWMA 3KJZA 1HZZC 4KB5A 4BNJA 4C0JA 3VUFA 1A4XA 3HBNA 3JYQA 4XJTA 4WHMA 3WADA 2EL7A 3G8CA 4MUHA 4BE4A 1T6BY 4ENUA 3A2LA 3COSA 5J47A 1O1YA 3A6LA 5CURA 1E59A 4P0PB 2OOSA 2P9TA 2K4MA 1UBLS 3UWDA 1VHWA 1MABB 2RSLA 3Q15C 4MR7B 3ZEIA 3E7PA 4JIMA 1KK1A 1JU3A 2VJBA 2ECQA 2GCOB 4TTTS 3D81A 1V11B 3VTZA 2VHQA 2Z08A 3U4HA 1OFGA 2I22A 5A7GA 1GVNB 2D1YA 2CV1A 2BL4A 1HETA 4FSHA 2QU8A 4ALMA 2HU8A 2D7JA 2JIOA 4EG0A 1N8SA 1PU2A 3TW8A 1BHQ1 1C8KA 2QL6A 1QHHA 2FWNA 2WHPB 2IY8A 3OI7A 4OGKA 1XNGA 4XA8A 3S68A 4B7AA 1Q0QA 4GWLA 4PTLA 4WNYA 3SNHA 4NBKA 3DMGA 4RHXA 1ESCA 5ELXA 1YDHA 3VAYA 5MN5A 3P52A 2WINI 1AK9A 4QICA 3OLCX 3SSMA 3TD6A 2ZYAA 1UIRA 3ZZ1A 2OP1A 4MO2A 2AKEA 4N47A 2NP6A 2GEUA 4CLEA 1QF7A 1Z25A 4RMNA 3CMCO 1KJQA 3HGMA 3GFGA 3GT4A 4RULA 3GQBA 1SQ0A 3B85A 5I7EA 1M8GA 2JGLA 5C4IA 4E2ZA 1JAXA 1R4MA 2LE0A 1BH6A 1ZVKA 2AMFA 2RHBA 4Z2AA 4IDHA 2QM3A 2Q1XA 5KJEA 4BWVA 1RPJA 3SYNA 1WQ3A 2I1VB 4EJSC 5CYFA 1KVRA 1NOKA 2ZIEA 1U7HA 1V9LA 2ZUWA 3IEKA 2C1XA 4MP3A 4UBKA 5CU7A 3BIFA 4KIJA 4EAAA 4C4XA 5EUBA 4OI2A 2ZOSA 3CRRA 5FDFA 5KHOC 3THOA 4A2CA 4Y2GA 1CUYA 1WOYA 2BWJA 1IY1A 1G59A 3BCRA 5B1HA 1N2IA 1OCEA 5TPZA 1V5IA 4F11A 3IP8A 4Q4HA 3ZU3A 4TL7A 1E3QA 1J1IA 4HNAA 2F3PA 2C9OA 1CJVC 2H5JA 2OSBA 5CFOA 1LDMA 2X9VA 4A2WA 1J49A 4TYPA 3PFGA 4WNIA 1Z6XA 3D4LA 4JA0A 1U8UA 3QITA 4OHOA 2L19A 4CHGA 3ICQB 5F5LA 3EIOA 3CS3A 2DUUA 3FJYA 3LT4A 4MVXA 4CI0B 2ZRLA 3L4BC 3N0XA 4FOLA 1RM4A 5DEIA 3SZGA 4N49A 3C70A 3FGNA 4N8SA 1YR7A 3P20A 1NI3A 3NV9A 4D8UA 1FZTA 3OLZA 3V6LA 2DFPA 2YNMC 3WQBA 3EVAA 4KXXA 3VDXA 4EF4A 4HN2A 1B23P 4MWZA 3RYHA 4X24A 1K2VN 1E96A 2JLCA 3Q72A 3SKXA 2WU8A 4PGHA 5H82A 5JR3A 5I7VA 4CCWA 1U99A 1OD6A 4LGCA 4XLZA 3SI7A 2XUAA 1P4JA 2OY0A 3D4PA 2FW9A 4DT1A 2QGFA 1Y8QB 4CQMD 2ODQA 1P8AA 3P97A 4OQLA 1AD2A 