4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
2QZ9A 3FNGA 1SEPA 2YQ5A 3O26A 3AUAA 5KKAA 1ADBA 4GVXA 1CQIA 3QLJA 3DBHA 1VLLA 2CNBA 1D8AA 2ET6A 3GAFA 1NHWA 4J2HA 4JROA 2JCVA 4Z0TA 3CUKA 4F6LA 2C20A 3TWOA 4CM3A 3GVIA 3MJVA 1UR5A 1MP0A 3WGQA 3ZU4A 1BW9A 2BGMA 4YEDA 4KDEA 3PVZA 5CHEA 3WBBA 1H94A 2I3GA 4CPDA 4E2YA 4DXHA 5IF3A 3C7DB 3ZWCA 3EY4A 3D5TA 3B6ZA 4TWRA 4E31A 2TMDA 1EE2A 4PZEA 4J4BA 2FSSA 4B7UA 5IZCC 3AOEC 2F00A 2EGGA 5TX7A 3ANMA 1ZJYA 2H9IA 4CQMD 1HF3A 1GADO 1A7AA 3ZWNA 1WAMA 3AUUA 3L9XA 4UULA 2WYUA 2B4TO 4U6SA 3UICA 4DLAA 3W8EA 1P9LA 4A10A 1YQXA 9LDTA 1HE2A 3IUSA 1UJMA 1EK5A 4H16A 4MVJA 3A4VA 4BUCA 3KB6A 4N54A 2AXQA 2PZMA 4PLTA 1B26A 2A4KA 1P1IA 1HDYA 4ZGWA 2X22A 1BHSA 2V6GA 4CMGA 3U4IA 3BTOA 3HG7A 1PWZA 1LA2A 1VL6A 1PWXA 3AY6A 4Y98A 2Y99A 3LC1O 2OMEA 4E12A 1DLJA 3QHAA 5KVVA 1IPFA 3JQAB 2J3HA 1FDSA 5L4LA 3K9QO 5K6AA 3H5AA 3I9MA 3PQFA 3BMOB 1OMOA 1T4DA 1KS9A 2Q2WA 3D1LA 1BDMA 2WYVA 3VH2A 2Q4EA 4CR7A 1B3RA 1VJ1A 4K28A 4P22A 1DC5A 2ZB3A 4QTZA 4CM7A 4I9UA 1D4FA 2J3IA 1RPNA 3FR7A 4L4RA 4I5EA 4J4TA 2ZTLA 3I23A 4FC6A 3EVTA 4TRJA 2X0IA 1N92A 4B3IA 3IL2A 1U5CA 2O3SA 2VHWA 3GUCA 1RKXA 1UP4A 4ZN6A 2E49A 1VSVA 4D42A 5MGBA 2Z5LA 3FNFA 2RBEA 1V3VA 2GN9A 4TZTA 2X8LA 4XR9A 3PHGA 1XCBA 3KZVA 2YFHA 1C1XB 2XXBA 4PLWA 4IXWA 2EP7A 4YPOA 4UEJA 2HLPA 3V8BA 1EBUA 3L77A 3QWFA 4E13A 3IOYA 3HDQA 4CM9D 4CQLA 3R1IA 2JD2A 4ZRNA 2FHSA 4WEQA 3NDIA 2EERA 4WCFA 5G0WA 1I3MA 3JYOA 3VHRA 4M1QA 3WYCA 4RVUA 4UVHA 4NR0A 1DO8A 3CE6A 4IDFA 4B7CA 3IDSA 4FOOA 1VL0A 2VWGA 2AQ8A 4UVEA 5TNXA 4B4VA 1WNTA 1Y8RA 1VSUA 4FJ2A 5G4KB 5AYVA 1ZEJA 6ADHA 1E3WB 2OGUA 3PWSA 1KVTA 2NU9A 4IUYA 4CMCA 2V6FA 2BH9A 3VH1A 2R2GA 2NADA 4PFJA 4U6QA 1DOHA 2JD1A 3RKUA 1UAGA 2EP5A 1YONA 2WJPA 5BNIA 1T2AA 4CM6A 2GDZA 4YJGA 3WTCA 2Z95A 1B3BA 1JWBB 2BRUA 3ZI0A 4PIVA 1ZUD1 3NV9A 4FC7A 3K8ZA 2BELA 2CSUA 1QYXA 1NNUA 3UXYA 4Q3CA 1O9BA 5EINA 3ZDFA 3S8MA 2Q45A 3GEMA 4PLPA 4HNHA 1CDOA 2NQTA 3H5NA 3S2IA 3PWKA 4KTTE 3RC7A 4M89A 2H5LA 5C7LO 3G1UA 5K0ZA 3WG9A 4RVGA 4JN6B 2PFGA 3EAGA 4FFRA 5AVOA 2DBQA 3CINA 4L74A 1T1RA 4JBHA 2VRCA 3GRPA 2CVOA 3NEPX 4AFNA 4Y8VA 1KOLA 3OA2A 3KVOA 2PV7A 3FF4A 4O63O 4ALJA 2FN7A 1YB5A 2WEKA 4BKRA 2VHYA 3E1KA 5B12A 3BTSA 3PYLA 1J4AA 3RI3A 1HSOA 1WMBA 1N8KA 1MXHA 4YQYA 2C2XA 3DBHB 2B5VA 1ONPA 4FQ8A 4BNGA 1JKIA 1NWHA 2Y1FA 3SX2A 4CM8A 1LU9A 3WQRA 5DZSA 1E92A 1X1EA 2GN4A 1N7HA 1BW9B 1F12A 2JFFA 3GF4A 1I30A 1E7MA 1RJWA 2AW5A 5BR7A 4HFRA 5IXYA 1ADFA 3FI9A 3OJOA 4ZD6A 3H2ZA 4XYGA 4GLOA 4CLEA 1HKUA 5DCWA 1NFFA 4BGVA 3RUIA 2IYOA 5JPIA 4GMGA 1LC0A 5KTKA 5CPFA 1QXSA 2VNAA 4D7AA 4L76A 4RF5A 2HMUA 3Q2IA 4CL3A 5F1OA 5A5FA 1K89A 8LDHA 3Q0EA 1H5QA 4NBUA 2EKLA 3HZZA 4XGIA 2HUNA 4KMSA 4B4OA 4Q3NA 2O3JA 2POQX 3TJRA 4ALKA 4Q3BA 1R0SA 2JAHA 3LU1A 1F14A 3ZW9A 3KYCA 1HT0A 1M6WA 1BWSA 1JVBA 4Q39A 3W6ZA 2VWPA 3SC4A 3RWBA 2NLOA 4YXFA 3LF1A 4IPTA 3F9IA 4FBGA 5DF1A 3RAJA 2NSDA 4GLLA 1O5IA 3P19A 5LDGA 4E5KA 3SXPA 2B4QA 4BNFA 3UN1A 4M49A 3JYNA 3VH4A 2HMVA 1A9YA 1J6UA 1RYDA 1MV8A 1W0CA 1N9GA 1QR6A 4RQUA 4YRAA 1O95A 4CLRA 2PD6A 1KEVA 3OECA 4BNZA 1A4UA 3QWBA 4EW6A 3H7AA 3OIFA 3SJ7A 2RH4A 3AWDA 1TEHA 2RHRA 4M87A 5CDTA 3W4JA 1KEUA 2GPTA 2GNAA 2IRWA 2A92A 2OZPA 1EQ2A 2E4AA 1X15A 1N1EA 1LDNA 4URFA 1ZH8A 4NK4A 4CL8A 1G6KA 1QYDA 5FWNA 2WDZA 2NV6A 4XQGA 1P0CA 1B16A 2JAPA 1T2DA 1PJ2A 4DVJA 1VKOA 1PZFA 5JNLA 3ETEA 3K30A 1KYQA 4LW8A 2EJWA 2YHIA 1A5ZA 1LQTA 1WMAA 4HKTA 5IZCA 3EK2A 3WMWA 5JO0A 2X0NA 1VI2A 3UCEA 2VCYA 1WPQA 1H2BA 3P7MA 1HYEA 1G0NA 4GSLA 1WW8A 1U1IA 1JN0A 3ZV4A 3D3EA 1HZJA 2FRDA 3U4HA 1GYQA 3F46A 3UHAA 4CQLB 5JYDA 3WGZA 5I7VA 1Y1PA 4CMIB 3ZNPA 2NM0A 2E37A 1QYVA 2YZ7A 2VOEA 2IZ0A 5IDQA 4JQCA 4WCFB 2FZEA 3G3EA 2CFCA 1MG5A 2Y68A 1HE3A 4RLSA 2VOJA 3ENNA 1PTJA 4MVJH 2IYPA 2WD7A 1EVYA 3ZWMA 2VYND 1F17A 4YAEA 3LT1A 3STHA 3PLNA 3PTZA 5KCZA 3TRIA 3QVTA 2QZZA 1YQGA 1GQQA 4TKLA 3MEQA 3UW3A 2NTJA 4E33A 2AE1A 3JQFC 2VYVA 3LVFO 4P4LA 4G5HA 4TKMA 3BZUA 2RAFA 2JJYA 1YQDA 1UXIA 1LLUA 2EV9A 1GDHA 4D3SA 2OORA 3DZBA 5U9CA 3CMCO 2FR1A 3IS3A 3WWZA 4ZHSA 1JW9B 4YAGA 4PG4A 3TF5A 5KJEA 3MWDB 5EPOA 2DT5A 4XDYA 3WJ7A 1DAOA 3S55A 4MIYA 3CSDA 4BIIA 2CVZA 3RFTA 4S3MA 2QYSA 4UAGA 3F3SA 2AG8A 4LSMA 3SJUA 3JD2A 3D64A 3HHPA 2C54A 4BKOA 2JD0A 3RKRA 2ZK7A 1C0LA 1H0KA 4CMHA 5G4LA 3SBOA 2B0JA 2VT3A 4P38A 4IQ8A 3D4PA 1A7KA 1E1LA 4Q3EA 3RASA 4ZRMA 1OZAA 5I8ZA 3I1JA 5CG2A 3VDQA 1P1HA 2XXJA 3K5PA 1U2GA 1F8GA 3LK7A 4WLEA 5GY7A 4B4UA 2OBYA 1R4NB 2VN8A 4D41A 4XQCA 3ZGYA 2FOIA 5F1PA 4R41A 5BNFA 1MFPA 3KTDA 4PN3A 5TLSA 4GX0A 2YJZA 1Y6JA 2O2SA 2J5RA 5GMOA 4E3ZA 3DOCA 3C7AA 4YACA 4YT5A 2DPGA 4II3A 4CM8B 3P2OA 1S6YA 3COSA 1EDZA 3DONA 4GPD1 1NFRA 3JD3A 1NR1A 1DC3A 5TT1A 1FK8A 3PHJA 5TGDA 3QA9A 3MOGA 3U3XA 2Y0DA 3HE3A 4LRSB 1BVUA 3UVEA 1T25A 1UZMA 2P9EA 4FPXA 4HFJA 5C7OO 2A35A 4ID9A 1IY8A 3ADOA 1A71A 4AG3A 1YJ8A 3C3XA 3IJPA 5KOIA 5HTOA 4IY1A 4CUKA 4E5NA 2W2KB 3NUGA 2Q49A 4WECA 2W2LA 1XEAA 4MJLA 1ISMA 1NPDA 1HSZA 4XRGA 3E48A 4OHUA 1N1GA 1U3WA 4UUMA 1PL7A 5B4VA 1ISGA 1XIVA 1HWYA 3H9JA 3C1AA 