3K6JA

Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.elegans
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
433
structure length
430
Chain Sequence
b'HHSTGENLYFQGSEVRSYLMEAHSLAGQWSLPNDRGDHTNSEAYDVNSVAIIGGGTMGKAMAICFGLAGIETFLVVRNEQRCKQELEVMYAREKSFKRLNDKRIEKINANLKITSDFHKLSNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGNCKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIITNFGFLMGPMTVADMNGFDVMEKLKKENGLEPNPIEKEMWRLKRYGRKTNKGFYKYDDKTQRKENDTEMEQIIRRVAKSNIQIINDQDVINFMLYPTVNEGYRCIEEGVISNESLIDIMFILGFGWPIHSGGPMRFGKTEGLDKIANMLVHWSSLEPKESAYIVADALKTAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F01G10.3, confirmed by transcript evidence
publication title Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 156
structure length 430
sequence length 433
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3k6jA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k6jA01
3FF4A 2D0IA 3ONEA 4ZHSA 1XWFA 2GZ1A 4MKXA 1XCBA 4FGWA 3VPGA 3WJAA 4EEZA 3LT2A 3JCZA 1NQAO 4RVFA 3ROPA 1DXYA 3WJ7A 2GR9A 3X2EA 5L7WA 1U3VA 2Q4BA 2VHZA 1V9LA 4JBHA 3VZQA 1NQOA 1PWXA 1CF2O 1FF9A 4AJJA 3GUYA 4IGEA 3UGKA 1HZJA 3P7MA 5THKA 2UUOA 4A03A 3PFFA 4J43A 3GRKA 1E3WB 4D43A 4BV9A 1N5DA 5U9CA 3CTMA 1FDSA 4NHEA 1G0OA 2P5YA 2UVDA 2W90A 4XEHA 3TJRA 4CLOA 3WGIA 1ZKMA 4PZEA 3O4RA 5G0VA 3EHEA 3G3EA 3FPLA 3GVPA 1EFLA 5L7YA 3PLRA 4CMIA 4FJ1A 4ZICA 2D2IA 3QSGA 1HSZA 3JD3A 2HK8A 2ZQYA 4ILKA 4HXYA 2OGUA 5TSDA 1KOLA 1U8FO 4D0RA 4BQPA 1PL6A 1Y1PA 4MP6A 4OL9A 3T7EA 2W2KA 2Q1WA 1M66A 1T24A 5FF9A 3OEYA 2EHDA 5GZ6A 2HK7A 2YDYA 2NLOA 1I3NA 3IIEA 5U4QA 3PTZA 4P22A 3KBOA 3HFSA 3IDSA 3RFVA 4CMBA 1ZUD1 3RBVA 3AK4A 2PH5A 1YE3A 1MLDA 3EC7A 1Z82A 4R1SA 3VDQA 5BNTA 1OFGA 1PJQA 1Y6JA 3DBLA 1H2BA 3JD2A 1U3WA 1MXFA 2J6IA 1NR7A 3DXFA 4C4OA 5KKCA 3GHHA 3C7AA 4R51A 4QO7A 3DZGA 4L4SA 4NK5A 3IJRA 4XRGA 1F12A 2HCTA 4NQZA 2JL1A 1DJQA 3VH2A 2E49A 1C3VA 4EUHA 1I10A 4BNTA 2PZJA 1TT5B 4H3VA 3GRPA 1GAEO 3VVBA 5KIAA 3EZLA 3RBXA 4BO8A 4DTIA 2PD6A 1K5HA 5EERA 5DOVA 2BFAA 1N2SA 3UW3A 5KJCA 1E0DA 2B4TO 4QO8A 4N54A 4E5NA 1Q0HA 4R1UA 3KZVA 2JCXA 5JAZA 3Q9UA 2B4QA 8ADHA 1VI2A 2AEJA 1Q2XA 2RAFA 2RH8A 1C0IA 3TF5A 1EBUA 1PZHA 1E3EA 1LEHA 3OFSA 4IS3A 1PL7A 2WM3A 1GEGA 1K0UA 2VNAA 1JW9B 1TA4A 2VTDA 4UEKA 2Y0CA 3COSA 1O0SA 4BQRA 4NU5A 1JLLA 1PGJA 4GAEA 2O3QA 4R3NA 3GY0A 1VSVA 5L40A 5L9AA 4J4HA 2PTGA 5A05A 3RKUA 1GDHA 1HDXA 3C24A 3DHEA 4ZQHA 5EINA 4R5MA 1NAIA 4XQEA 4B8ZA 4W7HA 4II2A 2J3JA 3PYMA 4XCVA 1YGYA 4RGBA 1RJWA 1Z45A 3NX4A 4GMFA 1C14A 5LC1A 1HL3A 5K0ZA 3WGGA 3LC7O 3I5MA 5A9SA 1H2HA 4HFRA 5AXAA 5H83A 1EVYA 3AW9A 1I0ZA 3JQ8B 4HFJA 3AU8A 3MTGA 3UH1A 3W8DA 4AFNA 4DMMA 4RZHA 4I9UA 1JQBA 3KOUA 1T1RA 3RUCA 4TROA 3RCBA 5L4SA 3IC5A 1J6UA 1MG0A 2J8ZA 4HNGA 4UREA 3ZZNA 4RF5A 1XDWA 3SJ7A 5F3RA 1EVZA 2RBEA 5ILOA 1KC3A 3AI1A 1PJSA 5JYDA 2JCYA 4CMGA 5L53A 4CMJA 1Z7BA 3BMCB 3VH1A 3DZHA 1FDVA 4A7PA 4BS9A 3F5QA 1QLJA 3ZV3A 4ALIA 5G4KB 5C37A 1K6IA 1HXHA 4PIVA 1BDBA 4R1TA 3RUEA 2LDBA 2P9EA 3DFUA 1U7HA 4N5LA 4RPHA 2FRDA 4ZVVA 2YFHA 1GEEA 1JU9A 2ZB8A 3GVCA 3PP8A 4I8XA 2UYYA 3DEYX 3NRCA 5KJEA 4CLOB 3H65A 1GV0A 4CLEA 5DOZA 1R37A 4XWYA 1E7QA 3D3WA 4N18A 4J9UE 1PTJA 1DAPA 1I8TA 1V0JA 4R69A 2ZYGA 1DEHA 1H5QA 4R54A 3B20A 2PWZA 3NT4A 1CETA 2C54A 2X58A 4YRDA 4TQGA 3ZI0A 4DQUA 2GDZA 1AXGA 3DL2A 3L4BC 4YWJA 4IZHA 5IDYA 3OA0A 1EE9A 2EW8A 1TI7A 4B3JA 1DJNA 4XQCA 1U4OA 1VM6A 1UXGA 4E31A 3V2GA 5HBRA 1S7CA 3KLMX 3JQBA 1YB1A 4PFJA 5DNAA 3UCEA 3WSWA 5IXSA 4J6FA 4CM9A 3TZCA 4EUEA 4WGGA 4XQGA 2BI7A 3WR5A 1GL3A 3WSVA 4DIBA 1KEUA 5A06A 3ZU3A 1E6UA 3CEAA 3I6QA 3OETA 3BMOB 2Y1CA 2GN8A 3HSKA 4B7XA 5DP2A 3K73O 4MP8A 5CDSA 4KMSA 2I67A 3GG9A 3CPSA 4NNJA 3HDHA 1WDLA 1U4SA 3RAJA 1A9ZA 1CIVA 4EW6A 5KWEA 3PHLA 5IDQA 4FS3A 3RUDA 1PJ4A 1XSEA 3FBGA 1E1LA 3GGOA 4ZRMA 4Q3CA 4YT5A 1LJ8A 2HDHA 2OFPA 3PHGA 4OQYA 2O3RA 4QX6A 1HDYA 4MKZA 3H4VA 5TNXA 1ONPA 2C20A 2X4GA 1PQUA 2Y93A 4IINA 5CEJA 1XELA 1DIHA 2EJVA 4IZIA 1J0XO 4WCFA 4YTEA 1KY4A 3VKVA 3AFNA 4UEJA 2PKRA 4ZA2A 3TWOA 2OL4A 2B83A 4GLOA 1QMGA 4XDZA 5DN9A 3ANMA 5FYDA 2GGSA 3K2EA 3ZNQA 1I3LA 1C1DB 4PRKA 4Z3KA 4CJXA 1F0YA 2DUUA 1NPYA 3E82A 4ID9A 3W8FA 5JBIA 1PGPA 3CZMA 2X23A 1P3DA 5L4LA 4E2YA 1MFPA 5JDIC 5A9TA 1I01A 5COAA 3SJUA 4YAJA 2NWQA 2VYVD 4GMGA 1E7SA 3JQFA 4RDHA 4HFMA 1BGVA 1VKNA 1EVIA 3DR3A 5GMOA 4AJIA 4PN3A 3PWZA 2FSVA 3JSAA 3B1FA 1LA2A 3R1IA 4YT8A 1ZXLA 3PJFA 4ROSA 4CR6A 3GDOA 4BNYA 1NVMB 2OOSA 1DC6A 1EK5A 4IDAA 1SEVA 4R5HA 1ZXBA 3K2BA 5HM8A 1QG6A 1G1AA 4NFSA 2FPIA 1YL7A 4R41A 3WDSA 1O6ZA 2X5JO 3QJ5A 2QIOA 1IE3A 3PQDA 4MIEA 4RV9A 5KOIA 3QRWA 1KVSA 2DKNA 3AUAA 3GHYA 3WWZA 3D4PA 5EL0A 2O50A 1O95A 4BNXA 4CMEA 5JW6A 2OZPA 2VHVA 4ALLA 3OF2A 4B7CA 4DVJA 4I9HA 1VJ0A 1ZEMA 3W1VA 4CM6A 4HP8A 4XR4A 3O03A 4GPD1 1KEVA 3ZW8A 2ZYAA 4CUJA 4RF2A 2WTBA 4XIYA 3C7DB 1U2DA 3JQGA 1MA0A 4EEXA 3PQFA 2VZ9A 4FIZA 2YHUA 1PGNA 4E5PA 2FZWA 2O2SA 4J91A 4CM3A 3QV1A 3HE3A 3GUCA 4YACA 4YJGB 2VCYA 3WQSB 4UVHA 2GNAA 4DBZA 4YQYA 2WD7A 2YQ4A 5IFLA 3FSRA 2XF8A 1NWCA 4W7IA 1A5ZA 3I1JA 3WIEA 3NDIA 1ADGA 4DQXA 1I24A 3WNVA 3GN2A 2VOEA 2Q45A 4MVJG 1CEQA 1CQJA 1GY8A 3KB6A 3ON5A 