3K6JA

Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from c.elegans
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
433
structure length
430
Chain Sequence
HHSTGENLYFQGSEVRSYLMEAHSLAGQWSLPNDRGDHTNSEAYDVNSVAIIGGGTMGKAMAICFGLAGIETFLVVRNEQRCKQELEVMYAREKSFKRLNDKRIEKINANLKITSDFHKLSNCDLIVESVIEDMKLKKELFANLENICKSTCIFGTNTSSLDLNEISSVLRDPSNLVGIHFFNPANVIRLVEIIYGSHTSSQAIATAFQACESIKKLPVLVGNCKSFVFNRLLHVYFDQSQKLMYEYGYLPHQIDKIITNFGFLMGPMTVADMNGFDVMEKLKKENGLEPNPIEKEMWRLKRYGRKTNKGFYKYDDKTQRKENDTEMEQIIRRVAKSNIQIINDQDVINFMLYPTVNEGYRCIEEGVISNESLIDIMFILGFGWPIHSGGPMRFGKTEGLDKIANMLVHWSSLEPKESAYIVADALKTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein F01G10.3, confirmed by transcript evidence
publication title Crystal structure of the dehydrogenase part of multifuctional enzyme 1 from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Oxidoreductase
total genus 156
structure length 430
sequence length 433
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3k6jA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k6jA01
1E7WA 3PPIA 2PKQP 2I66A 1VJTA 5COQA 4IDGA 3DB2A 4FFNA 1LLQA 2Y0CA 3ENNA 1R37A 1PSDA 5L95A 3QY9A 1I30A 2GDZA 3JD0A 5FEUA 1M6HA 3P5SA 3O9ZA 4Z9YA 1O0SA 3C3XA 3HFGA 4M54A 3VH2A 4A5OA 1SC6A 5TRTA 5JCJD 4BKQA 3MJSA 4XX0A 4PVCA 4RPHA 4GGOA 2E6UX 2J3IA 5TX7A 2RCYA 3WGIA 1GEEA 3LVFO 4OO3A 3DR3A 4O5OA 3ZI0A 4CV3A 2Y93A 4DPLA 1VLLA 2IDZA 2VRCA 3W8DA 1U3VA 1LDYA 1CQJA 2ZYAA 3CZRA 3P2OA 4MVJP 2E4AA 3JD3A 4YRAA 2Y05A 3OP4A 1HZJA 4PZCA 4BUCA 2Y1FA 3DHEA 1P1KA 3G3EA 3VZSA 3R0IA 1H0KA 5DF1A 4LCEA 4PRKA 1XU7A 3DAGA 4R1TA 1PR9A 1ISIA 1JN0A 2NV6A 4RVFA 4XR4A 1MXHA 2AQHA 2OL4A 2BFAA 3ADPA 1C14A 3ZU3A 1R0KA 4IDDA 3V1UA 1XIVA 1K3TA 1FXSA 3IJRA 1ZK1A 4J7XA 1NX6A 2PZKA 3KO8A 2VHWA 4AVYA 3VTZA 4R1NA 4CM6A 2HJRA 4AJ2A 1AN9A 1EFKA 1B16A 3H2SA 4KP7A 3I9JA 3DHNA 3S2IA 3OQ1A 1FMCA 3ZWVA 4NU5A 4ZHSA 2CMDA 4FN4A 3GPDG 2J3JA 2XPCA 4FGSA 4FFOA 3LF2A 4JP2A 3WYCA 1OZAA 1GZ3A 4DL9A 5A5FA 4DQXA 1SAYA 3TWOA 1GDHA 2EP7A 3AI2A 3NGLA 1GQ2A 3WGHA 3GMDA 4NI5A 1ZKMA 1SMKA 2X1HA 1JVSA 2ZYDA 3H9UA 3PHIA 3PIIA 1Y9EA 2QZZA 3GT0A 1G1AA 1U2DA 1RKXA 5A5EA 2UVDA 3AUSA 5BSHA 3CMCO 2J3HA 1LUAA 1M2WA 4WASA 5DBIA 3PWKA 3KYBA 4NJMB 1HF3A 1Y7TA 2H63A 2WJPA 3H5AA 4HWKA 4RVSA 1K5HA 1GD1O 2WSBA 4B7XA 4D43A 4ZICA 4J1NA 3ZWXA 4I9UA 1WDLA 4OXKA 2FSVA 2TMDA 1WAMA 3NDJA 2NTVA 1JKJA 5TC4A 5B4TA 4D42A 3HG7A 3TL3A 3GN2A 2Q1WA 2BFPA 2DTDA 4Q3CA 1XQ6A 3TZ6A 1WW8A 4BNJA 3RFXA 1LQTA 4P22A 3W4KA 3FF4A 1EDZA 1GPDG 3AY7A 3C1TA 5KJFA 2D3TA 3F9IA 4J7UA 5U4QA 3Q0EA 4TRNA 3VKUA 4AL4A 3IL2A 4BO3A 5L53A 2DUWA 3BMQB 5JDIC 1CJCA 4IPTA 2GD1O 2OP0A 3QP9A 4NJMA 4R51A 4RGBA 4BMNA 2PZMA 1O8CA 3LZ6A 1NP3A 1GU7A 3EAGA 1DIAA 3TNLA 5CDUA 5HWSA 4L4RA 3JQ8A 2DUUA 4JBGA 5BNTA 1ZIDA 3F4BA 2AQKA 3E9MA 1YE3A 4NZ9A 1ADCA 3DOJA 1UXIA 5JMWA 2VTDA 2PTGA 1QR6A 3NDIA 2GASA 5DBGA 1JA9A 5JNLA 2GF2A 2QZ9A 3GNSA 1JAYA 1U28A 4R01A 1YB5A 1LA2A 4OOEA 4YRDA 3K96A 1P0FA 3RUHA 1U7HA 2Q2WA 2O7QA 4BO9A 3WS7A 1DFHA 1QLHA 3KM0A 9LDTA 3QRWA 1P77A 2C82A 4YJDA 2Q4BA 3ONFA 3VPHA 3OICA 3GMSA 4B4VA 2X0IA 3STHA 3IIEA 1RM5A 3PJGA 3BMQA 4I9NA 3LT1A 4TKMA 1ONOA 4RO0A 1E3LA 4BV8A 2VNSA 1E3JA 3M2TA 4CM4B 1C1XA 1PIWA 3LDHA 3P19A 5F21A 4E0BA 3HJAA 3DZBA 3PJEA 2RHCA 1YBAA 3X2EA 3U09A 2NVUB 1QYXA 1HYHA 3V2HA 2FZWA 3DXFA 1TLTA 1J5PA 1UXJA 2I6TA 1TT5A 1UJMA 2YY7A 4W7HA 3I6QA 4OIMA 1ZJYA 3UICA 1ENPA 1LI4A 3AU9A 3CH6A 5G0UA 5TNXA 5IXYA 2BELA 4Q3AA 3BMNB 3HDYA 4OMUA 3ZV6A 4B3HA 4U6QA 4CODB 1NQTA 4QO8A 4CLOA 2GN4A 5HRUA 1LRLA 3RC9A 1H2BA 4BO4A 3NTQA 1S6YA 5DNAA 4JP3A 2H6EA 1ENOA 2O4CA 3VZRA 5G0VA 3ZNNA 4IMRA 1VJ0A 4YR9A 5AXAA 2J8ZA 1GUZA 3ZV4A 1LSJA 2JFGA 1CDOA 4DC1A 2YHUA 1B8UA 3FNFA 2CDBA 3GZ4A 1Y1PA 4CLRB 4CM4A 3SJUA 3LLSA 4FJ1A 1G0NA 4MVJF 3FSRA 4DQUA 1YO6A 4GAEA 3UCFA 3ICPA 3QIVA 4WLEA 4AJLA 3EVNA 3UH1A 4MVJH 3RUDA 5KJ1A 4A2CA 5JY6A 4GBJA 1ZSNA 3HNPA 1KEVA 2O3RA 2DPHA 3HFSA 3TOXA 3JQFC 2C2XA 1T2EA 1DLJA 4DIBA 1HE4A 1XR3A 5JO9A 2QYTA 3QWHA 1PEDA 2PD6A 1NQOA 2E49A 1G0OA 4W6ZA 4CM5A 1NR7A 1T2CA 2CUKA 2HAEA 2Q45A 5DZSA 4CM1A 4DLAA 4KTVE 3LLVA 2X9NA 1GCUA 4D45A 5K0ZA 1UZLA 3EYWA 4GI2A 3A4VA 1E6WA 3VC7A 4CUZA 3GNQA 4A73A 1NYTA 3U49A 3M1AA 3QJ5A 1FF9A 1VL6A 4Q39A 1P1RA 4GSLA 4R3WA 5JYEA 2V6FA 5JDCC 5JDIA 4R68A 3DC2A 2EW8A 2EKPA 3DQPA 1UP6A 3ZNQA 2GSDA 4BNFA 4S3MA 4DBVO 1YVEI 5ICMA 1ZFNA 2D2IA 4ILKA 1X7HA 3SXPA 4OQYA 4OKIA 1X14A 3KUXA 2HUNA 3E9QA 5H82A 3GVPA 3PXXA 2Y66A 2BLLA 2ZQYA 2EV9A 3O38A 4YTEA 2PGLA 3ZWCA 1E5QA 3LC7O 1K0UA 1PQPA 3WMWA 4ALIA 4FDAA 3R1IA 2CVOA 2IZZA 2PH5A 2FR8A 5CEJA 2BI7A 5DOVA 3LQFA 4HNHA 1IY8A 5IZCC 4GLLA 1E7SA 1V0JA 5G0TA 3ANMA 3RUIA 4FFLA 3JCZA 2NM0A 3DBHB 2RHRA 4EITA 1LRKA 1LXCA 1ZVMA 4WKGA 3NEPX 4DYVA 4L73A 4MP6A 4E2XA 1ZK4A 4XB1A 3KHUA 4AJOA 1ZEMA 2BGLA 4QFDA 1ONPA 1PGQA 2E48A 2VNAA 4NBWA 4OJNA 3U62A 5HS4A 4XDYA 5KVSA 1HRDA 1QMGA 1GV0A 1VRWA 4RF4A 4OSPA 1D7OA 5ENDA 3D3WA 8ADHA 4PCVA 3GDFA 4K9DA 4EEXA 1I3KA 1PL7A 1DB3A 5CEEA 5JAZA 1KVRA 1K2WA 2QG4A 3GG2A 2DLDA 1E3EA 2YW9A 4XYGA 3DL2A 1Q0QA 3WR5A 1H93A 1EZ4A 5KVQA 1UR5A 5TT1A 4ZQGA 3T4XA 1VPDA 3VH1A 1I2ZA 2C5EA 1ZXBA 2NQTA 4IGEA 5EESA 3ZWAA 