3WFJA 3GC6A 1R16A 1VC2A 1F0YA 3GH3A 3ZNNA 1GV0A 1ZW1A 3GG9A 4M8SA 1E7YA 3TDKA 4MVJG 1YOVA 5ES3A 4YAJA 2LDBA 4CODB 1KETA 1E6EA 1JDJA 1P1RA 2ZTUA 1WDKA 5L4NA 1Y81A 4OKIA 1IULA 3RFVA 2X1HA 3ICCA 4CJXA 3C1OA 4D44A 4A0SA 1LLQA 1UXJA 1GPJA 1HDOA 1LSOA 1MC4A 4K1LA 5AXCA 1E3SA 1SAYA 1X14A 3GFBA 1IUKA 2OUIA 3GMSA 4H15A 4CLRB 4JBGA 3H5RA 5EJ2A 4L4SA 2ZB4A 3HB5X 2IXBA 4JJIA 3DAFA 1ISFA 4N7RA 2PZJA 1QORA 1TT7A 3WX0A 2EWMA 4FSHA 4X54A 1BG6A 5COQA 3AK4A 2DQ4A 1D1SA 3EYWA 2GO1A 4RGBA 2FPGA 3ZU2A 4RDHA 3H9QA 1MFZA 4EI2A 3TOZA 4B8ZA 4JGBA 4U7WA 1XKQA 3KYBA 4I5FA 5HA5A 5KVSA 3WYEA 3HWRA 4KQXA 1NASA 2Y66A 5DULA 1DFGA 3LC2O 3G1TA 4Y67A 4JJGA 1NHGA 2VZ9A 2Y1CA 4IJKA 2VZ0A 4HFNA 2WD8A 5KIAA 5LDHA 3IMFA 3EMKA 4A2CA 2EEZA 5LC1A 2V6BA 1LRJA 1PGOA 3TZCA 4GVLA 3UFXA 3V5NA 4NHEA 4QT0A 4KP7A 1U7TA 2ZATA 4PVCA 4YJFA 3GK3A 2UVDA 1P1KA 3X2EA 4RVDA 1YWGO 1MC5A 3ICPA 5C5IA 3VVCA 5EQDA 2OO5A 2ZIZA 3AOGA 5FF9A 1A72A 1SOWA 2WE8A 3C1TA 5FEUA 2WD7B 4OJNA 4ALIA 3ITDA 3I9JA 3S1LA 4CLXA 4I5DA 1HL3A 1ONNA 2ZCUA 3T7EA 4BKPA 1ZNQO 1V3UA 3ZN2A 4UVGA 3TZKA 1UXKA 2I66A 3JD4A 2NTVA 4NBWA 1GEEA 1LRKA 3NGXA 3W6UA 1YBVA 4FIZA 4Z9FA 4YAIA 3PJDA 4GQAA 1YL7A 4AJPA 3PLRA 3U4DA 3EZYA 1CF2O 1GCOA 3UOGA 4BO4A 1Z6ZA 1PX0A 1DDOA 3RC2A 3DTYA 5L53A 3FBGA 4IDGA 4PLVA 4NZ9A 3KV3O 4PRLA 1IHXA 1R15A 1IZ9A 1WXDA 2OBNA 4N5LA 1E3WA 3GHYA 4OXYA 3RFXA 4ND3A 1NAHA 2X5OA 4BNLA 2Y05A 3DHEA 1PR3A 1SB9A 4YJHA 3RD5A 3PWZA 1XSEA 1ARZA 5JCJA 1SCUA 3PI7A 4XGNA 4ZQFA 4MO2A 3UCXA 3N58A 4ALLA 1PGQA 1ZMTA 1M67A 3KETA 2C0CA 2BFMA 2IZZA 5TF4A 3CH6A 3DDNA 3M1LA 3NT4A 1TT5A 4FJ1A 2D8AA 4EEXA 3WGGA 1Z7BA 1NQAO 1HDXA 1YE3A 2PK3A 1T2CA 5KVQA 5EN4A 3FNEA 4R16A 4GGOA 1T1SA 1I10A 4FFPA 3B20A 4ND2A 1U7HA 2HK7A 1C1DA 1KERA 1P3DA 1U3UA 2PD3A 3VAZA 3AY3A 3I6QA 3O9ZA 4YAKA 1I32A 1DJQA 1E6WA 1N7GA 1DRWA 5TQVA 4D3DA 4W9NC 2Z1MA 5L45A 3DHYA 1ZEMA 4FOSA 3RJ9A 4A73A 5BSFA 4J3FA 1E6UA 4IZIA 3NT2A 1LNQA 4KQWA 2VHVA 1Z7EA 4GI2A 2FMUA 4FFNA 2JFHA 1ADGA 1E1NA 4YB8A 4O59O 1R6DA 5DNAA 2Y1EA 1SC6A 2PY6A 1P0FA 3H6KA 5JE8A 5B1YA 1H2HA 1OC2A 2VHZA 4A27A 3VDRA 1F8FA 4GWGA 5T8KC 3ENKA 1UZNA 3RROA 4RJTA 1Y9AA 2EHDA 4B4WA 3FD8A 1FDWA 1P74A 4BO0A 3E82A 3NTOA 4IJUA 1DFHA 1YOVB 4G81A 4ONEA 1M66A 3QVOA 3FPCA 2OP1A 2UYYA 1PJLA 3S2GA 3V2UA 4BO9A 4I08A 3CTMA 4WKGA 2C29D 4HV4A 4YRBA 1MG0A 1LSUA 1DHTA 1O0SA 3RBXA 4DPMA 3EHEA 5C7IO 3ZU3A 4EITA 2CDCA 2J5KA 3D3WB 3SLGA 4D43A 2QHXA 4CMEC 2GZ1A 4XGKA 3WR5A 3VVBA 4IQ0A 2Q4BA 5JAZA 2O7SA 3QWHA 2G17A 1MUUA 3KO8A 2YV2A 4IS3A 3LC7O 3A14A 3PYXA 1BGVA 1JA9A 3BA1A 3H3FA 4YR9A 4KDFA 3QP9A 1L7DA 1NVTA 4MP6A 4B3HA 2P5YA 4QX6A 4BGIA 3DZFA 5HWSA 2DUWA 3NX4A 4TVOA 3OQ6A 1U3TA 1I2ZA 1V0JA 4INAA 1S7CA 5BT9A 4BNNA 3JYPA 4ZQGA 5CEFA 2Q99A 4RCVA 5COAA 3TOXA 1J49A 3BHMA 1UXGA 2I99A 1XYGA 2CD9A 1SEVA 3DBLA 5HS6A 3UKOA 3HFGA 3HSKA 3NTQA 1PQPA 1QV7A 3RBZA 2HMTA 2PGJA 4QECA 4LVCA 1NPYA 1XGKA 3BIOA 2YHUA 2XOXA 4NI5A 4A5OA 1P1JA 3GQVA 1JQBA 1O94A 5JMPA 1T2EA 1OOEA 3C8MA 3AI1A 1PJSA 2WE7A 3AUTA 4AJIA 3AU9A 2E82A 1MGOA 3DZHA 3LZ6A 4RZIA 1KEPA 5TJ9A 4CQMA 3DBVO 2SCUA 3RUEA 4YJFB 3C24A 2HJRA 4PG8A 5DOVA 1Q7GA 1YBAA 1LI4A 3WYBA 1J5PA 2Q1WA 5IN5A 4RO0A 4DPKA 4R68A 1KVSA 4E21A 1PJ3A 4RF4A 3UF0A 3GUYA 3KYDB 2CDBA 3E9MA 2X4GA 1R4MB 3GNSA 3S2FA 3TNLA 2I3AA 1D3AA 4Z0PA 3RSHA 3BTVA 3PRJA 4PLCA 1YBMA 3RU9A 3ZWXA 4CV0A 5KJFA 4DTIA 1QSGA 1YKFA 1NWCA 2PD4A 2GLXA 4QFCA 4CMIA 1SMKA 1SO8A 5B4TA 2P68A 4IINA 2FWMX 3DMYA 5A9SA 3TFQA 1EE9A 3VPSA 2O48X 5IG2A 1XU9A 4ZQBA 4FGSA 4WLVA 2DAPA 4BNXA 4YT2A 4QQRA 4CR6A 4YT8A 3DR3A 4Z3KA 4FFLA 2EG9A 1BRMA 4TZKA 4B79A 4JBIA 5JBIA 3E9QA 5L7TA 1BTOA 4TROA 1LX6A 2Q2VA 3KOUA 3WXBA 3F5SA 5IDWA 4YJHB 5DN9A 4A7PA 1P44A 4BV9A 3DQPA 1O89A 3PJGA 3JQBC 5TIIA 4UUNA 3BMCB 4XWYA 2H63A 2DFDA 3KHUA 1IE3A 2X7HA 1WZEA 5KJCA 5K9ZA 1TT5B 1GQ2A 4BNUA 4Q3AA 1X7DA 2ZKLA 4J7UA 3INRA 2R6JA 4MKXA 4L73A 1HEUA 3BHJA 3MCVA 1I24A 3ST7A 5B37A 2YQ4A 3DEYX 3EDMA 4GX5A 2ZCVA 3ZZNA 1U2DA 4GX2A 3WGYA 1AN9A 2YW9A 3I5MA 3GEDA 1DC6A 4LSWA 2UDPA 2BI8A 2V6MA 1C1DB 2YUTA 1YRLA 1B0AA 3O03A 1E7SA 1E3LA 1MA0A 2PKRA 3W8DA 4CM9A 1PEDA 2Y1GA 1CETA 2CF5A 1HYHA 2BFAA 3QWIA 2JCXA 4CV3A 6LDHA 3L4BC 5FI3A 3TQHA 1IB6A 3V2GA 2IXAA 1LDEA 1I2CA 3WSWA 1UP6A 1PQWA 2CF6A 4EUHA 2C5AA 1R4NA 1ADCA 2ZB7A 3E03A 3FNHA 2D5AA 3WQSB 5CG1A 3GNQA 1GYPA 2PGLA 4XB1A 4AJ2A 4E2WA 1EBFA 3O4RA 1U8XX 3AY7A 4BMSA 1LDBA 1H9BA 1ZK3A 4R5MA 2NUAA 5A9RA 4BO8A 1LC3A 2OP0A 4M86A 4QO8A 3GRKA 5H83A 2IE0A 3KSDO 2WMDA 4IIUA 3ULKA 4PZDA 5L40A 3K2BA 5A4DA 2C7VA 4RV9A 3GFGA 2R00A 2EKQA 1EK6A 3A9WA 4CR8A 5ER9A 1AE1A 2DUUA 4BV8A 3BHIA 3G0OA 3IP3A 4OQYA 2A94A 4FS3A 1Z75A 3RUDA 4UUOA 2W2KA 4OM8A 1Q7BA 5H81A 5U4QA 4BNYA 1DIGA 1GPDG 1TVEA 3CPSA 2W98A 2H6EA 1I0ZA 4A26A 1ZIDA 1UUFA 4HX5A 2X5JO 1CJCA 3TFOA 5TC4A 1PSDA 1ZSYA 3BMQB 1NQTA 1ZBQA 3DZKA 3ROMA 3GGOA 3BAZA 4DBVO 3MOIA 2IODA 1ULUA 1SPXA 3QSGA 2O23A 1J0XO 1PR9A 4L0QA 5KVCA 3V1YA 1Q2XA 3GEGA 4UEOA 1HDGO 3ASVA 5F21A 4PLYA 2DC1A 2Q1TA 4R1NA 3TPCA 1RM0A 3Q6IA 5THKA 2RCYA 1AGNA 3LSYA 5CDUA 3GY0A 