3K6JA

Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.elegans
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
433
structure length
430
Chain Sequence
HHSTGENLYFQGSEVRSYLMEAHSLAGQWSLPNDRGDHTNSEAYDVNSVAIIGGGTMGKAMAICFGLAGIETFLVVRNEQRCKQELEVMYAREKSFKRLNDKRIEKINANLKITSDFHKLSNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGNCKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIITNFGFLMGPMTVADMNGFDVMEKLKKENGLEPNPIEKEMWRLKRYGRKTNKGFYKYDDKTQRKENDTEMEQIIRRVAKSNIQIINDQDVINFMLYPTVNEGYRCIEEGVISNESLIDIMFILGFGWPIHSGGPMRFGKTEGLDKIANMLVHWSSLEPKESAYIVADALKTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
molecule keywords Protein F01G10.3, confirmed by transcript evidence
total genus 156
structure length 430
sequence length 433
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3k6jA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k6jA01
1Y8RA 1QKIA 1JWAB 1Y9AA 2UYYA 5KCZA 2DU8A 4R3WA 1MA0A 2Y99A 2ZK7A 3T7CA 1LDYA 1B26A 3ROPA 3ONDA 4OSPA 5EINA 4KQWA 2PLAA 1E3WA 1LXCA 3ZNOA 5HRUA 3KV3O 1ZKMA 2ZCUA 2PD4A 1Y7TA 2ILTA 1E3WB 1Q7GA 3B1FA 3BXXA 3D7LA 5AXBA 4GL4A 2Y0CA 4YQYA 5G4KB 3TRIA 2OO5A 3OJEA 1DFIA 3L4SO 3FSRA 5I7EA 4QECA 5F5NA 1TT7A 5EJ2A 5TX7A 1O6ZA 1RYDA 5C37A 3L9WA 1VL6A 4BMSA 1ID1A 2DQ4A 1XIVA 5ITWA 2WM3A 5KJ6A 1UR5A 1KYQA 5A4DA 4FFPA 1E3SA 5EESA 3QSGA 3ANLA 5CAEA 4J16A 1E1NA 1FDTA 3EW7A 3GH3A 5JCXA 5AXCA 4UUNA 3VAZA 3FNHA 3KB6A 4MINA 4XYMA 1PJTA 4BNTA 4ZN6A 1P44A 4MP3A 4PLTA 1XA0A 4RGBA 4CV3A 4RVUA 3KRTA 4FGWA 4ZRMA 5KIAA 3RUFA 4RQTA 1EFLA 1UAYA 4BNNA 1PGOA 1PJLA 1XG5A 1V8BA 3L07A 4J1QA 2YV3A 2W90A 1KEUA 1NVMB 5DCUA 1P33A 2GD1O 3I9KA 4BMVA 2HMWA 4AJOA 2X5KO 1G6KA 3WGIA 1J0XO 1VL8A 5JO0A 1R37A 1NYTA 3H8VA 4CQLB 3WWZA 5BSEA 3ZCXA 1B8PA 5HM8A 2DUWA 2UUOA 2AQKA 3EVNA 4DLLA 5AQ1A 1Y8QB 1ZK2A 3NDJA 1XQ1A 3PFFA 4J6FA 4A5OA 2GR9A 2W2LD 3A9WA 3WBBA 5ADHA 3QV1A 5JO9A 3JQAD 3D1LA 1GY8A 2VCYA 1K6IA 3DBLA 3I83A 3PGXA 4EUHA 1D1SA 2FY8A 2EERA 3FR8A 1Y9EA 1XU7A 3P19A 3OICA 2I5PO 2D8AA 5F21A 1ISIA 4AL4A 3FI9A 3H65A 3DOJA 4CMEA 3D5TA 1CRWG 3O9ZA 3F1KA 3K2BA 4UEKA 1PGPA 3AJRA 1YO6A 4CMIA 4BNUA 3I4CA 4G5HA 3ENNA 3PHJA 4PRLA 4RPLA 1TB4A 4BNVA 4ALKA 1VL0A 5BT9A 4WECA 2J3IA 3ZW9A 2FRDA 1XDWA 2GN9A 2HMTA 4R3NA 4O5OA 2EJWA 3TDKA 5J23A 3ZV5A 3G17A 4EUFA 3KYCA 3S2FA 5MDHA 1AE1A 2FR8A 1C0PA 3DZJA 4BNKA 4GVXA 1LDBA 2RH8A 2HRBA 5IZCA 1M67A 1PSDA 2XPCA 3RUHA 4IY1A 4Y6RA 1SMKA 3VC7A 1O5IA 1B3BA 1HRDA 4CM3A 4TMFA 4CM6A 1O9BA 1HDYA 4CPDA 1ZK4A 3RASA 3Q11A 1ZK0A 5TS3A 4EEZA 1S6YA 3DZGA 3W4IA 4BKUA 3LLSA 2Y1CA 1QYXA 4D3SA 3O8QB 3U5TA 4XYGA 2WYUA 1SC6A 4NMHA 4ITUA 3MJ4A 1ISMA 1MC4A 4P22A 1CQJA 3BA1A 4R1SA 3HUDA 4WGGA 5T64A 3TZQA 1M6HA 1YL5A 3R0IA 2BLLA 5KVVA 1E3JA 1OI7A 4I8XA 1SEPA 1P1FA 1XEAA 4OJNA 1HYEA 3GMSA 2DUUA 3E03A 3U4HA 4DYVA 1HE5A 1P45A 2H1SA 2HK7A 3OQ6A 1MFPA 2PD6A 3HB4X 4YRBA 4KMSA 3IP1A 1ONOA 1NFRA 2A92A 2B5VA 1KIFA 1XYGA 3BYZA 4YTEA 5IDQA 2CVZA 1BWSA 2FR0A 1MG0A 1V9LA 3JQEA 3WQSB 4ESOA 1UXHA 1T2CA 4J4BA 3F5SA 3NV9A 3C1OA 4B79A 2PFGA 1ZIDA 3WLFA 4B8WA 4HXYA 1GDHA 4PN3A 2GGSA 3JQAA 1JKFA 3JQ6A 1A7AA 3TSCA 1T2AA 2AEMA 2PY6A 4RV9A 1T2DA 3UICA 1X7GA 1SAYA 4I9UA 3PHHA 4CODB 1GQYA 4E6PA 5U1PA 1NFFA 5I7SA 4CV2A 1LLUA 2X58A 2F1KA 4QQRA 2C59A 3CSDA 3FHLA 4MVJF 1CETA 3WTCA 3FTNA 5H82A 2V6BA 3A4VA 2CDBA 5TJ9A 3JV7A 9LDTA 2B36A 1MG5A 2GN4A 2CMDA 1BVRA 5AXDA 1JVSA 4A27A 5JBIA 4W4TA 2D2IA 5L7TA 4WKGA 1YJQA 3KSZO 3QVSA 2WEKA 3BMNB 4J1TA 4W7IA 2BH9A 4NG5A 1BHSA 2GDZA 2IEDA 4XQ9A 2BFPA 3OIGA 1NHGA 1NQOA 4U8GA 3EC7A 1CDOA 4TZTA 3VDQA 1EVYA 3ZWOA 2DTEA 1WLYA 2BF7A 4MKRA 3L4BA 2IZ1A 2QQ5A 4JLWA 4RF4A 5L4LA 4BNLA 4PG4A 4R69A 1YVEI 2QRJA 1C1XA 1KC1A 4NBVA 5B12A 2EW2A 3ST7A 2GN8A 5GY7A 4F46A 3FRJA 3GPDG 5ENDA 4J2OA 5KJCA 3ADOA 3JD2A 4IDBA 5EMHA 1M76A 4R54A 4B7CA 4NDNE 2PD3A 4CQMD 1K0UA 1DRUA 4NK5A 3GVHA 1QYVA 3DZIA 3PLRA 1UAGA 3LK7A 1DLJA 1HDGO 3GRPA 3M1AA 2PA3A 3VPHA 2C29D 3HFGA 3Q6IA 4RQUA 4JQCA 2VYNA 2O23A 2Y1GA 3E82A 3MJEA 2HJSA 1E6WA 1V3TA 4KUEA 3TZ6A 2E49A 1ISJA 3LF1A 4MVJI 2EV9A 1E7RA 4UUMA 1ADGA 1U28A 1PQPA 3ITKA 3Q9NA 4M49A 2OGUA 2P9CA 3K92A 4O59O 1CWUA 4TROA 3PPIA 2FPPA 2ZIZA 4PLFA 2R2GA 1E7WA 3MJSA 5B4VA 5JSFA 3BTSA 3E1KA 3WGOA 1KOLA 4U0JA 4PVDA 4CLDA 1N9GB 5BSHA 3X2EA 1MP0A 5IN5A 4GSLA 2IYPA 3GVIA 1PJ2A 1HDCA 3IUSA 4Z0TA 2J5KA 3LC7O 3GDFA 5TF4A 4CM8A 1H5QA 4E32A 1Q0HA 4NU5A 3PHLA 3ROMA 4YB8A 1E3EA 3I23A 2VHZA 4GMGA 4BO3A 1ZEJA 2YFHA 2IEBA 5L40A 2BFOA 3ULKA 1MUUA 1B0AA 3VZPA 1WZIA 3OQ1A 4IQGA 3C85A 4ND1A 1B15A 2I65A 3GEDA 3K96A 1BXGB 3JQ8B 4UULA 1I3KA 4IGEA 3ZWCA 4WCFB 2VHVA 2WTBA 4RDHA 5CEJA 3DB2A 1T24A 4D79A 1M6WA 2H6EA 1Q1NA 1Y1PA 4F3YA 3X2FA 4RCVA 2NU7A 1HYHA 2BGLA 2DBVO 2W2KB 1DLIA 1Y8QA 3G1TA 1R0KA 2HQ1A 3I6QA 4B8ZA 5DOZA 4AJPA 3HNPA 2FPGA 1U4OA 4PG5A 4NR0A 3W4KA 4KUGA 4UUOA 1ZSVA 3GNQA 1G0NA 2IODA 1ISGA 3RAJA 3OMLA 2C07A 3JD1A 3BZUA 3B1KA 3MEQA 4CLHA 4RLHA 4OMUA 4WK6A 2D5CA 3UCXA 3PFWO 2YYYA 4OGWA 3QWFA 4MJLA 4WEOA 3D4OA 3DZFA 4AICA 4G81A 3HG7A 2Q3EA 2C7VA 5L95A 1ZBQA 4OQYA 3QWBA 4JBHA 4D3DA 4MOWA 3N7UA 2Q50A 2B4RO 1TA4A 5AOVA 5GZ1A 3JYNA 2PK3A 1C3VA 2HMSA 3R3JA 1H94A 4LRTB 