4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
b'AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
3RC9A 3CZMA 4YVFA 4MVJA 5CEJA 2GPTA 5F1OA 1K89A 5KVSA 1A71A 1HSZA 4XA8A 3AFNA 3LSYA 3OBBA 3UAGA 4YJGB 1WAMA 3RC2A 4CQMB 2CY0A 4AJHA 3KV3O 1X1EA 5F3RA 1ZSVA 4ROSA 1RPNA 3WOHA 1KVUA 2V65A 1H6DA 1E6UA 1NTOA 3F6YA 3WG9A 1UXIA 3TQHA 3QWHA 4IDBA 1HSOA 2ZCUA 1ZK0A 1PS0A 5KJ6A 1B14A 1SOVA 2IZZA 3GGPA 2YHUA 1E1LA 3PTZA 4MP6A 4WNCA 2VOEA 3K2BA 4J16A 4W99A 3OEWA 5B12A 3ZWNA 3DBHB 4FFLA 1VPDA 4BL5A 2GN6A 3JQBA 4HFRA 5IDQA 2GF2A 3G17A 4PIVA 3QWFA 2E49A 3I9JA 2C20A 2Y1GA 2VZ9A 1T1RA 2WYWA 2V6GA 3RVDA 1P3DA 1E1MA 2PH5A 4FBGA 1PIWA 1ZBQA 3I4FA 4C7KA 3T4EA 5JAIA 3I52A 3L9XA 1HYHA 1ZK2A 4RPJA 4JQCA 5JPIA 1DEHA 5A05A 3DOOA 1I5RA 3M1LA 3AUAA 3GDOA 3PWSA 5IDWA 1O8CA 1QKIA 2H6EA 2POQX 2B5WA 2W2LD 3NEPX 5CDSA 1JVBA 2EXXA 4CM7A 5EQDA 3DTYA 4RVSA 4XYGA 5G0TA 3U4HA 3F3SA 3H8VA 4YACA 1XU9A 3U09A 2C5AA 2YV1A 4XB2A 3WFJA 4ZQBA 2YQ5A 4J91A 4PVDA 1N9GB 3OEYA 4O5OA 1H2HA 4KQXA 5FI3A 3TL2A 4FQ8A 4HADA 1MC4A 1Z74A 2R00A 4DLAA 4CM9A 3LT0A 3F5QA 3WSWA 3IOYA 3W6ZA 2GRAA 3PJDA 4CQMD 2HUNA 3DAGA 3ZH2A 1PTJA 2IZ1A 4Y8VA 3SJ7A 4ILKA 4LCJA 4YJHA 2B5VA 1B26A 1VL0A 3RUEA 3BIOA 1YQGA 2E6UX 3DZIA 3NUGA 4E31A 4WLVA 3GZNB 2CF6A 1UXHA 4DPKA 2GN8A 5THKA 3RFVA 3H3JA 4NBWA 2YFHA 2CVQA 3FR8A 5A9RA 1P1IA 2EG9A 2GSDA 3AOGA 1EDZA 1ULSA 1A27A 1I36A 4DVJA 1LU9A 3H9JA 3ZW8A 1XKQA 4IS3A 4DGSA 5BNIA 1I3NA 2Q49A 1E7SA 2HQ1A 3E1KA 3D0OA 4B4OA 1JAXA 4E5PA 3W8DA 3Q9NA 2FZEA 3INGA 3HDJA 3DFUA 4U8GA 3KB6A 4E4YA 1Y5RA 4BS9A 4C4OA 2QRLA 4UVDA 3HNPA 3TRIA 4IXTA 4IJUA 4XYMA 3TFQA 5A5FA 2EGHA 1SAYA 4QECA 2J8ZA 4CLXA 5C5IA 3RWBA 1PQWA 4OXKA 5IZCC 1K5HA 2ZJ0A 1CQJA 1X7GA 4E5MA 1PX0A 3Q6IA 1J5PA 4F6LA 3VPGA 1PZEA 3HN7A 1C1DB 1B8PA 1HL3A 4NBVA 4NFSA 3RI3A 2O7SA 1EBFA 1HTBA 1VSUA 2J5KA 3FPCA 3MCVA 3NDIA 4PG6A 1DC6A 1LNQA 1NAHA 1HDZA 2JHFA 2UDPA 4LRTB 4L8VA 4CMHA 4OOEA 4D7AA 2BHLA 1QG6A 4FJ1A 2R6JA 4DL9A 4HKTA 2GNAA 5KJ1A 1R0LA 4R1UA 4CL8A 4OXNA 1YS4A 5JO9A 4DTIA 2DTEA 4OYRA 4AJLA 4ND3A 4MP8A 3OQ6A 3JQ6A 3PYLA 3GEDA 2X5OA 4NBUA 3ZWXA 1HDXA 1ZO8A 4A0SA 4INAA 4BV8A 4CMEC 2XXJA 4MP3A 4M54A 5JNLA 1CDOA 3JQ9C 1RYDA 2ZCVA 4RCVA 2ZKLA 3GDFA 3TZQA 1QYDA 1RM5A 1WXDA 4NFYA 4GX1A 3H9QA 3OF2A 1DFIA 1FJHA 4IIUA 3V2GA 1B8UA 4IJWA 1SC6A 4ALIA 4MIOA 3GF4A 3A4VA 3QE3A 4U6SA 4NJOA 4PRLA 1YE3A 2DVMA 1QORA 4I9HA 2JFGA 2UUPA 4CLEA 1I3MA 2AQHA 5L40A 3UCFA 5BSEA 2JHGA 1I01A 4KUEA 1HE4A 3LF1A 3A06A 4WPGA 1MX3A 1XWFA 2JD1A 1VI2A 5HWSA 3BMOA 2JKVA 3X2EA 4YJFB 3L4BC 3ULKA 2CF5A 1R0KA 2C07A 2JCXA 3GNSA 4EITA 4UUNA 1LI4A 3DHNA 3HHPA 1LA2A 1UAGA 1DDOA 4UVEA 4BNTA 3W4KA 4YAGA 3C7AA 2ZTUA 5AQ1A 2ZYDA 4KTTE 1HLPA 3KSZO 4OMUA 2FPGA 3DBRA 4WLOA 5TT0A 5ICMA 3E6AA 4MVJP 4MIEA 3I6IA 1SEPA 1V3UA 2WDZA 3TL3A 4CMJA 2W2LA 3KYCB 4XQ9A 1Q0QA 1ZVMA 1IHXA 4CR7A 3AY3A 1OBFO 2GDZA 5K6AC 4U0KA 3E5RA 4W9NC 4KWHA 4YAKA 4ITUA 2B37A 1M75A 2QRKA 1Z6ZA 4M1QA 4TRRA 4R3NA 3EAGA 4J1NA 4EEZA 2H9IA 4AVYA 4RGBA 2GD1O 3NYWA 2Q45A 3RKUA 1NFRA 4CQMA 4XQCA 5G4KB 3PZBA 3AFMA 1U2GA 2GN4A 1LRLA 3FHLA 3ICCA 4XDYA 3VTZA 3WX0A 5FI5A 2PK3A 3K8ZA 3SXPA 4ZU3A 3OJ0A 4AJOA 2VHVA 1KEVA 3H5AA 4RPGA 4WOKA 5G2OA 4ND4A 3QWBA 3ORFA 3AY6A 3ANLA 3WR5A 4FFMA 3RBZA 4FB5A 5JS6A 4YCAA 4BO5A 1N1GA 1ZZEA 4BQRA 4FW8A 3WQSB 2QYTA 4RF5A 3R0IA 1QYVA 4JN6B 4YT5A 1ARZA 3AM3A 3JD1A 3MJ4A 1XQ6A 1A9YA 4JBGA 1GFSA 1E7RA 1JA9A 5HM8A 1GR0A 3AWDA 4I5FA 3AY7A 1EFLA 2NU7A 3HE3A 5KVQA 2NTJA 4CMBA 5KTKA 4EUEA 2HK9A 1Y6JA 5TJHA 2XAAA 3GY0A 5JC8A 3ASUA 3FI9A 3DBLA 1A4UA 1IULA 4NJMB 3H2ZA 2B0JA 4KUHA 3VZSA 4AG3A 1X1TA 2Q50A 1SB8A 3C1OA 3OSUA 1VL8A 2LDXA 2BFOA 2O3JA 1BMDA 4UAGA 4D0RA 1X14A 3LT1A 1ONPA 2WTBA 1R0SA 4G5HA 1MC5A 2CDBA 3LLVA 5JMPA 4WLFA 4RDHA 2OXIA 1CJCA 4PLHA 1JKIA 4FJ0A 5GZ3A 1X0VA 4OO3A 5JBIA 1Y9EA 5JDCC 4GSLA 1CETA 2Z1MA 4YPOA 3PHGA 1C0PA 2Q2QA 1EQUA 3WLEA 2DQ4A 4ZQEA 3UVEA 5DBGA 3RSHA 4XRGA 2JFFA 1GEGA 2WD8A 4BVAA 4YRBA 4Z0PA 3ITDA 4JJGA 4K6FA 3I9LA 1YVEI 4E3ZA 1TA4A 1VJ0A 8ADHA 5KKAA 3GMSA 4PLVA 1RKXA 2HLPA 5F1PA 3U4IA 4E5YA 3TFOA 2VYVA 3IKVA 1F8GA 1UXGA 2C5EA 2CMDA 3B1KA 3K5PA 3MJSA 3GAZA 5LCXA 9LDBA 4YYZA 3ADOA 1YL6A 3OJFA 3HQ4O 4PZCA 3PHJA 2C82A 3WGGA 3CUKA 4PG4A 1GPJA 3DONA 4GX5A 2W2KB 4B4VA 1ADCA 1E3IA 1XR3A 1A72A 3NT4A 3LC1O 2X23A 4E2YA 4BB6A 1PWZA 4RL6A 1EE2A 3WGOA 1R15A 4GX0A 3NDRA 4JROA 5KWEA 2WSBA 4BKUA 1MB4A 2J5QA 1E92A 4E5NA 2CVOA 2YW9A 2VWQA 3OJLA 2B4RO 4XGIA 2P9CA 3CZRA 4WE3A 5AXAA 1E6WA 4NMHA 3L6EA 4GX2A 1HE2A 4EUHA 1W73A 4BO9A 4CR8A 1EVIA 4DLBA 4JJIA 3WWYA 5DOVA 3GDGA 1DIBA 1J0XO 2OORA 2WMDA 2HKIA 2NNLD 1Q7GA 3CEAA 3DOJA 2J3IA 2Q1SA 2Y05A 3GHHA 1Q7BA 4CLDA 4D3DA 5C3MA 5JMWA 4KOAA 1ISHA 2VT2A 3JYPA 5FFFA 1DAPA 1LDMA 3IDSA 1NPYA 2HMSA 5JAMA 1Q1NA 3LF2A 3GOHA 4EYEA 4LVUA 4OHUA 4J43A 3CKYA 1WMBA 2HK7A 2AEMA 4XEHA 3PDJA 2CVZA 2OUIA 3HZZA 3NGXA 4MVJG 3ZWVA 4CMIA 3VPXA 4BMSA 4A26A 2BLLA 4TQGA 3IMFA 2C0CA 2X5KO 1W8DA 1DJQA 3U9LA 4LISA 5H82A 1ZK4A 3ZWAA 4BGUA 1FDVA 1PJ4A 1A7KA 2IDZA 2FPIA 4O63O 4NU5A 4DQVA 3EMKA 4CM1A 