4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
1AHHA 2PD6A 3ZV4A 4EW6A 5HRUA 4R16A 4XYBA 1YL7A 3GEGA 5L7YA 4PLFA 1VL0A 4BVAA 3RD5A 4Q39A 4KOAA 3K9QO 3O8QA 2QQ5A 2AW5A 1HETA 2G5CA 2W2KA 3DBLB 2BI8A 4R68A 1J49A 4ND1A 3DAGA 1A9ZA 1YB1A 2PWZA 3DWFA 1OC2A 1P74A 4O6VA 2ZYDA 4IDCA 2ZKLA 1PL8A 4FW8A 4IJKA 3CUKA 3OECA 1LDMA 4DBZA 1T26A 4L4SA 1QP8A 3ORFA 5ICSA 1XHLA 4J91A 3ZU2A 2VQ3A 1S6YA 2A35A 3TSCA 2UDPA 3PWKA 4PLVA 1H5QA 3NKLA 4WCFC 1E3WB 5I8WA 4CLEA 3BZUA 2Q2VA 2QYSA 4MO2A 1XG5A 5F5NA 4Z0PA 5CDYA 4GWGA 2AEFA 3S2FA 2EG9A 1NPDA 1V8BA 3JYOA 3WGIA 2XPCA 4QUKA 3ABIA 4RF4A 3B1JA 3UVEA 1R4MA 4RJTA 4PRKA 1V0JA 3FF4A 2HCTA 1DIBA 2FP4A 4WE3A 4YRAA 1DIAA 3INGA 2LDXA 3HN7A 4WOJA 3A06A 4F6CA 4U6SA 1YQDA 3HFSA 3HADA 4KQWA 3GH3A 2X6TA 3ZWOA 1GUZA 5KKAA 3RUEA 5L9AA 2GYYA 5DF1A 5CG1A 4CQMD 4RLSA 1XA0A 4KWIA 4BNJA 3JYLA 1R66A 2Z1NA 4R1SA 3NTRA 4XWYA 5BQFA 3G0OA 1UZMA 3C7DB 1U3VA 5EQDA 3W4KA 5KVQA 1NAIA 4ZICA 1BXGB 5JS6A 1W73A 4XB2A 3GEDA 1D8AA 3WB9A 1BRMA 1N1EA 1ID1A 1LX6A 2AA3A 4KP7A 4M86A 1NM5A 1UXHA 4CL3A 1YE3A 5JMWA 2QW8A 1PX0A 2IEDA 1LTHR 4P8RA 1F12A 1ONNA 3RBZA 4E5PA 5IXSA 4YAJA 2DBRA 3WJAA 2J3IA 1VL6A 4G65A 4S3MA 3M2TA 4CMKA 3GVIA 4I5GA 4W7HA 1WPQA 4CM3A 3HDQA 4HBGA 4ZD6A 2GZ3A 1B8VA 3WTBA 4DPMA 4CM4A 2F1KA 5C3MA 1BXKA 3DB2A 2VN8A 1D7OA 4J4BA 3ZN2A 4CMJA 1EUZA 4GX5A 2CDCA 2POQX 4RQUA 3GVXA 5G2OA 4R3NA 2B37A 1GR0A 4BMVA 4YJFB 4CQMB 1Q1NA 2ZQZA 2Y1FA 3NT2A 1I30A 5EINA 4IJVA 3OETA 3PZRA 5IDXA 4RL6A 3P19A 4FIZA 2H5LA 3JQEA 3TNLA 1P33A 4H16A 4ZQHA 3INRA 1HWYA 4BO8A 4RVSA 2HU2A 1IZ0A 3CMMA 4BS9A 2EKQA 4BNXA 1JN0A 1XEAA 1Q0QA 2D0IA 3ROQA 2Y0CA 3ZDFA 3I4CA 3ZW8A 2W8ZA 2J6IA 4OAQA 4BNNA 4R1NA 1QLHA 1SMKA 2JHFA 1YB4A 1PR3A 5JXWA 2HKIA 1SBYA 3PI7A 1A5ZA 3D3EA 5I7FA 5GMOA 3KRTA 1BG6A 4J1QA 4BUCA 1DPGA 3D4NA 3I23A 2FY8A 3UGKA 1UDCA 4HY3A 4EJ0A 3G1TA 2YFQA 1BSVA 1VJTA 4CMEC 3EYWA 4XYLA 4GLLA 3P2YA 4ZVVA 4BGIA 4CM1A 1MC4A 3QVTA 5A03A 1B14A 3ZI0A 3PWSA 4KUHA 3TFQA 1NR7A 2RBEA 2DFDA 2VUUA 3T7EA 5HM8A 1P0CA 3EY4A 4YQZA 3SC4A 1N9GB 3WQQA 1KEVA 1ADBA 1Q7BA 1ZK3A 1NQAO 3BHMA 4AVYA 3OM9A 4Q9NA 1VRWA 1I33A 2QIOA 2CMDA 1CF2O 4U0JA 1WMBA 1DC5A 3HHPA 5DT9A 3TZ6A 1F8FA 3DFZA 1JAXA 4K1LA 1LA2A 2Q49A 4BNHA 1RM5A 3VZRA 3WFIA 1ZEJA 2NTNA 4XRRA 1H0KA 3RU9A 1P1KA 1ORRA 2BGKA 2FPIA 1IPFA 2OP1A 3S2GA 3PFWO 1YB5A 1ZKMA 4CM5A 2ZCUA 3ZW9A 2X5JO 4UULA 4MKXA 4Z6KA 3U0BA 4J90A 1Q0HA 1XWFA 3MJSA 4I9HA 3L07A 3VH3A 4L75A 4UUOA 2Q4EA 2ZB7A 1MXFA 3UHAA 4BO9A 1LDEA 1JAYA 4FR5A 1ZSYA 1HLPA 5F1PA 4BNTA 3FD8A 5GZ1A 2ZIZA 1SAYA 3D5TA 2O4UX 3DOOA 4NK5A 2FZEA 1GDHA 3G49A 3D3WA 2Q45A 1K6XA 2Y0EA 4OM8A 1Y8QA 3NYWA 4ALMA 4PVDA 3RKRA 1M76A 1Q7CA 4IZIA 4XGNA 3ZWBA 1ADFA 5TT1A 2C7VA 3OF2A 3L9WA 1YRLA 5LCXA 4FOSA 1JKJA 3JQBA 3LT2A 5TS3A 1ARZA 3IQDB 2EJVA 1Q2XA 4CLRA 1HXHA 1UP4A 4E3ZA 2CVQA 1EUDA 1SCUA 3IKVA 1YQGA 3PHHA 1VJ1A 4PG5A 1DRWA 5TT0A 4OQZA 3DHYA 2BFPA 1PL6A 2H63A 1P44A 4Q3CA 5ILOA 3GAFA 1EDOA 5JCXA 2ZB3A 5AXDA 1XGKA 4YAGA 4NNJA 1MGOA 1ULUA 2Y1OA 1UZLA 2PH5A 3DZKA 5T64A 1ISMA 3F9IA 4R9SA 