3K6JA

Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.elegans
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
433
structure length
430
Chain Sequence
HHSTGENLYFQGSEVRSYLMEAHSLAGQWSLPNDRGDHTNSEAYDVNSVAIIGGGTMGKAMAICFGLAGIETFLVVRNEQRCKQELEVMYAREKSFKRLNDKRIEKINANLKITSDFHKLSNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGNCKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIITNFGFLMGPMTVADMNGFDVMEKLKKENGLEPNPIEKEMWRLKRYGRKTNKGFYKYDDKTQRKENDTEMEQIIRRVAKSNIQIINDQDVINFMLYPTVNEGYRCIEEGVISNESLIDIMFILGFGWPIHSGGPMRFGKTEGLDKIANMLVHWSSLEPKESAYIVADALKTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Protein F01G10.3, confirmed by transcript evidence
publication title Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from C.elegans
rcsb
source organism Caenorhabditis elegans
total genus 156
structure length 430
sequence length 433
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3k6jA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k6jA01
2Y1EA 2NU6A 5KWEA 3ONEA 1E7RA 3EY4A 5A9RA 1H9BA 2W90A 1NQ5A 2G17A 1ZZEA 5JDCC 4CUZA 1GUZA 2P91A 3V1TC 1L7DA 2VUUA 4W7HA 3I5MA 1WWKA 2FP4A 3RBVA 3PHHA 4CQLA 1WDKA 4IJWA 3PFFA 5ITWA 4RVDA 2VN8A 3WS7A 1RYDA 1H94A 4IIUA 4FFMA 4YDRA 1LUAA 1J49A 3SX2A 5IDXA 1NVTA 3NRCA 5L7YA 1SCUA 2NTVA 4RPLA 1M6HA 3CKYA 1GTMA 3N7UA 4KOAA 2Y93A 3ASVA 3RROA 3KBOA 3D4PA 4GQAA 1E7QA 1BSVA 1VL6A 3QSGA 3JYLA 3JD1A 1B14A 3EMKA 1EUZA 5A05A 4E5PA 2AHRA 2I3AA 2VYNA 3JD3A 4IS2A 5THQA 1MGOA 3B1JA 2DU8A 4ZVVA 3MJSA 4ROSA 4RL6A 5DCYA 5IXSA 4TVOA 4XQGA 4BNWA 4FB5A 2PZLA 4FOSA 4BMSA 2HJRA 3H6KA 1YONA 3U0BA 4GLLA 4UVDA 4ZQGA 3OEWA 1E3WA 1UXJA 4EGFA 1CF2O 1E1NA 4R1SA 3RKRA 3VVCA 1YQXA 1PS0A 4BUCA 5IZCA 3JYNA 2FSSA 4FQ8A 3VPSA 1YWGO 4HNHA 4C7JA 3JYOA 3V2GA 3SJUA 4RLHA 5L53A 2W2LD 3UOGA 4PG8A 4GBJA 3R0IA 3I4FA 2AW5A 4YJFA 3C7DB 3TZQA 2R00A 2YFQA 4WOKA 1PL6A 3K2EA 1DRWA 3E1KA 2CDBA 3GGOA 2Q46A 1PR9A 1VSUA 3K92A 4QQRA 1C14A 4ZA2A 1LDMA 4R16A 4RPHA 1ZMOA 4ALJA 1V3TA 3WB9A 1LSSA 3ICCA 3Q6IA 4UULA 1UH5A 1YL7A 2D0IA 4EBFA 2VUTA 2WJPA 2JCYA 3CUKA 4XQ9A 1ENPA 3KHUA 2CNBA 3DBRB 3E8XA 3EVTA 4PG7A 4PLGA 1DIRA 4E32A 1I10A 3EZYA 5C3MA 2YFHA 1H6AA 3I9NA 2X5KO 4ZRNA 1NAIA 4LGVA 2JFHA 1LC0A 1ZCJA 4D41A 4CR6A 2CVQA 1EK6A 4MP6A 1V3VA 4XR4A 4GAEA 3WIEA 3ZWCA 2G0TA 2O50A 3PTZA 3VPHA 3F4LA 1VI2A 1JAYA 5GY7A 4CR8A 5TIIA 1DHRA 1ADGA 2FY8A 3GRPA 4ZQFA 1T26A 4ALKA 1MB4A 4WKGA 3VDQA 3GNQA 2PK3A 3S55A 2X22A 4J1NA 1PWZA 3DXFA 3QVOA 3HNPA 4IIVA 4CM5A 4BGVA 4BNNA 3KO8A 1JWBB 2AA3A 1QRRA 3I6IA 4I9NA 5DP1A 3ROMA 1I30A 4J91A 4CM4A 2EW2A 4KDEA 3W4IA 2QZZA 5JLAA 4DGSA 1C1XA 1B7GO 3IQDB 5JCXA 4FFRA 1EK5A 4FFLA 1YH3A 3QLJA 5A9TA 4DIOA 4ND1A 2X8LA 3DFUA 2J3IA 5CG1A 3JQAA 1DEHA 3FPLA 5TS3A 3ETEA 3WGOA 4DTIA 2CF5A 2PH3A 3ZNQA 3AY6A 4CMHA 4CLRA 3JQAD 4BNMA 3VVBA 3WMXA 2DT5A 4FGWA 4FIZA 2QQ5A 1GZ4A 2ZYDA 3DC2A 1KOLA 3IKTA 4CMIA 1V8BA 1U4OA 1E3IA 1PJCA 2I67A 2ZCVA 4NI5A 3RUFA 2Y1CA 4Z0TA 4YAGA 2ZTVA 5FEUA 2EHDA 1NTOA 4INAA 2DTDA 4NMHA 5HWSA 3LF1A 2O3JA 3ZH2A 4IGFA 1HF3A 2ZB4A 1I2CA 4PLYA 5U9CA 3BMQA 1DAPA 5C7OO 3D3WA 3BHJA 1XGKA 1LDGA 1XSEA 3LK7A 4JGBA 2PY6A 4CV3A 2Q3EA 5C5IA 3AOEC 2BI7A 4GWKA 4BGIA 2RIRA 4Y98A 2VTEA 4DBVO 4DMMA 5KJFA 3PQFA 4NU6A 2A4KA 2WMDA 5G2OA 1I3LA 2E48A 2NWQA 3JD2A 4GKVA 4RGBA 4AJJA 5KJCA 3ZU4A 4AJEA 2B83A 3Q0EA 4FFNA 1I24A 3KYBA 4LISA 2JD0A 4D7AA 4RF3A 4W7IA 3SC4A 2VUSA 1LQUA 4BNYA 3TFOA 4R4JA 3GVCA 1HETA 4MP3A 2GN8A 1NFRA 1QLJA 4E4YA 4JCOA 4L9RA 3OIFA 4PG4A 2QYTA 4BB5A 2C7VA 5ILOA 1C0IA 3TZKA 1OI7A 4X54A 4E2WA 2PD6A 4MP8A 4XYLA 4JJIA 3WWYA 4BKQA 2B35A 1B15A 3JQ9A 4YVFA 2IEDA 4J43A 5BSGA 4WE3A 2H1SA 2GN4A 1V6AA 1NAHA 3R6DA 4TROA 4MVJD 4XDZA 5B4VA 1YBAA 4QXMA 1D3AA 4L0QA 4PLCA 1UDAA 9LDTA 3P2OA 2ZB3A 5KJ6A 4YJDA 1GY8A 4L76A 2JFGA 1IPEA 2NTJA 5F1KA 5JMPA 1X7HA 4ALLA 1WMBA 4A27A 1KERA 4IZHA 3TSCA 2GR9A 4RPKA 5GZ6A 4KZPA 3WLEA 2DUUA 5EPOA 2HMTA 3F47A 3NGLA 3GGPA 2EGGA 5C7IO 4ID9A 1BXGB 1NFQA 1XLTA 2O3TA 4E2XA 3H5NA 1YL5A 5GZ3A 3K6JA 3AUTA 1JVSA 1BMDA 1HE4A 1N2SA 4CM8A 1CIVA 3T4EA 1R4NB 4JNKA 5ER6A 5ENDA 4DC0A 3GMDA 3VDRA 4HNGA 4RDIA 4QTZA 3JD0A 2OP0A 3L77A 2D5AA 2NVUA 5K6AC 1OC2A 2Q2QA 3LC2O 5COQA 5JDIC 3CIFA 2JAHA 1JDJA 1FDUA 5EN4A 1E1MA 4G65A 5JSFA 2GRAA 5A4DA 4Z0PA 3FR8A 3FD8A 4P4NA 3ZU5A 1DFGA 4CM9A 2CF6A 2AQ8A 1ZVMA 5JMWA 1H6DA 5L9AA 1UAGA 4OKNA 3E6AA 2IODA 4IBOA 3RFXA 4CMGA 1XA0A 1N5DA 4MJLA 4OGWA 3CPSA 3GAZA 1LQTA 3NTRA 3ANNA 1U7HA 2DFDA 1Q7BA 3RC2A 1GYQA 3AWDA 3V5NA 2DBVO 3LU1A 3VH2A 3H65A 4UUOA 3QVXA 3PHIA 1Q7GA 1GADO 2BMAA 3FTNA 4NBWA 5DULA 3RD5A 2D8AA 1LLQA 4R68A 5JPIA 4AJ1A 5CDGA 4IXWA 2B0JA 3OETA 3WGZA 3MJ4A 4HX5A 3WG9A 4YAJA 1P1IA 4MKRA 2BFPA 2VRCD 4CM3A 3I83A 3NT4A 2X0IA 4B4WA 3PIIA 4YR9A 2NM0A 4OYRA 1M76A 1O5IA 3AI3A 3WJAA 4KQWA 3WX0A 4U6SA 3ANMA 3I4CA 4ALNA 3PRJA 1SBYA 1W6UA 1IHYA 2B5WA 1U9JA 5CG2A 4LSWA 1ZNQO 3WIDA 3H3FA 3IKVA 1Y1PA 3AFMA 1GUFA 3HQ4O 2NU8A 2D1YA 3DTTA 3DWFA 2X7HA 2Z1MA 4XX0A 4YA6A 1U5AA 4R51A 4U6QA 4YACA 3H7AA 1DIGA 3WTCA 4I8XA 3GNSA 4BO3A 5JDCA 3GHHA 1X0VA 5TJHA 4NG5A 4E2YA 1UXGA 1I3MA 3K30A 2XXJA 2X4GA 3RASA 1AE1A 4HKTA 3MOIA 2G5CA 1YBMA 4YT2A 3WBBA 