3CMCO 5JLAA 1AXGA 1IY8A 1YXMA 2C2YA 4GQAA 4WLEA 4DGSA 2C7GA 4CUKA 4II2A 1NR7A 4AJNA 1GV0A 2P5YA 1QXSA 3EZLA 5KJFA 3K9QO 2PWZA 1NX6A 1IL0A 2Q99A 2JJYA 1ZO8A 1LSSA 2D5AA 5T5QA 3LT0A 3JYLA 3AOEA 1YBAA 2IYOA 4AJHA 4RO0A 2WD7B 4E12A 1IHYA 3I6IA 4URFA 2P4HX 2E37A 1GPJA 4X54A 3QVXA 3K8ZA 4AJIA 3IIEA 3ENKA 1UDBA 3TZKA 2AQHA 1VRWA 1P1JA 1KVQA 1LTHR 3OBBA 4CM4B 4IMRA 1E1KA 2D0IA 5HBRA 2DLDA 4HWKA 2Q4BA 3GEGA 3BMQA 4BNWA 3H9GA 4DXHA 2UAGA 2PZMA 3AY7A 1DSSG 1QRRA 4M86A 2W2KA 4S3MA 4F45A 1O0SA 5DBFA 4CLXA 4PLCA 3U9LA 4IJUA 1K89A 1L7EA 4I5DA 3SC6A 1A4UA 4IIVA 5I9NA 3PI7A 4YT4A 2JCYA 2G82A 3BMOB 1OC2A 3FPLA 3PZBA 1X7HA 3PYXA 4UVDA 1I33A 3UHAA 1ZJZA 2D59A 4ALLA 3GGOA 4CM5A 1PJCA 5B4TA 3NT2A 1A5ZA 3WJ7A 1EQ2A 5JY6A 2HU2A 1RKXA 1NAIA 4KWHA 1R4NA 2ZTLA 3AFNA 1EDZA 3L6EA 4QUKA 3L6OO 2YV1A 5AYVA 5CG2A 3UGKA 3WGZA 1LA2A 1N9GA 2A35A 2P4QA 4B4OA 2GO1A 4I9HA 1H6DA 3DBVO 4ALNA 3HDQA 3LT4A 4PIVA 1H93A 5TRTA 3BIOA 3NUGA 2Q1TA 4BO5A 1VE9A 5LC1A 1F14A 1T2FA 3HN7A 3U09A 4EYEA 4PLVA 1GUFA 4L4SA 4KQXA 1QYWA 4DPMA 3QLJA 2QG4A 2AA3A 1SBYA 3CKYA 2J8ZA 1YH3A 1B7GO 3JD4A 4R5MA 3BHMA 1QG6A 1ZSYA 4OL9A 4QFDA 4PCVA 4ZHSA 5IDWA 5K0ZA 3ABIA 1OBFO 4XJTA 4XR4A 4AJJA 4ALMA 4FFNA 5JMWA 5KWEA 4B3HA 3MTGA 4W82A 3ZI0A 4CLOB 3HDYA 2WE7A 1FDWA 4NBWA 3PXXA 4A26A 2JAHA 4WLNA 3W1VA 3RJ9A 3N74A 1J4AA 4II3A 4P4LA 4FS3A 1UDAA 3QWHA 2CFCA 5ICMA 3A1NA 4I5EA 5G2OA 5T6BA 5JAIA 1RM5A 4PZDA 2V6MA 1KERA 1TI7A 4J43A 5ER9A 4L4XA 4IDDA 2C82A 3VZRA 4EBFA 1GUZA 1OC4A 1NASA 2E4AA 5A5EA 2I6TA 3EYWA 1PR9A 4RZIA 5IDYA 3RBZA 3AOGA 1DAOA 1RM0A 1G0OA 1E6EA 2Y05A 3PIDA 4IZHA 1ADFA 4CV1A 3KYBA 4S1VA 1LSJA 1T1RA 4WASA 3VKUA 2ZYDA 4BGEA 3GHYA 2EW8A 4Q3NA 4Q9NA 3D4PA 4YACA 2ZKLA 4I5FA 4CMEC 4F6LA 5A9SA 2NACA 2FN7A 2I9PA 4IDCA 3WOHA 4QX6A 3ZU4A 3E5RA 4Y6PA 3I5MA 1SO8A 3GGGA 4D0SA 2W2LA 1A4IA 4J9VA 1UH5A 3TFOA 3QWAA 4QTZA 4UVHA 4R9RA 3EDMA 4XQCA 2X22A 2Z1MA 3U4IA 1GZ6A 1ZH8A 1ZW1A 4YEDA 1V3UA 1YKFA 2XXJA 2Y1FA 1NAHA 4BO9A 1K2WA 3DBRB 3RC9A 3DXFA 2B35A 1EZ4A 1Y5RA 1DHRA 3WQRA 3D4NA 3ZV3A 1KVRA 4JIGA 3DQPA 5T8KC 5C7IO 4ALIA 2PNFA 1NFQA 3QVWA 3DZBA 4TRNA 2V7PA 1EUZA 4AJEA 2FSSA 4LW8A 4RZHA 4RVHA 5CDYA 3GVXA 3E48A 3GVCA 5AVOA 4YAIA 1JQBA 4BV8A 4UEJA 1P1HA 1BDBA 3OJLA 1DFHA 3WTBA 3NJ4A 4MVJA 4YJGA 5L4SA 4PG7A 2NWQA 3MWDB 5CDGA 1RM4A 1VI2A 2W4QA 3RC7A 1J49A 1TXGA 1TT5A 4LMPA 4DYDA 3GC6A 4OOEA 5HA5A 3WMXA 2O3SA 3E6AA 1C0IA 3OEWA 5C3MA 1YOVA 4XB1A 4DVJA 4XGKA 4TRMA 3TL3A 2Q2QA 3GEMA 5CP8A 1ULUA 3FCOA 1YQDA 2ZQZA 3B20A 3RBVA 4M54A 1BG6A 1FF9A 2AE1A 1I3LA 4ZGWA 3AOEC 5BNIA 1NQ5A 4XD2A 3SBOA 4CV0A 2C54A 1A7KA 3G3EA 3MTJA 4NNJA 3H3JA 1UUFA 2C2XA 1PL8A 1BW9B 1UXIA 2UV8A 4WCFA 5IFLA 1U4SA 1LDMA 4HFMA 2NVUB 3UOGA 1HETA 1VSUA 3F47A 1E7SA 3ZWXA 4QEDA 1PJQA 4CMJA 1P1IA 3CPSA 5FF9A 2HO5A 1I3NA 4CLOA 1QV7A 3H5RA 3FNEA 4CMAA 4N18A 5EIOA 2OBYA 1PJBA 3LQFA 2JL1A 1QSGA 3CH6A 1U7HA 2J3JA 1U3UA 4FOSA 4RF5A 3AY6A 1ONNA 4WUVA 3ZWMA 2B0JA 4CM7A 1PS0A 1U5AA 3BAZA 5JCJA 1DIHA 1I01A 1R15A 2BKAA 3P2YA 3AU9A 2B5WA 4XGNA 4J1SA 1MGOA 1BTOA 1CYDA 3ZHZA 2QX7A 5GMOA 1GPDG 3P7MA 1KEWA 1YBVA 4GLOA 3U4DA 2Q46A 3W8EA 5BSFA 1KVSA 3WQQA 4RPGA 3LC1O 4J7UA 4OXYA 1W6UA 2ZB8A 2VZ0A 1PQWA 3AFMA 4P4GA 1O8CA 3V8BA 4LVCA 1FDUA 3LT2A 5A3JA 4XJSA 4DBZA 8ADHA 1R4NB 2QW8A 4R51A 4A7PA 1QMGA 3DMYA 2OUIA 4OXNA 1R16A 3FPCA 2X9GA 5TC4A 4BKPA 1N1EA 3SLKA 1IYZA 3WJAA 4NFYA 2OORA 3OIDA 3F5QA 4AVYA 2DVMA 4XDYA 5JDIC 3KLMX 2DC1A 5CPBA 1WDLA 1ENOA 2NQTA 3WSWA 1ZJYA 1ZXLA 3GDOA 4FC7A 1JWBB 5DT9A 2PGLA 4PG8A 1GR0A 4B3IA 1DHTA 3H5AA 1J5PA 1E3IA 1PX0A 2IE0A 1NXQA 4IDEA 3KBOA 2GCGA 2UDPA 4PG6A 4D43A 3BMQB 3EAGA 2QYSA 1Y6JA 3V2GA 3KSDO 4IQ0A 4ROSA 4RVDA 3HFSA 3MCVA 1PU2A 4BV9A 1YGYA 3BTOA 1FDVA 4E21A 4YJDA 1O95A 1RPNA 1HWYA 2YQ5A 4E2XA 1DC6A 1LUAA 5BNTA 2VRCA 3RWBA 2YJZA 3R1IA 3RIHA 4YVFA 4E5MA 5HTOA 4R16A 1I2BA 4P38A 4PLZA 1B2LA 5L51A 3GUCA 4TKLA 3OFSA 4LCEA 5ITVA 1IZ0A 3DDNA 1H9AA 4BHTA 2ZATA 1EBFA 4MIYA 3VH4A 4Z3DA 4GSKA 1YWGO 2NUAA 1KVTA 1A71A 3UCEA 4EEXA 2ZYGA 1LLQA 4DQVA 5G0VA 4BIIA 4CM4A 4IXTA 4XB2A 1Z73A 1P0CA 1CEQA 1UP4A 3RUDA 2Q2WA 2QRKA 2VOEA 3K31A 1W8DA 4NH4A 3STHA 1DDOA 3HJAA 5TT0A 4BNIA 5CDUA 4L8VA 4C7JA 4NJMA 5L3ZA 4ONEA 4GX1A 1MC5A 3SJUA 3NGXA 4D3FA 5FWNA 1A72A 4NJMB 4U0KA 1ONPA 4C4OA 2H9IA 5DP1A 3FWNA 2Y1DA 8LDHA 2ZTMA 2NNLD 1RWBA 1AHHA 3L9XA 4BNHA 3ZV4A 1ZMTA 3B1JA 1MFZA 1Q7CA 1YB1A 2ZJ0A 1WVGA 5DP2A 3AUSA 1N5DA 4PLWA 4FQ8A 5DCYA 3QWIA 4BKRA 2OFPA 3GMDA 4MP6A 4W6ZA 2GERA 1XLTA 3GN1A 3O4RA 2I3AA 2GLXA 4ND5A 3WGGA 5JC8A 2B37A 5KJEA 4K6CA 4JP2A 2EGGA 2G76A 2BMAA 1GZ3A 3PWZA 2JD0A 4YYZA 4XDZA 2X23A 2G1UA 3HWRA 4H7PA 2LDXA 4NQZA 1BXGA 3JQ9C 2RBEA 4CM1A 4GLLA 4DLBA 3RUAA 2PKQP 1F0YA 3ASVA 2FPIA 2X0RA 3RKUA 1PL6A 2NSDA 3KEQA 3WDSA 3ORFA 3MOGA 1UP6A 3TN7A 3WIEA 2CNBA 3JD0A 4XIYA 4Y98A 1GYPA 3T4EA 3F1LA 3RUEA 1F06A 3KHUA 4JX8A 1DRWA 4XIJA 4BGVA 1OOEA 3GRKA 4NBUA 2D1YA 2WD8A 3OECA 1WNTA 3OA2A 3D0OA 1R0SA 3RUCA 2H5LA 3RFTA 1GUYA 1IB6A 4BNFA 1LEHA 1B14A 4W9NC 3H2ZA 4DMMA 1HLPA 5A9RA 1X15A 4AJKA 4BO8A 1JKIA 3KETA 3UKOA 3PTZA 2PZJA 3ASUA 4EW6A 5K6AC 3PQFA 4L75A 3C1TA 2P9EA 2XF8A 1PZHA 2DBRA 3QVOA 4K28A 3TOZA 1GADO 2CVOA 