3S2IA 4B8ZA 3WSWA 5TLSA 4XQ9A 4AJHA 4RF3A 4DIFA 2B35A 4RPGA 4CM8B 1U8XX 2C59A 2EKPA 3O38A 5B4UA 2O4CA 3KSDO 3K2BA 3DZIA 2GCGA 2Y99A 3U49A 4II2A 1RM0A 4ND2A 5EL0A 1T2EA 4MVJE 4WLFA 1LDGA 5A9RA 1VKNA 2Q4BA 1BW9B 3QWHA 4IIUA 1KVSA 5H83A 1KEPA 3RFVA 2I76A 1R6DA 2I6TA 3PJFA 2HDHA 3HN2A 3TZHA 4NJMB 3T7CA 3WX0A 2B5WA 3TZKA 3W1VA 3VPFA 4XRGA 3L4SO 3U3XA 3CE6A 3AOEC 2Q1TA 4S1VA 1ISHA 3VZQA 1N5DA 1ZK1A 5IN4A 3O26A 1AUPA 3WNVA 2X0NA 3KYCA 3ITDA 1SOVA 1VKOA 5JCJD 1DSSG 4MVJF 2GDZA 1DXYA 3H7AA 3WSVA 1U28A 1RPNA 4ID9A 4MINA 2Y68A 1PGJA 2C2YA 3DOCA 2ZJ1A 1N1GA 2WYUA 4PCVA 3RC9A 4WOKA 4CMIA 3EW7A 1GFSA 3H9GA 1NFRA 2EKLA 3BTVA 3GDFA 3NJ8A 4UVGA 3W8EA 1PJCA 2FSVA 3BMNB 3V1UA 2NWQA 1GQ2A 4EGFA 1O9BA 1BTOA 2YDYA 3FSRA 2I9PA 3D4OA 4HWKA 3H3FA 1GADO 4J43A 3V2GA 3AUSA 1Q7GA 4PN3A 1X14A 3TFOA 5U4QA 3I9KA 2G82A 2Q99A 3IP3A 4NBWA 3PHJA 1EFLA 1KOLA 4TRRA 2R2GA 2E49A 2TMDA 2NVUB 3AM5A 4J4HA 5BSGA 4B4OA 1LRJA 4E5NA 5IG2A 1JVSA 3PK0A 2ZB4A 3H9UA 2XOXA 1YBAA 3I52A 3IUSA 5KJFA 4G2NA 1GYQA 2C29D 1KETA 5FYDA 4NBRA 5L51A 4JBIA 5EN4A 5I9NA 2OOSA 3RASA 2WTBA 2B4QA 1BVRA 2PD3A 1ISFA 3GNTA 3PJDA 1YKFA 2AQKA 3H65A 2BFAA 5B1YA 2C5EA 4ND4A 4IZHA 2B4TO 4FFMA 3GHYA 3L77A 1MX3A 2IXAA 3RKUA 4EUEA 4BGVA 4P4GA 1GEGA 1EK6A 4EUHA 1N8KA 3ETDA 3SBOA 5TSDA 4ZQGA 1NP3A 1Y9AA 4IS2A 4ESOA 1IHYA 2QG4A 3GK3A 1TT7A 2EWMA 4BMSA 1I2ZA 4JJGA 4XQEA 3KUXA 3O03A 4ROSA 3RFXA 3IAHA 1DFGA 3GMSA 3IC5A 4UEOA 3K92A 4KUGA 3EC7A 4F6LA 4TVBA 2VHVA 4WCFA 5CEEA 1T2AA 4LVCA 4RPHA 3ZWXA 3TRIA 4NU6A 1DAPA 2RHCA 5IN5A 3WXBA 4DA9A 1CYDA 3RUHA 1PJ3A 4GMGA 4Z9FA 3H5AA 1G1AA 2WYWA 3BTOA 5GZ6A 3ZNNA 2GR9A 3I3OA 4F46A 4U5QA 3L6OO 1A27A 2VHXA 4J7XA 4URFA 3I9NA 2DUWA 4H3VA 4NH4A 4Y98A 1B8PA 1P3DA 1DEHA 4R3WA 5IZCC 4BO0A 4BV8A 1DDOA 3CXRA 4HUJA 2NLOA 3K5PA 2O2SA 1NVTA 1TT5B 3PQDA 4E6PA 1XIVA 3RAJA 3ZV3A 3ONFA 1CQIA 2DKNA 3ICPA 3TOZA 1P1RA 3SEFA 1KVRA 1DO8A 3BMCA 4CV1A 4FS3A 3GEMA 1KY5A 3I9MA 3HSKA 2OXIA 4LVUA 4DC0A 4E13A 1FJHA 3WBBA 2HMWA 1ZUD1 4UEJA 4KUEA 4XR9A 5JDCC 1U4OA 1CRWG 5DOZA 1DB3A 3VVBA 2HRZA 3F47A 2Y1DA 3VPXA 3WYBA 1ZK4A 4DQUA 2BRUA 5TIIA 3I5MA 5JCJA 3R3SA 5FI5A 2C54A 2C5AA 5ES3A 2GF2A 4IM7A 4XQCA 3E48A 4BNLA 5JYEA 4GWKA 2HQ1A 1G0OA 2NNLD 3WICA 3V1YA 4DL9A 3JQAB 1KEWA 2ZYAA 3HFGA 3P7MA 3COSA 3D1LA 1RJWA 4O59O 1KBZA 1I3KA 3F3SA 3KEOA 1PR9A 3RIHA 4PIVA 1CQJA 3PYMA 3BHJA 5AOVA 4AICA 4C7KA 1IPEA 2O23A 3NDIA 3PDJA 5ILGA 3RUDA 8LDHA 1X13A 4TWRA 3FWZA 4GKBA 4MVJH 4RVHA 2EP5A 3KLPX 3RC2A 5IJZA 1NVMB 1BMDA 4EZBA 5A04A 5G0UA 5JDIC 5I7EA 5EPOA 1NXQA 3SLKA 2W2LA 3RC7A 4FFNA 3MJEA 2GRAA 4W9NC 3BTUA 5K9ZA 5TJHA 4CM7A 4OYRA 3WR5A 5ITWA 4CODB 5T67A 3S1LA 3H2SA 4TZTA 3WYCA 3M6IA 1CEQA 3NT5A 1GY8A 2E48A 5L45A 3PHGA 2FPGA 4ALJA 1I8TA 1PJQA 1PGNA 1C1XA 2V65A 3QRWA 4FFLA 2IE0A 2SCUA 1PGOA 3AI1A 3GHHA 4U6QA 3WLEA 2VHZA 4LISA 4R51A 1QKIA 3INTA 3X2EA 4JP3A 4DXHA 1M75A 1LRKA 4MJLA 2C7GA 1EQUA 1T1RA 1R0KA 4CMEA 4U7WA 4OH1A 3FCOA 4YT2A 2Y1GA 3PLRA 3R6DA 5JY6A 5L7TA 3OJLA 1HE3A 1IZ9A 2BF7A 4I9NA 3DFUA 1H94A 1ISJA 4CQLB 3GC6A 3O8QB 2JL1A 