4NI5A 3JTMA 1B26A 1LSJA 3PHHA 2B4RO 4Q9NA 1QSGA 2BKAA 5DP1A 3LT4A 1JKJA 4FFLA 4RLSA 2VWHA 1NFQA 3RFTA 1UP4A 1LRJA 2ZB3A 4G81A 3WGTA 4WJZA 1NP3A 1QRRA 3P5SA 4BB6A 1C0PA 1YDEA 4PLVA 4BL5A 3DBHB 3VOSA 1VE9A 4JBIA 2AQIA 3RC1A 5JE8A 3GDGA 1YB5A 2NU9A 1R4NA 3NT5A 5G0SA 2TMGA 4OMUA 1JA9A 5IG2A 4KDEA 4ZQEA 1PS8A 1F06A 3RU7A 3AU9A 2O3TA 4PLFA 2I65A 3H2ZA 1SCUA 2CSUA 2GPTA 4I5DA 3NTRA 4BNUA 1UXHA 1E1NA 2ZKLA 1I36A 3GPDG 3KUXA 1HDZA 3TSCA 3UOGA 4BMNA 4AJHA 4EGFA 9LDTA 1SPXA 4XJSA 1YOVB 1U2GA 2Y1EA 3ETEA 4WNCA 4GBJA 5C7IO 2C2XA 1UP7A 1D1SA 4YAEA 5FWNA 3H5NA 4RPJA 1QR6A 3GEMA 2WMDA 1WZEA 2C2YA 3BMNB 4MJLA 3U4CA 4IDDA 3E5MA 1JVSA 1E7MA 3I23A 3JQAA 1IPEA 3ONDA 1WDMA 3WMXA 3OH8A 2JHGA 3RI3A 4CQMD 1EFKA 1UUFA 2PGLA 2Z95A 3O9ZA 4XD2A 2EIHA 4FOSA 3RSHA 5KKAA 4ITUA 1DIAA 3I6IA 3ZGYA 1ISJA 4TSKA 1A4UA 1IUKA 1YS4A 3A28A 3D1LA 2O4UX 3LC2O 2PK3A 3L6EA 2CVZA 3A9WA 5ENVA 3KSUA 4P4GA 1Y5RA 3VZRA 2P4HX 5KVQA 3H2SA 4W6ZA 4QECA 2X6TA 1LRKA 4E0BA 5GZ3A 2X9VA 1AGNA 5JDCC 2OP1A 4BNGA 4MVJA 2PGJA 3G79A 1V3TA 3LF2A 4LVUA 4HV4A 1NM5A 2VOJA 2Y1OA 2VHXA 1O5IA 2YDXA 2Q2VA 4NFHA 1B2LA 5I7FA 1E3WA 2Q46A 3ANLA 3ABIA 1U1IA 4JK3A 4NBRA 5KTKA 4C7JA 3PWSA 1KEWA 4WEOA 4Y6SA 1GQQA 2XPCA 4LRTB 1GUYA 1X0XA 2I99A 5IZCA 1NVGA 4ZJUA 1IL0A 4K28A 1HSOA 2NTVA 3FHLA 4D44A 2R6JA 2YZ7A 2NQTA 3KHUA 1R4MB 1EMDA 4WOKA 2J3IA 5LDGA 3G1TA 1GZ6A 4YEDA 1X7DA 4LISA 1Y5MA 4FBGA 2H9IA 5T57A 2WEKA 4MIYA 3DBVO 3CXRA 3PRJA 3OQ1A 2Y0DA 4IJUA 1EK6A 1H6CA 4MVJM 1QV6A 3UCXA 2Y1FA 2PFGA 2X1HA 2EKLA 1PZGA 4D42A 4KWHA 5B4VA 1DC3A 5TRTA 3VAZA 4IJWA 3PJEA 4JCOA 2CDBA 2YV1A 4TVOA 4RL6A 1V3UA 2HJRA 3MJ4A 4WLVA 3S2FA 4MP3A 2JFHA 3KYCB 2D8AA 2VHYA 1W8DA 1PEDA 4DPLA 3RC7A 3DOCA 2OUIA 2EKPA 4BNIA 1WDKA 2RH4A 3GMDA 4CR7A 3BHIA 1A72A 2Y66A 1TT5A 3U62A 2C82A 3DHYA 4BVAA 4OAQA 3ZWMA 1C0LA 1PGOA 4H16A 1PJBA 1W6UA 4PVDA 2PD3A 1T2EA 4UVGA 3KEOA 1CQIA 4IIVA 3FPCA 2ZB7A 1P31A 1K89A 3EVTA 1E3SA 4TKLA 2A4KA 2AA3A 3MCVA 4J2HA 4BO0A 5BNFA 4DPMA 4BGEA 4FSHA 1D8AA 2Q49A 3OHSX 3WB9A 3WG9A 5COQA 1UZMA 3PIDA 4JLWA 2G1UA 2X5OA 1C1XB 5JLAA 2HRZA 4FFOA 4TRJA 1XU7A 4TRRA 3MEQA 3V2HA 1J4AA 1R4NB 2LDXA 3WLFA 5DCYA 3ZCXA 3GQVA 3Q6IA 4NJOA 4RVHA 3L9XA 3E1KA 4GH5A 1HLDA 4BNNA 3V8BA 4CMHA 2C7GA 2HQ1A 2NTJA 4OXYA 4YYZA 3K5PA 3OSUA 4JIGA 1IB6A 1XU9A 3DWFA 2ZYDA 1QLHA 4DLLA 1GQYA 3SEFA 2QZ9A 3JQEA 5A03A 3GR6A 1WZIA 4YJHB 3JQ7B 4HBGA 1DRWA 5C3MA 3GG2A 5ENDA 2P2SA 1XQ1A 1QYVA 1DIRA 2A35A 3AY6A 3GC6A 1HEUA 2PZKA 4J3FA 1O8CA 4LSMA 4L4XA 2QG4A 2I6TA 2WJPA 4Y8VA 2V65A 3JQ8A 4O1MA 1VJ1A 3WYCA 1WMBA 2ZK7A 2DBZA 5TJHA 1T25A 2CMDA 3AY3A 4OOFA 1JWBB 4FDAA 1MUUA 1N1GA 4K1LA 2WD8A 5CG2A 2VWPA 5JAMA 5CPBA 4A5OA 3I3OA 3I4CA 2NVWA 1ID1A 1PWZA 1B0AA 3PDJA 2DFDA 4R1NA 1P1IA 1ISHA 1EBFA 4D3DA 1B7GO 2DLDA 3OQ6A 3IP3A 1GUZA 4L74A 4NBVA 3AUTA 3HHPA 3D4OA 3I52A 1H9BA 1OOEA 1Y8QB 4CM8B 3GGPA 4DYVA 1WWKA 3BMCA 4IDFA 1LQUA 1FDWA 5T6BA 4BO4A 2X7HA 5F1OA 5G4KA 4WASA 1RYDA 1O94A 3OIDA 1FK8A 1VC2A 2DVMA 4ONEA 3K31A 3OICA 5ER9A 3L77A 2C7VA 4XYMA 1Y81A 1ORRA 3OJOA 3F4BA 1PX0A 1QYXA 4QXMA 4E4YA 1RKXA 3AM4A 1YRLA 4I08A 4TKMA 5K9ZA 2B0JA 2JD2A 1YBAA 2AEMA 1FDTA 4NBUA 4Z9FA 1KYQA 2HU2A 4DIFA 3TZQA 4HY3A 1ZK4A 4OOEA 1LDEA 3F5SA 2NVUB 3KV3O 3T4XA 3PZRA 4MVJI 4WOJA 2PY6A 2EXXA 3PGXA 4QEDA 4R68A 1DBVO 3WTCA 5IDXA 2ZTLA 5A5EA 1F17A 5A5FA 2PR2A 3LLVA 4F6LA 1B3RA 3JD1A 3BXXA 3DAGA 5ILGA 2AE2A 1XQ6A 4DWVA 5I7SA 4H15A 3AY7A 3TPCA 5T8KA 1ZK0A 4PLTA 4DRYA 2BF7A 3LT1A 1SZJG 2JD0A 1ZK1A 4CLXA 3GEDA 2X86A 2B5VA 3TQHA 3ITDA 4BKOA 4IPTA 4OO3A 1IHYA 5DCUA 4BNWA 5F1KA 2A9FA 3GNQA 3A1NA 4JQCA 3DMYA 1ZIDA 1KVQA 1CDOA 1NYTA 4KUGA 3M1AA 4MINA 5ITVA 3BMOA 4EI2A 1WMAA 2E82A 4IQ0A 1B8UA 3BIOA 5DZSA 4NR0A 4CLRB 5IN4A 3PFWO 4EBFA 3QWIA 3QVWA 2VWGA 3MWDB 3ZDFA 2D4AA 1GV1A 1RWBA 4KTVE 3KSDO 2JFFA 4XB1A 2H63A 1BW9B 2EERA 2J3HA 3ZWAA 3IQDB 4BNVA 3HN7A 2IDZA 1LLQA 3LSYA 3H5AA 5TQVA 3U09A 1K6XA 2ZIZA 3QWHA 2IXAA 3UKOA 4PG4A 1X7GA 1U5CA 3PVZA 4CR8A 4E2ZA 4XKJA 2BHLA 4W99A 3RASA 1OZAA 1IHXA 1C1DA 3S8MA 1X13A 3ZN2A 1ONNA 1LTHR 1X7HA 5G0TA 1B15A 4M54A 3ADOA 3E9NA 2C5AA 3F1KA 3DBRB 1HYGA 5B4TA 5C5IA 4J7XA 3T4EA 2G0TA 3MTJA 4E3ZA 4BNMA 1GYRA 4B4OA 2X0RA 5BR7A 2V6GA 4FQ8A 4B4WA 1AHHA 3NEPX 3GPIA 1GCOA 2P9CA 1L1FA 2AW5A 1YJQA 2VUUA 4XB2A 1M67A 4ZRNA 5CDGA 2G17A 3WXBA 2VHWA 3SXPA 3ZWOA 2WYVA 3JQ6A 1DFIA 1NXQA 2VNSA 3EUWA 4CM4B 3INTA 1YB4A 4CMCA 4YJDA 4NBWA 5FEUA 1YXMA 4IJVA 4EITA 2YV3A 2POQX 4BGIA 1YL6A 1F14A 1LSSA 4OHUA 2IXBA 5B37A 1PL8A 3ZWVA 4UUPA 1QKIA 3I9KA 4JP2A 1DIBA 2WSBA 3AI3A 4PG5A 1GPJA 2H1SA 4IIUA 4D41A 3EDMA 1P9LA 1YVEI 4KTTE 1I2ZA 5L4NA 3TZKA 3C8MA 4LCEA 3QP9A 5HS6A 1P1KA 4RPLA 5CDYA 2WE7A 4YBZA 1BSVA 3RVDA 3H9QA 2AXQA 1Y9EA 4GVLA 1ARZA 4FN4A 1ADFA 1X0VA 1LUAA 1Y9AA 3NTQA 4MDHA 4U0KA 3B1KA 4K6FA 4AJ1A 1O89A 4IDEA 1N7GA 1U3UA 3FNGA 3NDJA 1HRDA 4RVSA 4YJGA 4B3IA 1A27A 1M2WA 3NGLA 2D5AA 3S2IA 3D64A 3WGHA 5CG1A 5I9NA 3PPIA 1KVRA 5B1YA 3U4IA 1K3TA 2HMUA 4OSOA 2IZ0A 3MJSA 1SMKA 2GN6A 4O6VA 2HK9A 1BHSA 4GX0A 4BO9A 4CMKA 2PD4A 3E8XA 4PLHA 4ALJA 3LU1A 2E37A 3CSDA 3ANNA 3FCOA 2I3GA 3I9LA 5EESA 5JNLA 2Q50A 3CMCO 4GX5A 4XIJA 3SLGA 4AJNA 3KYDB 5DBFA 5HS4A 4U7WA 