3C7AA

A structural basis for substrate and stereo selectivity in octopine dehydrogenase (odh-nadh)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
403
structure length
403
Chain Sequence
TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDVKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDGGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Octopine dehydrogenase
publication title A structural basis for substrate selectivity and stereoselectivity in octopine dehydrogenase from Pecten maximus.
pubmed doi rcsb
source organism Pecten maximus
total genus 107
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2008-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3c7aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c7aA01
1P1KA 5A9RA 4OXKA 4CLOA 3RUHA 4OM8A 5LCXA 4BNIA 1OZAA 5TLSA 1JLLA 5K9ZA 1MGOA 5A05A 1WMBA 4R01A 2EEZA 1WPQA 1LRKA 3PHLA 3H65A 4WOKA 2Q1TA 4HX5A 4WPGA 4YJHB 1CWUA 2Q1WA 1SBYA 1EMDA 2YHIA 1YBMA 1YOVB 3FNFA 4Y6RA 2ZTVA 1GADO 1W8DA 4WCFC 4BV8A 2WEKA 3RFTA 5IDQA 3NKLA 3K2BA 4U0KA 3GH3A 3I9MA 4MP8A 4BNTA 5FYDA 2Y1CA 4IIVA 3LVFO 4B3JA 3L07A 2Y66A 3PWSA 1BGVA 3EZLA 1Y9EA 4D42A 3ADOA 1NVMB 1R4MB 3CZRA 2QZ9A 5MGBA 1MUUA 2IEBA 3F47A 4DC1A 2JCVA 2C7GA 1GZ6A 3ONDA 1O9BA 4TZKA 1P1FA 4BKPA 1HSOA 4B4UA 3OEWA 1EQUA 3AI1A 2F00A 2Z5LA 1O0SA 1PS8A 1F8FA 3TRIA 1AXGA 5CG2A 2AW5A 2HK8A 1GCOA 5T6BA 5JMPA 4KDEA 4OHUA 2Y1OA 3DZKA 4AJJA 3S2EA 1ADFA 3U09A 1H93A 5T8KA 5A5EA 2O23A 3VAZA 3X2EA 4HWKA 2NU8A 4CLHA 4P38A 1EBUA 4ALMA 3AY6A 3CTMA 4GL4A 5EPOA 2GUGA 4GX1A 3N74A 2BI8A 1O94A 4Q3EA 1CEQA 3UCEA 1HDGO 3KEQA 1LSOA 4RLSA 1A72A 5A04A 3QY9A 5HRUA 3GLQA 3R1IA 2B4RO 2CF5A 4WCFB 4I8XA 4TRRA 4IXTA 1UJMA 5JCJA 1TT5B 4B8WA 5A9SA 2D0IA 1OMOA 2JCXA 4FJ1A 4QSMA 3WS7A 4TVBA 1EVIA 1PQPA 3RASA 5KOIA 3K31A 3OJLA 3ROMA 1GZ4A 2VWGA 1LNQA 1N5DA 3OJ0A 1E7QA 4J7XA 4MVJA 1PGPA 3FRJA 1KEUA 3NTQA 1ZXLA 3I1JA 5A1TA 2B36A 3PZRA 1I33A 2H9IA 3ADPA 3AI2A 4XR9A 1GZ3A 5TT1A 5G0VA 3PEFA 2YY7A 4YRAA 1J5PA 3ROPA 3WG9A 3KBOA 2GZ3A 3E5RA 4UVIA 3OJOA 4NBVA 1X13A 5G0TA 4YWJA 4GSKA 4XB1A 2NU9A 3Q9UA 3VPHA 1VJTA 2C54A 3CE6A 4DTIA 1GY8A 3AI3A 5LDHA 3JQ8A 5L51A 4YRBA 4IJKA 3S2FA 4I08A 2PWZA 1N9GA 3WGOA 3L6EA 5ENDA 2C2XA 3GRPA 1YB5A 3SXPA 4AICA 1C0IA 2Q99A 4PLZA 4QO8A 4GBJA 1R12A 3JD2A 4MIEA 1QKIA 3GAFA 2Y1FA 1IPFA 1IHXA 1KVQA 1TT7A 2CF6A 2BRUA 3JQBC 1FDWA 4GX2A 4Y6SA 4BQRA 2D8AA 1VSUA 2CMDA 4FFOA 3VVCA 2DLDA 2G1UA 5TC4A 2HCTA 3SJUA 4FQ8A 3I6IA 2PZMA 3HB4X 1DRWA 2JKVA 2YV2A 3PVZA 3K5PA 2IZ1A 4EEXA 3OETA 2CVZA 2D1YA 5U1PA 1JAYA 4KZPA 5EQDA 1T1RA 3JQ9A 3A9WA 1AHHA 2DAPA 3ZW8A 1JW9B 2X8LA 1F8GA 4OO3A 2H6EA 3GGOA 3LLSA 2YDXA 3BIOA 3INGA 4OKNA 2NU6A 1V35A 1JN0A 2ZYGA 3S2IA 1AN9A 4FFPA 3QLJA 3IIEA 1U2GA 3MOIA 4PLFA 3VPGA 2VT2A 3FCOA 2W4QA 5JNLA 2W8ZA 4J91A 5THQA 2DM6A 3HDQA 2B4QA 3EAGA 3K8ZA 2EWMA 2UVDA 1WW8A 3HZZA 2GO1A 3KSDO 5G0SA 2V6BA 3SC6A 3VKVA 4IMPA 1R15A 2AE2A 2E37A 3E1KA 4J9VA 4IXWA 3E18A 1NPDA 5I7FA 5H81A 4YJGA 5T64A 3PDJA 2PH5A 3BTVA 3LSYA 3JQAD 1PSDA 5GMOA 4OOFA 5TT0A 3AJRA 5G4KA 1ZUD1 2X86A 5I8WA 2VOEA 4XDYA 3O4RA 2VHYA 4IQGA 2AG5A 3Q2KA 4LMRA 2JFHA 5L9AA 3NTOA 2Y1EA 1ZK4A 3IP3A 5BSGA 1HZJA 2BH9A 2XXBA 1IYZA 1LQUA 2DVMA 3EC7A 5TSDA 3HDJA 3JQGA 5MDHA 1GPDG 1SC6A 3MJEA 3M2TA 3RUCA 1B7GO 2CDAA 4XDZA 4ND1A 4RGBA 4TWRA 2BLLA 2BMAA 2Y67A 3FHLA 3VPFA 4EITA 2O4UX 4K6CA 2VTDA 3ZV4A 1TEHA 3IL2A 4CMAA 3WTCA 1KC1A 1TB4A 2VUUA 4BNFA 5JCJD 2Q2QA 4FB5A 1H0KA 2UDPA 3AOEA 4PLGA 4WKGA 3IP1A 4BO9A 3G3EA 1BVRA 1P1JA 3BZUA 3PZBA 2BFOA 1E3WB 1ZJZA 2OFPA 4AJPA 4CL3A 4B3HA 3FTNA 2PD4A 1VSVA 3M1AA 2AEMA 2YZ7A 1ONOA 5I9LA 2HRZA 3GEGA 4L74A 4MVJD 4Y6PA 2PGDA 3H9EO 4RQUA 1D7OA 4QFCA 5FI5A 2HRBA 5TX7A 4UUPA 5EL0A 1HE4A 1UZMA 3DONA 1P33A 3GN2A 1T1SA 1LSJA 2Q2VA 1MLDA 4MO2A 5GY7A 4XQCA 1GEEA 3V2GA 1GD1O 4W99A 1YOVA 4BIIA 1PJ2A 4CMBA 3NDIA 1Y5MA 5HM8A 4B4OA 5DZSA 3GZNA 4GLOA 1FDTA 1I2BA 3NJ4A 3DZJA 4O0LA 3W1VA 1KIFA 4M86A 4J7CA 2DTDA 1D8AA 3SC4A 3WLEA 1NX6A 2J5QA 5L53A 5IG2A 3KSUA 3DBVO 2X5JO 4YPOA 2Q50A 3I9OA 3RC7A 3C7AA 4JGBA 5EIOA 4CM9D 1EK6A 4PLCA 3ETGA 4RPLA 3U49A 1R4MA 3I4CA 3W4KA 2FN7A 3UGKA 4DGSA 5B12A 3BA1A 3DO5A 3CTVA 2POQX 3TZKA 5GZ1A 4OJNA 3M1LA 4PRLA 1GYRA 1PTJA 2X9GA 2XPCA 3D0OA 1NHWA 5F1KA 3BHMA 3PPIA 1BRMA 1DIRA 4XR4A 4NG5A 1B2LA 2P5UA 4E2YA 1XIVA 2FPIA 2ZKLA 3WMXA 2SCUA 4CMJA 3N7UA 4JXKA 1I3MA 4Q39A 3DL2A 4DRYA 2FR0A 4W9NA 1N92A 1QV7A 2EERA 5IAAA 3WB9A 3BHIA 4JNKA 4ID9A 3D3WB 4E21A 3RUIA 3GHHA 2WD8A 2AXQA 1O89A 3HSKA 5DOVA 1Y8RB 2CUKA 3KV3O 3OBBA 4MIOA 1HDRA 3JTMA 3EHEA 2GR9A 5IDYA 5IN5A 4Y9DA 3JYQA 1PEDA 2W2KB 3BMQB 3AU8A 3PI7A 1T2FA 1QLHA 3F5SA 1TVEA 4XKJA 2I99A 4A73A 2VN8A 2CZCA 3H8VA 4ALKA 4IY1A 1R0SA 2HQ1A 5A3JA 3WFJA 4H7PA 2FHSA 1I24A 1TT5A 2AEJA 3LC1O 5KTKA 3EK2A 1GUZA 2WE8A 3H5AA 1R16A 2IDZA 3L0DA 4BUCA 1ADBA 4W4TA 1KOLA 3DTTA 5ITVA 5IZ4A 4QUKA 1QYWA 1AE1A 1P1RA 1IPEA 5DBGA 4NHEA 2HMWA 1T2EA 3TOXA 1HDZA 3D64A 4DVJA 1H94A 1Q2XA 1E7SA 2PA3A 2PNFA 3ABIA 2Q46A 4N18A 1VC2A 4I1IA 1HETA 3V1TC 5BNIA 4YRDA 4I5DA 3NJ8A 3PLNA 3LT2A 3OJFA 3PWZA 5DBIA 1GV1A 4GX5A 1ZZEA 3HFGA 3KRTA 1V9LA 1ZBQA 