3FNEA 1O5IA 2PA3A 3PJEA 1SB9A 3GGOA 2PK3A 1I2BA 3JQGA 1ENPA 5ADHA 3QE3A 2JCYA 5T8KC 3W4JA 1HDOA 1WZIA 1XU7A 3ZV5A 2DTXA 4RPLA 2DAPA 3GGGA 1ZNQO 1P31A 2Q1SA 3PYXA 1ADGA 3L0DA 3L4BC 5JC1A 1DIGA 2CUKA 1FF9A 4D3SA 2RIRA 3ICCA 3QWFA 2Q2QA 4W4TA 2CSUA 2JJYA 4PLYA 1ZIDA 3DZHA 1AN9A 3EAGA 4J0FA 1F06A 2X9VA 4NZ9A 1HE4A 4OL9A 2V6GA 4YB8A 2EW8A 5A1TA 1W6UA 5B37A 2QRJA 3ON5A 4FN4A 1CDOA 1HDGO 1NTOA 4JK3A 4A7PA 3LU1A 3D5QA 1EBUA 2WE7A 2RAFA 4J2HA 1C1DB 3DBHB 2RHRA 2ZTMA 3E8XA 4IDFA 4B4UA 1GQYA 3ZWWA 4CV3A 4OHUA 1I5RA 5G0SA 3VTZA 3DBVO 1HEUA 1DRVA 1QV7A 1WZEA 4DIBA 4WJZA 5A3VA 2B83A 5EIOA 4YT5A 5ER9A 1U3TA 3GN2A 2CDBA 1SNYA 2HLPA 3ANNA 2OP0A 4NFHA 1AGNA 5JSFA 1WDKA 3EHEA 4XYMA 4YRDA 4IMPA 1TA4A 2B36A 2OBNA 4NQZA 5TX7A 3AUUA 4KTTE 1N7GA 4BQRA 5G0TA 4BKQA 1IYZA 1NFQA 4EBFA 1E3JA 4P38A 4Y8VA 1YONA 3RROA 3PIIA 5IDWA 2G0TA 4M49A 3KLMX 3PIDA 2V6BA 2DQ4A 1TXGA 3HB5X 4BQPA 1HDCA 2BI7A 3JQCA 4IGEA 1YDWA 1E3IA 3NUGA 3WGZA 3QVWA 3B1KA 3WGYA 3JD1A 2V6FA 1QRRA 4D7AA 1GYPA 2FN7A 4FJ0A 2GO1A 5L3ZA 2B69A 1LU9A 1UXJA 2OBYA 5JYDA 3QLJA 4E2XA 5A02A 2NQTA 5AXCA 2VYNA 2DUUA 4WLUA 1K89A 2QYTA 3E5MA 2JAHA 3LK7A 3RUAA 1HDYA 1QR6A 4ALLA 1PJBA 2J3KA 3AOEA 1X1EA 2NTJA 1LSJA 2GN9A 3Q2IA 2PY6A 5IDQA 3VOSA 2Y1EA 1VI2A 4U8GA 4A0SA 2IDZA 2YHUA 2GGSA 1EK5A 5G4KA 1MLDA 4HKTA 1U3WA 4N5LA 1RM3A 4OGWA 4BO2A 3DBRA 4GMFA 4QT0A 2D59A 4WUVA 4B7UA 4DVJA 3V5NA 3GG2A 4DRYA 4YVFA 2JCVA 2JD1A 3WWZA 3BMOA 2JFGA 1E5QA 3NT4A 4DC1A 4R69A 3KB6A 4HFNA 4XKJA 3MTGA 1ENOA 1KERA 1XDWA 2B4RO 4PGFA 3QV1A 1ZW1A 3TWOA 4CLHA 4JJIA 2DLDA 2IODA 2Q1UA 2FPPA 5H82A 4B3JA 4F45A 3JQ7B 4IBOA 1B3BA 3FTPA 4BO7A 3OIGA 4I5DA 2D4AA 1R4NB 5TQVA 2Y05A 4D46A 4IQ0A 2IRWA 3DEYX 1XCBA 3FI9A 4U0KA 3U62A 1NVGA 4LRTB 3WG9A 4JJFA 3HDHA 4J9UE 2HO5A 4BOYA 4MVJD 3KV3O 3JQ8A 2ZTUA 5AXAA 4F3YA 2NUAA 1Y5MA 2CVOA 2TMGA 4HFMA 3OQBA 3Q9NA 3GUCA 3TF5A 3U4HA 3K73O 3KHUA 3ZHZA 4A03A 1DHTA 4YJHB 4BL5A 5JAIA 3NEPX 3UAGA 3ULKA 1ZVMA 4HFRA 3MJ4A 4PLCA 2Z1MA 3GPIA 4ALNA 1QLJA 9LDBA 1ZCJA 4ITUA 2GERA 3PXXA 1PZFA 3DBLA 2YJZA 2X86A 5EERA 1LLDA 2EW2A 3Q6IA 3N7UA 3VKUA 3HUDA 5FFFA 3QIVA 1H6CA 1JLLA 2FSSA 2HK8A 3AY7A 5IDYA 1LLQA 2IXBA 3W4IA 5JO0A 4BNWA 4YCAA 1A7KA 3GN1A 1U9JA 3UCFA 2AE1A 4B4VA 1NPYA 1NQ5A 2PKRA 1QYXA 1UAYA 3QJ5A 3WOHA 1UXIA 1PEDA 3KYDB 1E3WA 4JP2A 4WEOA 3RBVA 3JD4A 5BT9A 1ISIA 2VZ9A 1IUKA 4RDIA 2UUOA 3OIFA 3RUFA 4EEXA 1RYEA 1GTMA 4NBUA 3ZH2A 1DLJA 3S8MA 1PGQA 1NHWA 3WYEA 4AJ2A 4XA8A 2Q50A 8ADHA 3OP4A 1P1IA 1P77A 2P2SA 4MDHA 4P22A 3AI2A 3RU7A 4HADA 1RM4A 2W90A 1AXEA 1Z45A 3DMYA 3I6QA 4RO0A 2I65A 3WDSA 3JQFC 3JQ6A 4TVOA 4OSPA 2WEKA 3EZYA 4CMBA 5IZCA 1TB4A 4NPCA 1WW8A 3MOIA 3RC1A 5THKA 1ENZA 1DJQA 5BR7A 3LZ6A 6ADHA 4PG6A 1HTBA 4EUFA 1A4UA 1R16A 2CF5A 3DZJA 1WDLA 4UUNA 1YGYA 2QRLA 1U7TA 1L1FA 1C14A 2DT5A 3ZHXA 4OKIA 2D1YA 2VRBA 2ZTLA 2AE2A 5KKCA 1BXZA 1Y1PA 3WBFA 1GUYA 5JW6A 2PLAA 1BXGA 1NWCA 1BHSA 1WWKA 3H9QA 1U8FO 4NR0A 3RSHA 3TZQA 5B12A 4D0RA 2X23A 2WWRA 1N2SA 2I66A 5JDCA 1I01A 4D45A 1H9AA 1ONOA 4DLLA 3EZLA 4CMAA 1QYCA 2NU9A 2UYYA 3GQVA 