5DCYA 3ZH2A 4PG5A 4B8WA 3B1KA 4J4HA 3OM9A 3ZW8A 4E6PA 1R37A 3LT0A 4R51A 4HBGA 4DMMA 1YDEA 3DBLB 5JC8A 4E2ZA 4IZHA 3KSUA 5J23A 1VM6A 4JIGA 4J1TA 4HWKA 5ER6A 4BQPA 4W7HA 2ZYAA 2FY8A 1YJQA 1LTHR 1NX6A 3R0IA 5T5QA 1NAIA 4DIBA 2DTXA 4L4XA 3UAGA 4HADA 3C7CB 4AICA 5T8KA 4DA9A 1YDWA 1UAYA 3Q11A 4NJOA 1SOVA 4CQMB 3LT2A 3GGGA 1YO6A 1QP8A 1ISHA 1ENZA 1XU7A 1FDVA 2HU2A 4ITUA 3I4FA 4H7PA 4XRRA 2Q1SA 4GKVA 4IQGA 5JDCC 1XR3A 2CY0A 3H4VA 1XQ1A 1KIFA 8ADHA 2PNFA 3N74A 2HKIA 3QIVA 3ON5A 3AOEA 3DMTC 2AE2A 3GHHA 1EEHA 1ISIA 1JWAB 3D0OA 4NBTA 3UUWA 4PG7A 4LN1A 3UH1A 4WPGA 4R5HA 4R3NA 5A9TA 2DVMA 2PKQO 3IIEA 3GN1A 1LLDA 3G79A 5JDIC 2XPCA 2P4QA 4Q9NA 4ALNA 1LRLA 4YRDA 3VTFA 5HBRA 1PGJA 1NR7A 1NVGA 4J49A 1G1AA 4CMKA 5JAIA 4UEKA 1Z73A 1X7HA 5A9SB 3N7UA 3EC7A 1DXYA 3DBRB 4JJFA 1G0OA 4CMEA 1VE9A 1PS0A 3OICA 2VWHA 4JCOA 1ZK2A 3GNTA 1CRWG 3WMXA 4EDFA 3ABIA 4OQZA 4I1IA 3U0BA 1KC3A 4M54A 3PQDA 4DRYA 1RWBA 2C7GA 4EJMA 4II2A 3KXDA 1EUDA 1ZK4A 4MKZA 4OMUA 1GU7A 2GCGA 1C0IA 2OHXA 3PHLA 4O5OA 2EW8A 3F1KA 1Y5RA 4BGEA 5ICMA 1PJBA 1GZ3A 3D4NA 4PLHA 3JYLA 2EKPA 3CEAA 4MVJI 3HQ4O 4J0FA 4QUKA 4TVBA 5DT9A 4OSPA 1X7GA 3WIDA 3HNPA 3OIGA 4DIOA 2YFQA 1AXGA 4LISA 2BF7A 3VZSA 4WNIA 1P77A 2PWZA 3FSRA 5IFLA 1HLDA 2GN6A 4WOJA 1IOLA 1Q1NA 1Y7TA 4BQRA 4RPJA 4W4TA 3NJ8A 3TN7A 2D2IA 1KVUA 2Y1DA 3AFMA 3PHIA 1B7GO 2P9CA 4IGFA 5TS3A 4E5MA 4HUJA 2GUGA 5T57A 4DQVA 3B1JA 3D5QA 3E5MA 2HJSA 1HETA 3NDJA 3R6DA 1JKJA 3QE3A 1RYEA 3GVPA 2FSVA 1HDZA 1XG5A 4XYEA 5I7EA 3IAHA 3ROQA 4D79A 3BMNA 3PIDA 1U28A 1X0VA 1PJQA 2B35A 1FXSA 2VYNA 3GGPA 3MWEB 3PQEA 4G65A 1EFKA 2UUPA 2PR2A 3IKTA 4W82A 3U49A 1W8DA 4YTEA 2J3JA 1SBYA 3TZQA 3OHSX 3PHHA 3JD0A 4G2NA 1FDTA 5FYDA 4UVDA 4N5NA 1GUFA 2X23A 3U09A 3GMDA 3H8VA 4H3VA 3S2EA 3ZWVA 1B15A 3ITKA 4WLNA 1DRVA 1ZVMA 4J7CA 4GWKA 3NT5A 1E7RA 1EVJA 5F1KA 4AJ1A 4I9NA 5COBA 3QV1A 1R12A 3O8QB 2TMGA 3RQSA 1DRUA 2B36A 3O38A 5EESA 3K96A 3VPHA 4WUVA 1LUAA 4MVJP 5IJZA 4I5GA 5CDSA 4IS2A 3GA0A 5G2OA 4A03A 5L51A 3A06A 3WGHA 4KWIA 3ZWPA 4BS9A 5EERA 3WJAA 3FPLA 1W73A 4LK3A 4BOYA 3Q2KA 3EZLA 4R3WA 4BNHA 4D0SA 2DKNA 1CQJA 4RPLA 4I8XA 5K6AC 3C85A 1ZK1A 4ZQEA 3WOHA 3E8XA 4BO3A 3AI2A 3BXXA 2HK9A 4DYDA 3ZNQA 2DTDA 3WB9A 3F47A 2OXIA 4DL9A 3NJ4A 1EDOA 4FFMA 4TMFA 2ZTVA 2D1YA 3JQAD 3MTJA 4J6FA 4KTVE 4YA6A 1QV6A 4DREA 5TRTA 4NJMA 3A1NA 3M2PA 1CERA 3L4BA 3P2YA 2O50A 2JFGA 2P5UA 3D3WA 2X6TA 3FRJA 4BNJA 3DTTA 2AQIA 1R66A 4L75A 3Q1LA 3VKVA 1QMGA 5TSDA 4IIVA 2V7PA 3FCOA 3ZWBA 1KC1A 1VKNA 1LDMA 4XDZA 2O3TA 2DM6A 5DBIA 5BSEA 1Z82A 3AU8A 3PPIA 3HN2A 4LGVA 1ZSNA 3CMMA 5IDYA 1X0XA 1GY8A 2X9NA 5BSGA 3PEFA 2AEFA 2G0TA 4J90A 5C3MA 4IDCA 2VUTA 1P31A 4L9RA 3U4CA 1ONOA 1D7OA 4BKUA 4OIMA 1B14A 3HUDA 1QLHA 3HFSA 4PG6A 3U5TA 4Y6SA 3OMLA 3QY9A 3NGLA 3UGKA 3DC2A 5IAAA 2PZLA 4FDAA 1KY4A 3HDHA 1LDGA 2P9GA 3PFFA 4OYRA 1MLDA 1E0DA 4ZU3A 4BO6A 3JQ7A 5CDYA 3RBVA 4RLHA 3E18A 4LMPA 4O1MA 4BO5A 2NTNA 5I9MA 4JLWA 2HSDA 4PLZA 4CMAA 4K6FA 2PTGA 3OIDA 3QRWA 3PZBA 3G17A 2IEBA 3F6YA 1NM5A 3AFNA 3MTGA 3NKLA 3KYDA 2NVBA 2VUUA 3DOOA 1R4MA 2QRKA 2A9FA 4PVDA 3I9KA 2PZKA 1ML3A 4OOFA 3ZWWA 4F3YA 2D59A 5LCXA 4K26A 4PGFA 1NXQA 3JSAA 3PFWO 5IXSA 1VJ0A 2IEDA 5EIOA 4D46A 3AW9A 4OGWA 4MDHA 1EVIA 2O7QA 2VT2A 3OETA 4LRTB 4MP8A 5I9LA 3VC7A 4E4YA 5KWEA 2NNLD 4NDNE 4MVJM 4PLGA 2JL1A 4E32A 2IZ1A 5I8WA 2GYYA 4CLHA 3WGIA 1E5LA 1Y8QB 5A1TA 4J2OA 3L07A 4NU5A 1B2LA 4RORA 1I8TA 1OC4A 5JC1A 4FGWA 4GBJA 3GR6A 4EEZA 1OAAA 3QWAA 2D0IA 4GL4A 1KVRA 4YBZA 1KBZA 4AJOA 1PZEA 3AM3A 2W8ZA 3OJLA 4AVYA 5JAMA 4P4GA 3RUAA 3WS7A 1FF9A 1ZMOA 3JQ6A 5MDHA 1HYGA 3BMCA 2I5PO 3GZNA 3PIIA 3OBBA 4C7KA 3OJEA 5JDCA 3ONDA 1O8CA 4J43A 4JP3A 1HE5A 3ETDA 3DOJA 2QYTA 2Q3EA 2JKVA 2HQ1A 4BB6A 4RVSA 1L1FA 3BMNB 3DMTA 4MIOA 4YJDA 4BO7A 3BTUA 4I9HA 4LCEA 3OSUA 1ZJZA 5JDIA 3RCBA 3MJCA 4NG5A 1XDWA 3OH8A 3HDYA 5ITWA 1QKIA 3ONFA 4J1QA 3EGOA 3Q9UA 1VRWA 2CVQA 2O4CA 2GF2A 2P91A 1RM3A 2I67A 2I65A 3M6IA 4O0LA 5DP2A 4XA8A 1I5RA 1OBFO 3LF2A 5IDXA 1SZJG 3DHNA 1PIWA 4UUPA 3E6AA 2GRAA 4FN4A 5BQFA 1P1FA 3MZ0A 3VOSA 2X58A 1GAEO 1N2SA 3K73O 3NAQA 3PYMA 3HADA 4BHTA 4WJZA 3DAPA 3L6DA 1DHRA 1U9JA 3JQFA 3GPDG 1C3VA 2YV1A 4WK6A 3SVTA 2NU8A 4DC0A 2O3QA 4XJSA 3EUWA 1ENOA 4MVJD 1FMCA 4FCCA 3V2HA 2YDYA 4Z9XA 4HXYA 3ZWYA 3JQ8B 4JK3A 1LSJA 2B83A 3MJ4A 1C0PA 5F5LA 3H2SA 4MKRA 4XIYA 3B1FA 3ZHYA 2D4AA 4DLLA 1EZ4A 1LBEA 1NQOA 1HTBA 2BGLA 2EF1A 3D4OA 2RIRA 3PP8A 2FR8A 5A05A 4IBOA 5ILGA 2GR9A 2QX7A 3CZMA 1W6UA 2YDXA 3I9NA 3IJRA 3L9WA 4OAQA 5ICSA 1T24A 1K6IA 2O3UA 3MJTA 3IUPA 3KLPX 3H9UA 4WCDA 4P4NA 4F6CA 4NJMB 4IMRA 1DC4A 4CM5A 1B8VA 2Q2QA 4NBRA 3IC5A 3BMQA 1A27A 4NMHA 5JMWA 1W4ZA 1A9ZA 4J7XA 1AXEA 4FB5A 1HXHA 4QSMA 2VTDA 4KUEA 3T4EA 3DAGA 4TRMA 4IDAA 1WDLA 1V8BA 4U5QA 4IJVA 4U8GA 3RC9A 5L95A 4EUEA 1QYCA 4BKQA 3ZWAA 4N18A 1P45A 3FWNA 1VL8A 1I3LA 4J9VA 3GVHA 4CLDA 3IQDB 3RVDA 3T4XA 1O6ZA 4WLOA 1ORRA 4BNVA 2DPHA 1JAYA 4R9RA 3PZRA 3FR8A 4XYMA 1NTOA 4DMLA 3GG2A 1AHHA 3M1AA 1IL0A 1YH3A 1E3JA 1YB1A 2AA3A 1E1KA 1EVZA 4UVIA 5L7WA 1Q7CA 3ZV3A 3GOHA 2NU6A 5FI5A 2CZCA 