2AG8A 4RF3A 3I83A 3DOCA 4J6FA 4QUKA 1ADGA 3GOHA 3JTMA 3JQ7B 3UN1A 1IHYA 4J2OA 4KQXA 1ISHA 3DZGA 3BTUA 3DBRA 4HFMA 3FNHA 1U8FO 2DKNA 2BRUA 3RUCA 3U0BA 1F8GA 4JGBA 1KEWA 2X58A 2VHYA 1R16A 4IIUA 4BGIA 5JCXA 5CPBA 2NUAA 1EDOA 1PWZA 1U1IA 3JQFA 3H8VA 4HP8A 4IXWA 2V65A 1SB9A 2VUUA 3U4CA 3VZPA 3OFSA 3HDJA 4IBOA 5DDIP 4WCDA 1N7HA 1YONA 1XEAA 1VKNA 3I9LA 4CLEA 3AI1A 1WPQA 2NU9A 3NGXA 1VSVA 3WNVA 4D46A 1HLPA 2OZPA 5CDSA 4IJVA 1N5DA 4AJPA 4YT2A 4DIFA 2OHXA 4BKRA 1DLIA 2YV2A 4BNUA 4Y9DA 1AE1A 2HK9A 3BA1A 2VN8A 4UUPA 2PZJA 4R69A 1H6CA 3G49A 2AEMA 3C8MA 3GUYA 4UVHA 4JLWA 5EQFA 3CXRA 5JDCA 5KCZA 2B69A 4P38A 5L9AA 1Q7GA 4IDFA 4BO2A 4IDBA 2PD3A 4RJTA 1PTJA 4WE3A 1LJ8A 2OO5A 3FTPA 1U3WA 4ND4A 1ZMOA 4AJ1A 3PFFA 5ITWA 1R0SA 2Y68A 1WZIA 3IUSA 1KVQA 2X86A 4C4OA 3VH4A 3WXBA 2D4AA 1B8VA 1I36A 3PVZA 4Q3EA 5L7YA 4BKUA 4HNGA 3HADA 1JTVA 4RPJA 4EGFA 1E1LA 3JD1A 4TRRA 2YV1A 4K6FA 3EVTA 1HE5A 2C07A 4CM3A 4PLVA 3H7AA 3FPLA 4O59O 3WYBA 3N7UA 5IZCA 2X23A 3OMLA 3UUWA 2AHRA 2OMEA 4R4JA 4UEKA 3RROA 2I3AA 4ZQBA 4LK3A 4HXYA 4IUYA 2HKIA 2GO1A 4EUFA 3EZLA 3JQEA 3ICCA 3NAQA 4F6CA 1I0ZA 4HKTA 1EE9A 4MOWA 5JS6A 3ZW9A 1BSVA 1YL6A 1YRLA 1ISFA 4CL8A 3UCXA 2B0JA 2EWMA 3WWYA 4WLNA 1PZGA 3F5SA 4MVJA 3ZHYA 4BV9A 2AMFA 5CG2A 4IS2A 1HDGO 2HMUA 2QW8A 2UUOA 1P1FA 3WGZA 3A9WA 3GFGA 1PJ2A 1B2LA 4L4XA 2ZJ1A 1LX6A 3I52A 2BH9A 1O94A 2ZB7A 3ZHBA 3Q2KA 1NFRA 4XJTA 1NFFA 4J0EA 2Y0DA 3OIGA 5JMPA 4CQMB 4YJHB 2Q1TA 4CM7A 1T2AA 1E7YA 1ADBA 1OAAA 5G2OA 4B4WA 1DO8A 1YS4A 5H83A 3CUKA 4A03A 1AGNA 3AUAA 4J16A 3QVSA 4WEQA 1TA4A 2GLXA 2YFHA 5JC1A 2GN8A 1NPDA 4RZIA 4CR8A 1E6EA 3C7AA 4FBGA 5LDGA 4I08A 1PU2A 1H6DA 1PJ4A 1QLJA 4XYMA 4R5MA 1JDJA 3V5NA 1BRMA 3M2PA 1SBYA 1U3TA 2QQ5A 1I3MA 3GZNB 5C37A 4FSHA 4MIOA 4UULA 4M1QA 2BD0A 3RBXA 3TZHA 4XGIA 1SOWA 3ZDFA 4R54A 4E33A 2G5CA 4YAJA 1HDYA 2O3SA 2P9GA 4BS9A 2F1KA 4CQLA 4J2HA 1T4DA 2Q49A 2IE0A 4DTIA 3JQ6A 4BNZA 4LN1A 4CM9D 3Q9NA 4XYLA 1PJCA 3MTJA 4IJKA 5TJHA 1KEPA 2NVWA 1U3UA 3WICA 1WVGA 1Q7CA 3WLEA 3GQVA 3INRA 1TT7A 4QECA 5JPIA 1PJ3A 4NH4A 3ETEA 3SC4A 5TF4A 4Y98A 2VWHA 3OSUA 4TRJA 2C5AA 5JFOA 3FWZA 2QIOA 2ZIZA 4KTTE 3HE3A 4DGSA 1K6XA 3H9JA 3MWEB 3KV3O 2BFOA 4YBZA 4IS3A 1H94A 3BMOA 3FD8A 3Q3CA 3KEQA 4J1QA 1JQBA 3BYZA 4XIJA 2AQIA 3Q9UA 4TMFA 4NMHA 2YDYA 4CPDA 1PGOA 1T1SA 1LSOA 3C24A 3S2FA 1PJBA 1BVUA 2JD0A 2FOIA 3S1LA 4MVJM 3VPFA 3VTFA 1GY8A 2P68A 3RI3A 4D0SA 1E6UA 4LMPA 3C1AA 5THKA 3GHHA 2J3KA 3AI3A 3BTSA 4LMRA 3KSUA 1Q2XA 4CLXA 3ITKA 4E12A 5JW6A 5JXWA 5JO0A 1PGPA 2O7SA 3KLMX 5TS3A 3PYLA 3QQPA 2C59A 4RDHA 3R3SA 3AY3A 2YJZA 5IF3A 1Y81A 3VVCA 1HTBA 3A1NA 4I5GA 2JAPA 3L4SO 2BKAA 4FS3A 3GN1A 4RL6A 3H2ZA 5DCYA 1D4FA 3DZJA 1M76A 4NFHA 5K9ZA 4HFNA 3TN7A 1MX3A 2CVQA 1HETA 4GQAA 5JC8A 4BVAA 1OC4A 4DLLA 1H9AA 4GGPA 3ZWWA 3WX0A 4ND3A 3WMXA 1UDCA 1GADO 4CL3A 2YFQA 3GRKA 5KJEA 3D4PA 1BG6A 1E0DA 4CQMD 2DTXA 2AEJA 4J7CA 4QSMA 1DJQA 5G0WA 4WUVA 3M6IA 1I10A 2R00C 3VH3A 4YAGA 1V9LA 1MB4A 3V2UA 2G1UA 1DC3A 4OL9A 3AU8A 1CERA 3KOUA 1MXFA 5AXBA 1DIGA 3GAZA 1G6KA 2F00A 1B3BA 1YBVA 2C20A 5EL0A 1SCUA 5IN5A 2X8LA 2NADA 4GKBA 4L8VA 5DBFA 4IY1A 4W4TA 1PS8A 1DEHA 1UAGA 4U5QA 2ET6A 5C7LO 4XR9A 4DBZA 2I67A 5IDQA 1UDBA 3WQQA 2RAFA 2VQ3A 5F5NA 3WBBA 1Y6JA 4ND1A 4EJMA 4URFA 5B12A 4DVJA 4L74A 3CPSA 4CMGA 1P31A 3AFNA 3EMKA 2Y0EA 1ZO8A 2WTBA 3GGGA 4YT5A 2QX7A 2DPGA 4F45A 4CMKA 4R1UA 5J23A 4JXKA 3WIEA 4PG5A 3OH8A 1GZ4A 1B26A 4WECA 3TF5A 4INAA 4PLZA 3PQDA 2Z5LA 4FFPA 1I3NA 4N5LA 3CIFA 2P91A 4A27A 1UDAA 2W98A 3UF0A 3MZ0A 2HCTA 3ASUA 1ADFA 3OJOA 5DULA 1CIVA 1F14A 1LQUA 3EGOA 2BMAA 3IAHA 1H2HA 2HSDA 2A92A 1HL3A 2PGJA 5ADHA 3DZHA 2CF6A 4ZVVA 4Q9NA 1R4NA 3UFXA 4WNCA 4ALMA 3RC1A 3WBFA 1ENYA 1FDVA 1XGKA 3RJ5A 2FR1A 3C7CB 4S1VA 1JAXA 1N1GA 1V3TA 4G2NA 2VHZA 1LC0A 3L07A 4LSMA 1MLDA 2FY8A 3H9GA 4BNIA 2EERA 4IZIA 1YXMA 1ZK0A 1MFPA 1KOLA 4GLOA 4GPD1 2FN7A 1F12A 3D4NA 1I5RA 1VM6A 3TZCA 2B5VA 4PN3A 4FFMA 3GUCA 4YAEA 1ULUA 5KVCA 3E03A 2DBQA 3V1YA 4BO5A 2VRCD 1GZ6A 3W6UA 3JQ8B 3QWAA 2I9PA 4NPCA 1LLDA 4CR6A 3FBGA 3ETGA 4J1TA 4WGGA 4Z0TA 3L6OO 3T4EA 2RH4A 7MDHA 4ZQHA 4LRTB 5IJZA 1SO8A 3RKUA 2WYUA 4MKRA 3DTYA 3K31A 6LDHA 3EK2A 4EYEA 3QV1A 3VKVA 3WFJA 4NBRA 1Q1NA 1EVIA 3IOYA 2O2SA 3OA0A 3RAJA 4ROSA 4CUKA 1EUDA 4P8RA 3DFZA 3I1JA 4BO6A 4J43A 1BDMA 1NHGA 2X22A 2YV3A 5IAAA 1X1EA 3JV7A 4M89A 4R41A 4Z9XA 2EJWA 2DTEA 2R00A 1ZW1A 4TRMA 5KIAA 1ONNA 2UYYA 4WOJA 3K5PA 3MOIA 4FJ2A 1C1XB 3OJ0A 5LCXA 1PGNA 1IYZA 4XQEA 2ZKLA 3H4VA 4YRBA 3U4IA 2NVBA 1CRWG 2V6BA 1B14A 1EBFA 1JU9A 3V8BA 5C7OO 1EQ2A 1K6IA 3DEYX 1KY5A 5HM8A 4PLTA 1PJLA 1TT5B 1O9BA 1W8DA 4NHEA 4BNXA 2PWZA 3ROMA 3UVEA 2HLPA 3VPXA 4BKOA 1XQ1A 5CDGA 5CAEA 3NYWA 4YB8A 3TPCA 4J91A 2P4QA 3DWFA 2GZ3A 1GYRA 3GAFA 3CMMA 4CLOB 3TDKA 1YBMA 4IGFA 5LDHA 3K9QO 2PR2A 4XB2A 5EN4A 3WNQA 3CSDA 1JVBA 4Q3BA 3L0DA 9LDBA 4MO2A 1SEVA 1Z73A 1XKQA 3D4OA 1LDMA 1Y8RB 2VOEA 3HHPA 2DFDA 1F06A 3HSKA 4YJGA 5GMOA 3AW9A 4DYDA 4LSWA 4LISA 4KWIA 1R6DA 5C5IA 1R12A 2V6MA 5GZ3A 4A26A 4PLHA 4GX5A 2H9IA 5I7VA 5IDYA 3IP3A 1DAOA 2PGDA 3JYOA 4AFNA 5GZ1A 1HT0A 1TVEA 3F46A 4DLBA 3E6AA 1LDBA 3DZIA 3IJPA 1JKIA 3OJLA 2H5LA 3QVTA 3WJAA 5TGDA 3ZWPA 1BXZA 3OEYA 2D1YA 3I5MA 1LTHR 