4P3XA 1TUGA 3GX1A 3FFBA 5K0ZA 2VLIA 3RS4A 4JU9A 4ADSG 3PF8A 3NHZA 3H4MA 2X76A 3MRVA 4GRAA 1TKCA 1HUQA 1EHIA 2AJLI 3AP2A 2JIMA 3CNLA 3EVEA 2Q3EA 3OZWA 3P2MA 4DVGA 5C1PA 5FWAA 1IK6A 1JZSA 4QA9A 3QOFA 3EQ9A 4FWBA 2BBTA 2L17A 4GUDA 3VGJA 3ZV6A 1TMKA 4P7KA 4B8ZA 3STUA 2OV8A 1VE9A 1R0YA 3AERB 1YBFA 1B73A 4KKVA 1GUYA 2PL5A 3R7NA 1PNTA 1PL8A 1ZGZA 2ERXA 1JYSA 1QRDA 2CBZA 1BFDA 3NDJA 3MBIA 2H2DA 5IULC 3ZLTA 4I2NA 2YC2C 2Q8PA 3VR0A 1R37A 3KB2A 3KQHA 1XD2B 4FLEA 4INPA 1LXCA 4MR9A 1ND6A 3FFAA 4IR7A 3TLYA 1P5RA 1NBMD 1UR5A 5FV7A 1L4GA 3CPJB 3WISA 2OE2A 1QU2A 3E48A 2TMYA 2Q4DA 4JP8A 3LT0A 4C2TA 2C7RA 3CISA 3AU8A 1R12A 4D9CA 2XEXA 5AK4A 1M3SA 3AR2A 4BL5A 4DWOA 1OF1A 3ZKAA 5LQDA 4DCCA 1RM5A 3RBXA 3T99A 1CR6A 1N8KA 4DV0B 2ZYGA 4KIFA 4NG4A 1P1FA 3IOEA 4B74A 2Y1DA 1W5TA 3WMFA 4QT4A 3IUQA 4U2EA 1UJ4A 2Y1EA 1Z63A 5CDYA 3DZGA 2BMAA 4EITA 1Y48E 1WP4A 3O31A 4LKRA 5HGJA 3TEMA 1RPNA 1KU6A 4O1HA 4HH1A 1M66A 5EP4A 1JQAA 3GEGA 5BN1A 1CYEA 3T3GA 1E77A 4XIJA 1D7OA 3LLMA 4H7JA 1FXWF 4ZPJA 3RVSA 3I1JA 1LU9A 2ZBUA 4D4JA 2J3HA 4LE0A 3RLFA 5EXXA 3K3PA 4GBED 5K2MA 3WICA 1LA2A 5A7FA 2I71A 4YCCA 1A50B 3B6JA 2FEWB 3EZ7A 5G41A 1DO8A 5IT5A 1N6OA 3KE9A 2EFGA 5CLFA 1L4LA 3RLIA 1R9JA 2TMGA 1U0JA 3G8DA 2FXVA 3HG7A 3MQ2A 1WF3A 1K1EA 3HGQA 4PPNA 3TMAA 4D9JA 5JSUA 5KX5B 1SVIA 3D3JA 1E5DA 1ZGCA 2A7XA 2I3ZA 4L16A 3UY4A 2FG5A 3MJCA 1XRQA 1MIOA 3D2AA 2B8WA 4Q12A 4ZOLB 2NU6B 2YZNA 4B5KA 1Q44A 3R3XA 2IOHA 4REMA 3RC2A 3LXUX 1CV2A 1CHDA 1GR0A 4A0QA 4DTCA 3F1LA 3I9NA 4KFTA 1L4HA 1EFTA 1Q0PA 3WNDA 4G1UC 4H7DA 4NS4A 4Y2SA 2QRJA 2CMKA 3DUFA 1ZM2A 2O2CA 3HYNA 4JVNA 4WY8A 3FR8A 1JPUA 1ID8A 5A2QA 2F59A 2Y1KA 2VTKA 3UH1A 4WCFA 2IPOA 4UE3S 3D8UA 1BQ4A 4WZBA 5A4FS 2FRDC 2ZBGA 4INJA 3RS9A 2WFLA 3H2SA 3Q7RA 4G4SP 4UZEA 3ZE2B 4XRGA 5A3JA 