2O3UA 1HETA 3UH1A 5I7EA 1YOVA 4OJNA 3H4VA 1Z82A 2NVUA 4PLFA 4AICA 4YT4A 2P68A 3DAFA 1GCUA 3O8QB 4FFRA 2YJZA 5DCYA 4J1TA 5ITWA 2AG5A 5ENDA 5F5LA 5ILOA 1GQ2A 5L3ZA 3SLGA 1FK8A 4X54A 1GTMA 1NVTA 4YJHB 1C0LA 5EL0A 2GR9A 2PGLA 2IXBA 2X9VA 1CRWG 4DPMA 4YJFA 4UEOA 3VVCA 2X58A 3BTUA 3IIEA 3QP9A 3WBFA 3ROQA 1HYGA 4NZ9A 1QXSA 1O0SA 2IYOA 1SB9A 1J6UA 4IMRA 4RJTA 2NU9A 4IGFA 2DC1A 4DQUA 2ZQZA 5B37A 5TSDA 5IDYA 4A03A 3KLPX 3T7CA 4BNUA 1C14A 1IB6A 1HEUA 2E37A 4ZQHA 2PD6A 3CSDA 2VQ3A 1PGQA 4FOSA 2FHSA 3BTOA 3COSA 2RAFA 4M86A 4U5QA 5BT9A 4J4HA 4I08A 2VZ8A 1JAYA 4AJJA 1HE3A 5GZ6A 1ISFA 1IZ9A 2Y66A 1PJSA 1YH3A 4Q3EA 3FNHA 4RVFA 4ZD6A 5ES3A 2W98A 3FN4A 2FR0A 3MZ0A 5IF3A 4MPDA 4RVUA 1UUFA 1DLIA 1ADGA 2PGDA 2WE7A 2VRCD 1BDMA 2G76A 1XLTA 3CH6A 5HS6A 2ILTA 3STHA 4BKPA 5C7OO 4J4BA 1KYQA 4CL3A 3H65A 4LN1A 3SC4A 3GVCA 1WP4A 1NP3A 4KQWA 3IUSA 3QY9A 4WLEA 3AJRA 4AJ2A 3RIHA 1H6BA 2FPPA 1NBOA 1PJ2A 3E5MA 4HFMA 3TDKA 2HRZA 2JCYA 3GMDA 2I65A 3QA9A 3BMNA 4LCEA 4RPLA 5T57A 1G6KA 3AUUA 2J3KA 2AHRA 4LVCA 3ZV6A 3PRJA 2RCYA 3FNEA 5HS4A 1Y5MA 1QSGA 1B16A 1DFHA 3ZWBA 2GN9A 4N5LA 3RD5A 5A03A 3PPIA 4I8XA 2GASA 4NDNE 3P19A 4MOWA 3EGOA 5BR7A 1P1RA 4QX6A 4OM8A 1P1KA 1EE9A 4U0JA 3K96A 1OZAA 1YDWA 2AEFA 3JQFA 4IZHA 4RPKA 4GWKA 4R5MA 3DC2A 4NJMA 1MP0A 3I9NA 4CMAA 2PH3A 2OGUA 4OH1A 5L9AA 3PHHA 5I9LA 2OL4A 3ANMA 4KP7A 3UHAA 3H2SA 3HDQA 4WGGA 5T8KC 1F06A 4XYLA 3MJEA 3LVFO 4J90A 3ZHBA 4PLCA 5JYEA 1M66A 3BMOB 3U4DA 3Q11A 4ALMA 4XCVA 4ALKA 1VRWA 4GQAA 1RM3A 3TN7A 4PLZA 1IZ0A 3EK2A 3MTGA 3KSUA 2WM3A 1K6IA 2OOSA 4Z6KA 1C1XB 4BKRA 5I8WA 3KEQA 5DCUA 2OP0A 5A3JA 4LK3A 4W4TA 2Q1WA 3DBRB 5L7TA 4FDAA 3CMCO 2Y0DA 3TZHA 2Z95A 4BO0A 3Q0EA 1ONOA 4EBFA 4M89A 3TF5A 1N92A 1NXQA 1JU9A 3VZPA 4R01A 1NR7A 4YAJA 5IDXA 2DAPA 3ST7A 5CFZA 3S2GA 1D7OA 1O6ZA 2FZWA 2FSSA 2V6FA 2X4GA 3S2FA 3E18A 1YJQA 1K3TA 4P4LA 3PLRA 2PTGA 4RO0A 2EW8A 4FD3A 4N18A 4WEQA 2EKPA 1B0AA 4BNZA 1D1TA 2FWMX 3WDSA 3U4CA 1NWHA 4UUOA 2PGJA 3HJAA 1GQQA 4TVOA 4OQZA 2X0JA 3MJTA 2X8LA 2QZ9A 4B4UA 4ND1A 3V2UA 3HSKA 4K6CA 3KUXA 4LMRA 3UOGA 4JP3A 3VPFA 5CPBA 5MDHA 1IPFA 3O4RA 1F12A 1I2BA 2VWHA 3N7UA 4J1QA 3ZI0A 3EZLA 2C7VA 2EP5A 4R1TA 1UZNA 2ZB3A 4II3A 4L9RA 4LW8A 4BO1A 1V3TA 4CM5A 1PL8A 1FDSA 5TJ9A 2J5RA 4MVJE 4HV4A 3GUYA 3OM9A 5GZ1A 3JD0A 4S1VA 3HWRA 4IQ8A 2D59A 3JTMA 4II2A 3VAZA 1B15A 1HE5A 1B8VA 4R5HA 2CZCA 3M2TA 4LSWA 3PVZA 3JQEA 4XJTA 5HBRA 1HDRA 1V9LA 4F6CA 1H9AA 4ID9A 2VT3A 3BTVA 2WWRA 3GGGA 3HN2A 4TSKA 3ONFA 4FN4A 4B4WA 1E7MA 2ZTMA 2AE1A 2B83A 1JKJA 3PXXA 4B3IA 3UUWA 3FSRA 2VCYA 1JN0A 2NSDA 3DBLB 2EGGA 2D0IA 3PHIA 4JX8A 3A28A 4FGWA 1DHTA 3JQGA 4MKXA 2GO1A 2EERA 3EDMA 4QTZA 1NHWA 2VRCA 3IP3A 1E3LA 4FOOA 4CM3A 5DP2A 3G1UA 3KLMX 3EUWA 4HBGA 2AA3A 3DMTC 4XZ3A 3OJEA 1XSEA 2Z1NA 4RVGA 4ALLA 2HRBA 3WTCA 2ZYGA 3W1VA 3GEMA 1ZXBA 2J6IA 3GZ4A 1X15A 3O8QA 3ZWCA 2YUTA 5DF1A 4AJEA 2ZTVA 1XEAA 4MKRA 4CLOB 2BGKA 4BKOA 1TLTA 1DRUA 1WMAA 2E82A 1WZEA 1P0CA 1Q0HA 3G0OA 4W7HA 3QJ5A 3Q1LA 3U5TA 1E1KA 5CDYA 3BZUA 1DAOA 1BXKA 2UAGA 2VZ0A 4JGBA 2NLOA 3ZDFA 3ZN2A 1FDUA 1V8BA 4TKLA 5DBIA 1WWKA 1GV1A 2EW2A 1NWCA 2A92A 2X0NA 2DPHA 5B4VA 3TSCA 2ZQYA 3PFWO 3KVOA 2GYYA 5IJZA 3I5MA 3IKTA 3GVIA 3HDHA 2Y1DA 3GVHA 1T2DA 2RH4A 3UF0A 4IPTA 4XX0A 2I3GA 3PHLA 4IJVA 1HDGO 2CNBA 1V6AA 1BHSA 3QQPA 1NQ5A 2WE8A 4FC6A 1LLUA 4A27A 3OQ1A 2IRWA 3S2EA 3V1TC 1YQDA 1EMDA 1FMCA 4FIZA 5ER9A 5G4LA 1N2SA 4ZQFA 3JQBC 1D4FA 4B3JA 1O5IA 3GK3A 1XA0A 5DT9A 4BIIA 4P8RA 4DXHA 4F46A 1YB5A 3RJ5A 1U5AA 4CR6A 1PGPA 1LSSA 4CV1A 4DBZA 3L4BA 2NVWA 1VLLA 1LQUA 5CG1A 3ZU4A 4RQTA 1U3TA 3WMWA 5C7IO 1A4IA 3KBOA 4R1NA 3B70A 2JFHA 5AYVA 4XB1A 5TGDA 3L0DA 4BNJA 1DC3A 4Z3DA 1E77A 4MVJM 4NFHA 3GPIA 4BO2A 1IUKA 4J2OA 3ETEA 4TRNA 4UUPA 1H2BA 2BI8A 3W8EA 5IXYA 3H6KA 1LXCA 2D3TA 2EJWA 5L45A 4L4RA 4QEDA 3ZW9A 1WDLA 4B7CA 4DUPA 4GPD1 4LMPA 3PP8A 1SEVA 1H6CA 2VWGA 2VYND 2I99A 1LTHR 2Q4EA 3RJ9A 1YO6A 1IL0A 4J6FA 5KNLA 2B36A 1YBAA 4IDGA 5K6AA 4HNGA 1MV8A 4QO8A 3RAJA 3DB2A 5IZ4A 4OXYA 1MLDA 1NAIA 5AVOA 3FRJA 3VC7A 1GCOA 4RZIA 1P31A 4CMIB 2PLAA 2R00C 2G5CA 3KEOA 3P7MA 1XG5A 2VYVD 3CINA 3V1UA 1MFPA 3AI3A 2ZB7A 4MKZA 3E03A 1ZFNA 3VH2A 3WGTA 1DIGA 4DC1A 2R2GA 5IN4A 5COAA 2CDAA 3SLKA 1YOVB 3AM5A 2LDBA 5T6BA 4YRDA 1O94A 1NVGA 1U8FO 1UR5A 2NVUB 3ZU3A 3FWZA 3FTPA 4Q39A 4BMVA 3EVNA 5A9SB 3GG9A 3C7CB 3W4JA 2EIHA 4KTVE 1OFGA 1UAYA 1GZ6A 4XKJA 2DTDA 5L4SA 5JDIC 1C0IA 3MJCA 3H9EO 2YQ4A 1DOHA 3G79A 2HK8A 3H9UA 4J2HA 1V35A 3K92A 2FMUA 3UFXA 1DXYA 5A1TA 4Z0TA 1Y9AA 4HFJA 3W6UA 1C1XA 1AXGA 2BH9A 3DHYA 3S55A 4BKQA 4EJ6A 1T2FA 3LT4A 1ZXLA 1QLJA 4EW6A 4CMKA 4DIBA 1I8TA 3ZU5A 5AXCA 3DZGA 4CM8A 4WASA 1H0KA 1UP6A 4Z0HO 4PCVA 1LX6A 2X86A 2RH8A 4CQLB 4D45A 4AJKA 4DLLA 1E3JA 3JD2A 4D3FA 1Y8QB 2ZATA 3M2PA 2FP4A 1LQTA 4ZRMA 5JCJD 1TXGA 3Q9UA 3DWFA 3F9IA 1H94A 2PZMA 2PZKA 1F17A 3ENNA 1SOWA 4E2WA 3WJ7A 1B3BA 4NQZA 4A73A 3GHYA 5A9TA 2DBVO 4GLOA 4MDHA 5COBA 4TVBA 5KJCA 1SZJG 1BG6A 5HRUA 1EQ2A 1PJQA 5ILGA 4BNIA 3SEFA 2P5UA 5K0ZA 4CV0A 2H5LA 1U5CA 5ER6A 1T2EA 2FR1A 1YBMA 5KKCA 1BDBA 3VH1A 3UICA 