2I76A 1MV8A 2CDCA 4E33A 2WWRA 5KVQA 1Z45A 4CMCA 3LVFO 1ZSNA 4DQXA 4AJ1A 1EVZA 3M6IA 3TZCA 1HT0A 2FZEA 1Q0QA 1DIAA 4CR8A 3IKTA 2CD9A 1P31A 2O7QA 2IDZA 4MO2A 2BGKA 1HE4A 2QIOA 4E3ZA 4Q3BA 3ZHBA 1GZ4A 4BVAA 2DBZA 3G49A 3V1YA 4EJ0A 1T1SA 3GFBA 4G2NA 1LDEA 2JCVA 5KVCA 3A14A 1C1DA 1VLLA 4MVJH 3C7AA 4Z6KA 4Y67A 3ZHYA 2Q2VA 3DTYA 1LNQA 3AI3A 3QW2A 3H2SA 1LLCA 5EERA 3WWYA 1WDMA 4TVBA 3KYCB 3RFXA 3GF4A 3F4LA 4L73A 2AG8A 3JQBA 5G0UA 1Y81A 3E18A 3V2UA 3FNFA 1LJ8A 3WICA 1ISHA 5JC1A 3MJTA 1EQUA 1C1XB 2VRBA 3HHPA 2E82A 4OQZA 4E30A 5COBA 2FP4A 2NVUA 4J7XA 3L0DA 2AQIA 3PK0A 3LC2O 1CJCA 3ADPA 4JN6B 2EWMA 3TL2A 2NU6A 2EG9A 2R00C 3CTMA 4Z0HO 2NV6A 3EMKA 4ALJA 4HV4A 2CSUA 4JJFA 4MVJM 2A4KA 5A04A 5G0WA 4ZICA 3HB5X 1DEHA 4IJWA 2OMEA 2CZCA 2OP0A 2O48X 1XCBA 1R0LA 1U2DA 4ZQEA 3DHEA 2AEFA 4GH5A 1GL3A 1PZEA 4IS3A 4A03A 4BMNA 3S2EA 1QLJA 1GYRA 4BO7A 4QSMA 3NTOA 3DBHB 5A03A 4K1LA 4CMHA 4WLUA 2VYND 4XEHA 3W8DA 4HFRA 2AE2A 3RU9A 1YB4A 4R41A 1FMCA 4JNKA 4WEQA 4E4YA 4OIMA 4ZJUA 4G65A 4BO2A 2V6FA 3L4BC 3RROA 5A9SB 4PFJA 3IS3A 2VNAA 3KUXA 4ZRNA 1XR3A 5F1KA 4IDAA 4XCVA 1SZJG 1H2HA 4CJXA 4A0SA 4I9NA 1ZCJA 3FD8A 3GNTA 4BQPA 4YJFB 3SJ7A 4RPJA 3DC2A 1E1LA 2AG5A 5FI3A 2HAEA 5TT1A 3PQEA 4FW8A 4IGFA 2GRAA 2NTNA 5TJHA 2TMGA 2W8ZA 5IG2A 2X6TA 3BTVA 2VUSA 4OAQA 4YJHA 3ZWYA 1LLDA 2RH4A 3F46A 4YAGA 3SVTA 2DFDA 2VUUA 2HKIA 4IJVA 4ID9A 4UUPA 1C0KA 1QR6A 4OKNA 4LMRA 4A2CA 2NVWA 3P2OA 2GYYA 1ENYA 1Z74A 4LVUA 4MVJG 4BB6A 1E5QA 1X1EA 2Q1SA 3DHYA 3H3FA 3JQAB 3FR7A 3PQDA 4L0QA 5C7OO 2Y67A 2VT3A 4FN4A 1NPYA 3CZMA 2FSVA 5KNLA 1PS9A 1TVEA 1LU9A 2ZYAA 3HN2A 1ADBA 4WOJA 4XYLA 5ICSA 4YT5A 4PZEA 3RQSA 4NZ9A 2O2SA 1VKOA 4YAEA 3V5NA 1EK5A 4BKQA 5FFFA 1PGNA 2UUPA 3WNVA 4FJ1A 1T2EA 4WNCA 4F6CA 1YL7A 2Z95A 4TRRA 3ETDA 1E6UA 1P74A 2XAAA 1QP8A 1UDCA 4YA6A 1Q0LA 3AI1A 3M2TA 3W6ZA 2ET6A 3VPFA 5H81A 3IUPA 2Y1EA 2CDAA 4IBOA 1UZLA 2VOJA 1I8TA 4RF2A 4O6VA 1U8FO 1JLLA 4Q3AA 1EVJA 3GAZA 3KOUA 2FZWA 4JJIA 5COAA 1H9BA 5F5LA 3ZV6A 2X7HA 4DL9A 3E9NA 3JQ7A 4RVSA 4W7HA 4BO4A 5DBIA 5FYDA 1P9LA 4FGSA 2OBNA 3JQGA 3ZWNA 3ZWAA 3OF2A 4BGIA 4LRSB 2C0CA 3O26A 4L74A 4BO0A 1FXSA 5CDSA 2SCUA 2EIHA 4D46A 2DT5A 1WW8A 1Z7BA 3JQ7B 3T7EA 2NTJA 2PTGA 4MDHA 3RU7A 1U2GA 2VZ9A 4ZU3A 2X1HA 1E5LA 2ZCVA 3DMTC 4RF3A 2X4GA 1NQTA 2C5AA 4E31A 5FEUA 1XQ6A 4MVJP 1YDWA 1DIRA 5IF3A 3PYMA 2FR1A 2W98A 3A28A 1JN0A 1UXKA 2BELA 2FHSA 4R1TA 3ICPA 1YE3A 3H5NA 2OL4A 5IXSA 1M66A 3H9QA 1D7OA 5IZCC 3TF5A 3NT4A 3FN4A 2BFAA 2PH5A 3HADA 3RCBA 5U9CA 1N7GA 4UVEA 4ND2A 3K2EA 4E5NA 2H63A 4BO6A 4D41A 3GUYA 2CY0A 3NYWA 1AGNA 4RVFA 4W9NA 2Z1NA 4A73A 2NVBA 3QY9A 4EDFA 1YL6A 1R66A 3ZHXA 2VYVD 4Y6SA 1NHWA 2HRZA 3HE3A 3E9QA 5CFZA 2E6UX 5JE8A 1EDOA 2NTVA 2O3TA 1NPTO 3CZRA 1K6XA 1LQTA 2PKRA 2O3UA 3BMNA 4E5PA 1BXZA 5ER6A 3AM3A 4IIUA 4FBGA 3V1UA 4RORA 1U3TA 2HDHA 2YFQA 3GZNA 1C0LA 1X13A 3IJPA 2JKVA 3RJ5A 5DN9A 5EQFA 5G0SA 3AUAA 3VZSA 1TLTA 5BNFA 5B4UA 3VOSA 4IPTA 1V3VA 5ES3A 2YDXA 4C7KA 1WDKA 1DO8A 2NLOA 4XX0A 4YXFA 3GG9A 4CL8A 5KKAA 4UAGA 1YDEA 1YOVB 2JHFA 2I3GA 3ZWBA 4QXMA 4HNHA 4DMLA 5I9LA 1A9ZA 1SNYA 4JBGA 1KY4A 3PRJA 5JCJD 1PS8A 4MP8A 3SEFA 1LC3A 7MDHA 1MX3A 1SPXA 2ZJ1A 5IDXA 5JFOA 1VJTA 1B16A 5BQFA 1EBUA 2GSDA 4ZQGA 2WD7A 2GUGA 1KY5A 2X0NA 2RIRA 3F9IA 3UVEA 1U1IA 4TQGA 3PJEA 2PKQO 4ZQHA 4XYBA 3VH1A 5DNAA 1LRJA 3UUWA 4BGUA 4PLPA 3PWSA 3RFVA 1E1MA 5B1YA 3H9UA 1NWCA 1UZNA 4WNIA 3GOHA 3E8XA 3ZW8A 3UFXA 1E7MA 4Z9FA 3WIDA 4Y8VA 3R6DA 2I99A 3HDHA 5T8KA 3I9JA 4IDFA 4OOFA 3JYQA 3CXRA 1Z82A 4BUCA 1LBEA 2Y66A 3AWDA 4FB5A 4R01A 5JXWA 3K6JA 4CQMB 5A1TA 2VHYA 3INGA 3RC1A 4PLHA 2DPGA 1SB8A 3FBTA 3KTDA 3MZ0A 4J0FA 5DULA 3DAGA 1I0ZA 1DIGA 5HS6A 1S7CA 2NU8A 3CEAA 1KS9A 1LSUA 3DOCA 3I3OA 3WB9A 3PHGA 1UP7A 3PWKA 4TVOA 5FI5A 3VTFA 2VTEA 4RLSA 5TGDA 4J4HA 5A3VA 4QO8A 2GASA 2GNAA 1I2ZA 5F1PA 1NM5A 4D7AA 4A10A 1YQXA 2B69A 3JQFC 2VWGA 4FJ2A 1U8XX 3BTUA 2CUKA 1IPEA 2FMUA 3D3EA 3TQHA 3DL2A 4B4UA 2VYVA 1YS4A 1I2CA 1C1DB 4YT2A 1CQIA 3M2PA 2WYWA 1NPDA 5I8WA 4O63O 3G79A 4HBGA 3H9JA 1I36A 5THQA 4MKXA 1K5HA 4UEOA 4Q3DA 2WJPA 1J6UA 3KXDA 4CM9D 2JFFA 2VNSA 4D0RA 3WGHA 2VRCD 2J3HA 3OJOA 4RL6A 4B7XA 1VM6A 3LSYA 3DFZA 2Q4EA 4PZCA 4AFNA 3I9MA 1IULA 4E5YA 9LDBA 5JDIA 2G0TA 5F1OA 1P0FA 1N8KA 1O89A 1UXJA 2YUTA 3NTQA 1F8FA 3OHSX 3RI3A 3IP3A 3VZQA 4FR5A 3RSHA 2QRLA 4YAKA 1H6BA 3WFJA 2Q1WA 5EL0A 3C24A 3I52A 3Q0EA 4JP3A 2XOXA 2HLPA 5I7VA 1T26A 2ZB4A 3GZ4A 1H0KA 4HFJA 5A05A 4BNYA 3KYDB 4HADA 3IQDB 3I9LA 3QHAA 1JKJA 4GGPA 2X9VA 2F00A 4E2WA 2EHDA 1PJSA 1AN9A 1JW9B 4FFMA 5IN4A 2X9NA 5JPIA 4H15A 4FPXA 3U0BA 1V35A 3PJFA 4CQLA 4GGOA 4EGFA 1NQAO 3H7AA 2PH3A 3NAQA 4DC1A 4R4JA 3IC5A 3TFQA 3GLQA 1JAXA 4LCJA 1BVUA 5TNXA 3SC4A 2HK8A 1DIBA 4FDAA 4CLRB 2X8LA 4KOAA 2HUNA 4FSHA 2JD1A 4OO3A 5CEEA 1YRLA 3DBLB 3IKVA 1WPQA 3ICCA 3CIFA 2R00A 5KVSA 2XXBA 1K3TA 4LISA 3DAPA 5C5IA 1B8UA 3AM5A 3BMOA 4IM7A 1IUKA 1HSZA 1DJQA 1IE3A 4J91A 3JYOA 4L9RA 4MKZA 3VPGA 4YPOA 3PEFA 3S55A 3RC2A 4O0LA 3LDHA 3ZGYA 5JAQA 2EJVA 3NTRA 1GD1O 4FOOA 1ZNQO 2Q1UA 4RDIA 2OZPA 2DBQA 4GWGA 3OA0A 1FDSA 3RD5A 4I08A 1WP4A 1MLDA 1IZ9A 3PHIA 3JQ9A 4J1NA 4MVJE 3A06A 2WSBA 2VWHA 4XWYA 4CUZA 4DIOA 3OEYA 