1PGOA 3BTOA 3KEOA 4CV1A 2C07A 1G1AA 2A9FA 4BO4A 4NH4A 3F9IA 1C0PA 3NT5A 3WXBA 1WDMA 4GLOA 3HE3A 1NVMB 3WGHA 4E5YA 4F6CA 3I9LA 1PGNA 2GLXA 4Z3KA 3QVWA 5HTOA 2XXBA 4ZQHA 3QRWA 3D5QA 1X15A 1YE3A 4MVJP 2NADA 5ENVA 1TA4A 4KWHA 2EG9A 3IMFA 4CM6A 2P4QA 2QZ9A 4BNUA 3LT1A 4YT8A 3H9EO 5FI5A 1F14A 2A94A 4R1TA 4D3DA 3OF2A 2IRWA 1QORA 4CUKA 1M6WA 4CQMA 3ASUA 5K0ZA 3JD4A 1C1DA 2F1KA 1DFIA 1GEGA 1CERA 2LDXA 3U62A 5F3RA 4EEXA 2C29D 1DC6A 1Y6JA 4JIGA 1PZFA 1YJQA 4OOFA 1E7WA 2OL4A 3VHRA 4BMNA 5I7FA 3DR3A 5K9ZA 2EW8A 4BNFA 2QW8A 2AQKA 4RV9A 2IZZA 3VZSA 2J3JA 3A06A 2EF1A 1FDWA 3ONDA 1HDGO 2WYVA 3TL3A 4I5DA 1RM3A 1HDXA 1FDTA 2C20A 3JYPA 3IP3A 2YHIB 4L4XA 1ZK2A 1DPGA 2PGJA 4PLFA 5CDYA 4Q9NA 1NQTA 2AEFA 4LN1A 5TRTA 2P4HX 3RWBA 4DYDA 5FFFA 1T2CA 1T25A 1OOEA 1VSVA 1XEAA 4MVJH 4W82A 4YBZA 4DMLA 5A5FA 4FJ2A 1E7YA 5MDHA 1HT0A 3DMYA 4JBIA 3W4JA 5CP8A 3DFZA 3JQ7B 3UAGA 3VTZA 4AJLA 4MKZA 3GGGA 3D7LA 4BQRA 4MVJF 1HDZA 2DUWA 2QIOA 3SLGA 4IDCA 1HL3A 3HN7A 1A71A 2HCTA 2V7PA 2ZJ0A 1MC5A 2YYYA 3HFGA 3JQGB 4E33A 1ONOA 5BSHA 2DTEA 1YQGA 2IZ0A 1P1FA 5T64A 1HE5A 2CSUA 1WZEA 3W6ZA 1R0SA 3PQEA 1MX3A 5G4KA 2WE8A 4EDFA 5T67A 2VNAA 3H8VA 1SNYA 1ZSYA 2DBZA 1IB6A 1ZBQA 2YUTA 3ZU3A 3U4HA 3MJEA 1EVYA 1YB5A 4K1LA 1VL0A 1J6UA 3GQVA 3ZNNA 1HWYA 4BNZA 1EDOA 4HFMA 1VJTA 1Y5MA 3BMOB 4JQCA 1LTHR 4A2CA 5ADHA 2Q1TA 1ADCA 3L6EA 1XYGA 2X0RA 1A7KA 4PLPA 4RORA 1K3TA 3OJFA 2JKVA 1LC3A 1SEPA 3W8DA 1P77A 1P45A 2VHWA 4JROA 4K6CA 3PLNA 4AJOA 4E3ZA 3PVZA 4BL5A 4CLOB 3UFXA 5JAIA 5JXWA 1DBVO 2B69A 1T4DA 5L51A 1BW9B 3D4NA 3OP4A 4ILKA 1N1EA 2VNSA 1U5CA 2POQX 2O7QA 2VOJA 5CDSA 1YB4A 3UHAA 3D0OA 2HRBA 1HXHA 2HSDA 1FDSA 4J49A 5EQDA 1E5LA 2YV1A 4IMPA 2WWRA 1DOHA 4ZU3A 5J23A 3NDJA 4PZEA 3ZHXA 2Z95A 3BMNA 3AOEA 1O6ZA 4FC7A 2O7SA 3VH1A 2ZQYA 3K5PA 3PXXA 1YS4A 3U3XA 1HZZA 1YOVB 2TMDA 2Q2VA 1ZXBA 4MPDA 1ZO8A 2ZQZA 5H81A 4J1TA 3H2ZA 4OOEA 4Y6RA 4E5MA 3COSA 4HXYA 1PL8A 1B8UA 6ADHA 1PGQA 1OFGA 2OGUA 4YJHA 3VC7A 3NV9A 4WJZA 1G0NA 3G0OA 3LQFA 4DXHA 4RZIA 1A5ZA 2FZWA 2Q49A 1HKUA 3UW3A 1I2ZA 3OJLA 3ZHYA 4NIMA 3AU9A 5BSFA 4IPTA 2CUKA 2E4AA 4I1IA 1F0YA 3V2UA 4J1SA 3F1LA 4WLVA 1TT5B 3RUIA 2LDBA 3LLSA 1LA2A 3UH1A 1JKJA 1UAYA 2CVOA 2YQ4A 3L9XA 4I5FA 4WLEA 3F4BA 1PJBA 4O6VA 5I8ZA 4DPLA 5KKCA 3D4OA 4FCCA 3H9JA 3IS3A 2ZTLA 3MJTA 4WK6A 3UF0A 3JQEA 2QYSA 1U7TA 3LT4A 4ZD6A 3QE3A 5EMHA 3DOOA 3N58A 5IG2A 4CLEA 3RUDA 7MDHA 3DBLA 3R1IA 1ISHA 3E03A 3WDSA 1T2EA 2X5JO 3DAGA 2J8ZA 4LCJA 3GEDA 2JFFA 4A5OA 5A02A 9LDBA 3H5AA 3O9ZA 3KLPX 1XQ6A 2UV8A 4BNLA 1NP3A 4Z9XA 1PGJA 3FNHA 5A3VA 3OH8A 3OM9A 4EJ0A 4DPMA 1J0XO 2VYVD 4D46A 2EGHA 5F5LA 2JJYA 4R5HA 3BTVA 5L7TA 3FPCA 1R15A 1GV0A 1O9BA 2O3RA 3GUYA 1P31A 5CEJA 3UKOA 4CL8A 3E9QA 4HUJA 1E1LA 1P0CA 2PLAA 3ZI0A 3L4SO 4J3FA 4D0SA 1DB3A 3E48A 5DP2A 5F21A 1PIWA 1XR3A 4DYVA 3EVNA 1TVEA 1MP0A 4YT5A 3DZIA 4E0BA 4GVXA 5TC4A 2WD7B 4WOJA 5K6AA 3S1LA 3AUSA 5JDIA 2UDPA 1UP4A 1Z73A 2IE0A 3WICA 2JCXA 4FJ0A 4MO2A 1LDNA 1P74A 3DONA 3MJVA 1UZLA 1DDOA 2V65A 4IUYA 1JTVA 4YXFA 5JAMA 1NASA 3CZMA 5ICSA 4YRDA 3GRKA 1KVUA 1Q0LA 2WEKA 1ZJZA 4U7WA 1N9GB 3DZHA 3E9MA 4R9RA 1E6EA 4IINA 3S2GA 4OHUA 1AUPA 2YDXA 4DQVA 4MKXA 1ML3A 4WNCA 1ZKMA 3I52A 2IXAA 4E30A 4NNJA 2UUPA 2HK9A 1ADBA 1DIAA 1YGYA 3WYBA 3SC6A 3ZWNA 1A4IA 3KYCB 4CM7A 1LLDA 2P9GA 4G5HA 3TOXA 3L0DA 4LW8A 4PRKA 4ZICA 4QX6A 1V3UA 2C54A 3DQPA 8ADHA 2W2LA 4W9NA 3TFQA 1BXKA 3JYQA 4R5MA 5DF1A 1F06A 2ZJ1A 1DXYA 1EUDA 4E12A 2J5QA 4H3VA 5BSEA 4G81A 1PS8A 3NKLA 4NQZA 4MIEA 3E82A 3GZNB 2VWPA 2GERA 3KYDB 2P5YA 2EJWA 4D3SA 4GI2A 2UUOA 4BNVA 4IQGA 3Q11A 3DBRA 1IULA 1HE2A 1QYVA 2VOEA 4L8VA 1YKFA 3RCBA 5ER9A 1BGVA 2O2YA 1R4MB 3HG7A 1LXCA 3WQQA 4J7CA 5KKAA 1XIVA 5KVSA 1DRVA 2NV6A 4NR0A 4DLBA 2B36A 4F45A 1Z7EA 1H2BA 2RCYA 5B37A 1E92A 2NVWA 2H9IA 3NUGA 1PJ3A 1GPDG 3HWRA 3EYWA 3WJ7A 1PJTA 3OICA 2DAPA 1B3RA 3ZWAA 3LT2A 3ZV5A 3O38A 3NTQA 2QRJA 3L6DA 4O59O 4N5MA 1UZNA 3U4DA 4AJHA 4XYGA 1ONPA 1EDZA 3KSZO 1ZEJA 4J0FA 1H0KA 3DZGA 1YXMA 2BFAA 3FWZA 4B79A 1SMKA 5TJ9A 2BH9A 3PJFA 1IE3A 5I7VA 1DO8A 1E3JA 3ORFA 1EVJA 2IYOA 1R16A 3FTPA 4N5NA 4U0KA 1LU9A 1ULSA 1EMDA 4W6ZA 1VLLA 3MWDB 2VRBA 1H6BA 3GN2A 4URFA 1I33A 4YJGB 1XU9A 3TZHA 4DLAA 4PZDA 4GH5A 5BR7A 4DWVA 2DBQA 4B8ZA 1SPXA 3FF4A 4PCVA 5JYEA 1HYEA 3A4VA 2O23A 3KUXA 4ZQEA 2OHXA 1KEPA 4ESOA 1H93A 1SZJG 3G17A 3K8ZA 4DL9A 1UR5A 4JJGA 5H83A 2AEMA 4AG3A 1KC1A 1D7OA 3HB5X 4GWGA 5I7SA 3GR6A 2FR1A 2NQTA 3WLFA 3ZZNA 2HK7A 4XEHA 4ZN6A 3VPFA 3KXDA 4CR7A 4D44A 4B4VA 4Z6KA 1C1XB 3NYWA 4MVJI 3A1NA 2O4CA 4FDAA 3GG2A 1Q2XA 3JCZA 4J7UA 5EESA 2AG5A 1B3BA 5L7WA 2RH8A 1BTOA 5IDQA 5IDWA 1GQ2A 4TZKA 2O48X 1KVQA 4XQCA 5AYVA 3NGXA 2HQ1A 4UUNA 5CPFA 4XYMA 2PZKA 4RCVA 3EAGA 4BNKA 4RJTA 1ISIA 1F12A 1DRUA 3QWHA 3PYMA 3MJCA 4NBUA 1XCBA 1GL3A 3SJ7A 3ZGYA 5KVCA 4FD3A 1L7EA 4F6LA 4B8WA 5KCZA 3GVHA 3C7CB 4XYEA 3U4IA 3Q9NA 1R0KA 3HN2A 4BNJA 4UVGA 4UEJA 2B4RO 1GCOA 4WLUA 2E37A 2VCYA 1SB8A 4AICA 5I8WA 1IOLA 4DVJA 4Y6PA 3RAJA 2Q2WA 1MG0A 1P1KA 1YB1A 4TRNA 5JW6A 1CQJA 4FC6A 1U3WA 4BV8A 1ONNA 1A7AA 3D3WB 4KTTE 3RU9A 3CE6A 1BDMA 4RVGA 4K26A 4QFDA 5CEFA 3ZNOA 3GF4A 1B16A 4UREA 3GOHA 4R69A 1PTJA 3GHYA 3OQ6A 3L9WA 4BO5A 1BWSA 3G1UA 4RZHA 