1PGJA 3QHAA 4H15A 4P22A 2NUAA 3I9MA 4WCDA 2AW5A 3ZWYA 1RYEA 3WTBA 1HLDA 1K0UA 1ZEMA 2C59A 4HY3A 5DZSA 1DSSG 3GLQA 1ISGA 3FBGA 1N7GA 2TMGA 3Q2IA 3ZNQA 3VPHA 3BMNB 4RDIA 1KY4A 5TLSA 1WZIA 3AOEA 3B1JA 1OMOA 4RQUA 4WUVA 5CEFA 1ZJYA 1Z7BA 1JQBA 3WIDA 3O38A 3VVBA 3GGOA 4OAQA 5ENVA 3E48A 2XF8A 1ISJA 4DQXA 4DA9A 1U4SA 1WVGA 1T2AA 1VSVA 3CE6A 1Y1PA 2W90A 1O89A 3L6OO 3ANNA 4TZKA 4YDRA 6LDHA 1AGNA 4QFCA 1SPXA 3IC5A 3KZVA 1F14A 1KEWA 4BNNA 1T4DA 1WDMA 4TROA 4RF2A 5DBFA 3HB4X 5DOZA 5KVVA 3D5TA 4WCFA 4J9UE 3H7AA 4TKMA 4RPHA 1OAAA 1GL3A 3GH3A 4D46A 9LDTA 4H16A 2NTVA 5ADHA 4L76A 5I9MA 1G1AA 1DO8A 1VE9A 3RUFA 4AJIA 5BNFA 4UVIA 1M76A 1ZMTA 4PLWA 2J3JA 3MEQA 3WGIA 1H93A 5L53A 4U6QA 4IDCA 3ETDA 2NADA 3F5SA 1W6UA 4Q3NA 3D4OA 1U8XX 3H5NA 1NFFA 3FNFA 8LDHA 1BXGB 2VYNA 3EZYA 3VDQA 3PIDA 1BGVA 4CLOA 4YBZA 3KSDO 4YAEA 3QWAA 3NV9A 4E2XA 5L95A 4NR0A 1SMKA 1M2WA 2JAHA 4ZHSA 2C29D 3JYOA 1OI7A 5G0WA 4WEOA 5IFLA 1N7HA 1ZIDA 1LSOA 3OHSX 3NT2A 3WBBA 4IDEA 4J3FA 4E5KA 4D42A 2W8ZA 1Y7TA 4O0LA 5A3VA 5C37A 4XQGA 1CQIA 1V0JA 2DUUA 2H1SA 3DOCA 3K30A 4YQYA 3DR3A 2B4QA 3G3EA 4DYVA 1CWUA 2O4CA 4GL4A 1E0DA 3H5RA 1YDEA 2UYYA 1C0KA 4D3SA 2HMTA 3S2IA 5L7WA 1B3RA 4OQYA 1P1FA 1QV6A 1TB4A 1GQYA 4TRJA 1YXMA 3ZV4A 2JD2A 3ITKA 2B35A 1EUZA 1QYXA 1TT5A 4DMLA 2C2XA 2XPCA 3JQDA 2O3TA 2WJPA 4NH4A 1LLDA 2XOXA 3OICA 1T25A 1KC3A 4OSPA 3L6DA 3I4CA 1DBVO 2A35A 1S6YA 2O23A 5DULA 3OIGA 4D43A 4DC0A 2BKAA 3NX4A 4GH5A 1ENPA 4JP2A 1N5DA 3DFZA 1GDHA 5I7VA 4QXMA 5F1KA 1P9LA 3ZWWA 4J0EA 3ROPA 5LC1A 3B6ZA 5CDGA 3DDNA 1CERA 4PZEA 1LC0A 2Y93A 3GN1A 2P9EA 4AJ4A 2W4QA 4XR4A 2IE0A 3M1AA 3U49A 5JCJA 3WNVA 1HDCA 2D4AA 5JW6A 1PR3A 2G17A 4FFOA 2HAEA 4RLHA 1VL6A 1AE1A 4TMFA 5F21A 2I9PA 1UDBA 2EKLA 4LRSB 1HDYA 4ZN6A 5L4LA 1YONA 1NM5A 1TEHA 4GI2A 1VKNA 1N1EA 1JVSA 3HFSA 2Y68A 5TQVA 3KETA 3DXFA 4ZJUA 4D79A 4URFA 3PQDA 5T5QA 4IZIA 3JQGB 4HX5A 7MDHA 1CIVA 1U3WA 1U1IA 3PJGA 3JQAA 2ZIZA 5AXBA 4UULA 4YA6A 4HNHA 2VN8A 3TZCA 1LLCA 4BNFA 4BMNA 5MGBA 3BMQB 1UZLA 1ZK3A 5JY6A 4L73A 1GUZA 4IDDA 2EV9A 3DZFA 4GWGA 2VUTA 2X6TA 1PEDA 5G0UA 5A9SA 1CYDA 4K28A 2V6MA 2Q46A 2VHWA 1ISIA 2ZYAA 3K31A 4WECA 1NYTA 2X9NA 1ZSNA 4BGEA 1RWBA 2PNFA 2QQ5A 4I9NA 3GPDG 4GKBA 3HUDA 3UKOA 1KBZA 4R68A 3ONEA 4ND2A 1XGKA 2O3SA 2ZB8A 3C7DB 4ALJA 1U9JA 4BNHA 4WLUA 1HF3A 1MUUA 4MINA 1KC1A 1ZW1A 4IDFA 3ZU2A 4D0SA 1NQTA 4R3WA 2EWMA 3WYCA 1PZGA 5EIOA 3SBOA 3V2HA 3ZHYA 1UP7A 4AFNA 2PZJA 1F8FA 3L9WA 5TF4A 4Q9NA 1HZJA 3RBXA 4CM4B 1BXZA 4KUGA 4BUCA 3RQSA 1HDOA 2Y1FA 4CQLA 4WLNA 1P74A 4NU6A 4FCCA 4QUKA 3WLFA 4BNXA 1Y8QA 4UEJA 3ZGYA 4TZTA 1PJTA 3LT2A 5L4NA 2O50A 1PGOA 1FDWA 5AXDA 2HO5A 1DRVA 3GRPA 1C3VA 4P4NA 1E7WA 3D1LA 3OMLA 2NV6A 1X13A 4J7CA 4BOYA 5CEEA 3MWEB 1KS9A 1I0ZA 3ONDA 2WYUA 3UN1A 5JCXA 3Q3CA 2I3AA 2VUSA 5EERA 5CP8A 1Z45A 3SJUA 4J9VA 1ORRA 2JL1A 4EGFA 5T67A 3PQEA 3RFTA 5L7YA 1P33A 1GYPA 1GU7A 4IBOA 1GZ3A 1PQPA 3TPCA 2DFVA 1L7DA 3JYLA 3FD8A 1PS9A 5EQFA 2UVDA 2IYPA 5A5EA 2E48A 3D3WB 3ROMA 2WD7A 1AXEA 1P45A 3D7LA 4JBHA 4TWRA 5TS3A 4IXWA 4O59O 3FPLA 5JLAA 4M8SA 3PYMA 3RUIA 1KERA 3DEYX 3IJRA 1VM6A 2DT5A 1U7HA 4WKGA 3ADPA 1XELA 2IODA 3ZNPA 2RHCA 3PLNA 3BHIA 1Q2XA 3WWZA 4ONEA 5BNTA 4NG5A 5B4UA 4G2NA 3NAQA 4S3MA 2YDYA 4AJPA 2V7PA 3JQCA 4Z3KA 2Y1EA 4DREA 4IY1A 3QIVA 4CV2A 4YWJA 1N8KA 1BSVA 3W8FA 1KVTA 1I3KA 1LSJA 3D5QA 4E33A 3I9KA 2JAPA 1A7AA 3H9GA 4BO7A 1KVSA 1U3UA 3ZWMA 3AK4A 3QLJA 3T7EA 4HP8A 5A06A 1OC2A 3PJEA 3BYZA 2ZB4A 1J49A 1HWYA 2BGLA 2PKQP 1DIRA 3PI7A 4A10A 2BD0A 1DC4A 1UDCA 2HMWA 1OOEA 4GMFA 4MVJI 1KOLA 2X0RA 4IQ0A 2DM6A 4UVGA 3NDJA 3FR7A 1UXKA 1BXGA 4IGEA 4L4XA 4LSMA 3CTVA 1W0CA 1EUDA 1T2CA 4XIYA 3IP1A 2I5PO 2EP7A 3ZWOA 3LDHA 3I6QA 4CM8B 4PZDA 1EVZA 1PS8A 3LU1A 3JCZA 5H81A 1EFKA 2YYYA 4F3YA 4N5MA 2OP1A 1X7HA 3NJ4A 3RC1A 3IUPA 5F5NA 4O1MA 3RCBA 3E9QA 4YT8A 1E3WA 4WJZA 3VH4A 5DCWA 1WLYA 4IIVA 1JKFA 4ZRNA 3IAHA 4NI5A 1UZMA 4BO6A 5DNAA 3GQVA 2H63A 2YDXA 3E9NA 4OKIA 3UCXA 5LDGA 2FY8A 5KCZA 3KHUA 2OZPA 4RVDA 1BVRA 2D8AA 1QMGA 4YRAA 3HADA 2C7GA 5CPFA 2P91A 4XYEA 4H3VA 3JD3A 4GKVA 2QZZA 2HMVA 1U7TA 3VZRA 1DJNA 2CSUA 3EVTA 4CUKA 3WB9A 1VJ1A 1MXFA 2X7HA 5FWNA 3U62A 3K2EA 2DLDA 3FNGA 4EZBA 1XQ1A 2Y1OA 2O2YA 4JCOA 4WOJA 4FR5A 1I32A 2HCTA 1YL5A 3WQRA 4EDFA 3AW9A 1BTOA 2G82A 1PWXA 3JD4A 4Q3BA 3KOUA 1KVRA 1PJ3A 1EVJA 4QO7A 2QHXA 3BXXA 4NBTA 1LBEA 1QR6A 2FOIA 3A1NA 1LDGA 3JQFC 4OOFA 5A04A 1EUCA 2YHIA 3WFIA 1BRMA 3UCEA 3R6DA 2AQ8A 5A02A 3WJAA 1T24A 4MJLA 2BELA 5AOVA 5BSGA 1TI7A 3PFFA 4CM6A 4CMGA 4PN3A 1AN9A 2BF7A 3M6IA 2ZJ1A 2A4KA 4YQZA 2QRJA 1UP4A 3DZBA 3ABIA 1FF9A 2EKQA 3OFSA 2YZ7A 3RUHA 1MG0A 4D41A 5BSFA 4R4JA 4E13A 1BVUA 3K73O 1DC5A 1PQUA 5JO0A 4WCFB 3INRA 1BW9B 1HT0A 3WNQA 1DB3A 5IZCA 4J7XA 4R9SA 3PIIA 1YWGO 3RFXA 3C85A 4XDZA 1HKUA 3GT0A 2BGMA 3ON5A 3BMQA 2VNAA 5JE8A 4Y6RA 1XIVA 5L51A 2C2YA 3OA0A 4PLGA 4J1SA 4JK3A 4E32A 3BMCA 1O95A 4R41A 5A4DA 2OMEA 2AMFA 1T1SA 3N58A 4JIGA 2UUOA 4CPDA 3PDUA 4JBIA 4Y98A 4NNJA 2HJSA 4F45A 4B79A 5CDTA 2D5CA 4IINA 4A2CA 4H7PA 3ZV5A 1A5ZA 1MG5A 1E5QA 5TIIA 2B69A 2PA3A 2AQIA 