1DDGA 2FKAA 3ABQB 3DG9A 1Q7CA 4M99A 3F67A 3DUWA 4LXIA 4RV5A 4Q9LA 4CG2A 1ZU5A 4X3CA 1L5YA 2J5BA 4PLCA 2VCHA 1N5KA 3NGXA 5FO1A 2RC6A 3LNTA 1YZHA 1ZGGA 1V3TA 2WSMA 4HLUC 3PCTA 1CY2A 2NSDA 5B1DA 4OH7A 3LY5A 1I3MA 1RDFA 1PV1A 1VMIA 2E49A 3HN2A 2ID9A 3I52A 3ABZA 1WUJS 3E3MA 2RGRA 4UBOA 1Y33E 3D1LA 2J08A 3LNCA 2OYSA 3SP1A 2MYPA 1LBHA 3EFHA 3R5TA 5CGZA 4R5MA 4YMHA 3D6MA 4URFA 3VTAA 3U16A 2QN1A 4PR0A 4AY6A 3GJXC 4KFCA 1JMKC 2VJCA 4C0LA 3VR3A 2X6RA 3KO8A 3UKJA 4US2R 1P45A 1KI7A 3ENWA 1U0EA 3UG6A 4B83A 3ZK8A 2YS6A 4A0FA 1JX6A 3IIEA 4Z4CA 1J0XO 2CYAA 2QX9A 4LDNA 4CCAA 1BX0A 1PAUA 2HN9A 2QL7A 3GMDA 2XF2A 1IHOA 4KAXA 1QWOA 4P4NA 2WQ6A 4I08A 2A5DA 2IU6A 1TUBA 3EE6A 5JQWA 1V2HE 2QE7D 2FEMA 3ET4A 1K7SN 2FFJA 4WIAA 5M2QA 1XLVA 4U6SA 4MVJH 3W1VA 4B43A 1DV2A 2BKEA 2WR8A 3A2NA 2O0KA 3TNFA 1U2ZA 2DWPA 1GZ3A 1V8OA 1JR6A 2HQ1A 4I1UA 1KZ9A 4AF6A 1MEEA 3UAWA 3PXAA 4ZCIA 1M2WA 1JR2A 1LVUA 2I4OA 2J4FA 4QBIA 4DLXA 1M6VB 4Z4FA 4MW4A 4UPDA 2A3NA 3EMBA 4MVYA 4JQCA 4KRGA 5AICA 1SOMA 1U31A 4HB4A 4BRUA 1PEDA 2MHCA 4LJ8A 4PAWA 4A0GA 1UANA 3BT7A 4O2LA 1Z13A 2QZ9A 1FXUA 2C07A 1TT7A 5L3SA 5JCZA 3IUBA 4W7HA 3OE1A 3HCNA 4QIHA 5BNZA 3BF7A 4JP3A 3RAEC 1HZJA 1NVXQ 1H22A 3M6WA 1F2DA 3IQGX 4PG4A 3RUPA 1OFUX 2E3JA 4IHJA 4BMOB 1RXUA 1OX5A 1H4QA 4LG1A 1N7IA 4KW7A 3LU1A 4R2MA 2BKAA 5DTIA 3WZ2A 3KZMA 1UBUS 3IPXA 2CLSA 1O2DA 4NU6A 3SHVA 4A91A 2VWHA 4MS1A 3BERA 1FUIA 3SM9A 4LXUA 3KDPA 1EXMA 4K9NA 3PHBE 4UM5A 4AS3A 3ERCA 3VR5D 1LDEA 1VIAA 3OLWA 2XYVA 3UEOA 1DELA 3HXPA 2ODPA 2FR1A 2MTBA 1PDOA 2CJYA 4EPVA 4Z9FA 4JIGA 5JMTA 1WU8A 2FLWA 4IQ0A 5DW3A 1TE2A 3CRMA 5EIFA 2R8YA 1C9DB 3EC1A 3PA6A 4RPJA 2O1EA 2Q27A 2J87A 2Z5VA 5GMOA 4AM8A 1BXGA 3CEJA 5C8YA 4UBLA 5EESA 1AO3A 5FFMA 1X92A 1GPH1 4B2IA 4C6SA 2CF6A 3NWOA 4LYDA 2EZUA 5I8ZA 3K6KA 