4CPDA 1X1EA 2WM3A 4TRMA 3WR5A 2XOXA 1PR3A 4BO8A 1MA0A 2VHXA 4MOWA 4MVJA 2I66A 2E6UX 4B7CA 3W4KA 5BNIA 3I1JA 1U8XX 3MTJA 3BTUA 5JY1A 4BVAA 1IY8A 3EGOA 4AJ2A 3FNEA 3HFSA 1RJWA 5TF4A 5AXDA 3VZRA 4XKJA 2BLLA 2X23A 1PX0A 4Z0HO 3ZWXA 2EP5A 1E0DA 1GZ3A 2C5EA 3DZFA 3LC7O 2DFVA 1P1JA 2GZ2A 3V1UA 3NDIA 6LDHA 1GV1A 3DBHB 1BRMA 4QO8A 4Q3BA 1GFSA 1CETA 4Y8VA 1J4AA 3ROQA 1BXGA 4XGNA 3K2BA 1B8VA 2DM6A 2FMUA 4EUHA 3VTFA 1PEDA 3TRIA 3KSDO 3ONFA 1A9ZA 1YL6A 3OQBA 2E82A 2YDYA 4BGEA 1JA9A 2G82A 3WYEA 4ONEA 4HFRA 3VPXA 4BKRA 2QG4A 1R4NA 4WECA 5EJ2A 4C7KA 4MDHA 3GEGA 1Q0HA 3GDGA 2X86A 1YDEA 3DHNA 4J16A 3H3JA 1ZH8A 4UUMA 2ZYGA 2Q4EA 3DBVO 1LSJA 5G0UA 1ENZA 1B8PA 2NSDA 3JSAA 1EUCA 5ITVA 2PR2A 2H5LA 4Q3EA 2WTBA 1I3NA 3RC9A 3FN4A 3V2HA 3BXXA 2G1UA 3UN1A 3QJ5A 5ILGA 4CMAA 4RVFA 4XRRA 1XU7A 2HRZA 5L4NA 4KP7A 1SEVA 4YB8A 3MWEB 5AXAA 4AJNA 5JE8A 2HMSA 1Q1NA 1CDOA 4TKLA 4AFNA 4GSLA 4P38A 1MUUA 2PFGA 4NFHA 4OSOA 1WXDA 4IJUA 2O3QA 3OBBA 5AXCA 4DUPA 3ENNA 5THKA 3B1KA 3ZW9A 2Y1FA 4BO1A 3TOZA 3AU8A 3NEPX 4XGKA 1FDVA 1M75A 2X0JA 4M89A 1HDOA 2QHXA 3WYCA 4A73A 1IYZA 5DZSA 5KVVA 5L95A 3GPDG 4QSMA 3ZU2A 1E77A 4JP3A 3ST7A 4CM1A 3I9MA 3WMWA 2Y99A 5BNFA 4LVCA 2D5CA 3PWZA 4N5LA 3C85A 4XGIA 3HHPA 3UXYA 1YDWA 4BO7A 4BNTA 3S2FA 2VRCA 1QYWA 4M54A 3ZWVA 1ZXLA 4PVDA 5JS6A 1NPTO 5ICMA 2PKQP 5FWNA 2VWQA 3BTSA 2FR8A 3I9OA 1MG5A 4HY3A 5ES3A 4W9NC 3ZWYA 5I9MA 1D4FA 4EEZA 3OA2A 4OH1A 3HDYA 4R54A 1JWAB 2TMGA 3NJ8A 3RBZA 5TLSA 3H4VA 1E5QA 3EUWA 3VH3A 4GMGA 2CY0A 3RJ9A 3I23A 1HE3A 2VZ0A 4KMSA 5F1OA 3V1YA 5BNTA 3WNVA 1PZEA 1U4SA 3F6YA 3O4RA 4XB1A 3ZNPA 1JU9A 1UDCA 3KEQA 1ID1A 4NK4A 4E2ZA 4RDHA 1HZJA 4O5OA 3S2IA 1Z7BA 4QEDA 4EUEA 5A1TA 1XQ1A 3WWZA 4HADA 5DT9A 3A28A 1VM6A 1C0LA 5C37A 2RHRA 3ZWMA 1GDHA 4GKBA 1R0LA 3DO5A 1V9LA 2GCGA 5JCJD 3GMSA 1P3DA 3QQPA 5JC8A 5A9SB 5KJ1A 1KVSA 4RQTA 3VH4A 2EKQA 3I9KA 3QVSA 3NTOA 3JQ8B 1I5RA 2DPGA 1EQUA 3RUCA 3TQHA 1KY4A 2PA3A 4YAIA 3CXRA 3KRTA 1B0AA 4IDEA 3DDNA 4FBGA 3KETA 3IL2A 4KDFA 4BNIA 2ZK7A 2D2IA 4J7XA 1XKQA 4LMRA 2C2YA 3TWOA 1VKNA 1ZUD1 3PPIA 5JO9A 4RPGA 2IEBA 1FK8A 1ZEMA 1T1RA 3D5TA 2HMVA 5H82A 3PGXA 1JLLA 3C3XA 1Z6ZA 4BV9A 3FBTA 2W2KA 1Y9EA 3PIDA 1TLTA 1W8DA 4R41A 4MVJM 3ZCXA 2Q50A 5AXBA 4J2HA 3M6IA 4OMUA 3OQ1A 4B7UA 4CLXA 4L75A 3FI9A 1Y8RA 4QT0A 4TSKA 4CMKA 1EEHA 1ADFA 1GQQA 2NLOA 1LSOA 5HS4A 1DC3A 1OC4A 4S1VA 4BS9A 2VZ9A 1K89A 5IF3A 4FSHA 3P7MA 1U2GA 3ABIA 3BAZA 4J9UE 4JP2A 3ICPA 2CMDA 1NXQA 2R2GA 3DZKA 4YQZA 1GYPA 2D3TA 1Z45A 2Y1DA 3HZZA 4WCFB 4YWJA 3FNFA 1F8GA 4UUPA 2YHIA 3DMTC 4QFCA 1CJCA 3F46A 2NU7A 1DLIA 1VL8A 2UAGA 3GT0A 3P2YA 4R3NA 3CH6A 4P8RA 4OL9A 4MINA 1NPYA 4NU5A 4OXNA 1DFHA 4B4OA 1T2AA 4CQMB 3C1TA 2EXXA 3KVOA 5TQVA 3JQ7A 2Y67A 1GR0A 2JHFA 2NU9A 2EERA 1PJLA 2BELA 4ND2A 4II2A 3UCFA 1PJ4A 3ANLA 3QWAA 3PJGA 4CV2A 1X14A 3OECA 4E31A 4D42A 2O3UA 2PWZA 4WNIA 1CYDA 3JQGA 1J5PA 2Y05A 1OBFO 3C1AA 3FRJA 2UYYA 1W4ZA 5IN5A 1LRKA 1CWUA 5TT1A 4CMEC 2YHUA 1WVGA 4ZRMA 1TT7A 3RVDA 5HA5A 2BFOA 2BRUA 3E18A 2X0NA 1U1IA 1RM0A 5COBA 4JLWA 3IC5A 1WZIA 2W98A 4H16A 5KNLA 2HDHA 4YQYA 1OMOA 3KV3O 4XJSA 4YCAA 1CQIA 1PQWA 2AMFA 3BMOA 1JW9B 2BFMA 3GVPA 1U2DA 1ZK1A 1VJ0A 3V8BA 3HSKA 3MZ0A 4NBVA 2Q1WA 4MIYA 4WLNA 2BKAA 2FHSA 2I9PA 4WLFA 1JAXA 2YV3A 3PHGA 3PZBA 4AJIA 3M1AA 1Y7TA 2PNFA 1K5HA 3OIDA 4XRGA 5T57A 5JAZA 2PH5A 2I3GA 1BW9A 3AUAA 1E3LA 5IJZA 3INRA 1F17A 5JYDA 1N1GA 2VZ8A 4HP8A 4IQ0A 1S7CA 2NVBA 2X9NA 3JV7A 4L74A 1LX6A 1ISGA 4U5QA 2FZEA 4DC1A 3E9NA 4QUKA 1UDBA 2Y0DA 3ETGA 4FFPA 4EW6A 4YAKA 2FPPA 1RWBA 3KZVA 1XHLA 4P22A 4IY1A 5FF9A 2V6MA 2GO1A 3WGIA 4NPCA 1A4UA 1HDYA 3H2SA 1NM5A 2PZMA 4PLZA 3P19A 5HM8A 4KUGA 1LDEA 2I99A 4PFJA 5IFLA 1MFZA 3L4BC 1I32A 2X5OA 4BKOA 4S3MA 5I9LA 1V0JA 5EINA 3WQRA 4K9DA 4D79A 3CMCO 1LDYA 3Q2IA 1YQDA 3IUPA 1KC3A 2Y68A 1K6XA 2WYUA 5CDUA 2XF8A 4GX2A 4XCVA 5LCXA 1WMAA 1PWXA 5AVOA 5KOIA 3ADPA 3DEYX 5U1PA 3PDJA 1I0ZA 4B3IA 1B26A 3S2EA 3GEMA 3I3OA 3RIHA 2B4TO 1HLPA 3E5RA 2FN7A 4Q3DA 1PJQA 4Y9DA 3PI7A 3AK4A 1PJSA 5AQ1A 2FRDA 4NJMB 4PVCA 4IJVA 5DCWA 3ZWWA 1QYDA 3UUWA 3N74A 3EC7A 4XDYA 1KVTA 3LF2A 1EBUA 4I9HA 4CMJA 1UXIA 2GGSA 3RUEA 1NFFA 4AVYA 3FHLA 5KIAA 3RI3A 5F5NA 1Y8QB 4H15A 2GN6A 3INTA 3ROKA 4M8SA 4IQ8A 5F1PA 4GX0A 4IDBA 1LBEA 3X2EA 2PGLA 4GPD1 1QR6A 4IS3A 1Y9AA 1ZK3A 2GZ3A 1U3UA 1UZMA 4GGPA 4FJ1A 2BGKA 4DQUA 4EYEA 2EJVA 3O8QB 2F00A 2X9VA 1H5QA 4GMFA 2VYVA 1SB9A 1ZW1A 3B1FA 1Q7CA 1ZSVA 4IMRA 4RF5A 1O94A 1PL7A 4F46A 3WFJA 1A72A 1YVEI 3DHYA 1KETA 1R66A 4JX8A 3WOHA 5A03A 3R3SA 1M2WA 1PGPA 3KM0A 4J6FA 1IUKA 2ET6A 3PHLA 4MIOA 1YRLA 1SAYA 1ZK0A 2O3SA 1W73A 3DBLB 4XQEA 1I3KA 5G4LA 3SBOA 2Z1NA 1RM5A 2WD7A 1WP4A 4IM7A 1NHWA 2OUIA 4RVUA 3NT2A 5I7EA 3QWBA 5G0TA 5T6BA 2GZ1A 5TT0A 2HMWA 4XWYA 3OHSX 3RC7A 2HAEA 4E5NA 3PYLA 5TNXA 1K0UA 1QKIA 3EW7A 1BG6A 4L73A 4IJKA 4EITA 5G0WA 3ZHZA 1ISFA 3BMCB 3B20A 3PK0A 2J3HA 3CMMA 2OOSA 1N9GA 1Y5RA 3LYLA 4QO7A 4LRTB 4WUVA 2FPIA 2Y66A 3O03A 4NBTA 3ZW8A 4PZCA 1UUFA 3GH3A 2Q1SA 3FCOA 3VOSA 2GSDA 2DKNA 3VAZA 3MOGA 3INGA 1PU2A 1IZ9A 1QV6A 3PLRA 3PZRA 1SO8A 4CLHA 1WPQA 3AM4A 3WSWA 3T7CA 2E49A 3B70A 2P9EA 3PFWO 1U3VA 1JN0A 5FYDA 3UCXA 1O0SA 3WBFA 4AL4A 1BVUA 3QY9A 4CQLB 