4RPGA 4IDBA 1F06A 5JAQA 3RU7A 5CDGA 2PKQP 3X2FA 1YVEI 3I3OA 5JFOA 3JQ7B 1PJ4A 1PZHA 2C59A 4U0JA 2E6UX 1GCUA 1X13A 4OXNA 4E30A 3GAZA 5I9NA 1NFQA 5G0TA 1JU9A 3L6OO 3TSCA 1ZFNA 3WTBA 4OH1A 4OO3A 4QO7A 4DYVA 3IKVA 3SLKA 1PS9A 4LVUA 1HDRA 5FFFA 3OF2A 4MP3A 3ROKA 5L9AA 2B5WA 5CEEA 1I01A 3KBOA 2B4RO 5CFZA 2BFPA 2OOSA 1BXGA 1PGNA 3IP1A 2P2SA 4NFYA 1K5HA 5A5EA 1R0KA 4AJKA 1M76A 1YL5A 4ZICA 4YYZA 1U8FO 3JYQA 4XQ9A 3DBRA 4FW8A 2X0RA 3CKYA 4GKBA 4NU6A 3GPIA 5ENVA 4RPHA 3WLFA 3RC1A 4Z3DA 4NFHA 3ZCXA 4NK5A 1KVQA 3OFSA 2HRZA 1I2BA 1AUPA 1E7QA 1YS4A 2NQ8A 1JTVA 2X5KO 5TT0A 2I9PA 1BXKA 2C07A 3WDSA 5ITVA 2VRCD 1HRDA 4MINA 3WSVA 4R01A 3HB4X 4CMBA 4AJNA 4XIJA 1WVGA 3GZNB 2O2YA 2ZTMA 1JAXA 3K92A 5AXAA 3V1UA 3I83A 2G5CA 3ZV6A 4EZBA 2GASA 1ZZEA 5JS6A 4AJ4A 2BKAA 3MJSA 2GZ3A 1ENYA 4MPDA 4JNKA 4Z0HO 1DIBA 3WGOA 5A03A 1GTMA 1CWUA 1U4SA 3V1TC 5HM8A 3LLSA 4W6ZA 2Q50A 3FN4A 3OQ1A 3OQBA 1P33A 4EBFA 5KJ1A 3LDHA 1ZXBA 3PXXA 4NIMA 1DAPA 3TZHA 4Z6KA 2C5EA 1UZLA 4K9DA 2DTEA 1QRRA 1BXZA 1DPGA 1WWKA 1XQ6A 2G1UA 2XF8A 1ZXLA 4Q3DA 1GQYA 1DSSG 1SNYA 1Y9EA 3Q3CA 3I9OA 3W4KA 1LJ8A 1U4OA 5HS4A 3WWYA 3TL2A 4FJ0A 1WP4A 4CM1A 1NBOA 3P5SA 4FR5A 2UV8A 2D3TA 2AG5A 3OP4A 4XYLA 3LQFA 4IJWA 1PL6A 2PH5A 2O4UX 1A4IA 5EL0A 5F5NA 3F5QA 1WZIA 1QLJA 2VWQA 5JSFA 3INTA 1GFSA 2DLDA 2NACA 5THQA 2P4HX 2HDHA 4F46A 1DLIA 1JLLA 2HMWA 3AUSA 1DIHA 1K0UA 1UDAA 4D0RA 3ROPA 3O8QA 2HMSA 5JY1A 1ID1A 4BMNA 3KSZO 4J0EA 4IXTA 2GERA 1UP7A 3HN7A 5T64A 3U62A 3WNVA 5A3JA 5KNLA 3DZJA 1Z45A 5JXWA 5A3VA 1PQUA 3ZHXA 5TJHA 4NQZA 3L4SO 4J1SA 3CTVA 1C0KA 1E7WA 3JQGA 3DXFA 4PZCA 2O3RA 2EXXA 4AL4A 3FHLA 4TQGA 4BO2A 3F1LA 1M75A 2BHLA 4AJEA 2GD1O 1YB4A 2J8ZA 1UH5A 2EIHA 4HP8A 4DC1A 2CMDA 4GX1A 5KJ6A 4R54A 3VPXA 3WBFA 1OFGA 1PJTA 1BSVA 4GSKA 4R9SA 5BNTA 9LDBA 4WNCA 2YYYA 3JCZA 1PS8A 1EUZA 2W4QA 5A02A 1H6AA 5T67A 2VNSA 1WDMA 1UXHA 2EW2A 2UUOA 2WSBA 4O6VA 3DWFA 3NTRA 4W9NA 3L0DA 2C82A 1UDCA 1T4BA 2X0JA 3I6IA 4ROSA 4BL5A 4E5YA 3DZIA 5F3RA 4S1VA 1YL6A 2AMFA 2JCYA 3GDOA 3HJAA 2PGDA 3H9GA 5G0VA 3WNQA 5I7FA 2NVWA 3QJ5A 1V9LA 2DBRA 3B70A 2Q1UA 4B3JA 1LDYA 2HCTA 4WGGA 4XCVA 3DFZA 4HY3A 1GD1O 4B7XA 4YVFA 3FBTA 2DU8A 4NPCA 1GZ6A 1BMDA 4FFOA 1OI7A 3QW2A 4P8RA 4GH5A 2QIOA 4E2XA 1LLCA 3AJRA 5DBFA 4MVJF 1DBVO 3PDUA 2BI7A 4BNKA 4C4OA 5I7SA 5DCUA 4BO1A 3DFUA 3JQ9C 4JXKA 2Y0CA 4ZVVA 3LYLA 4YDRA 2VYVD 5CP8A 4LMRA 4CV2A 3PK0A 1QG6A 3QVXA 3VKUA 3SC6A 1BXGB 1Y5MA 4KOAA 1E3IA 3RUCA 1ZKMA 1E77A 1JKFA 4DLBA 5AXBA 3JD1A 1Q0HA 4EUFA 4TRRA 1CYDA 3M2TA 1GYRA 2GZ2A 4Y6RA 5ILOA 1H6CA 2WM3A 3RIHA 3AM4A 1GUYA 5T6BA 2BLLA 4PRKA 1K2WA 3VPFA 4BNMA 4DWVA 2VRBA 2J3KA 2WWRA 4HFMA 2ZJ1A 4EJ0A 1K6XA 1Q0LA 4ZQHA 1K6JA 1E1MA 3GN2A 4OKNA 4RL6A 2AHRA 4U0KA 1XELA 5L4SA 4L8VA 3W1VA 5HRUA 3WGTA 3PGJA 4MVJE 4BVAA 1M2WA 2CDAA 4GGPA 4UREA 1PGPA 2ZQZA 3DO5A 3OJFA 3T7CA 5AXDA 2DBZA 4BB5A 3NDRA 3NYWA 3VZPA 1ZK0A 1VPDA 4CLOA 4ND4A 3ZHBA 1Y8QA 1C14A 1Y8RB 2IDZA 1RM4A 3I9LA 1CIVA 1D1TA 2B69A 2E48A 3EW7A 3QQPA 4WE3A 5GZ1A 2OL4A 5A04A 1NYTA 5DP1A 5CPBA 5EQFA 3VZQA 3AM5A 1B8PA 4XJTA 2VZ8A 1I33A 4RQTA 1XA0A 4DUPA 1U3VA 4EYEA 2ILTA 4CUZA 1BDBA 2BGKA 4GAEA 4WLUA 4DIFA 5A06A 4YJGB 4CV1A 5CEJA 1U5AA 2GSDA 1V35A 3Q9NA 2ZJ0A 1YXMA 1YGYA 4NBVA 4Z9YA 5L3ZA 3BYZA 1TXGA 3H3JA 4XX0A 2X9GA 3PGXA 3KEOA 2NVUA 3KM0A 3ZU5A 1MB4A 3KLMX 4CUJA 1PL8A 2W2LD 5B4UA 2EGHA 2J6IA 1IHYA 4R4JA 7MDHA 2J5QA 1DIAA 4XD2A 1HZZA 2EJVA 2H1SA 2Y0EA 5KKCA 1XHLA 4W7IA 2AEJA 2VUSA 3ANLA 4EJ6A 3ZV5A 2HRBA 3JQCA 4OSOA 3GDGA 2CUKA 1ZCJA 4DQXA 4IDDA 1RM5A 4NFSA 2NU7A 2W90A 1FDUA 3TL3A 1HLPA 1E5QA 7ADHA 4ZJUA 4BNIA 3QVWA 4OL9A 2FR0A 2WYWA 1M6HA 4BMVA 1I3NA 2PA3A 4OOEA 1I3KA 2GGSA 4WASA 1SB8A 2VTEA 1PJCA 2C2YA 1ZSVA 2DBVO 2VQ3A 3OEYA 2Y67A 3PDJA 5ENDA 3JQBA 3FTPA 4RZHA 3I4CA 4CM4A 4J9UE 2GN8A 2FP4A 4N5MA 3JQGB 3ADPA 4WLFA 2NWQA 4DBZA 3JQ8A 4XEHA 3JV7A 3LT4A 3K31A 3WICA 4YQZA 5CAEA 3VTZA 3R3SA 2XAAA 4ZA2A 2PLAA 4R1SA 2JHGA 2ZYGA 3ORFA 4IDEA 3A28A 1EUCA 1GL3A 1JVSA 1MXFA 3K2EA 1GEGA 2X86A 3TZ6A 4KUGA 1R0LA 5G0UA 3QVSA 2BFOA 4BGUA 1I36A 4K6CA 1ULSA 3ONEA 1L7EA 2QW8A 3JQDA 1XWFA 4ALMA 1H6BA 3DB2A 3F4BA 2BD0A 3WIEA 4E5PA 4IMPA 4PCVA 4RPKA 4YWJA 3W4IA 3KYCB 2I6TA 4HNGA 3D7LA 1KEWA 2YV3A 3LLVA 4QFDA 2LDXA 3OJ0A 3RUFA 1DFIA 3CIFA 1HE4A 3L6EA 4BNWA 3PJEA 2WTBA 3E9NA 5GZ6A 4XKJA 1UDBA 3ETGA 4Y9DA 1AHIA 3NRCA 2FZWA 4R1TA 4FD3A 3WQQA 2Y1OA 3AI3A 4WOKA 5DOZA 3PJFA 1EQUA 3JQEA 1K3TA 2RH8A 4JP2A 4AJJA 4WCFC 5U1PA 3K6JA 1N9GB 3FTNA 4EGFA 4DGSA 1EMDA 1NP3A 2Q46A 2QQ5A 5L7YA 4YT4A 3VH3A 3ZHZA 4NNJA 4XR4A 4W99A 1NPTO 5JO9A 3ZWOA 4R69A 4C7JA 3G49A 1MX3A 2G82A 3CXRA 1FJHA 1ZO8A 2FPPA 2I76A 1IZ0A 3CZRA 1IYZA 1H6DA 4ND5A 3GVXA 4OXKA 1NQ5A 3JQAA 4RF2A 2UAGA 2F1KA 1N5DA 2V65A 3MJEA 5JLAA 2VHXA 3E5RA 2AQKA 5H82A 3GLQA 2HK8A 1QYWA 2QRJA 4YCAA 3BMOA 3DZGA 4QEDA 2OFPA 4KZPA 3F4LA 2FPIA 2D5CA 2YHIB 1GR0A 1E3EA 4PLFA 1GV1A 3WLEA 3I52A 4J1NA 4JX8A 2JHFA 3R3JA 5JCJD 2X9VA 3GDFA 1T2FA 1LXCA 2RHCA 1LQUA 5IN4A 1TA4A 1BVRA 3UCFA 5BSHA 5EMHA 4XZ3A 4DPLA 2B37A 2HAEA 4TRNA 2Y93A 3GZ4A 3KUXA 4Y6PA 