4IBOA 5H83A 4UEOA 5IZCC 3PYLA 1EVZA 1KETA 3BMOB 3PHGA 3WIEA 4N5NA 3JQFC 4OH1A 4PZDA 5A02A 2AEFA 4U6QA 5L7WA 3PQEA 2ZTUA 2D5AA 2JFFA 3DQPA 3GDOA 3QIVA 4RORA 4WECA 5IDXA 2JD2A 4GQAA 3MJTA 4FCCA 5TNXA 5B1YA 2RHCA 2GDZA 3QWBA 4MVJH 2XF8A 4PZCA 3ZN2A 1DIBA 1YB4A 3BHJA 5COBA 1WDLA 3S2GA 4HADA 1EE9A 5F1PA 2Z1NA 3OSUA 3TZHA 4A5OA 4OKIA 4BL5A 3U5TA 4MKZA 3OH8A 3RJ9A 3ORFA 3GMDA 3QE3A 2PD3A 2ZYAA 4FOOA 3H2ZA 3D4PA 2VRBA 5AXDA 4QTZA 4XIYA 3U4IA 1SMKA 4KWHA 3OQ1A 1C14A 1KY4A 4IDBA 2WYVA 3UN1A 3JCZA 4BQPA 2ZATA 5BT9A 1X7DA 3C7DB 1ZVMA 2YJZA 5DCWA 1C0KA 4CM1A 5CDSA 4BB5A 1RM0A 1H5QA 3HHPA 4XYGA 2JFGA 4BS9A 5CHEA 1NWHA 3BMCA 3KYBA 3PK0A 1YRLA 3GPDG 4CV2A 2EP7A 2PZJA 4CUJA 2HK7A 3ZZNA 1DRUA 3WNQA 3GN1A 4IDFA 4C7JA 2H5LA 4E5MA 1Q1NA 2DTXA 2YHUA 4F6CA 3DHEA 3ANNA 4FGSA 1PZFA 1Z7EA 4RPKA 3H3FA 2BF7A 2PY6A 2RCYA 1PJCA 1MX3A 4Q9NA 1X0XA 3KTDA 3RWBA 2F1KA 5EN4A 3RI3A 2EKQA 2PTGA 4XYMA 1F06A 5C7LO 2FZEA 4E0BA 2X5KO 2Y0DA 4XYLA 4FBGA 2NWQA 1LLUA 4U5QA 1MXFA 4J2OA 4JQCA 4L75A 4XQ9A 2UAGA 2UUPA 1Z7BA 1CDOA 2Q2WA 2VUSA 2QZZA 2X4GA 4BNXA 1DBVO 1VL6A 2WMDA 4YJFB 2DFVA 4BNJA 1Q0QA 2J5KA 4BKOA 1CETA 1GUYA 2G76A 2RH8A 5I8ZA 4AJ2A 2VRCA 3DBLB 1ISFA 2GF2A 4UVGA 1UAYA 3WBFA 5B4TA 2ZQYA 1HYGA 2XAAA 4FFLA 1L7EA 1VJ1A 2QYSA 4Q3CA 4NJMA 4RVFA 3AUTA 1P9LA 4XEHA 3TPCA 3NYWA 4DPLA 4HV4A 1A9ZA 3AFMA 2PLAA 1CRWG 4GWGA 1YS4A 4DPMA 4RDIA 2E48A 4YT5A 4PLYA 3FWNA 1EEHA 4EBFA 5L45A 1GQYA 2ZTLA 3QWHA 3ZH2A 4XGKA 4CQLA 3ZWXA 1RM5A 2PZLA 4Z6KA 4HFRA 2GYYA 1FDSA 2RAFA 3DZHA 1E3WA 4PRKA 1RM3A 4ITUA 3ST7A 1D1SA 3F5QA 1N7HA 4ALIA 4LISA 1H6DA 2OUIA 3EMKA 4DWVA 2ZB8A 3ZWCA 3L9WA 3D4OA 3F1LA 3JD1A 4LCJA 1NPYA 4F46A 1NBOA 2X9VA 2OHXA 1AUPA 1DHRA 1IY8A 1XELA 4FW8A 2CY0A 1DLJA 4FJ2A 4HFNA 3UF0A 4E5YA 4A03A 3UCFA 1B8UA 3ZNNA 2I5PO 2P91A 3HNPA 1MV8A 1HRDA 1NQTA 1ZKMA 1YQXA 2PZKA 3TDKA 2O3SA 4L4XA 4IDEA 5BNTA 3I3OA 3U62A 5DOZA 5KVCA 2GD1O 2RHRA 3CMCO 3AM5A 1LDGA 5T67A 3DHYA 4ZQFA 1SEVA 4BNLA 5F1OA 3E82A 5B37A 3IOYA 1YVEI 3TFOA 4H16A 3OM9A 1ISMA 3WLFA 1WXDA 1YB1A 2B0JA 2JHFA 3OECA 2HMUA 2OP0A 1BXKA 1P3DA 1GCUA 2BKAA 4KQXA 2D2IA 5B4VA 1DC3A 2QG4A 4BNWA 1OC2A 3SVTA 3E03A 2PH3A 2YFQA 3AK4A 2O3UA 4B3IA 3RC9A 1TA4A 4M87A 4JP2A 1P1IA 4ALJA 5BR7A 5KNLA 1B3BA 1DIHA 5COQA 1GQQA 4M1QA 4BNKA 4KP7A 2WYWA 1ONNA 3QP9A 2FPGA 4PGFA 3GC6A 1RYDA 3D3WA 3GG9A 3I9JA 4GVXA 2A92A 2PKQP 2YFHA 4OYRA 1KVUA 3GNQA 3VH1A 1Y8RA 3GRKA 2GN4A 4O1MA 3TNLA 5BSFA 3C7CB 4PG6A 2FSSA 3SBOA 2Y0EA 4CV3A 2W2KA 3AWDA 1ULSA 4R3WA 3GUYA 3SLGA 3DC2A 3ZV3A 4LVUA 1VLLA 5KJCA 3BMNB 5JBIA 4NBTA 2PGJA 3LT4A 3GHYA 5J23A 4ZRNA 4J1NA 1OFGA 1R4NB 3ENNA 4IDGA 4BNMA 1DFHA 2CDBA 3WSWA 2QX7A 4CUZA 5KWEA 3NDJA 3DOJA 4ILKA 4BGVA 1FK8A 4WLOA 2VWPA 4JIGA 3U4HA 4K9DA 4A27A 2WJPA 3MJVA 4E33A 1U5CA 3F46A 3JQEA 4NH4A 4PVDA 3Q11A 4E2ZA 4LMPA 3DBHB 1DOHA 2PKQO 1TI7A 3O38A 2B35A 3GVXA 2A9FA 4G81A 1XQ1A 4IS3A 3ETDA 4ZVVA 4DBZA 2HAEA 1E7WA 3CIFA 2VRCD 2GERA 4L73A 3RAJA 3V5NA 4KDFA 1NYTA 5AYVA 4MVJF 3OQBA 3D4NA 4J1SA 4XGNA 5DULA 1P1HA 2TMGA 3H2SA 3QA9A 1HDXA 3BMOA 4M54A 3AUSA 3DB2A 3AM4A 1M6HA 1GAEO 3GA0A 1BW9B 4LSWA 1YO6A 2GN8A 1DC5A 4MVJP 1JA9A 4R69A 1ML3A 4B7UA 1LLCA 4OQZA 2QQ5A 4U0JA 4DPKA 3VKUA 3PLRA 5IN4A 2DBRA 4O6VA 4DQUA 3H3JA 2C29D 2A4KA 5FF9A 3DBRB 4ZQGA 3ASVA 3GVPA 3WBBA 2I9PA 4KUEA 5KJ1A 3ULKA 1XKQA 1ISHA 2VWHA 4UULA 4RF4A 3JQAA 1B26A 2VZ9A 5JO9A 4BVAA 4OIMA 1X1EA 2AA3A 4CL8A 4EJMA 4DC0A 3S1LA 3BTSA 4ND4A 3R3SA 4E3ZA 1NASA 3PJDA 4AL4A 1UXJA 2NM0A 3LC2O 1Y9AA 4B7XA 1E3SA 3DAFA 4QFDA 5EMHA 3IJPA 1KBZA 2BD0A 2JAHA 3TWOA 7MDHA 1LXCA 3GEDA 3ZU4A 1L7DA 1FDUA 3ZI0A 2QYTA 3HWRA 2B83A 1UXKA 3QSGA 4INAA 4R1UA 2JL1A 1F14A 4WLUA 1SO8A 5K6AA 2Y05A 4TRJA 3DMTA 1UXGA 3T4EA 4UVEA 2CFCA 1C0LA 2DBZA 3ZCXA 1ZK1A 3ZNPA 4ALNA 1MXHA 2IXBA 1YH3A 4BO4A 1DIGA 1G0OA 1LEHA 3MJSA 5JO0A 1HLPA 3ZV5A 3GVHA 2C7VA 3GNSA 9LDBA 3OP4A 4BO0A 4ZICA 4N7RA 2QRLA 4MVJE 1H6BA 2OZPA 4NZ9A 3JYNA 1SNYA 4R41A 1RJWA 4UEJA 4EEZA 4FC6A 5CDGA 1B8PA 4NI5A 1K6XA 2O2YA 4PG5A 4RVSA 4L9RA 1DLIA 3PIDA 4YJFA 4L8VA 1ZIDA 4AJ1A 3WIDA 1ARZA 1R0LA 4XQEA 3DBLA 4DLAA 4BNGA 3PHIA 3KUXA 2FZWA 3WOHA 4D43A 1JVBA 1IULA 1NXQA 2B4TO 4URFA 3RKRA 1GYPA 1LDNA 1M6WA 2I76A 4WLFA 4QEDA 4Y8VA 4Z9XA 3C3XA 3HE3A 4HXYA 3ICPA 3SJ7A 3RQSA 1NQAO 1YBVA 2TMDA 1EE2A 1CF2O 1LSSA 3RFXA 2X7HA 3BAZA 1P44A 4JCOA 4J2HA 3U3XA 1DAPA 4WEQA 2EG9A 2GLXA 4PIVA 3HADA 1IUKA 3C85A 1DEHA 4CM9A 1PJ3A 1GR0A 3OQ6A 3OIGA 2P9GA 4PLHA 1LLQA 4MOWA 3TQHA 2NTNA 4M8SA 4XGIA 4XZ3A 4EDFA 2NTJA 2JAPA 2A35A 5AVOA 4IQ0A 3EVNA 3CXRA 4AJLA 3GY0A 3JQ6A 4M89A 3M6IA 4HKTA 4GX0A 1KVSA 4RPGA 2WSBA 4FGWA 2NTVA 1U3WA 4N5LA 2EW8A 4Z3DA 4BKUA 5DCUA 2JD0A 2QIOA 5CDYA 4HY3A 5KVSA 3WJ7A 1PX0A 3MWEB 4QX6A 3H9GA 3P19A 1PJTA 1V0JA 1UH5A 5U4QA 1O8CA 1DJQA 1ZMOA 3HB5X 5CPFA 1W4ZA 4MDHA 4XX0A 3ZWPA 2IEDA 1E1NA 1VL8A 3F1KA 3PDUA 1PQUA 4CMGA 3WXBA 5LC1A 4UEKA 4BGEA 3PGXA 2FY8A 3B1JA 1HL3A 1ID1A 4Z3KA 3WGQA 3IQDB 4WK6A 3FR8A 4NK5A 4XRGA 5I9NA 4D3SA 1Z74A 2X23A 1K2WA 4JP3A 2GN6A 3KO8A 3L4BA 3NT5A 4W82A 1C1XB 4GSLA 4J3FA 1VJ0A 2HSDA 3VTFA 5I7SA 1DO8A 4J1TA 1EFKA 1DC4A 1XDWA 3HJAA 5JSFA 2P5YA 4N54A 3ONFA 3ZHBA 3FD8A 