1AHHA 2OMEA 1FMCA 3S8MA 4R1UA 3KYCA 4IDFA 1WAMA 2CZCA 4E5KA 1JKIA 4IZIA 1TI7A 2WSBA 4HBGA 3GK3A 1N92A 4JJFA 4PGFA 1O95A 5A04A 5FI3A 3GZNA 2XAAA 2EKLA 2ZIZA 4WCFC 5CEEA 4EUFA 2P5UA 5TX7A 3W1VA 5IXYA 3KYDA 3F3SA 4E21A 1QYCA 2JHGA 2Z5LA 2FWMX 2P68A 1PZGA 4M86A 5GZ1A 3H9GA 2V6GA 2VYND 4XJTA 1Z74A 3DL2A 1X0XA 3TJRA 4XR9A 2EIHA 2GN9A 4DPKA 1RM4A 4PLTA 5KVQA 1R4MA 1IL0A 1NYTA 2EEZA 4HV4A 2GASA 3I6QA 4MVJE 3GFBA 4O0LA 3RU7A 2AQHA 3TPCA 1E3WB 2Q45A 5CAEA 5DDIP 2H6EA 1C3VA 5JNLA 1SOWA 4UVEA 4P4LA 2GD1O 2O2SA 3QWFA 4PLVA 1TEHA 2HK8A 2FOIA 4LVUA 3GPIA 2JAPA 4R9SA 5L3ZA 3BA1A 4RVSA 1DHTA 4HFJA 1VPDA 3QWIA 4GX1A 4WPGA 4LCEA 3FWNA 1T24A 4JK3A 4YJFB 5CFZA 5CDTA 1FJHA 4XA8A 3CSDA 4XIJA 2EKPA 1VC2A 3ROPA 4J90A 2DTXA 1MFPA 2VT3A 3P5SA 2DPHA 3WGYA 2OO5A 4YT4A 3GZ4A 2DLDA 2OZPA 3MTGA 4JXKA 4ITUA 3OA0A 2BI8A 3CZRA 1NX6A 3AI1A 4Y67A 4YJGA 1LJ8A 2Y0EA 4TZTA 4BO9A 1H6CA 1O8CA 3JTMA 1QG6A 4WASA 1E6UA 2RHCA 1UJMA 2PKQO 1AHIA 3U9LA 1K6IA 1VKOA 1SOVA 2EWMA 4RO0A 2R6JA 5JFOA 3TDKA 5DN9A 4LSMA 1LRJA 3DTYA 4TWRA 2HKIA 3JQFC 2FR0A 2A35A 3TL2A 3CEAA 3AI2A 2PGDA 4W4TA 3PYXA 4UEOA 1HRDA 2VHVA 3WNQA 1AXEA 3K9QO 4DREA 3IIEA 1KBZA 4TRRA 4Y6SA 3ZN2A 3DMTA 2ZKLA 3Q3CA 2NNLD 4U0JA 4CM4B 1ENOA 3DZBA 2D59A 2FPGA 1WDLA 2WYWA 4N54A 2OORA 4A10A 2QRLA 1NWHA 1A27A 3JQAB 3QA9A 5L4SA 1T2FA 1N7GA 1LSUA 2J5RA 4CLRB 2B5VA 5TSDA 2QRKA 2OBNA 1GYRA 1JKFA 3O26A 3I9JA 2Q4BA 2BD0A 3G1TA 1E1KA 3JQBC 3U4CA 4RPJA 4FGSA 1BXZA 3RSHA 4CMIB 1ARZA 2C0CA 3KB6A 3RUAA 1I2BA 1U3TA 4KQXA 3WQSB 4TQGA 1GAEO 4P4GA 3GUCA 4ALMA 5B4UA 1ZIDA 4CMEA 1NR1A 3Q1LA 1V35A 3PEFA 3CINA 1T4BA 4WGGA 3AY3A 2W4QA 2PZJA 3BMQB 3G79A 4KUHA 4R3WA 5LDGA 1IHXA 2Q99A 1DC4A 4YYZA 2J3KA 2GF2A 1JQBA 3ITDA 3OIGA 1E6WA 3A14A 2GUGA 3ITKA 1ZJYA 4XYBA 4YRAA 4CMBA 5IZ4A 5HBRA 4PN3A 3NX4A 2XPCA 4ZHSA 3F5SA 3AM5A 3DAPA 4GL4A 3AUUA 5CPBA 5TGDA 3EDMA 4UAGA 4BHTA 5JAQA 3NJ4A 4JBGA 4R01A 4J0EA 4B3HA 2CVZA 1QXSA 3DBHA 3FNGA 2B37A 3PHJA 3C24A 4DQXA 4GGOA 3R3JA 3GG9A 3DOCA 1OZAA 3NAQA 4D3FA 4OJNA 1I8TA 4R1NA 1ULUA 3U49A 1M66A 2A92A 3HDQA 4ZGWA 2H63A 2EV9A 1KIFA 4QECA 3A9WA 3WGGA 2CDAA 3PGJA 1LLUA 1DJNA 4OSPA 3L4BA 1E3EA 3EHEA 2ZCUA 4BB6A 3U09A 4NZ9A 1QSGA 2JD2A 4JN6B 4IDDA 2NQ8A 1O89A 4CMCA 4YEDA 1Y81A 1HDRA 1RPNA 1EFLA 3G49A 3ULKA 5B1YA 3IJRA 2VT2A 5JY6A 3BHMA 4NHEA 4M87A 1OAAA 4DRYA 3ETDA 2J6IA 1MXHA 2V6FA 3OJ0A 3BYZA 1MV8A 1P1HA 1P44A 1RYEA 1R37A 3HADA 5T8KC 1MC4A 4WEOA 3OJEA 4N7RA 4OXYA 1H2HA 2JL1A 2V6BA 4CV0A 4BO0A 3OJOA 2VWHA 2YY7A 4JBHA 1KEWA 2X1HA 3KLMX 4PG6A 1DLJA 2ZYAA 1KS9A 4TMFA 2OXIA 3OFSA 3WFIA 1HLDA 3AY7A 2ZATA 1UP7A 3DB2A 3NDRA 4O63O 4D45A 1LDBA 1EE2A 4K28A 1ORRA 2X9GA 4CM8B 3PJDA 1GZ6A 2ZB7A 2VWGA 3STHA 4NBRA 3GVIA 4M49A 1D1SA 1X7DA 2CFCA 1ISJA 1Q0QA 3C8MA 4TRJA 3L6OO 5A5EA 1PSDA 5EIOA 1EBFA 2NVUB 1P0FA 3KSUA 4TVBA 4OXKA 5DBIA 3PP8A 1NWCA 4A0SA 4A7PA 1WLYA 4BQPA 4B4UA 2C82A 1KEVA 3D3EA 4BOYA 3IDSA 1ISMA 5JBIA 2VQ3A 4OO3A 4ZJUA 4NFSA 1P9LA 4WLOA 4CM9D 1EE9A 4DLLA 1EQ2A 1K2WA 1E3SA 4LRSB 1PQPA 5HS6A 4XZ3A 3X2FA 7ADHA 3GDOA 4BGUA 3WGTA 2WDZA 2X58A 2Y0CA 4YRBA 3U5TA 4Z9FA 4EJMA 4CJXA 3MCVA 1HSOA 3ZWOA 2WE7A 2DC1A 1I01A 1E7MA 5AOVA 2AEJA 2VHYA 1AN9A 4IDAA 3LLVA 4OKIA 2OP1A 2YW9A 3BZUA 4N18A 5DOVA 1CRWG 2AG8A 4G2NA 2DQ4A 3IP1A 2B4QA 3UVEA 3FSRA 5JC1A 5IDYA 5IZCC 4LK3A 4B7XA 3BIOA 5JO0A 3C1OA 1LRLA 2P9CA 4NK5A 3RKUA 4F3YA 2PD4A 2IDZA 2OBYA 5JCJA 5A9SA 4PRLA 2GPTA 3JQ8A 5DBGA 2BF7A 2R00C 1X7GA 3QVTA 1NQOA 1PS9A 5MGBA 5DNAA 1KEUA 3RJ5A 2FSVA 2DBRA 3HJAA 2NACA 1HYGA 2PD3A 1ENYA 1FF9A 1KY5A 3PDUA 5G0VA 3ZV6A 3EK2A 4BO6A 2NUAA 2Y1OA 3SVTA 4D43A 4I5EA 1GPJA 3AFNA 4J9VA 3HUDA 4FS3A 1D8AA 4FR5A 3ZHBA 1KVRA 2AQIA 3RC1A 3KTDA 3WSVA 2RBEA 1GEEA 3PJEA 3QW2A 4B3JA 1I36A 3GA0A 4XD2A 3JQ6A 5EERA 3RQSA 4ND4A 5I9NA 1MLDA 2DVMA 4OQYA 1EFKA 4DBZA 1BDBA 1IZ0A 4RQUA 1NQAO 4I08A 3GDFA 2HU2A 1CEQA 3D1LA 2AE2A 3ON5A 4PLWA 1HYHA 1WW8A 4BNGA 2I76A 2ILTA 5L40A 3LZ6A 3GY0A 3RFVA 2Q1UA 2W8ZA 1QLHA 4WCFA 4AJ4A 2BGMA 4ND5A 3HB4X 4ALIA 5B12A 8LDHA 3VKUA 2I5PO 3F5QA 3VZPA 2UVDA 2AE1A 3H9QA 3LSYA 3DOJA 1M67A 3UCEA 3FR7A 4CL3A 1XWFA 4Z3DA 1GUYA 4TKMA 1SC6A 2O4UX 2HUNA 2W2KB 5BT9A 2YV2A 4MVJG 3H5RA 4CQMD 4K6FA 5KJEA 4LMPA 3IOYA 1Z75A 4RF2A 4M55A 3TF5A 1HSZA 4XB2A 1Y8RB 3M2PA 3AM3A 4HFNA 2PKRA 1C1DB 4WEQA 2I6TA 2CDCA 3T4XA 2JCVA 5DOZA 3WGQA 3ZV4A 1C0KA 2CD9A 3K31A 3VKVA 4D0RA 3QP9A 1QV7A 3LDHA 4GSKA 1GQYA 1P1RA 1X13A 1VE9A 4DIFA 1XDWA 2BGLA 3PWSA 3OMLA 2PTGA 3GVXA 3L07A 1W0CA 2PV7A 2RAFA 3M1LA 1AGNA 1QP8A 3F1KA 3JQCA 4I9UA 3B6ZA 3W6UA 2IXBA 1DAOA 3G3EA 1X1TA 2C59A 3Q2KA 2YZ7A 1T2DA 5IAAA 2C2XA 4KTVE 1Z82A 4BNHA 4Q3NA 3EZLA 3ENKA 1F8FA 4EI2A 1YBVA 1QMGA 4FOOA 5LDHA 3SLKA 1UXHA 3H9UA 1K6JA 1DC5A 2C7GA 2X6TA 3DZJA 5EL0A 3W8FA 1PQUA 5CHEA 4YTEA 4IDGA 4BKUA 4BIIA 1WNTA 4PLHA 1NVGA 4OQZA 4BKPA 2J5KA 1U28A 1AXGA 2ZB8A 4L4RA 4E6PA 5B4TA 4C4OA 4CLOA 3GNTA 1G0OA 2IYPA 1BVRA 1QYXA 3JQFA 4FPXA 1IPFA 3GFGA 3SEFA 3BHIA 3T7EA 4NDNE 3AW9A 4XIYA 2HJSA 1HEUA 3E5MA 3LT0A 3VZQA 4KUEA 2YQ5A 3JQDA 4UEKA 3RBXA 4AJKA 4Z9YA 5G4KB 1NR7A 4GVLA 4HWKA 4RVHA 3TZ6A 1UP6A 3ZWPA 4EZBA 4IGEA 4FW8A 5LC1A 3JQ9C 1DIBA 3ZDFA 3RUHA 3KOUA 3AJRA 2ZTMA 3IUSA 1H9AA 