5A3JA 1GUFA 2WE7A 5A1TA 4WCFC 4OOFA 1M66A 4YQYA 2WDZA 4O6VA 2VT2A 3RC2A 1A71A 2FR0A 4BKPA 5L40A 2VWPA 4EZBA 4E2ZA 2QHXA 4BNYA 2G76A 2X0NA 3PQEA 3DZKA 2ZK7A 3VPGA 2AEFA 5A02A 4CMBA 2Y1OA 3ONEA 4YVFA 5TJ9A 1Y8RA 2D5AA 4OSOA 2X5KO 3GLQA 3NJ8A 2AW5A 2FHSA 4RQTA 3IQDB 4MVJG 4NFYA 3MCVA 2DM6A 4PG7A 2G17A 2GCGA 3KRTA 4ALNA 4EW6A 4CMIB 3G17A 4MIYA 2X5OA 2IODA 2EHDA 1R15A 1DIHA 3OBBA 1EVZA 4OAQA 3ETDA 4ONEA 4B79A 2Q2VA 3HUDA 4ND5A 3U5TA 4IM7A 3BMCB 3GPIA 2VRBA 3EUWA 4B4UA 3WFIA 4BNMA 1PL6A 3GK3A 4OKNA 5ILGA 3AOEC 4R16A 1NPTO 1PZFA 4IDCA 1UH5A 5JE8A 4O63O 1GTMA 1RWBA 4JJGA 1QKIA 4MJLA 3GC6A 5F1OA 4WLVA 2X9VA 1U4OA 2P4HX 1M75A 2GN6A 3FRJA 3T7CA 4CLDA 1QYVA 3AUUA 3GGPA 1I32A 4LRSB 4NK5A 4ZRNA 1YH3A 2G82A 1HDRA 2W2LA 1KEUA 5EIOA 3PK0A 4JIGA 1U9JA 4ZRMA 1A7AA 4D3DA 3KTDA 2HJSA 4PG6A 2IXAA 2Z1NA 4QX6A 4CMIA 2NU8A 1MFZA 4R9SA 3WOHA 4EDFA 1U4SA 4YAIA 5DP2A 3JQBC 3TQHA 3WGTA 4FFRA 4JROA 4E5MA 4UUNA 1LLUA 1V6AA 5AXCA 5I7SA 3S2GA 3BMCA 5FI3A 3TZQA 3ADOA 4EUEA 3PI7A 4MINA 1KC3A 2PH3A 2O4UX 1E5LA 1VC2A 3HN2A 3D3EA 3E5MA 1PGJA 1C3VA 1HXHA 2CFCA 3TOZA 5T6BA 1BHSA 2EJVA 3WGGA 5COBA 3KBOA 1A5ZA 2EF1A 4HY3A 5A9TA 3D3WB 4JNKA 1DBVO 4FCCA 3QWFA 4KUHA 4D7AA 3RUEA 1IZ9A 4XZ3A 1P1HA 3RASA 2WE8A 2O2YA 4UUMA 5BSFA 1U5CA 3A28A 3M1LA 3O8QB 2NLOA 1WDKA 1P1IA 2D59A 3RU7A 1DDOA 1E7RA 2AXQA 3OHSX 3MOGA 5L3ZA 3SC6A 4EJ0A 3IC5A 4Q3NA 2WD7A 4A10A 1BVRA 2VYVA 4M49A 3BIOA 3D1LA 1OI7A 5KNLA 4CLHA 3D64A 3FNGA 3W1VA 1VI2A 3DBRB 2IZ1A 4HADA 8LDHA 1X1TA 2JCXA 3I6IA 1N92A 1UXKA 1I33A 4XQCA 5G4KA 1HKUA 3QLJA 4E6PA 2Q2QA 3LC1O 3DZFA 4PZEA 2ZCUA 3ON5A 1P9LA 3GG9A 4IDEA 4J1SA 2ZTUA 1K6JA 3WSWA 1N1EA 4WCFA 4TROA 5MDHA 3PDUA 5TLSA 3JQAA 3O8QA 1EK6A 4EEZA 3RWBA 2Z95A 4HFJA 4CMCA 2WEKA 4PLWA 4RPLA 4U8GA 4J4HA 3FWNA 1T25A 2Q3EA 4U0JA 5T5QA 3NDRA 1AUPA 2EGHA 4AJEA 1YL5A 1WP4A 4BMVA 2PKRA 1Y8QB 3UXYA 1FDSA 2PZLA 5CP8A 3VDRA 2FWMX 2X5JO 1BW9A 4I9HA 3WJ7A 2VUTA 1I2CA 4KUEA 1ZXLA 2BI8A 5TQVA 4TQGA 3HDHA 3WIDA 1Y5MA 1A9ZA 1YJ8A 4IQGA 3PDJA 2ZB3A 1HE2A 1W4ZA 1XCBA 2E37A 4W82A 4BNGA 1Z75A 3PIDA 3DAFA 3S2EA 4YDRA 1XYGA 3ONDA 3AOEA 5A06A 4YA6A 4ZA2A 5A9SB 5I7FA 3ROKA 3PRJA 1I01A 5EQDA 4IXTA 3N58A 2EKQA 3ASVA 2C7VA 3GVCA 3MTGA 4ZQEA 1A4UA 2X6TA 3PHHA 3FR7A 4GSKA 3RCBA 4E30A 1QSGA 4A0SA 2X4GA 3D5TA 1KETA 3JYPA 1Y8QA 4Z9FA 3MJVA 4W9NC 1D1SA 1J4AA 2XXJA 1N9GA 3DBVO 2PFGA 4MDHA 2V7PA 2YYYA 1E1NA 4CUJA 4DQVA 2DQ4A 3HWRA 4G65A 3E9NA 3LF1A 2LDXA 1EUCA 2LDBA 2IYOA 3JQBA 4BNKA 1JWBB 2IXBA 3UW3A 3ZGYA 1RM3A 1Z74A 5L4LA 2RBEA 1U5AA 1GAEO 4JBHA 1FDWA 3D7LA 3NKLA 3BTVA 5A9SA 3LU1A 3K2EA 2AA3A 1A4IA 3PLNA 5I9LA 1IL0A 2JHGA 3EHEA 3PWSA 2O23A 2XF8A 3AM4A 4TVOA 5IDXA 2DBRA 4FC6A 2VTEA 2Y99A 1ZCJA 5I9MA 2HMWA 1NFQA 5FI5A 4FB5A 5CPFA 1KVTA 4XRGA 2A94A 3QVOA 4PLGA 3ZNOA 4UUOA 5JY1A 2JCYA 1LDGA 4NU6A 4PLYA 2DFVA 2A35A 2J5RA 5A05A 2GN9A 3PYXA 2GUGA 5AXDA 1M6WA 1Z7BA 4CM8A 3PGJA 1KVSA 3UGKA 4Z6KA 3UAGA 5KWEA 1A72A 3TFOA 1HZZA 1YDWA 2FRDA 1HE3A 3QVXA 5CEFA 1E3WA 4I8XA 1EBUA 3H6KA 3T7EA 3ZU5A 3DAPA 1P44A 4TZTA 5JSFA 4AG3A 3D5QA 4E21A 1E1MA 1HLDA 5L51A 4XGNA 4L9RA 4CQLB 3W4IA 1T2DA 2A4KA 2NTJA 1GQYA 4RF5A 2A9FA 1HSZA 2GERA 1HYEA 2JD2A 4XDZA 2B37A 2EGGA 2ILTA 5EMHA 1MV8A 2NNLD 1Q0HA 1IHXA 4XWYA 4HFRA 3GVXA 1MG5A 4R1SA 2POQX 3IDSA 2NACA 4OH1A 2GGSA 2EEZA 4WLOA 2IZ0A 3OETA 5BNIA 3BMOB 4BQPA 2DU8A 3IKVA 2VZ9A 2B35A 4O0LA 3ST7A 1NWHA 2CDAA 4NDNE 2Y67A 4ND2A 3KYCA 2OFPA 2J6IA 5U1PA 1UUFA 1C0LA 1E1KA 3F47A 2JCVA 5HBRA 3RD5A 3RJ9A 2Q4EA 3ZV3A 2W2KA 4XEHA 4D3FA 4B4OA 2ZTMA 1T1RA 1U8XX 1NM5A 1OFGA 2EXXA 5BR7A 1QXSA 1RPNA 2OGUA 3S55A 4FW8A 1U7TA 3ZWOA 4MKZA 2J5KA 4UREA 1X7GA 1YB4A 4J4BA 2C7GA 3MJEA 4NJOA 1NTOA 4DIOA 1BXGA 2GZ1A 4YQZA 5I7EA 5KOIA 1UAYA 2UV8A 3RC7A 4AJIA 3UOGA 1DC6A 3ULKA 3AK4A 3DO5A 4AJNA 2YUTA 3TZKA 2B4RO 2BFMA 5TT0A 1XLTA 3SVTA 2HDHA 4MVJD 1B15A 4M8SA 4B8WA 2ZB8A 4W9NA 2VYNA 1PQUA 3RQSA 1WXDA 6ADHA 4WLFA 2Y1GA 4GX0A 5AOVA 3FNEA 2W4QA 4YCAA 4MP3A 4QO7A 1GEGA 4WK6A 4YXFA 3QWBA 3GDOA 1IPEA 1H6BA 1EVYA 2PA3A 4RVDA 2DC1A 1KY4A 4KZPA 4EBFA 4KQWA 3B6ZA 2XAAA 4A7PA 3VHRA 4B7UA 1O5IA 4HV4A 1ARZA 1YDEA 5AVOA 3CEAA 4AJHA 1MGOA 3ANNA 3JSAA 1GYPA 2X9GA 4FJ0A 4GVXA 5F1KA 1ZEJA 3RFTA 1CF2O 2VCYA 2JL1A 3U9LA 5JCJA 4RLSA 3NT5A 4CMJA 3DHYA 4CV2A 1MP0A 1LDNA 1ZK3A 2CD9A 2NQ8A 2O48X 3GEDA 3GR6A 4R3NA 3ZCXA 4F6LA 1ISMA 5CDTA 3MJTA 4C7KA 3VAZA 1I2BA 2VOJA 1HDXA 4CMEC 3HZZA 5BQFA 4P4LA 4NNJA 2ZTVA 3A14A 3NT2A 4RVGA 5ER9A 2FMUA 4PIVA 2ZJ0A 1LNQA 2AG5A 4ZU3A 3DTTA 4ESOA 1Z6ZA 2FP4A 5IZ4A 3OECA 2GPTA 1N8KA 4GH5A 4UVEA 1YWGO 4YJFA 4DPMA 4W99A 1PZEA 4CMHA 4QQRA 4RV9A 4NBVA 3RU9A 3V2GA 3ZU4A 3KLPX 1E3IA 4L0QA 4NQZA 1SZJG 3ANLA 2NSDA 2VYND 1R4MA 3PHGA 4J90A 5JAMA 4N5NA 4JK3A 4PLCA 3RKRA 4ALJA 4BO8A 2Q46A 2B4TO 2HMSA 3GF4A 1ORRA 2NU7A 4KMSA 1E7QA 1A7KA 3OQBA 3L9XA 4I1IA 4R5HA 3KSDO 4CMAA 3NJ4A 1R4NB 5L45A 4GWKA 4F46A 4IJWA 2VUSA 2O3QA 1YGYA 3WQSB 1QYWA 2YHIA 1YQGA 5BSGA 2B5WA 4MVJE 1PQWA 1DFIA 3F5QA 3AFMA 3JQGA 1HWYA 3PTZA 4I5DA 4JJFA 1Q7BA 1W0CA 4MPDA 3GEGA 5T64A 3PZBA 1DC5A 1KC1A 1PR3A 2J5QA 5FWNA 2XOXA 1MG0A 1ZBQA 1JW9B 2CSUA 4Q3DA 4RZHA 4XKJA 3PYMA 1CQIA 5F1PA 4M86A 1F17A 4I5FA 4YPOA 2P9CA 1PL8A 3DBLA 