1F17A 1MC5A 4J16A 1QORA 1Q7BA 4O5OA 3RC1A 4BMSA 1CIVA 4BO2A 4CLEA 3MJ4A 4ZGWA 2I3GA 1XR3A 3GEMA 1PIWA 2HJSA 4R54A 1LC0A 1ISGA 5JDCC 4OSPA 5FI3A 3VZSA 3NGLA 1OOEA 3TOZA 3V1YA 1DSSG 2EJWA 1LBEA 4XQGA 1J0XO 1KEWA 1BSVA 1X1TA 2UUOA 2JCYA 3CMMA 3ANLA 3BMNA 3HDHA 5IDWA 3JV7A 3R6DA 2J3JA 3GMSA 3S55A 4QQRA 1RYEA 1PZHA 2LDXA 1DHTA 3RD5A 1JTVA 3NRCA 3RKUA 3KM0A 4F45A 4P4GA 4CJXA 4D41A 2IODA 4J0FA 1HZZA 1E77A 4CMEA 4HP8A 1DAOA 4YEDA 3DBHA 1T4DA 3EW7A 4OQYA 4P22A 1H2HA 5A5FA 4PG4A 3CINA 2H63A 2HUNA 1JKIA 5CDTA 2VHWA 5L7TA 3MEQA 4XYEA 3TZ6A 3GT0A 4YJHA 4HFMA 3G79A 1C3VA 2IZ0A 3KOUA 3QQPA 5KJ6A 1GEGA 5JAMA 3WDSA 4PCVA 4JROA 4II3A 3OFSA 5ITWA 4D7AA 3ZWVA 3O8QB 4YBZA 4E5NA 2EP5A 3G49A 4DUPA 1UUFA 3A28A 3PYXA 3GFBA 1I2CA 1XCBA 2YYYA 3IMFA 3WJAA 1ENYA 4DQXA 2CVQA 1LDBA 1WVGA 5TGDA 3ZU2A 4DYVA 3E9NA 4UUMA 4Y67A 3WR5A 3RJ5A 3VC7A 3DWFA 3A14A 5G4LA 5GZ3A 3DBRA 2C59A 5KKCA 1W0CA 1T2AA 1YQDA 2VYVD 3RU9A 3KETA 3WGTA 4ZJUA 4OMUA 3KSZO 4UVHA 1SB8A 1ENOA 1U4SA 1GDHA 1PQWA 4GMFA 4AJKA 5ER9A 2IE0A 1E1MA 1K0UA 3ZWNA 5L4NA 3W6UA 2I6TA 3P7MA 1OBFO 5DN9A 3RROA 3TZCA 2UV8A 3FN4A 4KQWA 1SAYA 2OGUA 5AQ1A 4RVHA 2I3AA 3LU1A 4ESOA 2J3HA 4GVLA 1KY5A 2I66A 3ZWOA 1A5ZA 3QV1A 5ICSA 2Q4EA 4DBVO 3PGJA 1I3NA 3E9QA 1DDOA 4B7CA 5CP8A 4UREA 4IMRA 4WCFA 5TQVA 1QYVA 4I5GA 1A4IA 2XOXA 1X0VA 3JQ7B 1U7HA 3P2OA 1VE9A 5G0WA 3GPIA 1ULUA 1VKOA 1BDBA 1KC3A 1EDZA 1KVRA 2X0NA 4LRSB 2BI7A 3ETEA 4R3NA 4XB2A 3RU7A 4PN3A 4M49A 5A9TA 1LC3A 1VRWA 2ZTMA 4LW8A 3N58A 3EUWA 3KXDA 3A1NA 2CVOA 3MTJA 3IUSA 4J6FA 4JK3A 3W4IA 3QVWA 1ENPA 3RVDA 1RWBA 3GNTA 4MVJM 4CQMB 4NBRA 3EVTA 3K6JA 1B8VA 4IPTA 2OMEA 2X0JA 2O2SA 3SX2A 1A9YA 4ZHSA 2PV7A 1MA0A 3D1LA 4D0SA 1E7RA 2OP1A 4WGGA 4J7UA 4LVCA 4NU5A 2HMSA 3LT0A 3RFVA 2Y99A 4MVJG 3IJRA 1XWFA 3FNGA 1PL6A 1LLDA 1LQTA 5C7IO 5T8KC 5CG1A 4CLOB 4J49A 2AQKA 4XYBA 1N1EA 4LGVA 4CMCA 4I9NA 4RJTA 2B5WA 4O59O 1LU9A 2P68A 3OMLA 4AJHA 3OHSX 3ZWBA 3F9IA 1TLTA 2EGGA 2P9CA 1U4OA 3T7EA 1QXSA 4TZTA 4IZIA 4TQGA 5JMWA 1Y6JA 4L76A 1QRRA 3CEAA 3W8DA 1UXHA 4BV9A 5JYEA 3W6ZA 5JW6A 4XWYA 4HNHA 2IYOA 2D5CA 2GASA 4FDAA 4ZRMA 2ZYDA 2DBQA 1X7GA 1Z73A 1LSUA 5IJZA 3FTPA 1K89A 5HS4A 4J43A 4E6PA 4RCVA 3INRA 4FOSA 3KB6A 4CM6A 4AG3A 2PK3A 3EY4A 3ZHZA 3WTBA 5DNAA 5ILOA 3EGOA 4X54A 4W7IA 4YTEA 4I5EA 4O63O 5AOVA 2AG8A 3C24A 2R6JA 5U9CA 4BMNA 3PFWO 3WMWA 4DMLA 1QG6A 3WGHA 1F12A 2HO5A 1A7KA 3PJEA 3ROQA 2ZIZA 4YAJA 1WDMA 4ZQHA 4TVOA 1ZFNA 1UDCA 2FPPA 4A7PA 2VHXA 3WNVA 3F4BA 3IDSA 3QVTA 1GQ2A 4HUJA 4B4VA 1U1IA 2AE1A 3FSRA 5CEJA 2FR1A 4P4NA 3L6DA 3KVOA 3GDFA 5L7YA 3NAQA 3H4VA 2P4HX 2R2GA 2NVWA 5ENVA 3GFGA 4QECA 4RVDA 3WQSB 2V7PA 1ISJA 2Q4BA 4YB8A 5ILGA 1WLYA 3O26A 3HQ4O 4JJIA 2EHDA 1C1XA 1N8KA 1PWXA 2C5AA 2X6TA 1ZW1A 4H15A 3V1UA 2WWRA 4UUNA 3GAZA 1JKJA 4DREA 2O3QA 4D3DA 1I8TA 1YL7A 2X1HA 4UVDA 4PFJA 1GU7A 2ZQZA 3JQBA 3TL2A 1YE3A 2CNBA 4AJNA 3TFQA 1HKUA 4GWKA 5KVQA 5T5QA 2QRJA 1YJ8A 5BSHA 1E92A 3JQ9C 1LDEA 4IDDA 2BGMA 1UZLA 4U6SA 2O3TA 4FPXA 1HDOA 2CSUA 4U8GA 4GH5A 4R5MA 1ZNQO 2OL4A 3L77A 4NPCA 4CLXA 6ADHA 1MFPA 1PJQA 2VNSA 1EDOA 4RF3A 3Q3CA 4TRMA 1EUDA 1XLTA 3T4XA 1BXZA 2AQHA 5THKA 2AMFA 4IS2A 4R4JA 5ER6A 4CV0A 4HFJA 4G65A 4U7WA 4TSKA 4ZN6A 2O3JA 4EI2A 4NIMA 1PS0A 2VYND 3GVIA 5A03A 4BMVA 1N1GA 2XXJA 1RKXA 1LJ8A 1NHGA 3QVOA 4RVUA 4CM5A 4S3MA 3JQ8B 3E9MA 2GZ1A 3AY3A 3CPSA 3DHNA 1KVTA 3V2UA 2PD6A 3OEYA 4BNHA 3E48A 4GPD1 4IGEA 3MWDB 3P2YA 1ENZA 1DC6A 4FFRA 1F0YA 4GLLA 1PR9A 4DIOA 5JC1A 3Q9NA 1JQBA 1NPTO 4IJUA 5HA5A 1B3RA 1ZSYA 1SPXA 3L9XA 4KTVE 3O8QA 4RO0A 5EJ2A 2NV6A 1PGQA 1NQ5A 2PKRA 2IRWA 5TJHA 3VZQA 4BO5A 1AHIA 2C2YA 4GI2A 1PL8A 1ZCJA 4LRTB 2V6MA 3I9NA 4XJSA 5DDIP 4BO3A 4BNYA 5TIIA 1UR5A 1P74A 1SB9A 2VOJA 2ZB7A 4A2CA 4BO8A 4A0SA 4MKXA 2D59A 5LDGA 2DQ4A 4CMIB 4H3VA 2D4AA 1DRVA 4I9UA 1ZK2A 2P4QA 2NQ8A 5CFZA 1SOWA 3PWKA 3AOEC 3FI9A 3ZV6A 1T4BA 1DJNA 4MP6A 4L0QA 1ISIA 5DP2A 4OXNA 4D0RA 3M2PA 3BTUA 4RF2A 1B0AA 2VUTA 4WEOA 3PYMA 3DOCA 3INTA 3PIIA 3JD4A 4J1QA 2JD1A 4LCEA 2Y68A 3P5SA 4DLBA 4PLPA 1EVYA 4PLTA 5L40A 3PFFA 3VTZA 3K9QO 1DFGA 2AQIA 5CEFA 3GR6A 3QWAA 1HYEA 1GV0A 4YJGB 4KUHA 1Y7TA 4JLWA 4DYDA 1PZEA 4XCVA 2YDYA 4YT8A 4A26A 1NAIA 3G1UA 1O6ZA 3GDGA 5CPBA 3UXYA 2DPGA 3BMQA 4TKMA 4P8RA 5JAZA 5JFOA 2OBNA 2J6IA 4DMMA 5IFLA 1YQGA 3WQRA 2Y93A 5BSEA 3W8FA 4YAIA 4DLLA 4KUGA 3B70A 3EZYA 1ADGA 2PFGA 3WGGA 3JQ7A 3JQGB 4J9UE 3RUDA 1ZH8A 3FPCA 5JS6A 3ZU3A 1P77A 1MC4A 2HU2A 2G0TA 2P9EA 4A10A 4DA9A 3K73O 1OC4A 2O50A 1U5AA 1DXYA 4EGFA 3NTRA 1KERA 4P4LA 4PG8A 4CQMA 3ZDFA 1H6CA 1YL6A 2QW8A 3TL3A 4EUHA 4WJZA 4AFNA 1E1LA 1RM4A 1D3AA 4NJOA 1H9AA 3LQFA 4II2A 2NQTA 3E8XA 3VPSA 3ITDA 1JDJA 4HNGA 1E5QA 4W9NC 4RDHA 4NMHA 3HFSA 3OIFA 4C4OA 4YT2A 3RSHA 4E30A 1A27A 4CM3A 1I3LA 1HF3A 1PJSA 3ZWMA 4CMHA 3GGPA 2NACA 4DIBA 1U8FO 2NVUB 4RVGA 4Z0TA 3RBVA 1LA2A 2AQ8A 2AHRA 3GZ4A 5JXWA 5JCXA 4BNNA 2Q45A 4FJ0A 2Q1SA 4FD3A 3DAPA 3U4DA 3FNHA 3ZNOA 4CR7A 3GK3A 4AJOA 1U8XX 1ZSNA 3BYZA 4FSHA 4PZEA 4YYZA 1V3TA 5AXCA 4YJDA 5JYDA 1YONA 3DZIA 2FWMX 3GZNB 4Z0PA 1I5RA 3H5NA 4YVFA 2OO5A 3QWIA 1A71A 2P2SA 1U28A 2J3IA 3H9QA 5F21A 1IL0A 2HMVA 3C1TA 4EW6A 3DAGA 4I5FA 4BKQA 3C1OA 3DOOA 