4MO2A 1DOHA 3WYEA 2CZCA 5AYVA 5TT0A 5JCJA 2W8ZA 1SOWA 5A3VA 3RQSA 4L4RA 4RCVA 5TLSA 2NU7A 1N8KA 1XR3A 4J2OA 4E30A 4U6SA 4E21A 4OXNA 2EEZA 2DQ4A 3DQPA 1HE2A 4KDFA 1JWAB 3DBHA 3VZSA 3U4HA 1CRWG 4IDBA 3IMFA 1ZJYA 4RORA 2P68A 2B37A 5JO0A 2O3UA 1WAMA 2BI8A 2VZ8A 5CP8A 2I3AA 4B3HA 5AOVA 4FW8A 5A9RA 1GZ4A 4E5YA 1AUPA 4PZDA 5ADHA 1PIWA 1PJTA 2FR0A 3DZIA 1PSDA 3JQBC 3H9GA 2W4QA 4DQVA 2VYNA 1LLDA 4J1NA 2G5CA 4L8VA 4NG5A 2OHXA 5ES3A 4P4LA 4IMRA 1XKQA 1DLIA 3AUUA 3C1AA 1TEHA 5L7TA 4TZKA 1EE2A 4CQMB 1YOVA 2VRCA 4Z0HO 5AXBA 3FR7A 4XX0A 3HDJA 1EDZA 4DMLA 3TZ6A 1Q7CA 3B1JA 1WLYA 3BTSA 3PK0A 4YAKA 4WLUA 1P1HA 1P0FA 1Y8RB 3BMNA 4EZBA 5ICMA 1BVRA 3NDRA 4RO0A 4PLZA 4UAGA 4ALMA 3ZW9A 2WYWA 1VKOA 4N5MA 4CV0A 3IJPA 1NPTO 3GMSA 3A4VA 3ZV6A 1ZMOA 2EP5A 3ONFA 2PA3A 3RKRA 2Y0EA 5HWSA 3MJEA 5TX7A 2EJWA 3WBBA 1OI7A 1X1EA 4D7AA 1ENZA 1LNQA 3TL2A 3GVXA 1N9GB 3D5QA 1NBOA 5JY1A 4WCFC 3MJVA 5MDHA 2Q4EA 5GZ1A 3CUKA 2HAEA 2DM6A 3FN4A 3DOOA 4RDIA 1JVBA 1LLUA 4BO7A 3W8EA 1ISGA 1P1FA 4LSWA 1QXSA 4UEOA 1B14A 2Z1MA 4E6PA 1E7WA 1YQDA 3U49A 1ADBA 1GFSA 3GAZA 4RQUA 2E4AA 3JYQA 2IEDA 3FR8A 3ZNOA 1BDMA 2C29D 4M49A 4AICA 2XOXA 2ZJ0A 3ROMA 3WMWA 5ICSA 1YDWA 1EUDA 1T2FA 1H6BA 5DULA 2HMWA 3JQFC 5H81A 1PQWA 5G4LA 3A06A 2NVBA 1A7KA 3D4NA 4Z3DA 2ZCUA 1Z75A 1BXKA 4BO1A 2DPHA 4WE3A 3QVTA 3VTFA 4B4UA 3K96A 1R15A 1PU2A 1P74A 1R4MA 4M55A 4FB5A 4PG7A 4R4JA 3DONA 1ISMA 5B4UA 1E5LA 1I2CA 3L6DA 7ADHA 4R9RA 4LMPA 3RUHA 1P1JA 3E9MA 4NU6A 4AG3A 4CQLB 1ZJZA 4WECA 3SC4A 4CMEC 4O59O 1DRVA 5F21A 4YJFB 4IS2A 4JNKA 3E18A 4TRMA 1UXIA 2JAHA 5AQ1A 3BAZA 5JMPA 5C7OO 4E12A 3DZBA 2R2GA 1VLLA 2I5PO 3WGQA 5TIIA 1YQXA 1AN9A 3C3XA 2EWMA 4L73A 3KYCA 1R12A 3CE6A 4INAA 2FOIA 2YFQA 3OQBA 4ND2A 4GSKA 1X15A 3HDYA 3TZHA 2NNLD 1JDJA 4Q3NA 3IAHA 3F4LA 3OIGA 2BMAA 3BHJA 1S6YA 3GLQA 4IBOA 1Y7TA 4NDNE 4M87A 4Z9XA 1D7OA 3RWBA 2GZ3A 3NTOA 4ND3A 2AMFA 3JD0A 5TS3A 4CV3A 3L0DA 5AVOA 1YO6A 2F1KA 2FR8A 3ICCA 4BMVA 2UV8A 2IRWA 3WICA 2YUTA 5L95A 1NQ5A 5K6AA 4DREA 3U0BA 1V3VA 1UDAA 3ZH2A 3AOGA 1PZEA 3D3EA 3L6OO 4N5NA 3L9WA 1KERA 1KC1A 3Q3CA 2YY7A 1C1XA 2ZCVA 3O38A 4L9RA 2X0IA 1ZK3A 4Y67A 1PS0A 5CDTA 4W82A 5JAIA 5HA5A 3ZWPA 5JO9A 2C5EA 2GRAA 4GI2A 1T26A 1F8FA 1DPGA 3CMMA 4XRRA 4GSLA 1H6AA 1VRWA 1DSSG 2Y68A 5F1PA 4ZQFA 4CV1A 2D3TA 4BKRA 4YJHA 4YPOA 3JQ7A 3PGJA 5I8WA 5IXYA 1XA0A 4PRLA 1ZEJA 1ZZEA 4F3YA 3ZHBA 3WOHA 1I3KA 3DB2A 2V6MA 1HDOA 1PQPA 5BSFA 2XAAA 2X22A 1RM5A 3Q9NA 5C7LO 1ISFA 1RM0A 3F46A 4BGUA 5KJ6A 1XHLA 3B6ZA 4XGKA 1NFFA 2PV7A 3E5RA 3P19A 3HZZA 3ZU4A 1D1TA 2HMVA 4KOAA 3DMTA 2OBNA 1UDCA 1UAGA 3C85A 4F45A 1Z74A 4Y98A 4AJKA 3DOJA 3RUIA 3WS7A 5KNLA 5HRUA 1Y8QA 4CM8A 1HYHA 2CDCA 2EG9A 2IEBA 1F8GA 3GFGA 3PZBA 3K8ZA 4G2NA 4HNHA 4XQ9A 3WLEA 3RU9A 5DDIP 1LXCA 3FTNA 3R3SA 4QQRA 1GTMA 1MX3A 1I30A 3E48A 2UAGA 3EW7A 4UVIA 4P38A 4DC0A 3INGA 4UVEA 3FRJA 2X9GA 1T2AA 5A3JA 3I9NA 1OMOA 2HRBA 2Y05A 3JQ9A 3NAQA 1ZSNA 4C7KA 4OJNA 5BT9A 3H3FA 1E6EA 5JYEA 4FOOA 4GGPA 4EJMA 3JQ9C 3H9EO 2FSSA 2NVUA 1E3LA 3FWNA 5IZCC 2ZTUA 3MJTA 3UUWA 2YQ5A 3ZWWA 1LDNA 5A02A 4E2XA 2ZTVA 4I9NA 3F1LA 4S3MA 2NTNA 4NBTA 4NFYA 4NH4A 4TRNA 3OM9A 4RPKA 2HJSA 1LDGA 4FFPA 4XDYA 2VT3A 2B69A 1V8BA 3LVFO 1GADO 1BXZA 1QP8A 2BGKA 3EMKA 4IXWA 3QW2A 4J4TA 1UAYA 3G17A 7MDHA 3TOXA 3TNLA 5JS6A 2X0JA 4FFRA 1GZ3A 1OC2A 3ENNA 4Y9DA 1GD1O 4KP7A 3GK3A 1TB4A 2R00A 5KJ1A 2BH9A 1SOVA 2HLPA 4GKBA 1E3IA 3GDFA 4K26A 2AQHA 4HADA 5DBGA 1EUZA 1X1TA 4CLRA 3QY9A 4KUEA 4AJEA 1EQUA 5KCZA 2H6EA 4D0SA 3BYZA 4LGVA 1HE5A 5AXDA 4A10A 5I7EA 3W6UA 1BW9A 1ZVMA 3CH6A 1U8XX 3BTOA 2Q99A 3M6IA 4B8WA 2JKVA 5AXCA 1CWUA 3K30A 4RPGA 1B8VA 1NR1A 1ONOA 2F00A 3Q0EA 3HN2A 4D45A 2I66A 1G6KA 1NPDA 4DPKA 4NIMA 1BWSA 1WW8A 2P91A 3AOEA 1TXGA 3BHMA 4I5EA 1MP0A 2VYVA 1KEPA 2DTXA 1ZK2A 1LBEA 4J4BA 4Y6PA 5TJ9A 2NSDA 3QVXA 1H0KA 2CDAA 4LW8A 4XGIA 4EDFA 1SEPA 2VN8A 5JMWA 1GYPA 4O5OA 4CM7A 2QYSA 1V35A 2DBRA 4S1VA 1JKFA 2Q2WA 3DBRA 1IZ9A 1NFRA 4CLHA 5KVCA 4P8RA 1YL5A 4IDGA 4UULA 3ZU2A 3MJCA 3JQCA 1PR3A 2DTEA 3DO5A 4R16A 3W4JA 4BNFA 4EJ0A 3GZ4A 1ULUA 3H3JA 3OP4A 2EP7A 3P2YA 4W9NA 1DIGA 3DAFA 1NQTA 2XXJA 3VPFA 4LRSB 3AM5A 4AJ2A 2AE1A 4BHTA 4CMAA 3WQRA 1ENYA 1PJLA 4CM4A 3HUDA 3ZNPA 4XYLA 6LDHA 5L3ZA 2Z5LA 2OO5A 3PHJA 4XR9A 3WBFA 4B79A 4IQ8A 4OKIA 1ZH8A 4TMFA 5A1TA 3A14A 1QORA 2BFMA 5J23A 5L51A 2O23A 3CKYA 3AM3A 2EGHA 3WWYA 1JN0A 2QHXA 3WGYA 3JV7A 3IS3A 4I1IA 3VZPA 1LSUA 1DRUA 4U8GA 3WYBA 5ER6A 2P4QA 4CM9D 3DTTA 3NUGA 3AUSA 4MVJE 2NU8A 4CUZA 3VHRA 1YWGO 2BGLA 3ZV4A 1I2BA 1KS9A 1LRLA 3NYWA 1FJHA 3WFIA 5IAAA 1IZ0A 1R6DA 4J0EA 4O0LA 1ZW1A 2QRJA 1IULA 4BKPA 3U9LA 1PJ3A 1XGKA 1M6HA 3E03A 3JYLA 4M89A 1U5AA 1BTOA 5MGBA 2Y67A 2FHSA 1H93A 4D3FA 3VTZA 1UXKA 4IJKA 1KETA 2A92A 2PGDA 5FFFA 3Q11A 4J1SA 1A9YA 4NMHA 3P2OA 4LVCA 4J1TA 1FXSA 3DZKA 3H9JA 3S1LA 4J1QA 2JHFA 1KVTA 2CD9A 2VRBA 4CV2A 3KYDA 3K9QO 3KSZO 2SCUA 3WNQA 1B16A 1I32A 2CNBA 4EUFA 2QYTA 3G49A 1R0LA 1HF3A 4YCAA 1LX6A 4U5QA 4K9DA 3RBZA 3NJ8A 1Q7GA 3VC7A 3SVTA 3PIIA 4MVJP 4XYEA 1MV8A 4FR5A 1N7HA 2JFGA 3T7CA 4IMPA 4DIOA 5THQA 4YAIA 4YXFA 2IODA 1Z6ZA 2CY0A 2IZ1A 2PH3A 4HUJA 4XYGA 3PWKA 1NVTA 3ST7A 4BNLA 3ZWYA 1YH3A 4J0FA 1SBYA 3G0OA 