3CTMA 3TN7A 2EP7A 4ND3A 1ZFNA 3HDJA 3Q9UA 3QIVA 4PG5A 3ZWBA 1YOVA 1VRWA 4CUJA 3DAFA 4EJ6A 3K73O 4A26A 1U8FO 4H7PA 2GNAA 1YJ8A 3JQBA 2GDZA 3SXPA 3W8EA 4FN4A 4CLDA 5GMOA 4J4TA 2HLPA 1LI4A 3TZCA 4BMVA 1GU7A 1TB4A 4J2OA 3AOGA 1DIHA 1N8KA 2SCUA 4UVHA 1DJQA 2I65A 3GLQA 1DSSG 2QX7A 1TT5A 3FBGA 1S6YA 5BQFA 3UGKA 4IXTA 4NJMA 1EZ4A 1YO6A 3LC1O 2VHZA 5DCUA 1E7SA 1XELA 2BHLA 3RFTA 3IAHA 4CODB 1B2LA 5A06A 1P33A 3BMNB 5L45A 4W99A 1Y8QA 5L4LA 1LNQA 4RF4A 2OFPA 5HRUA 5COAA 3GN1A 5C7LO 4YPOA 4U8GA 3PQDA 4O1MA 1D1TA 2HMUA 3OSUA 2GYYA 4Q3CA 2AXQA 3D64A 5EQFA 5T5QA 4YJHB 3GAFA 2C5AA 4NFYA 1TXGA 4J1QA 4E13A 2D4AA 2G76A 3TNLA 2NTNA 3O8QA 4A03A 1A9YA 3MEQA 1KYQA 3PWKA 3QV1A 4Q39A 5DBFA 3WTBA 4KWIA 1NNUA 1XG5A 1L1FA 2WD8A 1VJ1A 5G0SA 5U4QA 3LVFO 3ADOA 1R12A 4RLSA 3HDHA 1EVIA 4PIVA 4II3A 2VTDA 4OIMA 4BO2A 1BHSA 2Y1GA 3DHEA 1LEHA 4BNXA 1GD1O 2HO5A 3K96A 1HDCA 3OEYA 1GCUA 1NPDA 4J4BA 4DA9A 1N7HA 4Q3AA 4NJOA 3UICA 1FXSA 1G6KA 3C7AA 4GX5A 1MXFA 2YJZA 4UVIA 3QHAA 3ZV3A 4ZQBA 5KTKA 3VPGA 1R6DA 1LLCA 1EVZA 3M2TA 5A3JA 2IZ1A 2RH4A 1NBOA 4FFOA 1ZSNA 5T8KA 1HTBA 4OAQA 1PZHA 4AJPA 5IN4A 3IJPA 1T1SA 1ZMTA 4WCDA 1UXKA 3BMCA 2P2SA 2JD1A 4OM8A 4L4SA 4I5GA 1PJ2A 3GC6A 1RKXA 4YAEA 4DIBA 4M1QA 1JVBA 2ZTUA 4J4HA 1NHGA 1ZK4A
chains in the Genus database with same CATH superfamily
1JLRA 1ZOSA 1L7XA 2CB0A 2DUJA 2Y1EA 5DI9A 2DXIA 1SVLA 3ONEA 3AYZB 5IPFA 1LVUA 3OPMA 4NZYA 2ZSIA 1JIKA 3A9VA 2BE9A 2BKEA 2W90A 2JEYA 4X5OA 5SICE 2ZVDA 1UM8A 1S96A 4N3BA 1Z6PA 1ORHA 4W7HA 3ZLUA 1YS6A 3I5MA 2RARA 5CXUA 1BJKA 2FP4A 4WZAA 4EHLA 2PTHA 1KFJB 2Y8EA 3R44A 2GF9A 4LFBB 1WSAA 1EFPB 1TPYA 2PT9A 4RFSA 4C6SA 3F7MA 5AKLA 5DLPA 2E2WA 4EGAA 1EB8A 2NO4A 2PGOA 3TW8B 1RYDA 3N8NA 1XTPA 3F96A 2E6KA 4X8HA 3HJBA 3T3IA 3SX2A 5IVDA 1WMSA 1ZVJA 2ZI7A 1TVKB 3LQ2A 2GILA 5EJAA 2PX4A 1IWPB 1SCUA 1ZR2A 4F72A 5TQJA 3Q3HA 3ZVRA 4IHKA 1GTMA 3N7UA 2IPNA 5REQB 2WBLC 3RROA 5CVUA 1D4ZA 2F8MA 2RGYA 3OTWA 1A4RA 2GDJA 5F1YA 1NBME 4DRZA 1GTSA 1WCWA 1RWPA 3OBIA 4I81A 1S4MA 1EUZA 1NDQA 3BXOA 3RVSA 5IJ0B 2WU3A 3KD2A 3I8SA 4W8HA 4PYQA 1E9BA 3RJTA 2VQEB 1XXHB 4NMMA 4YJ3B 3JQQA 3N05A 3UMVA 3KQLA 2C7RA 3JD3A 5THQA 1H23A 5KNCA 1KZ1A 2YZGA 2H8KA 1HQDA 3MJSA 4LX0A 3C1UA 4RL6A 2OCXA 2XMZA 5CH5A 4TWBA 1OCEA 5DCYA 4B3BA 1JILA 3L3BA 1HA3A 2REBA 4FOSA 3H6KA 1BS9A 1YONA 1NSYA 1W94A 2FWIA 2CMHA 4P7KA 2PXCA 2YIMA 3U0BA 2W70A 2VQ6A 5CITA 4TL6A 3USCS 2AN5A 3LZDA 1UXJA 4JVNA 4JR2A 1SY7A 3THWB 3DMGA 4GZ3A 3RKRA 1YQXA 1PS0A 1YR2A 1RXEA 2XDQA 2YXPX 1ECLA 2FSSA 1HT1E 2YINC 3CGWA 3N28A 1JKXA 3E7DA 3PIRA 4X8MA 1NVAA 3NYQA 4HNHA 3V2GA 4LBYA 4EELA 5L53A 4GBJA 3R0IA 3RREA 1K7SN 3IA2A 3T5TA 3R24A 2ZM6B 5FIUA 1Q95A 2C4HA 2JH3A 1EUDB 4DRXB 5JZMA 1DRWA 3GGOA 2CDBA 3LPLA 3UMMA 2FW1A 1ZOOA 4QQRA 1NW9B 2YCBA 4MLDA 1LDMA 4R16A 4KKVA 2G70A 4ALJA 1N6PA 4RJIA 4G85A 2ZBEA 3WB9A 4PYIA 2PEYA 2F3QA 2XE4A 4N0EA 1LSSA 2HA2A 2RC5A 5J4VA 1YL7A 2XQKA 4Y2TA 4XQ9A 4EBFA 1KZHA 4PG7A 2ETVA 3NANA 3V8NA 3KPYA 4E32A 2IXEA 1II9A 3EZYA 4MR7A 3RK4A 2NIPA 3TIXB 3I9NA 5EYPB 4ZRNA 4MICA 1NAIA 1ZD3A 2HPAA 2JFHA 1ZCJA 5FUWA 4Z5XA 1JEYB 4NOJA 5GAJA 5CDFA 4WN9B 1V3VA 2Y1KA 3OKCA 4GRAA 3TJMA 3KJHA 1B6GA 2LD4A 5EOVA 3QELB 3WIEA 2J0UA 1OFVA 3E2MA 1O6FA 2ZWMA 2EEPA 2WR8A 5GY7A 1TKRA 2ZRLA 4ISBA 4A2WA 4LJSA 4TTSA 1N3IA 4KKXB 1HQYE 5LA6F 2FYTA 1JBEA 4GLBA 2ZE6A 2PK3A 3S55A 3P32A 2P2CA 1Y9JA 1X3SA 3URMA 1FNBA 3C4JA 1BEUB 1NVDA 3HNPA 3G8YA 1UPTA 4BGVA 4BNNA 4RVOA 1JWBB 5LB4A 4PCUA 4G5FA 3QPAA 1UJNA 5DP1A 1KOFA 1IH8A 4J91A 4ENRA 3TXYA 5CYFA 2EW2A 1OFUA 3AJ8A 1FYXA 4JYAB 4DGSA 5JLAA 3AEKB 2VLBA 1C1XA 5JCXA 2J09A 4FFRA 4FFLA 3I2JA 3VR6A 3LGXA 4ND1A 4XGRA 3DFUA 4C05A 4DBLE 2YWEA 2KBFA 3O91A 1DEHA 3ETEA 3LX6A 4GM1A 5A6SB 2CF5A 3E1SA 3MCAA 5C8VA 3ZDDA 2PH3A 3FKJA 5CA0A 2BFDA 3T99A 4LQCA 3JQAD 4QUJA 2P1RA 2JFOA 3AGQA 3U31A 3IDZA 2QQ5A 4MQ6A 4YLGA 2AFIA 3IOMA 1GZ4A 2RKOA 4MULA 3DEFA 4KZKA 1SCIA 3DC2A 3KT6A 1NIJA 5K0LA 3IKTA 4LYHA 1UJ5A 4FKMA 4OQMA 4CF3A 3G02A 2O8FA 4BBJA 1PJCA 1ZGZA 2I67A 3LC0A 2XZPA 2ZCVA 3MC1A 1GPAA 2Z56A 3WAKA 3BILA 2F9FA 2AIRA 1D4AA 2NUPA 2Y1CA 3NEJA 1WMDA 4M1WA 4PAWA 4S1OA 1W52X 4YMSA 4Q5IA 5DH9A 3SBXA 2ZI6A 2DTDA 2ATXA 3IUQA 1M6VA 5HF5A 3LF1A 3DLCA 3HU2A 3K0KA 1WJGA 2O3JA 3EGVA 4MS3B 3ZH2A 3HLKA 1QU2A 1XRMA 1NXSA 1ZH6A 3BQ9A 4L85A 1YJXA 3DV0B 2HV8A 3A0UA 2BUCA 4A1FA 2X42A 5LSAA 4MSUA 4EQZA 2PJUA 2XCRB 2YZMA 4JGBA 1XGKA 4E88A 5C5IA 4G4SP 2VJYA 2PY6A 1C2YA 2YOGA 4YUAA 3AOEC 4Q6WA 3A2KA 1LPSA 2N1BA 5FAKA 4P3XA 1KBOA 1YVRA 2P6UA 4Y98A 1E6KA 1RZVA 4DMMA 1WV1A 5DX1A 4C0XA 2UZ1A 2EJCA 3LY7A 2ZIGA 5D7BA 4M36A 2E48A 3FOEC 2Q5CA 2AS0A 2G5TA 3RSGA 1WW3A 2AYXA 2H0AA 3CIOA 4GKVA 3QE2A 1R0RE 2B98A 2C8KA 5H3CA 4LNUB 4YV2A 3EPPA 2B83A 1T6NA 2XDYA 4BAGA 4ABYA 3KYBA 5IC6A 3HU5A 3BD6A 4IYRA 3IHLA 5ALPA 1R64A 1YR9A 4M1TA 5DN6D 3UKDA 3PGA1 1FNNA 4BNYA 1PFYA 3B1ZA 3CJQA 1WVIA 2I4OA 1TUBB 5AM1A 5EMKA 3VU8A 1QHYA 2IQIA 2GN8A 4XVCA 1JR6A 1QLJA 1IEWA 4RABA 2WHEA 4Q4DA 3C43A 2QYTA 1CC1S 2LWIA 1C50A 1SCDA 2YWBA 4IX1A 5ILOA 1CQJB 5F3DA 5ITZA 2A67A 2UYOA 4IWNA 2D0OB 1CR2A 3LP6A 4G5OA 3WWYA 3UTCA 4BKQA 2IEDA 3I28A 4QYXA 3ES9A 3K6RA 4XLTA 1OJ7A 2H1SA 3LY8A 1V6AA 