2H8KA 2YW9A 4MGYR 4AJEA 1BGXT 1Z0FA 1IM5A 3BGOS 1XLTC 3QKTA 4GMFA 5K3CA 1ZH0A 4XFKA 1HGXA 2P4HX 4RSMA 1C3VA 1QKIA 5ELMA 3TTXA 1XX6A 1PR1A 4ZMSA 1YV9A 1SIOA 1PV4A 1GLVA 1XA0A 2PIDA 3CTPA 3QOWA 4MGIR 4JLNA 1C4XA 1Z5UA 2C82A 2Y0BA 3CRZA 3VSDA 4BX8A 1J06A 4MKHA 1OROA 1NHGA 1C1DB 5L6LB 1YS9A 2VA9A 1E3SA 4TMYA 3H2IA 1TJ3A 2M9MA 4ZAXA 4EMBA 5HZMA 1LB1B 1FLDA 1G8PA 2H4JA 2WJYA 4PSDA 1QHYA 1KJ9A 3QXJA 1SXJD 1VA5A 3K94A 4M1TA 1Q1ZA 4TRNA 1N9GB 1RYBA 1Y8CA 4YUVA 3ZNOA 2VRCD 4DDWA 1I7LA 3BE6A 3LWZA 1EA7A 2O8NA 1U0GA 3IJ5A 3FKSD 5EKUA 4AMUA 4X93A 3OZBA 3WJ2A 2F8SA 1FNCA 2POCA 1MABA 1CJCA 1XJ0A 1EIZA 1XT6A 4MR7A 2Q4RA 1IG0A 2J3MA 3KD3A 3U9SA 1RXWA 3RNOA 1JG4A 2RFLA 1P0QA 2B4RO 3O93A 4JT9A 4R8LA 1JIIA 5JWHA 2GCOA 2HU2A 1NATA 1V11A 3KQTA 2NVWA 2XQFA 5G0VA 1HLGA 3T0GA 3WNVA 1DLJA 4IH1A 4RCZA 3RSFA 4EJFA 1E9SA 2VYVA 3VVBA 3ZGOA 2QL9A 1LTKA 5K09A 4HX5A 5EP1A 3CLUC 3ROMA 4GQBA 1K6XA 4QOEA 3TIFA 1TKAA 2JVIA 3HTXA 1M7GA 1UKEA 3P0FA 1CFZA 5CDGA 3L82B 2J8ZA 1U9IC 2ESRA 3ZGZA 2OCIA 1QBGA 2VYNA 2WHPA 2QRGA 3HA7A 4QRDA 2NNLD 1JKJB 3LZDA 1RWMA 2HQOA 2DPMA 4RL6A 3UANA 4K2HA 1YR9A 3L02A 5HFNA 4BFYA 3RS3A 2EEZA 2ZUCA 3SE7A 1DC6A 1MJFA 2VHXA 4JC4A 3BKXA 4UPVA 3NHRA 2HLNA 2ZE8A 2LDBA 2PMWB 5AMXA 5AVJA 1LLCA 4CDGA 2W6IA 4A6DA 2XYQA 1Q0HA 2J31A 4UZSA 2FSGA 3E5MA 4L4XA 4NK5A 3CTMA 1YHNA 5AXBA 3D7NA 1O54A 2E4YA 2HHHB 2BGUA 3GI1A 1KI9A 3L8ZA 4R2JA 2JFZA 1PJQA 2D2EA 4JNKA 4FNGA 4NCKA 4IMRA 5EXPA 4UVGA 4Z6KA 4M83A 2WF7A 5C8DA 1H23A 1V37A 3MCVA 2UVQA 1GGEA 2ILVA 4CT0A 1APBA 4DA4A 1DO0A 3GJYA 1KI3A 4KI0A 2IYUA 1KP3A 3F5SA 2BPOA 4R1QA 4YHBA 4N3AA 1AKQA 2OB1A 3JWHA 3NNDA 2NSHA 2ODEA 1KO4A 4LA4A 1IWOA 4MRAA 4IIGA 5IG2A 3CONA 1FRZA 3L7LA 3MM4A 2BFOA 4ZIRB 5BSUA 2YXDA 5E0KB 4F4FA 4ND2A 3EC2A 1Z5WA 3R4VA 5IM4A 5CNKA 