4R41A 5JAMA 3JD2A 1J6UA 2J3HA 3CZMA 1XKQA 3GZ4A 3RI3A 4EJMA 3HDJA 5G4LA 3CMCO 1U5AA 1Z73A 4O5OA 4GL4A 3DHNA 3NAQA 1DHRA 3OMLA 3QWIA 4FJ1A 3ADOA 1PJSA 2GLXA 1O94A 1DOHA 1HL3A 1SO8A 4E31A 1MXHA 4Y6SA 1GV0A 5A9SB 3ZZNA 4N5MA 4YJFA 1E3SA 4CQMA 1DC6A 3UN1A 2AHRA 1PWZA 2GZ2A 2YHIB 3A4VA 4J1SA 4GBJA 1YXMA 3W6UA 4ILKA 4Z9XA 3CSDA 2VRCD 3DZBA 3IS3A 4IXTA 3CIFA 5DCWA 3GY0A 1E3LA 5JBIA 1L7EA 3ZWPA 4DIOA 3WGQA 4UVEA 4CMIB 1E7QA 5A06A 5C7IO 1VM6A 5CP8A 5JDIA 4JX8A 4OOFA 1HE2A 4M8SA 3NV9A 4CV0A 3KETA 4W9NA 5A5EA 1WNTA 3ONEA 3OJ0A 1O6ZA 3ZHBA 3AUAA 3HWRA 4IJUA 3SJUA 4BO5A 1X7DA 1LJ8A 3PYLA 9LDTA 3WFJA 2DVMA 3HE3A 4B3HA 4E4YA 5G0VA 2VWQA 3I9LA 1HE5A 1E6WA 4QX6A 4RPKA 3BYZA 4INAA 4J7CA 1V3VA 2P9GA 1P1JA 2VTEA 4DBVO 4DMLA 1JKFA 4ZQBA 1DJNA 3RQSA 1IHXA 3DAPA 4BKPA 4CR7A 4FSHA 4XJTA 3QWAA 4FBGA 5KJ6A 3ANLA 3KZVA 4YJGA 4O1MA 3K2EA 1LC0A 4GH5A 4A27A 2VWGA 2X4GA 5CHEA 1N9GA 1YL5A 3VPSA 1LSSA 3WQRA 5IZ4A 2HMVA 3AFMA 2BMAA 2BFOA 1HDXA 1A4IA 3U4IA 1JW9B 2WMDA 4I1IA 1DIHA 3E82A 1T4BA 2NV6A 3GF4A 1KVTA 1V3UA 3ZU3A 2P5UA 2EV9A 4UVDA 1JKIA 1ZJYA 2I3GA 1YBVA 4AL4A 5KJCA 1MUUA 1NAHA 1KS9A 5T8KA 4GI2A 5KJ1A 1Z7BA 1PZHA 1TLTA 2VOEA 1IY8A 3L4BA 3Q0EA 4IIVA 1B3RA 2JFFA 4CLDA 4DYVA 1I3MA 5IXYA 3AU8A 3Q2KA 3FPLA 4DWVA 3LC1O 2OGUA 1K6IA 3WGGA 3N74A 5HS4A 2QZZA 3LF1A 1F0YA 1E3EA 7MDHA 1SEVA 4FGWA 4NFYA 4CLOB 4PVCA 4N5NA 1NHGA 4FPXA 4GVLA 1I24A 4XJSA 2NSDA 2OUIA 2BD0A 2VWPA 4DMMA 3NGXA 2VZ0A 4ZRMA 1X0VA 2VUSA 1EVJA 2PKQO 1YS4A 3FNGA 1S7CA 1WVGA 4FQ8A 1VJ0A 3IUPA 1X1TA 4LCEA 3LSYA 5ENVA 1LUAA 4BMNA 1GEEA 5A9TA 1T25A 4BIIA 4PZCA 4GSLA 1JDJA 3SC6A 3PPIA 1DFHA 4YACA 1QV6A 2X5OA 4M1QA 1Y8RB 1ZBQA 4JXKA 5JAZA 3H5RA 1E1NA 3OJFA 3CINA 3WTCA 2XXBA 4KDFA 3JTMA 3HNPA 3PGXA 3OBBA 5H81A 2PZLA 3E18A 5BNIA 1UP6A 2WD8A 5C5IA 3I83A 1E7WA 1QSGA 2X22A 1GAEO 3PWZA 1BDBA 1U2GA 2B5VA 3KSZO 2QX7A 4GVXA 1A9YA 4DLAA 4UEKA 3BMQB 4BNYA 4LCJA 4CM8A 3GVCA 3E5RA 3A1NA 4J1NA 2HMUA 4WLEA 3PQEA 2XAAA 4XD2A 1PJLA 3AFNA 2YFHA 4UVIA 3FPCA 4B79A 1NWHA 3PQFA 4MIEA 1BW9A 1GZ6A 1HDRA 1RYDA 1U3UA 2VRCA 3DC2A 3E03A 3E6AA 1CJCA 3G1UA 3PLNA 4NBTA 5EJ2A 4ZU3A 3DZGA 1M66A 1ZZEA 4EJ6A 5B4VA 5F1OA 4IJWA 4NJMA 4LN1A 2LDBA 3I9JA 1JQBA 2E6UX 3DL2A 3MEQA 4BNKA 1DIRA 3A14A 4WLNA 1IULA 2UAGA 4IDDA 3C7CB 6LDHA 3ETEA 1BVUA 2YYYA 4L0QA 1OAAA 4MKZA 1NPTO 3GZNA 4DPKA 4AJOA 1ZXLA 2W4QA 5DN9A 5HTOA 3GDOA 3OEWA 5DP1A 3NDRA 2A94A 3U5TA 4PG8A 3ZWYA 3JQAD 2IZZA 1FK8A 3I9OA 4MP6A 2H9IA 3BMNA 3UW3A 3V8BA 3JD3A 4UAGA 1DFIA 2P9CA 3UUWA 3GOHA 4I08A 4WNIA 1Y9EA 1DBVO 1B16A 4JGBA 3MJVA 5EESA 4XYGA 1NFFA 5T5QA 1O95A 3GAZA 1PTJA 1WXDA 3C1TA 3WIDA 1KEUA 3ZWNA 4DGSA 2Z95A 4CUKA 2NVWA 1A7AA 4MIYA 2NM0A 1PQPA 1NBOA 2NADA 4IPTA 2JHGA 4AJNA 1KVQA 1ML3A 3CKYA 5L4LA 2NVUA 4Y67A 1PZGA 4FOOA 2FR1A 1E7YA 1Z74A 1YWGO 1K0UA 1O8CA 2OORA 1NX6A 2J5QA 3QVXA 4TRMA 1H6AA 1E5LA 1PU2A 3LLVA 1XYGA 3OICA 1R12A 4TROA 4NU5A 2BHLA 2UV8A 4O63O 2P4HX 1B8UA 2X0RA 5DBFA 2BKAA 1ZFNA 1VSUA 4B3IA 5KOIA 2IYOA 1KIFA 1KY4A 3FTNA 3NDJA 4BGEA 1HKUA 3KEQA 5KVSA 2RH8A 4ONEA 5EQFA 