1BSVA 1GEGA 1WXDA 3EUWA 2HK9A 3V2HA 1HKUA 3VDRA 1WMBA 3DR3A 3S1LA 2ZB3A 2HMUA 2EGHA 4BNJA 4ZA2A 4RPHA 4DPKA 3C3XA 1E92A 5EQDA 1HXHA 3I4FA 1VC2A 1EEHA 2WYVA 2VZ8A 4ILKA 1PIWA 4DLAA 3QIVA 4BS9A 3DBRA 4CR7A 4FFLA 4NI5A 4R1NA 2VUTA 1AHIA 2QZ9A 1BXKA 1R12A 2Y0DA 3PIIA 1EE9A 4K9DA 4TWRA 4B7UA 4GX5A 1DAPA 4RPKA 3COSA 1UXGA 3ANNA 3DHNA 4FC6A 2O7SA 5JDCA 3VH2A 5CDTA 5L45A 5G4KA 2P9GA 4RVGA 1BMDA 1HTBA 1ZXBA 3UN1A 1W73A 3TWOA 5C7LO 3OP4A 1VJ0A 1KBZA 3IJRA 5BR7A 1SCUA 3VKVA 4R1UA 4Q3EA 4HP8A 3I9NA 3WXBA 4DPLA 1RYEA 2GN6A 4O1MA 4B4VA 3ETEA 3ZWPA 1HZJA 2PR2A 1EFKA 1F17A 1PJ3A 1VKNA 3HDJA 3NT5A 1IPFA 2AQ8A 4HUJA 5HWSA 1T25A 1GQ2A 1JAYA 3AY3A 4QFCA 1A9YA 3ZWVA 1JTVA 1OAAA 5GZ6A 4NFSA 1VPDA 3WFIA 1ORRA 3D64A 5TQVA 3DBHA 1QLHA 1FJHA 1R4MB 3KEOA 5I8ZA 3K73O 3U49A 3KSUA 2CF5A 4XZ3A 4YT8A 3NKLA 2GZ2A 3MOIA 3DOOA 5JDCC 1YBMA 2AHRA 4EJMA 2DAPA 2Y93A 2VT2A 1HYGA 2BGMA 3DTTA 5A5FA 4L4RA 3UF0A 2EKPA 2EF1A 4B3JA 3Q2IA 4IJKA 3RVDA 2NQ8A 4PGFA 2YV2A 4M8SA 3C7CB 1T4DA 1LQUA 1QYCA 5I7FA 3CE6A 3FNGA 1GFSA 3AW9A 4BNMA 4UVIA 4OHUA 2AXQA 4CM8B 3OSUA 3ITDA 5T57A 3WLEA 3ZZNA 4GX2A 1Y5MA 7ADHA 1N2SA 4UVGA 3I9OA 4ZD6A 4BO1A 3ONFA 3FBGA 5U4QA 3OM9A 1QV6A 2G5CA 2PV7A 2JAPA 1ZEMA 1N92A 4CR6A 5CG1A 2EKLA 2OHXA 1E7QA 2R6JA 4FD3A 2JFGA 4R68A 3VHRA 4ND3A 4BL5A 1ZMOA 1Z6ZA 4CMGA 5IAAA 2A94A 4IDGA 1SEVA 4E2ZA 1FK8A 2B83A 4J2HA 4KDEA 1P77A 2IZ0A 3GHHA 3PLNA 2YZ7A 1L7DA 1P1RA 1EUCA 4BNGA 1ZUD1 3F6YA 4D45A 4PLYA 3RBXA 1BW9A 1NWHA 3P5SA 1OMOA 4NFHA 3WX0A 4JXKA 3CINA 3PGJA 4OH1A 1AXEA 4YBZA 5DCWA 4E13A 4GX0A 1ZK1A 3S8MA 1ULSA 5L7YA 3BMCA 2NU9A 4KZPA 4YR9A 1WZEA 1RJWA 3AU8A 1ZZEA 1XHLA 3U62A 5K9ZA 3EGOA 4GAEA 4Y9DA 4JK3A 3KO8A 1V0JA 4K6FA 2BHLA 1JA9A 4Z9YA 1KEPA 3PDUA 2WMDA 4IUYA 4WE3A 4FCCA 3IMFA 4JJGA 4MVJD 2DM6A 1ML3A 1X7DA 1TT5B 3UW3A 2J5RA 3CUKA 2BD0A 4GI2A 3OJFA 4CMKA 4DRYA 2AMFA 1DFGA 4KTTE 1ZK3A 1B8VA 3LYLA 4YRDA 2BI7A 4YAJA 4DTIA 5LDGA 2BI8A 3LF2A 3TJRA 1GYQA 2X0IA 4L76A 4XRRA 3VPSA 3HQ4O 1PL7A 1GCOA 3DFUA 5LDHA 3QA9A 1CERA 1GCUA 3G1UA 4BOYA 4LN1A 3L77A 2EP7A 1HDRA 2Q45A 2ZQYA 3GAFA 1SOWA 1HEUA 4DUPA 3O38A 1BGVA 4BNZA 4P8RA 2QZZA 2O4CA 3ON5A 3Q3CA 5JYDA 1HF3A 3HSKA 4XRGA 3GR6A 4CMBA 2GPTA 1GEEA 3D3WB 4J7CA 2OXIA 4DQUA 1LRLA 1GV1A 1PJ4A 4DWVA 3PYLA 4HX5A 3B6ZA 1H2BA 1HL3A 1SOVA 4AJ2A 5JAZA 2AW5A 4DREA 1DC4A 3KLPX 2CF6A 2JCXA 4YJHB 2EXXA 1DOHA 1I24A 3WYBA 2VHWA 4NBRA 4P4NA 3EVTA 3H6KA 3WGYA 4EZBA 3Q9UA 4ZQBA 1K6JA 4W99A 1ISFA 2VTDA 3GK3A 4M87A 4YQZA 1T4BA 1I32A 4TSKA 6LDHA 1SB9A 4LSWA 2X5OA 3JQFA 3NX4A 1V6AA 2J5QA 3F4BA 2HSDA 4PLGA 1JU9A 2CVQA 2GF2A 4BQRA 5T67A 3VVCA 5JW6A 3M1LA 4D44A 2X5JO 5I9MA 3DEYX 4E5KA 1OZAA 5L4NA 2EKQA 3JQDA 3UXYA 4DC0A 4WPGA 2Y1OA 3VVBA 1MB4A 1Y8RB 4J3FA 1LI4A 3CMMA 1VSVA 3C8MA 3Q2KA 3TNLA 2VWPA 4DIFA 3JCZA 5A02A 1ARZA 5EPOA 1H6CA 4WLFA 3PVZA 4GPD1 1X0VA 5DOVA 4M89A 4XYEA 3ETGA 2V65A 5L9AA 2EP5A 4HNGA 4TZKA 1M2WA 5L7WA 3U3XA 5THKA 4KP7A 5L53A 4AJ4A 1HLDA 3EZYA 3JSAA 5JNLA 3QQPA 4CLRA 2HCTA 4XQEA 3O8QA 4Q3CA 4U5QA 4UREA 2Y0EA 4J9UE 5IJZA 3GVPA 1EVIA 3FWZA 3H9EO 4YCAA 4KWIA 2DKNA 3WS7A 2O3RA 4KDFA 2A9FA 3O03A 3OETA 4FJ0A 5ILOA 4PVCA 3SLGA 2DFVA 1P1KA 2DTXA 1GTMA 2BFMA 4EUEA 3OQBA 1EK6A 1M75A 3B70A 3NGLA 3ZU5A 3DAFA 3WYEA 5CEFA 1NBOA 2ZTUA 3S2GA 3PZRA 3AK4A 1D4FA 2JFHA 1ZFNA 3LLVA 4WLOA 1AUPA 4HKTA 1F8GA 1GU7A 1N1GA 2O50A 4BKOA 4EITA 5TLSA 2NM0A 3GNSA 1XSEA 4IINA 1NNUA 4N5LA 3ROQA 1HDOA 1KC3A 4M55A 2YY7A 1HE2A 1LC0A 2Y68A 3BMCB 3E9MA 3GN2A 3GQVA 2RHCA 4QO7A 3PJGA 5IZ4A 1IOLA 3H4VA 3BHIA 2POQX 3KYDA 5LCXA 4EJ6A 5G0TA 3C7DB 4HFNA 1I30A 3WR5A 2YHIB 4CMIB 2PGDA 2V6GA 3IAHA 1KETA 1LRKA 4YDRA 3ZWWA 2AEJA 1PGQA 1XGKA 1HE3A 4IZIA 4Q39A 1MXFA 2B4TO 3EHEA 4JROA 2G17A 1G1AA 2DTDA 4N7RA 3TOXA 3V1TC 3S2IA 2O4UX 3GG2A 3NRCA 4GKBA 1XKQA 4K26A 2OP1A 5DBGA 1D8AA 4OM8A 4BB5A 4INAA 2IXAA 4U6SA 3NJ8A 4I5GA 4XGIA 3WSVA 1VJ1A 4ZVVA 3JQBC 3GPIA 1I10A 3AUTA 4XR9A 1YQGA 1YB5A 5DDIP 4DIBA 4DA9A 4RJTA 2QHXA 4NK4A 3JQCA 5JYEA 3K30A 1LX6A 3DONA 3QP9A 1OFGA 2O2YA 2PGJA 3ONEA 1DC5A 4OYRA 4YRAA 3QE3A 5HS4A 4ZQFA 3K5PA 4J0EA 4CLEA 2YQ4A 3ZH2A 3WNQA 3PJDA 4GWKA 4WJZA 4IS2A 1EMDA 1PR3A 1LSOA 4Z0PA 3WBFA 4E0BA 5AXAA 4N5MA 3OJ0A 5ILGA 3DMTA 4B4WA 5JS6A 1JDJA 2PZLA 2JD2A 2E48A 1DRVA 3TZHA 4KTVE 1EE2A 4J90A 1EUDA 3PP8A 4R5HA 1KVUA 3QJ5A 3DO5A 1ZVMA 2PZKA 5KOIA 5K6AA 1DC3A 2TMDA 1Z75A 1B3RA 4R9SA 5GZ3A 4GBJA 3W8FA 1I5RA 1RM3A 4I1IA 1WWKA 1X1TA 3VH3A 1P3DA 1D1TA 3HZZA 3NDRA 3DWFA 4PRKA 5H83A 1MXHA 1E77A 2I66A 3SXPA 2YW9A 1PQUA 4GKVA 1E3LA 4NBTA 3GY0A 4XQGA 3ZNPA 2C20A 2FOIA 4GVLA 2FWMX 1PWZA 3I1JA 3D3WA 4YJFA 4YWJA 3KVOA 3DZKA 3FF4A 1PWXA 3GGPA 4NPCA 3ANMA 1BDMA 4LSMA 1PZFA 1DBVO 1TEHA 4XKJA 1DPGA 4FIZA 2VWQA 3GFGA 2OOSA 3W6UA 1DJNA 4YJGB 5JAMA 1PEDA 4NJOA 3WGQA 1Z7EA 1CF2O 3LU1A 1U7TA 2YHUA 2VQ3A 4NHEA 3WMWA 2YDYA 2B4QA 2VN8A 1U3WA 2DPHA 5B37A 4AJLA 1R6DA 1QYDA 3R3SA 4Z3KA 5ENVA 5KKCA 1U3VA 2RAFA 4CUJA 4TKMA 3LT1A 4U6QA 3GA0A 3L6DA 3G0OA 3IL2A 1WAMA 2J6IA 3JQ8A 1GQQA 3JTMA 4NU6A 1QORA 3GZNB 5IXYA 3JYPA 2NADA 5TSDA 2BRUA 2P68A 2ZB7A 4WOKA 4ND4A 1XWFA 1XELA 3MWEB 4E2YA 1E0DA 2IZZA 4FFOA 1YONA 1X14A 3RKRA 1ENPA 5JMPA 3INRA 3PDJA 