4K1LA 1YRLA 1E3EA 2Y67A 2PKRA 1GUFA 1YKFA 1PZHA 1U3VA 1DIAA 4CMEA 3CPSA 4GSKA 3KM0A 2DBRA 1I33A 1M6WA 2NQ8A 2O2SA 3S8MA 3NJ8A 3JQ9A 1BWSA 4YTEA 2P5YA 4RV9A 2EF1A 1RM4A 5DN9A 4ZVVA 1E5LA 1JW9B 4CM4A 3VTFA 1MA0A 4IJKA 3NRCA 2I6TA 3GFBA 3I9OA 2AG8A 4JNKA 3HG7A 1LEHA 2HMUA 4R16A 1R4MB 1EEHA 4W82A 4I9UA 2F1KA 1SBYA 1TT5B 3QVSA 1KEPA 3W4IA 1MGOA 4TRMA 4NHEA 3UXYA 5CHEA 4M55A 3SVTA 3T4XA 4FC7A 5JDIA 3ROKA 2HJRA 5I8ZA 1ISMA 4QFDA 2IEDA 1GZ4A 3SX2A 3NTOA 3OIDA 1IYZA 1XU7A 1R37A 3V8BA 5IAAA 5EPOA 4YT2A 4NPCA 2AXQA 3QRWA 4KWIA 5U4QA 4JJFA 4M87A 4BQPA 3U3XA 4CLRA 1DLJA 5I9NA 4LGVA 1NASA 1YGYA 1ZCJA 1NQAO 1ZKMA 2CFCA 3VPSA 4A7PA 2GUGA 4EI2A 1NHGA 2P4HX 4R51A 4L75A 4ESOA 1M67A 1GD1O 4Y9DA 1WW8A 3BHJA 4E30A 3D3WA 1VJTA 1ZJZA 3P2OA 5TRTA 1ADFA 4D44A 1G0NA 1P77A 1WNTA 3V1YA 4UUMA 2I66A 3CXRA 2DPGA 3FF4A 1WPQA 1ONNA 2IEBA 3C3XA 1HYEA 4GLLA 4Y67A 4W9NA 5IG2A 5CDUA 1D8AA 5JY1A 4DYDA 3GA0A 1FXSA 3KYDA 2PY6A 4GBJA 4KZPA 4J49A 2Z5LA 1DFGA 2I67A 3JQAB 2O48X 2Y0EA 2PWZA 4PVCA 4BNYA 4CODB 5CG2A 3G1TA 4EUFA 4GVXA 2EEZA 4HXYA 4DBVO 1T26A 1ADBA 1KIFA 4N5NA 5HTOA 4IDAA 2CUKA 1ZUD1 4ZA2A 3LC7O 1NFQA 5THQA 4PG8A 5C7LO 1ZNQO 3E9MA 4I5EA 1UJMA 2Y99A 3PZRA 3WICA 4NK4A 2V6BA 2GERA 3B1FA 4BHTA 1NPDA 3CMMA 4QSMA 3GG2A 3INTA 3RUAA 3FTNA 1Q0LA 3RBVA 2Q2VA 3JSAA 1I3LA 3ENKA 3D64A 4PRKA 1Y8RA 1NQOA 2JD0A 4E6PA 3KYBA 4YB8A 2Y1CA 1XCBA 4N54A 2B4TO 2Q3EA 4DIFA 3D4PA 1EBUA 1ENYA 1KEUA 1PJLA 3AM4A 1JWAB 1YB4A 2BI7A 3QSGA 4XRRA 2FN7A 2QG4A 3RC7A 1LLQA 3L07A 4J4TA 3GVXA 4XD2A 1YQXA 2BMAA 3RROA 1MFZA 5BSHA 1IE3A 3GNTA 2VTDA 3GNQA 1EK5A 4J0FA 3WIEA 1PJBA 2EHDA 1HZZA 2WEKA 3PGXA 4NBRA 3LK7A 2FSVA 1FDTA 2GGSA 1PGNA 4BV9A 1UDAA 4RLSA 2GZ1A 4R9RA 5B4TA 2CD9A 1O9BA 4IMPA 3IS3A 5EJ2A 1Z73A 2JJYA 2YFQA 3DZKA 3K9QO 3JQ8A 5COQA 2XXBA 5JDCA 1OC4A 4AL4A 3I83A 4RORA 3JQAD 7ADHA 2Q1TA 1EK6A 2VRBA 2DBQA 2P2SA 4I5DA 3PJFA 1RM0A 1PL6A 3QVOA 3QW2A 3OJOA 4GVLA 2Q4BA 4UEKA 5FYDA 2VOJA 2P4QA 3LZ6A 4PG5A 3WXBA 2O3RA 3AI2A 4FGSA 4K26A 2Y0CA 3MTJA 3ZNOA 1M6HA 1V3VA 2QIOA 4CMCA 2WD7B 3P5SA 4BNKA 2A94A 1K2WA 3GVPA 1ZH8A 3NT5A 4YJDA 5EMHA 3F46A 2PZLA 3MWDB 3C1AA 4YJGA 1H9BA 1GYQA 4E2ZA 1XDWA 5DDIP 4Y6PA 3KTDA 4WNIA 3C8MA 4HUJA 4CV3A 2ET6A 3PYXA 3WGYA 1PU2A 3JQ7B 3KRTA 2YV2A 2J3HA 3BAZA 5H83A 1UXJA 3JYNA 3VKUA 4EJMA 4JXKA 2AEJA 1IOLA 1Z75A 4FFNA 2YV3A 3EY4A 3WYBA 4E0BA 3L77A 4G65A 4B7XA 3TJRA 4KDFA 1U2DA 4BGIA 3PK0A 1QYWA 5TT1A 3WMXA 2IZ0A 2X9GA 4IUYA 3ZCXA 4DRYA 2F00A 1HXHA 2YY7A 3DBHA 2D2IA 3FCOA 4YAIA 2X5JO 1NX6A 3R1IA 1BW9A 3O03A 4HWKA 2GCGA 4B8ZA 2Q2WA 3IJPA 3DHEA 3LC2O 3QVWA 4BB5A 4BGVA 3GAFA 1MXHA 3ZV3A 4ALNA 5DP1A 2FRDA 4K9DA 4BNWA 3PGJA 3F4LA 1AUPA 1JLLA 5K9ZA 3O9ZA 5I7SA 1DIHA 1GUYA 1Y81A 5IN5A 2VHYA 1ID1A 3V5NA 1E7QA 5U9CA 3DL2A 3H3FA 2TMDA 1YBVA 2JCVA 4CUJA 1LDEA 1L1FA 1VC2A 4WK6A 1AHIA 3Q2KA 2D5AA 1I30A 1U28A 2P9GA 2ZK7A 4IM7A 3B20A 4ZGWA 1E1NA 1R4NB 3DQPA 3R3JA 1HRDA 3TWOA 1E3WB 1N9GA 1K6XA 4NK5A 3ZZNA 5GMOA 4BNVA 4Z9FA 1CF2O 4BO8A 4M49A 2G1UA 2E4AA 1W4ZA 4GGPA 4B8WA 1YB1A 3DBVO 3MJVA 4Y6SA 1P44A 3BTSA 3PEFA 3O26A 1KETA 2QYSA 1KY5A 3OIFA 4FJ2A 1ZK1A 1Q7CA 5G0SA 3GZNA 1R4MA 4I5GA 3TZKA 4R54A 3MOIA 6ADHA 1NPTO 2GLXA 2BRUA 1DPGA 1ZEJA 3AOEC 4OKNA 3DZJA 1DRWA 4DIOA 4OIMA 4YR9A 4UVHA 3AI1A 4I1IA 4U7WA 3VZQA 2PFGA 1QRRA 3GR6A 3RU7A 1R6DA 3QVXA 1GYRA 2O3QA 2OBNA 3CTMA 2EJVA 3WYEA 4ZICA 1X0XA 1PZFA 2RBEA 3LQFA 3WGHA 3GC6A 1S7CA 4BNGA 1LDBA 3G49A 4KDEA 2DBZA 1ULUA 3QWIA 1QP8A 4MO2A 4XQEA 2DU8A 1NVMB 2YHIB 5TC4A 2X1HA 2O7QA 3DO5A 1ML3A 5EN4A 4WCFC 3L4SO 2NWQA 3OA2A 2VHZA 1R66A 4JLWA 3UW3A 2GZ2A 3HFGA 4Q3DA 3LYLA 4OGWA 3R3SA 3NKLA 3EYWA 1C1DA 4FPXA 1EZ4A 1JTVA 4ND5A 3GUCA 1EDOA 2BFPA 5FEUA 1IHYA 4BO4A 5GY7A 4J7UA 5EINA 4PLYA 1QV7A 1B2LA 3P2YA 4BNLA 4E12A 5JAZA 5U1PA 5LDHA 2A9FA 5KJFA 2UV8A 3BHMA 1E3SA 4KMSA 3GFGA 3KXDA 2Q1UA 2PV7A 4MIYA 1IPEA 3F4BA 3IQDB 1AHHA 3BMCB 3RUCA 3E82A 1GV0A 1E7YA 3AUTA 3ETGA 1U4OA 1SO8A 4Q3CA 2GZ3A 1LRJA 3FBTA 3WSVA 5EESA 3DZHA 5G0VA 4EJ0A 4GGOA 1QYCA 4W7IA 3PWKA 1LDYA 1I2ZA 1PR9A 1LJ8A 1LSUA 1ENOA 3TOXA 3X2FA 4R69A 2VNSA 3EC7A 2NVBA 4PLPA 4MVJD 2PR2A 3VH3A 2OFPA 1GEEA 1Z7EA 3RASA 1NR1A 2NU8A 3AUSA 1EVYA 3GEGA 4P38A 4XIJA 4O6VA 1R12A 5I7FA 1A9ZA 3QVTA 3WQQA 2AE2A 2PD3A 3ASVA 3FWNA 2D1YA 4C7JA 4HFNA 5ITVA 3I3OA 4YEDA 1I10A 3E8XA 3JV7A 3U0BA 4Z9XA 1GAEO 3TNLA 3TOZA 3TZ6A 1XYGA 4XGKA 4ZQGA 1TT7A 5T8KA 4PG7A 3WGZA 1J4AA 5KOIA 2RIRA 4FS3A 3HB5X 2HU2A 5IXSA 3VDRA 3EW7A 2BFAA 3D3EA 4CJXA 4RF3A 5TX7A 3OH8A 5JSFA 2QW8A 3KYCA 2X22A 3HDYA 4GAEA 1LDNA 3SC6A 3QV1A 1D1SA 2CDCA 4CLRB 2DTXA 3DAPA 4DWVA 3VOSA 4PFJA 3D4NA 1YL7A 4N7RA 3F1LA 4XR9A 2VUUA 3MOGA 5JXWA 4Q3AA 2HDHA 1H6AA 5TNXA 2BFMA 3ZWPA 4DPLA 3AU9A 2VHXA 5KJEA 5BQFA 2Q99A 4DMMA 2OBYA 3NGLA 2X0IA 5G4KA 1PL7A 3BA1A 1F0YA 2I76A 5B1YA 3JQ7A 3KYDB 1DHRA 1L7EA 3OETA 2G0TA 1PJCA 4A5OA 4RVHA 2VTEA 5HA5A 3GRKA 4IQGA 1I24A 4CM9D 2OHXA 4NIMA 3K6JA 3DTTA 4GMGA 5FF9A 4MVJH 3A9WA 5JFOA 4AJNA 3PWZA 4OSOA 3I1JA 5JAQA 1VKOA 1P1JA 1NNUA 1R16A 3F1KA 5JYDA 3VHRA 4MVJF 1ENZA 1ZMOA 4B3HA 4RZHA 