4DYDA 2AQ8A 1ZNQO 3O26A 3ROKA 2YV2A 3INRA 3TL3A 4D79A 2OORA 4PLCA 3B70A 5T8KC 2Q1SA 4E2WA 1YQGA 2VUSA 3GZNB 3OECA 3PYLA 1MC5A 4MOWA 4Q3EA 2FP4A 2E6UX 4OSPA 3V1TC 4G5HA 1Q0LA 3UHAA 4ZN6A 5CFZA 1DC4A 5JFOA 5BNIA 1D3AA 5I9LA 5BSGA 2WE8A 3EYWA 3IUPA 4I5GA 4ZQGA 4ND5A 2ILTA 2O2YA 2ZTMA 3AFMA 4ND1A 3GA0A 1NTOA 3PEFA 4U0JA 1NNUA 1HDGO 2JCVA 5TC4A 4CQMA 1T4DA 2Y1DA 2J5KA 3VPHA 2NM0A 4WNIA 1AHIA 4GKVA 4XGNA 3OIFA 1E7RA 4IXTA 4FC7A 3NV9A 1Y8RA 3SBOA 4QT0A 1QV7A 2Q1UA 2NUAA 2B35A 2UDPA 4RZIA 4OYRA 1PJ2A 1I5RA 2CF6A 4X54A 1U7TA 2AQKA 3EGOA 3Q2IA 1TVEA 4FD3A 3QWFA 3UF0A 1H6DA 1W73A 3UXYA 2E48A 3IKTA 1PR9A 4FC6A 3AJRA 2IYPA 1N9GA 1ZBQA 5TT1A 3VDRA 4HX5A 2PNFA 3ZHXA 2YYYA 3DZFA 2DFVA 2GASA 2JAPA 3FNFA 3L07A 3KETA 3ULKA 1JKIA 4GWGA 4NJMB 3RJ5A 3S2EA 1MXHA 3AWDA 2VQ3A 3UN1A 5JCXA 1H94A 1R16A 2NQ8A 3ITKA 1HE4A 3QIVA 1DDOA 3W6ZA 4R01A 1P77A 4MVJF 2AHRA 1CERA 4NK4A 2OP0A 2Q2QA 4J7UA 1BVUA 1X14A 1RM3A 2CVQA 3BTUA 4E5KA 4J90A 3PHIA 4TWRA 2QRKA 3JYPA 3QQPA 1Z73A 2Y99A 3I4FA 3VPSA 3PI7A 4PZCA 2X0NA 4OIMA 2GUGA 4BO3A 3RD5A 4BV8A 3MOIA 4DUPA 2O3SA 1KIFA 4WKGA 1ZFNA 4E13A 4GLLA 2EF1A 4H7PA 1FDUA 1CYDA 3IKVA 3GAFA 1YBMA 4HFNA 4DLAA 2BD0A 1SB9A 4Z0TA 4CQLA 2O3JA 2TMDA 4ZU3A 2ET6A 2EW2A 5LDHA 4HWKA 4OQZA 3O8QB 1GU7A 4YJFA 1BXGB 1E77A 1IOLA 2ZB4A 4J16A 2AG8A 3WGZA 3NT2A 1LSOA 4MPDA 1UZLA 1GCUA 4DA9A 3PDUA 4Q3DA 2Y1GA 3UVEA 1RM4A 3MWEB 3DDNA 2RCYA 2W2LD 3BMQB 3EK2A 3KVOA 4JXKA 2FZEA 2JJYA 3ETDA 4YRAA 1OC4A 3WIDA 1HDCA 2BGMA 1T2DA 2QRLA 3L4SO 1ZMTA 5KVVA 1TLTA 4UUNA 3RIHA 3HWRA 2D5CA 2H5LA 4IQGA 4W4TA 3JQAD 4ESOA 3W4KA 4M86A 4PG6A 4CL8A 2QW8A 6ADHA 4J9VA 4PLPA 1M75A 2RHCA 2IE0A 1AE1A 4WUVA 3I9OA 4URFA 2GZ2A 2RHRA 1D4FA 1HLPA 1E7YA 1P44A 1HKUA 3ENKA 4WCDA 3HFGA 4UVDA 5JY6A 1NX6A 4R9SA 5EPOA 2J3KA 5I9MA 3GVHA 1MGOA 3ASVA 3PJGA 4BOYA 3V2UA 5T64A 1LU9A 5DT9A 1LC0A 1U3TA 1E1KA 1DLJA 1GUFA 4OH1A 1DHRA 2BRUA 4CMIB 1K2WA 3HADA 3KXDA 2DPGA 3L4BA 1GYQA 1Q1NA 2DBQA 2V6BA 4MVJD 4CM5A 3OJLA 4TZTA 4KQWA 3HQ4O 8LDHA 2W2KB 1YJ8A 3D5TA 4E33A 1EEHA 2D1YA 1UH5A 5DBIA 3F9IA 4Z0PA 3LDHA 2CF5A 2WYUA 4RF3A 1HDRA 1EUCA 2BFOA 1E1MA 3OEWA 4FFNA 4MKRA 3VVCA 5F5NA 4BB5A 4D46A 1VL6A 3DBLB 4IGFA 3H9UA 1UXJA 3JYOA 4U6QA 3ZHZA 5T67A 3KRTA 3RC9A 1L7DA 3AI2A 1R66A 5CEEA 1B3BA 4WLEA 2NADA 3JD4A 5G2OA 4PGFA 1QYDA 3WX0A 1N1EA 1VJTA 4J7CA 5G0UA 3NGXA 4KZPA 1DFGA 1HYEA 2BELA 1N92A 2A94A 3R6DA 5U1PA 4BO6A 5IJZA 1SNYA 4YVFA 3QHAA 2PZMA 3IL2A 4FPXA 1DB3A 2V7PA 4Y6RA 3R0IA 5JC8A 2I9PA 1Q7BA 1SB8A 3GF4A 1M6WA 4A26A 2HSDA 2X9NA 5L45A 3TFOA 4RF4A 2C07A 3LZ6A 3H7AA 3BZUA 3EAGA 3UICA 3HDQA 1JAXA 3GFBA 3NJ4A 3EY4A 4O63O 4AVYA 4PLWA 3GEGA 1KVUA 4A73A 3OBBA 2B5WA 1NHGA 4EYEA 4CPDA 3W4IA 1HWYA 2YW9A 3QLJA 5JDIA 3V5NA 4E5MA 1ISIA 3I9MA 1EZ4A 4KWIA 3ZV5A 2EKQA 3CZRA 1LI4A 3E6AA 1GPDG 4F46A 4N7RA 3EVNA 2YHIA 2YJZA 3GVIA 1HE3A 3LT0A 3TRIA 1K6JA 4UUOA 1WXDA 2GLXA 4UUMA 4BGVA 4EJ6A 4WLOA 3FNEA 4JJIA 3LYLA 3ZNNA 3OA2A 2VWQA 4JJGA 3DZJA 2NACA 5IN5A 2VT2A 3QWAA 2IZZA 3GOHA 4RVGA 4ZD6A 4P4NA 4RVUA 3MZ0A 2DC1A 1GR0A 3FWZA 3SC6A 5A9SB 4AL4A 1I3MA 5JPIA 2GD1O 3GGGA 4GGOA 1V6AA 4BKQA 5TF4A 3N58A 4JGBA 4BNJA 3K6JA 5EJ2A 1YBVA 2B36A 1NAHA 5KJFA 4DLBA 3LC1O 2BFPA 1WVGA 2O7QA 2O4CA 4IY1A 1SO8A 3C1TA 4CLDA 2UUPA 4M1QA 3WQQA 3ZWXA 1U28A 4II3A 2NV6A 4RJTA 1LLCA 2GCGA 2Q3EA 4K6CA 1UJMA 4A2CA 1ZSYA 3LQFA 3S55A 4BIIA 4DGSA 5DCWA 1LDBA 1Q0QA 2CFCA 3KTDA 3DFZA 2GO1A 2GYYA 4QSMA 1PGQA 2EGGA 3GT0A 3SX2A 3WTBA 3PLNA 5KVSA 1MB4A 4XZ3A 3Q2KA 2V6FA 4Q3BA 4E32A 4AJPA 4IDCA 1ENPA 2CUKA 5BQFA 1P33A 1P0CA 5JXWA 3DHNA 3DAPA 1BRMA 2O48X 3LF1A 2ZATA 4FGSA 5K6AC 3PYXA 4L0QA 4QFCA 4WPGA 3PXXA 3FD8A 5CAEA 2G82A 1WPQA 3QVOA 4QFDA 2DT5A 3D3WB 3ZU5A 3E9QA 3KO8A 3IUSA 3I9JA 3ZWCA 3UFXA 1E6WA 4DBVO 2DTDA 1GQ2A 3F47A 1AXEA 2DAPA 2PZLA 1G0NA 4YB8A 2JD1A 4MIOA 1A71A 1IYZA 3HJAA 4B7UA 1LQTA 1PS9A 1MFZA 5CHEA 4TVBA 4HKTA 3V1YA 3QVSA 4WLNA 3D7LA 3H5RA 3I83A 3DC2A 5IZ4A 1ML3A 4FCCA 5I7VA 3GNTA 2GSDA 4NPCA 3BTVA 3CINA 1XLTA 4WEQA 1JTVA 2PLAA 3G1UA 1JAYA 4FJ2A 1LC3A 4GWKA 1HETA 4DC1A 1HZZA 1NHWA 3Q1LA 4YRBA 1NASA 2RIRA 4IUYA 4DXHA 1VL0A 4CL3A 3GH3A 3M1LA 5T5QA 3RUFA 4JROA 1MC4A 5GY7A 5COBA 3RROA 2GF2A 3VPXA 4KQXA 5TGDA 5BSHA 1P1RA 2PKQP 3R3JA 3WGOA 1XIVA 4CM1A 4GX2A 2FWMX 2Z1NA 2X8LA 2G76A 4MVJH 2HO5A 1VPDA 4GX1A 1RYEA 2FPPA 1W4ZA 1R0KA 3C7CB 4BNKA 2W2LA 5EIOA 1R0SA 3GNSA 2C0CA 2FMUA 4OGWA 5FI5A 4Z6KA 3U3XA 3DMTC 2FR1A 1T4BA 4XJTA 2FN7A 4XYBA 5JC1A 2GN4A 3ZWBA 3OJFA 3QA9A 4GVXA 1XEAA 3F3SA 2HUNA 2WWRA 3M2TA 1A7AA 3S2GA 3OMLA 4WCFB 2J5RA 5HTOA 2FY8A 2GN9A 5B12A 1J49A 4B4VA 2WDZA 1HT0A 3M2PA 5A04A 2ZJ1A 1DO8A 1B8PA 5A4DA 1PZFA 2VZ0A 4F6CA 1RPNA 1YONA 1YKFA 3OJ0A 3EZYA 5JDCA 1W0CA 3OJEA 1ULSA 2C59A 1A4IA 5JAQA 1DAOA 2HMTA 3KYBA 3MOGA 3JYNA 4NZ9A 5EQFA 4BKUA 3VH3A 2YHIB 4D3SA 2OMEA 1MG5A 3KM0A 1TT7A 3HG7A 5EQDA 2FPGA 3C1OA 4GL4A 4YT2A 1VSUA 3N7UA 2OXIA 1E5QA 2HMSA 2AG5A 3H6KA 4LCJA 4YR9A 5JSFA 4FJ0A 3FBTA 3F6YA 2X5KO 1QYCA 3STHA 3TFQA 5CPFA 1XG5A 1T2CA 4ND4A 5EMHA 3QWBA 4ALKA 1OAAA 1UDBA 3NKLA 5LCXA 2J5QA 2QZZA 3GZNA 5CDUA 4G65A 3LLSA 3RFXA 1O9BA 3ETGA 5CEFA 2CVOA 2IYOA 1EVJA 1ZO8A 5IDWA 2W98A 4LMRA 2ZQZA 1EQ2A 