4E12A 3FF4A 1HXHA 3GOHA 1J4AA 1JAXA 2BFAA 1IOLA 5COAA 4ZD6A 1J49A 4YQZA 1QLJA 4MKRA 3RUEA 1YBAA 4W7HA 3Q6IA 1HE5A 5C37A 1E7YA 1P0CA 1XGKA 2V65A 4FC7A 2NSDA 2GPTA 1QR6A 5JY1A 4IINA 3OICA 4FFNA 4DXHA 2R00C 5IZCA 5B4UA 1Z6ZA 1P45A 4MJLA 1EQ2A 3CH6A 2E4AA 3AUAA 1Y1PA 3JQFA 1Z82A 4L4SA 4DQVA 4E4YA 3JYLA 3I5MA 4WUVA 3NEPX 4YACA 3RIHA 4K6FA 3VZRA 2RH4A 3I83A 3Q1LA 2PGLA 3V2HA 4E32A 1E7MA 3QVXA 4XIJA 4CMKA 1FJHA 3W4JA 1K6JA 4BO1A 3W8EA 1AXEA 2DKNA 1C1DB 1ZJYA 4IDCA 3QRWA 3OIDA 4QT0A 2E6UX 3AY7A 1D4FA 1YWGO 4XD2A 3E6AA 4WCDA 3WGIA 1KS9A 1N7GA 2GN9A 5K0ZA 1FDVA 4S1VA 3WICA 4IQ8A 3I9LA 3L4SO 3K2EA 4K26A 5ICMA 4RL6A 1T25A 4Q3BA 4Y98A 4GAEA 2DU8A 3H9UA 3IAHA 3I4FA 5I7VA 3JD0A 1XU9A 2FMUA 1LDMA 4MIYA 4OOEA 2EF1A 2DPHA 1EVJA 2O48X 5EQFA 4BOYA 1M75A 5TS3A 1ZEMA 3ZHYA 4G2NA 1UZNA 4ONEA 1NFQA 4IJWA 6LDHA 4ND5A 2Q1UA 1X7HA 1ZO8A 3G17A 2RIRA 3NT4A 1XSEA 2IXAA 5L3ZA 4B79A 3JSAA 3DZBA 3RBXA 4NQZA 3JYOA 1HSZA 1HE3A 4D45A 2W98A 4JJGA 4NFSA 5G2OA 1H6AA 1NTOA 2VYVA 1PGNA 4Q3AA 3BXXA 1E3JA 3HN2A 4CQMD 3I23A 4PVCA 4AVYA 1W6UA 2G82A 1LRJA 2OORA 2X9NA 1NWCA 1QYCA 4MPDA 1TXGA 4TROA 2IYPA 2VQ3A 1BWSA 4YAEA 7ADHA 2Z1MA 4YR9A 1ZK3A 2JJYA 2PR2A 1KEVA 5EERA 3CKYA 3DTYA 3VDQA 1HDCA 4KWIA 2NVBA 2WYUA 1AGNA 1LI4A 2ET6A 2QHXA 1I01A 3PP8A 3ZHXA 2GZ2A 5DT9A 1SZJG 1R37A 2B69A 3HN7A 4PLWA 2O4CA 4IJVA 4CODB 5C5IA 4Z9YA 1N2SA 1QV6A 2HJRA 4WLNA 4AJEA 3ZWYA 4BO7A 1O95A 4MVJI 1VI2A 3L6OO 5I9MA 2GNAA 4BKRA 2HDHA 4CMIA 1PS9A 1EK5A 1PGOA 1LDYA 1BG6A 1LTHR 3BMCB 1HLDA 2Y0CA 1DFIA 2J8ZA 4UUOA 5FFFA 3R0IA 3FBGA 3OA0A 1ZXBA 3RBZA 3FWZA 1E3IA 4WLVA 1I30A 3BTOA 1WMAA 4Q3NA 3DZFA 3ROKA 4F6LA 4R1SA 1E5LA 1ONPA 2BHLA 2EV9A 1I10A 1RPNA 3KHUA 4RZIA 4OL9A 1UAGA 2HK9A 4C7KA 3IKVA 4JX8A 1OAAA 1GPJA 2OBYA 3LDHA 1KEPA 3UAGA 1SEPA 2J5RA 4RPHA 1I2ZA 2Q3EA 2BGKA 2YQ5A 3LF2A 3LK7A 5HBRA 4BO6A 1KYQA 2DUUA 2GGSA 2ZJ1A 4B8ZA 1P31A 2CD9A 4IIUA 4KMSA 4NFYA 3WSVA 4EZBA 1NFFA 4W6ZA 2EIHA 3UUWA 4CPDA 1CQJA 3KYCB 2E82A 1SOVA 4BGIA 1QP8A 3ONEA 4EJ0A 2W90A 1R4NA 2B37A 5A06A 3FPLA 3ICCA 3SLKA 4JBGA 1PR3A 4JBIA 4Z0HO 1Y8QB 3B1KA 4ZQEA 4FN4A 4OXYA 4E2XA 3U9LA 4FIZA 4NJMB 4CLDA 1JU9A 3AUUA 5JE8A 3PHHA 1UDAA 1Y5RA 2X58A 1H9BA 1UP4A 5TJ9A 3UKOA 4CLRB 1G0NA 2CDCA 3ENKA 4J4HA 3VDRA 1YJQA 3JQCA 3NT2A 4K1LA 3O03A 4R1NA 1PL7A 1FF9A 1NR7A 1BXGB 4B4WA 3K92A 3U0BA 2C82A 5DF1A 1YL5A 4YA6A 3DEYX 1FMCA 4R9RA 4WNIA 2DUWA 3TN7A 1BDMA 5A3VA 2WD7B 4CQLB 1SCUA 1CYDA 3QW2A 1NP3A 4M55A 1Q7GA 2VTEA 1BW9A 3H9JA 1V3VA 3CUKA 3OA2A 4RLHA 2VWQA 3AU9A 1YDEA 4CV1A 5F5LA 4FFMA 4MINA 2NVUA 1D1TA 2Q49A 3VH2A 4BHTA 1GFSA 4OSOA 3X2FA 1Q7CA 3IKTA 5L4SA 1C0PA 4CM4B 4RQTA 3ZNQA 3NGXA 5AXBA 2HLPA 4Z9FA 3UW3A 1NFRA 3KYDB 3LLVA 5AXAA 1K6IA 3PRJA 1PJ4A 3VZPA 4R68A 2EXXA 3WX0A 4IM7A 1XEAA 2BFMA 3F6YA 4Q3DA 4TMFA 4GKVA 1LX6A 1IZ9A 2EGHA 3RC2A 3IC5A 2ZB3A 4QO7A 2GCGA 3VPXA 3ZWAA 1EBFA 2BGLA 4GMGA 5DP1A 5HTOA 3D3EA 1IZ0A 4L4RA 5JDIC 1BTOA 3F4LA 3TJRA 1WDKA 4XJTA 2EJVA 4G5HA 1V8BA 3SEFA 3TSCA 5F3RA 1CJCA 4IDAA 4YDRA 1A7AA 1ORRA 3NDRA 1T26A 3STHA 3PQDA 1PZGA 8LDHA 1P0FA 1XU7A 3ZGYA 1K3TA 2FSVA 5KIAA 2A94A 2ZJ0A 3HUDA 3VOSA 2D3TA 1WNTA 1G1AA 2YV1A 4IUYA 2O7SA 5FWNA 2X0IA 4RF5A 2Y1DA 3WWYA 1XHLA 2YQ4A 1A4UA 1NNUA 1I0ZA 2FR8A 2BFPA 2H1SA 4D46A 1U7TA 5C3MA 4BGUA 1E6UA 1ZMTA 3QJ5A 1T2DA 3JQDA 1MP0A 3GG2A 3GVCA 1B16A 2V6FA 1V3UA 4HBGA 2VYNA 4N5MA 4MP3A 1M67A 4J0EA 2VZ8A 5JLAA 1E3LA 3KLMX 1NAHA 1B14A 1C1DA 3PHJA 3OF2A 3RUFA 4CM8B 1DIAA 3A4VA 2UYYA 3G0OA 2ZB4A 1EFLA 2GSDA 3WYEA 1R6DA 1Q0LA 2NUAA 1U3VA 2VZ0A 5KCZA 4YCAA 4J90A 3A06A 3WFIA 1WWKA 4AJ4A 3PQFA 3RUAA 5T57A 1NVTA 1HTBA 1S7CA 4RPJA 4GGPA 1ZK0A 3R3JA 3I6QA 1NVGA 2WTBA 1FXSA 4EJ6A 2ZCVA 3DFZA 3O9ZA 3LYLA 5EESA 3RCBA 1JKFA 4E5KA 8ADHA 5K6AC 3KZVA 1XA0A 3DMTC 2VHVA 1U3UA 2VCYA 1NQOA 1Y81A 4YT4A 3FR7A 4OGWA 5FEUA 1HWYA 1E6EA 4R16A 1X15A 2YHIB 2YV3A 3UCXA 3GQVA 2RBEA 1EZ4A 1T2CA 5JY6A 2WM3A 4PLVA 1HE2A 1ZSVA 4CR6A 4NU6A 3WYCA 2DT5A 1PWZA 5JAIA 2EW2A 2R00A 5HWSA 4R1TA 5BNFA 2FOIA 3WWZA 3FBTA 1WP4A 1W73A 2WDZA 4BB6A 1JWBB 2WE7A 4FS3A 5A4DA 3K30A 4JBHA 4D79A 3JYPA 5KJEA 5KVVA 2NLOA 3F3SA 1WAMA 1VM6A 4YQYA 1DPGA 3U4CA 5KKAA 2I67A 4GKBA 3CZMA 1MB4A 1MG5A 4YXFA 5I7EA 4TRNA 2OXIA 1Q0HA 1I3KA 3JQAB 3B1FA 4NFHA 4LSMA 3GF4A 1PJBA 1YGYA 3UH1A 2FP4A 2I65A 1X14A 3EYWA 2NNLD 3ASUA 1DB3A 3KLPX 3S8MA 1XYGA 3ITKA 3CSDA 1GYQA 1EUZA 3D5QA 1MFZA 4OAQA 4YAKA 3IUPA 3MZ0A 5CAEA 2C5EA 1VPDA 5EINA 2J3KA 1GTMA 1NM5A 3IS3A 4ND2A 3I9KA 3VHRA 3NV9A 5TF4A 3E5MA 3UICA 1R66A 5BQFA 4ZU3A 1VL0A 5DCYA 4DL9A 5DBFA 5HS6A 3PJFA 1IB6A 2NU7A 2W2LA 4TKLA 1UP6A 2B5VA 1PGJA 2EKPA 1B15A 5A9SB 3WGYA 3EDMA 2E49A 4NNJA 2C0CA 1XG5A 2IZZA 1V6AA 3UVEA 3ZU5A 2VT3A 5JC8A 5TRTA 4WOJA 3MOGA 2DFDA 2G17A 2X22A 3VH3A 1PJLA 4XA8A 2EKLA 1LRLA 3KYCA 3AM3A 4D3FA 3MJCA 1M2WA 3H7AA 3FNEA 3AOGA 2Y1GA 4KTTE 1M66A 2VHZA 1L1FA 1JWAB 3OJEA 1Y8QA 1NR1A 4ALLA 3QWFA 4EUEA 2C07A 2V6GA 2QRKA 2C20A 1WZEA 4FR5A 2YUTA 2ILTA 1GL3A 1U9JA 4F3YA 4JN6B 4NK4A 1UXIA 3H6KA 4CLRA 5ADHA 1QYDA 2DC1A 3UHAA 1U2DA 1VKNA 3C8MA 1QMGA 3WYBA 1QYXA 1UDBA 4GGOA 5GZ6A 3L4BC 1N9GB 1HDYA 1BXGA 3UOGA 1Z45A 4CUKA 4NDNE 2GRAA 1MG0A 