1GPDG 3ICPA 3JYQA 4G81A 3LLSA 4E21A 1LRKA 4PGFA 4Z9YA 2NQTA 2NU6A 3A14A 4P4GA 4QT0A 2SCUA 1TVEA 4UREA 3S1LA 1Y8RB 2NACA 3DMYA 1G0OA 1XHLA 1E6EA 2IXAA 3RUDA 1ZSYA 4XYBA 3RKRA 3RU9A 4EEXA 2VWPA 2QX7A 3KO8A 3IL2A 4XJSA 1UH5A 1PSDA 2DFDA 4B7UA 1YJ8A 2ZTLA 2RHRA 1H5QA 5KVCA 5T64A 2HSDA 3N74A 1KVQA 3C24A 3WS7A 4W6ZA 5JC1A 3C1TA 1P1HA 1QLHA 1T4BA 3OECA 5J23A 1P0FA 1K6JA 4YXFA 1LC3A 1R4NA 3VKVA 1CEQA 2OO5A 4L74A 4FFPA 1GADO 5KIAA 4L0QA 2NTNA 1SNYA 4CLHA 1D3AA 2NM0A 3CIFA 4QQRA 3ZHZA 2DKNA 2O4UX 2WYVA 4FSHA 5CAEA 3ZHXA 1X7DA 3OQBA 3NTRA 4IS2A 4BNMA 2AQKA 3PQFA 3ZNNA 3DMTA 1B7GO 3NTQA 1I2CA 3EHEA 3JQ8B 1JDJA 4XGNA 4AJ1A 4CUZA 4XWYA 1WDKA 2FR8A 4L4SA 4R1SA 2C54A 4BO3A 1LUAA 1SCUA 2PD4A 4RF4A 2PKQO 3GN2A 4OL9A 5ICSA 2DUWA 1JWBB 3AU8A 3I23A 1IY8A 1RJWA 3F47A 4PLTA 1GY8A 2W2KA 3OP4A 3WGQA 3UGKA
chains in the Genus database with same CATH superfamily
3RC9A 1OBOA 2B1QA 3CZMA 4QOJA 1CQXA 4YVFA 1KSGA 2QUHA 1J20A 3DAOA 2GPTA 4WN9A 2J30A 5CEJA 1PNRA 3SYNA 1O54A 1K89A 1PEYA 1A71A 1HSZA 3LAWA 3PQCA 4Y1RA 1BHQ1 5D3ZA 4LXHA 3UAGA 1UANA 1ZUWA 1SHJA 2JGDA 5DYGA 4BPRA 4ZI7F 3LGAA 3RC2A 7AT1A 1G8GA 2CY0A 1U99A 1V16A 1X1EA 4P2GA 4YRKA 3FUWA 5LM3A 2V65A 4MVCA 1L5HA 1H6DA 4LHVA 1RJFA 1UXIA 2XYVA 3IAM6 5AQEA 5JXJA 2DCUA 5CD9A 3VSBA 5AW3A 1GPAA 4JI5B 3WLPA 5IKMA 5AKHA 2Q27A 1QCYA 1U1FA 3EXHC 4JELA 2YHUA 2YYZA 3DLIA 3HVUA 4JLKA 1KSHA 4KNVA 5KOHB 3FX2A 5D3MB 1J0CA 3U16A 3OEWA 3FDIA 1CY1A 1GARA 2Z5FA 3UKJA 3SDZA 2PMCA 1JR3E 5G53C 3PE6A 1AKVA 4RV4A 4M7PA 2PR7A 2VEOA 5GIOE 2E49A 3I9JA 2WK1A 2LPMA 4MR9B 2IKQA 2OQVA 3WHIA 4EYOA 3GPBA 1OH6A 2BOVA 3UKOA 1MMFB 3VVMA 2Q3CA 2V6GA 4ARCA 4Z99A 5CJJA 3RGWS 4FBGA 3VI3B 3MF4A 1L8XA 5LWHA 2ZSHA 1DTWB 1CNFA 2H1CA 1N2CB 1H2FA 1HPLA 2E4ZA 2WWGA 3I52A 4TL6A 1V41E 2OHVA 3LTEA 1GL6A 3TB6A 4AZ0A 1Y48E 4RPJA 3ZU6A 4IDOA 3MTAA 4JQCA 3CF4G 5A05A 3OQHA 2O2IA 2JLSA 3KOXA 1YR7A 1GHTA 4AY5A 4ECEA 3C3BA 2O14A 1NT2A 5IDWA 3K9GA 2H6EA 2J9GA 5LNK1 4D6YA 2W43A 3NEPX 1EX7A 2F1RA 1HMPA 2O8DA 2GAOA 1JVBA 1UPAA 5KQGA 1KAOA 4UCFA 3EIFA 2O2GA 5EQDA 4RVSA 4XYGA 2FW1A 3SQOA 3L7YA 2ID4A 1EUYA 2SICE 1RI2A 1S2IA 1TF7A 3F3SA 3ZZTA 4YACA 1F1BA 1UBMS 2ENWA 2WG2A 4HJXA 3RG8A 5BMVA 2CCKA 3F49S 1IXRC 2YV1A 1T9CA 4ZQBA 1M8KA 2YQ5A 3DR5A 3I2YX 3QYAA 2QBYB 4ZAZA 2ZRFA 5DHFA 2NXNA 3OEYA 4O5OA 1U0HC 4OK6A 1RVV1 3CUTA 3TL2A 3VZCA 2PLWA 3WAGA 2XDAA 4RK4A 4F5WA 421PA 4DLAA 3BD8A 3LT0A 4I50F 4I3HA 2XT9A 3IOYA 1L4MA 4XGRA 1LF5A 1YCHA 2GRAA 3BCHA 5ECYA 4PFQA 2ZI9A 3B6EA 4V3BA 2JGFA 3R6WA 2OGSA 3SJ7A 1QU2A 4YJHA 1TO1E 4PYJA 2Z5GA 1B26A 2CFTA 3P26A 1DWPA 3PDIA 3TJZA 1IOVA 1RQ2A 3NUGA 2QX6A 5E6RB 3WNDA 2JJ1A 5CG2A 2GETA 721PA 4L1KA 4RK0A 3VO9A 5JZOA 4DPKA 2GN8A 3M6LA 2XYQA 2R7LA 4FFDA 4QBFA 3D81A 4KXMA 3C6XA 3OWHA 1RE0A 3K20A 3AERA 3FR8A 1P1IA 3FYUC 4ZTBA 5IASA 4DR5B 2GSDA 2O8CB 3TIIA 1ABEA 1S96A 4AMYA 4LJ8A 3NEAA 2OQRA 1EDZA 4NZMA 1W4AA 5EHIA 4E5VA 1W36B 3C3MA 2GKGA 3HCFA 1J9EA 3D3KA 3EMVA 3R3ZA 3F98A 3EGVA 1KU6A 3VSEA 5FOTA 1E7SA 2HQ1A 4Y7DA 4BE4A 3BWEA 2XYPA 3DAYA 3Q9NA 1XD2A 4YP9A 1DWQA 2GH1A 1HDIA 3N2LA 3PQ8A 2AF4C 4KQEA 4ISCA 4MPJA 4U8GA 4UNIA 5B1EA 3QF4A 3I32A 4AS3A 4YMGA 1QRUA 3L40A 2CUNA 3TRIA 4BCBA 1NSYA 3HV0A 5A5FA 2Q62A 5JROA 4DE5A 2BY4A 4PSVA 1FYEA 1BCRB 1I6KA 4HWTA 3AJ8A 2QTFA 3BKXA 4CLXA 4ZYVA 5E8RA 3AI7A 1RWXA 2QLLA 3EFOB 3MFQA 1OYOA 4ZT5A 4LHEA 1PZEA 3HN7A 4WWHA 3AO0B 2AW3A 1ZIXA 3FVVA 4HAZA 4LK2A 1TO6A 1HTBA 3K1YA 1YMQA 1XQYA 4DIMA 4PG6A 2W6OA 3HK2A 1Z35A 3D7KA 4QUHA 1HDZA 2UDPA 4IIDA 2EZ8A 4JSYA 2AOUB 1SC4A 4MW6A 1QR2A 4OOEA 4QXQA 3RS7A 5C8YB 3HKEA 2WA1A 4HKTA 5K7SA 1I2DA 1MU0A 1GN9A 3MS2A 4KN6A 1ZAYA 5JJIA 1R0LA 1XXHE 3ELWA 7GPBA 4RZSA 5B2ZA 2DFTA 2YJNA 2QPTA 3HJCA 3QXCA 4RC9A 5HF5A 4CL8A 3A4IA 5K8CA 2WZCA 1MN6A 4LZOA 4XVRA 1J06A 4MP8A 4ND3A 4ZVTA 3S2UA 4TV9F 4BMDA 1HBJA 4ZC1A 3PYLA 1LKZA 3S28A 1CBUA 1HDXA 1ZO8A 1XTJA 3RSSA 3V4LA 5DM2A 3X1KA 2XMQA 4C89A 4CCYB 4UDNA 4B2YA 3JVEA 3KR2A 1RAIA 3JQ9C 2HTFA 1ULZA 1MQSA 1SUEA 5EEGA 3TLKA 3IO3A 2CMKA 2P62A 4NFYA 1G8PA 1J1IA 1DFIA 4IIXA 3KL2A 3II6X 4E46A 3BD7A 3V2GA 1B8UA 1XYYA 2ISSD 5HVNA 5CDFA 2QSYA 1D5WA 1UOQA 4RU1A 2A7QA 4ZO9A 1FFSA 2F59A 3A4VA 3HZRA 4GM4A 3HNOA 4AS2A 3G2KA 1YE3A 1PO7A 2IFTA 3L0YA 4DSZA 1QORA 5JV5A 1W47A 3UBTA 3DPSA 5BSEA 3M9XA 3R3VA 4G0UA 2H31A 3T1VA 3LF1A 2JS7A 3A06A 3ZIUA 4KO2S 4ZCRA 1X1RA 1WW2A 4UNRA 1JLKA 1MX3A 5KHAA 1RRFA 5HZGA 2JD1A 5JNRA 2P1RA 2CHQA 1C9JA 2D2EA 3RKSA 3QMVA 1XEFA 4G0VA 1LI4A 1EUQA 3DHNA 2C9BA 1T5TA 2PCJA 3OT1A 4NZOA 5CRIA 2XUZA 5A2GA 1JSRA 3R7SA 4QNNA 2BSQA 4P5DA 1N4DA 3G5TA 4WZBB 4C3VA 1XJQA 2GTHA 3CPHA 4OMUA 4P7JA 4TQ9A 2OHOA 3DBRA 1Q21A 1RMQA 5I9SA 5AJTA 1TM5E 1DEXA 4RAOA 4AIIA 4JL8A 5EJEA 1Q22A 3OKAA 2PKCA 3NNDA 3J81k 2P9HA 3TL3A 4M8KA 5B58C 4ZTUB 4BNDB 3AESB 3ETNA 4CTOA 4AJ9A 4GOJA 4B3RB 3B52X 4IWXA 4Z8XA 4A5SA 5U4XA 3OM1A 1EFAA 4UCXA 1OBFO 2Z08A 5K6AC 1AQNA 4U0KA 4H35A 4OHZA 3NOQA 1LJUA 3PPYA 3GRYA 4TRRA 2OUKA 1FLVA 4M1TA 1ODSA 1E3TA 2ABWA 2BMDA 1TGYA 5FUYA 4JKYA 3HXQA 3I6BA 2JLQA 4RSGA 3W90A 4FGUA 3WYAA 5DI9A 