3ZBQA 4EL0A 1Z8DA 2VRBA 3A1FA 5JCOC 5CFRA 2IZ7A 3HUFA 1VCHA 4XVRA 1RQRA 3R7FA 2FCAA 4DDMA 4YP1A 4OBWA 1FNBA 3UNXA 4RXTA 2VDQB 4PLYA 4M8SA 1QBKC 2CXPA 4ZEVA 1GYPA 4UMEA 1K98A 4LMBA 1NXTA 1DC7A 1P91A 3BH7A 3NCTA 1CUHA 5E38A 5L3RA 1MO3A 1IJKA 3SMQA 5HJ7A 3RAFC 3B1WA 1UDXA 2AL7A 1DCKA 1DS6A 4D0GA 1MTOA 1IRXA 1XMXA 1ATZA 4EYSA 3EPJA 2OBBA 2HNKA 4GR9A 4JB2A 3GLHB 4HZGA 4NJEB 4PBRA 4WVLA 4F3CA 1G66A 2WK1A 3FZQA 1AN9A 1M2OB 1YQTA 2Y66A 4B7XA 4NYJR 3TRIA 3PXEA 5CVTA 4EGJA 2H1LA 4PGAA 1VBMA 1Y8QA 5HKLA 2DQYA 1F1BA 3DL7A 3GB9A 4E15A 4M53A 4NZOA 3U0VA 4CIDA 3HA2A 3FMGA 3GP5A 3QXGA 4CIVA 2R00C 4YWJA 5IVIA 3VU9A 1T9CA 4C0KA 3ND8A 4PR3A 2PJRA 3MS7A 3SLGA 3GVHA 3ITNA 4KWHA 3WJ7A 4MGHA 4RDXA 1A5TA 2AQIA 2B4AA 1AKMA 3AERA 5ALOA 2IDJA 5DSZA 2NSJA 2YXBA 3BE8A 4KAFA 3L0SA 3FI0A 3FSGA 1KF0A 3OX1A 2CXHA 4YP5A 3N2GB 4DREA 2XMQA 3NHJA 1NP7A 4MZXA 2HJ9A 2NZXA 4ZO6A 5AKIA 3R0QA 3WGOA 5FL3A 4JBIA 4M55A 5JAHA 4OIMA 1V7PC 3U3ZA 1X1AA 2HIAA 2YHIB 2X5NA 3LUGA 5F52A 5FI0B 4KAAA 2IEZA 4ROSA 3EN0A 2EW8A 5E4JA 2CVPA 6CHYA 1JSXA 1VLVA 1XTSA 1F0YA 3C7TA 3GWGA 1M2NA 4HQLA 1FX0B 1SQ5A 2WKPA 3ETJA 1PDWA 3QTTA 4JYCA 4D1YA 1KDYA 3GPBA 3RF7A 1X8JA 4W8GA 5J2TF 4Y30A 5K2OA 1YB4A 3KXLA 4OHUA 4XSHA 4Q3NA 5CH8A 2WTBA 3NJ4A 3WGVA 1WMBA 3AF5A 1LKZA 3LYLA 1HDEA 4MQMA 2R2AA 4MUGA 4OXYA 3G82C 4YCAA 1RYZA 1WCXA 2RI6A 1IK4A 2WPDA 4I1YA 1E4VA 2AW5A 4YQEA 3S5UA 1JR3A 3T1NA 3TFOA 3LL4A 1ZIDA 1SRRA 1XTPA 1GTG1 2ZTUA 3BWVA 3GDWA 1MAHA 2EAUA 5GVSA 1VYVA 4LWQA 1I4LD 1XZPA 4I5DA 4JI3B 2TS1A 3BPSA 1N5DA 2NZVG 4L50A 4NCHA 1GPUA 3ZU4A 4MV3A 1XRJA 1LFAA 3GDHA 2QK4A 2QZSA 5CW1A 3WL4A 3O73A 1Q11A 4XEHA 1QIIA 3DOUA 2BT4A 2WJZB 3RBZA 1U3DA 2ZBVA 2P3LA 2VPWA 1XPUA 4NHEA 3UJCA 5K7SA 5L6MB 2C2WA 3F2VA 4ZMBA 4YHHB 2Q6TA 4UEOA 2OUKA 2AB0A 3A0RB 