4XQGA 5I8ZA 2CY0A 3RUAA 4X54A 4TVBA 1IPFA 4YEDA 1DXYA 4J9UE 3JD4A 3KZVA 3QVWA 5HS6A 3AY6A 3PHJA 2E82A 3UCEA 3ZWNA 4XCVA 4HBGA 4BL5A 2G0TA 1T4BA 4H16A 5DCUA 3JD2A 3JYQA 3PP8A 1H6AA 2EG9A 5U9CA 5B4UA 1J6UA 3L77A 4Y6SA 5GZ6A 4WEOA 1O89A 1ZSYA 1KBZA 2Y1DA 1ZUD1 3OF2A 1YOVB 1EUZA 4WJZA 3IP1A 1J49A 1VKOA 2GR9A 4JX8A 3H9EO 1X0VA 1NAIA 5B1YA 3PJDA 3F3SA 4O1MA 3WTBA 1RM0A 1V35A 4PFJA 1ISJA 4P4GA 1C1DB 2Q1UA 4RDIA 3BHIA 2CZCA 4DUPA 3AWDA 4P4NA 2RIRA 4J49A 3O26A 3RBVA 3NX4A 4BIIA 2HRBA 3RSHA 2Y1EA 4FOSA 5CFZA 1EMDA 1C0IA 3ZH2A 2PKQO 4B3IA 1Z45A 2HK8A 1SPXA 4H15A 3DMTC 3B1FA 1NQAO 4PG4A 4GWGA 4BNNA 5DT9A 4XYEA 2IRWA 1PWXA 4BMSA 2AQ8A 1TI7A 1V3VA 4E2WA 4CMEA 1LDEA 2O3UA 4J3FA 1YOVA 1EEHA 3GHYA 1SNYA 4L4SA 4W7IA 4GX2A 2WYWA 5DP1A 1HDZA 2HRZA 2EP5A 3I4FA 1EK5A 3KYDB 3PGXA 2VZ0A 4IINA 5CG1A 1L1FA 5THQA 3VOSA 1E7MA 2YQ4A 1PS9A 2ZTLA 4E2YA 1Q0LA 3ORFA 4IMPA 1C1DA 3VVBA 1JLLA 1KIFA 5F5LA 3V1TC 5AQ1A 1A9YA 1BMDA 1GQQA 2VWQA 4YJGB 1C0KA 1YQDA 5JBIA 1PZHA 4QXMA 3G1TA 1W73A 2WWRA 1XHLA 4FQ8A 4TSKA 5HTOA 4DREA 3GFBA 1I8TA 3MJCA 1E3SA 3WTCA 3H5NA 2Q1SA 4U6SA 1V3UA 2H1SA 1NPYA 3H65A 2PNFA 3PJFA 5K6AC 1GFSA 1QRRA 4C7JA 2UDPA 2PV7A 3IS3A 1SEPA 1FDTA 3GY0A 1S7CA 3WB9A 5L7WA 1RYEA 3HB4X 3GGOA 1OMOA 3X2FA 5C7IO 2FPIA 3KYDA 3H3FA 5B4VA 1XG5A 3DONA 5BT9A 4CR7A 1QORA 4FC7A 2AE1A 4NBUA 4YWJA 2CF5A 7ADHA 3P2YA 4GL4A 3ZHXA 2JFHA 1WLYA 5A04A 2DBZA 2B4QA 3K73O 3UHAA 3ZWBA 1UZMA 5CDYA 2YZ7A 1IULA 4JQCA 3PZRA 1ISGA 4E5YA 1B8PA 2Y1CA 1XDWA 1ML3A 2TMGA 3SX2A 5ILOA 1WWKA 2I76A 5FFFA 1GUYA 3GA0A 1BWSA 1HSOA 1CYDA 3VPSA 1HEUA 3I23A 2AE2A 4D3SA 2FPGA 1NVGA 4ZD6A 5EJ2A 3DOOA 4BNWA 2DVMA 5CHEA 1D8AA 2WYVA 1LLCA 1VSUA 2O3TA 1R66A 2BGMA 4M55A 2IEDA 4ID9A 3ZN2A 4H7PA 3FN4A 5KJCA 3FTNA 3H5RA 1IB6A 4LGVA 1X15A 2PD4A 5I9NA 2VZ8A 4N5MA 4RF2A 5KJ6A 1YQXA 4QFCA 3LSYA 1CEQA 2I3GA 1L7EA 3TL2A 3QSGA 3FR8A 1T2FA 3WWZA 2GNAA 1UXHA 1IE3A 2EKLA 4KDEA 3GNTA 3SEFA 3OEWA 4HX5A 3FHLA 3NRCA 3FPCA 1YKFA 4E32A 1WDMA 1MC4A 3GRPA 1BGVA 3HN7A 3A06A 3U4DA 4BO0A 1DSSG 1IOLA 4DWVA 3JQ9C 4N18A 3ROPA 4E13A 3PEFA 1WMAA 4BNHA 2NU6A 2I65A 3GH3A 4RVHA 3RVDA 2R6JA 1DRWA 4NG5A 1K89A 1NWCA 1SOVA 4PLPA 1OC2A 1WMBA 2ZYGA 3DMTA 3MWDB 5MGBA 2DBVO 3RFVA 5L4NA 2VHVA 4DPKA 3E48A 3I9OA 1XU9A 4YYZA 1ULSA 1DHRA 4OHUA 1QV7A 5COAA 4BNLA 4LVUA 2NVUA 2EIHA 5H81A 3FBTA 4G5HA 4RORA 1H9BA 4Y6PA 4L76A 2P2SA 5T67A 4JCOA 5KVVA 4II3A 2CDCA 1ZZEA 2OUIA 4D79A 2P9EA 3W8FA 3VDQA 5IG2A 3GEMA 2IYPA 1UZNA 1NXQA 3BMNA 3RUFA 3MEQA 4XYBA 5IDWA 1NAHA 1NNUA 1D3AA 2OP1A 1GV1A 1MC5A 3OJFA 4J4TA 4J9VA 2WD7B 3RIHA 3LT2A 3PFWO 4GVLA 1GPJA 4NK4A 3SLKA 3NT4A 2QRKA 1HDOA 3F4LA 3NV9A 4UVIA 3U3XA 4UVGA 3B1JA 1IZ0A 1NHWA 1V8BA 2ZATA 3ENKA 3L6EA 1QYCA 3CTMA 1ZNQO 1ZMTA 1DAPA 4YACA 5I8WA 2PY6A 1NBOA 3B70A 5B37A 4CLRA 1XELA 5BNFA 3G79A 3ZU2A 5G4KB 1X7DA 5K6AA 4E5KA 3C7DB 1QG6A 3COSA 2X0JA 3TFQA 2QYSA 3AUTA 4BNTA 4WCFB 1RJWA 1FJHA 3JQAB 3E8XA 2Z1MA 3WDSA 3WQRA 4PLFA 2X0RA 5AYVA 4XJSA 1P3DA 1GR0A 5TIIA 3IUPA 4KUGA 3I9KA 3L4BC 2NTNA 4GMGA 1P33A 4CV1A 1PS0A 3RBZA 2FZEA 3F1LA 4OM8A 5T8KC 3INGA 1P45A 4PZDA 2CVZA 1BW9B 4WPGA 2WD8A 4B8ZA 2DAPA 5FF9A 1OOEA 4MVJI 2JJYA 4IJUA 1TEHA 5EPOA 4Z0PA 1X13A 4DRYA 3C1OA 4ZN6A 1I3LA 1TXGA 3EDMA 1ZSVA 3CZMA 1GCOA 4D44A 4RVUA 2W2LD 4BB6A 1ID1A 3ROQA 1BTOA 4BB5A 3K92A 1I24A 4AJJA 3NTOA 2UUPA 4ALLA 1VL8A 2EW2A 4KWHA 5JAIA 1PJQA 4LCJA 2D8AA 2P5YA 4BGEA 1AXEA 4DXHA 4QEDA 3GDGA 4G81A 5F3RA 4BQRA 5G0SA 4EUHA 2YQ5A 3IKTA 1JKFA 3DMYA 4II2A 1O6ZA 3HB5X 2YDXA 3Q11A 3S8MA 1N9GB 1DRUA 5ICSA 3LK7A 3OM9A 3ZWYA 4YAKA 4OXYA 3Q6IA 4M87A 3O03A 1GYQA 4XGKA 4TKLA 4OQZA 2HO5A 3EC7A 3JQ9A 5A3VA 5L7TA 3DBHA 1D1TA 2JAHA 1N7GA 4I5EA 1NR1A 1GL3A 3ZHZA 2HQ1A 4FOOA 3I4CA 5JLAA 4CV0A 1U2GA 4IQ8A 3LT0A 4BO7A 1LEHA 2C0CA 2QRJA 2JD1A 2VYVD 1Z7EA 5FYDA 5A03A 1T24A 2CNBA 2JFFA 1F0YA 1ENZA 4K26A 4PVDA 1X0XA 3GVHA 3IMFA 3WSVA 2OBYA 3SBOA 4OYRA 4N7RA 4BNVA 3KSZO 4UEJA 4QT0A 1IUKA 3I9NA 4CM8B 4NR0A 4RLHA 1B7GO 4FPXA 3I3OA 3TJRA 1XWFA 3OQ6A 4XQ9A 3WGOA 1E92A 1L7DA 3JQAD 4K6CA 1E3WB 4L75A 3NTRA 4WLUA 5ER6A 4RCVA 4FD3A 5ES3A 3BAZA 3O4RA 4FR5A 4E5PA 1E77A 2GRAA 4MKXA 4H3VA 3W8EA 3K30A 2VWGA 4EJ6A 3W6ZA 3OIFA 2HMVA 3WGYA 3R3JA 2O50A 2UAGA 3JQ7A 1DPGA 3BHJA 1P1JA 1Y9AA 1QV6A 3PQFA 4NFSA 1QP8A 1LBEA 3KB6A 2Q50A 1LRJA 1CETA 1YB1A 1ZK2A 3QW2A 4TWRA 2W90A 4N54A 5KTKA 3I9MA 4UVDA 1RM4A 3FI9A 1LU9A 4GX1A 2D5CA 3L4BA 3LT4A 1YL7A 5ITVA 5DN9A 5IN4A 1LC3A 4WOKA 5DOZA 3WGQA 2QRLA 1BDBA 1F8FA 5T8KA 3PWZA 1ZH8A 5LC1A 1FDUA 1P0CA 2B36A 4BGUA 3KYCB 2OOSA 4OGWA 4PGFA 1AHIA 4PG8A 1WZEA 3E18A 4ALKA 1RYDA 2C54A 5DCWA 5BSEA 2FPPA 3DFUA 1DRVA 4ITUA 4CM9A 2NWQA 3GVIA 2W2KB 1SB8A 4RPKA 1MA0A 1Z82A 4IZHA 5IFLA 5G4LA 4IIVA 5ENVA 4WNIA 2VT3A 4U7WA 1MUUA 5JAQA 3K8ZA 1DFGA 3CINA 1NVTA 3HQ4O 3B20A 2ZB4A 3AM5A 4D0RA 3AM3A 3U4HA 1BXGB 1EVJA 2SCUA 3HDQA 1EQUA 4FGWA 4XD2A 1XSEA 1A27A 4KOAA 2D0IA 4E31A 4FIZA 3K6JA 4AJKA 1EFLA 2OXIA 1JWAB 1DHTA 3ZNPA 3EY4A 1H5QA 4DA9A 1DIRA 1WNTA 1HDCA 4E3ZA 2I5PO 3AOGA 1NQ5A 2JKVA 3JYLA 4DMMA 1DOHA 1N2SA 2O3JA 1ZJZA 3W4JA 4JBIA 3B1KA 3FCOA 3NUGA 1CWUA 4GMFA 1DC4A 3INTA 2V6GA 2R2GA 1QYDA 4IDAA 3ZW8A 4UEOA 3VZQA 4Y67A 3DDNA 1KYQA 