4XIYA 2CNBA 4HFJA 7ADHA 2WD7B 2DBVO 3TJRA 4J49A 4IXWA 1X7GA 3C85A 4KMSA 4WK6A 1N7HA 4HXYA 3Q11A 3JSAA 1ZMTA 1YO6A 4JNKA 2QHXA 1W0CA 2FR8A 1UR5A 3EUWA 4MVJM 4BV9A 1K3TA 2EJWA 3VKVA 4E30A 1U7HA 3UCEA 1P1HA 3GR6A 4J7UA 4YR9A 2YQ4A 2X9GA 4BO6A 1Y7TA 1KC1A 2GD1O 3AM4A 3TQHA 3GMDA 4RGBA 1Q0LA 1NQOA 3ETGA 3MJCA 3UF0A 4E5MA 2IYPA 1Z7EA 1PS9A 3OQ1A 4K6CA 2Z5LA 3HQ4O 1MG5A 3E9QA 3LVFO 1GCOA 4XQGA 2E4AA 4IS3A 4QTZA 4Z3DA 3ZWCA 3VPGA 1PIWA 3BAZA 3FR8A 5I9MA 4R4JA 1FMCA 4YA6A 4OXYA 2HMSA 2G1UA 1NQTA 4EITA 5ICMA 1GQQA 1AE1A 4MP3A 3UH1A 1R15A 3LT1A 4KZPA 4D3FA 3JQBC 4OXKA 1XR3A 4YAEA 1TI7A 3T4XA 2ZK7A 1LXCA 5AXBA 3JQFA 4A26A 2VT3A 1I36A 4P4NA 1TT5A 1QMGA 2GNAA 2P5YA 4BO1A 1YOVB 1ZXBA 3PVZA 2OFPA 2JFHA 3K31A 1LDYA 3A9WA 1E7RA 4A73A 5L95A 3NRCA 3D4PA 1NYTA 4KQXA 3KYBA 4PLPA 1C3VA 4GQAA 3SX2A 4KTVE 3PHIA 3G3EA 4TRNA 5JPIA 3MCVA 3C3XA 2NTVA 4YBZA 1BWSA 4BNUA 5LDGA 1LRLA 2W2KB 1YDEA 3V2HA 4YRBA 1VC2A 4K6FA 4WASA 5F5LA 3WWYA 5KWEA 3EGOA 1Y5RA 1H6BA 2VHWA 3D0OA 3F1KA 3HJAA 2AMFA 3GT0A 3MTJA 4PLZA 1N92A 3DO5A 5THQA 3ZNOA 2YQ5A 4FFOA 5KJEA 3JQAA 4RF5A 1D3AA 3F6YA 2DPHA 2WYVA 1U1IA 2PTGA 5F1KA 3V1TC 4J1TA 2D2IA 5DNAA 4GX1A 4MVJI 1EVIA 5U9CA 4Z3KA 5JE8A 3ONDA 2BFMA 1GV1A 2Y1CA 2ZCVA 3NJ4A 3ZU4A 5DBGA 1QYDA 1X15A 4L8VA 5JMPA 3VZPA 4BHTA 5ITVA 4PLHA 3PJGA 2WDZA 2YV2A 3ST7A 3E9NA 5BSHA 1R4MB 2AXQA 2QZ9A 4C4OA 1ZK0A 4IDGA 3B70A 2GASA 4IGFA 1V3TA 4E33A 3G17A 4TKLA 3ITKA 4JN6B 4BKUA 1G0NA 3FHLA 4HNGA 3WGHA 2VNAA 4CR6A 2R00C 3FBTA 1YH3A 2FZWA 1MA0A 4A10A 4ALKA 1IB6A 4FD3A 3RFTA 1MC5A 2DTDA 3AWDA 2GN8A 3IJPA 4R9RA 1M2WA 5BSFA 2WE8A 1UAGA 1E6UA 4CMHA 4ND5A 4GGPA 1UUFA 2O50A 1WMAA 1HSOA 5IF3A 4WLVA 3BA1A 4TRJA 1SC6A 4CUZA 4MPDA 2AQHA 2IZ1A 4NK4A 5L53A 1Y6JA 4MOWA 3LQFA 2BELA 3C7AA 5GZ3A 3OJEA 2HJRA 4FC6A 4NG5A 2EF1A 4II3A 2O3UA 5B4TA 1G6KA 1LDNA 4TQGA 3GVPA 1ENYA 1E1MA 3NX4A 2CVZA 1UJMA 4CJXA 4RV9A 5U1PA 5I7SA 4PG7A 4CQLA 5CDSA 2UUPA 2Q3EA 4RZHA 1J0XO 2O48X 4NI5A 1ULSA 4JROA 5TNXA 2BGLA 4FGSA 4DLBA 3JYQA 5KVVA 4CM4B 1VE9A 5C7LO 3R0IA 1C0LA 3STHA 4GX0A 5AVOA 2QRKA 4IDEA 1E0DA 3CZRA 1PQWA 1EE9A 2X9NA 2AEJA 1H6DA 2X1HA 1B15A 3WS7A 4QEDA 1PL7A 5BNTA 4B8WA 4RVUA 3GDGA 2FWMX 4MIOA 3OA0A 3HG7A 2VZ8A 4N7RA 1E7SA 1MG0A 1ZO8A 1MFPA 2C82A 3R1IA 1OFGA 5TJ9A 3UICA 3T4EA 2VTDA 1CERA 1T1SA 3JQ9C 3E9MA 2Y67A 4E12A 5FF9A 1C1DA 1JTVA 1EDZA 3DBHA 5LC1A 3IDSA 4XCVA 5DULA 3DXFA 3VH4A 2X5KO 3H2ZA 3ENNA 3K8ZA 3DHEA 1YL6A 4NFSA 4GLOA 1A72A 3WQSB 1EMDA 4ALIA 2G17A 3TL2A 4E32A 4K9DA 4IUYA 1LQTA 3JQDA 3JD0A 1WP4A 4W6ZA 4WGGA 2B0JA 3JYNA 4BGUA 4AJLA 2I67A 3K30A 3ZCXA 4J0EA 5ER6A 4CUJA 3SJ7A 2H6EA 1YVEI 3GFGA 4PLGA 4E5YA 3VDQA 1FDWA 3F5QA 4L73A 5FI3A 2Q1WA 5I8ZA 3WNQA 4HP8A 3ZU5A 4G81A 4E2WA 4BKOA 2GN4A 3ZNPA 1HLDA 4AJ1A 2YY7A 2J8ZA 1OZAA 5CDGA 2PKQP 4EDFA 2HJSA 4BB6A 4A2CA 4GAEA 4BNGA 2EXXA 4RPJA 2DPGA 2EEZA 4QO8A 4YPOA 2P68A 2GSDA 5BSEA 5L40A 3ZV6A 1T4DA 3PEFA 3LC7O 4AFNA 3B6ZA 2I3AA 4OIMA 3OFSA 4XR4A 3FNHA 3K6JA 1MFZA 1QYVA 3RJ9A 4J9VA 5JY1A 5KTKA 1NR1A 4MVJG 2ZTVA 1UZNA 3JV7A 5T57A 4TZKA 1FDSA 