3JD3A 4MIOA 1NTOA 1DXYA 4IQ8A 1NP3A 1Q7BA 3DZHA 3OH8A 4WCFC 3U4CA 1WMAA 1XU9A 4M1QA 2Z5LA 4EI2A 3WYCA 2HJRA 1UJMA 3ZNQA 1W0CA 3W4JA 1NVTA 2O3QA 1L1FA 4BNXA 3T4XA 4WCDA 3NEPX 2IXBA 3ZDFA 1O94A 1X0XA 2RCYA 2RHRA 4KUHA 5A06A 4JGBA 5CPFA 3OIFA 2GZ3A 2WE8A 4JBIA 2QYTA 3N58A 2I67A 4WLVA 5CHEA 1CIVA 2P5UA 1Q2XA 4JCOA 3WG9A 4DBVO 1GAEO 4U7WA 2YHIA 2GZ1A 4H16A 1NR1A 4OXKA 1YJ8A 1N7HA 1I3MA 1H6AA 5JY1A 4IXWA 3ROKA 3UH1A 1C14A 2D3TA 5DF1A 2Q49A 5BSGA 3UCFA 4OSOA 2VHXA 1PTJA 3NDIA 2HMVA 4CL3A 3RUIA 3ZU2A 3ZN2A 2D4AA 2J3KA 3KM0A 4XA8A 2X0JA 1HZZA 5A9TA 5G4LA 1D3AA 4HY3A 5KJ1A 1R4MA 3LZ6A 3INTA 3EY4A 5DZSA 1HSOA 4MIEA 3AI2A 2EEZA 5EN4A 1NVGA 5MGBA 3EK2A 2LDBA 3QRWA 3D5QA 3QVTA 1U5CA 3FTPA 1HDZA 3IDSA 4Z9XA 3Q1LA 4MPDA 1E7YA 1UZMA 2JHGA 2WDZA 1HDXA 4H3VA 1PZGA 3MJCA 1PGJA 6ADHA 4J49A 1A27A 2C5EA 3JQGB 3AM4A 1LDNA 3IOYA 3MJVA 4FFRA 3VTZA 5KTKA 2P91A 3E5MA 1F12A 2P2SA 1LDGA 2ZTVA 1ADCA 1KEVA 1W4ZA 4N54A 1JVBA 5F3RA 3WGTA 3KZVA 4QT0A 3UAGA 3BHJA 4GMFA 3AUUA 3SX2A 3ZU3A 4CQMA 3GT0A 1IHXA 4LGVA 3TPCA 4CM9A 1BRMA 4D42A 2IRWA 1ENZA 5TIIA 4N5NA 4J4TA 2UVDA 1DB3A 4TRJA 3F3SA 5COQA 4LK3A 3C1AA 2O3JA 4IMPA 3ZNNA 4AG3A 1U9JA 3VPXA 4OKIA 2X86A 3GDGA 4NIMA
chains in the Genus database with same CATH superfamily
1Y8RA 5KCZA 2DU8A 1JE0A 3H8WA 3A3NA 1DBQA 1FP7A 2C4KA 2W00A 3T7CA 3L6BA 4YUZA 1B26A 2JIZA 4RNDB 4A2WA 1EGQA 1V8PA 1V8DA 2VG8A 2WOOA 1ONSA 2OVFA 5DSZA 1W4AA 2Z56A 4S0XA 3LPDA 1E3WB 3KELA 4R7ZA 4LX0A 3T54A 1S2NA 5LQMA 5KYWA 3B1FA 3BXXA 5FORA 1OY1A 2BI4A 2WFLA 3VR5A 2NGRA 4OM7A 2BCEA 5AJTA 4DMKA 1PDVA 3FSRA 2ARKA 4D6PA 2VP0A 4R2XA 5BSTA 3SX0A 1P9NA 2QBYB 2QSUA 3UJPA 2TECE 3CZCA 2DFTA 4W1PA 1N2JA 3FZQA 2H5IA 1KP3A 1L8XA 4YDHB 3B3AA 3QLVA 3BE5A 1XO1A 3KLNA 2DQ4A 3AVUA 2WM3A 2WSLA 3IJEB 3OKFA 4FFPA 1ZYUA 2V7UA 4TV8B 3QSGA 3PQ4A 5AVQA 2HD4A 3ANLA 3O8DA 4FNAA 1L6RA 1PTJC 1T0HB 1K5GA 3FVRA 2NSHA 5EJ6A 1DBSA 1FDTA 1Z2AA 4B76A 3GH3A 1OXUA 5JCXA 4QOHA 2RAPA 3Q5EA 5DCLA 2XUZA 5DI3B 1X7XB 5TMPA 4XCXA 3ZQKA 4DCUA 1Q3KA 2O8EB 1W25A 3V4VB 1P8JA 2NO6A 2NU6B 2QRUA 3G0CA 4BNTA 1L1RA 4TT3D 1LF0A 4RGBA 4EHIA 5KOHB 4RVUA 4S1WA 1LW7A 4C0KA 5IJ9A 3RUFA 2AC4A 4UHCA 1EFLA 2BGUA 2CJYA 5GQSA 5E4JA 1U11A 4BNNA 1ULBA 4J1QA 4PPGA 4WNAB 4GPTA 4CYMA 1E2BA 2RGBA 1NQWA 2YS6A 3TLGB 1VYVA 1HFWA 1P4SA 2ID9A 2WM9B 3RVPA 3VO9A 2YNMC 1J0XO 4HMOA 4UE2A 2QD2A 5JO0A 4DUGA 1SUCA 2QENA 3DSRA 5BSEA 3H5TA 4Q4HB 2ANCA 3ZCXA 1SR8A 3KFVA 1IY0A 2DUWA 4DLLA 2HA6A 2XMPA 3EVNA 2HHAA 5AQ1A 1Y8QB 1W5BA 5E7MA 3KKQA 1XQ1A 4UTZA 5I7HA 4Y3UA 5DH9A 2GR9A 5EFOA 4WHMA 2V74B 4ZCIA 2GCIA 2J0EA 1FNDA 1G63A 3KQOA 2YOFA 1NVKA 1YULA 4Q9AA 5DI9A 2VCYA 1V5GA 3EIXA 3PGXA 4PZLA 5HE9A 3DKKA 4A0FA 1UBKS 4EUHA 3DV9A 1Y9EA 1DC8A 1G291 5BSWA 1D2GA 1QX3A 4AL4A 1ZA1A 3FIJA 2KE5A 4DBLE 5E9JA 1NMXA 1P17A 1XA4A 5JLJA 2XOKA 1C8BA 3O9ZA 1MR3F 3F1KA 1Z34A 2HYIC 4GPAA 2CHQA 5BUQA 2YFKA 2LBPA 5E4YA 5FYQA 3E58A 4NXNB 3DPIA 3PHJA 3TZLA 1KJNA 3NBUA 4RPLA 1TB4A 3OO1A 3GZJA 2GLTA 4JZYA 1J22A 1SC4A 4RK6A 4ALKA 4DSZA 3USZA 3EPHA 3LL4A 2I6FA 3HVJA 1SUBA 3AVQA 2F3SA 5J23A 4U2DA 2XIQA 2XCIA 3LZDA 2NP7A 4EUFA 1SBQA 2QLMA 3HYNA 3KYCA 1XVUA 3KE8A 2OOKA 4HB4A 4V0NA 4YP1A 4YJ2B 2IUUA 1QBKC 1XJQA 3PC2A 4YV7A 2EZUA 4GVXA 1I4DD 2HUPA 1YVUA 2QL5A 1PSDA 2I2DA 1TKAA 2DQKA 2IDKA 3D3KA 3PFCA 4KQ2A 2VJMB 3AEQA 2W6OA 4EY5A 2V9CA 1SMKA 1IJFA 4JVMA 5ESDA 1B3BA 1HDEA 2D7JA 2HMAA 3AR6A 1SCJA 3GA5A 4FFBA 4FYXA 3BF8A 4US0R 5ALKA 1Z8NA 3AL0C 3GLIA 3WWOA 4ZI7F 5C8YB 3NEYA 3QUAA 1HI9A 2ZUEA 1N0VC 2GXQA 5TS3A 4TS4A 4HATA 2K5UA 3LPNA 3MSCA 4BKUA 3O8QB 3V3KA 1GFWA 1SC6A 2GRJA 2HV9A 1SHLA 3KIPA 3OY2A 2GFIA 2A9QA 4PZYA 5CR9A 2AJCA 6ABPA 2XVYA 1NUPA 3RODA 4OL0A 3V2IA 3P9CA 2YL2A 4R1SA 1RXEA 2JLWA 2YZGA 4AY5A 3HVIA 3TZQA 1YL5A 1PLJA 3MLAA 4F4HA 5KVVA 1N6LA 1OI7A 1X7WB 3B13B 4UNQA 4WVLA 5FWXA 1P1FA 1XEAA 2JFVA 2XE4A 2YBDA 3E03A 3M7IA 2E21A 3JAWB 4N47A 1Q7EA 5IK2D 5MN5A 3OQ6A 1KZHA 1FA9A 3PT5A 5SV2A 3WLLA 3TBKA 4GPBA 4GL2A 1CJTC 1ICEA 1LNZA 1RVV1 3DEHA 5FRDA 4BVBA 2GN1A 2QNRA 1ZHOA 1KIFA 2XCTB 4BYMA 3HRKA 3PSHA 3WHLA 1UDWA 2CVZA 2P4EA 4AZ0A 4URXR 2H59A 1AX9A 1MG0A 1SCUB 3R44A 4MPTA 3BZWA 1XZMA 4MGIR 1X92A 5DISB 1FCJA 2BHSA 1T9DA 4Q4AA 4BC0A 1IUNA 3TIIA 1SXGA 1DJOA 1E62A 2PWBA 2PZAA 4QKQA 4MQFA 4B79A 5KYKA 2Q6IA 1E2IA 2V8OA 4PN3A 1JKFA 3AUJB 4LOHA 4PM4A 2ACKA 1L7BA 1T2AA 1JEDA 2AEMA 2FE1A 1WXGA 2XY4A 4HQKA 2WSSD 4RV9A 2TSYB 3UJ9A 4ZK6A 4CODB 5KTSA 2WV9A 5I8PA 1SHTX 4WUTA 3VU3A 2G7MC 1E2DA 2VUIB 3SN6A 5B53A 7GPBA 3UA3A 4KQ6A 4QQRA 4YRIA 5J4LA 3CSDA 3FHLA 3PF9A 4D0NA 1EWRA 3H2KA 2DUJA 5H82A 3AL2A 2V6BA 2NUTA 2JA2A 2R1VB 1V25A 3COVA 4GVPA 9LDTA 1RAAA 2GN4A 2CMDA 2IGTA 1ORWA 4TMVA 2LCQA 3WWCA 4WESA 1BVRA 1W4LA 4PAOA 3CKKA 4NE7A 5JZVA 4ENWA 3T7AA 5JXGA 3CF0A 2WTNA 2EOAA 5L7TA 2E55A 3AZPA 4QRHA 1ZCFA 4W7IA 2BH9A 1WOMA 4LSGA 2IEDA 4ZDJA 3AONB 4U8GA 4FXOA 3VDQA 4P7KA 1Y9ZA 4L85A 2PO5A 4K87A 1V43A 3ENZA 1FFGA 3DE7X 3MAJA 2FMTA 2JLBA 4P82A 2DTEA 1WLYA 2FWJA 1XMOB 2BF7A 2GPSA 3H6GA 1REQA 5YASA 3CR3C 2IZ1A 1N2OA 2P9JA 2QQ5A 3LUPA 4RF4A 4BN5A 1NVWQ 2HGZA 1AUOA 2EC5A 2Q5JA 1QUFA 3KXPA 5F52A 1H42A 1YVEI 4AUEA 5AIBA 4NBVA 1OI2A 5TXGA 3A2MA 