2O7SA 2R00C 4YAGA 1BG6A 4BNHA 1DC5A 4QTZA 1SAYA 3U5TA 3JQGB 1XYGA 2OBYA 3FNHA 3RJ9A 4YDRA 4PCVA 1J5PA 3KLPX 2XXBA 3SLKA 5H82A 3IP1A 4Z9YA 4BO5A 4Q3AA 1ZSVA 4XA8A 4GQAA 1FMCA 1T1SA 4M8SA 3PJDA 3HB5X 3ICPA 3UCFA 3V1UA 1LDMA 5FI3A 2WD7B 4AJLA 4ZGWA 4R3WA 4PG8A 1C0KA 3VH4A 4RLHA 1UR5A 2DU8A 3RUAA 3TN7A 3TOZA 3U4DA 4FFMA 1DFHA 3WFJA 1P45A 1CJCA 4CUKA 1WP4A 3H8VA 3AOEC 4WK6A 1HTBA 4OKNA 2I76A 1ADCA 1PJCA 2NU6A 4DL9A 4ALNA 1I33A 2DUWA 3IOYA 3PQEA 4NJMA 3RC2A 4BMSA 4YQZA 3DTYA 5BSEA 1ZCJA 9LDBA 2P5UA 4L75A 3GN1A 3ASUA 1L7EA 2D59A 3FI9A 1DHTA 3D0OA 4QUKA 3X2FA 2VUTA 5G0WA 3HB4X 4WLFA 1LDYA 1KY5A 2PKQO 2EV9A 1OBFO 5I8ZA 3N74A 5F5LA 1VL8A 3QE3A 5JCJD 4JN6B 3TDKA 4BNZA 4W9NC 4BO2A 4KUHA 3LK7A 3K92A 4JJFA 4I5FA 1ENOA 4OXKA 2VTEA 1UP6A 4JX8A 2GERA 2HKIA 1SC6A 2DBVO 3CIFA 4JP3A 4PLGA 4YT4A 3FTPA 1QYWA 1U9JA 3BA1A 1Z7EA 1KBZA 4RQTA 3JQDA 2QQ5A 2P9GA 3VKUA 1NWHA 3ZHYA 1UZNA 5ITWA 3UAGA 5EN4A 3ADPA 2AEFA 4LN1A 4OM8A 3ORFA 4A0SA 4LK3A 4AJ4A 1IPFA 4AJOA 2VYND 3O8QA 1IY8A 3ROQA 4CODB 1BXGA 1H9AA 3KEQA 2Q1TA 3JQAB 1WNTA 4PVCA 4BUCA 3HNPA 4IM7A 2BLLA 4YA6A 1BMDA 4Q39A 2VRCD 4A27A 4RVDA 5IF3A 3BMQA 1E3JA 1E92A 4JBGA 2QX7A 5DF1A 4L76A 1EDOA 1M76A 4ZQBA 3ZWNA 4PLYA 4J49A
chains in the Genus database with same CATH superfamily
5FUWA 2V6JA 3DE0X 3KHTA 3ONEA 3ADCA 1XWFA 4MH0R 1H4QA 2PSDA 3Q7EA 3T0IA 2FFJA 4HQOA 1UWKA 2LTAA 2QI9C 4S1NA 4RD0A 3LT2A 1XZAA 3I3SR 4PX2A 4RVFA 5L7WA 2INGX 3OZEA 2Q4BA 1IWPB 4I9FA 1V9LA 2GKOA 4EMTA 1RI4A 3IGFA 3T7KA 1NQOA 1ZYUA 3PGMA 4BLTA 2H9YA 2Z30A 4AJJA 4C06A 5SY6A 3UGKA 2OV3A 2YRFA 4G0PA 4GPTA 3RYHB 2ATCA 2Y8EA 3A6DA 4I3FA 3GH1A 1IU9A 4A03A 2QTVB 3ETLA 4WA7A 4BV9A 2CVHA 4INPA 4DCMA 1RI3A 1CZHA 4IXMA 4CLOA 1ZKMA 4HSEA 3C70A 1GRCA 3P4UA 3G3EA 3FPLA 5JSKA 1LJUA 1KHHA 2PQ2A 3SCZA 1YQWA 4FJ1A 4ZALA 1ZCAA 3ZD8A 4ZICA 1K4YA 3O8RA 2ZQYA 2P7HA 4ZVMA 1ACMA 1WPGA 2OGUA 3UKDA 1KI9A 5BSRA 2WYOA 1SUBA 4K6OA 4XQ0A 1A96A 4D0RA 4I1PA 4U9UA 1XNJA 4BQPA 3I30X 4GPBA 1GN8A 4G0OA 2ZTHA 3RG8A 2Q1WA 4RFVA 2FZKA 3HI6A 5GZ6A 2OORC 3T7SA 2HK7A 3M1YA 1Z6YA 4IIJF 1I3NA 1OE0A 5U4QA 3IRVA 3PTZA 3GU3A 3JVVA 1YS2X 2HHHB 1ZUD1 5DYGA 3AK4A 3HVIA 2EZUA 2PH5A 1Z82A 2L82A 3MB8A 4I50F 1PNOA 4LEIA 2V9CA 3L7KA 2WZBA 1TC2A 3GGCA 1PJQA 3AKYA 2I91A 2WM8A 4HMPA 3JD2A 2PTHA 4JSYA 3DPSA 4C4OA 4H60A 1L7MA 4U4AA 1EVEA 1JHUA 3GHHA 3G5LA 5CXXA 4TTTS 1VP9A 3VO9A 4R51A 4V0LA 5SY4A 1ICEA 3KS9A 2VR1A 4QO7A 3H16A 4NK5A 1AQNA 3WB2A 3IJRA 5KOHA 1F12A 3QVLA 1UMKA 4LHEA 4NDZA 3ICVA 1DJQA 2JBAB 4XGQA 4Y2JA 4EUHA 4MTCA 4HQLA 3CA8A 2FF7A 4G0MA 4WY2A 1XD8A 2REQB 2Z83A 1SCNE 3D4LA 5H16A 3VVBA 4Y6LA 4FOTA 4F5DA 1T1IA 3RBXA 3UJAA 4WZBA 2PD6A 1K5HA 3D7MA 4BO8A 1RACA 1XZJA 4FHDA 4H1TA 3MD9A 5K8LA 3UW3A 2GEVA 1G7RA 5KJCA 1NE2A 2ZKIA 3G2MA 2JKZA 4R1UA 3BFJA 1Q7TA 5A3QA 2J87A 3KZVA 1AMUA 2B4QA 2PV0A 8ADHA 1YNSA 2RH8A 5KO2A 2F3TA 2R9VA 8GPBA 2VP0A 1PZHA 1G3IA 2C5SA 2B25A 2C9CA 1K0UA 3AQ4A 4C4ZA 4HAYA 3WJ2A 1JW9B 3DFFA 4RWZA 5JHGB 1U2QA 3BD6A 3R3VA 2Z9CA 2FDRA 1Y4ZA 3COSA 2PRYA 2ZE8A 1WSBA 3KQQA 1E2BA 2C2HA 2D00A 3LBIA 2EBUA 4R3NA 1LWOA 4TL6A 3PXGA 4F3KA 1G9TA 1TNDA 3SZUA 2D5LA 5JNTA 2A88A 1WQ4A 3Q5DA 2PTGA 2Q4RA 5REQA 2DSNA 1HDXA 2GCIA 1UEXC 1Y42X 3L84A 2VYCA 1T34A 4JYMA 4ZQHA 3PR3A 2XIQA 5IC5A 1YS1X 5E9JA 3U7IA 3HLKA 5H9VA 2NUTA 4N40A 1IRXA 2D2FA 4B8ZA 4H6WA 1OPRA 4II2A 1SG6A 4YPVA 2J3JA 3LKDA 2I6SA 1T4GA 5EI5A 2QGZA 3BE5A 3O8NA 3Q9LA 4RGBA 5IXJA 1QQ7A 5HKBA 4Q05A 2GTIA 3NX4A 2ZJOA 3MPUA 4AP5A 1C14A 5KSOA 4X1IB 5K0ZA 5AFSA 1IJEA 3EZNA 4UUQA 2G83A 3LC7O 3QPVA 4IL5A 3QQ5A 4HFRA 4CDGA 4YRNA 4H08A 1EVYA 1IY2A 1I0ZA 1NZDA 3AW9A 3AU8A 1XZGA 1XYVA 3MTGA 4DMMA 5C5DA 2WFZA 4RZHA 3USZA 3OZVA 2GD0A 3M6MD 3HVUA 3FCAA 4TROA 4BV3A 1RI2A 3AEKB 3LRXA 1U0NA 2OBFA 3U7HB 1W9MA 3DB1A 3D8SA 4JKIA 2BM1A 3PKIA 3CWCA 3P9YA 1MG0A 4HNGA 2X9LA 4ZKDA 1RYHA 2Q5FA 1CUBA 4LDAA 2E4XA 2WQ7A 4IG9A 4MLPA 4ZDIA 3DFKA 4JY7A 5F3RA 3UBMA 1VKHA 4L6CA 5G1NA 5P21A 3OEED 4DUGA 1F38A 3AI1A 1TIPA 3ND5A 4UOEA 2JCYA 2YJGA 3GYGA 2QUJA 1H3FA 1Z29A 2X2FA 2ZWMA 5HF6A 3BGIA 5L8VA 1Z7BA 3BMCB 5JCZA 1FDVA 1QO0D 1DG9A 2BP7A 2J67A 4JT2A 4BVHA 1RJ9A 4CG0A 3BJEA 2CN1A 2ZIEA 1MJNA 2WPNA 3ENQA 5JEEA 2CXRA 1SZPA 1HXHA 3A8TA 5G41A 1Q20A 3NTVA 3IUBA 4HLUA 3EVCA 3G02A 1DQRA 4N5LA 4RPHA 5PGMA 2BONA 2ZB8A 1FDOA 3IBYA 1C9EA 4MPTA 4C4RA 2I2DA 2WJGA 3ZBTA 2NGRA 3BD7A 3L41A 2HSGA 1BVYF 2NZWA 3AESB 2Q5JA 4DOMA 3I2GA 1GV0A 1CJKC 1PJZA 2ZRAA 3I8OA 1XEXA 4FNMA 1XMIA 4M0MA 4XWYA 3D3WA 2FMIA 2DLCX 4PO1A 3LRTA 1GM5A 4N18A 2AXNA 5K01A 2MT9A 1V0JA 4QBGB 2ORVA 4R69A 2Q27A 4Q4AA 1G59A 1Z17A 2QYOA 1QP4A 3REFA 4F7WA 1H5QA 4R54A 4C03A 2WIBA 1L5SA 3AERA 5DRTA 5B2ZA 1QVAA 1ZNZA 2D7JA 4YRDA 2F3SA 3L0SA 1EA7A 3DL2A 4OB8A 3SKXA 2RCNA 4YWJA 2QRZA 1EE9A 2RBKA 4EG7A 1TI7A 1DJNA 2ZJ4A 1W52X 1U4OA 3FVTA 1UXGA 4NF2A 4WZAA 3PB3A 4PTLA 2FJUA 3UJ3X 1QG2A 4QU5A 2J3EA 5CVTA 2RGGA 2VUHB 2AYXA 2WFLB 3JQBA 4MI1A 5HW0A 4HH3C 4PFJA 4YRCA 2NTYC 4DF3A 4EUEA 4MIKA 4WGGA 1WV1A 3IUNA 3PDIB 1FFCA 1WE2A 3A32A 3WR5A 2YQZA 1YVRA 4UBLA 5ALMA 4N3CA 1TKRA 1RPAA 2I33A 3P2JA 2ZRFA 5GAJA 3ZC3A 3A0UA 3ZIAA 5ICFA 1FUUA 3E2PA 4OGLA 3TL6A 4LF9B 5CA0A 3S0JA 4BP9A 