4OJNA 3O4RA 2CZCA 1MB4A 4CPDA 2AQ8A 2P9EA 5LDHA 1EFKA 4YJDA 4YTEA 3KBOA 3QY9A 1VPDA 4XZ3A 3GRPA 2O3TA 2X0IA 4KDEA 3C24A 3QQPA 5BNFA 4UVHA 4ZQFA 4QSMA 5G0WA 3D3WB 1Y8QB 1Z75A 4AJIA 2YV1A 1GCUA 1ZMOA 2EGHA 2FR0A 4H15A 1C0IA 2ZYGA 1CWUA 2C07A 5T6BA 4WLOA 1VLLA 1JWBB 1R37A 1PJTA 3FN4A 3CH6A 4EEZA 1HYEA 3AI3A 5JAQA 4ZJUA 1PJ4A 4RVDA 3GLQA 1DLIA 1QG6A 5HS6A 1I0ZA 3JQ7A 4K28A 3CTMA 1UP7A 5F3RA 4KWHA 4CLRB 4CMGA 4YAKA 3F46A 1R4NA 4HNHA 1T2DA 4DUPA 3LC2O 2NQ8A 4I8XA 4D79A 1YQXA 4XGIA 4LMPA 4JIGA 5L7WA 4JQCA 1ISGA 3DTTA 1OI7A 5I9LA 3B20A 3HDYA 4UUPA 1WDMA 2A92A 2X7HA 4R54A 3EVTA 3H8VA 2HK7A 3PHLA 1Z6ZA 4L4XA 3S55A 5JC8A 5FWNA 1Z82A 4PLTA 1GPJA 3ANMA 4CR8A 4FDAA 3L6EA 4Y6PA 3FRJA 4CM6A 4TMFA 4YJHA 2Y93A 3IP1A 4YJGB 2PH3A 4XYEA 1ZH8A 3LDHA 3RWBA 3C1OA 1D1SA 4LGVA 2O3RA 2XF8A 2O7QA 1NNUA 4B7XA 3OEYA 4AG3A 1XELA 4JBGA 4YDRA 4D44A 5CEJA 2EP7A 2PZMA 3E1KA 5CDUA 1Y81A 3W8FA 1R0SA 2UVDA 4NHEA 4R5HA 3ZWMA 3EDMA 3OIDA 5DCUA 4O0LA 4AJEA 5K6AC 3OA2A 4B4WA 4AJKA 2E37A 3AY6A 5JO9A 1K2WA 3I1JA 3PRJA 1LI4A 4PFJA 4D42A 3KYCB 4E21A 2FRDA 1HDZA 4LSWA 4N54A 3PDUA 3QVSA 3BIOA 5L4SA 3ENKA 5C37A 3SVTA 4ND3A 4QECA 4YAIA 2CFCA 2J5RA 4TKMA 1LBEA 4MVJA 3KYDA 3WGTA 2CD9A 2D8AA 3MWDB 1IE3A 3RUCA 3FNFA 3WMWA 3CPSA 1OBFO 1TEHA 3EVNA 5KCZA 3VH1A 1P0FA 4WKGA 4I5EA 2FOIA 3R3JA 3TL3A 5AYVA 1KYQA 3LT4A 1D1TA 1A71A 3DZFA 3H4VA 1HSZA 5MGBA 4JCOA 1P45A 1DRUA 2AG8A 2JD0A 3C1AA 4WNCA 2VHYA 5TF4A 2ET6A 3KVOA 3KSUA 2JCXA 4UREA 3AM3A 1GYRA 3U09A 2Y0DA 1YJQA 2OO5A 5DOVA 1W8DA 3DMTC 2DTEA 2PGJA 4J4TA 3CTVA 2D3TA 5K0ZA 4Q3NA 2OL4A 3AUTA 2RCYA 5DZSA 1RKXA 4CMCA 4D41A 1KC3A 2NACA 1H9BA 2G76A 2BGMA 1E1LA 4ZN6A 1T2CA 4R1TA 3VZSA 1ZK2A 1B2LA 1LQUA 2GUGA 3MZ0A 2A4KA 4YXFA 4LMRA 3PGJA 1C0PA 5KNLA 3ZWAA 3AW9A 4Q3DA 1H93A 1QXSA 3GG9A 2D5AA 4NMHA 4R1UA 1FDTA 2O7SA 3KM0A 1W4ZA 4PZEA 1IOLA 3DTYA 4L74A 1EVYA 1LC3A 2C0CA 4H7PA 4CV2A 1TVEA 3PFFA 2DM6A 4RVGA 2GPTA 4BO3A 4B7CA 4XIJA 3VPHA 1JA9A 4XGKA 1NASA 4PG4A 4OQYA 1ZJZA 1SPXA 4RVFA 1WLYA 2O2YA 2EIHA 2DFVA 4CL8A 4PZDA 4OKNA 4J3FA 4XX0A 4NJOA 3Q3CA 3RCBA 5GY7A 5IAAA 1XQ6A 4ZQEA 2ZJ0A 1PSDA 5A9SA 4WCFB 3RUIA 1HF3A 5J23A 1I3NA 1E7MA 2E82A 2OZPA 3DDNA 3GA0A 3ROPA 2V6MA 5CPBA 4L4RA 1L7DA 4K26A 4DPLA 2YHIA 4D0SA 3D64A 3O9ZA 3GZNB 1ZEMA 1J5PA 3ROKA 1LEHA 4DQVA 4C7JA 1LSOA 2VNSA 5CPFA 3WLFA 4YT8A 1EEHA 4NBVA 3OQ6A 1VL8A 4XDZA 2NU6A 4NIMA 1PWXA 2VOJA 2YV3A 1J4AA 4N18A 4Q3BA 3NTOA 2R00A 5COQA 3JYPA 4D3DA 3QSGA 4A5OA 4W99A 1DC4A 5ENDA 4LW8A 4M55A 5DP2A 5EMHA 1LSUA 4GKVA 1I32A 3H3JA 3BMCB 1PS8A 4M89A 4Y6RA 4Z0HO 3TN7A 5KIAA 4QFCA 1PS0A 4IQGA 1X0XA 1DC3A 2C20A 3LLSA 2YDXA 2AEMA 1XU9A 3L6DA 2O3QA 4YEDA 1E1KA 1MP0A 4AJ4A 3F4LA 5HBRA 3ZGYA 3U9LA 1U5CA 4R01A 3H9EO 3BXXA 4YYZA 2W2LD 3F1LA 2DBZA 2HSDA 4J6FA 4FJ2A 3TZCA 4RCVA 2O3SA 3LT0A 5TC4A 4CLXA 3IIEA 1B7GO 2BLLA 4GPD1 4OOEA 3GPDG 3FWNA 2CDAA 1GU7A 1OC4A 3OSUA 5DDIP 2VYVD 2X0JA 3OH8A 2F00A 2JAPA 1GZ4A 3DQPA 3H6KA 3HB4X 3IL2A 2HK9A 5MDHA 1BGVA 5JNLA 1V9LA 4FCCA 4E2ZA 3IOYA 2ZATA 3MJTA 3QW2A 1QYWA 3MOGA 4E2YA 4WCDA 