1RMYA 2YV4A 1I7SB 1NAHA 3FVVA 3R6DA 2CZGA 4JEMA 4X66B 3UKJA 4ERXA 5EUQB 3CUVA 1UDAA 2IXGA 3H9CA 1T5TA 1DAFA 1V4VA 2ZB3A 3D0KA 1RFLA 1AF4A 3JR7A 3P2OA 4Q9LA 5KJ6A 1VPTA 4L76A 1DZIA 1FX0A 1V25A 1VG1A 3BF7A 3D6TB 1NG9A 1VLHA 2FMIA 2WT4A 3GB9A 2ENWA 1NJ1A 3TI9A 1IN5A 3RYIA 4NESA 4G5QA 4K0RA 4NE2A 4E5UA 4OHYA 1WMBA 1SCBA 1M8KA 4M9XA 4Q7LA 1NF2A 3BDVA 3S99A 4YR7A 3WGNA 2AX3A 1ACMA 2PUAA 3CVOA 1D2NA 4O0MA 3UQZA 1W5AA 2DUUA 3DMRA 3IIIA 3QPBA 3VKFA 3ZHTA 3A9RA 2OGTA 4C7VA 3NGLA 3UGQA 5K3EA 2EGGA 5C7IO 1IHPA 3FHTA 4QASA 3MJHA 1BXGB 3HV2A 5DBOA 3CB2A 4B09A 2XCQA 1ATZA 1UMCA 2I2CA 3BHNA 1JYSA 3B7PA 1S2LA 3F49S 2Z2IA 4JYZA 1W48A 1Z0ZA 1HE4A 3F8SA 2CVHA 2ZJ4A 3PX2A 1E61A 3SIXA 4FWBA 1S2MA 4JNKA 5ENDA 4AWXA 3GMDA 1ZIXA 3ZU6A 2OC4A 4D25A 4UCFA 5EEGA 4HEHA 2BOVA 1B0UA 3PA8A 1WE2A 2D5AA 2XQIA 2VBCA 4MJ7A 3I9V1 1OC2A 1OKKD 2I6GA 3LC2O 4C0BA 3TLKA 4LHWA 4OX9Y 4MW2A 5EIEA 1KKUA 5BW5A 4PGAA 2V8BA 1ODTC 3AUKA 5JSFA 3C3BA 3H75A 4DCUA 3NIBA 1NY5A 2GRAA 1AA9A 4RL4A 3T4UA 4JVLA 4R7ZA 3OOJA 3SM9A 4CM9A 1V8DA 2EFJA 3SICE 1SBQA 2DJ5A 2Q9AA 4E3WA 5L9AA 1UAGA 2AFVA 3LKDA 4IBOA 4MPJA 4OKNA 4RZ2A 3LUKA 1E6CA 3VYTB 4ZOCA 4A8JB 4CMGA 5K3DA 3OG9A 3U44A 2DFDA 1Q7BA 3QUSA 5EWJA 1N34B 2H2GA 3KKPA 5ALKA 3V6LA 5FJJA 3IA7A 5KTRA 1GYQA 2VQDA 2EHJA 2RDMA 3LK6A 3LU1A 5JWRA 3M49A 1ZD5A 2PH1A 1TGYA 1TGVA 5EIBD 2PIAA 2IEZA 4WAUA 4DIEA 5B64A 5CDGA 3RRYA 2JGKA 4JVMA 3QEMA 4IXWA 4RACA 3IHWA 3PGVA 4AZ0B 2B0JA 3NI2A 2FQ1A 3J80A 2VS1A 2C1EA 1ODLA 1ZL0A 2N42A 3LGSA 3LNCA 3HXPA 3PUZA 4HX5A 3BERA 3N87A 4J6EA 4D8WA 3A8TA 1P1IA 2NVOA 3LVRE 1BCSB 2BFPA 3LCJA 3I45A 5J1SB 2D1FA 2AKEA 3O9VA 3D3QA 4B4WA 5BP7A 1W0JA 4I3HA 4YP1A 1XZFA 4OGKA 1V37A 3A0RB 3SF8B 4B3RB 2UVQA 4HH0A 4M21A 3WX0A 1KMQA 3ANMA 3C6BA 3I4CA 4U6SA 4BLTA 1XNJA 5DWVA 2VPPA 5HYVA 1TQ4A 1W6UA 1IHYA 2ATCA 5KAMA 4MV8A 3KUCA 3ENQA 1K6MA 1FBNA 1H05A 1QE3A 1TJ5A 2FPXA 1ZHOA 4V0SA 2B1RA 3HQ4O 3RVKA 2GJ4A 3KQYA 3DTTA 1P61B 1LQ2A 1RABA 4JL5A 4XX0A 4YA6A 1U5AA 4R51A 1I4WA 2XIQA 4QOSA 1DIGA 4I8XA 5DHUA 1RHRA 1NW6A 3I39X 3PL1A 1RHJA 1X0VA 1LKZA 1REQA 1ZISA 3CKLA 4NG5A 1R9NA 2BFWA 1UXGA 2OKCA 1JR3A 2IX3A 3DVAB 2GFHA 2PBFA 1CRZA 1SUPA 1WTAA 4QGBA 4REQB 3OF5A 3V9AA 1H2RS 2V03A 2G5CA 2XEXA 2VR1A 1C29B 3PNKA 4RY0A 4EVIA 1F2DA 3BTOA 3A9TA 3G1WA 3H13A 2ZSDA 3KBBA 3KEOA 3UJPA 3B1WA 4BO4A 5AKGA 5EJ4A 1UPCA 3F9IA 5ALUA 4QU0A 1C0PA 3W78A 3R0JA 4B1FA 3KPVA 3BEDA 1G63A 1ZS9A 3IR6A 5G40A 3HA2A 4D56A 5DHSA 1AUVA 2X1LA 5KHOC 3I9LA 2IC5A 5CX1B 3T7DA 3DP7A 2WA1A 2FRXA 2AFHB 2CCGA 5HTOA 3QRWA 3PUWA 1AQLA 1BYIA 5HHTA 3TUZC 2NADA 5C7YA 3IVRA 3GLKA 3DWEX 2OUKA 1PWHA 3F5FA 3LT1A 4KMOA 4PS1A 4V3CA 2R5NA 3DG9A 5EKSA 4KR3A 3FGPA 2QTHA 2I03A 4CIYA 4B6FA 4PNEA 4KR2A 4R1TA 2GSWA 2Z8XA 1E2UA 2IRWA 1OX5A 1M54A 1JLLB 3U3OA 5K0ZA 4QWMA 2QRNA 3D7KA 4TMWA 1IN1A 4RV4A 1C1DA 2PZAA 1RVV1 4Y0VA 5HSGA 3GP3A 1CDEA 1KPIA 1OD6A 4EEXA 3IXLA 2WK1A 2JCSA 3WNCA 1QCZA 3A26A 3NZEA 1YJQA 2I6XA 4H35A 4OOFA 4EQ6B 1UJ4A 3VMMA 2ZIFA 3TLYA 2CN1A 3KP1A 4ZHQA 3FOBA 1FXUA 1H69A 4FYWA 4OQDA 2OXTA 3WQBA 5CHYA 3Q0IA 4MQFA 4I1UA 3G2IA 4FHCA 1AUXA 2FCRA 2J3JA 3A06A 3JALB 3TSYA 5BMVA 2EF1A 3DA8A 1U7XA 4ZVLA 1O96A 3JASB 4U3JA 4R40A 4UM7A 2WYVA 1WCXA 4GP7A 3BQNB 3C6QA 4IIGA 3TL3A 2GXSA 1RM3A 1HDXA 1IHDA 2FWAA 2JRLA 3JYPA 1GZ7A 4KV7A 5C2JB 1HPLA 4MDYA 3L01A 1ZK2A 4Q9NA 4LN1A 2AEFA 2C2KA 2POCA 2NU7B 3GCDA 2P4HX 3RWBA 3IMGA 4DYDA 3CG0A 3MIZA 4GBGA 1T25A 1OOEA 2GM3A 4WOCA 5J2UF 2ZRGA 1DBIA 2XUOA 4XLLA 3UT0A 5CFOA 5MDHA 4G0PA 4F2GA 1LLFA 2FPWA 4NZMA 5JD5A 2NGRA 3W4JA 2G9RA 2O7NA 3JQ7B 1UAAA 9ABPA 1SHZA 4HWSA 3IERA 4DSNA 4RTOA 4IO1A 4C87A 1BFDA 1GPBA 2DB3A 3P9KA 1PI3A 4MVJF 1UIMA 3EFBA 1Z2EA 1S2OA 1S9HA 2V7QD 1OLSA 3KEGA 2X4DA 3C6YA 4IDCA 1A71A 4UFNA 3V4PB 5BSWA 3R9XB 1EM6A 1RQRA 3JQGB 4X97A 4E33A 4EA6A 1HQKA 4QPCA 2DTEA 5BSHA 3TD2A 2IZ0A 1GKYA 2BKLA 1A88A 3FZGA 4K6GA 1AUQA 1C3JA 2VYCA 1HE5A 1WEKA 1Z0UA 2GN0A 2MJLA 2Y9PB 4TLMB 4TWAA 4I2VA 4OXXA 4EDFA 2YHAA 2QAIA 2YC4C 3COZA 5G4KA 3USES 5T67A 4V0LA 2O8EA 2XBLA 4JJ7A 1JHXA 1OYWA 2GARA 1UC4B 1J8MF 5HIAA 4CG0A 1TA9A 2ZANA 1N32B 2FKAA 3ZU3A 2VC2B 3TBKA 3MJEA 2ODBA 5H02A 1ZUNA 1GVHA 1VL0A 2B8TA 4G8DA 4K1LA 3ZNNA 2GHTA 2AW3A 4AZVA 4BNZA 4BUJA 1U8UA 2Q62A 1VJTA 2RGNA 3EZNA 3R5SA 4JQCA 1LTHR 4Y2PA 1E9CA 3A2NA 3GJ7A 1ADCA 1TRHA 1YD7A 3L6EA 1A7KA 4Y1RB 4V0RA 1QOQB 1C7EA 2Q5QA 1OWNA 1KQPA 2QRVA 4MMZB 2IJGX 4RE5A 3TMKA 3FGZA 4BMXA 3IBTA 5ULLA 5ALHA 3UFXA 3Q7EA 4J7AA 4JB2A 1DBVO 1B41A 5L51A 3IDFA 4CIXA 3LS2A 2WMYA 3NLLA 3S7ZA 3DNFA 1MDFA 3KUUA 3A6PC 1DO0A 1OWOA 2VOJA 4LHYA 5JZOA 4IKOA 2P6OA 4LOKA 1M1NB 1YBFA 3UC5A 2F43A 3D0OA 3TLMA 3BGIA 4E1BA 5K01A 2HRBA 1CUEA 4KAAA 3E9RA 1ELOA 2FPPB 4KXUA 4WNAA 1DOHA 5EWMB 3VI3B 1CTQA 3BE4A 3TE7A 3WL7A 2IUEA 1ZGBA 4FZJA 3ZHXA 2ZUFA 2Z95A 1K5DA 6ABPA 3BMNA 1O6ZA 2O7SA 1AKUA 3RAFC 2X9QA 2YHBA 3O6VA 1CULC 5CMLA 1E8MA 1UBCA 1RHUA 3KT0A 4J75A 1HZZA 3NBMA 5B1DA 1VMIA 2CNDA 4QNRA 1B0ZA 3ME5A 2OWDA 1UJCA 4GKKB 2QTBA 4JA0A 1JA1A 1V4BA 3KYIB 1ZD8A 1C5KA 3LIPA 4NF2A 4ZVSA 3COSA 4UDOA 4O4JF 5H1YA 1GM5A 1B8UA 1CVIA 5CYGA 6ADHA 1PGQA 4YJHA 1H8EA 1G21A 1QBGA 1U2QA 3DFIA 3EQ7A 1G0NA 3KZMA 5G53C 1JZTA 2FZWA 