1VQ1A 3L18A 1FMFA 4B7XA 2GN8A 3OOEA 3S7TA 1PEYA 1J7JA 4LTNA 3K73O 1GTZA 4EG3A 1YCGA 1AB6A 5D86A 5CDSA 3WI7A 3GG9A 1Y4DE 5FO1A 1WDLA 1KI6B 1YUMA 3FYDA 3REOA 1CIVA 3A1SA 4DV2B 3H0CA 5HCUA 5IDQA 1FYWA 1R3DA 4FS3A 3RUDA 3PG5A 4ZRMA 5FCDA 3RIEA 1UQUA 2ZRLA 5MFPA 4YT5A 2XJ9A 2ZS9A 2IK8A 4IXDA 3ESRA 3MJDA 4KE9A 4A8PA 4CCYB 4QQNA 3IBGA 3F4KA 1PQUA 1NVKA 3EGDA 3NAMA 4I81A 4KQ6A 1XELA 3A05A 4Z1OA 3BZBA 4IZIA 2OT3B 4IIHA 2C00A 4WCFA 1ESCA 1YR3A 2VP2A 4DSUA 4ZA2A 2B83A 1MW9X 2O2ZA 4ZOCA 2R751 4GLOA 1BU5A 4EKYA 2C5FA 3ANMA 2GGSA 3HDGA 1CYEA 1C1DB 1XDDA 4Z3KA 1ESMA 1V16A 5TEWA 4CJXA 5FUXA 2GWRA 3C3JA 4B47A 1G4AE 1VECA 5EMJA 1VLMA 2FTKE 4DLVA 4E15A 1J5EB 1PR0A 2D13A 3EULA 3PQ3A 4GF5A 3IPLA 1H2RS 3AW8A 3F74A 4DIEA 5JH7F 5ECGC 3MCAA 4E2YA 3MWJA 2COUA 3EAQA 1RZRD 1I01A 3DOIA 3FYUA 5DYTA 4EHJA 3ILSA 4Q7EA 3JAKB 3R7LA 4BV2A 4Y6QA 5KNCA 3G9ZA 3BL5A 4RDHA 1BA3A 1VKNA 3HY3A 4AJIA 4ENSA 5ELLA 4OKSA 3PWZA 5CB8A 4R8KA 2I4TA 3HJBA 3IODA 4QKQA 2XRFA 1HFWA 4OY3A 5FQOA 4B2YA 1NVMB 2XDQA 3I05A 4IDAA 621PA 3QKTA 5DMHA 1MPXA 3RAGA 3SXUA 4KXLA 3S2YA 5HM8A 1TZ2A 1DKRA 2PL1A 3F7TA 3FDFA 4UUBA 2AOTA 4FGKA 5GIPE 4X8HA 4LGYA 1O6ZA 1M10A 1Q2UA 2P77A 3R7SA 4DM4A 1A88A 5LMCA 5AM0A 4AMYA 2NZJA 1US8B 4Z86A 3GHYA 2H1HA 3BILA 2XZTA 4B34A 2XY4A 5K0BA 1JQ5A 1ZJ4A 2IHVA 4OJMX 2GAFA 2WU4A 1JQ3A 4BNXA 5JW6A 5JVDB 4B7CA 1QH1A 2YNMA 1SD5A 1ZEMA 1V1MB 4CM6A 4XR4A 4DNOA 1V1RA 3IFSA 3O03A 4FILA 4GPD1 5M29A 3LIPA 4E7PA 2IPMA 1CF4A 1QF7A 1M33A 5JUWA 2RC6A 3U3OA 2WTBA 3R9IA 4Z4HA 2XLCA 3UTDA 3JQGA 2R47A 4KXUA 1MA0A 4EEXA 1AUVA 2ZYHA 2ZSEA 3PQFA 5FOSA 4D96A 3I4LA 4LPKA 2FZWA 1TUEA 4C0LA 2IYYA 2HPZA 2WICA 4QEKA 5EC8A 1ZIPA 2BWJA 1QGED 2VCYA 5GV8A 1RNLA 5ADUS 5EJ6A 1PUJA 3AP1A 2J07A 1Z6TA 1V5GA 1XZMA 2VZLA 1JKXA 1E63A 3UIEA 1GFIA 1HMYA 2AJLI 2CLSA 3TGLA 1A5ZA 1BYUA 1QANA 2JLVA 1SC1A 2VP5A 2HRRA 4BBAA 4DQXA 4ARSA 2FEOA 1R8QA 2VOEA 4QUDA 3PV0A 2ICAA 2H1IA 4QYSA 5C2JB 1C9JA 1CY2A 4NI5A 5LL6P 5CH8A 3MTQA 4HCJA 3WIVA 3WRYC 1QSGA 1TU4A 2BKAA 5AVQA 2V7UA 1X80A 4RNDB 4FFLA 1ZI6A 1NFQA 2ZB3A 3BX1A 5ERXA 3VNAA 1QRRA 3JAWB 3KSMA 3SBDA 4HL6A 1F6DA 4PLVA 1NONA 3VC1A 2VC2B 1VE9A 2WVAA 1NC3A 4JBIA 1POWA 2GB4A 3OIYA 3DFMA 3RC1A 5JE8A 2FZ4A 3EEIA 1JG4A 2XYGA 3JALB 5DI3B 3CNQS 4YRZA 1R4NA 3TNYA 4F8JA 2XD9A 1F3LA 3CVXA 4R40A 4EHBA 1F06A 2BUAA 2YH2A 4EYGA 1BU8A 2KB0A 2IV7A 4IFBA 1LQ2A 2O3TA 3AU9A 3CLTC 2WAYA 3BIXA 1G9SA 3H2ZA 4BJ6A 4DA6A 4L5IA 4I5DA 5FBHA 3NTRA 3OTIA 4YCDA 3UAWA 2I4IA 4K1XA 3I5UA 4K87A 1Q3KA 2V3WA 1VI6A 1CS0A 2HTFA 3ODPA 4GEKA 1E1NA 3KUXA 4GRIA 1HDZA 1UOEA 3T3IA 2AFHE 3AFOA 5EMKA 3VU1A 2AJBA 3GFQA 3WK4A 4AJHA 4EGFA 4A92A 4AUMA 3B3GA 3JQRA 4QUEA 5FH9A 5EJ7A 3AIKA 4HOYA 2YWEA 3RSOA 2C4WA 3DV9A 4GBJA 1KDYA 4BE7B 1VMDA 5FI1B 3EZXA 3INNA 4QE3A 3MIIA 4MAAA 3K9LA 3R24A 4HT3B 1FLVA 2O2JA 4IV0A 1P29A 3BMNB 2Q07A 4DMFA 3U4CA 3L0OA 5FTNA 3E5MA 1JVSA 1D2MA 1VKJA 4N7JA 5EYPB 3KJFA 4YRKA 1ZAKA 2DECA 4I4TB 1IPEA 1A4XA 2NZ2A 2PIDA 2XODA 1NJFA 4TTSA 3OT1A 3WMXA 2GBLA 3V7UA 3JAMA 5G02A 1U0RA 3A6HA 3RI3A 1QRUA 4KE8A 2X4IA 4IHKA 4OHWA 2CDNA 4QYIA 5CCXA 2E5WA 4O4IA 4U5XA 3K9FC 2HIAA 4XD2A 2PSEA 2EIHA 3ID6C 5IVDA 3ZY2A 3KLOA 1VCNA 2REXB 4LQ4A 4J94A 3V8RA 2YYAA 2IXFA 1HA3A 3IXMA 4M1KA 1A4UA 1IUKA 4WY8A 4GMKA 3LC2O 2ZI3A 2XBUA 1N3IA 3DEIA 4UFOA 1YVUA 1H1TA 2F8TA 4FYYA 3VZRA 4H7HA 3FOZA 2P4HX 1AKRA 1G4UR 5E2BA 4QECA 2ZPTX 1WXWA 5K3BA 3SBEA 1HGXA 2X42A 4I2NA 2OP1A 1DMSA 5EP4A 3RVPA 1ZOIA 4C6HA 5HKAA 4LVUA 4HV4A 3ICEA 1RLIA 1SZDA 4RFSB 2Y1OA 1H1DA 5AI5A 1O5IA 2YDXA 2ZRPA 4NFHA 3G0HA 4TKUB 2Q46A 1DKNA 1Z07A 3GLRA 3ABIA 3B6JA 3K09C 1B6TA 3PHBE 4NBRA 3DMDA 4Y6SA 1QBGA 4X20A 4ER3A 1H1LB 1NVGA 1VGVA 3CLRC 1AQLA 4FFWA 4ZAGA 3G13A 3ZGNA 5IFKA 2LBPA 1IL0A 2AL7A 4K28A 1HSOA 4U6NA 1MJHA 2IHKA 3T9CA 1Y4SA 3MAAC 4ASUA 3H5TA 4D44A 5IAOA 2YZ7A 3L40A 1TO1E 1NC1A 1K9VF 2NQTA 4BVKA 4WOKA 4EH1A 1KIMA 1PWEA 1W35A 3SZGA 1PWHA 1QO7A 3P2EA 5DV9A 1FTQA 3G1TA 5JARA 2EZ4A 1GZ6A 1XXHA 5F35A 5C9ZA 5HKOA 4F60A 3HKBB 2FZLA 3A70A 1KRHA 3QU7A 4HDRB 4KAXA 4MIYA 3DBVO 3PFNA 1Y33E 4RANA 2JBHA 4AAYA 2F2TA 4RAQA 3SN6A 3UCXA 4UFNA 2PFGA 3KZXA 2X1HA 3U80A 4EB6A 3H5LA 1N1MA 2VK2A 3KP1A 3IJ5A 4KWHA 3RJTA 4C1NA 5TRTA 3VAZA 4JCOA 1TLFA 2ACVA 3EZ7A 4FEAA 1V3UA 3QOXA 3MJ4A 1WCWA 1CFJA 4MP3A 5HILA 5HKLA 3S68A 3THYB 1C7IA 2CZQA 2WD9A 3OLCX 5K51A 3BFVA 3RYFA 3TGPA 3ZBPA 4DPLA 1FYEA 2ODTX 2A9VA 4M98A 2GEUA 3EGXB 3C16C 2FPMA 1W0KA 3ZCRA 4IX9A 4US1R 3X1KA 1X7ZA 4HN9A 3BHIA 1A72A 1XTQA 3O94A 2C82A 3DHYA 1T10A 4BVAA 4ZCMA 2FEXA 2ZVJA 4M6WB 3BCUA 3ZWMA 4PVDA 1VMEA 4CEIA 4BCBA 4F38A 4LYGA 2ZREA 1OCEA 1V4BA 1XMPA 2CHVA 2CL7X 3ACDA 3B13B 3GRAA 4UM9B 1ZOSA 1E3SA 3GRUA 3LA8A 4YYEA 1THMA 1W94A 1O4WA 4D8VA 1E1CA 2XT0A 3K4PA 2Q49A 4FSHA 2YX1A 4G8BA 3RHSA 4TT3A 3U4GA 4ZI7F 1KK3A 4H7IA 5COQA 4IWXA 4A36A 3ZCPA 1PZNA 3PIDA 4EATA 5HQ3B 5DBOA 4JLWA 4A23A 1N2CE 2G1UA 2IEZA 5JLAA 1MO6A 2FG7C 4Y1RB 1MJFA 2QZPA 1XKTA 4NFLA 3VHXB 4FB4A 2VYFA 5C51B 4LOKA 2LIVA 3W90A 3WLFA 1HRKA 5LQCA 4Z3OA 4BVJA 3DVQX 3Q6IA 4NJOA 1XEWX 3DOEA 1Z39A 3OF3A 4GH5A 4POAA 1L3BA 2C7GA 2HQ1A 3ECCA 1I6KA 3DUWA 2ZRGA 3HZRA 1VSQA 4FDTA 4GOJA 4LZJA 4MS3B 1V5IA 