1TI7A 4D3FA 1V6AA 4IGEA 4MIEA 1PU2A 4CMJA 4E0BA 5JY6A 1LEHA 1CEQA 4CLOB 1C1XA 3H65A 2DFVA 3DL2A 3ASUA 1Z74A 2YY7A 4LCJA 5ADHA 5JCXA 4XYBA 1WLYA 5IZ4A 1XLTA 3INGA 1ENPA 1DB3A 4NH4A 4AJLA 4J16A 3W8FA 2QG4A 4RF3A 1Q0QA 1X1TA 3EVNA 1VJTA 3OEWA 4ND1A 2AQHA 4XB2A 3RUHA 1LSSA 5G4KA 3GVCA 1TLTA 2R00C 3JQ9A 4D45A 3KRTA 5AQ1A 4TSKA 2HO5A 3VZRA 1DJNA 2NVUB 1TB4A 4DQUA 1PZGA 3HDJA 2AEMA 1KY5A 3RJ5A 1IPEA 4RVFA 1DIRA 3SEFA 3KEQA 1H9AA 5JW6A 4R1UA 2QRLA 2Z1NA 1EFLA 3GT0A 5DBGA 1V3TA 5C37A 1GZ4A 4QXMA 4KUHA 2ZQYA 1HDCA 3ANNA 4MOWA 3FWZA 4RVHA 3ZNOA 4AJHA 4IM7A 2G76A 1B8UA 2BMAA 5AOVA 5JYEA 5G0SA 1H93A 4J91A 1DEHA 5DDIP 3H9EO 2ZB8A 3U9LA 4BNTA 4ESOA 4F45A 4GMFA 4WEOA 2PH3A 1GUZA 3OA0A 3JTMA 4M55A 1T26A 2ZYDA 1NVMB 4ILKA 4RDIA 3VPGA 1ISJA 4XQEA 5GZ3A 4CM4B 3WFIA 4KWHA
chains in the Genus database with same CATH superfamily
4DNFA 3FNGA 3QOWA 4W1SA 1V8DA 3ZJ4A 2RARA 1S3IA 1SKYB 1Z6XA 2GKSA 1KH1A 3AUAA 3O26A 4UM9D 3TLEA 5KKAA 4CWAA 1ADBA 2QI9C 1TU0A 1CQIA 1I6LA 3QLJA 3DBHA 4GI3A 1TPZA 4XOUA 4D9CA 2ET6A 3JWPA 4IIJA 4WRRA 4Z0TA 1EUCB 2G04A 2JCVA 4ZKEA 4BN4A 1I2DA 4WGFA 4G4IA 5CYGA 3KTOA 1MF7A 2JEZA 3GVIA 1BXRB 3MJVA 4XEUA 2FUNB 1EGQA 1MH9A 5TPWB 4OP2A 2ZJ2A 2I3GA 4YC7A 2FLWA 3MAJA 1BWQA 3ED1A 3DAHA 4OI4A 1M10A 3HYNA 4I4TB 5AK6A 5F3WB 1H1LA 3E1GA 3NI2A 3C7DB 2YCBA 1HQKA 3EY4A 4H4DA 1IOWA 1J5XA 3CF2A 4ECAA 1YUNA 4GS5A 2WT8A 3QEAZ 3U44B 1CR0A 5IZCC 2ZBRA 4JB3A 4N03A 1XDDA 1S9DA 1SRRA 3Q7TA 4IH1A 4WKPA 5AW9A 1A7AA 3ZWNA 3TIGA 3EQZA 4BJ1A 1DKOA 3PR1A 3GMIA 4KQMA 4U6SA 2QJFA 2QOEA 3GJ0A 3HV2A 4IOLA 4UUQA 3W8EA 3G0HA 2XOEA 4A10A 2Q6IA 1E1YA 1YQXA 1FNCA 1T4CB 1HE2A 1G5FA 1UK7A 2Y27A 3EDCA 3JQQA 4HWGA 2NZYA 1C29B 2RAVA 2YASA 1PTJC 3BGVA 3BVPA 3IMGA 4MVJA 1QHXA 4ARBA 4BUCA 4N54A 2XHZA 5KSYA 2DECA 2ETVA 4KVGA 1B26A 2A4KA 4PLTA 1PYDA 1KZGB 1TIKA 4DM3A 1BHSA 3S1AA 1GXSB 4D02A 3G8CA 1U0HC 1PT7A 2GFQA 3OZAA 5E4YA 2UXCB 1SOMA 2ZUSA 5EAIA 1P7ZA 5IRCD 1TZJA 4M8NE 4MQLA 2FPPB 4FE4A 4RHYA 1L5HA 3AEUA 4CIAA 3DQQA 1QQTA 4DLUA 3TNFA 1C8KA 5I7HA 1SOAA 3QHAA 1RADA 3MCZA 1MIOB 1OWPA 3O92A 4L85A 3KSBC 3VC3A 2AI2A 2R5NA 4G37A 2VEDA 2P0AA 3ZJ5A 4JKOA 3OWXA 1X7WA 2IVFA 3A4IA 1NKTA 3HKEB 1RWNA 2IXGA 2PXHA 2VTBA 5AHKA 1CW2B 3SKXA 3ZE8A 3D1LA 3GP8A 5JIBA 2WYVA 2V54A 3AVWA 5CDFA 4PO1A 1K88A 3KKQA 3UOAB 4B3GA 5ALKA 4IOMA 3K4QA 4AZTA 4RTKA 3NC1C 3PICA 5F64A 1PG0A 4I9UA 1W9HA 4AY6A 4US1R 3FR7A 4RQBA 4ISCA 3IR6A 3B1YA 4I5EA 1PJAA 2CHQA 4FC6A 3I23A 4FXPA 4EELA 4TRJA 5KNBH 3SR4A 1XAHA 2EFHB 1W94A 2FJPA 4HSEA 2WM2A 1IJBA 2JIZD 2OM2A 2GLUA 3CW2A 3OM1A 3GUCA 4QT4A 1RKXA 3E0QA 2Q6LA 1KAHA 4A1OA 1E1RA 2HQRA 4NAUA 5BO5A 1A9QA 4UMEA 2GPSA 3DLBA 1V3VA 2EFYA 2GN9A 4TZTA 4XR9A 2P2ZA 5M04A 1BCSB 2FSUA 3GFVA 4M9SA 3KZVA 2XXBA 3HY3A 1I1NA 4Q4HA 3RVLA 1OKKA 3V8BA 1AJEA 1EBUA 1VECA 5K4GA 4E13A 3MVEA 1D2NA 2E2WA 1T5BA 2OXRA 3FZQA 3IA7A 3LWDA 4CM9D 1RMTA 2JD2A 1L7RA 2FHSA 4WKOA 1NC3A 1W1WA 3KOMA 3LPAA 4HL6A 4WEQA 1G6OA 4OQLA 1NJGA 2ZVJA 4HS4A 3VHRA 1MV5A 4XFKA 4RVUA 2YRXA 4B74A 1T1EA 1X7XA 1YIDA 4IDFA 1T3HA 2VSXA 3NLLA 3V7YA 1VL0A 1ZR4A 3TW0A 1ZUNB 2W6ZA 1ZVJA 5HG0A 5CGZA 5FOXA 5TNXA 1PSZA 2Y9MB 1WNTA 4BGDA 3NIBA 1KDVA 5AYVA 2V5VA 1GCIA 2XWQA 4FEEA 2IS4A 4EA9A 3PWSA 1KVTA 2NU9A 3BH6A 4IUYA 5KHLB 1UL1X 5HK8A 4EM6A 4OYLA 3T61A 3B6MA 4PFJA 4WDRA 3OT1A 1FY2A 1XQXA 4H08A 1DBWA 5EWJA 1N2GA 5CVCA 1PYOA 2AV6A 3WDKA 2AMYA 1G9TA 4K0KB 4Q1VA 5DCLA 3AXTA 1L5FA 5KX5A 3OLZA 4URYR 3HS3A 1Z8DA 1NNLA 3MINA 3ZK7A 2XUAA 3PDIB 5AUOB 3ES9A 4JU8A 1JJIA 1QGUB 5F7OA 2KLBA 3K8ZA 3OIVA 1NNUA 1DV1A 4Q3CA 2HBQA 2W6JA 2F90A 3SHFA 5CX4A 2FPRA 1P61B 2K4MA 3GEMA 4PLPA 3U7IA 1Z7YA 4H7DA 2ZUTA 3S2IA 2H2IA 3PWKA 1Q0PA 3RC7A 3MLEA 4EO7A 3G1UA 2CL7X 5MN5A 4RVGA 3DE7X 4FX5A 5EFZA 4JDUA 1M6EX 2WU1A 3CZ5A 2FQQA 3JVVA 3X1MA 5AVOA 1EDDA 3EEOA 4L72A 4HX2A 1O96B 3LTEA 4JBHA 1JMVA 4MKHA 3GCXA 2E1RA 2CVOA 3DHVA 4JKYA 4AFNA 1ODTC 2GCOA 1KOLA 1BH6A 2F3RA 4PAMA 2IEZA 1G4HA 3FF4A 3I04M 3KOXA 1GNSA 4O63O 3TPFA 1PDWA 4U63A 3SSAA 2WWFA 3G9UA 4BKRA 3O3OB 1DAKA 2VHYA 3E1KA 1EJ0A 1T3ZA 3QG5A 2NMVA 1J9EA 4AKIA 1V5GA 3RI3A 1HSOA 3N2ZB 2UUBB 1CQIB 1N8KA 5B7PA 4YQYA 2C2XA 3DBHB 2CXRA 1WKBA 1W29A 1VG9B 4IIJB 3L1KA 1JKIA 2Y1FA 4TV8A 1OROA 1P29A 4EUKA 2YXEA 2C97A 4KH0A 1E92A 1OHHA 1X1EA 1N7HA 2GN4A 2R11A 3FGNA 1BJKA 4G24A 5JQGF 5CYFA 2FUCA 5B2EA 1EXVA 1I30A 2KS6A 1WZCA 4RMHA 1VRVA 2HCFA 4ACAA 5CLHA 3EMVA 2R6AA 3GT7A 3H2ZA 4CLEA 4OXXA 1E6KA 1HKUA 1H1LB 2AFHB 2XB4A 2YMQA 4L8LA 1G8SA 2H18A 3IHTA 3LA8A 3LZDA 4RELA 5EE9A 3UJNA 2ZRLA 1NFFA 5BRAA 3WYDA 3BREA 5JPIA 4GMGA 3QVMA 4X20A 2GRUA 5D87A 1PG5A 3AVYA 5KTKA 1T4MA 1N25A 2IXTA 5ESWA 1QXSA 1YT5A 4XVRA 2Z4TA 3PHBE 3LQ2A 5JZSA 1H5QA 3AP2A 4NBUA 3JWJA 4LHEA 5ECWA 3HZZA 4D3YA 3PDHA 3NAGA 4FXOA 1ZD1A 4G6ZA 4KMSA 3ZIUA 2XBLA 2O3JA 4ALKA 1OXSC 1UEXC 3DVRX 1X1RA 2VDMB 3LU1A 3KYCA 1HT0A 1BWSA 4DV6B 1RPZA 1JVBA 3DV0B 4Q39A 2HR1A 3W6ZA 2ECFA 2X0KA 2YXLA 4Y9SA 1SVKA 3SC4A 5EMMA 1SKQA 1XPUA 5BUQA 2DHRA 4IPTA 3BWCA 1BKDR 3F9IA 2WRZA 4P3OA 4W7SA 2EFDB 5DF1A 3T94A 1WMFA 