2X5OA 3QVSA 4KOAA 4LK3A 1HEUA 1OI7A 3WQQA 5L4LA 2WD7A 3H5RA 3HG7A 1R0KA 3D5TA 4BNUA 3ON5A 3LZ6A 3GGGA 1PU2A 3B6ZA 4RZHA 1WZIA 5KJFA 2X0RA 3DZGA 1CQIA 4E2WA 4PG7A 4ZQBA 3WGZA 3MTGA 1IHYA 3NX4A 3HDYA 1U3TA 5CEEA 1HT0A 2OOSA 4CM4A 3QHAA 3NUGA 4EUFA 3KYDA 5JAQA 4D44A 1E6WA 4WE3A 5JPIA 3COSA 4NBUA 5JDCA 5IXSA 4K28A 3JD3A 3B20A 5G0UA 2ZK7A 3I52A 1YKFA 9LDTA 1UP7A 3T7CA 4NBWA 3Q2IA 1Z75A 3V8BA 4E5PA 3LC7O 4BNVA 1QSGA 2BELA 1CERA 3ANMA 2DTEA 4LN1A 4IZHA 2DBVO 4XRRA 1LUAA 4CMEC 2YW9A 3DDNA 4WASA 3DFUA 2O3RA 2O7QA 2G5CA 1JVSA 1ZEJA 3UFXA 4ZA2A 4YAGA 5CDUA 4R5HA 1YDWA 1BVUA 3PTZA 1GUFA 2VNAA 3GUCA 4E31A 4J4BA 5L95A 4IGFA 3C1AA 5G4KB 4E13A 1YXMA 2LDBA 4R51A 4DIFA 4RV9A 4EYEA 1T24A 2ZCUA 3ZW9A 1BMDA 1I32A 1O5IA 3LT1A 5F5NA 4J4TA 1S6YA 4AJIA 1E3EA 3DXFA 1M76A 1ADCA 4CR8A 2Z95A 3LF1A 5ES3A 3G1TA 4CM7A 1BHSA 5IXYA 1J6UA 2HMTA 3DR3A 3AFNA 2FRDA 4QXMA 1XQ6A 3MCVA 1K5HA 4UAGA 4BNZA 5H82A 4JJFA 4WNCA 3TZQA 3VVBA 2NADA 3DMYA 1E0DA 5IF3A 1I36A 2HKIA 4CM8A 3PJGA 1IE3A 5C7OO 4WLEA 2W2LD 1HYHA 4R9SA 3D7LA 4ND3A 3PXXA 2JHGA 1H2BA 3VH4A 1E1KA 3ZWWA 4NR0A 1EUCA 1G6KA 3Q0EA 3TF5A 3KEOA 5JDIA 3AW9A 3K96A 4ROSA 4I9HA
chains in the Genus database with same CATH superfamily
1OLOA 1XZLA 3CNHA 3LSTA 2W00A 3KU4A 2FZKA 1VLQA 3REOA 4CLOA 4GS5A 5KDOA 5KOJB 1BKDR 5GJCA 1RAFA 3AF1A 4RMIA 5K9ZA 5TLSA 1B23P 3W2IA 1LRKA 1ZUWA 3PHLA 1GVNB 5GOZA 2HRCA 3AIOA 2AMVA 2Q1TA 4ZU6X 4WPGA 4BJ5A 5KTTA 4LZOA 4KDRA 1N34B 2Q1WA 3H8SA 1X19A 2QE7A 1J56A 3ZE0B 5EP4A 4AJ9A 4OHWA 3FNFA 4RMNA 1NMEA 1UPBA 1ZCAA 3E7PA 2ZTVA 1W8DA 1A77A 2IOFK 3OCJA 2WEKA 4G86A 3Q5DA 4IICA 3A9RA 3NKLA 4U0KA 5F12A 4BV8A 3I9MA 2IZ5A 1N2EA 3DMPA 1ZMRA 4Q9KA 1XDUA 4GP6A 4CKCB 5EP1A 1JDBB 2A1TR 4B3JA 3L07A 2Y66A 2CMFA 3D81A 2J46A 4LXIA 1Z47A 3A1UA 3RS4A 4INJA 5CGZA 4I99A 2GTIA 2BBSA 3UJ7A 4D42A 1Q77A 4J0CA 1Q0PA 1ZL2A 4PAQA 2FZVA 4WH0A 5I3CA 1NVMB 3I73A 3CW8X 1GSOA 2BJHA 1N7IA 3CZRA 1M83A 3U16A 4IH1A 1YHYA 4BX9A 3BEOA 4LTDA 3QEBZ 2IEBA 3F47A 4OGKA 4LHXA 1UF9A 1ZVQA 3VR4D 3TR5A 4TXNA 3I0ZA 1E0JA 1GZ6A 1O9BA 1I14A 3QVLA 4XJXA 2VH5R 4RCYA 3VYRB 4BKPA 1TMYA 3IQEA 4RAOA 1E1RA 3AESB 3Q85A 4O2BF 1DOAA 5HM6A 4Q7QA 5AW6A 1NVEA 3OPQA 1L8XA 1ZMXA 1H42A 2FPIB 3OQPA 5BRNA 1GSIA 2SCUB 3U9TA 3AVYA 1AXGA 5CG2A 4W5OA 1NX9A 3H5LA 3LK6A 4HEQA 1GN8A 3V9PA 3OCUA 1PDVA 2RC6A 1VG9B 3S2EA 1TVKB 1XTUA 1H93A 2QGNA 4L0DA 3UATA 3VU1A 3COYA 3U09A 1O0CA 4MEBA 2GFIA 4WZAB 2ECPA 3G6WA 5F52A 3HYNA 4CCSA 2JK0A 4CQNA 3ECCA 3MMPA 5LUBA 2JDID 4ZI3A 4ALMA 3CTMA 3FMVA 5K8CA 2GUGA 1CQWA 3MRSA 1RP1A 3N74A 1L7VC 1CEQA 3CURA 2YWBA 4KX3A 5B7GA 3GT4A 3H4IA 3TMYA 1A72A 1X7YA 5A04A 4L78A 4R31A 2PYDA 2B4RO 5AUNB 9ATCA 2H4JA 2H7VA 5H4HA 1NSTA 1EJBA 1PR1A 3MTBA 4TRRA 4V39A 5H3LA 5J58A 2IU3A 3SFZA 4ETIA 4YR7A 5A9SA 3L7CA 1YI0A 5IUNC 1O6CA 2B9VA 2QD4A 1EVIA 4TVBA 1JHXA 2AH5A 2CBZA 2ENWA 3K31A 4R2HA 5H9VA 5EY5B 1LNQA 1QGUB 4UAUA 2IYAA 4JJ4A 4HMOA 1R64A 4MVJA 1S8NA 1XRMA 2OY0A 1KEUA 3RC3A 1QFZA 1ZXLA 3Q41A 3R23A 3AETA 1MD9A 5LXTF 3WGVA 3I1JA 1Z2DA 3S2SA 2B36A 1I33A 1NZDA 2H9IA 3AI2A 2C2OA 4H31A 5KTPA 3RARA 1GZ3A 3UENA 2IUSA 4A16A 2P77A 5B58T 2G88A 4MAMA 1SCNE 3ONWA 2FWBA 3VBCA 4UVIA 4C88A 1DRJA 3CH4B 4GSKA 2B7LA 3VPHA 2EBFX 3CE6A 1GY8A 3GRRA 1GOTA 1JS1X 4JGGA 3AI3A 2KM1A 1K68A 3S0JA 4C07A 4C5AA 1JPJA 4ZVMA 3MQ4A 4FI3C 4BQIA 1JDZA 2Y1LA 4Q19A 3VR6D 2QP9X 6REQB 1YB5A 2Y9ZA 2MSKA 3SXPA 1CRZA 4X44A 2Q99A 4K87A 5KYYB 1TEZA 1R12A 2AFHB 3QH4A 2H59A 4MIEA 4YNBA 5J4KA 1EE1A 1KI6B 1RAGA 1GKYA 3IEPA 4O4JF 4AZ0B 2MYTA 4B3CA 2BMVA 1XTTA 5E3HA 5J40A 2ZDQA 2DLDA 5TC4A 2WB2A 1Q1ZA 2HCTA 5B3JA 3I6IA 2PZMA 2RHDA 4NV0A 1Z36A 5JNLA 1YVPA 3RIMA 5JARA 3P20A 1PQYA 1NJ8A 1PT6A 2B0CA 1TC2A 3EGDA 4FDTA 5U1PA 3A4MA 4X1KB 3PC8A 4TMVA 2C7PA 4FT4A 5EQDA 3SF8B 2PUBA 3MC1A 1DJPA 4HVTA 4YO7A 2G25A 2QE7D 3SFTA 3ZW8A 1Z5PA 5GONA 1JW9B 4D8UA 1N9KA 1KORA 3IXLA 5AK0A 2LNDA 3GGOA 2YDXA 2KW5A 4OKNA 3HSYA 4BWFB 1XAJA 3KDSE 3WIUA 1YDMA 2I1VB 1ANKA 4XCQA 2C3MA 2PT9A 2K2WA 3HI6A 2DCUA 1K8QA 5IVDA 3S2IA 3BSYA 5EJ4A 1O57A 2NOAA 4BTLA 1EINA 3QK7A 3VV3A 2IPMA 1V7ZA 5DLQC 4B6GA 4FNOA 2W8ZA 2FUKA 5THQA 3UGTA 1NXSA 3K4QA 2EWMA 4KMOA 1LX7A 3BE4A 4DUZB 1X1QA 3FZNA 4FSDA 4AZ3A 3ENQA 3NFRA 3KSDO 2XYHA 2XVMA 3K1TA 5G0SA 3SC6A 1QHGA 4IMPA 3WAGA 1OV6A 2E37A 3AP1A 3E1KA 3EFOA 3VPAA 4A0HA 4PSUA 3E18A 4LJ5A 2WW8A 4GMXA 4YJGA 4FFDA 4Z7JA 3BTVA 2V58A 1P4SA 2ZREA 5EJ5A 3JQAD 1BQ3A 1C7EA 3C74A 4PO9A 3W2TA 1Q15A 4UPEA 4EHFA 1SBNE 5G4KA 2AC4A 1OAOC 5CLFA 7YASA 1RTKA 3CWQA 2OAP1 3TTTA 3O4RA 4IQGA 1BIFA 1WA5A 3Q2KA 4P3OA 5HOQA 4PEVA 4JVNA 3PPXA 3NTOA 4KO4S 3IP3A 4NNPA 3K5IA 2XXBA 2IZ6A 1QH1A 1NG9A 5AVQA 5IVKA 1N2BA 3CLSC 1XCPA 2PL3A 1QH8A 4LE0A 2X3YA 2BDEA 3HDJA 1THGA 2HJWA 2ZIAA 1GPDG 1SC6A 3RYFB 3NH6A 1SULA 3CG4A 3ADDA 1C30B 2BZGA 2CDAA 4C3UA 1TRKA 4QPCA 1LZLA 4RGBA 4WZZA 2IGBA 3LCVB 5HNKA 2DBYA 2Y67A 2YV4A 1N3LA 3MVEA 1GKUB 3OKAA 1KBQA 3OT1A 5AIAA 3VPFA 4F4DA 4K6CA 1XVAA 4EKYA 2GF9A 2OLJA 2V1XA 3GRUA 4A8JB 4NSNA 5ERYA 4CMAA 3IL2A 1W2HA 1TB4A 1NI4A 3OJWA 4XSHA 2Q2QA 1H0KA 2JA1A 4PLGA 4EJSA 4RIGA 4L07A 2YOGA 1BVRA 2ZI4A 2W9XA 2VUIB 3PZBA 4TLMB 1P2BA 3OWOA 4FDUA 