3T5CA 1FPMA 3WK9A 4DBLE 2PZAA 3QFFA 4ECAA 4ER7A 4YYZA 2C61A 1IB6A 1XU9A 2PH1A 3M9WA 1P0MA 3RW9A 5EA2A 1GQYA 4QU9A 2QZ9A 1JHZA 2P65A 3GR6A 1WZIA 5BMVB 4EPYA 3VR0A 1UOOA 3CY6A 5FA8A 3WKBA 4C0XA 2VIIA 3UGJA 4CN8A 1TTPB 1S8OA 2WJYA 1QYVA 1YCHA 1DIRA 2FU5C 3AY6A 3CR8A 3TUJC 3T1VA 3ZE2B 4FE3A 1IBMB 4DIDA 4QQFA 4ZAXA 2PZKA 4J3FA 1O8CA 3OZ7A 4MWOA 3DLHA 3DVLA 2V65A 3JQ8A 3W3ZB 4F9FA 4GW3A 1VJ1A 3LP8A 1BQ3A 1LNZA 1VJ5A 4RKRA 5L4NA 4P3YA 1E2JA 5JWOA 3C8DA 1PBNA 4D82A 2UXBB 4U7HA 1N1GA 2WD8A 3L5OA 2BYTA 2GZAA 3JW8A 4Q93A 3J80A 2VDJA 3PUHA 1PWZA 2H16A 1OYWA 4BWGA 1P1IA 2OGZA 1EBFA 3KB2A 2DLDA 5AKZA 1B6RA 1GUZA 4KNWA 3ZPXA 1IATA 1G3MA 4C05A 1PFYA 1TD1A 3HP1A 4L3VA 1WKCA 4X7BA 3WXMA 5L6LB 1KFEB 2GYWA 1H9BA 1OOEA 1SXJC 2CFRA 5L3SB 4HPJB 4RQBA 3K70D 2B2XA 4PRZA 5HK8A 1L9XA 3TO5A 1N0IA 1LQUA 1JZTA 5HFNA 3TINA 1FDWA 3PF9A 4MUKA 4FE4A 3FMVA 2QXTA 5G4KA 4JUFA 4ONEA 4KQEA 3NC1C 2J4CA 3H1FA 4JC0A 2J32A 1F51E 3U7GA 3KJZA 1E3QA 4N9QA 2O8DB 3I73A 1L4KA 3F4BA 1OTXA 5HF8A 2UVQA 1QYXA 3CEPB 4QXMA 1Q3TA 2H4WA 3AM4A 3G68A 5J2TF 5HM6A 3E22A 1TK3A 4JL8A 3D9QX 4IVPA 3OTWA 4N7BA 4TKMA 4TQAA 3E3MA 5K9ZA 2OXRA 4HLQB 1NRIA 1UK9A 4NBUA 1ZI9A 4MYTA 5DH9A 1KR2A 1XMQB 2FMTA 3NAGA 1QAMA 1FUYB 1NG9A 3REQB 1JG6A 2AOUB 1RWNA 4HY3A 3VQTA 5DM2A 5J5AA 1L5HB 1RYZA 3T4XA 3OZWA 2NVUB 1DMRA 2GHTA 1FRFS 2Z04A 5ES4B 4M22A 3IALA 5GADl 1JIVA 3PZRA 1VZ3A 3BF7A 1FCJA 2RGCA 4WOJA 4R68A 5FPSA 4ERXA 3WTCA 3F6RA 4YJ3B 5IDXA 5IANA 2B1RA 5A5FA 2PR2A 3A3YA 4KXMA 2ID9A 4F6LA 3DAYA 3JD1A 3WZMA 3K0FA 2AE2A 3DE6X 4F2HA 4XVHA 3W2GA 4PLTA 4EBBA 2H2FA 4IVRA 3RU2A 1CU1A 2BF7A 4WACA 4R84A 1P5FA 4K8RB 2LXNA 2XAUA 1NNLA 3DLAA 1NUUA 3ZGZA 2GRUA 1QTQA 2FSFA 4AKTA 2QN6A 1XNQB 4MXDA 1KQFA 1OAKA 4IRMA 1IHYA 5DCUA 1L5VA 3L7NA 1NZFA 3A1NA 2FQQA 4WKBA 3TS1A 1QP0A 2OLJA 3UG6A 2XDYA 3IPAA 5IT0A 3NBZC 1HOTA 3M1AA 1H2ZA 2P3QA 4RLFA 3HJHA 2HTEA 3UHJA 2E82A 4B3XA 3RU3A 5DZSA 3F73A 1RXEA 2FPLA 2XR1A 2NXCA 2QP9X 2XUFA 2Z8YA 4EBFA 1F4LA 1Z38A 3QVWA 3SNKA 3MWDB 2D4AA 1H3EA 1T1JA 2NX2A 1TUBA 2HWWA 1L6RA 4KTVE 3VA7A 4XB1A 1BW9B 3OI7A 4YCMA 1NRWA 3HSSA 4FMCF 2WR8A 3CUEF 1JIXA 3V8MA 3CVWA 4EW2A 5CMLA 5EWLB 3MB5A 3EQ8A 3DDOA 2VSQA 5C8DA 5CT9A 1L5WA 2RB5A 4PG4A 4CTMA 3L4JA 1Z37A 2O5RA 3WGUA 2O7RA 1WZUA 1X94A 5AJWA 4CR8A 1Z16A 4LYDA 1B8OA 4N82A 4W99A 3BC1A 3FVVA 3L04A 4PYNA 4IFIA 5HDQA 5KTNA 2BEVB 4P7KA 4OQNA 1O0BA 1TAUA 1ZPDA 4DNXA 3O6VA 4MQ5A 2ZRQA 1ZD5A 1JKMA 2X3UA 2G9NA 3GJ3A 4JEUA 1OAOA 1HEYA 1RWKA 2NZUG 1EFRD 4U39A 4M54A 3ADOA 1JB9A 4Q4DA 4PBSA 4EB8A 4EM6A 3RVKA 1F48A 2XMBA 4TVSA 5DK6A 1MDFA 4DA8A 1AKVA 4PFSA 2HGSA 4MKFA 5FP0A 2DHDA 3A1EA 3ELWA 3OD1A 5C46F 2X0RA 1Z34A 1DQSA 1TYCA 4D6PA 5F51A 4P9NA 2V5VA 4O5AA 1N3LA 2FEWB 3GPIA 4RD6A 4YJKA 4BMCA 5IAKA 1GCOA 4H1UA 1RQ7A 3IEIA 2P9CA 2QE6A 4HDKB 5EVCA 2AW5A 1YJQA 1GL6A 2QSYA 2VUUA 3UG7A 4PIMA 1M67A 2OPHA 3IP9A 4MRRA 1D6NA 1FP4A 2G17A 1K8ZB 3STUA 3WXBA 3ZWOA 3T1YB 4OYYA 4P54A 2CXUA 3JX9A 5FHRA 5JMTA 2HBYA 4YJDA 5TDHA 3BEDA 4TUYB 1MTOA 4UCXA 4FI3F 3UWMA 1W4RA 2CW5A 4KXFB 2HK6A 1YL6A 1QOPB 4OHUA 2FNAA 2BH2A 4B80A 2GHRA 3FUUA 4H7FA 1ZHFA 4TYQA 5B37A 3ZWVA 4BRUA 2GXAA 5EKTA 1WXEA 1QKIA 3A27A 4EG1A 5HYVA 4DMUB 3ESQA 4JP2A 1DIBA 4GR9A 4PG5A 4IIUA 4D41A 3FH0A 4KTTE 4FIDA 2ID8A 3PX2A 3MMNA 5DFAA 5HS6A 2HJGA 4B3TB 5CDYA 3QH4A 3UA4A 1ULHA 4QOIA 3AH8A 2GEBA 3GEPA 4QHTA 1JAIA 1ADFA 4YX9A 1Y9AA 5DM60 3B1KA 2ERXA 4K6FA 4YMIA 1O89A 2BMEA 1N7GA 3FNGA 2XMSA 4I14A 4RVSA 2H29A 2W93A 3V7NA 4S2EA 2HPHA 4YJGA 1QGYA 1M2WA 3NGLA 4JGIA 1CQZA 2I6FA 3S2IA 2QF7A 3D64A 3WGHA 3WRWA 2DUMA 2OMKA 2A9QA 3V4ZA 3AL0C 3PUIA 5B1YA 1K3TA 2HMUA 1QDLB 2TECE 1H2XA 4O6VA 3LUGA 4LA4A 3KJQA 3J81k 1K8RA 4OX9B 1R8SA 4QLBA 4R3UC 4YK7A 3UMFA 1NX9A 4K5QA 4NCHA 2CJXA 3KNZA 2YOGA 3LU1A 1IAVA 1ETUA 2GHIA 2H1OA 2GJ4A 3AKEA 2RAPA 3CMCO 4XIJA 3TPFA 1M6YA 3D4BA 4MV4A 1FSZA 5HS4A 2C2ZA 2P3OA 2X15A 4MO2A 1CV2A 3WIBA 3AINA 1IJBA 4WN9A 2J5BA 4MEJA 2W8ZA 2P5TB 4K88A 4BE9A 4I1YA 4RCVA 5JI3E 1WJGA 1XR3A 1XP5A 4J2OA 1PTJC 1DEXA 3P1JA 1A9XA 1EJ2A 3CN7A 1YV9A 1DG1G 2SHKA 2EEZA 1ODJA 2DQ4A 1HE2A 3HFRA 3I6ZA 1HNXB 3W06A 4ESHA 4RACA 2YHAA 1CRWG 5SYAA 4B75A 4HN4B 3BVPA 3IMFA 3MTAA 2HA3A 1E5VA 2HOQA 3D2CA 4NENB 4KOEC 4Q00A 1NVWQ 5LYJF 5ED0A 2UZ4A 3MS4A 3DDUA 1U90A 2ZXEA 4O4HF 5BN4A 2X77A 1X8LA 3KB1A 3O8DA 1Z6QA 4B6RA 4WH0A 1RS0A 3BXZA 5IW8A 2VZ8A 1N6HA 1C8BA 1T6BY 3HA5A 2O8EA 4LHZA 2IS4A 2V9PA 3PDWA 1IN7A 2W8BB 5KSWB 1UZUA 3AC0A 4KR2A 4AO7A 4IHQA 3H9GA 5HQTA 1OH8A 1R9MA 4YASA 3HBJA 2CXPA 2DCUA 2Q3BA 1CRPA 1TZKA 4YIHA 3H19A 2PYDA 2XZPA 3BSWA 5H3HA 1PFUA 1XP8A 1U8ZA 1MTZA 2VDUE 2W6IA 3KJNA 3LXUX 3SNHA 4KV9A 4IIGA 4G23A 1K7YA 4TZKA 2VRCA 3TGWA 1O7JA 1PLLA 1EDZA 3DO8A 5D85A 1Q7CA 3QF4A 1P2UA 3DKVA 1IOVA 1XVLA 2ZJAA 1NIPA 3G2NA 4G4SP 4NS1A 4MI3A 1OXBB 4QYWA 4XLZA 1TE2A 3HWSA 4X45A 2V3VA 3M49A 3KE9A 3EVZA 1N2HA 2ZPUA 3O93A 4K03A 1CHNA 4NE9A 1OX4A 1VGRA 4GLJA 4NCIA 4RO0A 5TMBA 2OV1A 4UAGA 3WOVA 2ENUA 3A2LA 4ALMA 3H1BA 3ROEA 1YZKA 1GRQA 1ZMOA 1KH3A 2Y4OA 1L8OA 3ONFA 4HNAB 1J25A 3IHTA 4EA7A 5JAPA 4FSXA 2X8JA 1MQ8B 2Y1KA 1Z5VA 2IUEA 1MB2A 3ORRA 4U1RA 1ENZA 1LNQA 2EQ5A 2Q6TA 5DHTA 3TL2A 5A4KA 3RV4A 1EFCA 