1HKUA 1I2ZA 2CUKA 2P9HA 1YZQA 1P4HA 3E8MA 4JI2B 1DAEA 2XYVA 4MV9A 3MILA 1DL5A 1ZG3A 2GKGA 2ON6A 4WLVA 4C30A 3RUIA 3WNBA 4GNRA 1N4DA 3ZY4A 5BWLA 1Y6GA 4X3PA 3AF6A 1JKJA 2AC4A 2CVOA 2H29A 2YQ4A 3L9XA 2C4TA 4I5FA 4WLEA 3IBCA 5JZ9A 3QX3A 3W05A 4DPLA 5KKCA 4BMDA 2JEOA 2R8EA 3PR2B 2C4VA 4U5XA 5JSYA 4Z1MD 2D62A 2ZTLA 3L8YA 4BIMA 1CZLA 1ID8A 2DHQA 3GYGA 5K0BA 4R9VA 1U7TA 3DEAA 4MRPA 3T41A 1HO3A 2HTEA 2ID8A 4ZD6A 3BGVA 3WRYC 2W2XA 4MUYA 2REXB 4PZPA 2AJDA 5NULA 4ED9A 2XGGA 6NULA 2V7EA 2DERA 1PZXA 4JZKA 3E35A 1TL7C 4I55B 7MDHA 3AYXB 3PVSA 3R8FA 4RZQA 1XVIA 2NX2A 1T2EA 4C76A 3RHFA 1ZKDA 4BDTA 1I7NA 4JQZA 2Z4RA 4WK4B 2J8ZA 4RBNA 4LCJA 1TW2A 2JFFA 5IYZB 1GIAA 4A5OA 5IM4A 3SVLA 3VR5D 4PRYA 1Q2UA 1AO0A 3H5AA 3U3MA 3VBCA 1XD2A 4UPVA 1XQ6A 1PFVA 2YS6A 4O2BF 2DFKB 1FMLA 3UWOA 2OXCA 3OE7D 9ATCA 1UDWA 3VR3D 1QGED 2Q7XA 4JFRA 1TIPA 4ZI7B 4EPXA 3RVPA 2M6RA 3H5IA 4Y2HA 3OH8A 3UJBA 1RXIA 2X9LA 4HMOA 4DPMA 2F7SA 5F2NA 1JT2A 5EHZA 1EUYA 2PLFA 1F9EA 5LJLA 4OM7A 2JJYA 3SS9X 4TS9A 4R8RA 5L7TA 1W0KA 1L7NA 2V97A 2ZSKA 1UEJA 3WL3A 4XUCA 5DX0A 4Q05A 5CEJA 4CU2A 4NDZA 3G88A 4N3GA 2HEGA 4DAOA 2M9MA 3B1XA 2IUTA 1E1LA 1V48A 4X6LA 1ISRA 2BDEA 3Q0TA 5HFAA 3L4SO 4D0SA 2ZRNA 4E6EA 1JEJA 3O84A 3QBEA 5E6UB 1PIWA 3D2BA 2GD6A 5J9FA 1TVEA 1EFPA 4V0MA 3CNHA 3SQMA 4YT5A 2K5UA 4NYMQ 1OSNA 4WY5A 4Q4CA 2JK1A 5C46F 4RD4A 5TC4A 3TW8A 4TTRA 4U2EA 3U0VA 1M1XB 2IBMA 3CFYA 3A9SA 1DAIA 3PFKA 1TVKA 5H80A 1XDBA 1UP4A 4LOLA 1CIJA 4G07A 4MO2A 2WICA 1LDNA 1PBTA 5REQA 1P74A 2G1JA 1F5SA 2K7FA 4D9GA 1TZMA 1Z4JA 2IYZA 4MB2A 2AGVA 3KB2A 1IHUA 1DDOA 2CLCX 4KWTA 5BYJA 2V65A 3LL7A 4BQIA 3IYLW 3B7GA 2DQZA 1J0EA 5IJ0A 4L9WA 5ICSA 3KWLA 1C9JA 2R97A 3GRKA 1XVLA 1KMHA 1XXHA 1ZJZA 3CUYA 2FWPA 2W7TA 2O1XA 4YJ3A 2R7LA 2IV3A 2ECOA 3C3KA 3DC7A 1QIDA 1E6EA 4R9RA 3S2GA 2X2FA 3HACA 5I48A 5GINE 3BXFA 3AJEA 1AUPA 4JLPA 4YK7A 1VJRA 1EXDA 2HGSA 5E95A 1ZOIA 4QTXA 2EATA 1AK1A 1B8NA 3DTNA 1MB3A 1PD1A 2RBKA 3I52A 3IESA 3TCNA 2J9ZB 4UTPA 1KI6B 1GGFA 1T29A 4UTRA 2Z6UA 2W5UA 1ADBA 1DIAA 3Q2OA 3X1ZA 3C98A 3DYIA 3P4YA 4V38A 3SC6A 3ZWNA 4HNAB 4BRUA 4FYMA 3BREA 4O4LB 4CM7A 1OWMA 4QQNA 4DR3B 1QDUA 2O19A 4G5HA 2ZR7A 3RRMA 4TTPA 2OFXA 1R9MA 1J24A 1U11A 3DV2A 3H83A 4LW8A 3TOXA 4DN6A 5F3WB 1U2GC 2A4MA 4WK0B 1RBYA 2UVPB 1UT5A 4UE6A 2C5SA 5DF1A 1LJUA 4YQEA 1IUNA 1EG2A 4Q7QA 4IH1A 1EUDA 5JD4A 4DRXA 3ETHA 1O6BA 3PX3A 4PBRA 4C9BA 1ZH0A 2DFLA 3E82A 4BPRA 3MFYA 4RNCA 2HCFA 3TFWA 3KYDB 2C99A 3QOWA 1DG9A 1J7KA 1FLDA 2O2DA 2JJ1D 3EZ9A 3KZXA 4JWTA 2HGZA 2JLXA 1JP7A 4D3SA 1Z07A 2L17A 3H11B 2QD2A 1VKHA 3NO4A 4BNVA 3NNDA 4IQGA 1D6JA 1ZW6A 4MGZR 2IYTA 4L8VA 1YKFA 5ER9A 2LV8A 721PA 1A3CA 1BNCA 1UJ2A 2O2YA 1R4MB 2OHOA 1LXCA 3G2JA 4MGHA 4MKIA 4J7CA 2HHAA 7AT1A 5KKAA 4NBSA 1PUXA 1L5RA 4LBZA 4JB3A 3UMGA 5H68A 1JEYA 1DRVA 4YWHA 3EA5A 4JKOA 3SDSA 3VYRB 3QELA 4DLBA 2RK6A 4RM3A 1P5HA 2B36A 5CAEB 2RCYA 3KTOA 4TTJA 4ZAXA 5B37A 1J0BA 2Q7OE 3F5MA 2NVWA 2BM0A 2LCQA 1QNFA 5JTUA 3HZOA 1OU4A 3FIUA 3EYWA 4N5DA 2DHEA 4D0LB 3ZWAA 3X1KA 3NTQA 5AUNB 5LQRA 1N8NA 2BKXA 3UB2A 3L6DA 1UJ6A 3U4DA 1EHIA 2IS2A 1EDZA 4HB4A 2H59A 3C41J 4J0FA 2WINI 4OJKA 4HDMB 1H0KA 2OG1A 2QLTA 1KJ9A 3DZGA 4PSUA 4QATA 3IP9A 5CH3A 4FN5A 1JG6A 1SMKA 1RR6A 1SZPA 1PR1A 1L4UA 2BH9A 3AEKA 3PJFA 3BZWA 5DNCA 4W5OA 4NY1A 5DGIA 5I7VA 3TQRA 4AXBA 3ORFA 4MQ4A 4D6XA 5FFMA 3E61A 5CA1B 4N5NA 1AM4D 2ZDGA 1FFGA 1LU9A 4CLEA 3IE2A 5J4YA 2QUJA 3D8NA 5J2TF 5A6SA 2AH5A 2HHLA 2Y6UA 4CKXA 4URFA 1SQSA 2JFNA 1I33A 4EF5A 3NMUF 3JWPA 1VTKA 1Z6TA 4Z7OB 4PZDA 1PKEA 4DKXA 4JR1A 5BR7A 2RGNC 2YMPA 1QJ4A 2IUSA 4B8ZA 5JYEA 1CZRA 4K40A 5JVDB 3QKIA 1HYEA 2E5LB 3PUKA 1RRGA 3MIIA 5EZ6B 3C48A 3GCGA 3SQOA 4PBTA 1JQKA 3GJRA 5IKEA 1ML4A 1DGQA 3JVIA 1SZJG 3G17A 1KXZA 1WXHA 4KGDA 3V4ZA 2V7UA 1UR5A 4Q4AB 3WMGA 1OZFA 1PKXA 2AEMA 2AN4A 4AG3A 1D2RA 4JHXA 1F51E 1OASA 1D7OA 4B3MB 3B60A 3VR2D 1IOZA 3K0CC 1E5VA 2FR1A 1WF6A 3O1JC 4TVKA 4MS3A 3AHCA 1C9DB 4RNDB 3ZZNA 4ECEA 4AKEA 1Q3HA 5FYQA 1KS2A 4RZUA 2FWBA 2PE5A 1TYZA 4QTUB 7REQB 2IYSA 3C6MA 1ZGCA 2BEUB 3MRSA 3VOTA 1G8HA 2V45A 4CR7A 4F3KA 2JA1A 2WVGA 3NYWA 2O2XA 4QQFA 3WGVA 3NBXX 5A5VA 4ZEWA 4PIMA 2FX2A 1MT0A 4OMFG 4JUFA 4UHHA 1VQ1A 3A6FA 2AMYA 3AV0B 3GPCA 2FX3A 4IFEA 1TAHA 1CNFA 3EGEA 3M6MD 3M81A 4R0NA 3RS8A 3TRKA 3CVYA 3FKSD 1N78A 1FXWF 1IBMB 3PFIA 2PO5A 3VM6A 4LNUA 1PP4A 2F67A 4I3FA 5DMHA 1F12A 1DRUA 1V11B 2GPYA 2R5WA 2OZVA 4HPWA 2TS1A 1O7JA 1G8MA 1E2PA 2FN8A 3GBVA 3ROFA 2R1UA 4HX9A 4NEGA 2CXHA 2X8AA 4D1YA 3ZVKA 1F3OA 5KVCA 5DN6A 621PA 2XLBA 3OLZA 1L7EA 2XMCA 1TUBA 3NB0A 5KCZA 3BSSA 3HR8A 4AKHA 3U4IA 1R0KA 1XZNA 1ZLYA 4PANA 4UEJA 3ADDA 5JD3A 2PXHA 1H4QA 5JCZA 1GCOA 4ZTUB 4D26A 3ZY3A 3BB4A 2R6GA 3REQB 2QF7A 1MG0A 4H7DA 4XOUA 2XUZA 3LWDA 1CQJA 4FC6A 3LMKA 5FOTA 3TKLA 3WVNA 1ONNA 4P3KA 1QZTA 3D3WB 3KX2A 1XRJA 2HRRA 5ABPA 1EXVA 2ZIUB 1JIUA 3GF4A 3GOHA 4R69A 1PTJA 2JKYA 1JMKC 3PNSA 5HMLA 3ZR4B 1KZ7B 4A4DA 3MS2A 1KI9A 3OZVA 4CPDA 3OI7A 1X1EA 4TRMA 1QZUA 3STYA 5ITWA 2H1WA 1BHO1 2VHXA 3D7MA 5BNIA 5IVPA 3R5XA 3RSCA 5KCMA 3W4KA 4EH1A 2FN9A 2FEXA 2K2QB 1NTRA 2D54A 4BVAA 3ONNA 2E5WA 3SYTA 2Z6VA 2O8NA 4DV4B 1KZ9A 1OXBB 4KREA 1JDBC 1I2AA 3H87A 1RJWA 4ZALA 