4FHZA 2OFPA 2YH2A 3RS0A 3FTNA 1VSVA 3M1AA 1XI2A 2I7VA 1ONOA 3BFPA 4NBLA 2QROA 4MVJD 4ZO8A 3PL5A 3PRYA 1L7PA 3GZJA 5FYQA 4RJKA 5NLLA 2GCOB 3CISA 1SC3A 1IB0A 1ZD5A 4RQUA 1D7OA 3EIXA 4L8WB 4DHWA 3Q12A 5B2EA 1QTIA 1UZMA 2J9FB 5EL0A 3ZXUB 2BSQA 3HJFA 1T1SA 1LSJA 4ZOCA 5FPQA 4HHEA 1N6RA 4MO2A 5SICE 4XQCA 2QP4A 4YCDA 1U7XA 3A4NA 2D2EA 3VSDA 2KX7A 3D3KA 4U2FA 2XMSA 4DEXA 4YJ3F 2QL6A 4G4GA 3FTCA 3UPUA 2VL7A 1PJ2A 1WF3A 4HC4A 1Q6ZA 1XVVA 1Y5MA 3NXKA 2Z8YM 1AKRA 4RACA 1XJWA 4C3VA 1X8LA 2WM2A 5HM8A 1TCUA 1I2BA 4BP8A 1MEOA 5BORA 4CKBA 2VQSA 4FGKA 3MN1A 2PV0A 4HNTA 4Y9RA 4M86A 1L4UA 4J7CA 4ZVUA 2QTNA 4IG4A 5TMBA 1ZISA 1C3XA 2G67A 3WLEA 5L53A 1TJ3A 5IG2A 3KSUA 2CLCX 3KR2A 3I6BA 4YPOA 3I9OA 4H7EA 4MPJA 2X2FA 1TAGA 3OZFA 2Q3LA 3K1AB 1AUOA 1SWVA 3DC7A 3SICE 2JGJA 2IFTA 3PRKE 3W4KA 2XTMA 5B12A 2MYNA 1YB7A 2VBIA 3TE7A 3BA1A 4PR3A 3UXEA 2P79A 1EB9A 4LUCA 2X9QA 1GQFA 3DCIA 4YPVA 3MTQA 1KJYA 2YICA 2I4RA 4JLKA 4P2GA 5C8YA 4Z4IA 3LM8A 3CR8A 3D0OA 3K16A 1DIRA 3HBNA 3R6GA 1P8JA 4TYPA 4ZVSA 1VZ2A 4ME6A 1B2LA 1RJGA 2BGGA 2IHKA 2ZKLA 3FKSA 1XQYA 5A4IS 4IH9A 1RRFA 3R5HA 5J4LA 2EJCA 2I8LA 3MCWA 1AK9A 4JXKA 3QLEA 2WNHA 5JJIA 1NBME 1NIJA 1BNCA 4TSRA 5TR9A 3CF2A 4EDHA 5ALFA 4TXJA 2ISQA 3N3AC 1QP0A 1N92A 1QV7A 3G5LA 3R2JA 5IAAA 3JQQA 4JNKA 2WBLC 4ID9A 4E21A 5EWMB 1CUBA 3RUIA 5KNCA 1KAGA 1P3Y1 1VIDA 2AXQA 1O89A 2GPJA 3I2KA 4ZZ0A 3OUZA 2JI6A 3FMFA 3QTBA 2CUKA 4AUNA 1MIOA 3SSMA 3R6WA 1HDRA 3OG9A 3TUIC 5FPKA 3N70A 3EHEA 3JYQA 3PCRB 2W2KB 2BDTA 1J33A 4QL3A 5IKOA 3PI7A 1T2FA 3T95A 3UH0A 3KTFA 4U2DA 1TVEA 3E3MA 3G9ZA 2RARA 4XKJA 1E9VA 5LP6B 3MILA 4JEMA 1DC8A 3CNEA 1IN8A 1R0SA 1EM8A 3PDHA 3SNKA 2IPLA 3TNJA 4W5RA 1AKNA 1TT5A 1U28C 4RK7A 4Z2YA 4J94A 2AEJA 1WM1A 3AJEA 3IXQA 4KO3S 5JWRA 4MV9A 4L6IA 2OHOA 4C0XA 1ZOOA 3QPWA 1OASA 2IDZA 1XMJA 2XIJA 1TL7C 4KLNA 3SJBA 5ITVA 1XV5A 3C6KA 1XUOA 4LKOA 5B1HA 3E9YA 1QYWA 1P1RA 2PT5A 4ZXFA 5BSKA 2JI9A 4LBVA 2WIKA 3D64A 4QYIA 3KLBA 4O2RA 2P2DA 2ZRFA 4YRPA 1OU0A 1KDPA 4CT0A 3W6NA 1W36B 2QVXX 3KQNA 1N7JA 5KX5F 3HCEA 2WWXA 4I1IA 4N18A 3J81A 3R3XA 1NOJA 2HH9A 4YRDA 3BGWA 6AT1A 4MQMA 4N48A 5BY2A 3LT2A 1X9IA 2X14A 3R0XA 4IBOA 3HFGA 3KRTA 4OHMA 3U3KA 4OMFG 1GNSA 2XTZA 1QQTA 2XW6A 4UEOA 3LX8A 1EVZA 1JG2A 3UJ8A 5H8WA 1QP4A 4HK4A 3BT7A 4N5NA 2FFAA 1UZUA 2IH4A 3E53A 3DQZA 2Z3VA 5A02A 2AEFA 3A6FA 1KYYA 1DAHA 1S9DA 2G06A 3MELA 5BV0A 2PWYA 3Q88A 1QH9A 3Q7EA 4PAOA 5CHYA 3RJMA 3WKDA 1GTL1 3DVAA 1VQ1A 1CG6A 2NZYA 1Z8FA 2ZIUB 1F6DA 1M34A 3KKNA 3MJTA 4FCCA 1XTVA 3UHPA 4CFSA 1ZHHA 2WJIA 4UCXA 5F2EA 5B1YA 3O8CA 1GG5A 2GDZA 2O8CA 4PZCA 2B25A 1YRYE 1OWPA 1DIBA 1OA1A 1IUPA 3DF7A 3PNPA 1JHPA 5F23A 4HADA 1U98A 4RK6A 5F1PA 2B98A 1Z6QA 1JNXX 1JJVA 4UFPA 1CRQA 3ESQA 4OHKA 3IOCA 1F0KA 2WNSA 3GMDA 2PD3A 3TAXA 1ACJA 3N28A 4QTZA 2M32A 2P40A 4KWHA 1T3LA 4Y9TA 4JQOA 1PWEA 4PPGA 5WRFA 5EHGA 2WYVA 2Z6VA 3IVMA 4UC0A 5LZ9A 1ZVMA 1UK9A 1IJFA 4HDNA 1NQWA 1TYCA 4XW2A 3CU5A 4DCOA 4BS9A 1QRDA 5CHEA 5L8VA 1ZA2A 5F9FA 2Z3WA 1YRLA 3DO8A 3GPDG 3KQMA 2Q7DA 2W70A 4CV2A 2HYIC 2EP7A 2VP2A 4IP0A 1XVTA 2BFNA 3FH0A 4LXHA 4CUJA 1NUUA 2IPAB 2HU7A 3WA7A 2CNKA 2G07A 1A4XA 1GZ7A 3GN1A 4IDFA 4IOLA 2W37A 3P27A 4LPKA 2H5LA 2PQMA 2WSSD 1SZCA 3RYTC 1QB8A 3ND7A 1UT5A 3PC6A 2YHUA 1SUSA 1EZZA 4PZYA 3OX3A 3PIRA 4F6CA 2R62A 5KZMB 3EPRA 3NYQA 2W2MA 5TXGA 3PXBA 1E2QA 1QIKA 1DBRA 1XTKA 4FYIA 4Q7KA 3WZLA 3WXMA 1OXTA 5J4VA 1PJCA 2WC1A 3FOBA 4YJ2F 4I1PA 4C30A 4Q9NA 4Q05A 4RD3A 3QLVC 3RWBA 3D8BA 1OZFA 3LE8A 1T9KA 5KEIA 2EKQA 2PTGA 1F06A 3LFTA 5BQXA 2Y0DA 3DW1X 2FEOA 1LPSA 4XYLA 3K5HA 4MQ6A 2JRCA 1L3BA 2D0PB 3BF7A 3JWPA 3HXOA 1MXFA 2I33A 3KB2A 3FKSD 4J2OA 2V5VA 3NHFA 3SG0A 2XNCA 1K27A 2H1FA 2G83A 2VPZA 4GICA 4R8RA 4DCPA 3RK0A 4MRAA 4IV0A 3AZQA 3P9PA 4RIFA 1MH1A 4ABYA 1WB9A 4AZWA 4BNJA 5JI2E 3OY7A 3BCHA 1ZHOA 2G76A 4AJ2A 3AHFA 2L82A 2P2ZA 4EO4A 3L1IA 1ISFA 1O95C 2IA5A 1T15A 1QRUA 2YFYA 1UAYA 2DUJA 5FWYA 3O90A 4BEJA 5B4TA 4Q3CA 1TUEA 2QYSA 4NJMA 1HNXB 1VLZA 3X44A 3PS9A 1L4YA 2QVGA 3JALB 5JR3A 121PA 5CIWA 1T3GA 2CLDX 4MUKA 1SVMA 4XEHA 4RKRA 4UBLA 3OE7A 3D0QA 1WXFA 3HNRA 1K5GA 5HUHA 2BSXA 1PNRA 4NICA 1YV9A 5AKGA 3FW1A 1YS4A 4Q1DA 4IW3B 1OBHA 1Z18A 5L45A 3FWNA 5H02A 4EBFA 2H4FA 3CVOA 3PNVA 4M8IA 3ZH2A 1UINA 3E2IA 3ZWXA 3GA5A 2GYYA 3ST7A 3PC2A 4YCBA 3ZEIA 2Z4SA 5LZ5A 3DNFA 5REQB 2A9QA 2OBBA 1BEUB 4Z51A 3EMKA 3D8NA 2ZB8A 2A78A 1J2YA 3D4OA 1VDMA 2LP4Y 3JD1A 2IC5A 3HU2A 4F46A 1J22A 1NBOA 5ANRB 3DMGA 3FCUB 2ZYIA 2X9VA 2OHHA 3QENA 1AUPA 3X1KA 1V8OA 1ZNWA 4AMUA 4F4JA 4EM6A 1VA5A 1IY8A 1XD2A 4E15A 4NAHA 3KHKA 2KYRA 2CY0A 1P0IA 3AB8A 4HFNA 2GHTA 3L6RA 4EA9A 1L9KA 3KDAA 1U2ZA 5E4YA 3UCFA 3IELA 1WOYA 2I5PO 2P91A 1MV8A 1HRDA 2POCA 3ELBA 3LBAA 3PNLA 3QZUA 4RIIA 3X1ZA 2R6FA 2O8BA 1SVNA 4RVOA 5DE3A 1A9PA 2XCSB 1T8TA 1XZHA 1R27A 2JZCA 5K4GA 1JGTA 2G9ZA 2JJQA 2IHVA 1LDGA 4F3NA 4C6RA 5B6JA 1VSBA 1V5IA 3DHYA 4ZQFA 4DG5A 1SEVA 1TO6A 4KN8A 3QKSA 4BNLA 4IXNA 5JCPA 3VDMA 1ESCA 2HL6A 2J0UB 3NTUA 4PICA 1N5MA 4PQRA 1EK1A 3R7WA 3TFOA 3RAEC 3Q7PA 4DR2B 3OM9A 2I6XA 3WLFA 2CUNA 3MPUA 3QOWA 4M4SA 4JP5A 1N2CA 1G9TA 2B0JA 2HSZA 2JHFA 2OP0A 3OECA 4MV5A 1NC1A 2VP9A 3WKBA 