2EW2A 2B98A 1USUA 3P4UA 3TE6A 4CKBB 4OGLA 4LECA 2GN8A 2A4MA 2HDOA 1F2TB 2IY8A 4PONA 4ABYA 5GY7A 3TXAA 4IOMA 1JRLA 4J2OA 3VSDA 2J7KA 3B12A 3ADOA 3KKLA 1Z2NX 2BFNA 2RC5A 1M76A 4PQEA 3WGNA 2PD3A 1T2UA 1L5RA 1G18A 1CS4C 2WG2A 2Q5FA 3WA6A 1YQTA 3G2KA 4HDSA 4M9XA 3BXFA 1MGPA 3IP7A 5AESA 2C29D 1EFRD 4RV4A 4JJKA 1IEXA 4HB2A 1DQYA 1R9NA 1XLWA 2R4UA 1KH1A 2XE8A 3AZOA 1KJWA 3MJEA 4QVGA 5EEGA 4ZDWA 2HJSA 4KO3S 3SXUA 1E6WA 1V3TA 5DNVA 5KYUA 5BYJA 3E7XA 1QCYA 1O9GA 4EBBA 3TZ6A 2WU8A 5BN1A 3LF1A 3W5JA 4MVJI 1ONBA 2EV9A 3B7WA 3STWA 5A6SA 1SCBA 1YCHA 1GGMA 4GQBA 4W8HA 1ADGA 1UBRS 3UKJA 1WHTB 2PMEA 3WYGA 4HXFB 1H66A 2OGUA 3K92A 5CURA 1PD0A 4UAJA 3C6ZA 2FPPA 2I55A 4PLFA 1E7WA 4RXMA 3EXEB 1LY1A 3M6WA 4MXDA 1RYZA 5CLGA 1KOLA 3FOEC 1NSYA 2CXNA 2ID4A 1ODSA 1Y34E 1ILEA 4CLDA 5BN5B 2IYPA 3H1AA 2XAUA 2YQZA 4KN6A 3TLEA 4YFVA 1LJLA 1HDCA 2DX7A 3QU5A 5EEHA 2P7IA 4Z0TA 4DR5B 4RE5A 3TCNA 3GDFA 2IXEA 1I1NA 4E32A 4G1EB 1Q0HA 4NU5A 4ICIA 1H4TA 3HYRA 1UM9B 4EMBA 1E3EA 3I23A 1WEKA 5HRCA 3U7QB 4KPUA 4BO3A 1ZEJA 1TJ5A 5KSPA 2XNCA 3ULKA 2HWYA 2QAJA 4OATA 4W5OA 3VZPA 2XNJA 3U56A 1CRLA 4QU0A 1D07A 5IF9A 4ND1A 5JASA 1U1CA 2E0IA 3Q9LA 4Y2XA 1QCCA 3QPAA 13PKA 1SQ6A 2FSIA 2H31A 2I65A 3ABQB 3AR3A 2CMGA 1XCGB 1G20A 2R6R1 3JQ8B 5TQ0B 3UA4A 5J9FA 4E94A 1XJ5A 4R84A 1QHSA 5I47A 1L5OA 2Q62A 5BSMA 3MCZA 4RPCA 1G7SA 1K8RA 2JPDA 2NZXA 3LHIA 4OKSA 4CEHA 1NBAA 5MN4A 1ZOIA 4WXEA 1HQCA 8ATCA 2WQ7A 5D5QA 4GSYA 3SQLA 2BGLA 1Q74A 3I6QA 1DLIA 4V0LA 1Z62A 4E6EA 2A14A 3HNPA 2HJHA 3TTWA 1G0NA 3L06A 3SNKA 1UPUA 2IODA 2WM8A 3PXDA 3OMLA 4HN2A 4MR8B 1W85B 1PSWA 4CLHA 3TEJA 4RLHA 4OMUA 4EJ2A 1QR2A 3C3AA 5EKDA 2D5CA 3MILA 1FB5A 1GSHA 1T8RA 4K88A 1B2RA 4OGWA 2VK8A 4Z49A 1CUDA 5KQGA 3MUOA 3QHPA 2R8PA 4XWOA 3CX8A 1DV2A 4AF8A 3HG7A 1KEKA 1O94D 2GBCA 3LGAA 4EGFA 5L95A 3JAMA 2A0FA 4FDVA 1OHHA 2FKNA 3D43A 4JBHA 3C3BA 5LLSA 3WL5A 4DRXB 1JNXX 2HSEA 5DX8A 1OX4A 1H5NA 2Q50A 2E5LB 3JYNA 3IOBA 1XAJA 4UPDA 3R3JA 4DOMA 1Z5ZA 2FEXA 2HF9A 2Q6LA 5EP3A 4ZVQA 5JLAA 1AXGA 2W43A 5BQPA 1Q19A 4FOTA 4WLEA 3NLLA 1U81A 4JBLA 1NR7A 4KSBA 5DM60 4XQ0A 3S5UA 1Z2CA 1AGRA 1QXSA 2BMDA 3IPXA 2QVZX 3LBNA 1YMUA 3FJOA 4YX9A 3HKBA 4O4HF 2ZR0A 4P7JA 1UJ2A 4J6EA 1XZ8A 1PAUA 1LSSA 3SM9A 3JYLA 5C8VA 5K0EA 5A0FA 1IONA 3GFOA 3PNYA 3H86A 5JSQA 1NATA 5ITZB 5JZMA 4PYQA 2JFQA 3VO8A 4EG5A 3NNNA 2YR0A 5CVDA 1X1QA 2IYOA 2GM5A 2Z6VA 3DE6X 4RZQA 1H2AS 1IHYA 1JNYA 5DJ5A 1O87A 1KMQA 1DL5A 1RWOA 1OLUB 2E37A 2NPIA 4P84A 4PGGA 3K8ZA 5KNBH 3IIEA 4MRRA 4E2FA 2GBPA 1UDBA 3FCUB 1QRUA 2VP6A 4UPVA 3I5UA 3ZDEA 4QOFA 1KVQA 3WAJA 4CM4B 2JJ8A 1YU6A 4IHJB 3MMXA 1DT3A 1I7NA 4Z8XA 1PNOA 2Q4BA 3QNMA 3JXEA 3SFVA 3BMQA 4BNWA 4BQQA 2WQ6A 1AKYA 1GGKA 5TQ2B 2D7DA 2DQSA 5MHTA 1RHMA 5CM8B 5F9FA 3PC8A 2QX9A 2PZMA 2W2KA 3NHZA 1U7PA 5DBFA 5D86A 3U9LA 4NMWA 3T1OA 1L4KA 2GCOB 5HKAA 4KXLA 4R0VA 4US1R 2QMZA 5AM5A 5K1ZA 4QODA 3ZJTA 1DMSA 3T5AA 4H1TA 4IIVA 1IZ7A 5A5VA 2DQZA 5E6RB 4OHVA 4RK7A 3BMOB 3ESCA 1OC2A 4GXTA 5JS8A 1X7HA 3PYXA 5KTOA 1I33A 4QATA 3F6SA 2PV0A 1JLSA 1KQNA 2HPVA 2R8EA 3IDFA 4MW6A 5IK2A 4P5PA 1YIAA 3MPOA 3RBAA 1A5ZA 4DZRA 3H5VA 3G2NA 1OIWA 1QF9A 2J4DA 3R3XA 2ZTLA 2FAXA 4G9GA 3MWFA 1IWOA 5BV0A 3AFNA 1Z13A 5BYAA 1ZXXA 2B3DA 1JEYA 1TQHA 2IV3A 3N76A 1BOFA 2ENUA 3L7BA 2YV1A 3HU2A 4AKEA 4D8TA 2A1UB 1T8UA 2PH1A 4EEKA 7MHTA 3FMVA 2WQZA 3UGKA 2GEDA 1ZI6A 4BP1A 3ZH9B 5CVEA 1N9GA 2MOKA 4QOGA 1MAWA 1Z4OA 2OECA 4M1KA 4Q34A 3V8QA 4B4OA 1H6DA 3HDQA 3LT4A 1WQ1R 5TRTA 3BIOA 3NUGA 4BO5A 2QLJA 4PSAA 1T2FA 5LC1A 1XTTA 1B8OA 1JKJB 2OV8A 3LA6A 1BN7A 1GZSA 2L18A 3EH1A 4Z9BA 1GUFA 5L3QB 2F43B 4PCAA 1L7VC 4TGLA 4HWPA 1HO3A 3IVAA 1I51A 2EW1A 1P4JA 3QLJA 2QG4A 1YZKA 4YK7A 2FCAA 1DARA 3V4FA 2GVNA 1K6EA 3CNLA 1B7GO 1RQNA 3SQNA 4R5MA 3BHMA 3QEOA 2XQIA 1NI4A 5AO9A 4CEJB 4NESA 4DB2A 1L4YA 2ATIA 4DEVA 5DM1A 2O1EA 3K1JA 1YVDA 1CR0A 3ABIA 1OBFO 4HQ0A 4XR4A 4AJJA 3DXXA 721PA 1W36B 1KMHA 3G5LA 4W82A 4XH9B 2J6HA 2NVOA 5FKJA 2YZNA 5EYPA 1CLEA 3RDPA 2BSAA 1FDWA 4CLOB 2Y2UA 4BNDB 2NT3A 4DNPA 3A6FA 4RKEA 3JQRA 3C6KA 4EZIA 1PW5A 5IKMA 3W1VA 3RJ9A 3TIXB 1JPJA 3QXJA 4C03A 4C9BA 1H1TA 4AF7A 4L02A 4II3A 4BATA 3OFJA 4ZMRA 2X5XA 5BOSA 4GR4A 2UVPA 1FMJA 2WP0A 3QWHA 2HJ9A 1OV4A 4AUMA 2CFCA 5E6UA 1GJRA 1T6ZA 1RM5A 1KMMA 2HWWA 2QE6A 4CCYA 4F97A 1XZHA 2SNIE 4XFKA 4J07A 4JC5A 2VQFB 1NJSA 1E4EB 1Z35A 1CKEA 1ZGJA 2Q5LA 4HSEA 4YMWA 4KPYA 4IDDA 3DE1X 1DBWA 4UCQA 2C82A 5CDFA 3EGDA 4EBFA 5CDFE 1GUZA 1OC4A 4XWWA 8ABPA 1KK1A 5AK0A 3M4XA 1MNAA 2O6LA 1NF8A 3OESA 2CBZA 3O90A 4A6PA 4F85A 5AVUA 3LLCA 1LK7A 3IIMA 4N3GA 4A1OA 1P19A 1H5UA 4TLEA 3BSWA 2AOTA 2Q5CA 2DE0X 4QREA 1UKAA 4PINA 3A2LA 3NBZC 2QTVB 1G19A 2XTNA 3EEBA 5F3DA 5FADA 1BJKA 4LOAA 4G5YA 4Q3NA 3RVJA 1X74A 2VEOA 1DBRA 1Y5LA 3ND9A 4FGLA 1SM4A 4INPA 4EG0A 5A9SA 4KW7A 4WOCA 2FN7A 5E0OA 4TXHA 3VI3B 4EMTA 1OZGA 1VIYA 3GGGA 3R4CA 1VI5A 1JIKA 5CFPA 1KZ1A 5FA6A 3HB9A 3N28A 1EFVA 1Z0KA 3EDMA 1FSFA 1PYGA 2Y1KA 3QF4A 4IWXA 4MCIA 1X3LA 1ZGHA 4MRMB 4UHDA 2NX2A 2X22A 2QOEA 1U2QA 2PL3A 4E5UA 1ZW1A 4G23A 4KRFA 2XXJA 1TECE 4S05A 1Y4ZA 3ACCA 1VG8A 3L3BA 2J3QA 3RC9A 5KYTA 5AKLA 2ZDQA 1C30A 1RWXA 2IELA 4Y6OA 3FZGA 3D4NA 3DCJA 2FQWA 