2QRVB 1FIUA 4UFPA 4ZCSA 4CNBA 4LDZA 1BXKA 4PG7A 4QELA 1K4MA 5KX5A 5DNEA 3LKDA 3O1JC 4L6CA 2QD3A 2H0AA 3FHJA 4QJ3A 1SVKA 2OORC 1J33A 1FP4B 1Y89A 3KR9A 3QLJA 4TMXA 5G1NA 3BDVA 4ZOLA 3VV2A 2IXDA 2NU6A 5H8WA 1IUNA 4B1FA 3VQTA 3W8FA 2R8ZA 2BFEB 4RBNA 4G5SA 4I55F 1B7GO 1T4BA 1H66A 2AMYA 3DVAB 3P5BA 1F12A 2XUDA 5CLIA 3X3HA 6Q21A 3PX2A 2J7KA 3CNEA 3A3PA 1ETHA 3QVMA 5AJWA 3TZQA 4LSMA 4IH9A 4C20A 1C8VB 4NV0A 1A9ZA 2RGAA 2GYUA 1WKVA 4KYTA 4Q3KA 2VQ3A 3ZYZA 4P5DA 3Q3CA 1NJFA 1L0BA 1VHTA 1QFJA 3AVTA 1XXHE 1Z7YA 3D59A 4GXRA 2WVAA 2WP8J 4MJXA 1ZRNA 2X23A 3EB9A 4LGYA 4E09A 2CUZA 2HO4A 4DHWA 1Q3KA 1SPXA 2HF8A 1R4NB 2XTMA 1TO2E 1QUFA 5U4XA 3SOZA 4D92A 1NYQA 1VJ0A 4DCUA 5IFLA 5IS2A 2G7MC 1Q1BA 4QGGA 3V8BA 4RADA 1KEWA 1UPFA 2N1MA 2PYDA 1TF2A 1FFAA 2ZYSA 3EVCA 3PUZA 2KBFA 4DQVA 1B6SA 3N07A 2PJUA 1C41A 3NHAA 4GPAA 1Y6JA 3UYLA 5JHGB 1MFPA 1JHXA 3LC2O 3BFJA 1QWSA 4LYHA 2DLNA 1WG8A 2AFHE 2JFFA 4PG5A 4EHDA 5IF9A 4R05A 4BY9E 1JEYB 2ZYTX 3LPDA 3BILA 2ZB4A 2GM3A 4WT7A 3IHWA 4XWKA 2WV9A 4QT0A 3ED1A 3WA7A 2IF2A 1UJBA 2IYYA 1OV6A 2D1FA 5EJ4A 4PX5A 1UK8A 3OIYA 3UAZA 2A67A 2NN3C 1BFUA 3I5XA 1BG6A 1GKUB 1E6KA 4MEAA 3ANTA 1IBCA 1K9SA 1Z0UA 2FF7A 1T6YA 2QLJA 4R2IA 5FA5A 3HS3A 5DGCA 3P5SA 4DC9A 1M6VA 5KJFA 2BKUA 3BAFA 4G8BA 4EW1A 3GFFA 1JJ7A 1FZQA 3PXUA 4LXQA 4UKDA 5EHIA 5JPDA 4BRWA 1QK3A 4AZ0B 1VCMA 4KVGA 4ZI3A 1J99A 2O19A 1NVKA 1HT2E 2GZDA 2WTAA 5ADVA 1EFAA 4C7BA 1HQCA 2JEOA 2QUIA 2M6RA 2VP5A 3MQ4A 4WWHA 2PCLA 1EH5A 3PNKA 3LKBA 1L1RA 3PG5A 1JDSA 2WICA 4PGMA 1W44A 2FRVA 4MEJA 1VC2A 2HYIC 1Q21A 1DZ3A 2GJ9A 3B12A 2IYRA 3IQEA 3S6JA 1B8OA 1IHYA 1PBNA 5DLQC 2J5QA 1G5PA 3DPSA 5ALEA 3E7WA 1JQLB 5FOWA 4PHHA 1W48A 2IDMA 2C59A 1VKHA 1X0VA 1KEEB 2AFIE 3M83A 3RQIA 1QFMA 2EJWA 2QLBA 4HG2A 4BYMA 4Y9UA 4MW2A 2P9GA 3K09A 