2B8WA 4X6UA 4M8LA 1GNVA 1N32B 2Z8XA 4N0QA 2SICE 4EG8A 3DP7A 1HLFA 1KJJA 3LUCA 3N8KA 2FB9A 3QVMA 1KPGA 2HSWA 4MA5A 1OC2A 5EZSA 4ZYTA 2BP7B 3KYJB 2XCLA 2GK7A 5LQNA 3BRCA 3IIIA 2HT1A 3EGIA 4LHZA 4UZEA 3LQ2A 2HV9A 3AV3A 3R0QA 3NXSA 4J0IA 3U80A 5L3RA 4ALJA 2N46A 2WKWA 4U39A 3MBIA 5KNLA 1B3BA 1DIHA 2DUNA 3CUEF 3DP9A 3H16A 4JJ7A 1U3CA 5EZ6B 1RZUA 3SEAA 2LRHA 2AOTA 2WYWA 2YY6A 3QP9A 3WGKA 3BIFA 1FQWA 2CLMB 3HP1A 4MS1A 1II0A 2Q4DA 3GG9A 4Z2AA 5JFTA 1A5SB 2PKQP 2VHQA 1JIQA 1GPH1 2MSDB 2YFHA 2YVUA 1Z0AA 2YVLA 3NYIA 4IIXA 1BX1A 5AJVB 1XFAA 3MS4A 2DPMA 3PQ5A 3RS7A 4J0GA 3LNCA 1RACA 1Y8RA 1HC7A 2O54A 1W44A 3AZOA 5IPFA 1FVHA 3ETHA 4M1MA 4JUBA 1RW4A 2NYAA 2R5FA 3EQ8A 4BXOB 1QZUA 4F4CA 2DYKA 2A1UB 4R3WA 3SLGA 1JZQA 3DC2A 5FWXB 1HI9A 1P17A 1PSZA 4H3KB 2BYTA 3KCNA 2OHJA 2V8OA 1VSTA 4DRXB 2V0CA 1M3SA 4JT4A 3ENNA 1RMTA 3PDCA 1DFHA 2CDBA 3SQDA 4LGMA 3KWFA 1NF8A 2WTXA 4B71A 1LK0A 2Q0SA 4E33A 3GMIA 2D0DA 3LUBA 3I1IA 4M1SA 5EIBC 2UUBB 4TTVA 3BCRA 2JFPA 4YLEA 3FMIA 1V71A 4HPJB 4KVFA 4WZBB 1II8A 3O38A 4ITVA 5FBQB 4ENQA 3GVXA 3T35A 3VI3B 4RPIA 5D86A 4PHHA 2YWJA 1I1NA 1YIAA 3ETDA 4DBZA 3I72A 4KBGA 4RTQA 1V8DA 2GERA 4D92A 5H80A 3V5NA 3ZCVA 1T13A 2RK3A 4MVJF 3WGJA 5DULA 5BWLA 1P1HA 3E3NA 1JEDA 3HRKA 4GU5A 4W5JA 4XSVA 5AT1A 3QA9A 4F7WA 2QMYA 3PQCA 1FFDA 4MRMB 3QG5A 3AUSA 3DB2A 4G09A 4M0FA 4B45A 5D3MA 4LSWA 5CNKA 1BW9B 1UWLA 3EUFA 3G0DA 3H19A 4R69A 5B6PA 4EFNA 5TARA 4LNUB 2ZWPA 1C3OB 3RB8A 4EZEA 4ZYLA 5EVJA 4OQZA 3PQ2A 4PV7A 4DPKA 1X7XB 4GIBA 4OQDA 3V80A 1UPTA 3OZIA 5DYIA 4DQUA 1JFLA 3ICWA 4QE3A 2J45A 2ZTHA 4HXEB 1QO7A 4DLUA 5LJLA 3DBRB 3V8EA 3GGCA 3M83A 3WBBA 1E1DA 3ZDCA 5TEWA 4F3KA 4OPMA 4QZVA 1Y8ZA 4BJ1A 5AM0A 2JFNA 5CJPA 1EFVB 1EIZA 4BZWA 4NABA 2VZ9A 1B26A 2V9PA 3C4QA 2IU4A 3CN7A 5CB4B 4EJMA 1DTEA 4DC0A 2NIPA 4J07A 1L3CA 3BTSA 4E6EA 3SLRA 4QFMA 3K15A 4E3ZA 1NONA 3TMAA 4H1VA 5F98A 1M54A 1TECE 5A5DA 1X1RA 1KMQA 2X76A 1Y9AA 2IGTA 2Z98A 1E3SA 1NQVA 3AV0B 4CCYA 1FC0A 2RJNA 1OLUB 3LQYA 4GNRA 5AKXA 2JIMA 4LJLA 4PHGA 4QRDA 4HRYA 4BLTA 4UM8B 5BN3B 1AQYA 1DZIA 3GEDA 3ZU4A 1AHNA 5C46F 3LNTA 4QOFA 2CHVA 1Z2AA 1FDUA 3P2MA 4ZAZA 3HWRA 1UXKA 3ZI0A 1KTIA 3O2QB 2JL1A 5LNK6 1HEIA 1SO8A 2X77A 2ILVA 3UA4A 3WL6A 2YYSA 3DMTA 1SPBS 4FQ7A 1ZBDA 4JHLA 2PKWA 3IUBA 1JAZA 3QBJA 3TCXB 2BEUB 4UTOA 1G8MA 4UVEA 1QGYA 1C0LA 1G42A 2GPYA 1J2EA 5LA6F 3ZCXA 4HGQA 4PONA 1EHYA 1ZK1A 3ZK8A 1MXHA 4BKMA 1W4AA 2IXBA 2PWAA 4DWOA 1SN7A 1UPCA 4YX9A 4DANA 2J0EA 2XVXA 3EXIB 1YH3A 3TLXA 4WN9A 5HMMA 4KCGA 1GQSA 4LF8B 1TYDE 1HLPA 4JC4A 2DE0X 2ZUBA 5FUXA 5LZ4A 3Q3JB 1U7DA 3QX9A 4ZALA 5GQSA 2W4IA 3MINA 1QFXA 3N0XA 3PFCA 1DQYA 1IH8A 1IONA 3L0YA 4MVJE 1H6BA 4PYNA 1QG4A 1PG2A 1XYVA 5BQ5A 3JYNA 1U5BA 1SNYA 4JYCA 3DE6X 4R41A 1RJWA 3B60A 3PVSA 4KRGA 3M4YA 4DWWA 4IZ6A 4LWOA 3RGGA 4CGYA 4ZFNA 5CDGA 2Y0PA 3DLBA 4I46A 1IVYA 3A3OA 1XZMA 1FCJA 2WSMA 2NP6A 1G2PA 5DM0A 1MNAA 4L9RA 1YCHA 4CWAA 4ESHA 1DLIA 3PIDA 3L2OB 1I13A 1QPZA 4MYSA 4PYOA 2EKDA 2NPIA 1WEHA 3WIDA 3FLAA 4QTTB 3QMWA 4F60A 4B3SB 2ZBRA 4BQSA 1ZJ4A 1Y98A 3VOTA 4PQEA 4HDCA 2FW8A 4BNGA 4DLAA 5CFNA 3AJ9A 3FYCA 2RCNA 4HJRA 3ZY2A 3KUXA 2ZJFA 2FZWA 3WOHA 2XYQA 2B4TO 2VPWA 2XD4A 1GLGA 1LDNA 4CBVA 5M3BA 1WB6A 3BREA 3K0FB 4LQLA 4QEDA 2CW5A 2AWOA 2A57A 3SJ7A 3RQSA 2DT8A 4N3CA 2HO4A 5HF9A 3FIUA 1CF2O 5JXHA 3FPSA 2P3SA 5BVHA 2Y3IA 4CEJB 2LBPA 1P44A 3FCCA 4O0MA 4JI6B 1O96B 3U3XA 1B1AA 4B6SA 1Q6YA 1DAPA 4CIXA 2EG9A 2WWWA 5KYWA 1IUKA 1X1BA 3OTIA 4FX5A 4UHKA 4Q4JB 4Y2VA 5J5VA 3D7SA 4AWBA 5GIOE 2ARKA 3VJRA 3OIGA 4WY8A 1W29A 2ZRHA 5JWOA 3IQWA 4LTNA 1LLQA 4MOWA 3SJAA 3TKLA 4UEWA 4XZ3A 4OLAA 4EDFA 3DJFA 2EQBA 1GAXA 2A35A 2AJDA 4U7PB 5FLXA 1Q0UA 1PR4A 1TZJA 3HJUA 3JQ6A 3IAAA 4FDMA 5CLIA 3TQIA 2BGIA 3M6IA 1EYZA 2FV8A 5E9JA 3ZW7A 3K0CC 3ZJTA 4GX0A 1KVSA 4RPGA 5IVIA 1W5FA 5AOAA 5K01A 4Y2JA 3GCWA 4BFSA 2A58A 4UHCA 1NXXA 3CUVA 4N5LA 1G5TA 3DE2X 3PSAA 5DCUA 2JD0A 5EXPA 3L8MA 2OD7A 4KQIA 4HY3A 3VSCA 3WJ7A 1LTKA 3N53A 2D7CA 4B84A 4DLWA 3HKCB 3IP9A 4OA5A 4PQFA 2OENG 4QX6A 1KH3A 2PKYX 1PJTA 3P19A 1RYHA 3PC3A 4EY6A 1N2JA 3IDFA 1W88A 4MB0A 3UMMA 5CPFA 1FRNA 1O87A 4P3KA 4F2GA 4XX0A 1OWNA 5D1NA 1YU6A 3KELA 4FBLA 3TJMA 4MIKA 1YNOA 4ACBA 1TC1A 2Q7XA 1SXJC 3LYAA 4EIWA 4H0NA 3WXBA 1OLXB 2Q5FA 3BGOS 4P53A 3CB4A 2QF7A 2FF5A 4RZQA 4X94A 4NEGA 2I9KA 2C7OA 4HZUB 3L0PA 2VYQA 4Z3KA 1VCHA 1NY5A 3IVXA 3UWOA 1A8QA 2EZ8A 1MVOA 4JA0A 5C4MA 3FR8A 4NK5A 2JIOA 5EXEA 5I9NA 1Z74A 5ERGB 1M1NA 1XTQA 1XVLA 3EXG2 2GN6A 4HAXA 1BWRA 3W78A 4HS9A 4RQBA 1BA2A 5CW2A 3NT5A 1D2EA 2XB8A 1AKQA 2HGSA 2R87A 2QN9A 2WKRA 1TA0A 4R9VA 3ETLA 2PS9A 2Q6VA 4FHGA 4RD1A 1DO8A 3WIVA 4F5YA 5ITZA 3QBTA 3X43A 1C8KA 3R5KA 3K70D 4OH7A 1Y82A 4DDWA 4HWRA 1EFRD 5C8YF 6GPBA 4MVWA 1RCUA 2BM0A 2DR0A 3MHPA 4MKGA 4AX8A 2ERXA 4BE9A 4YRZA 3QVGB 4NE2A 3KXPA 3UV7A 4UFOA 4XVRA 4C5CA 1IHDA 1WP9A 1ZN9A 1WOMA 1T2UA 3ZHBA 3F49S 1GARA 4J16A 1L5YA 4MQFB 1KK2A 4P3NA 5DYNA 5FR2A 3RC1A 3RFCA 2Z6AA 2O0KA 1KSJA 4JB8A 3MJ4A 4OGGA 4BO2A 1M2NA 3KQPA 4IVRA 4F1KA 4ZGWA 1PJAA 3GEMA 1PIWA 4KYTA 2UYOA 4HB0A 4N1AA 4R54A 2J32A 4F97A 1ISGA 1S2LA 5JDCC 3AJDA 3H84A 4HWSA 5FI3A 3NGLA 3U7JA 3ZQJA 3V1YA 3CNQS 