4JIGA 3S7ZA 1T0IA 4BDSA 4QVKA 2HSJA 2PNFA 2PQMA 2VYFA 3S2ZA 4F3NA 1WBBA 1EUZA 5C9ZA 2BC9A 2X0KA 3N8IA 3GJ3A 4DLSA 1EZZA 2WG1A 3U4QA 1JS1X 3E48A 1OA0A 3IESA 5G3YA 1YK0A 1HLGA 3OJLA 2Q4DA 3ESDA 3OWOA 3RG2A 3VYUB 1T15A 3KJIA 4F5YA 5EC8A 5L4SA 5CA0A 1D2HA 1K92A 3MWDB 5CDGA 3RSLA 2EX0A 1M6VA 3EF0A 2PQ6A 2W4QA 4RVNA 4DR7B 1HY3A 1THTA 4PNEA 2LRHA 3RYIB 4LMPA 4DYDA 1EP2B 2IL1A 4N0QA 4S1OA 3TMKA 3MINA 3EF3A 1Y8CA 5FJIA 4B09A 3D2AA 3E6AA 1W85A 1XQVA 1MW9X 2HHCA 1XTKA 1YOVA 1PR0A 4IJ6A 1UIMA 4OGGA 2FJPA 3GEMA 5G40A 4ZU1X 5MN6A 4QBKA 2ZP1A 2OILA 1G9SA 1BG6A 1FF9A 5H3HA 1Y7PA 1I3LA 1SVOA 2DHCA 4N7BA 3FPSA 5AOBA 3W77A 5CRIA 1J5EB 1CD5A 4RGQA 4XD2A 3VOAA 4AO8A 2PUTA 3AB8A 3ZC3A 3X1MA 3H3JA 3S99A 1UUFA 5JSZB 1MZPA 4BP8A 3IIKA 1NRWA 3SIRA 4WCFA 5IFLA 3JAKA 4HGYA 5L8VA 1LDMA 5BWMA 3RT9A 3UOGA 4AY4A 3EXHC 4Y2JA 3F47A 2AGVA 3MMSA 4TMXA 1P2SA 1OA1A 4XGRA 3I28A 5FF9A 2GEKA 2ZRIA 4Y2YA 1ZP6A 3WHPA 3PL5A 3KK0A 3H5RA 4B44A 3L6UA 2BHTA 3U81A 4QGSA 2C8VA 4D4GA 3SR0A 2JRCA 3UH0A 4RV5A 3AKZA 2J3JA 1TO1E 4EOGA 3STUA 3B52X 3AY6A 1ONNA 1R9JA 3ZWMA 7REQA 4CM7A 1U5AA 3WOVA 2BM0A 4URUR 4LV6A 3W5DA 1R15A 1WUKS 3AQ4A 4ZVSA 1Z63A 5CCXA 4IIXA 5EFZA 4BE9A 2I4MA 5JZ9A 1VHDA 2RAUA 1XQ9A 2QX7A 1Z8DA 2OYCA 1HOTA 4C21A 2N3ZA 2Q46A 3JZMA 5ALZA 3V00A 4XDHA 2J07A 3AEUA 3FKQA 3O47A 4KR3A 4HQRA 5DPMA 1CCWA 3D6FA 4RXTA 1R0BA 2W93A 4ZDKA 3EPJA 3BH0A 1JX6A 3KZXA 3T5DA 2ZB8A 2O8FA 4UD6A 3OCVA 3VDXA 1PQWA 4K40A 4P4GA 2YXPX 2ZT5A 3V8BA 4LVCA 4DJTA 3L7CA 3NTVA 1RE1A 4XJSA 4DA8A 2GYVA 3EZ9A 3GAMA 1VLMA 2QW8A 1D03A 3HDTA 4A7PA 2FG5A 1TKRA 1JHAA 3JAKB 1JQ3A 3ACBA 4G8CA 2W2NA 4LCBA 5BV2P 3FPCA 3VGJA 3SIPA 1VPWA 4YMVA 1U2TA 1GPKA 5CT5A 3ZGLA 3WJAA 2ECQA 2P6NA 5A4IS 4C6TA 1GM5A 3OIDA 1PR2A 4JGGA 1R0WA 2QYOA 1E4OA 2DVMA 1KIAA 2A5GA 3RIGA 1YA6A 1WKBA 4XDYA 2X1LA 2P0YA 2R7NA 2J33A 1WDLA 1ENOA 2H8KA 3WRYA 1H4VB 4ZYTA 3EG5A 3AESB 4D4HA 3O94A 2Z4TA 5HF8A 4JLJA 2JGNA 4JLMA 2RB4A 5DT9A 2PGLA 3E1SA 2ROQA 3GU3A 3ZXSA 4EA8A 1RAHA 1E3IA 2HQOA 5A7GA 3IP8A 5ALEA 3IE0A 3MCUA 2X40A 3ZZMA 1BKDR 1G59A 3WO1A 2QRPA 3DVSX 1GSIA 4ZARA 3WV4A 1TYCA 4A16A 3QXSA 1K3FA 2IWRA 4D43A 1VE1A 1SHJA 3FDXA 5L3SB 2E4VA 1QZUA 4PAQA 3KSDO 1N2IA 4ROSA 4RVDA 5HK8A 3VR5H 3MCVA 1PU2A 3CZPA 5CA0B 5FBVB 1RIFA 5J4KA 2P30A 4BV9A 2PPLA 3L7MA 3ZHOA 1GNTA 3WL6A 1YMQA 2VZLA 1QYIA 2ZT6A 3KZCA 3RVNA 4E2XA 2QAIA 5IULC 3AM1A 1DC6A 4O08A 2O8CA 2CNLA 4KIGA 4LEIA 4OXQA 4OX9Y 2VRCA 3AYXB 1JLRA 4TXLA 1NBMD 2YJZA 3AUYA 4G4GA 4DMUB 4F4CA 5HTOA 4YP5A 1QPBA 1Q77A 4N65A 3BL6A 2GJAA 3EEYA 4I6GA 4PLZA 5BO5A 3ZLUA 3BB4A 4KITB 5L51A 3VBCA 3GUCA 4TKLA 5EVJA 3UAVA 3UMGA 4E11A 2NYVA 1IZ0A 4U2BA 3DZDA 4M3NA 3TGLA 5J4YA 5PGMA 1KR2A 3REFA 4HDRA 4EA9A 2RGGA 3TD6A 221PA 1N7JA 1X1SA 2VHCA 2ZULA 1C8VB 1WTAA 2HU7A 4N49A 1A71A 1OZHA 2ZYGA 5FUYA 2E4ZA 2VJNA 5D3QA 3RBZA 2NN3C 4EHJA 1RR6A 2RC6A 3C3KA 1D6NA 1Z73A 1CEQA 2C2GA 4MKGA 4N01A 2HEIA 4E4TA 1W8DA 3AUKA 5TT0A 1Y33E 4HRAA 2AI3A 5CDUA 1R6AA 4C7JA 3WLKX 2V4UA 2Q8NA 1CZNA 3OUUA 4U9HS 4LRWA 3AWIA 1FQKA 4OJQA 4P35A 2XTMA 4PIPA 4N3BA 1TA0A 3UB4A 2HI0A 1UBOS 2PLRA 2YWGA 3IUNA 3QG1A 1Q21A 4LOIA 4NJMB 1EFHA 3FWNA 3JATB 2Y1DA 3GL9A 4H60A 4X6UA 4BBZA 4ZYYA 3OOJA 3VISA 2IS6A 1AHHA 1NVVR 1Z15A 2NXNA 3L9XA 4GRDA 4BNHA 1QPGA 1MFZA 1Q7CA 2HIHA 2ORWA 5KNCD 4PLWA 2ZITA 1KDRA 5DCYA 4US2R 1M5RA 3GMDA 1X38A 3AO0B 2GERA 2JDIA 1YDHA 5LOVB 1L7PA 1AKEA 1XDZA 4R2JA 3V1NA 1U2RA 2GLXA 3C3YA 1NI3A 2XZTA 4NKRA 4V0RA 5KJEA 4GPZA 3V1MA 3U9TA 4EL5A 1G7CA 3JSXA 2G76A 3K72B 1GZ3A 1VP9A 2HQSA 3KLBA 4FMBB 2VDWB 4HHEA 2PQ2A 3UMSA 2DCMA 2OHOA 5EJMA 3VHXB 2P1ZA 2WC1A 5DGDA 1D6MA 2X23A 1RPJA 2G1UA 2V5AA 4YMGA 2AS0A 3TW4A 1NU8A 1FTYA 1U98A 2H2GA 5I51A 4QDJA 1T6XA 5KQLA 4EDHA 3MB5A 1TJYA 2X15A 2OC4A 3F2VA 1F0YA 1DBPA 1SVMA 4XW2A 3AF0A 5CNKA 2FPIA 2X0RA 3ZK8A 4ZT4A 4Z1MD 5U4XA 1WLSA 1N78A 1BA3A 3MOGA 3TN7A 2CNBA 4B34A 3QKSA 1PDWA 1S4QA 4RY9A 4Y98A 1ZH2A 2PM8A 1ZM4A 3CLHA 1XBTA 1NBIA 4HYYA 4AWXA 3QVUA 2CHVA 2C5LA 2PPVA 3KHUA 1H2ZA 4XIJA 3ZJYA 2F3UA 4M7OA 1YCGA 3UJBA 4YQFA 4NBUA 1WX1A 5ARCA 1HT1E 4MYHA 3OECA 3OA2A 2XZOA 2FGJA 4B9AA 3HBNA 2W37A 3QBDA 1I6LA 1IB6A 4CFYA 3TNYA 1B14A 4W9NC 3MFYA 5CIYA 5KDLA 4Y1EA 4DMMA 1PX2A 5A9RA 5TQ0A 3UT5B 4NX2A 1JKIA 2PFKA 3F6CA 3MYYA 3WV5A 1Q16A 4YI5A 3UPUA 3UNXA 3C1TA 1DEOA 3MRSA 3L1UA 3TOZA 4FBMA 4RMHA 2E85A 1SURA 1RXYA 3V32A 3B3FA 5J2UB 3MS4A 2I91A 1MV8A 3T6KA 4K9RA 2YOHA 4NZNA 3LXXA 1VKJA 1WB5A 1T35A 1ZSNA 2UZ4A 1ZD9A 4AJ1A 5L3VA 1JYFA 2ZXUA 4LZPA 3BICA 3D5EA 4HN4B 3FDZA 1ZMXA 4XE5A 4K6OA 1DIAA 2AJ8A 3EISA 4W9RA 3GLFE 2ZXFA 2O7QA 2QMEA 1T5OA 3A26A 3IIIA 5I9IA 2BGKA 1HE4A 2J5BA 4JL8A 4ZZ2A 3WWPA 5K0JA 2O8FB 3ZHBA 2H52A 4OHRA 4YJ3A 4BVAA 2DBZA 3LQ4A 3V1YA 1T1SA 3SBXA 3G2IA 1P6QA 3A14A 1C1DA 2WKPA 1H23A 2QAGC 3AI3A 1DXQA 2R3SA 3OQIA 2BUCA 2QK4A 2V3VA 4I14A 3VUFA 1XNQB 4TVBA 1EFAA 2RGWA 3KYCB 3RFXA 1AB5A 2IYFA 3C5HA 3F4LA 4QG7A 1U3FA 5DGTA 5G0UA 1SC1A 2DR3A 4LRQA 1TYAE 1CUXA 3F90A 5AMXA 2JHPA 5JC1A 2REOA 1GLNA 1IDOA 1GPNA 2VRBA 1Z22A 3O9MA 2E82A 4K86A 4LC0A 2H4WA 4M53A 5DLQC 4B6RA 3CZ4A 3EXFA 4RM3A 3AVVA 4IV8A 4OQPA 2I2WA 2VJKA 2CYBA 5SZJA 3RS3A 1GHTA 2CN1A 1CJUC 