2AG5A 2AQIA 1FDVA 5F21A 3VTFA 1EBFA 2FMUA 1D4FA 4M54A 2I99A 1EUCA 4ZHSA 2PZKA 3DOJA 4MP8A 4R5MA 4E0BA 2PGLA 4GX2A 1IL0A 1CETA 1HRDA 3QHAA 3CEAA 4QXMA 5CDTA 1M67A 3ZWVA 1B0AA 4Z9YA 3EK2A 1CIVA 4BKRA 3I6IA 1JVBA 2PNFA 1GD1O 1JU9A 3WIEA 4I9UA 4WECA 3UOGA 2DBQA 3ASUA 3NGLA 2YZ7A 1JWAB 4QO7A 4GGOA 2J5KA 5DBIA 1LNQA 5CAEA 2A9FA 2HAEA 4Y9DA 4QQRA 4AJJA 4CLOA 5IFLA 3JQ9A 2DC1A 2V7PA 3VAZA 4I5FA 4DREA 2NVBA 2P91A 3PTZA 5FEUA 2Q2WA 1OMOA 3ASVA 3KO8A 4Q3EA 2PFGA 1I3LA 1LLCA 2HUNA 2H1SA 2X8LA 1R0LA 1C1XB 2GZ1A 4LRSB 4JLWA 2IZ0A 3FBGA 4MKRA 1Y8RA 3H9JA 3S2EA 3WMXA 4ZGWA 3C8MA 3ZHYA 3AOGA 3JCZA 4LK3A 3F4BA 2YUTA 2NU8A 3U4DA 4YT4A 4YQYA 1HYGA 1M6HA 1PQUA 3VDRA 5HWSA 2ILTA 4RLHA 4IY1A 4GSKA 4ZRNA 4IDAA 1H2HA 3SXPA 1QORA 4CM9D 3LF2A 4ZA2A 3DR3A 3SLGA 1VSVA 2EGGA 1ZSNA 3BMQA 1GPDG 1HYHA 3NTQA 4DTIA 2ZQYA 4W7IA 3GGPA 1KVUA 3JQGB 2VWHA 4BNIA 3PZBA 4BNFA 1C0KA 4PRLA 3U4CA 5TGDA 2EERA 3VH2A 1SB8A 1T2FA 1E92A 4FFRA 4WPGA 1V35A 3KXDA 4RQTA 5A4DA 1V6AA 2WSBA 3W8DA 4BNVA 1I10A 4UUMA 2IEBA 4BO4A 3ZNQA 4WEQA 4J16A 1AHIA 3VVCA 2R6JA 1AXGA 1X7HA 1RWBA 5L4NA 4IINA 3TDKA 4LSMA 4RORA 5COAA 1PJ2A 3V2UA 2HMTA 1I2CA 3Q1LA 3IMFA 1T24A 3W6ZA 3LYLA 2PV7A 1FXSA 3VC7A 3IKTA 2JKVA 3GNQA 4IMRA 3TPCA 4DQXA 3UXYA 4XDYA 2JD2A 3I4FA 1B26A 1P9LA 4Z0TA 3KTDA 5I7VA 1O0SA 2Y66A 1K6JA 4BNZA 2D5CA 3Q9UA 4IDBA 3UCXA 5COBA 4L76A 2VYND 2GN6A 5CG2A 2X58A 3QVOA 2OMEA 1F8GA 4RF2A 1K5HA 3HZZA 3GRKA 1EE2A 2NU7A 3P2OA 3K96A 2O3JA 1GUFA 3H5NA 4AJPA 3ADPA 4OO3A 4OXNA 3WJ7A 4DYDA 2VYVA 4BNMA 5KVCA 2VT2A 3AU9A 3OHSX 3GVHA 4J2OA 4Q3AA 3M1AA 4M87A 1YJ8A 2VCYA 1WAMA 4PLWA 1YBMA 5AQ1A 3N58A 1SZJG 3QA9A 1E77A 5A5FA 2EHDA 1XSEA 3DONA 3QWBA 4G5HA 2CY0A 3KOUA 1EQ2A 3VHRA 3UKOA 1UDBA 3BTSA 3EMKA 3UFXA 2Q46A 3AK4A 2W98A 5JFOA 2FHSA 4FFPA 4HX5A 5A05A 4HV4A 4BB5A 1EZ4A 3A28A 4FC7A 2OHXA 1GL3A 3IJRA 5A3JA 3RVDA 4YWJA 3MWEB 4OMUA 3X2FA 3M2PA 1SOWA 1HT0A 3WGOA 4JBHA 4XB1A 4E5KA 1P1FA 4MVJP 1O89A 2WD7A 2YW9A 1DAOA 5CFZA 2HRBA 1BDMA 1UH5A 1SEPA 3AY3A 5HA5A 1M6WA 2C2XA 4L9RA 5K6AA 2DU8A 4RDHA 2ZB8A 1E6EA 1FDUA 3TOXA 5JLAA 5TRTA 3M1LA 4D43A 1XQ1A 2PZJA 3G79A 1PGPA 1ONPA 1MV8A 1HZZA 5DCYA 1UDAA 4XEHA 4EYEA 4OSOA 5C7OO 5G4KB 1F14A 5CEFA 3P5SA 4EI2A 2CF6A 3DBRB 2WM3A 3PP8A 3RJ5A 1F17A 1LDBA 1LLUA 1ZSVA 3BMOB 3GFBA 1XLTA 3ROMA 4FB5A 4IQ8A 3BHIA 2BH9A 3B1FA 4NDNE 4RZIA 3OJOA 1UXGA 3DAFA 2PGDA 1U2DA 4QFDA 4W82A 1H2BA 1UXKA 2P4QA 1PZEA 4CM9A 1ADCA 1HZJA 2WJPA 2PD4A 4P4LA 2RH4A 4X54A 3RBXA 4TSKA 3F5SA 2PR2A 3FR7A 1U4SA 2I5PO 3D7LA 2XXJA 3AJRA 3GNSA 3JQ8B 3DMTA 1EVZA 1YOVA 1OOEA 2VUTA 2J3JA 1GZ3A 3QP9A 3GUYA 3L9XA
chains in the Genus database with same CATH superfamily