3QOXA 4HAOA 1JMKC 2BEJA 2P9QA 4X41A 3HCOA 4NL4H 4ENRA 3O8BA 2D13A 1DTWA 1L5HB 1RABA 3A26A 3AEUB 3I1YA 3CE9A 3JAWA 4IUBS 4NPHA 4Q02A 1SUCA 2W6QA 4ZVQA 5IM4A 2H8GA 2C4UA 4FP9A 3TEMA 2I3BA 3L1IA 4RQUA 2H57A 1O95A 3C6XA 4A0GA 2C9DA 1KI1A 2PD6A 3K0CA 5BSMA 5LMUB 4M0FA 1NNSA 3T3PB 2ZWOA 3ITEA 3QNUA 1L8AA 3C4VA 4R0NA 3O9VA 1W5EA 3QWBA 1RLIA 3T41A 3TOCA 3NONA 3F8WA 5LFAA 2VTBB 2RH4A 3AWDA 1TEHA 2FVXA 2R9VA 2Z2YA 4M87A 2GEBA 4UM5A 4E88A 1KEUA 3RVQA 2MSDB 4JEIA 1I13A 2QTAA 4LA4A 5F2KA 1TUEA 2A92A 1H1TA 1KAQA 1EQ2A 3H5TA 3O5AA 3NMUF 2H8KA 1RSZA 1XDGA 5EP2A 1R0XA 3OU7A 2EZUA 2W5UA 3UB3A 3KUDA 4CL8A 3WYAA 1U1DA 3GFPA 1T2NA 3HUEA 1G7CA 1P9NA 1F6DA 1SCDA 4BBZA 4DG9A 1QIDA 3L8FA 3HMQA 1NTRA 3EZ7A 3NANA 5ILQA 4DVJA 4RBNA 3ETEA 3K30A 3E7DA 4I66A 2ZBPA 2PANA 3F6PA 4R7ZA 3WQBA 5BWLA 5TMPA 1Z15A 2BSQA 1NULA 1AZLA 2I7VA 5AW1A 3PDCA 4LBYA 1VFNA 5C1PA 5IZCA 2C7RA 1Q1ZA 5JO0A 2XITA 4ITVA 1VI2A 3MBKA 3UCEA 1UCFA 1HYEA 4Q4HB 1WW8A 1U1IA 3MT0A 2Q7OE 5KU7A 1AF4A 1CIPA 3EZGA 3I1FA 3U4HA 3PRYA 3F46A 2XTJA 4MRRA 2IWRA 2P5TB 1KDRA 1FQOA 3FYCA 2MSEB 1MX5A 3FPBA 1S1MA 3OZEA 4B0PA 1UFRA 2IZ0A 1V39A 3FRHA 4HOYA 1P4GA 2WHQA 3UMCA 4MGHA 3H7IA 2BFFA 1OBCA 2TSYB 1PTJA 3CN7A 2OE2A 2CZQA 3L43A 1GKYA 4I50F 4MVJH 3SYNA 3A6EA 3UHJA 4AUKA 2Q0HA 3LT1A 3MB5A 4HLCA 4NYIQ 1W9MA 4NCNA 3PCXA 3PTZA 3TRIA 1J2TA 4ZI7A 2NU9B 1FDRA 2OD9A 1O0CA 5DI3A 2NTJA 1X80B 3KQVA 5IJAA 3TRJA 1FW8A 5EI5A 2C2GA 3FH0A 1ZN7A 2SKCA 3RS9A 1O03A 1SUAA 1P2VA 2VYVA 3H5VA 4TL9A 3ZDEA 3BZUA 2XNJA 2RAFA 4BN5A 1Z68A 5EWJB 4D3SA 4W1RA 1M1NA 4L95C 3RVBA 5U9CA 5MF6A 1CFZA 1VHWA 3GJXC 1WTCA 3A3OA 3K9LA 5DGXA 3IS3A 1C4KA 3UT5B 3WWZA 1XNQB 3MINB 3VKWA 4CDRA 1PK7A 2V7UA 5ARBA 3MJRA 5EPOA 2DT5A 1CDDA 3V1LA 4PNEA 3CSDA 3FCUB 1GSIA 2ZXFA 5IDVA 1SWVA 3S8YA 2A3RA 2VYQA 3TTXA 2PH1A 4H60A 3D64A 3HCRA 3K16A 3LXUX 4BKOA 5BR8B 2ZK7A 1C0LA 4IHJA 1LS1A 3W05A 1W5BA 4UC0A 1TGVA 2VT3A 4C7VA 4IQ8A 4ZHQF 5KNDD 3GBSA 1RRMA 4MA5A 1O54A 3RASA 2ORWA 1UM8A 3HVIA 3MPOA 1OZAA 4ZU1X 1R0BA 1VYVA 2GCOB 2JHPA 4A8HA 3VDQA 1P1HA 2XXJA 3K5PA 1L9XA 3T6KA 1E8NA 1EGAA 5GY7A 4B4UA 1Y3HA 2MTBA 2WJYA 3SSMA 4TTPA 3BXFA 2VN8A 4AY4A 3I8XA 2GD2A 3F73A 2EVWX 1SXGA 1XEFA 2R79A 4EPWA 2ZULA 4R41A 1SHZA 1DZ3A 4V0RA 2YJZA 1K66A 2PL5A 3PA8A 5GMOA 1DEAA 3T1QA 3LOQA 3PR3A 4I1VA 1WCIA 2HJWA 4N7BA 1F5SA 1PEKE 1NI5A 3NIWA 4XSVA 1NFRA 3BGSA 3T3DA 1OCEA 4UTVA 3GLIA 1Y3FE 4H4EA 3L8YA 2JLUA 1BKYA 3PE3A 2PUGA 3L18A 3R7NA 1Q5PA 3RYCA 3IE1A 7YASA 5I7AA 3ESCA 4AKTA 2QRUA 3EB9A 1OR8A 4OL0A 5K09A 1P72A 4R3UC 4FPXA 4MKXA 2GBFA 3RNLA 4ID9A 2AX3A 3CG4A 4OYHA 2WAOA 1OXUA 4YV1A 4UM8B 1R88A 4EY6A 2DFLA 6AT1A 3TW8B 3NTVA 3TRFA 4CUKA 4EYOA 2XKAA 3NUGA 4WECA 2W2LA 4MJLA 2HU5A 3KYIB 5T4FA 3TTUA 1ISMA 3AFGA 3CF6R 1MB0A 5HF8A 1HSZA 3VAYA 2ZYRA 4ZVOA 1TYBE 4OHUA 3KT3A 2CNLA 2JK0A 1XIVA 3SSNA 3WFJA 2EBHX 3GC6A 3C3EA 1LTKA 4O4LF 4UU0A 4UTRA 2FZ4A 1DAMA 1GV0A 1ZW1A 2XUGA 4BX3A 4G1EB 4RTPA 1QK4A 3DGEC 2WKRA 3MJFA 1NLZA 2RGXA 4OUDA 5ES3A 5TGZA 2PA0A 1QAMA 1JEEA 4YRCA 5L4NA 1Q0SA 3KL4A 3H16A 1A8PA 5HZMA 1NV8A 3DDUA 4B34A 1ST3A 4OLAA 1DQZA 1BJRE 2YZMA 3ICCA 4RSHA 5DM4A 3C1OA 3S7ZA 3SHVA 4L2IA 2J9GA 1LLQA 4KAAA 1XQWA 1NATA 1MC4A 2VHUA 3JAWB 1DTWB 1E1QA 1WUJS 1N7IA 2XTNA 5KYNA 1QF6A 1N2CE 1P2TA 1FS4A 5LXTB 2XTAA 3TYXA 4B7ZA 1IUKA 4IG4A 1QIFA 1ZC4A 2OUIA 5A62A 2ATVA 3D2BA 1T0UA 4L4SA 1HEYA 4HNAA 5DW0A 2ZWVA 2IXBA 4HH0A 5KYKA 3DFMA 4KI0A 4HDAA 2L18A 1RMQA 3OFND 1JKXA 1IVSA 1DBIA 5HFJA 5EIBD 2VP0A 1A9XA 4MW0A 2O7NA 3TL6A 4C29A 1AGXA 1Q44A 3IRVA 1BG6A 1GARA 5ITZB 3L6RA 1ZMBA 3OZUA 3EYWA 1QZZA 2WMNB 4RGBA 5BQ5A 1WB9A 1ZGAA 3CX8A 2R7KA 1P17A 4RDHA 4PV7A 3R7AA 4EI2A 3OCXA 4NJEA 3PE4A 2JFQA 4U7WA 4GFDA 1H2EA 3P27A 3TEJA 2FMFA 3QF7A 2Z30A 5KVSA 4QZVA 3CWZA 1NASA 4D25A 2Y66A 3HR4A 2ZBDA 3QIAA 3FTCA 3PNKA 4LY0A 4BU0A 1K4MA 1DFGA 1DBQA 1N6HA 4YJ3B 1C1HA 4LF4B 1NHGA 4P80A 4IJKA 2QTNA 2VZ0A 2WD8A 2C78A 1SBHA 1Z12A 2X13A 1QTNA 3B5EA 3RIYA 4NOLA 1U2DC 1UBOS 4S0ZA 2V6BA 1LRJA 5JANA 5A2QA 3HHEA 4JB0A 3UFXA 2XR1A 2VNIA 3V5NA 4R2LA 1X2EA 3O21A 1DX4A 2YQZA 2E89A 1Z2AA 2WAXA 4BFSA 2IK8A 3H0EA 1O6FA 4Q1FA 1YWGO 4MCAA 2ORED 4HQFA 4W1QA 4IO1A 5ALMA 5C5IA 3VVCA 1H0RA 1Q0RA 1I80A 2BFFB 2J9ZB 4OK5A 3LHFA 1XNRB 1MT3A 5CT8A 3MT7A 4XJXA 5B3AA 4KR9A 4PGAA 3EXEA 1PT8A 5J2TF 5KU1A 1R6TA 3G0IA 5EPUA 3IBTA 2HRCA 4BRZA 1E69A 5KUTA 1CR6A 2CE7A 2FW9A 4I5DA 1HL3A 2R6FA 5FR2A 5KYXA 1NUAA 4C30A 4BKPA 2G36A 3G0BA 4QYMA 1V3UA 2H0AA 4C7XA 3ZN2A 1SBZA 4ZI7B 2PUEA 3RANA 2CVPA 4YDHB 4ZOEA 3TZKA 5JXHA 2VXYA 5DI3B 5E9QA 5IVKA 1SC3A 1TJ3A 3I53A 3M5PA 1EHCA 3IDQA 5FOSA 4NDAA 4U9IS 4AK9A 3F6CA 4ZAVA 5CT4A 5K0FA 4AJPA 1VRCA 3U4DA 1AQNA 4YX9A 1M1NB 3DW3X 3G2LA 1PX0A 5DYGA 1DDOA 4J29A 1JR3A 4LWZA 3RC2A 4IDGA 2C7QA 4NZ9A 2MT9A 4UMFA 3V42A 4B82A 5KS2A 5KQPA 1H0SA 1E3WA 4V3BA 1FQKA 3FCYA 3RFXA 2RK4A 4LYHA 4LHXA 4V38A 2GESA 4Q47A 3P96A 2OQVA 4RANA 4DZRA 4YJ2A 1TIBA 3CA8A 2V0NA 2X5OA 4HWTA 4KMOA 2GAFA 3DJYA 2BHSA 1TQDA 1LH0A 2V9CA 3LA6A 4PAWA 2GBLC 2QUAA 4YJHA 3PWZA 2DZDA 2UXDB 1PV1A 2AG6A 4W1PA 