3VISA 5BW4A 1KRWA 2WB2A 4XKJA 2C9YA 2BLLA 3PT9A 4GMKA 3RSLA 3ZWXA 4DV1B 5CJPA 1GZ3A 2C5EA 3DZFA 4LJLA 3LBFA 4ZU6X 3RVJA 1P1JA 2PQ6A 3H86A 3AHIA 1TO6A 3ZZ0A 4JVOA 6LDHA 4F3TA 1DOZA 2JLAA 2QSUA 3DBHB 1U9IC 1ZRMA 2GWHA 1XCMA 1SHUX 2IIVA 2XUFA 1K5GA 1CETA 3EC2A 4ARZB 1ZJ4A 2J3EA 1YZ3A 1BXGA 4AJ9A 1HM5A 1N5RA 2EZTA 1B8VA 2DM6A 4D99A 2IBSA 1KDPA 2B8JA 5BO5A 5LOVF 1HH4A 4Q93A 2FGJA 4LWPA 2Z8YM 4B6OA 1JQ3A 1QH8B 4BGEA 4Z8YA 5IKPA 2G82A 1X7XB 1U98A 4NDAA 5ESXA 3VPXA 4O2AB 2QG4A 1W5FA 5EJ2A 2J32A 2CYBA 5EIFA 4FFVA 1MNAA 1QZXA 1YDEA 2E21A 3HCEA 4TKUB 1WOMA 3FH0A 3H3JA 2PS0A 1ZH8A 1WKVA 2C4KA 4PR3A 1EUCA 1VIMA 2JNWA 1KL7A 2HWUA 4GRIA 1OKKA 4LI0A 5FR2A 8GPBA 3RC9A 1DC7A 2ZJOA 4IHJA 1XCJA 3V2HA 5AI6A 3IQEA 3U3DA 1PT5A 4A8TA 4NL4H 2FEAA 3V8EA 2EIXA 1QRAA 2HRZA 1KMIY 1PR4A 3L18A 3I2HA 4KQIA 3HUEA 4BEVA 4IP0A 5T7BA 1I7LA 4A8JA 2VA9A 4CQJA 5BSRA 2GAFA 4LY3A 4TKLA 3UO8B 3N59A 3A6KA 4YI5A 1E2NA 1MUUA 3AONB 1NXWA 4DUPA 2ZXEA 4IJUA 3ENNA 5E9WA 5THKA 1UPXA 3B1KA 5IK2D 4N0QA 5KNDH 1E8NA 1KH1A 2O8VA 2RHTA 2B7LA 4LJ6A 4PICA 4BAUA 2R3SA 4TXJA 5AOBA 3RBAA 3MRVA 1AC5A 1M1YB 4KDCA 3FVWA 3FRHA 4Z7NB 3BWYA 4ZCQA 1KAQA 5BXQC 3O3MB 2NO6A 4QSMA 3FCSB 3EXG2 3L02A 1E77A 4AZ0A 3NS7A 2R79A 4H17A 4CM1A 4TL9A 3I9MA 4WWHA 4B6EA 3S6JA 4RKWA 1TVCA 2AJ8A 1BCSA 2G6TA 3HHPA 3G0IA 5SZKB 2IUUA 4TSRA 4DQDA 3U80A 1QYWA 3TR0A 1XZBA 1ZXLA 2OCYC 2PMBA 3E5HA 3SF8A 4CRWB 5H9WA 4HRVA 2KS6A 4BVEA 4MWCA 2PKQP 2ZWOA 3BTSA 3TRHA 2FR8A 3A1CA 3I9OA 1G7CA 4L16A 2HB6A 1N6HA 2HJ9A 4C0WA 2GJSA 3FPJA 4C04A 1XHFA 4O4IB 1WBDA 1Y3FE 4Z4IA 3K9HA 4IYJA 3OA2A 1ZCBA 4OH1A 4WN3A 4F9TA 3NJ8A 3OLQA 1L5GB 5C52B 4J76A 3H4VA 4KXLA 2FG5A 1BQEA 2O0LA 1J22A 3W77A 3R7BA 3U61B 3RJ9A 1MZVA 4C2BA 4XE5A 3DH0A 1N25A 1T0IA 5F1OA 4AMBA 4W7SA 3I8XA 3T5MA 1U4SA 3O4RA 4NZNA 3DOHA 3DVAA 4XB1A 4XVQA 5SY9A 1IG3A 4REQA 1ID1A 2E1PA 4NK4A 3ZNPA 1Z5ZA 4RDHA 2DQYA 4O5OA 4EUEA 3ZQJA 4V39A 4P83A 3LI2A 5A1TA 2HADA 1CBUA 1KHHA 4FLFA 2ZBGA 4G0ZA 3SHFA 3WWZA 4HADA 4RADA 4HGNA 4UPDA 5K0SA 5L3QB 2CJWB 2WT9A 1SD5A 1INLA 3WL8A 1SXJD 5DTRA 1GZHB 1QO0A 4BQFA 2Q6VA 4DCTA 1SXJB 4KWCA 1R18A 4AY2A 1R0LA 1V9LA 1R8QA 2PL1A 2Q5LA 5CX1A 1WXWA 3HCNA 5FHQA 5KNDD 2Y4OA 3TKAA 1RDFA 4ZWNA 5GP1A 2AFHA 3TM5A 3UA4A 3RSQA 3AJDA 4EVQA 3ZK7A 2D7DA 1I5RA 1KO4A 4M9SA 2PA3A 4HCJA 3CXRA 1QHIA 5CVVA 3TECE 1N7JA 3FUUA 2ZITA 4UBNA 2ZK7A 1GUBA 3VSEA 4U2CA 5DBHX 1P39A 5J59A 4ND6A 3ZLTA 4B75A 2XB4A 3DEKA 4LMRA 2FUEA 3FM9A 4EY5A 3HCRA 4WNYA 5JO9A 1Y3BE 1ZC4A 2RGWA 2HMVA 3D5TA 3PB3A 4CGZA 1JLLA 3HUFA 4NENB 3OZBA 1Y9EA 5BV0A 4B44A 5JI3E 3O1IC 1JJFA 4M0MA 4K6HA 4R41A 4UAJA 1T15A 3THXB 5AXBA 4AO8A 1W5SA 3BJRA 2ZAOA 1YT5A 3TLJA 3IPRA 1SJ9A 1I7QB 4QT0A 4UC0A 3TAXA 1R50A 2O8EB 1E5DA 2IY8A 3V6MA 3ZWDA 4O3FA 2AF3C 1ADFA 4YAFA 4X45A 4BS9A 2VZ9A 1I4OA 2GJAA 3ZH9B 4DC9A 3KR1A 1BJRE 4JP2A 1A98A 2GLUA 2BFEB 3L7DA 2CMDA 3U7EB 4DLNA 4ARIA 2WUEA 3JALA 3COWA 1UK8A 5FI1B 1J8DA 1JKMA 2P6RA 2C5HA 1BJTA 1OTXA 4LF6B 4QDJA 1SKMA 1T8TA 1Z45A 4KO8A 2FF5A 4R6WA 4GO1A 5SYNA 3HZZA 4CHTA 2NPIA 3QU7A 2RGRA 4YWJA 3FNFA 2CBZA 1T43A 4UUPA 3TCXB 3RHZA 3DMTC 5EE3A 1K8ZB 4L0DA 1KP2A 4H3HB 4D9CA 1YV9A 2NU7A 1UKVY 4CGYA 3L49A 2YWDA 4GQIA 4ILEA 1MN6A 2LNDA 4R3NA 3GEEA 3BG5A 3ZHSA 2IEIA 3IKJA 2WWYA 3U7GA 5HUQA 4E11A 4LZOA 4OG2A 3QBTA 4KIJA 4P7BA 4B4OA 1T2AA 1TQ2A 2ZJYA 3KQNA 1R1DA 3U3RA 5HZGA 2ORYA 3CF0A 3CPHA 3JQ7A 1H4VB 2PAAA 3CN7A 2JRCA 4ICIA 4L1KA 3AMVA 4QNMA 4Y1FA 3ZK9A 4LJAA 1X1CA 2X3FA 3FHOA 5WRFA 5KDOA 1HOXA 2ZGVA 3MJRA 1YQTA 3CU5A 1JJ7A 2ID7A 3DZDA 3QF4B 5JH7B 1JLMA 1DP4A 5D8DA 4I2NA 4E31A 1RXSA 3R9XA 4D42A 3CX4A 2PWZA 4WNIA 1UBGA 3JQGA 1NMEA 3C1AA 3VZBA 4ZYTA 2UYYA 5BR8B 4PWYA 1QQAA 4F5YA 1FFXB 2WFAA 3KFLA 1JH8A 1D07A 2XB9A 4GP6A 2VA8A 5TT1A 1FZTA 2YWXA 5FTLA 2BFOA 4M7OA 4I7EA 2X0NA 3IPXA 5EIHA 1DI0A 2B82A 4F56A 1A5BB 5COBA 3W7BA 2Y1XA 1CU1A 2WOJA 3V4FA 2MSWA 1OMOA 3KV3O 3P4UA 1H65A 1XFAA 4LWOA 4YCAA 4PFQA 3MMPA 3X1WA 1PQWA 2UZ0A 2QVZX 4RKRA 2Y9MB 3HUTA 2IYEA 3HBLA 3GVPA 1YC5A 2V59A 1CJBA 1U2DA 3BSWA 1DARA 4I6JA 1ZK1A 5T4FA 3Q8MA 4Y1RA 4NYIQ 1WU8A 3HSKA 3MZ0A 3AF4A 5AM4A 4ER3A 5CBPB 1PTJC 2R65A 1PNRA 3WI7A 1MVLA 4PNPA 4ARAA 1JAXA 4Q9AA 1UFQA 5H59A 1DKPA 1NT4A 4AJIA 1RWNA 2OO3A 3DT8A 1GTG1 1QPBA 3MTQA 3OIDA 3V1MA 4XRGA 2ZRHA 1V2GA 5JAZA 4UD6A 4QDXA 2O2EA 2CBXA 4DIKA 1QGZA 3OPYI 5B6PA 1MO5A 3OKAA 3IILA 3R0ZA 2YXLA 5F9MA 4HP8A 2J9XB 1S7CA 3JV7A 4IRXA 4HLDA 4QUGA 2QU8A 5B3AA 5I51A 2YHSA 4QUKA 2PUWA 1O08A 2RHOA 2Y0DA 3ETGA 5KDLA 2ZRDA 4EM6A 2FPPA 1RWBA 1N2ZA 4PS0A 2V4UA 5EWMA 4D2IA 3D2AA 4PCLA 2K2WA 2OFWA 3I4LA 4IY1A 3NU1A 1DEXA 5ADVA 5LQCA 5HG0A 3WGIA 1UF9A 2GBCA 1HDYA 4FMCB 3KZKA 5EJ5A 5HM8A 4KUGA 1KFEB 4PFJA 5IFLA 4ARSA 2X5OA 4EPTA 4M3NA 1HFWA 5I9LA 5EINA 3WQRA 2CXSA 5DASA 3DDCA 2FKNA 5BUCA 3DLBA 4QGSA 1ZXXA 4YP9A 3PPVA 1TM2A 1VYHA 1ZMBA 4PXYA 2C8LA 1IQRA 5TMBA 2ZRKA 1UBKS 1SQFA 2X2EA 2I7VA 5FKJA 1WMAA 4DUGA 1PWXA 1A5SB 5IVHA 1TCUA 5KNBD 3UY4A 2I3ZA 2V3CC 5K20A 1GL6A 1CDZA 1IWBB 1K2VN 2GKSA 1JSCA 2O5VA 2W9XA 2AOTB 2WWHA 3O5AA 3ZD9A 3PDJA 2F59A 3DQQA 1X80A 1F4PA 2QVLA 3AR3A 5FADA 1LK7A 3V1NA 1K7FB 1E9EA 2AXEA 3OOHA 1QQ6A 3EVBA 1OU0A 5FHRA 4UUBA 1SOUA 3E5RA