3B3GA 3CVOA 4P7FA 1E2NA 2PSSA 3R7DA 2ADFA 1ES9A 1JIJA 2Q45A 4G4SP 3MMPA 1JH8A 4LC0A 1CQZA 5KMGA 5B5SA 3PZBA 3QIAA 2C4NA 4M8LA 4Y2JA 1VSBA 1LRLA 2XUFA 3WX0A 2VT6A 5LOVB 5MN4A 3ONVA 3PFGA 3B6KA 2CXTA 3L05A 3K8ZA 3SXPA 2ATXA 3E53A 4EF4A 1KQOA 2VHVA 1DJMA 5F98A 3HA7A 3T7JA 4WOKA 1MORA 3D02A 5G2OA 4IGKA 3O8OB 4ND4A 5DNDA 1DNPA 1NW9B 2IYEA 3ANLA 3AY6A 1I7SB 2IP4A 2P2LA 2R1VA 4KSYA 3RBZA 2ZU0C 1JPVA 3BSFA 4YCAA 3IEMA 1FDOA 1ZZEA 1D7AA 1J1UA 2OCKA 5THXA 4FW8A 4LZWA 5T4HA 3OY2A 1NI4A 2GWHA 2PFSA 2PMDA 4YT5A 1FJXA 3AM3A 3GCDA 2FOLA 1Z8DA 1A9YA 3JD1A 4HTFB 3RWOA 1GFSA 1VJDA 5AVRA 4J75A 1JA9A 1F2TA 5FRDA 4D99A 2G9ZA 3MWJA 3L0ZA 4HPWA 5EHGA 1QYRA 3HZOA 1ZD9A 1MCZA 1INLA 4EUEA 1FP4A 1WMEA 5IDVA 3EODA 2I3ZA 5FULA 4TL8A 5J47A 4P98A 4F9GA 1S4MA 1GKLA 2QL9A 4QBKA 4UHCA 3EPRA 3AM1A 1IULA 4NJMB 3DGEC 1Y6GA 1DKNA 3H2ZA 4B2LA 2QTVA 2HRRA 4HN2A 3LQQA 2IZ6A 3SR4A 1KHTA 1GTSA 1BOFA 4WK2B 5E2IA 1HZZC 4JZYA 1CS4C 1QE3A 3C1OA 3HB7A 3IAXA 2QRGA 3OSUA 3FOFC 1THGA 1MJNA 2OBBA 4WJLA 4D0RA 2C2GA 5JMPA 1ONPA 1N0VC 2OENG 1ZISA 2V5VA 3PT9A 3SNKA 2OXIA 3DMDA 4FJ0A 2Q3DA 2XIJA 3RDPA 4F5ZA 2VXCA 4NLLA 4TLEA 3PE4A 2QL7A 2EFCB 4L9WA 2WTXA 1WZ2A 2PU7A 2POCA 2QNIA 1RJ9A 1T6ZA 2BF4A 1CETA 1FYFA 4GSLA 4LJ9A 4J0GA 4KQ1A 4AYWA 2H1RA 3LKZA 3NHMA 4IJMA 3A0RB 3A6EA 1LCIA 1PD0A 2V59A 4OXQA 6YASA 3K1AB 3PUWA 3V6MA 4BQFA 1GEGA 3M70A 3IMKA 4YRBA 1Q7TA 2FPUA 2OXFA 5JRJA 2XB8A 1R0RE 3BWVA 4JJGA 1E5XA 4HDMB 4ZPJA 4K9KA 1RAFA 1VJ0A 2WQ6A 5HRCA 2YWDA 1UDWA 2QN2A 1RKXA 3DE4X 4TL9A 2XKAA 3BM5A 2HLPA 3P9YA 4Q1FA 1SCUB 3S5JA 2JJ2D 3QKUA 3U4IA 2R7MA 4EB0A 2F2TA 1V11B 5BVHB 4JI7B 1XC7A 2IHJA 3K5PA 2CB0A 4GXNA 2FHPA 5LCXA 4MZXA 1U0LA 4TS3A 4X00A 4GMHA 3K8QA 3CUKA 1GWNA 4PG4A 5DPMA 5C5DA 3DVSX 4GX5A 2W2KB 3E9CA 1ADCA 5DNCA 2QYHA 2PL1A 3QXXA 4AKEA 3IVCA 4E2YA 2BTEA 4RL6A 1FFWA 1G8JA 4HLNA 2IY7A 3LWBA 2OVFA 2RI1A 4JROA 4UQOA 3UATA 1BZYA 3PNQA 1U2DC 3D8NA 4HQKA 1JFLA 2IXFA 1MB4A 2IZOA 2JJ8A 5D8DA 2J5QA 1YZNA 5KYWB 1E92A 1E62A 2IHUA 4L7VA 3UMYA 1DQYA 5BN4A 1ZL0A 2YW9A 1OIWA 2NMVA 2ACKA 4QYMA 4XGIA 1PW5A 3JX9A 5AVUA 1NKVA 3LY5A 5AXAA 1E6WA 4C04A 3Q3VA 4NMHA 3L6EA 2QY6A 4F3RA 1PF7E 1WVMA 4WKNA 5BV1A 3QEMA 3HO8A 2V7GA 2ZSKA 4BO9A 5A0TA 3ZX4A 1EVIA 3KDAA 4IIJF 4TWBA 4JJIA 4GM1A 2NT4A 4B80A 2WOOA 1V7ZA 2EZ4A 2WMDA 5A4KA 3DOJA 2I4LA 5H5JA 1KHHA 4C0XA 4S1PA 2OQIA 4CLDA 4NAHA 4NJEA 1M2KA 3TTVA 3RS2A 3EBOA 1X7WA 5HBGA 5JMWA 4GNKA 5ALGA 2VT2A 4URYR 5CVJA 5IJ9B 1DAPA 1YD7A 2HTEA 4WVFA 1HMYA 2JGNA 4MEJA 2COUA 1ZA1A 2B1GA 2WF6A 2YCBA 2JFNA 3ZY2A 1BKYA 3MINA 2JZOA 1X1AA 1XLUA 1VI5A 2F48A 1NJ8A 4LVUA 1U28C 4J43A 1V26A 4OHUA 4U7JA 1UPXA 3R6GA 4E1VA 1AT1A 2HK7A 2AEMA 2JBHA 4FINA 4ANFA 4IHKA 1AO3A 3ESCA 1UBEA 3DD1A 4JD5A 2I6QA 4F72A 1PX2A 2JFUA 3NGXA 3OE7D 4MVJG 2Z09A 4KQ2A 4MYRA 2IOHA 2VBGA 2OYSA 4NEGA 4G6ZA 4BRSA 1E64A 2OFXA 3HYTA 5I7OA 3KWLA 2HDNB 3DL7A 4LISA 4XWKA 2X4DA 3SXUA 1QFZA 3W5IA 5ALFA 3BCSA 3BT7A 2IDZA 4O63O 5TPWB 4NU5A 4HH4A 1E79A 2O3UA 4OFZA 1HETA 3E27A 2QRVA 3G6KA 1D5CA 2R4UA 3N87A 3QKRB 3T7AA 4EQ6A 3SS7X 3AVTA 1PK9A 5CK5A 4PV7A 4DR7B 1A0OA 3EA0A 5FO1A 5TMEA 4LDNA 1XEWX 2HA6A 2YJZA 5DCYA 1H4TA 1XMXA 3WJ1A 5ITWA 2QU7A 4S12A 3ZJ5A 3SLGA 1VSQA 4C4RA 1OFHA 1C0LA 4QA9A 3OP4A 4DANA 2Q21A 1TM1E 2GR9A 2CT8A 2ZBDA 1K3UB 3VVCA 2QB5A 4AP6A 3CZPA 4I5IA 2GUWA 3AB3A 3QP9A 2VAVA 3T5DA 3CRRA 3PQ7A 1P19A 5TVGA 4UM9B 4ND8A 2J31A 4JLDA 3H2IA 5LXTF 3TUIC 4E09A 5A3RA 2IH4A 1QXSA 1O0SA 1JQEA 4IV5A 1SB9A 3DO6A 1RKBA 1P4GA 1QB8A 2NU9A 3NVAA 4IGFA 4IW3B 5I8PA 4F9EA 5FIUA 5TSDA 3X0DA 3DQQA 4X8LA 3KLPX 5DASA 2IH5A 4MMZB 5IM5A 4BNUA 1TEZA 4F3TA 1IB6A 1K4KA 3FETA 1HEUA 3VYRB 4C4PA 3CBGA 3I6ZA 4ESVA 3QUSA 4R2HA 3TSYA 1NOKA 1ND5A 2YN0A 3AR8A 1EWTA 3TIXB 4D9HA 5BSVA 5L3VA 1ABFA 3OG9A 4FNAA 5JJKA 1E4VA 3EG9B 3BTOA 1YJAA 4B9AA 4F8YA 1XNQB 4J4HA 2FEMA 4HDCA 4HXEB 1BFUA 1JZTA 4BLOA 4WZZA 4NCBA 3MILA 1MR3F 1CR4A 1GUBA 1O9HA 2WUFA 4G0ZA 1YH3A 1J8QA 2IHKA 2AN3A 2JIBA 3FNHA 3K0AA 4QRDA 5C1IA 4EHAA 3CX4A 2W98A 3KEGA 4LZNA 3QTTA 4PSDA 2REBA 2YWHA 3R9XB 3AXTA 3CLKA 3UHOA 1ORDA 3DHWC 3ZUGA 5HJ5A 1ZM3A 4UASA 3JAKA 1FS4A 4W5JA 3HYSA 1P7WA 1UUFA 2QV7A 2FFRA 1DLIA 1QAMA 1ADGA 3WBKA 1YK0A 2G76A 4OFWA 3IXQA 5FBRB 1RRKA 3ICVA 1W75A 3UENA 1Z4IA 5TB5A 3GCGA 3SC4A 2JB9A 1NP3A 2J48A 2ZJ3A 1VLJA 1KMQA 5FTMA 2JJ2A 3VU8A 1T6XA 1KO8A 1NC3A 5FTKA 3V8PA 1H6BA 3E5MA 1NBOA 4ZO6A 1G9XA 3TDKA 1E3DA 2WFAA 3BIFA 3UJHA 3L3BA 2JCYA 3V97A 5SYMA 3AEUA 4HMPA 3JAMA 4U00A 4PYOA 1U5BA 5T57A 1RCTE 3L0CA 4BX9A 3JWHA 2J3KA 1CY8A 2CXUA 3X2SA 5HYVA 4W9RA 1FQJA 3ZV6A 2Q8QA 4B47A 1Y5MA 4YPFA 3HUUA 3L1JA 5JPDA 3NALA 1B16A 4BWGA 4ZEVA 3U44A 2ZUSA 3OFKA 1GZHB 1Z56C 2KX7A 1T5BA 4KL8S 4YREA 3RD5A 5A03A 3NETA 4MRNA 5LN1A 2O8FA 4NDNE 1NXVA 1C8LA 2J9XB 3B5IA 4C0SA 3BJZA 5BR7A 1P1RA 2XBMA 4QX6A 5IHXA 3H1GA 1NW5A 2W6PA 4UAGA 3WLAA 1UL1X 1WUYA 1EE9A 2GVDC 4CU2A 1DTSA 4QUDA 1AQUA 4JR0A 4R5MA 1XKXA 5IT0A 3ZVRA 4L72A 3CB4A 1MP0A 5NLLA 3VO1A 4IDPA 1JAZA 2BEKA 2HW8A 1I1NA 2QVGA 2X0EA 4W5TA 1DBPA 2VBIA 3WB2A 2HL6A 3C48A 4OB6A 1T0HB 2IP1A 