1EE2A 4E4YA 4TZKA 1DJNA 5KKCA 3KEOA 4NIMA 4K1LA 3ZZNA 3CE6A 5L4SA 3UKOA 3Q2IA 1KVUA 2WMDA 3BHMA 4K28A 2C2YA 3OJEA 3SLGA 3E5RA 5JYDA 1W6UA 1NVMB 3E1KA 2DT5A 2RH8A 3MJ4A 1UP7A 5T57A 1VE9A 3SJ7A 4ZJUA 3QE3A 1OBFO 4LW8A 2JHFA 4D41A 5A9RA 3TRIA 3F1KA 3C85A 4QTZA 4RQUA 2ZCVA 4F3YA 1BXKA 1VJ1A 2OORA 2ZQZA 1AXGA 4Z3KA 2B83A 4E5NA 2BGKA 1J0XO 4GKVA 2PLAA 4LVCA 3ABIA 4OXNA 4CQMA 4Y8VA 1PJSA 1LSUA 4YJHA 1KERA 4DC0A 2IEBA 3P7MA 3H9QA 3Q1LA 4U0KA 1R0LA 2HU2A 3BTOA 1PX0A 3ITDA 3JQCA 1XA0A 1UXGA 4JJIA 1Y5RA 3G0OA 3QWIA 4YJFB 1FK8A 2BHLA 3EZYA 3L9WA 3L6DA 4JN6B 3N74A 4XA8A 5GY7A 3KVOA 3PLRA 4AJ4A 4BO1A 5IXSA 3QHAA 5EERA 3GZNA 2GYYA 2GZ2A 3BXXA 1R4MB 3OIDA 1B3RA 1T26A 2BF7A 2Q99A 3ZV5A 4NBTA 1TB4A 1P74A 3K2BA 4YT8A 4RPGA 4B3JA 1C0PA 2W8ZA 1UP4A 3CKYA 2XXBA 5EINA 2HK7A 3WLFA 3WG9A 3WYEA 3JQDA 3D0OA 3R6DA 1O95A 2X7HA 2P5UA 4PRLA 5TSDA 5A4DA 3AJRA 1PJTA 1HYGA 3BZUA 4ZGWA 4BGVA 2YHIB 4BOYA 1NASA 2I99A 3EW7A 3TSCA 1DIBA 2C29D 4UAGA 3LC2O 4XRRA 2FSSA 3KXDA 3JQGB 4MIEA 4MP8A 1M67A 4Y6RA 2VHXA 1B0AA 4BHTA 1VL0A 5C3MA 2HMTA 4EI2A 4XIYA 5HA5A 4YT4A 4Z3DA 3JYNA 3OA2A 4ZQFA 4AICA 3F6YA 3QA9A 3E82A 3LYLA 3DBLB 1YJQA 3KETA 4KDFA 2WM3A 4Z0HO 5KKAA 1KS9A 3H3JA 4J0FA 3ZWMA 4B7CA 4HUJA 1AHHA 4DMLA 2PK3A 3PHLA 4CJXA 3G1UA 1LSSA 4R9RA 2OBNA 4IQ0A
chains in the Genus database with same CATH superfamily
1E7WA 1RYMA 4HDSB 3NASA 3MUOA 1VJTA 3EGDA 4EF4A 3O84A 3AF6A 5COQA 4YDSA 2BTOA 2Y0CA 3LIPA 4OV6B 3S8EA 5EUCA 3T5AA 3U44B 2P90A 1OWLA 1N7IA 1VE7A 3B7PA 3SS9X 5IC4A 1QH1A 2IP1A 5T3YA 1X1AA 3O9ZA 1C4KA 3O1HB 5FYQA 3VH2A 2GJSA 4A5OA 1TTPB 1V5GA 3LVBA 4AYTA 2IA5A 4AY6A 2MWMA 4I2NA 2WP0A 4FE4A 4BKQA 3THWA 4RPHA 4GGOA 2G70A 2QAGC 1XA4A 3GD5A 1RAHA 2VJBA 4TTVA 4B33A 1GEEA 2Y1WA 5EZ6B 3FJ1A 4FEEA 5LMZA 3IEVA 3DR3A 4IGAA 3ZI0A 4BXOA 3SLRA 2O0HA 1KKUA 1Z5WA 5DTIA 3CO0S 3WE7A 3BK7A 1MA3A 1VLLA 2IDZA 4QFBA 3RG2A 4DB4A 4KO3S 3TMKA 4KR6A 4E1VA 1CQJA 1RBQA 1A2QA 1TC1A 4OHVA 1L7RA 4MVJP 2E4AA 3CX7A 5C1IA 3JD3A 2I8LA 4DJAA 4B82A 4PZCA 3LE8A 5INTA 2GWRA 3DHEA 1P1KA 3G3EA 4ENUA 1FZTA 3R0IA 4PRKA 2QD4A 1TK3A 5FX2A 4M1TA 1ISIA 5A7GA 2GN0A 2NV6A 3LNTA 4RVFA 4ZCLA 4A8PA 3RRXA 2BFAA 1CUUA 1CX9B 3W9BA 3ZU3A 1DTWB 1X2BA 1Z28A 1M3SA 3FMOB 3I76A 1EHIA 1R9JA 4LG1A 4Y0AA 3TBKA 4EF5A 3STWA 4L28A 4JQYA 4DZRA 4F4IA 1MAUA 3KPUA 421PA 2C3PA 3RTDA 3ZXUB 2HJRA 2WR8A 4RKFA 1EFKA 4KP7A 4DRXB 5JZMA 1PX2A 4DG5A 3I9JA 4EO9A 3E3LA 1FMCA 2CJPA 2H29A 4KGZA 1L7BA 4QJIA 2GBPA 2R8OA 1ZMRA 4G23A 4BWVA 4ZHSA 3W5VA 5MHTA 1C3OA 5DNVA 1KMQA 4FGSA 2CL0X 4FFOA 4H35A 4NL4H 1UWCA 3CO5A 3M5CA 3PD1A 5CIQA 5B3AA 3VO8A 2G77B 3WL5A 2UVQA 5IAOA 1GDHA 2EP7A 1YHZA 5EUBA 3ISTA 4JT4A 1ZKMA 3V6LA 2X15A 3JZMA 3NO4A 5FAXA 2IW3A 1A82A 3O8NA 3QI2A 2GZHA 1Y9EA 1WPRA 2XUHA 4KODA 4ZYZA 2JEYA 4D9HA 4Z7NB 1SKQA 4YUWA 4RULA 1QGYA 3FYUB 1QIHA 3CMCO 4ZVOA 3VR4H 1LUAA 1VBMA 1IZ8A 2GJ9A 2EVWX 3N6VA 2JATA 4HEQA 2BEUA 4IEIA 5FLKA 5PGMA 2ID4A 3AEYA 3I6MA 1EFDN 2H2HA 1QQ5A 1Y7TA 4Z99A 3H5AA 4Z0NA 3VNSA 5CFOA 4WINA 3AJ9A 3U3OA 4J1NA 2FPIB 3ZWXA 1PYOA 2O1EA 3VOBA 3PEYA 1WDLA 4OXKA 1KFJB 1G8JA 5C2JB 1O6GA 2PSHA 2TMDA 3KLNA 4CHGA 2OECA 1WAMA 4INPA 2YZ2A 1GL7A 4TMKA 4U7FA 3NDJA 4JJZA 4YONB 2NO5A 1V48A 4B9EA 3LX5A 3NHRA 1E8DA 1Q22A 2VDPB 2W6ZA 3I04A 1X80A 4KFRA 4D42A 1EPUA 2GI4A 3R5FA 3TFWA 2WWXA 3FDJA 2QAIA 2BFPA 2YIMA 2XCQA 3W0LB 2GEDA 2JJ2A 3P27A 1WW8A 3DWEX 4M3NA 3TZ6A 7ABPA 5JIBA 2FPKA 3CT6A 1QO0D 2PJZA 4FUTA 5FHRA 3T35A 3FF4A 5JV5A 1KARA 4ROTA 4URXR 2V7TA 2C7OA 2D3TA 1Q1ZA 1YDFA 5U4QA 3Q0IA 1YSCA 1ZVKA 4Y9TA 2C9OA 2QVZX 2WZQA 3LM8A 3VO2A 3W05A 4JOCA 4LYHA 3EGIA 2NXEA 2J9FB 2OP0A 4NJMA 3QITA 2NUBA 2ID8A 1BU5A 4RGBA 2F9FA 1O8CA 2NXNA 2PZMA 3D1VA 1NP3A 1GU7A 1TZKA 3OZUA 4L6IA 3USZA 5HWSA 3FFTA 2C7QA 4L4RA 3TZEA 3I1FA 3KQPA 2D1QA 5B55A 2VL7A 2GTIA 1QG2A 1THGA 2G9QA 4HRAA 4IKOA 4GZ3A 1UXIA 1GA4A 1H42A 4JMPA 4C5BA 1Y3FE 4JA2A 3KK0A 2FPSA 1JIQA 2BF4A 3K05A 5DBGA 1D7AA 1LVUA 5KYUA 2QTHA 4ZALA 1RRGA 5CM2Z 1F7VA 2Q3LA 5AM0A 2PQ2A 2IHUA 1R7RA 3LXMA 4FHCA 4HPWA 2G5PA 3RUHA 2H4XA 2QTTA 3WZLA 5JCZA 2Q2WA 2YVUA 3L8GA 2O7QA 3LRTA 5T3UA 5FLYA 4CCSA 3KM0A 9LDTA 1KQOA 2NZ2A 4YRRA 1A77A 1P77A 1P2GA 7AT1A 4OBBA 1IWBB 1NTRA 1XMXA 1QB8A 4NYJR 5FBHA 4ACAA 4H7EA 2VAWA 2D7JA 3ONFA 4PXSA 5BR1A 4UTOA 3VPHA 3OICA 4B6QA 3K9FC 4LFAB 4FKBA 4NTZA 3IBSA 1ZMXA 1QOQB 5KOJA 1WB6A 1XTKA 2WUDA 3IMEA 2YZKA 3F7TA 4WN3A 2GPNA 3S7ZA 4A8JC 3K0FB 1US8B 4IOJA 3SXUA 2D1TA 3RSFA 3LDHA 3PE3A 2IOHA 3GQBA 2CFSA 5B7GA 1ADYA 4EI8A 2R7AA 4PHHA 2RHCA 4HJXA 2PXCA 4GM0A 3RQIA 2CJWA 2XUGA 1W4AA 2NZYA 1R0RE 5AVSA 3TSAA 4AMBA 3U09A 1JSRA 2QM0A 4R0NA 3JS5A 1MORA 2Z4TA 3HKCA 2ZSHA 2I7XA 4IUCS 3KYJB 3T12A 1UJMA 1SXJB 2RKWA 1QU3A 1SQ5A 2YY7A 3KT0A 4ZO7A 3GUUA 4X64B 4OIMA 1YACA 2FLVA 3ZDDA 1KSHA 1ENPA 4EFMA 4EKYA 5IAJA 1V1RB 2BELA 2HF7A 4Q3AA 4OMUA 5CRIA 3A05A 1WX1A 5DFAA 4KREA 1FXUA 2GN4A 2XD9A 4X8LA 3RANA 2R85A 1LRLA 3RC9A 1FP6A 5JZBA 3LCRA 2ODBA 3BD8A 2E0IA 3STXA 4EB6A 2QK4A 1ENOA 3ES9A 3LOPA 5DM1A 3G7NA 5G0VA 3VZRA 1PQYA 1QNFA 2BL4A 1NI4B 3MJDA 3ZNNA 1W35A 1WXFA 2MDTA 4HCJA 4YR9A 2ZT8A 3ZV4A 5SY9A 2QL6A 2XV1A 3P2EA 3C15C 4ZVQA 2E18A 4DW8A 4MROA 1TZJA 1B8UA 1QO9A 2CDBA 3GZ4A 