2MWMA 3RF6A 5H9VA 2R6R1 2A88A 4FUTA 3TQCA 1Q2UA 1GCGA 1CEQA 1HRKA 3WAGA 3VPCA 4YCNA 3OOJA 2FV8A 1ZOPA 1BOFA 1DBIA 2AG6A 1C5KA 2QS9A 4ZPXA 2FEXA 4A8JC 2GCEA 2OR3A 2XSZD 3I9FA 4CFZA 1B14A 2ZRHA 3C3YA 3R6WA 5HZGA 1HNXB 1SHZA 1CQIB 1DB3A 2F1OA 3A27A 4NE7A 4A7PA 1BRMA 4OJMX 5IAGA 4N7BA 3RIXA 2C92A 2QQFA 3G2JA 4XZ3A 3RJ5A 5GADl 2XWQA 1Z82A 1LRJA 5EGNA 2Y0PA 4S0XA 4Z0PA 4HTAA 5KYKA 1IU9A 2Q4TA 4KO2S 1J56A 1OI3A 3L93A 4Z4HA 1DOZA 2C95A 3FTEA 4PSAA 3WL3A 1T9DA 1S3FA 3TB4A 4C4OA 2BZSA 2XH8A 1C1DA 3U3JA 2XODA 1KIAA 5JAZA 1HOXA 4QBKA 1T3TA 2WHRA 3QFHA 5KTOA 1JH9A 3FPFA 4C5CA 1Z5OA 2CXQA 2VHJA 2Q3HA 4J6EA 1DFIA 4HNHA 2IQIA 5H5JA 3RJZA 3VNQA 4AKHA 4I50F 5C5CA 3AFOA 1ODTC 4Q7EA 4TTVA 3DB1A 3U31A 3VPHA 4D45A 1Q95A 4UUOA 1N9GA 3MB5A 2A1IA 3EQ2A 3K8ZA 3T7EA 4KP7A 4A8HA 1QAQA 1PX0A 2O6HA 4DEYA 1UMBB 4K9SA 4NFLA 3FPAA 4CDMA 1P6QA 4MULA 4KWCA 3WLQA 1N0WA 1RLJA 3PEWA 4L7QA 1DE0A 2LKCA 4PICA 4Y2HA 1AQYA 1DUSA 3M1IA 3JPWA 4RSHA 4LPKA 1OREA 1U0NA 3PVCA 5I6DA 4C2BA 1SXPA 3F3KA 5GONB 3OEHA 2ZM6B 1H9AA 4CR8A 2YQ5A 2XWJI 4Y1FA 2EP8A 2HPAA 2W2VA 3GUVA 2CL6X 1P2FA 4NRDA 4P2BA 4XR4A 3ST7A 3WSVA 2BM8A 2IKSA 1B93A 3VH2A 1UT8A 2PWBA 3CN7A 3QV2A 1E64A 4YDSA 4HSEA 2C4HA 3UFBA 4YUYA 2DY1A 2PT5A 1PQPA 2A84A 3WV5A 1TPZA 5TC4A 1ZJ6A 2LCQA 1JL3A 1I2CA 4LYJA 1NNSA 2NXWA 2VEDA 2QHXA 2PKXA 2FSSA 1JKJA 4KMMA 4U1RA 3KSDO 3O84A 3OPVA 3RSCA 3WIVA 4ALJA 1BVHA 3RU3A 2ZB8A 3E15A 3UTDA 5FULA 3A6KA 3EIEA 3FIUA 4FMDF 5T8KC 2WWWA 4BV9A 3B13B 2BDEA 5CVEA 2O4CA 3ZY3A 4F6RB 1G0OA 2YZ7A 4R4JA 1TIKA 5IC6A 4F4CA 3QUBA 1V6CA 1L7OA 1YCGA 4WXPA 2ZBFA 3ZQUA 1NX6A 1U3CA 5JHHB 1RRGA 5ITWA 2V74B 2Q29A 2XTZA 2R62A 1C7IA 5DYYA 1YZUA 1V8BA 2QPLA 2HUNA 1WUIS 2ZT7A 4CCYB 2GN6A 3KVNA 4GPTA 4QSMA 2ZWVA 3SKVA 4NCAA 3T41A 4PFKA 1F60A 1MV8A 1YS7A 