5F4ZA 3NXKA 1NYQA 4P84A 1QH9A 3OAAA 4XGNA 4ZQFA 4D5GA 2EFJA 3ZG6A 4PN7A 2BHRA 1XCJA 1SUBA 4GR5A 4IHJB 1M67A 5TY0A 3KETA 1KOFA 3C3WA 4PX5A 3UJ9A 5TF4A 4FU0A 1JDNA 1FFGA 1U6IA 2V7QA 2VJAA 2D8AA 1M34A 5B6PA 1YTLA 1TTHA 4Z0NA 1I5EA 5C1IA 3OE5A 3WGLA 4C43A 1Q22A 2XB9A 5KVQA 5JWOA 3VNQA 2HH9A 1GZ7A 1VYTA 1I10A 2YFYA 4LNUB 5HJ5A 1Z6YA 2CK3A 1FX1A 3HPQA 5D3QA 3QKWA 1T8UA 5EE5B 2L82A 4GLFA 3RYIA 3HDVA 4RK4A 1U3UA 4TKVA 5LQUA 1Z6TA 4DYHA 4OAPA 2F1OA 2CLEB 1ODLA 2VA8A 1WCIB 3O9ZA 2VT6A 5CFNA 3FRIA 1YCGA 3GEIA 5JV5A 5TQVA 4D3DA 2WAYA 2VA9A 4GLJA 5BSFA 3RJ9A 5BYJA 2F3TA 1DWQA 2C8LA 3K9WA 4BLVA 4H1UA 4TWIA 4YH1A 1U81A 3NCTA 3RYCB 3OOWA 2P78A 4WXYB 1PUXA 2GTHA 3QA3E 4NZPA 3NU1A 2FMUA 2RHHA 2RSLA 3AR8A 3GP3A 3JR7A 4IJ5A 5FNZA 1RXCA 4KN8A 5DNAA 4ZVSA 3J80A 3C16C 2AXEA 1SC6A 1Y6GA 2PY6A 3UBMA 3KQPA 4JVOA 1L5QA 5BURA 3FUCA 2VHZA 1ZGZA 4Y0VA 1ITZA 4LZPA 4X63A 3VDRA 5IBQA 3CX4A 1TYCA 2DR0A 5IYZF 2IX3A 2FSPA 5T8KC 1VIYA 4YRTA 1UWVA 5K8TA 2KW5A 1KMIY 3ENKA 5H3CA 2FF7A 1UZNA 3VRHA 4UAJA 1IEQA 5BPHA 1NMYA 2XDQA 3ZY4A 1WUHS 4BO0A 2EU8A 5FJJA 1OI2A 2CFSA 3H5LA 4H17A 4QPZA 2CLCX 2IP1A 4XWAA 3HC7A 5KYGA 1DFHA 3FOWA 1Z2OX 4V0SA 2OY0A 4JQSA 4OUDB 1JHRA 5EXPA 1YS9A 2WU8A 2QZJA 4ITRC 4KK4A 4P7JA 3QVOA 4WZBA 2ZAYA 3FPCA 4EY3A 2XD4A 3F7OA 4Q1EA 2WICA 3V97A 3RVKA 2B9VA 3IPXA 2IL1A 4B6FA 4L2IB 3GFQA 3FFXA 3KHKA 4X3OA 3EVFA 2QLMA 3DOEA 4D9EA 2W22A 1U7OA 2OXFA 2GF0A 1N5JA 1Z17A 5AVSA 4YI3A 5EIWA 1V7ZA 3UQYS 1H8EA 3KPVA 4MA0A 2QQFA 4NOMA 13PKA 3CZ4A 1KAEA 4HGZA 3EFOB 4HNAB 4JEUA 3NHJA 4CMEC 4FR0A 5IULC 2GZHA 3C5WP 1E4VA 4IL5A 5F7XA 2DWOA 3VVBA 1XFDA 3CN9A 4IQ0A 3BCSA 4IR7A 4MQ4A 2O7SA 2FCRA 2G17A 1MUUA 5BW5A 4BQNA 3IPYA 3LC7O 5C8YF 1EFDN 3H3FA 3KU4A 4MP6A 2BM0A 4M88A 1SHJA 1K7YA 3ZGVA 2EG5A 1C2TA 3OC6A 3EFEA 3NX4A 1FSFA 1T9GS 5BT9A 3CRQA 1AKTA 3REQA 4EYQA 5C2JB 3LGAA 1TO2E 1JPNA 2VDNB 3TOXA 2PT9A 4NJEB 1KRWA 2B2CA 3DCYA 2CD9A 1SEVA 3MTBA 5K7SA 3UKOA 1LVUA 3HEAA 1C9MA 3H6HA 3QYFA 1WM1A 2H4HA 1QV7A 1HL7A 1NBAA 2B30A 2RGAA 3LO5A 3RBZA 4N3GA 2FPWA 2PGJA 2DFKB 5K0CA 3LQYA 4LVCA 2A5LA 3JRWA 2PFSA 1EFCA 2B7CA 3GQVA 3PSAA 2QPOA 3IJEB 2BM9A 1CUIA 4QEKA 4M0LA 1QCDA 2FN9A 2AD1A 4FLEA 2VHCA 2E4VA 4JGGA 3SYMA 4ETIA 3AU9A 2E82A 3UFXB 2BZSA 3LZ6A 3WP0A 2OO7A 5B7QA 5A6VA 4QG7A 1JJVA 3R7WA 1XA3A 4CQMA 3DBVO 3RUEA 1JG4A 4ZI3A 1VE5A 4PG8A 4YRZA 5DOVA 1J5PA 2AGVA 3F74A 2Q1WA 4JSTA 1OT3A 2BGRA 1GTZA 3C0KA 3C3CA 3CR3C 4UJ3A 1FIUA 4MGZR 2IH5A 1V6CA 4WIAA 4DPKA 1XTIA 3N0TA 4R8LA 1KVSA 4B6OA 4E21A 1PJ3A 2C1EA 2KB0A 4RF4A 3GLGB 3CNQS 3PV0A 1FS5A 4ZO8A 3E9MA 3GNSA 1Z3IX 1UKAA 3S2FA 2I3AA 4Z0PA 1KQGA 4CV0A 5DMHA 4PLCA 1XZ8A 3ZWXA 5KYXB 4UDXX 1TW3A 1CJBA 2EDAA 4LBWA 5AOCA 1UPCA 2WSSD 4DTIA 3ICEA 4PZ9A 4DB2A 1N8NA 2WWHA 1NWCA 2NZJA 3E7PA 3HJNA 3TEFA 2G25A 1Z8NA 2PIAA 3M6WA 4CMIA 4MHTA 2GLTA 4OGGA 3SOZA 3A11A 2Y9ZA 1FTSA 1SO8A 3FYHA 3IX7A 4LZZA 3LLCA 5EZ5A 3V34A 4BVFA 5A5VA 1Q1GA 4HWPA 5A9SA 1F38A 1EE9A 2IHVA 2ZBGA 2O48X 3C97A 4LXIA 4Q3LA 4RD4A 5DM60 1ISPA 1W4BA 1OLUA 2R8ZA 3KR0A 3QG1A 1QCZA 4RWZA 5FQOA 4NFLA 3TOSA 4YT2A 4U8HA 4CR6A 1UQTA 3K6KA 3DR3A 1E63A 3HFRA 5DHUA 4YT8A 4FFLA 4GEKA 5EP4A 4JWTA 4BMDA 4IXMA 5TVKA 4EJFA 5JZVA 3LUJA 1Q12A 4TT3D 3OLQA 2O07A 4QIHA 1C30A 4EKGA 2IYAA 1QUFA 2Q2VA 5JASA 3KOUA 1A2BA 1UPUA 4HB2A 4YJHB 4ETWA 5DN9A 1SJ9A 5HEKA 1BD4A 3DQPA 1SKAA 1JXAA 3ZH9B 5HYVA 5TIIA 2O9JA 4IZOA 3DP7A 1NMQA 4JLVA 3KHUA 3BF7A 1TW2A 3KXIA 1KMNA 4FUTA 1IH8A 1U6KA 2PGAA 2VBCA 6REQA 5BN4A 2OFFA 1GQ2A 2KBEA 1CX9B 1M34B 4Q3AA 5DGHA 3STXA 1KH2A 2R6JA 2W6ID 3ADKA 3FDIA 2ZSAA 3INRA 2C04A 1MQ9A 3LUDA 1KQNA 2JC3A 3JZFA 3LUPA 2B34A 2YQ4A 3LP8A 1S4MA 1U2DA 3AHDA 4EHHA 1DC6A 4LSWA 2IYRA 1P1CA 2BI8A 2R3SA 4TWAA 3ZOZA 3O03A 3K9HA 2XB2A 4RHXA 4DQ0A 4RD3A 4TKVB 4FBLA 1G2PA 2ZRFA 1YNSA 2JCSA 1NE7A 2AC7A 1FVOA 1BJTA 2VF7A 1JFFA 3EQ6A 2XMZA 1CETA 4AP5A 4O2RA 3WL6A 4WXMA 4CV3A 3UTDA 4WY8A 1U3CA 1E32A 5E3JA 1SBQA 1JHXA 3AV0B 4TQUS 3V2GA 1KORA 4OHZA 2OV1A 2CF6A 1PQWA 3KCNA 4IX9A 4IYRA 4O5AA 4MIKA 3W6NA 1XNGA 2ZB7A 2XWBF 1ADCA 1IXYA 3ECSA 2D5AA 5KNCD 5KCMA 3OBIA 4E2WA 3PC3A 5AJZA 4M37A 2I0FA 3O4RA 1VCNA 4WBNF 4ZIRA 2QL9A 1XTRA 1H9BA 1HMPA 3NBUA 2XQJA 3HCDA 2VQSA 2BBWA 2NUAA 5A9RA 3DA8A 4R40A 4BO8A 2UYHA 2OZLA 3AJ9A 4OH7A 1RR6A 4N3NA 3WLAA 4H6PA 5H83A 2J3QA 3VO1A 3S2UA 2QTHA 1S8NA 3SIWA 4O4HF 4UZFA 4H1VA 4MUYA 3ZUGA 2IQIA 2XDQB 3ICWA 4RV9A 3GFGA 3ZCPA 3G2IA 2GI4A 3TQRA 4OI2A 4CR8A 4JXJA 4H1HA 4OF4A 5ER9A 4ZYZA 3WLLA 4I4NA 4DLXA 4BV8A 1UJCA 5LP6A 3ABSB 4BTEA 1MCZA 2AF3C 3CH4B 4K9NA 1FA9A 2VDJA 2GBLA 4WZBB 4DCNA 3TSZA 2W2KA 5U4QA 3O3CA 3OHPA 4BNYA 4FYJA 4B3TB 3A9UA 1DIGA 4AIIA 4BATA 2F8TA 1F0NA 3R0JA 5TF0A 3CPSA 4D8VA 2CGEA 1KKLA 4HLQB 3CNEA 1ZIDA 1I9GA 1FUIA 5K8JB 3HDTA 5LD2C 1FS6A 5LU9A 1C1YA 1P62B 3AV3A 5TC4A 4DCGA 3TFOA 1IAQA 1Z4OA 2O2HA 4JLDA 1NQTA 3WZMA 3ANXA 4ENPA 1DMSA 5ICGA 4FEAA 4N5DA 1ULUA 1SPXA 4RGYA 4LWOA 3R4VA 4ER0A 1B41A 2O23A 5JBNA 4L22A 5CFQA 4UEWA 2B1RA 3CPJB 1DCTA 5LBIA 2CLDX 1Q2XA 2OCAA 2IU4A 3BE4A 3NRJA 4O2BA 4UEOA 4UHHA 4Z2YA 2QR3A 