4TT3A 4Q9HA 1QS0B 1Y1PA 4CLRB 4YUXA 5FFMA 3CVWA 1RXIA 4FJ1A 1P2UA 1NW9B 5CA0B 4Z53A 1YO6A 2AKEA 1XTUA 3D3JA 3ZG6A 3QIVA 3AR6A 5FBKA 4C76A 1QP4A 3DUFB 2YMLA 3EXIB 4N3BA 4ZU6X 5J40A 5DNCA 4JLNA 3UH1A 1Y9ZA 3N8DA 1M1YB 1PHRA 4QLBA 1W5EA 1RACA 4R84A 5F98A 3DEZA 3QXGA 5BUQA 3IAM1 3AR3A 3OI7A 3A7EA 1EZ1A 3I0MA 2O3RA 3HFSA 1EWTA 4M1OA 3TOXA 2I03A 5G1PA 3JQFC 1PR0A 3EFBA 4ILEA 4X97A 4DIBA 2HCJB 1EDEA 1XR3A 1YCFA 2X2FA 4OTZA 5DNEA 1OV6A 2CCJA 5JO9A 1EFRD 1KR2A 3SHFA 1DQNA 2JLXA 1RJ9A 2HNKA 1EM8A 4KFCA 4HRVA 2B30A 2BE9A 1UDRA 2PD6A 3QU5A 3R40A 3RJZA 2G67A 1G0OA 5JS7A 3BH6A 3WADA 3OO0A 3AL0C 4CM5A 2I6GA 1DBWA 1I2DA 2CUKA 4M76B 2HAEA 3EZ9A 3PNOA 4IWNA 1YQQA 4AK9A 3BD6A 3LLVA 5FJIA 1ZPDA 4BMPB 3O2NA 5K0ZA 4FGKA 4N6NA 2OCDA 4NMXB 4E15A 3EG5A 1XKTA 4J03A 2XJ9A 1HNXB 1LKZA 1VL6A 2PH7A 1P1RA 5JSZB 3OTWA 3IAUA 5JYEA 4LV6A 3U4QB 3QKRB 3DC2A 1QH8B 4OQNA 4ZTZB 1MX1A 3EAQA 2PJRA 3F49S 1PTJC 4NV3A 1T0JB 5TF0A 4F4CA 4ZXPA 3RE1A 1JQAA 2PZFA 2X1VA 1YVEI 1TJ5A 2J3MA 4TMWA 4XOUA 5ICMA 5LQCA 3FAZA 4F8EA 4ILKA 1X7HA 5FQNA 3SXPA 3IVAA 3WK8A 4ZANA 3KUXA 1MVLA 4MR8B 4Y7CA 2Q6IA 1OB2A 3ZZ0A 1IWPB 2FWPA 1Z29A 4PZLA 5GADl 2ZJBA 4X5OA 5DM4A 1EGHA 2BLLA 2HYDA 5K5EA 1KKMA 2HCBA 2PGLA 1E5QA 1V1MA 3HY3A 2WY2D 1UQUA 2FP3A 4XWAA 1K0UA 2VH2A 1QLWA 4OJTA 2QDXA 4ALIA 5EY5B 4FDAA 2CVOA 4I2VA 3NBMA 4KPFC 3GRVA 3PDIB 4P83A 2X2OA 2Q6LA 2IKSA 1IY8A 1FNSA 1O96B 4HNHA 3WGNA 4OL0A 2Q6VA 5A2GA 5C8YB 5IZCC 4DCTA 1DMSA 3NV7A 4L51A 3PE4A 5GONF 3CISA 4KBGA 2CUTA 2RHRA 2ZE8A 4FKZA 4WZAA 2ODNA 1LXCA 1ZVMA 3LHFA 5JHGB 1XVAA 3AEZA 3D6FA 4D9JA 1CHDA 4U7DA 4CF5A 3NTLA 2J4FA 4XB1A 2FZ4A 4UBNA 1HGXA 4KDRA 1YA8A 2BGLA 4QFDA 1O3YA 4NBWA 5DSTA 3VPAA 1L7VC 1HRDA 2CBXA 2VXOA 1ZUHA 2XKJE 3CLRC 1F6WA 1NI5A 5EHQA 4F85A 1GV0A 1S1CA 4NAHA 1U8AA 2CN1A 1QK5A 2ZBRA 4J0GA 1EUYA 1F4PA 1EWVA 4UCWA 1D7OA 1NDUA 5IK2A 3N53A 3USCS 5JXGA 1DKPA 2FZ5A 1K7FB 2XCUA 3L0BA 2MT9A 2YVAA 4KSYA 4TQUS 2P6RA 2RGXA 5K2OA 4PCVA 2IYAA 3GDFA 1GPMA 4EEXA 3FRIA 4HB0A 1I3KA 1OW3B 2W4MA 5EC8A 4DIDA 2QI9F 3AJ8A 1Z12A 5KYKA 2EX0A 1D0VA 1QRDA 2QGNA 2ZVDA 2PSSA 4IVPA 1E6LA 1QGAA 2LZ0A 1Q0QA 3WR5A 2DUJA 2UZ0A 4BWGA 2C42A 5EJ4A 1YRWA 1UR5A 5TT1A 4L57A 1GTVA 2OK7A 1I0IA 3D8NA 3MCZA 2HIHA 1V7ZA 5IH7A 4Q18A 4GLBA 1ZXBA 3Q0TA 5EESA 2K2QB 1NVVR 1E79D 4MQFB 4BJHB 2XCRB 3GBSA 4RF3A 2PS3A 1BKSB 5EHIA 4UBLA 4UM9B 4UTNA 3LUCA 1NJ1A 4J2OA 5AKXA 1C9JA 1NA5A 3BIXA 3CH4B 2V7XA 2CLDX 3M81A 3OPMA 4HFMA 4JGIA 4PAWA 1JHQA 5AUOB 2Z98A 5BV7A 2DKNA 4MTLA 2IXDA 5D7BA 1JXMA 2QF7A 3KEMA 3CNNA 3G9ZA 3RODA 3SSOA 4N65A 5I4BA 2X58A 4J0QA 1ITZA 5BR8B 1YVUA 3LKDA 4QUAA 2NUAA 2VF7A 4QXQA 4HP8A 3H8VA 2V5VA 2V65A 1SB9A 4WN9B 5DDIP 5MN4A 5DEIA 1YONA 1XEAA 1Y7IA 4WD3A 3NGXA 4RTQA 1VHQA 2JI7A 5DHSA 2A7QA 4XPIB 5EOVA 4ZQCB 3V55A 4F8YA 5HK9A 1E58A 1LS6A 1M8KA 2AOVA 2IYUA 2XYGA 5JJKA 4GZMA 4TXLA 3G88A 2PUHA 3N3AC 1HTTA 5KNDA 1Z6TA 5KMGA 2EP8A 2YV2A 4BNUA 4F7WA 1Y1KE 1I1OA 3IQEA 5HGXA 4HWOA 1GPNA 1UBLS 1VTKA 2QGFA 2WINI 1QFYA 3PC2A 4NE2A 4B3FX 2YJGA 4ARAA 4Q1CA 2DHDA 1H6CA 2K5UA 3G49A 3I6ZA 2ZSUA 3KZXA 4JLWA 3RTBA 3SFVA 5BPHA 5KCZA 5L9AA 2CXHA 3I9FA 4JD5A 1ZWLA 4IDBA 4C7OB 4C3ZA 3ZS9A 2JFPA 1X2EA 4FU0A 1LJ8A 4D2IA 2R2AA 2E5LB 3VQTA 4ND4A 4AJ1A 3UMYA 3LJKA 3PFFA 1R0SA 3G7UA 4Y9UA 2VAMA 4DY4A 1U3DA 3GCDA 2ATIA 3DOFA 5ETJA 1T4MA 2X86A 4C4OA 1RHQA 4F5ZA 2V74B 4PGMA 3WXBA 1ZA1A 2D4AA 5KDLA 1PFWA 3G8AA 3TX2A 4FGJA 2TSYB 3U31A 4BKUA 5JTUA 3NCTA 1L8AA 3I8XA 2FSPA 4MGZR 5LZ2A 1NUPA 3GLHA 1NE2A 1E1LA 1W34A 4TRRA 2WTMA 1FPQA 4IGKA 4ZZ1A 2J85A 4JJ8A 3EVTA 4JVLA 4Y18A 2C07A 2MSEB 4PLVA 1L5SA 3SKVA 4CM3A 1V71A 2I54A 3H7AA 4O59O 1HC7A 2WYOA 3PSHA 4GHWA 5BW5A 4GS5A 4UD2A 3OMLA 1DWQA 2AHRA 1ZY2A 3TVDA 4X9XA 4QNMA 2YKGA 5KYTA 5JANA 2H7CA 2HKIA 2IBTA 3I45A 3ND5A 3UQZA 1WZNA 2WUVA 1Q77A 3OT5A 4LY9A 4Z9AA 5F2NA 1I0ZA 1KAOA 1Z16A 4ZHQF 1ISFA 2XWPA 3CH7A 4X66B 1T2UA 2EL7A 4NS1A 1LW6E 3F5SA 2PZEA 1BS1A 2JW5A 3IIIA 2AMFA 2OPBA 2NMVA 4DJ5X 3PEWA 1WUJS 2WWTA 1M6YA 1Z26A 2LKDA 1HDGO 2QW8A 1VCOA 1P1FA 2L69A 2R86A 3HA3A 2NW6A 1B4DA 4OPMA 3QFTA 2ZJ1A 2BH9A 4LJ9A 4MKGA 1FQJA 1RXWA 1NFRA 1QPBA 1UDXA 3E9CA 4IG9A 5DLQC 2FFRA 2F59A 3OIGA 5JMPA 2WI8A 3VYUB 4TTSA 4GO1A 4HMQA 1YQTA 3CUKA 2FN3A 2REQB 3D7MA 3L1KA 4A03A 3AUAA 1C7FA 3ER6A 3QVSA 4FCTA 4MULA 4WEQA 4YP9A 2GLXA 4MS4A 2GN8A 1H2FA 4P3KA 4CR8A 3AVUA 2UU9B 2B1QA 4FBGA 2I4RA 3VR1A 3TQTA 4XYMA 1QLJA 3PQ2A 4MQBA 4BFWA 2C8JA 4MRAA 1O2DA 1XZFA 2I80A 4FYPA 4UJ5A 3TI7A 3OM8A 1MD9A 4G8JA 3GZNB 3U7RA 3UGTA 1AQYA 1YC2A 1D09A 3BFXA 4QNRA 1NOKA 2P4EA 2PDAA 5FNVF 2BD0A 3RJTA 4XGIA 5FJJA 3WKBA 4R54A 5HK8A 4BLPA 2G5CA 1OR8A 4I3GA 5FTJA 2QZSA 1GG8A 1U1FA 1A50B 2P9GA 2PO5A 1FDRA 3EZ2A 1QUEA 3KVYA 3L7OA 1L4UA 3BL6A 3X44A 3AEQA 3CLHA 3FLBA 4R1QA 3MB5A 2K87A 3GJTA 3Q9NA 3GAMA 1W87A 3GT4A 4D25A 3L8FA 1TIPA 2FLKA 1U3UA 4Y2XA 5ARBA 4CG3A 1NRWA 3JAWA 1TT7A 3ZQKA 4LXGA 2QLJA 2Y92A 3BE4A 2PMEA 4M7OA 4PO3X 5IVHA 4HZIA 2PSJA 5JFOA 3FWZA 4TN5A 1GPLA 2AS0A 2QIOA 4A9AA 1VA4A 2I2CA 4DGSA 3HE3A 3FDFA 4Y1RA 1TRKA 1K92A 3KV3O 3IAM6 3UJAA 1M54A 4TYQA 2ZJ5A 3OTQA 4YRNA 3IH5A 2O1SA 3EB9A 3ZDEA 3LTNC 3BMOA 3FD8A 1Z39A 4TWAA 3BE8A 1L4YA 3HL4A 4XIJA 1TYDE 4TMFA 