2ZSBA 4JZKA 4OJKA 1P0FA 4Y9SA 4KPYA 1DSSG 4XAQA 3CPHA 3CVOA 3R3YA 5DGTA 1E1QA 5HJ2A 1XDGA 5KNCA 3W5DA 1EFKA 2VNHA 3NATA 3NHKA 2AOTB 1P17A 2FQ1A 4PHFA 2GM4A 4LC9A 1PJ4A 1NW3A 4ZIRA 1AGXA 2GBLC 3QLVA 4OSEA 3TTWA 4DLTA 1Q83A 1YI8A 3RFVA 2G88A 3MPUA 2XOKD 4NCBA 1SVWA 4GOND 2HJHA 3TCXB 1HZZA 4IM7A 3CGWA 3F1KA 2HJGA 4OQYA 3FYTA 4FOOA 4JKYA 5SICE 5BMVF 4PYOA 3AFNA 1W5BA 2HFKA 4JUCA 4XPIB 4F2GA 4LBYA 4PVDA 2ADFA 3RFTA 4MYCA 1GUFA 3H7IA 3SXPA 3VTKA 2HTFA 5FQOA 1P8JA 5I47A 2GHRA 3PR1A 3HYSA 2R48A 1XTTA 4X1KA 1XDUA 1RWKA 3BFVA 4AJ9A 1P39A 3HKBB 2G40A 5JS1A 2XQGA 1USGA 2MMGA 3L8GA 5BN4B 3KD2A 3RS0A 4ZYWA 4QFMA 1DIAA 3DZKA 4NJEA 5E6RB 3GLHA 1WUYA 5JCXA 4AJLA 4HGQA 3X1KA 2QPTA 1L5VA 1M2OA 2OXRA 5LUBA 2C7QA 5CRIA 3KSAC 3CUTA 3AFMA 1UFVA 1P7CA 1ZBQA 5KTRA 3NTUA 5KKAA 2FOLA 1ATIA 5IAEA 4WXHA 3ZK7A 2WDPA 1TQ4A 1LSUA 2CGEA 2A59A 2WAAA 1MO6A 3BD9A 5A0FA 5AVVA 3AEQB 4UASA 4QM6A 2I6TA 2I6FA 2BGRA 1ORHA 3G23A 4FGLA 3H9GA 5CD9A 2OLJA 3AVXA 3ZHBA 1YKSA 3LGXA 4HB0A 2PU5A 3T3NA 2D0DA 1SVSA 1X7ZB 8AT1A 1Y42X 4YCJA 4B6JA 3CZ5A 2VJOA 1LLFA 3N2GA 1QXSA 3B2EA 3DC7A 1XQXA 3WLAA 1I0ZA 3NBFA 3R6DA 3TQRA 1JW9B 3HYTA 3UK7A 4CRWB 2QB5A 1D2CA 1T9AA 1IVYA 1PT6A 2R9VA 1FQOA 4AULA 2B1RA 3CC8A 4HNRA 3RSSA 2I87A 4NDZA 4D44A 4BBAA 2EX1A 4O6VA 5E9JA 3C3BA 4IQFA 2F6RA 4CLHA 2ZAYA 3M6XA 2BCEA 1ZI6A 2JCGA 2OXTA 4NEGA 5M7EA 3Q41A 2GPNA 3SJCA 2IK8A 1C30B 3LLSA 1T2CA 1I2ZA 2F8LA 1BQ3A 1VMEA 3U9LA 4WAUA 5LP6F 4W5HA 4EVQA 1T2AA 5IBCA 3QXHA 4B2LA 3OT5A 1TX4B 1RJ9B 1RRKA 1U0LA 2CDCA 1YONA 3E3AA 3AY0A 3ZLVA 2GHTA 1KSGA 4XVCA 5JQGB 2R5NA 5HS4A 5JXIA 3T3IA 3QEBZ 2OO5C 1TEHA 2X0RA 4JA2A 3BFXA 4JHXA 4D43A 4HDMB 1LPAB 4H60A 3G59A 1T5SA 1XNJA 3A2MA 2ZYHA 3NVAA 2BISA 2OM2A 3L7MA 4C14A 3VISA 4KTVE 4O4LF 3NJRA 1O7JA 1G18A 4BP1A 2O3RA