1KP3A 1MVOA 4X66B 5JY1A 4AF7A 1OXKB 3N75A 4E7OA 3FX2A 3GCDA 4PYRA 4FLMA 3SAJA 3DNMA 3FN4A 4PO3X 1W85B 1XWIA 2O52A 1P1FA 3E3NA 1YQUA 1L5KA 3PNBA 1OXVA 1NW8A 1YCFA 3VNQA 4E6PA 1YQDA 4OLFA 1N4DA 3R3ZA 4UNQA 1UINA 1ADBA 3GAZA 2F1RA 3JYQA 2IEDA 2IVZA 5WRFA 4E08A 2OA0A 4M49A 1OVGA 2XOXA 3ROMA 2N42A 2VXYA 1O97C 4FZJA 5ICSA 1YDWA 1T2FA 3I12A 1H6BA 5BWMA 5IU6A 4MUXA 1D6JA 5H81A 1PQWA 1PW7A 3EE6A 1Q57A 5G4LA 3D3KA 3L7BA 3TQRA 5CA0F 3O8CA 1XTRA 3THOA 2OC9A 3AR5A 1Z75A 4O2BB 4ZQBA 4RZSA 2Y76A 1RHMA 3CLVA 5EHZA 4OGGA 4AKGA 2XCLA 1UPBA 1U6IA 1XAIA 2JW5A 3P71T 2Z5VA 4K9LA 1DAIA 4DGQA 3KOYA 4EKEA 3HCRA 4Q1AA 1R15A 3BF8A 1FW8A 1W88B 1QV9A 3BZWA 2GN0A 1R4MA 3MBKA 4MV0A 4Y9SA 4PG7A 4ZK2A 3HUEA 1ISMA 2R5NA 1QIGA 3L8YA 1E5LA 3RSQA 1GTG1 1TO6A 3RUHA 2PGXA 4DJ5X 5HUHA 2HJ9A 4NU6A 4AG3A 1IM5A 1IBCA 4BB0A 3KZNA 3LYUA 3N5CA 4F0JA 3SC4A 2RGNC 5JJIA 2CHEA 3D6NB 5EIBC 2NXJA 5F21A 3EMBA 2CZGA 4IS2A 1GA6A 3E18A 5JAUA 4PE5B 3OF5A 2C9DA 3QKRA 1UCFA 4LC0A 5IMBA 1G21B 4ER0A 1VA5A 1P4JA 2DR0A 2I29A 1KJWA 1ODLA 1W9HA 2I7XA 2CNWA 3T3NA 1COWD 2TRSB 3PPWA 3RS2A 9GPBA 3NIGB 1UKCA 2Q3DA 4L73A 1R12A 3CF0A 3CE6A 3F7NA 4FDLA 2YFQA 3OQBA 4BBPA 5I9TA 2NNLD 3TJMA 5C1IA 3OIGA 3BHJA 3HKEB 1KH2A 3I53A 2QT9A 4EHFA 2A78A 1KFBB 1J8FA 3DL4A 3K9BA 5FLEX 3OIWA 1Y7TA 3RWBA 1QJ4A 2I2WA 3WYGA 3NTOA 4LXGA 2AMFA 2OBXA 4LKRA 5TS3A 1CUJA 2F1KA 3BCSA 2BVNA 4NV3A 1J8YF 3CRQA 3ICCA 2UV8A 2GHQA 3FZNA 2ACEA 4KMRA 4KQIA 4AY4A 2YUTA 5IK2D 2H7VA 1NQ5A 1XNRB 4F9TA 2H0AA 3AJEA 1UDAA 1UJNA 3KEGA 3S2ZA 1AKNA 4GC9A 3HJNA 2G9ZA 3H3XA 4XLTA 5BRJA 4RY8A 2XWBF 2ZDHA 1RMTA 4LXYA 5JNWA 4UE3S 2HF9A 4RY2A 1AF7A 3Q3CA 1EU1A 2YY7A 3I9FA 4FMBB 1DARA 2ZCVA 3D8UA 1HQDA 1XDGA 4NZOA 2X0IA 1YI8A 1PS0A 4GI7A 1YULA 2KLBA 5I5GA 1S02A 4G26A 2ODQA 3ZWPA 4OB7A 2XUDA 1B76A 2AXPA 1EGAA 3AVWA 1SVNA 3RKSA 1WUJS 4GI2A 2OFFA 5KYUB 5HEKA 3WHIA 3ISTA 2JAXA 4RHEA 2J7PD 2YXNA 4YIKA 3TM5A 2YKGA 5AHRA 3ITNA 5DWDA 2I0FA 2FRXA 3CMMA 2HWKA 4QU0A 1QIJA 3HCWA 1XVAA 2FMHA 4UQPA 1N77A 1VRWA 5HG0A 3IAFA 1KO4A 1QF6A 1Q91A 4CV1A 2P30A 3U7QA 3ME5A 5DX0A 2CK3A 2RHOA 3C41J 3I2HA 2I87A 2V5UA 3PGJA 4WXYB 4CI0B 4M7RA 5I8WA 1R6XA 4I50A 5FWXA 2ZLBA 1IZYA 1N34B 4AQYB 1BOOA 3VR6D 1AJEA 5C8XA 1JIKA 3V80A 4C78A 1OYVA 3Q7QA 3M5WA 3UAXA 4KI7A 2Z43A 5DW0A 3PNQA 4ES6A 4XSVA 2ABWA 3ORHA 1HOXA 3HUUA 1X77A 3I1IA 1OY1A 4PS1A 1TK9A 1X7YA 3HEBA 1ISFA 1RM0A 2FW0A 3F46A 4BNDB 1JJAA 4J0CA 4BGUA 1WO8A 1JQKA 1Y6FA 2XNSA 4EHLA 4D5GA 3HDTA 3SQNA 1S8FA 5GM2A 1X1AA 1RAEA 3B2QA 2HQSA 1ZVQA 2Z0MA 1D1TA 3L1JA 3TE7A 2XKBA 3U3KA 2JAQA 2HJHA 3I6MA 1DELA 2YIDA 3FFWA 2O2HA 4I1VA 3OP1A 4Y98A 4AJKA 4A8JC 3R0QA 4UM8B 4I3GA 4JOBA 1B43A 5KNLA 1HYHA 2BBSA 3WLEA 1F8GA 3BJZA 3U3ZA 2YRWA 3RU9A 1V9CA 5IF9A 1BGXT 1QM5A 1KSHA 1LXCA 2Q6LA 2YRXA 2WMNB 3R3SA 4QQRA 2I80A 3C6QA 3OTHA 3RABA 4KCGA 2FUNB 3KQVA 5KEIA 1I30A 3E48A 1M8PA 2JASA 3CG4A 2UAGA 4ZHQB 5AJYA 1V41E 4UVIA 4P38A 3TEJA 3OUUA 2FQXA 4KSBA 2QP3A 3UHFA 2ZDGA 3INGA 2PUAA 5C5EA 5FDFA 1YHNA 1BN7A 3A1WA 1Z5ZA 4GBED 3I9NA 1QUEA 2EHJA 4EG4A 3HYCA 3EIOA 1NM5C 2CB9A 3Q7SA 3WC4A 3H3FA 1OFIA 3LNCA 4NU0A 4EY7A 2DF8A 3L0PA 4GOOD 3PEWA 4FHFA 2VPQA 4ZC1A 4KNYA 2A7QA 4G1EB 3JQ9C 2EBWA 1A04A 1NYRA 5L3RA 2ZYTX 3A6LA 3P5BA 1USWA 2Q5HA 1BWQA 3F3YA 5JBNA 1OILA 3LTNC 1DTSA 2PS3A 4J29A 1LDNA 4JL5A 3UUWA 3ZWWA 1P1BA 3WMRA 4BMXA 1H2FA 4HMQA 3GPLA 4S3MA 1R7RA 3B2NA 2YWHA 4FU0A 4X7RA 1TUIA 3SKYA 1U1DA 1D0VA 2MINB 3LP6A 4RMIA 2H7CA 2PLFA 1YTLA 2VSOA 3HP7A 3OM9A 3NOXA 5KQSA 1W1WA 1XV5A 2ODAA 4FFPA 2G1KA 4QBIA 1FP6A 4P81A 2B69A 5BNZA 4MHTA 3VJKA 4KXQA 1BXZA 2Y1LA 4F85A 2YWCA 1R27A 1ECJA 2FRVA 3G17A 7MDHA 4JB3A 1M1YA 2V54A 3IVCA 2OOKA 3MGKA 4FFRA 1GZ3A 1FTYA 4LQCA 4M0KA 4P1ZA 5GVSA 3U9TA 1JH9A 3VM6A 4YXWA 3GK3A 1TB4A 5KX5B 1EFPA 4JOCA 3AVQA 2XB2A 5KJ1A 2BH9A 2X14A 2HLPA 1T36B 4LJ6A 1R4ZA 3GDFA 2CJWB 2YMLA 4K26A 3WL8A 3ZCTA 4B7AA 4HWGA 3R8CA 1A2BA 3PCRB 4C7VA 3B9QA 4JJZA 4P3NA 4FFBA 2G8NA 4XVRA 1MF7A 3QVJA 4LGVA 1BFUA 4BRWA 2CFSA 1XTSA 4A10A 5I7EA 2E55A 2B98A 4HPWA 1NJGA 4KNVA 5DGCA 3JZIA 3R6GA 3CH6A 1OIWA 1TU0A 5HJEA 4MHSA 1WEHA 2AMLA 1IVSA 3G6KA 1CWUA 1GLNA 2CHQA 1NR1A 2LKCA 5HPYB 2F00A 4GBMA 3EAFA 5DHFA 1URPA 2WIKA 3WMEA 4BMZA 2I66A 3ET5A 5BW4A 1TM2A 1G6KA 1ZIXA 2AOWA 2I2FA 2PFKA 2QM8A 2V96A 1U9CA 4Q1CA 4V0QA 3N39C 1VL2A 3WY9A 3JZMA 4PZYA 4YP0A 1E1DA 1TXGA 1NDQA 1Z26A 1MP0A 3DYIA 1KOGA 1YI0A 4CKWA 2DTXA 1ZK2A 4L85A 2IOHA 1DCFA 5CAEB 5TJ9A 3TZEA 4ZV4A 2IY9A 5J4VA 5H70A 1H0KA 1W7AA 2DETA 1VSTA 2QN8A 1SEPA 3ZJUA 1ETHA 1GYPA 3H97A 1NL3A 1Z83A 2G7ZA 1IZ7A 5ALNA 1YR1A 2D6FA 5E6RB 2DBRA 3NHLA 3UO8B 5C5CA 4LX0A 3IPXA 3SP1A 4IH4A 3NC0C 1FS4A 4CQNA 1GXSA 1EQAA 4P8RA 3K0EA 4IDGA 1XAHA 1GP2A 4DYHA 1KBOA 3TE6A 3TLCA 4W5JA 4KL8S 2GZDA 1SRQA 4BLPA 3QTBA 4UDNA 4G36A 4BNFA 4EJ0A 1S3SA 3H3JA 3OP4A 3PRYA 2WSYB 2EP7A 1L7RA 3P2YA 2CFIA 4W9NA 4YGXB 4XM2A 4A1FA 4D8XA 3EFOB 3RV3A 5C8ZA 4AY3A 3R8FA 1EI9A 1PD0A 1X7WA 4XUEA 2B8TA 4HGQA 2YBDA 4RA9A 4MWBA 3D8BA 2BCEA 1PJLA 4QQKA 2IV2X 3HC7A 2HMYB 5FUQA 2VQFB 3IAEA 3IPYA 3ZNPA 3IXLA 1ADYA 3ZK9A 5L3ZA 2BF4A 3ZKWB 3G88A 3C43A 5KC8A 1FLDA 3QKSB 4IQ8A 4OKIA 4I66A 2IP1A 4PZAA 5AKJA 1N2CB 1ZR4