2DFLA 4NMHA 4PX3A 1RXUA 1N2JA 1DPFA 2PKCA 1D2CA 2M2IA 1E1QA 2D13A 3EGVA 1M7HA 2P41A 4UPDA 3S2FA 5CB6A 4I4TF 4L15A 3HKBB 5FDFA 1WJGA 5AHXA 3QKUA 3VTFA 1GY8A 3WI7A 2FUKA 2V6IA 2P68A 4DKXA 1E6UA 1Q1GA 2J3KA 1XDBA 3GHHA 4QXPA 4JUDX 5TGTA 4EPTA 1X1BA 1Z0KA 4LMRA 3OOJA 2JDIA 2WV7A 1YB6A 1NJFA 4CLXA 2FG7C 2VYQA 3ITKA 5AT1A 4YV1A 1D4ZA 3HKDA 4L7QA 1YC5A 4E4TA 1BIFA 3ITNA 2JIRA 3DGEC 1DRJA 1JLHA 3I53A 3S3TA 1T8PA 2CLSA 4DR5B 1Z25A 2GKGA 2O7SA 3KLMX 1P5HA 1XRSB 4GRAA 1UEXC 2C59A 4RDHA 5IF3A 3H97A 5CXSA 4MUYA 1W5TA 4QSHA 1E0SA 1R27A 2BJVA 1IHUA 5BMOA 4I5GA 1POWA 1J97A 4N7JA 3VYWA 2QROA 3GIDA 4EX6A 1SCUB 1QH1B 4FS3A 3GN1A 1JALA 1S2NA 2VJNA 3LCCA 4EB8A 1L5QA 3QOWA 1IK4A 1CUZA 4MQLA 3DZJA 3SYTA 2CXQA 4F72A 5FWYA 1V5WA 3QE4A 1G5IA 3THWB 3RT1A 2C88A 1YFLA 1KBQA 1PV2A 2WM8A 4GQAA 1AU9A 2V55B 1BAPA 4WKBA 4KMOA 3HDGA 4BXOB 4DG9A 4E2FA 5HIKA 4AS2A 2BCGY 2HA6A 2PCJA 2QR3A 3NDPA 3LHKA 2FDCA 2KMLA 3HCCA 1CSEE 1UC5B 4ND8A 5KJEA 1CUEA 3HR4A 3D4PA 1HT1E 3AF4A 3E7XA 4IH9A 4PS0A 1CQJB 1E0DA 2QSUA 4PYLA 2B3TA 2AEJA 2AH5A 3BX1A 3PQ4A 4WXRA 3R7SA 3ZGZA 5G0WA 4WUVA 5JJLA 3GBPA 1X74A 5K4AA 1HNZB 1NVAA 2WJYA 1RI5A 3TBHA 5K1ZA 1IM8A 5JQWA 1AM4D 1MB4A 4QJ5A 3SEQA 4RK0A 1UPCA 3LOQA 3CUSA 1FFCA 2XCIA 4GXTA 5AXBA 3CKMA 1DIGA 2OMKA 2W2VA 4YAUA 3ELUA 1BNCA 2X8LA 4G63A 4BTLA 4BCBA 4CDGA 5TMBA 5ARCA 3Q3EA 3JAKA 4ZRDA 2A2ZA 4HT3B 1PS8A 4KCGA 1V7QA 3DFMA 1IN5A 3H04A 1M0TA 5C7LO 5LLTA 4LJ8A 2ZRAA 4IX1A 1ESCA 5KO2A 1DTSA 4PGAA 4BB9A 2I67A 1CZKA 2ZFUA 2OV3A 5HP4A 2L17A 4M6WA 5ICCA 3G5LA 2RAFA 4RSRA 3U40A 5FLXA 3WBBA 3Q8WA 2I34A 1C3OB 1Y6JA 1JHRA 1RTKA 2C9CA 3C6YA 1N3IA 1PNVA 1T0BA 2LP4Y 1G20E 3KJZA 3P9IA 4L74A 1M0SA 2ZBEA 5ALOA 3VNQA 5B12A 1Y9JA 2Y0EA 1FP7A 1ZO8A 2VAVA 1BE1A 5KI6A 4EG5A 3OE7D 1N5JA 2QX7A 4HZUA 4CMKA 5JSHA 3QBDA 1ULTA 3RADC 4JXKA 5CTJA 5AI4A 4PG5A 4TGLA 1DT5A 3NHYA 4QBTA 4F8JA 1JG6A 2WIGA 4LF5B 3H9CA 4ZO4A 1V3QE 3WP1B 5I6DA 5F3DA 4EQ6A 5JRZA 4KR2A 4GYYA 4KR9A 3KQQA 5AJTA 2W98A 1EAYA 1BOOA 1U0TA 2B1RA 2GX6A 3CLTD 1F14A 2XGSA 1YS6A 2BEUB 2BMAA 1CJVC 1H2HA 4IFIA 1NG9A 1HL3A 5EJIA 1KMIY 1ZG3A 4FILA 1SBNE 5DTEA 2CF6A 3P9QA 1FZQA 4ZVVA 2JFYA 5EJFA 1N5KA 1TE2A 5CNMA 2QU8A 4L3OA 4D99A 4OHBA 2V8BA 4UHCA 3LL7A 1VXOA 4S0XA 2YVQA 5F51A 5LBUA 4AO7A 5JD5A 5K8JB 4B3SB 3ACBA 4Q9KA 5HJ7A 1E64A 5BOVA 4D92A 1XD8A 4S1VA 2DWUA 3TQIA 5BN1A 1JYSA 4YJ2F 1JAXA 2WT8A 5GPBA 1VIYA 3D02A 4D8WA 3CB2A 2VHZA 3VKHA 4HWTA 2GAOA 1WRBA 4IIYA 4EHJA 3OTGA 1MLDA 1BE8A 4OQMA 3GEHA 1GNSA 3GCZA 4K6OA 4IG4A 3KUUA 4UHDA 1RYZA 3JRNA 3LPAA 1YDGA 3FF1A 4ZHQA 4KVGA 1CY0A 1OZ0A 3ZLJA 1F12A 1WCYA 2QRUA 3QNUA 1BYIA 4ZCTA 1FVFA 2YWEA 1ULUA 5KVCA 3E03A 3F3MA 1T36A 2DBQA 2ILVA 2VRCD 3L6UA 3LPLA 1B0PA 2O2DA 4CN8A 2VK1A 4TUYF 1ATZA 3ZOZA 4J1TA 1QRUA 1D2EA 3SQOA 3ZX5A 1CRZA 1JQKA 1O03A 3TQOA 3U16A 2DEUA 3I2KA 3KJIA 1NXTA 1V16A 5HZGA 3T4EA 2OZKA 4ZQHA 4Q9AA 1S0UA 2SNIE 3ETLA 4MKRA 3U9TA 4G0MA 1G6Q1 3EK2A 1K7CA 3OT1A 3QV1A 3QTLA 2O14A 4P93A 3VKVA 3LP5A 1V11B 4BBAA 1Q1NA 5LQDA 2VEDA 3IOYA 3PITA 1BE6A 5E4TA 5AKZA 3RAJA 5C9ZA 4ROSA 4F5WA 2X1MA 3I1JA 1QCCA 1VHDA 1PE0A 3A1SA 1CVLA 3JV7A 3WB1A 4KEAA 4Z9XA 2JLSA 2EJWA 1N8NA 3W77A 1V41E 5FNVA 3S68A 2CBZA 2Q0SA 3WMGA 3ZXSA 2R00A 3LLUA 5KOJB 1SH7A 3T4PA 1N32B 3F8SA 4TRMA 2I3DA 3BBLA 2UYYA 4I7EA 3SXUB 1FRZA 3L8HA 3A4IA 1S96A 1WP9A 2GHIA 4M83A 5TQ2A 3TSZA 3ZIAD 1VJGA 1IYZA 3GQBB 4YRBA 3RS3A 5KTYA 1QGOA 2CJWB 1OT3A 4PM4A 1X3LA 3F98A 2VIIA 5C7OO 2R60A 4A0HA 2XNDD 3HKCB 4PYJA 1C2YA 1L5WA 2ZRQA 2X2EA 3IBYA 3R20A 3BWYA 3WNBA 5CYGA 3KJFA 4DWJA 2RFLA 1PNTA 3UVEA 1SOUA 2HLPA 1I4LD 1CUWA 4BKOA 2GYVA 5EEGA 2VDWA 3HYTA 4W1PA 1GKLA 1M2JA 1W46A 2HSGA 2IBSA 2Z5FA 3BIJA 4IGFA 5LDHA 3E0QA 5EN4A 1ONSA 2HFJA 2QZPA 2XITA 5AW0A 4H3KB 5ICEA 1JVBA 1QHHA 3L0DA 2HOQA 1NUHA 4J0DA 4EB6B 1SEVA 2GEFA 4FHFA 4P58A 1G4AE 1ODFA 4V3BA 2MYNA 4I4TA 3TUJC 2FSHA 1MTZA 4N7MA 3IVMA 4O29A 3B3FA 3IPCA 5TEVA 1CS4C 1VE3A 1P8AA 4EEKA 4XM1A 3I0ZA 3K9LA 5I5EA 1ESDA 2OM6A 2ZWPA 4AZWA 1G8MA 1DBSA 1ODLA 4JB2A 4K9LA 4KWIA 3QXSA 4PIMA 5AHWA 4CFSA 5GZ3A 1AS0A 4A26A 5AVWA 2RKOA 4PICA 4L4UA 2G6TA 4GX5A 1MAVA 4C05A 2V45A 6Q21A 3J7AC 4NCIA 1PZXA 2CFIA 1OTXA 3F46A 4C6TA 2IYNA 1YGPA 1EFVB 2VQSA 1JKIA 1NNSA 3DZIA 3MPUA 3NEAA 3OJLA 3QEKA 4P80A 3U4AA 3ZWPA 4AUKA 3RSLA 3TRHA 3OEYA 3NHKA 2D1YA 4GD3Q 2Q3JA 1LTHR 1T5HX 5A3JA 2ZW9A 3E70C 3G8YA 4EA8A 2QX8A 3EF1A 2PLNA 4P35A 2G9VA 2JKYA 3A9TA 4BMOB 2SICE 4B47A 4DJTA 3IT1A 4EHFA 1TM5E 2CL7X 4YQFA 1JWLA 1FW6A 2VT2A 5L40A 1A71A 1AX9A 2I6XA 3L7AA 3LUHA 3H8SA 2W00A 4K81B 3W5SA 3X1JA 4ZJYA 4RANA 1EM8B 1FSSA 2IGBA 5CLHA 2ZK7A 1NBEA 1Z2DA 2XE7A 2XWQA 3NB0A 3ONEA 5ARDA 4ER3A 1Y8RA 3W78A 4TZ6A 3B13B 3W6NA 1JE1A 2JC3A 2CXSA 4BJ1A 2EQAA 4KN9S 1AZSC 4MVJG 4EHKA 2IW1A 4PSCA 1QH0A 2GCGA 5JJ5A 1KFCB 4ALNA 1NLYA 4K03A 4FZVA 1RTTA 4P81A 2COEA 3HBNA 3G17A 4MIYA 2HSJA 3EWSA 1F0NA 4K9OA 2IODA 2EHDA 3HCDA 4JBWA 5C8ZA 5CFQA 4BBZA 3S81A 3WNZA 4F9FA 4YHHB 4ONEA 2CZGA 1GZSA 2W6JA 4IDPA 4E1AA 4LOHA 4JT8A 3BMCB 5DTRA 3R3ZA 3WFIA 1UANA 1ODCA 4BNMA 4OKNA 5ILGA 2VH5R 4KN5A 5K0SA 1SBTA 2JPDA 4PX5A 2BGUA 4R7ZA 1WKVA 1AUVA 1TM1E 1U8CB 4ZV4A 2M6RA 5KNCD 3A04A 1Z4LA 1QKIA 4JJGA 2JAQA 4KJZA 