1KNQA 4A6XA 3PK0A 3LC2O 1CJCA 2JJ1D 3OC6A 5T4BA 2WUFA 3D4IA 4X63A 3CTMA 4MQ5A 2I6UA 3RYCB 3TB4A 1G6HA 1NT2A 2PS9A 4MVJM 5JJCA 3LOPA 5G0WA 5K0NA 4HTFA 5AHXA 3HB5X 3LKVA 1DEHA 2V7GA 1KF0A 4X97A 4IJWA 1HDIA 1KKUA 3K9HA 1CJSA 4UDNA 4RKWA 3DHEA 3I5AA 1VZ3A 1W4RA 1CHDA 1JIUA 1GL3A 2AEFA 4GH5A 4M7PA 5TPZD 2JGIA 3WY9A 1QTQA 2XB6A 3G5UA 4LHYA 1OH7A 1NLUA 2C8LA 3ECAA 1QLJA 3M0EA 1KL7A 3TZEA 4DEYA 4BGDA 4MB6A 4O2AF 4P58A 3TTXA 5LZ9A 1K7CA 3EF1A 5H9WA 1X8XA 1ADJA 3LS2A 3DBHB 2IEZA 2FVXA 2PUHA 4XEHA 1XXLA 1CQPA 1F60A 1IB0A 1RRPA 3M4ZA 4L27A 1R9GA 4U2KA 2R84A 4WAUA 3ZE9A 1YB4A 1V37A 4MW5A 4GI7A 3O4FA 4QPPA 5FNVA 4JEIA 1SKMA 5EZYA 3RHFA 2ZE7A 2J6CA 1OLXB 1X9GA 5AW0A 2QVCA 2X19A 3ENQA 6REQB 4Q7KA 1VMDA 3LPMA 1NXTA 4UATA 4AYTA 3AVTA 2C9BA 3UGTA 1QTNA 2WT9A 4XCVA 4CJXA 2R97A 1VXRA 4KNYA 1M6EX 1RQGA 2ASEA 2G88A 3FD8A 5GTDA 4BQPA 4YJFB 3C87A 4BBPA 5E4TA 1RAEA 4JZKA 4RPJA 1JTFA 3GRUA 1MQ8B 1PEKE 4M2LA 1G7RA 5E1DA 5FI3A 1C1HA 5L3RA 5TT1A 5LP6A 4XPIA 4G0NA 1E2QA 5LYYA 3TQOA 3ZHVA 5BURA 2F9FA 4BLRA 3KU4A 2X6TA 3Q2OA 3LTEA 5D2CA 4OEHA 1LLDA 4B6JA 2WU4A 2FCRA 2C61A 4IJVA 1XK6A 1QMPA 3BVPA 4ID9A 3WDKA 4KLCA 2ZBRA 3HN6A 2B78A 2BCGY 4LDNA 4CCYB 2UXCB 2BR4A 1FMLA 1SCNE 4QXRA 1QIDA 2FW7A 2XKBA 4WCVA 2X6RA 3CT6A 3IXQA 1Z74A 2ACVA 4HAYA 1BCSB 4MVJG 1X1EA 5BMVF 2Q1SA 4U4AA 3UV6A 4HGRA 2JJQA 2QTVA 4L0QA 2Z0MA 3CISA 3Q85A 2RK6A 3N9IA 2Y67A 5C7OO 2CVPA 3B9BA 3D7KA 3ZHQA 4B5KA 3CZMA 1W75A 3HL0A 3B38A 1TVEA 2LIVA 4HVCA 4AY6A 3E4DA 4RC9A 5SICE 4YMTA 1U6KA 3QVLA 2BN4A 1EK5A 3B89A 3V5NA 5BPFA 5D6OA 4BFCA 4KV9A 1A5SB 1RRFA 4FS8A 1T2EA 4H27A 3NYQA 4LBYA 1DG9A 2EZ9A 2GUWA 4WNCA 1YA4A 2JEYA 2CXSA 1TK3A 2OHVA 2VA8A 4O1HA 1CT9A 1K66A 3LQYA 3QKWA 4QPZA 1WKVA 3OZAA 3RRFA 4F6CA 2FQQA 5I5EA 4C07A 5IT5A 1G66A 2O0JA 5BVGB 2I62A 3BORA 1G5TA 1Q0LA 1P1CA 4YA6A 1DMRA 2ET6A 1KYWA 2XCLA 2DFLA 3IEUA 1PDOA 3FB4A 1T4GA 3F8TA 4EAQA 3WHIA 2BH2A 2Y1EA 4AAYA 4FLMA 3KTAB 5CXXA 1HG0A 4O6VA 3IAS6 3ABSB 1QGOA 1JLLA 2CK3A 2BEUB 3IOMA 4M21A 1VKZA 4YJ2A 1W2WB 5HIMA 3H18A 2XA1A 3ZV6A 4DSNA 2JLRA 4KXUA 4D26A 3BS4A 1A88A 1ACMA 4YUVA 4BO4A 1FUIA 4UBNA 4GD3Q 3KKZA 4ZT5A 3HH8A 1R8YA 5F7JA 4F5DA 2F1OA 2OBNA 2CV2A 2DT8A 1QBGA 2A57A 1RWMA 3R9KA 4WVFA 1EWVA 3IBCA 3CVVA 2YIDA 4BO0A 1FXSA 2I2FA 5CDSA 3VI4B 2FG7C 5DEIA 4JBXA 2Z9CA 3PQ2A 2DT5A 1WW8A 4D46A 2FTKE 2VSQA 3IPAA 4AD8A 1KYTA 3JQ7B 3C3MA 3UXMA 3T52A 1QHIA 1M0TA 3R7FA 1JFFA 1W0JD 3NP9A 1XTIA 2BTOA 3KAQA 3DMTC 2ZCVA 3BL5A 1SUAA 2MHCA 4E31A 1ID8A 1R8XA 3A6DA 4JMLA 2Q28A 1DIRA 4REOA 3ZDAA 2WT8A 2Q1XA 2OY0A 1I6WA 3V4OA 5C8XA 5JZOA 1RDFA 1UXKA 1W36C 4R1PA 3SHVA 1FRNA 1Y4DE 3ICPA 3UAWA 1YE3A 2GAFA 4JLBA 1M66A 3GEPA 1ODCA 4AB1A 2R79A 4O4HA 3ICQB 1V7QA 1TC1A 2BFAA 3FN4A 4CE6A 2NYAA 2JFZA 4L9SA 4M22A 4UVEA 4UUQA 4ND2A 4X62B 4V1CA 5TQ2A 4E5NA 3E84A 4OU5A 2PSJA 3N8KA 4KOEC 4RTQA 5JJ5A 3GUYA 3OQHA 5CDHA 3DMPA 2Z1NA 1ECGA 4TTAA 4YAWA 3NYRA 4J7AA 3L8FA 2JARA 1M2NA 1X8KA 2SBTA 2VYVD 4EABA 1QHEA 2A7XA 4RJ2A 4TYYA 1Z4JA 2CMHA 1T10A 3TVDA 1EDOA 2Q8QA 1WMFA 3CZRA 3D6HA 1LQTA 3DLTA 3GT7A 5E6RA 3TIGA 5ER6A 3T7JA 1WHSB 4UTNA 3HCCA 2YWXA 4FBGA 1NXVA 3OC0A 4ZAVA 4RULA 2HDHA 2YFQA 3MWJA 1W1WA 1ORHA 3GZNA 2OHIA 4K3VA 3RSOA 2YJNA 1W7AA 3F8WA 5AKZA 3L7JA 4TWAA 2FQYA 3IIJA 2ZIEA 1GTSA 1KTVA 2C5HA 3AUAA 3RF7A 3O3NB 4D4MA 5H9VA 4ZOAA 2X0FA 1V3VA 1ZCBA 3H42B 4IH4A 5ES3A 5HHTA 4QNNA 4JB0A 4XX0A 3VTKA 1NNEA 1ZC4A 3T3HA 2IYQA 1L9KA 3EVCA 4LYJA 4NVRA 5KKAA 1HEIA 2A9RA 3AIIA 4L4ZA 4LC9A 4WY2A 3VU0A 1BIFA 3JALA 3SDSA 2BY4A 2HGSA 4HNHA 4TTJA 5D00A 5JSYA 4JBGA 3V46A 4ASUD 4MR9B 1P9OA 3FWPA 3OAAD 4DDTA 3ZIDA 2NSYA 4Z4CA 3UATA 2G71A 2BE7A 3BD9A 1PS8A 4MP8A 3SEFA 1LC3A 3B5EA 2IZ6A 5IDXA 5DWDA 3MC1A 3MMPA 4JJ4A 4CEIB 3NWEA 4I36A 1S7GA 5JAHA 2ZRPA 1QE0A 3N05A 1KOGA 2Q3HA 1U1IA 3I04M 3NH6A 4I8DA 1N3IA 4D5EA 1JR3E 1XALA 1A7UA 2OD2A 2YRXA 1BCRB 2J32A 4G4SO 4LNUB 3UUWA 1TMGE 5A1JA 1U1EA 2WY2D 1FTWA 1YE8A 1GLVA 5ALJA 1EESA 2UZAA 2PR7A 5B1YA 2IX3A 1A97A 1N2BA 2O54A 3U6KA 4RH3A 2XWJI 1TQ6A 3AVOA 4K6HA 4G89A 4Z9FA 1BA2A 1LZKA 1PWEA 3IAFA 4L5AA 4Y8VA 4TS9A 3RS9A 4OHBA 2JLXA 4DIDA 3FAKA 3B2NA 4MV9A 4G9EA 3HDHA 3GDHA 3HSSA 3BK7A 3LKDA 4IDFA 5DNYB 3JYQA 1V1JA 1H1LB 1NUQA 2Q3BA 3L2OB 4GOOD 2ZLBA 1LPBB 2MR6A 1KFKB 3KKOA 2DQYA 3NOOA 3L4EA 3OZIA 2FPKA 1Z82A 1COZA 1G8YA 1RWKA 2GOYA 4BUCA 4N1AA 2XMDA 3TX2A 3UJCA 4BQOA 1CRPA 2VLIA 3H0KA 3RC1A 3U39A 3LFHA 2J0VA 5AW5A 1SB8A 3G5AA 2B3TA 3SFZA 3P2IA 5JIBA 4U2GA 2F4VB 4J0FA 3ILVA 3HYTA 3DAGA 1DIGA 5HS6A 3W6PA 3RNLA 4JI7B 3K9GA 2AI2A 2MSKA 1O1YA 2ZW9A 4QBHA 5A5DA 2PH7A 4CN8A 3L7IA 4I19A 5IBQA 2TYSB 3ILSA 2REQA 4TVOA 5DLDA 2ZT7A 4J0KA 1F1BA 3AF3A 5DWQA 2X7XA 5A3VA 4QO8A 3C97A 2GASA 4KAJA 5TMEA 2C3OA 2GJ4A 5F1PA 1E9AA 4MQEA 1UFOA 3LD9A 2I7XA 1YQXA 1N2HA 1T5HX 2NO0A 2OHJA 2VWGA 3JQFC 4L5YA 1U8XX 4QDUA 4R2HA 3EIFA 4XD7D 2FMUA 3TQHA 4WQMA 4JEUA 1XROA 4UHKA 5EIBD 1J8MF 4B4UA 4EUSA 1OB2A 3TLAA 1I2CA 1C1DB 1TAGA 1XEWX 1DX4A 2J3DA 3GQBB 5ECWA 1FSGA 2W4IA 4FNGA 1JHMA 4MWOA 2ZUFA 4HBGA 3H9JA 5FA8A 3YASA 4BQNA 4Z4EA 3O0TA 4MKHA 4YAOA 4MKXA 1K5HA 4L7VA 2E5FA 4HMQA 5HQJA 1JPNA 4JWTA 5TPZA 2WJPA 1J6UA 2IOHA 5SY4A 4M99A 2JFFA 2RDMA