3HDQA 3V7WA 1NI3A 1ZDMA 5J40A 3LVFO 2IYTA 5JYEA 1M66A 3BMOB 3H86A 1AK1A 2LR0A 4W7SA 2DH6A 2ONCA 4WOCA 5GM2A 3Q11A 3IXLA 4UD6A 3X44A 4XCVA 5BSKA 3R8FA 1NYRA 1VRWA 2I29A 1RM3A 3BPSA 1NBME 1WO8A 3MTGA 3LRPA 3W6OA 3RIGA 1MAUA 3GL9A 4Y9SA 2W8BA 3FSEA 4GOND 4Z6KA 4QBIA 4X7PA 3CEHA 3DYIA 3KQNA 2B7CA 3KEQA 5A3JA 4KYIB 3L5OA 4HEQA 4QPDA 2Q1WA 1HOTA 4L5JA 5FUWA 5HJEA 5K0BA 5FBVB 5J1SB 5CLGA 4OHYA 4Q37A 2PMEA 4EBFA 4ZI3A 4FZ5A 1NXQA 3N2GA 2YZGA 3OE7A 3EXG2 4R01A 2DAPA 2HIHA 2V1XA 3S2GA 1D7OA 1LPOA 5AVYA 1N6PA 1A69A 2IYFA 2O2HA 1NLFA 2FZWA 2X4GA 1GCIA 5CH5A 1Z63A 3S2FA 1G8AA 1YJQA 3E18A 3GEIA 1T9GS 4FSDA 1OFUA 2XWPA 4FOLA 5BMVF 3HH8A 2FWMX 2P35A 4YLEA 1FX0A 2I4TA 4IFTA 7REQB 3ENWA 1ID8A 2DFLA 4LOJA 3MJTA 4LNHA 3NHLA 1ND6A 1XDZA 2X19A 3EDYA 3KJQA 4B4UA 1UC5B 4D9JA 1F4VA 3DEJA 4PO8A 4R1PA 4ER7A 4XSGA 3JVUA 1FYXA 2R6DA 1TIKA 4BRUA 1TJ3A 4ZVKA 4IL5A 5KSPA 3C7KA 4DJAA 5LLTA 1APBA 1RQLA 3AUXA 1SHTX 1N2JA 3LIIA 2PGXA 1QC5B 2VF8A 3BORA 3SJZA 1NJGA 4JP3A 2D2XA 4P36A 1JF8A 5BYBA 1IPFA 4A92A 4Z7NB 1W7AA 4GC9A 2FWNA 3N7UA 1FY2A 2LKCA 4IG9A 3DS8A 2RC5A 4ZO8A 5EQTA 3C4JA 5HUHA 1QHIA 4BO1A 2PRJA 3IEVA 4CM5A 1QPGA 3ABSB 3CZQA 2I8AA 5TJ9A 3ESXA 1B74A 3GUYA 2OHJA 2JVJA 3N2IA 5GZ1A 1UBGA 1SVLA 3HWRA 2YTZA 1JR3A 2UZ0A 3ASZA 4II2A 1QGUB 1SUCA 4LZAA 1V7QA 1VE5A 3C45A 5C2JB 1HE5A 2XUAA 3WDLA 3WGKA 4R5HA 1M0WA 3GLRA 3U9TA 2CZCA 3M2TA 4FNMA 4YUZA 1V9LA 3TGWA 5IBQA 1YUBA 2B20A 2G25A 1H9AA 2OB2A 3PF8A 4MWBA 2VJAA 4DCUA 2IP2A 4MQEB 5AT1A 3GGGA 2J4CA 4NEHB 1IIRA 4UXJA 4FN4A 2GPWA 4YMTA 5CFNA 1RYFA 4BY9E 5D87A 1QVAA 2HUPA 1X92A 2FG5A 5HP4A 3P2JA 1RYMA 3HA3A 3UUWA 3GLTA 2BFCA 2VCYA 4BC1A 3CURA 2XWBF 1U0TA 2EGGA 4D9GA 1R6BX 1C3XA 1UADA 2D0IA 3CX3A 1YZVA 2DPXA 4NU8X 2WNSA 4FGWA 3NP9A 2OO5C 2GI4A 2D06A 2RMKA 3NIBA 3VKGA 1GGNA 4K2AA 3DOIA 4MYSA 2IS4A 3BK2A 1DI0A 3WLJA 4HS4A 5DO9A 3KFLA 4KBGA 2Z4RA 2FJPA 2FMFA 5EMLA 4QDUA 2PS0A 3SZUA 3WYNA 3KD2A 3CH5A 1F0KA 4NS4A 5KX5B 1GGFA 4I4TA 3M5WA 2W22A 3KLMX 5LA6F 4HBGA 1WZCA 4ZV9A 5JAUA 2AIRA 3OJEA 4MLPA 4NOMA 3MWYW 4P5PA 4HX9A 5EYPA 2HRBA 4XFKA 4ALLA 3SVZA 4B85A 4WFIA 3CVVA 3GEMA 2RHDA 4TXHA 3O8QA 3EGXA 2GRJA 4A8PA 3ZWCA 3UMMA 4AJEA 2ZTVA 5JHHB 5D7NA 4UEQA 5TQ0B 5LYJB 2BGKA 4D26A 1DRUA 1WMAA 1WW3A 1Q1BA 1P0CA 2E82A 2WKWA 2KS6A 5J2UB 2GPBA 3ZWDA 3G0OA 3H1BA 3WAJA 4RDCA 1T43A 1TZKA 3F4KA 1GLVA 4MQUA 5CDYA 1EX6A 2JVKA 2PGAA 3MCAA 2VZ0A 5DYTA 1GU1A 3GLIE 1WV1A 2A88A 1FDUA 1JIUA 2IWRA 1NSFA 4PNHA 3R77A 2A92A 2O0KA 2VF7A 3WLTA 1Y1KE 4PYQA 3TSCA 2B8WA 2CD7A 5CW2A 5KINB 3I5MA 4X5OA 4I6EA 3BQ9A 3T5TA 1SBCA 3F3KA 1VE1A 1YR6A 4RACA 2Y1DA 1GG5A 3RS8A 1FVHA 2HXSA 3AFOA 2JIPA 3TEMA 1EFPB 2I3GA 3KZKA 4V1CB 5FI0B 2W58A 1HDGO 3L0BA 3M3DA 4DG5A 1JIKA 3QQPA 4FC6A 2WE8A 4FFBA 3RYCB 2DPLA 4Q4AA 3QFTA 3SHQA 2BGGA 2IWHA 2IRWA 5LUAA 1IEQA 3DKPA 1KMMA 1QAOA 4C2UA 2JEYA 4FIZA 4XI9A 2WUVA 8OHMA 2ZUVA 1GAWA 4BXOA 5JZMA 5EKSA 4B3JA 1D4FA 1JEJA 4KACA 3GK3A 5ALMA 3WYDA 4P8RA 5ERGB 1U5AA 3VR6A 3UUGA 3D8HA 3KAJA 3L4BA 1O96B 1H0SA 1SG9A 2NVWA 1VLLA 1LQUA 2QOEA 3DP9A 5CYGA 4Q03A 1U3TA 4RQTA 2Z2JA 2Q3JA 3KPYA 3WMWA 5C7IO 4R1NA 3ZVKA 2JFHA 1EK2A 3U48A 5TGDA 1VHWA 1YJXA 3L0DA 3PC8A 1FYVA 3W2IA 3RVLA 4PO9A 3JZAA 5ARDA 1E1QD 3KZ1E 3OCUA 4TKVA 1V71A 5JJCA 4RSMA 4QPJC 2Q29A 3O4FA 3U3DA 3RANA 4A4DA 2I2DA 2I55A 3KIPA 3I37X 1VZ3A 2RJOA 3RHZA 3W8EA 4E7OA 1U02A 3VSDA 3MMZA 1LXCA 2VQDA 3NPAA 2EJWA 5L45A 4XAQA 1QF6A 4DUPA 1WDLA 3FPEA 1X38A 1QKJA 1NF2A 2XMZA 1WSAA 1E4EB 1GPLA 3VYWA 4XE5A 4N5DA 2J5XA 4DNOA 4XLTA 4LX0A 3PEYA 3IUNA 1T36A 2ERXA 3RJ9A 4ZT4A 3ZCTA 1W4BA 2A33A 2B36A 1SHKA 4F0JA 1YBAA 4MAAA 1MV8A 4QO8A 1NATA 1T4CB 3D0RA 5IUKC 1KE2A 4B40A 1MLDA 5CA1B 4EF5A 1MJGM 3WKBA 2ZUBA 3H11B 4H1TA 2PX6A 3ESZA 1A1SA 2JGMA 1X3SA 2X3YA 2FQYA 1P31A 4CMIB 5EKUA 4RD3A 2VAPA 1TE2A 2Q2NA 4MA4A 1JALA 1XG5A 2VYVD 2G67A 2PYIA 4KJZA 4Y2QA 3V4SA 3ESYA 5E4TA 4LMBA 1HLFA 5C8VA 4IKEA 1ZLYA 1ZFNA 2G83A 3WGTA 3K9BA 4F3NA 3G7SA 3IIKA 1DIGA 1RMYA 5LUBA 4NG4A 3AM5A 4R8MA 1K86A 1NVAA 2ADMA 4R84A 1BMQA 5AW4A 4UNSA 5K0LA 2NVUB 5JXGA 2HGSA 4OI2A 2ZI3A 4Q39A 1C41A 2JIOA 3UQZA 4U2BA 3DE6X 5DWDA 3GG9A 4BCCA 1GAJA 3W4JA 3TSAA 7YASA 1KA9H 3PQ4A 1JHYA 1UAYA 2AN4A 5C8XA 1RBQA 4NBSA 4QG3A 5BOVA 5LBTA 2Q6TA 3B8EA 1N32B 4PS0A 2YQ4A 2BEVA 2HK8A 3H9UA 4J2HA 4UU7A 2R1UA 3JAWB 1F8XA 4RY8A 3GLFE 5AIAA 1T0IA 4UTPA 3UFXA 1DXYA 3CNBA 4ND6A 1MQ9A 3SSNA 5B1IA 3HYNA 1QIIA 5LQJA 1CEEA 4Q4CA 3JWGA 5EAIA 1C1XA 4YUAA 3DHYA 1CPYA 1YFKA 3W2FA 2CXSA 4FU0A 4GKKB 1ZD2P 2C1ZA 2NO9A 3GJ7A 4FYKA 1QLJA 4EW6A 4CMKA 2VDWA 2B3TA 2IYSA 2HHCA 5AXCA 4CM8A 5BY2A 2BGWA 3DLHA 3A9RA 3AG5A 2YMLA 3MWGA 4RETA 5DCLA 2P9FA 1KXJA 3A6KA 3EQ9A 2QVLA 2X86A 4CHTA 3L6RA 3W2TA 4CQLB 3OAAD 2CFIA 4MKGA 3ENZA 4RW0A 4D45A 2V1UA 4FHCA 2WM9B 3A4MA 4P3KA 4B82A 1HNWB 2ZATA 1KOGA 1NG1A 1MTOA 3DWFA 4N9WA 1KP9A 3F9IA 3CKKA 2OFOA 2PZKA 3ENNA 1S0UA 1B3BA 2ST1A 4NQZA 1YA8A 4QPNA 5T6MA 3GHYA 4FMDF 3VNAA 4N47A 1HEIA 5COBA 4TVBA 2DETA 4HMQA 3N2EA 1OXXK 4LJYA 1BG6A 2WU8A 5ILGA 5K0ZA 3CZAA 2HU7A 1FFBA 2H5LA 3R3YA 3MAGA 3TTSA 