4DSZA 5G3YA 1YBFA 5BN1A 5CA1A 5BOSB 3HTXA 4FINA 5JCZA 1J0XO 2HA7A 1DCFA 3ANLA 3BMNA 1M6YA 5IDWA 2P9QA 3R6DA 1FXWF 4DA8A 1UADA 3M4NA 1EX7A 2ZUWA 1NW9B 1S2NA 3CUSA 5D5QA 3GMSA 4AT1A 3TOVA 4ERNA 4WBNA 5KYUB 1CUFA 1PZHA 4LOKA 4QLBA 1I7SB 3I09A 1O7JA 3KEGA 4WADA 1R4ZA 3NRCA 2NQ2C 3AVWA 2BR4A 1QFJA 1ULTA 1H2AS 4KN9S 2OBMA 4LJ6A 4XM1A 4L51A 4F45A 2MINA 4J0FA 2AJLI 4EPWA 4HP8A 2QT0A 2UZ1B 3PQ7A 3Q3VA 2GK3A 4J6EA 1W5EA 1RI4A 2LWIA 1U2QA 3IVAA 4P22A 4EUKA 1JIXA 3CINA 3O1LA 2H63A 2IS2A 3G8AA 5CDTA 1E6KA 2YN4A 3LO5A 2F6RA 2AI1A 2J08A 3MEQA 2BFDA 5JG7A 1YJBA 4YJHA 1TQHA 2E0IA 2L0XA 4EYOA 1C3VA 2BN4A 3AR7A 4ATNA 4BNDA 4UM9B 5K2MA 2B20A 2HUPA 2EWVA 3T5DA 4ER6A 4NVRA 1SBIA 4R7ZA 3EVFA 5LFAA 9MHTA 5E4TA 1GNQA 4DMHA 1HM5A 3G49A 1FRQA 3CUWA 3FYUC 3AEYA 3CV3A 1E5XA 1ZA1A 4EGJA 5HKBA 3GGDA 4HH0A 1VXOA 3IMFA 5F35A 3ZKWB 2O8DB 1M0WA 1BROA 4MR8A 3ZU2A 2JZNA 4KRYA 4IHJA 4DJ5X 2CMHA 4LYAA 4UUMA 4Y67A 2P90A 1FUKA 3VU0A 1WD5A 5BSVA 4S1OA 1F4VA 2ZUSA 3BE6A 3A14A 2G63A 2BPOA 5GZ3A 3UWPA 3R75A 3AT1A 3O9VA 2C59A 4B73A 4ZANA 5KKCA 1AIPA 1J06A 3IP7A 3A58B 1D09A 3LG2A 3P94A 4JBXA 2HA5A 5E7QA 1CW2B 1M1UA 1EP2B 3RU9A 3WGTA 3KETA 4E07A 4ZEWA 4L95C 4JVLA 1EFTA 1L4GA 3KSZO 1LPPA 4HLDA 4RA6B 1LY1A 2J7PA 4MB2A 4Z4CA 1Q22A 4GI1A 4B0OA 2IF2A 4KACA 3QA3E 4BBJA 1CY7A 2GZDA 1V45E 2YZMA 3CLHA 4M7RA 1JQJC 4Q3KA 1FTNA 2IE0A 3D2CA 3E8MA 3GEHA 2H92A 1E1MA 2JGDB 3A0UA 1D0IA 3C8HA 3PCTA 5DW3A 2WAAA 4RETA 1DIOB 3ZWNA 5L4NA 3F71A 2A9KA 4G5OA 1VMAA 1PBNA 3DXXA 1I7NA 1UIRA 1SBHA 3KJQA 3GJQA 3KJXA 1ZUNA 3P7MA 5KHAA 5KTYA 4D4IA 1FYXA 3QSYA 2GJSA 1SAYA 1BOFA 1FUEA 2A5FA 2OYCA 1P4HA 3FVWA 4FDVA 4FFBB 4OMCA 3RAGA 2I66A 1A5ZA 5ICSA 1DDOA 4NMLA 4HRAA 3DV0B 1NN0A 5JD5A 2R8RA 4E1BA 2YN0A 1ZH0A 3AVQA 1QYVA 2WR8A 3K53A 4LFAB 4R98A 3O2JA 4M7PA 1U7HA 4TLCA 3J80A 1VG1A 1ULUA 3A9SA 1BDBA 4C08A 3GBVA 1EDZA 3OQVA 2BI7A 4KB5A 4MQEA 2FQYA 4R3NA 3QE4A 3RU7A 4GEGA 5A9TA 3DE3X 5HXAA 1P5JA 2X5NA 3EUWA 3N58A 4OHXA 5J2TF 3A1NA 1BS2A 3RVJA 2CVOA 4J6FA 1ZWKA 3IUSA 2I34A 2V55B 4JK3A 3T9EA 3QVWA 3W4IA 1DX4A 1ENPA 1W85B 2RJ3A 3ND9A 3RVDA 3GNTA 3P0EA 3K9WA 4MVJM 4JOQA 1U8CB 2EX4A 3SIWA 1LS6A 2BTQA 1VLHA 3EVTA 2XE4A 2GVNA 4ARBA 4RHXA 4HZIA 2OMEA 2X0JA 3VOBA 4KR2A 3ACCA 1AHPA 4CTKA 1A9YA 4ZHSA 4ZJPA 2PV7A 4KXUA 4FONA 5IRCD 4J7UA 4LVCA 4MLZA 3SX0A 3S2YA 3JXEA 3TH5A 5EWLA 4Q12A 1VYHA 1XWFA 3IV9A 1FFWA 1PL6A 5BR4A 4YHHB 4GRAA 5JZVA 4KRFA 1NBIA 3C14C 5C7IO 3I61A 2VTBA 3TIGA 2HHLA 1M34E 3DM5A 2ICAA 4J49A 4CLOB 2MWMA 4LGVA 4WDRA 5TMEA 4I9NA 2APJA 4CMCA 2B5WA 3NHAA 4RH3A 1LU9A 1P6XA 1Y5IA 2FXVA 2P68A 3ZWBA 3NDPA 3IPLA 3OHSX 4M0UA 2P9CA 3AKZA 4GPTA 4LY9A 2WT4A 5FD8A 3N07A 4TZTA 5AHOA 4NYJR 5IJWA 3KJFA 3OY2A 3PGLA 2PL1A 5JMWA 5E0KB 4L76A 2VS1A 3CEAA 1DU4A 1UXHA 3UTCA 1E9RA 2OKGA 2OAEA 3W6ZA 1XAIA 3OPNA 5HILA 2RAUA 4HNHA 5KAMA 1U90A 3ZV7A 1PYDA 1M7GA 4ZRMA 2YY5A 2ZYDA 2DBQA 3W04A 1VKJA 1X7GA 4MDYA 1UJ5A 1XPJA 1Z73A 2H2GA 3EXEA 2PNJA 1BOOA 1O5OA 3BZBA 3ZJYA 2Q3FA 4HGRA 1U0BB 2VLIA 3OCWA 1A8HA 3INRA 1BJRE 4KKXB 2RBGA 3CY6A 1PYGA 2OM2A 1C41A 1BYIA 1JT9A 2ORWA 3E70C 3IA7A 5A4MS 2XHEA 2AUMA 4W7IA 4O63O 3LT5A 4TYYA 1RIFA 2ZVQX 5TQ2B 4U3JA 5AOVA 4KGVA 2R6JA 3MWEA 5EE1A 5U9CA 3V4OA 4C4SA 1YQUA 4OX9B 4DMLA 3TB4A 1QG6A 5T7BA 2D00A 4EBBA 1CUYA 1R1DA 2DKOA 2ORYA 4A7PA 3ROZA 1J39A 2HCJB 4NENA 4UHBA 3RU2A 1JH8A 1Y3BE 3F4BA 4FU0A 1GZVA 4PPQA 4QARA 3QVTA 1GQ2A 2VLBA 1ZUIA 4REOA 4A9AA 1EESA 3NBKA 4RNCA 1L5QA 1K8YB 4P4NA 3I58A 3L6DA 3WMFA 4RIHA 3DOHA 5L7YA 1J42A 4FEGA 4X1IA 3NAQA 3KVVA 2P4HX 5CXSA 2WWVD 2R2GA 2G5TA 3TZBA 5ENVA 2OHVA 4IHQA 3KR0A 5A0FA 2V7TA 2R0QC 1N3YA 2YWXA 4TMKA 3AGQA 3HQ4O 5IBRA 5TGTA 1W49A 2A59A 3TO5A 1JECA 1PEYA 1C1XA 5AVKA 1PWXA 2C5AA 3V1UA 3WRVA 4H15A 1R3UA 1O4VA 3GAZA 3D6MA 3C16C 4JL8A 4RS4A 4U02A 4ED9A 3ES9A 4ZHQF 1SHKA 4D3DA 1I8TA 4DVGA 621PA 2X1HA 1W4CA 2FRXA 2V5UA 4PFJA 3N39C 2HK6A 2HM7A 3JQBA 2CNBA 4IYRA 4LC1A 3U9SA 4TKVA 1J20A 1GRVA 3TSYA 2X0FA 1JJBA 1U3GA 5KVQA 1ATIA 2QTBA 4YAOA 3RSQA 1EDEA 2I2DA 3JQ9C 3TQSA 3TTXA 1LDEA 2WICA 4OK6A 3USCS 3L8FA 4CG0A 4OXQA 1USUA 2D4HA 2HLNA 1HDOA 4O4LF 3LDAA 3U3JA 1PEAA 5A6SB 4R5MA 1YS2X 3L77A 4HLCA 4DB2A 3GJ0A 1PJQA 4K8OA 2XUDA 5FPSA 1EDOA 4RF3A 3AETB 1O1YA 1JSZA 4EOGA 2QV7A 4YRJA 1U2GC 2JI8A 1Y8AA 3I0MA 4MGYR 1L5NA 2AQHA 1X70A 2AMFA 4R4JA 5K51A 8AT1A 1CUJA 4H2DA 4NYIR 2GILA 3BXEA 2VSXA 3K9GA 1JXQA 4EI2A 5A03A 2BUAA 2VDKB 4PFQA 5IM5A 1U2TA 3FB4A 3EDRA 1JA1A 4KAFA 1LJ8A 1NHGA 1PHPA 4ARIA 3WLPA 2O1SA 3X1WA 4RVUA 4UBOA 3V46A 5JADA 3F0TA 2ZZMA 1B6TA 3E9MA 2QI9F 1QIFA 3F67A 3V9AA 3CPSA 4H0CA 4K7JA 3V2UA 4OFBA 5JXIA 2ZRPA 3GPCA 4HGNA 4GPD1 4IGEA 1Z0KA 1P7CA 2Q28A 2FZ4A 3OX2A 1ENZA 3R5FA 4FFRA 3GLIB 2NPOA 1DQRA 1OCEA 3G8CA 1PR9A 4DIOA 4EF5A 3IAXA 1JQBA 4IJUA 1B3RA 1PFVA 1ZSYA 4X84A 3TQRA 4Q47A 5E1MA 2GA9A 3RIXA 5EJ2A 5EMNA 3B2QA 1RHMA 4YCMA 1TJNA 3IE0A 1Q83A 5ALQA 4MUFA 3MCTA 4ZI5A 3T3DA 5TJHA 2C2YA 4GI2A 16PKA 4LRTB 5DTQA 4LFCB 4MHOA 1NKTA 1ULHA 4ZMSA 1A9QA 1PP4A 2HNAA 2IYTA 2M2IA 3EGDB 5B53A 2GTHA 2Q4OA 1PWHA 1UR5A 1SB9A 2ZIXA 1N2CE 1O58A 2VOJA 3E7WA 1NT4A 3G8BA 3H1GA 5EJGA 4CRWB 5KTOA 1T4MA 4JKYA 1E9BA 4JOSA