2PWPA 4MJLA 3OQIB 5KSYA 621PA 4PYIA 2A3RA 2X9VA 4WLVA 1YFZA 5F1OA 5AKJA 5F76A 1ZGCA 5HZKA 2D3WA 2G04A 2O1WA 1GG9A 4ZI3A 2R4QA 3MRVA 4W8HA 2CSXA 3KQNA 4LRSB 3IHKA 1SELA 2OXFA 4NK5A 1HM5A 1KJZA 3FSEA 4NENA 5HGJA 1YH3A 3HO6A 4KAXA 1VB3A 5EIOA 3WYFA 4ZRMA 4JIGA 1U9JA 3N6RA 5FUXA 1A9QA 1Z5ZA 5KX5A 3IUNA 1U04A 1XEWX 2VJPA 2JZNA 3I6YA 2IXAA 2C9DA 4LZNA 2Z1NA 3D9QX 1GN9A 3ZZUA 4WBSA 1NQWA 2B7BA 4WZAB 4YFYA 2D0OB 1G2PA 1CV2A 2JLYA 3C8DA 5F73A 2V3VA 3U13A 1LLUA 3Q88A 3UH0A 3QBTA 1CU1A 4U7GA 3GJ4A 4AM8A 5D00A 3UEOA 3HU1A 4TLCA 3Q5GA 4MINA 1KC3A 3C39A 5KYVA 2F1RA 3NNSA 3K6KA 3GPLA 1X38A 3O3NB 1G3IA 1M34A 1MN6A 2C7BA 2B61A 2YV4A 4KLAA 5CU7A 2PBFA 3ED1A 4XSVA 4OYLA 4G3XA 4GWLA 2WWWA 4KUHA 3RS2A 3UGJA 2LXNA 2Z8ZA 4XZ3A 3RUEA 2MMGA 4OCZA 1KPIA 1O87A 2AB0A 2IFTA 4UUMA 3T7IA 3LIIA 4C07A 3QU9A 3CVYA 2NLOA 2BONA 1ZONA 1AS3A 3RU7A 2KLHA 1ACMA 3A6ZA 3OHSX 4MWSA 1GCAA 1ZN7A 2RH5A 5L3ZA 4YJ2A 3FIJA 4Q3NA 4NESA 1XMOB 3P4XA 1EFTA 5LUBA 4E94A 1ULBA 3A31A 2DRIA 2FRDC 3FOAA 3K9GA 3NYQA 3OPYI 3BIOA 3QYJA 4C3VA 2EDAA 4HDMA 1OI7A 2PHZA 2ERCA 4H0FA 3OFND 3EEIA 2RK3A 3WRYC 1O5TA 5P21A 3LZCA 3K6SB 4NYJQ 4P2BA 1ZU5A 5FPSA 2EZTA 3KEGA 3ZXXA 1N92A 3K0CA 3VJMA 2EX1A 1UXKA 1I33A 4E6PA 1YIAA 1O94C 4FBMA 1EWRA 1QHXA 1ABFA 1U9IC 3SIPA 4IIHA 3GG9A 1FLAA 4K88A 1NP6A 2I7TA 5LQSA 3WSWA 1N1EA 4WCFA 2NUAB 4RK1A 3KJHA 1I51A 4D9GA 1P6UA 1ZW6A 5E1BA 2VBIA 4CEHA 2Z95A 4HFJA 2WEKA 2ZVPX 4Y2HA 1U02A 4U8GA 5FUWA 2WPNA 2AKYA 1IN6A 4L4YA 1C9YA 3Q3VA 4J6EA 4H31A 2IPLA 5DLEA 5DBHX 1YL5A 4AJEA 4BMVA 4E22A 2ZRGA 3PFHA 2BHRA 3L7LA 2OA0A 1NE7A 5GJVC 3EZFA 1EA5A 1AK1A 3R5HA 4FEYA 4OQ4A 4AXBA 5KMGB 1BZYA 1LH0A 1U2SA 4AF7A 4DC9A 2H85A 3VDRA 1TGYA 3DMDA 3OWXA 1L1QA 5I48A 1QFZA 2Q3HA 1CS0A 3S0JA 4AQDA 1V9CA 1YJ8A 1WSBA 4GXRA 4Z4CA 4IQGA 3VAAA 3D6VA 4JVNA 5EVCA 1WUYA 1Z75A 2JFBA 4C89A 3DAFA 2QB5A 5B1IA 4OFWA 1JQDA 4LDNA 3FPEA 4R1PA 1TMKA 3ONDA 3W5DA 4M1EA 1CW2B 5A06A 3G1WA 3DBOB 3EJ6A 1KSJA 4ZA2A 1L8QA 5AKEA 3SOPA 4IXTA 2YYSA 2C7VA 3MWKA 3UPUA 5EKTA 3U0VA 3TB4A 1IFXA 4FCVA 4L07A 4CF6A 2A84A 1E2HA 1YZVA 3PSAA 1A4UA 2B34A 3PHHA 2ORED 2W7TA 3SIWA 1YS2X 4LKOA 1JXQA 1Y3AA 1QSGA 2NN3C 3GLHB 3UUGA 1KETA 3WBKA 1Y8QA 4Q6BA 2X7JA 2YJ5A 1KDZA 1PT6A 3WYNA 1LW7A 2YYYA 4CUJA 1FUKA 2AN3A 4DQVA 4XVCA 3E9NA 1JILA 1PCXA 2CXPA 3LF1A 3JWPA 2CWDA 4CG0A 1EUCA 3JQBA 1EHYA 2WLTA 3FPGA 3ZCUA 4K7JA 1N25A 2CYBA 4CL0A 1S2MA 5K09A 3QUCA 3U81A 2XQIA 3KVNA 3ZGYA 4UUAA 1DS6A 2VDQB 3L0IB 1UJ6A 2RBEA 1GAEO 4GZ6A 2ZZKA 5A9SA 1E96A 4ZC8A 5HYVA 2C61A 4U2DA 1N5LA 3TS1A 5I9LA 5E6RA 1SHTX 3NIWA 3WA6A 3PCXA 1UJ4A 4TVOA 3RIGA 4X62B 4AT1A 2DBRA 8AT1A 2AFHE 5B7PA 1ZCJA 4XRGA 4UD6A 1MDBA 5FTNA 3IBCA 5EE1A 5HKAA 3PQ7A 5JY1A 3BGIA 2Z2ZA 4NU6A 1JDUA 2DFVA 3JVDA 3MYRA 1OI2A 2J5RA 2E4YA 3KJXA 4RV4A 5A05A 2GN9A 3AIKA 3K8QA 4KOEC 1KZ1A 6YASA 1M6WA 2KBEA 1SVIA 1UPXA 2XYQA 4MS4B 4BX0A 2I8AA 5F7OA 3J81k 1NN1A 3BKXA 4O3FA 3JASA 4NH0A 3ZQ4A 4EKIA 4Z6KA 3P26A 1A72A 4V0OA 5EKSA 4BECA 2RB4A 1ZOPA 3QVXA 3MQFA 2ZWIA 3VUEA 1WY7A 2Y77A 3H2YA 4G5RA 4KBYA 1E3WA 4LAFA 4YLEA 3WC4A 4GKAA 4I8XA 1EBUA 3ENQA 1J8FA 3D1JA 2JIBA 1DBQA 1KYYA 2QLFA 1P44A 3EY9A 3KDPA 2N1BA 1HR0B 2YXEA 4BX9A 4M0UA 3IV6A 3ZK8A 2YR0A 1E1MA 1R74A 1VMIA 4LYEA 1U8UA 3AR8A 3TAHA 3OQNA 3CNHA 2BZ1A 3VX4A 2CXUA 5LQAA 1OLOA 1PT5A 2RE8A 2JH3A 1T2DA 2H1WA 3AHIA 1LK0A 2NZJA 3AEQB 4AWAA 5HUJA 2NTJA 1VIMA 3MXOA 4RQAA 5LWQA 3L0SA 2A9FA 1KYWA 4Q1EA 4ESEA 1PG5A 3L82B 1O0CA 4J0CA 5AJZA 4BUJA 1NQVA 1NW7A 2C3OA 2XCOA 5K2MA 4KE7A 2NNLD 1MO5A 2B1IA 2QAJA 1XK7A 4WZZA 2VNIA 1QIJA 3KYIB 3R24A 4Q3LA 4ETWA 3H6GA 2ZQ5A 2ZUSA 1GDDA 4Y1RB 4REOA 2QRGA 1DAMA 5EIHA 1M2GA 1T8WA 4OH1A 4AECA 5WRFA 1RDFA 2B5OA 3ORYA 3BMOB 4I6JA 3V48A 1AKVA 2O1XA 3G9QA 4ZARA 3RSZA 4H9GA 3ABSB 2IH5A 3FDXA 2VZ9A 1L8LA 2XLBA 4O0LA 2NTYC 3ST7A 2H57A 1A0OA 1SBHA 3IEUA 2Y67A 4LWOA 1T15A 2Z58A 2J6IA 5U1PA 5H3HA 1G59A 2PZGA 3DOEA 3R3UA 1E1KA 2HIMA 2I4MA 5HBRA 1YT5A 5TPWB 2Q4EA 3FOWA 4CGZA 3ZV3A 821PA 5ED0A 2A5DA 4P4SA 3CR7A 3L93A 2CNLA 4FR2A 1D0SA 4K9SA 1T1RA 1Z6PA 2W58A 3SKXA 4DM7A 4MWZA 1M83A 1IATA 1NM5A 4H4EA 4DV3B 5DRYA 2F48A 2PXAA 1QXSA 2OAEA 4B3GA 1NVVQ 1EX6A 3TD2A 3I37X 3FSGA 2DPYA 5ALYA 1MQSA 3WK4A 1B42A 4G9GA 2O5EA 1E2EA 3HGMA 2PH1A 3NWPA 4G67A 4CFYA 5KOIA 5FRDA 2A14A 1PUXA 4K0RA 2W2XA 1LY1A 1VE5A 3ZCVA 1P61B 3AK4A 3DO5A 1R88A 4HLNA 4YP7A 4XIGS 5DHQA 5JUWA 3VTAA 2YUIA 4INJA 1JECA 1TO2E 4MYRA 5LMCA 2JANA 2ETVA 1W1IA 2J0EA 1SFRA 4JX9A 4KG7A 4OGLA 3ZDXB 1XTJA 4HDOB 5H5JA 2FVYA 2YNMA 2ZB8A 4W9NA 2C9BA 5EJAA 1PQUA 4RHYA 1II8A 3M9LA 4C88A 4DNPA 5KDDA 5KQLA 4LF6B 4GX0A 1VP9A 4NX2A 4LBYA 3MLBA 3L6RA 5AOVA 1KJQA 3N2NA 3DE0X 4PGHA 3JALB 2O8CA 2P1ZA 2ZKIA 4QO7A 2SHKA 4C06A 4WBNA 2PAAA 2FP4B 3QWBA 5BW8A 3KQHA 2C04A 5EI5A 3BG5A 1H6BA 2FF5A 3AJAA 3LG2A 2PA3A 2EYUA 2RSLA 2DC1A 3KLBA 3QFCA 1KY4A 4KZPA 4EBFA 2OZEA 4KQWA 2PKYX 3JWEA 4O8CA 4BVGA 3GJ3A 3RPEA 2VJAA 3IKLA 3SVLA 1K98A 4X91A 3RS0A 5HRAA 5ALVA 4Z2YA 1MGOA 3ANNA 3HNOA 3JSAA 1GYPA 1XZCA 2X9GA 3A4YA 3RFTA 1ZEJA 3M6WA 2WICA 1K5DA 1F4LA 4LK2A 1W2GA 1UKZA 3PXBA 4NMLA 4OQDA 5JCJA 2VSYA 3OX3A 2NQ8A 4R3NA 2O48X 3N87A 4F6LA 5I7RA 3N28A 2PRYA 5JOQA 5JNVA 4B3MB 5CDTA 3FPFA