1U5CA 1J70A 1C30A 1G17A 4J07A 4NX2A 3O9MA 4QHSA 3UICA 1PGJA 3VH1A 5A4AA 2QZ4A 4P22A 3ADDA 2P67A 4AURA 4Q15A 1P2VA 3I9MA 1POXA 2J7PA 3ZWYA 3ND8A 4R1QA 3WTBA 4ZEMA 3I01A 3JTEA 1M6EX 1XEXA 1PNQA 2LTAA 3TO5A 1ISGA 1B0PA 2XT6A 2ZBFA 1KZ7B 3FBGA 2LRHA 4XWWA 2I2CA 4CF5A 1YS7A 1K3FA 4QRHA 5EMMA 2AJDA 4JBYA 4MQMA 4P3PA 1Z36A 3BMNB 4P31A 1W35A 4RDIA 2ID9A 1WZIA 4YAWA 3UWSA 3K71B 1SM4A 3FPSA 3WBJA 4F4UA 1LK0A 4WUVA 1ZJYA 3A10A 1JQBA 3UT5A 5K8VA 2CLIB 4OAQA 5ENVA 3T0FA 2JA2A 4DMHA 2C2HA 2IEAA 5B3JA 1ZC3A 4MV8A 2QM7A 1S1CA 1L7OA 1W85A 3DYBA 1U4SA 1DC7A 1T2AA 3O5AA 4RY2A 4DLRA 4YPVA 3FFWA 3NI2A 1IY0A 1QG0A 1RIIA 1O89A 4MEBA 3RYTC 1QRSA 1IG3A 1Z6YA 2CLCX 5AM0A 1SPXA 2QTAA 4MICA 1KEWA 4LG1A 3WYGA 1T4DA 1WDMA 1OYWA 2DH5A 3HB4X 1VHJA 2QVYX 3L1UA 4J76A 5K6TA 5H59A 1RPTA 3KQVA 3H9CA 2CNKA 4PYKA 5DIFA 1ORWA 1KMHB 2PL3A 3E8SA 4TKMA 4JH0A 1G60A 4D46A 3BGVA 5ADHA 4EG8A 2NQ2C 1BCSB 3PC4A 4LXYA 1QS0A 4L76A 1G7RA 5AR1A 4G4SO 3VPBA 5LP6A 1Q0TA 3RUFA 3DOHA 1FTQA 3EXHB 4AJIA 5KYYA 1E1QA 2W2MA 2ZR8A 3AG6A 1XX6A 1A77A 2CWWA 5ALOA 2BEUA 3EN0A 1AS2A 5BV7A 1NN3A 1N2CE 2FZVA 3IVGA 13PKA 3B9PA 3ETDA 2NADA 2EAUA 5DSTA 3F5SA 4X1YB 1JI3A 1QH9A 1Z68A 4L8LA 3R09A 4Q3NA 1YQWA 3LUPA 3TSOA 4ILEA 4V0QA 3FNFA 1ODKA 4MWDA 1BXGB 3PXDA 3ER6A 4JJEA 2ZVDA 1R6AA 1P2BA 3GQBA 3NV9A 1NRIA 3QITA 4NR0A 1SMKA 3RHFA 1MPTA 3JYOA 3L79A 4WEOA 3LWZA 1CZHA 1N7HA 1SGWA 1XU4A 4WY2A 4X1KB 4ZP1A 3TNFA 4B09A 1J0DA 3CZ5A 3HWSA 4L51A 4A6PA 3ET5A 1V0JA 2DUUA 4OUDA 3RJTA 3UTDA 3K30A 3C8DA 1CK4A 3FVRA 4LBVA 3BSYA 4K3UA 4M83A 4QWMA 1JHUA 2B4QA 3EWNA 4BIMA 3LFHA 4LOKA 1KZ4A 4MUIA 4B2PA 3DG9A 4FMBB 4GL4A 3CVXA 5CNJA 1YDEA 1C0KA 2HMTA 3L43A 1DMRA 3ELYA 3OPYI 3P9XA 1WPRA 4TWZA 1R88A 2KI5A 1YVPA 1U65A 1MJ5A 2DPMA 2F43A 4LDJA 4D4IA 1PQYA 4CDNA 2UYHA 2JD2A 3DXYA 4L28A 1ZGCA 4G0OA 3BS4A 5AJHA 1EUZA 2X2FA 1QYXA 5DWQA 1PLJA 3I1YA 1RHMA 5BW4A 2UZ4A 2CMFA 2O3TA 4DV3B 3HCRA 1BEZA 3QFHA 1Z6GA 3OE1A 4G37A 1XTTA 3O8RA 3AXSA 1PYDA 4WVLA 3BGDA 4D97A 3H05A 3THYB 1IWPB 2FUEA 1M1ZA 1SUPA 1SUAA 2P9YA 1VHDA 1E9AA 2VDNB 4C9BA 1QHFA 3AJ9A 1GA4A 2O23A 3TLXA 3OIGA 4D43A 1GGMA 3MRVA 4XEUA 3UA3A 5TVKA 2HIAA 2KBEA 1OGYA 3L46A 3K8OE 1GDHA 3MMXA 2H4FA 2CXQA 3WC4A 1MAHA 1P9LA 3FROA 3WKDA 5LC1A 3B6ZA 3FYUB 3WIOA 1E2MA 1KOJA 5CDGA 5AW7A 2ACEA 4JL5A 1VDZA 1YRHA 2IS6A 3EMDA 4BMZA 3ENVA 4F5DA 4PZEA 3UAWA 3OAAA 4X93A 2HWYA 4X6LA 3TW4A 4AJ4A 4CEHA 4PHFA 1Y3CE 2AEEA 2QTNA 4A0RA 1ATIA 4V24A 3U49A 3BWMA 5HDQA 4AN1A 1SBIA 1HKHA 2WB4A 4RMHA 1KO7A 1VL6A 1AE1A 4TMFA 3TRJA 1W96A 1QB7A 4NCKA 3REOA 4C08A 3B38A 5L4LA 1VYVA 4X7BA 5HCUA 2XUHA 1EJ0A 1VKNA 5FWAA 1LNSA 3MA0A 5F76A 1VG8A 5TQVA 2V96A 3CNQS 1SRRA 4QOSA 3TSWA 2FI1A 3PQDA 4YV2A 3H16A 3JQGB 1L5LA 2PSJA 5EHXA 3ZCSA 4QXPA 3L18A 4TYNA 3MWLA 3RRZA 3ZDRA 3GFVA 4ZVMA 3PX2A 4A0GA 3STWA 3KQHA 4KRXA 4O25A 4Q1AA 1KIMA 4BMNA 3UJ7A 3AR9A 4IIBA 4M1KA 4KDRA 5JADA 4M60A 4J7AA 4MHSA 1L5YA 4RIIA 4YO8A 2EV9A 3DZFA 4GWGA 1OXKB 1Q3HA 1XUOA 3EGDA 2P2ZA 3K4HA 3O82A 2F4VB 6NULA 2V45A 1E8NA 5A9SA 2O8FB 2PFKA 1ISIA 2ZYAA 2VQSA 3ZTWA 3EAFA 3SE7A 1NYTA 1ZSNA 1GZSA 4MUKA 4D96A 1NP7A 2OZVA 4NZYA 2DOKA 1RHUA 2QQ5A 3RTBA 3EULA 1U1CA 3P8ZA 3R5FA 4GKBA 3HUDA 2Y2UA 1KBZA 1JKXA 1DE0A 2W0MA 3ONEA 4GZ6A 1GPBA 4R8SA 5EE5B 1G2IA 2QM3A 1TZ2A 2GMWA 3BFJA 4QG7A 4BNHA 1HF3A 4YCLA 1XZGA 2GD0A 2OR3A 1I6MA 2RKOA 4JB8A 2I91A 2P3SA 4UBJA 1NQTA 4F06A 4WACA 2YV5A 4R3WA 2EDAA 2EWMA 1NN5A 1PZGA 5KU1A 1JSLA 2X1MA 1VTKA 4HAUA 3IB6A 4KPEC 3H97A 1YDFA 1ZN8A 3V2HA 2Y76A 1G6Q1 2VH1A 3FKSD 2PZJA 1F8FA 2EJBA 3JRNA 4XX0B 5TF4A 3STUA 4CTJA 5JS7A 1QZUA 2OHFA 1YI1A 4BX3A 2DR3A 3PUXA 3M6MD 2C7PA 1P74A 1IC6A 4KQKA 4C4YA 1H0HA 4RD1A 3U19A 1TZJA 5FBQB 1KI2A 2XHEA 4JUBA 2R8ZA 5AUNB 4DB2A 4TZTA 1QQ6A 1JEDA 2WUGA 3LT2A 5L4NA 1USVA 3U7FB 1N5RA 3GROA 1PGOA 1SCNE 2WJGA 4KIGA 3U4QA 2BTQB 5H16A 3PU6A 3Q15C 4NYJR 3GRPA 1F48A 1RU3A 1JB1A 4J7CA 1X13A 2FQ1A 2O1WA 4PCLA 3W79A 1P5HA 3ONDA 3UN1A 5A4JA 1XTVA 5CLHA 1BX0A 2KSQA 4NCAA 3OFVA 2J4FA 4X20A 4DCNA 2PJZA 1ORIA 1P33A 4DZTA 2DFVA 3IP8A 5F23A 2QTRA 2XDQA 3JYLA 5EQFA 1PS9A 4B31A 3QMWA 2IYPA 1Z0UA 5AFSA 1WHSA 2GRUA 1L4HA 5IYZB 5EA2A 1O95D 1LW7A 2CLMB 2NGRA 2VSNA 3VDXA 2DX7A 3H8WA 4JBHA 2C7OA 5KSYA 1FE8A 2A0KA 3RU2A 3B53X 1B0UA 1WABA 2JNWA 1S9DA 2YJ6A 5JLAA 4M8SA 1DXQA 3KKZA 2O8NA 5DRTA 1UOOA 1H1LA 4Q4HB 2I7TA 4C06A 2IODA 3MUEA 2B34A 1EXVA 3ZHQA 4TMWA 5EGNA 2BDUA 5JANA 1BE0A 2P69A 5EE3A 4DCSA 2CW5A 5TQ2B 3IMGA 4AULA 2L82A 5SICE 1OU0A 3TR5A 1L9XA 4CV2A 4V0ME 5B6JA 1N8KA 1BSVA 3NH9A 5IM4A 1P18A 4AY6A 5DNVA 2XAUA 3SBEA 2GCIA 4KG7A 2A30A 5FFMA 3UB2A 4YY3B 2QKYA 1I3KA 3N2KA 4Q19A 2XRYA 4FBMA 4JC0A 2VG8A 1BH2A 4AO7A 3K0EA 3WGJA 1H69A 3TQOA 3L4KA 2JZCA 3H9GA 4BO7A 1KVSA 3VC1A 4G25A 4I55B 4QOFA 4JT4A 4QYWA 2VRNA 4PQGA 1CY2A 1LI7A 4PGMA 2PKQP 2R1ZA 3PI7A 3IALA 4AXXA 2BD0A 1PV4A 2RHMA 5FO0A 4M53A 3I04A 4X7MA 1BS2A 1OOEA 3ADBA 2ZUCA 3UGTA 1B8OA 2ZXUA 4UVGA 4U1RA 4BFSA 4G56A 2IYXA 1KDZA 1KARA 3FR7A 1QZTA 3SVLA 3EZGA 4ODIA 4XIYA 1EUDA 4XM2A 4CKWA 3SD7A 3IP1A 4WUTA 2BUAA 2OCAA 2LCQA