3L6BA 5KOJA 3WWDA 4G1BA 2RCYA 1DC7A 4G25A 1P5FA 5DCYA 2BMVA 1RI3A 3IAS6 1I6WA 2A9KA 1US8A 2C2WA 3KKNA 2C3PA 3OM9A 3RIEA 5K03A 1L1EA 2ZZMA 3I42A 4R8SA 3LT0A 3PPYA 4HBGA 4R51A 3VTAA 5CX1B 4DMMA 1IBCA 4AX8A 2R751 4GXNA 2A8YA 4E2ZA 1GPUA 2IOFA 2ZAIA 3C3BA 3M7IA 1U80A 2VEOA 3C5HA 4HQOA 2NPFA 1NF9A 4Q9DA 2QMEA 4MA4A 4NG4A 2YIVX 5ER6A 3MRSA 2ZYAA 1OZGA 5AKHA 2QE7A 3ONNA 4HGQA 1XLTC 1RJGA 5DIFA 3UJ7A 1NX6A 3EF0A 5ESDA 5T5QA 1ILEA 1JJAA 5DXJA 1NAIA 1EIZA 2J4FA 4HQLA 4DIBA 4AICA 1A96A 4NWIA 3ENWA 1S01A 5T8KA 1YDWA 4DA9A 4YCMA 1Z25A 2H1FA 1SOVA 4NJOA 3NIGB 3R7WB 3T0FA 4CQMB 4J0GA 5AP9A 2YOFA 5JNUA 1L8XA 2X40A 4G0PA 4GF5A 3N6XA 1EXMA 3JZIA 1V37A 1GNVA 2Q1SA 4GKVA 3A10A 4KYIB 5JDCC 1E2IA 1XBTA 3PNBA 3VR6D 1SQFA 2GETA 2I33A 2QPAA 3NOXA 1IBMB 3QIVA 4PICA 1EDEA 1XLWA 3CRVA 3VZBA 3WNZA 2GCPA 3KOYA 1QLWA 1WQ4A 3N2YA 1JU4A 4NYIR 2PRKA 1RXEA 2BMWA 3WRWA 2E87A 3UUWA 1PE0A 3HXMA 3SU8A 2QROA 5BV0A 3HABA 1XTJA 4R3NA 2DVMA 4GYWA 3GLHE 1MEOA 4ZVUA 4DLPA 2ICAA 2QQGA 1N77A 2QYHA 3TNDA 1PR0A 1WXHA 2XPCA 5JWRA 3W04A 3D6VA 4ALNA 2PX6A 2ZT8A 3L0SA 1BOOA 5HBRA 2RKWA 1NVGA 2AJDA 2NOGA 4TTAA 3I2YX 1Y42X 3S27A 2H59A 1O5OA 1DV2A 5A9SB 2VAWA 4JJFA 4KYUA 2CLIB 1AA6A 3Q4GA 1GL9B 5ALWA 4DY6A 4PNZA 4WHMA 4I2NA 4CMEA 1OLUB 2XI4A 2VWHA 3H1EA 3OICA 3GNTA 2DPMA 4D99A 4EDFA 4DMRA 1Z22A 4PSDA 1FUEA 3DDWA 4TQ9A 3PPXA 1JAIA 1C50A 3U0BA 3B8HA 4V0ME 2DUNA 2R4TA 4HRVA 5BYAA 2FKAA 4M54A 1C30B 4DRYA 3THSA 1FTWA 2C7GA 2REBA 3NM4A 4D98A 4D9FA 4EJMA 5FLXA 4UZEA 4Y2JA 1GM5A 2FZKA 2PLFA 2JGJA 1DJLA 5C34B 4I1RA 1BU8A 2PMCA 1GU7A 2GCGA 2OHXA 2QDXA 3AGPA 2IHNA 4LJLA 4O5OA 3OTIA 3HVHA 5ICMA 1Y5RA 4JB2A 1NVVR 2AR0A 3CNBA 1HNNA 3CEAA 3RC3A 4AP6A 2D5BA 3HQ4O 6REQB 4KCGA 3FTEA 4J0FA 5BN4B 2D0DA 3OT4A 4QUKA 2HN9A 1SZDA 4HUQA 1O6CA 2HNAA 4PGMA 4X91A 2XQVA 5ALIA 5M3BA 4M9QA 3C8UA 5JZMA 2I71A 4AU1A 3KALA 3QJYA 3K0HA 4F12A 2PWZA 2BR5A 1HLDA 4LFCB 1TUBA 3OZRA 1M8JA 4PZPA 4WOJA 4B5LA 1Q1NA 1Y7TA 3RRFA 1TAHA 2EFGA 2BJHA 1IVYA 4MLDA 3I2IA 3AW8A 4IGFA 1JFFB 1YA6A 4X8MA 5T57A 1VYHA 4DQVA 3R6DA 2WVHA 1RQRA 3HZHA 2G8LA 3QLEA 4QUIA 2FSVA 1GILA 1U9ZA 1NRWA 3WIDA 4HDRA 2QTTA 3EEBA 1Q3KA 4H77A 4I1YA 3GGPA 5LZ7A 1GZUA 3HUTA 2NZVG 3MWEB 3QXJA 2C9BA 5I9TA 1USGA 1ECCA 4Y7CA 5GJVC 1ZDMA 2A7XA 4UDYX 3TLMA 2HI0A 5KNBD 2J3JA 2Z09A 4FYYA 4PAQA 3LUFA 3TAXA 3OHSX 3RSCA 4H3HB 2CV2A 4Q37A 1ECBA 1FDTA 3AYZB 2RK3A 4P9NA 2CNWA 3LWNA 4KU4A 4MB0A 2OZLB 3H18A 3TCKA 4B32A 5IT4A 2VDQB 1W87A 4FQ5A 3S2EA 3C1UA 1B15A 3KJZA 1LZLA 1M72A 1CNMA 4JLNA 1E7RA 3QI2A 2FX2A 4R2WA 1AZWA 1O6BA 1XVIA 2H52A 3N8KA 1BWRA 2H7CA 3DCNA 1EX7A 1KJJA 1FNSA 1KI2A 3AETA 4CEIA 5DRYA 2OVFA 2B36A 2JLZA 4Z8YA 3AINA 5HIMA 4WUVA 5LP6B 3FWKA 5EJMA 5L51A 3M6AA 1NBMA 4DARA 2EYQA 3C3YA 5KMGA 2J3MA 1CDZA 2ZE8A 5EERA 1B0UA 2XTZA 3RRZA 2WWIA 2QJRA 3WJAA 4BOYA 2AKYA 4R3WA 2ZUBA 2WU3A 5K4HA 3GZJA 3HVJA 5AVRA 5K6AC 2X2FA 3CV3A 4CYMA 4XDGA 1K7SN 3NHRA 3Q7SA 4ZQEA 1J1ZA 2CN1A 3GJQA 4BO3A 3AI2A 1IBSA 3O3NB 4MH0R 4MQFA 2HK9A 1I7SB 3FNQA 1P9WA 3AG5A 1DMRA 3PUVA 2DTDA 2XWJI 3EEYA 3OX3A 5KHOC 2XYQA 3AZOA 2OXIA 4DL9A 1T3TA 5A2GA 2H85A 3BHNA 3OKPA 3U1BA 3FOZA 3QX3A 1VBMA 2C58A 1OLOA 4GZ3A 5D3MA 4X71A 1F2VA 1SXPA 4O2BB 1FUKA 2C5SA 4DV0B 4UMVA 3LBIA 4DREA 1POXA 1AKRA 1X1CA 2GM9A 2TECE 4KLZA 4RGQA 1JG1A 2P6NA 4LRWA 2Q41A 3UHFA 4S1PA 5JCOC 3A1NA 3DL0A 3M2PA 3NAZA 2B3TA 2IYSA 1US8B 4TM8A 3FIUA 3P2YA 1MX1A 5DLQC 3D3WA 3FRJA 4BNJA 3DTTA 1JFLA 1M54A 2BP7A 3OI7A 4IHAA 4CE6A 3COZA 1X70A 1Q50A 4L75A 3Q1LA 2QD4A 2VDWA 2RD2A 1YVPA 2DB3A 3W79A 2EW1A 3K70B 3EOBI 3KKPA 3TKLA 3QUQA 2AJLI 1XPRA 4E3WA 1M33A 5A7FA 3UAYA 2AN9A 3PXAA 1KC1A 1VKNA 1HA3A 4DQKA 5K05A 2RH9B 1PFKA 2I3DA 2ONYA 2CV1A 5AVVA 3ECAA 1B00A 3HLTA 3L92A 4LGVA 2V74B 3QVKA 1PHRA 3B85A 3D3QA 1GY8A 1XDSA 5BSGA 5KQSA 3U16A 5C3MA 3PX7A 5DWDA 2GBCA 1WP9A 2VUTA 4IMJB 2P3OA 4TLEA 5AKZA 4EEKA 3HUDA 3TXYA 5HW0A 4KV9A 1IN7A 1QLHA 2KWIA 4J03A 1W7AA 3OMLA 3JZMA 3U80A 3UGKA 5DBEX 3DD1A 2PZLA 2CEKA 4LQDA 2REOA 4MRAA 8ABPA 1N1MA 2P9GA 4RIIA 4K2AA 1XE3A 4IIEA 4OBXA 3M5WA 3KKLA 4OYRA 3M9XA 4TMKA 3SHQA 1Z06A 3FDXA 3VR4A 2PMFA 3HPRA 4L07A 3AG6A 3JAKA 1NXXA 4AZVA 4A1FA 3PPWA 4BASA 4EGCB 4IRMA 5CDYA 4OPMA 3CIOA 4BAGA 1PUIA 3KLOA 2NTNA 4KQHA 2BFBA 1YE8A 1PBTA 4W5OA 2QAGC 2BRUC 2CJWB 4JLWA 2C4KA 2HSDA 4YMUA 2AUNA 4LYEA 4C6HA 2KQUA 2PTGA 3K0FA 3OFVA 1DUSA 4FEGA 2W83A 4YBRA 1JBEA 1SHLA 3G17A 3PZBA 3ZGLA 4F4CA 2BE9A 3F5FA 3MTGA 4P4SB 1WVIA 1R64A 1NY6A 4MUGA 3KYDA 4AURA 2VUUA 1VJDA 5J5CA 1R4MA 2QRKA 5BMVA 3W8NA 1KJWA 2OLJA 5LQRA 4EVSA 2I29A 1P0IA 4JYBA 3ZWWA 1V1MA 4QLAA 5LCXA 2D62A 2JLSA 4RZ2A 1V8ZA 1P39A 1E5TA 1OFUA 5IXSA 2IEDA 4QLOA 4RKWA 3O82A 3DV9A 3NHLA 2HNBA 3OETA 4LRTB 4MP8A 4X60A 1LX7A 4DIDA 5I9LA 1BROA 2GA8A 3SS9X 2NNLD 4HWSA 2WPDD 1RHJA 4MPPA 2EJCA 1TZCA 2QN2A 4P4TA 2IZ1A 2B8EA 2XMBA 4IP0A 1E5LA 4HH4A 4BWVA 2MSNA 2DCMA 2PEZA 4GO1A 4DWOA 3PUJA 4NU5A 1BX3A 2HCRA 5C51B 2LXNA 4W8HA 1J09A 1I2AA 4G2TA 4C3VA 1ONSA 5JC1A 2C2MA 3GR6A 3KPWA 1Q19A 4LBZA 5TMEA 4D6YA 1BMQA 4PNHA 4G1VA 1OAAA 3OCVA 4G09A