1AHHA 1PDOA 1ULZA 4LDJA 4FOTA 3S7ZA 4E5SA 1D1QA 2VUHB 2J6HA 1JT9A 2D3WA 1F5SA 5GIPE 1J2RA 1YL7A 4XYBA 4DR1B 2P41A 4PTYA 4I81A 3BAFA 2VDPB 4D02A 4OXQA 1FP7A 1DAIA 3ZZTA 1F4VA 2IHBA 2J9FA 3O8QA 5J5AA 2AW5A 3IURA 4ZJYA 1INLA 4MS3A 1SWVA 3PNQA 3RVKA 4BX8A 1PTKA 3LUJA 3UWOA 2WG1A 3D2BA 2W2KA 3DBLB 4LGYA 1P29A 2B2NA 4JIMA 1QGED 4I1YA 2MSEB 2PWZA 1Z37A 3DWFA 1OC2A 1P74A 3KX2A 2ZYDA 2VSYA 5DPMA 2YHAA 1PL8A 2FSPA 2MSCB 3REFA 4DBZA 3QXCA 1JPNA 1X77A 1SUIA 3FYUB 3IPAA 4KDRA 1QP8A 2EFCB 1U9ZA 2G9RA 3DWEX 2VNJA 4A0HA 1JT2A 2A35A 5F98A 1F8XA 3T3OA 3TSCA 3LOQA 2P0AA 2R7NA 4PLVA 3DFMA 1VIYA 2QSJA 1VYHA 2H2GA 4Z9AA 5DLPA 2LIVA 1E3WB 1XQVA 4INPA 3IUNA 1JFVA 1K7EB 3GUZA 4BTEA 4L8LA 4YMSA 2VBFA 3JALB 2WOOA 4YRPA 3MOSA 1KI7A 2J31A 1TCVA 2A1UB 2AEFA 2EG9A 4TWAA 3NM6B 3STWA 4B43A 4ZJZA 1W2GA 3Q7TA 1UF9A 5HK8A 4ESVA 3GFTA 4U7JA 3M9XA 2YV4A 3PNLA 1F4LA 2BM8A 3DCIA 4BLWA 3AYZB 1O1YA 2OZVA 1ULHA 3FF4A 3Q3IA 3P97A 5KMGB 1L8AA 3FPAA 3M6AA 5LZ8A 2LCIA 2GPYA 3INGA 3U26A 1H8HD 1U7DA 1UEXC 2D06A 4F6CA 1O5TA 2WWTA 1JTEA 3EEFA 2CB9A 2P75A 1CVLA 3TR6A 2GFHA 5EMMA 4AURA 3GH3A 4EYQA 2O14A 3WV4A 1WMDA 3I9V1 1CIPA 4LJKA 1T5DX 1U99A 1NMSA 3KWMA 3P71T 1KIMA 4P7KA 2A5LA 4QTXA 4CQMD 5CG1A 3M5CA 3EZ7A 5JJ5A 1JWLA 3GEBA 2C9CA 4ZYWA 3JYLA 1R66A 1SU7A 4WXHA 4G1EB 2X6RA 4M4SA 3SK0A 3DXXA 2SKEA 3G0OA 1UZMA 2F8TA 3PTAA 4N5HX 4Q19A 3SMVA 1YFKA 1GNTA 3BDAA 4P92A 4PSAA 1BXGB 1ULTA 4BMYA 2XXAB 5BWBA 4X1OA 1GSHA 3I1YA 1J20A 3WB9A 1EFHA 4KFCA 5CCEA 4FZ5A 2ZRAA 4JX9A 4CXMA 1I6LA 1ID1A 1X1DA 4L57A 1ULBA 4CL3A 1THTA 4QDKA 1SRRA 1AZSC 1YE3A 4M9CA 4U2BA 1PX0A 2IEDA 3MCWA 1PEKE 3OWXA 2YV5A 4P8RA 5TPWA 2RKBA 4YAJA 3RBZA 5IXSA 5DFAA 1OSNA 2J3IA 3RHTA 1V48A 1JL3A 4S3MA 2OC4A 5HIJA 5A4JA 4KAFA 2HCJB 3UUGA 1A9PA 1U9IA 3KJFA 3R8XA 4O8CA 2COEA 1SKUA 1B8VA 2HPVA 3EIHA 4RYLA 4Z4CA 4CI0B 1ORVA 5J2UF 1BXKA 1QQ7A 1KMMA 2A5DA 2WU4A 3C15C 3LLMA 2H9AA 4MB2A 4IOKA 2O2GA 3G68A 3UGQA 4BV3A 3NI2A 2R8PA 5IC6A 1ST3A 4U63A 4OFBA 3FCCA 4ZOQI 1Y3AA 4R3NA 1Z88A 2Q6KA 2B37A 2CN1A 3C3WA 3PXCX 4HNQA 4YJFB 3SZMA 3BD8A 4Z53A 2AC7A 2FW0A 4MRRA 1I30A 1ZW6A 3PZRA 3R77A 5IDXA 1L7PA 2XDAA 4IRUB 3C98A 5G3YA 1EFTA 1CF9A 3JQEA 1OI2A 3FZEA 4N8SA 2X9LA 3H2KA 3QF4B 1T5IA 4YMIA 4JNCA 2XGSA 4MA4A 3GP5A 1NJ5A 1YCGA 5G41A 5IKOA 1IZ0A 2P6PA 1RQXA 2ZAIA 2A5GA 1R6XA 2ARKA 2EKQA 3CMMA 5J4KA 1GSOA 3VR5D 4BNXA 4Z4FA 1WMFA 2OVFA 1Q0QA 2XTMA 2ZPAA 4TXJA 1A69A 3F71A 2D0IA 2E85A 4OP1A 5AK3A 3ROQA 1LFAA 1KWKA 2Y0CA 3RIGA 4C2BA 3LP5A 4Q02A 2IV2X 1GL6A 1QLHA 1UM9B 8GPBA 4KJXA 1PR3A 3K5HA 1RIFA 4DV7B 5ALKA 1POXA 2ZYIA 3C6YA 3PSHA 3PI7A 2X42A 1D2EA 1WQ3A 4LOKA 5TPZD 3FUTA 1YDHA 3A2NA 3TX2A 3LYHA 5EJEA 4KRFA 4MWOA 4LZOA 4NMLA 4TN1A 1J70A 2ON6A 3A3OA 4N6NA 2VDJA 1JNYA 4N0QA 5HHTA 5DO9A 4GI3A 4Q9DA 3JWIA 4GLLA 2D5LA 4ZVVA 3T9FA 1G63A 1MC4A 1XQXA 3A9VA 4EY7A 3PNVA 5CBPA 2NO1A 2XTZA 1K97A 2Z0MA 3TFQA 1NR7A 2RBEA 5CX1B 2DFDA 2Q41A 1DAHA 4GLJA 4YMWA 3T7EA 2XUFA 2F1RA 3LUFA 3OJCA 2LKCA 3ZY4A 1OZ0A 4YRGA 5IF9A 1N6IA 3RS2A 1VYVA 1DUVG 1L7NA 3VSBA 5B7QA 3BHMA 1XZHA 4BLQA 3EEYA 3H0KA 2ZE8A 1AHPA 3NHSA 3D6VA 1TVCA 3F6CA 3TM4A 2YZGA 2PUWA 1UJCA 1F8FA 2V9PA 3HJHA 3EAFA 3N6XA 3LQRA 5BO5A 3R7AA 2Q49A 5KZMB 1JEDA 2QA5A 3VZRA 2ZBVA 3DNMA 4AMGA 1DXHA 1LS1A 4C7VA 1N25A 3OU7A 2IS4A 3ETNA 3TAUA 4ZO7A 4BU1A 1VBMA 3S2GA 3UWSA 2EX0A 3BWXA 4CM5A 3ZW9A 3LJKA 3L0YA 2X5JO 4NDZA 2WTUA 4Z6KA 3DEJA 1U8YA 5F2EA 2IY7A 4EABA 3ENZA 5FHRA 4Q4AA 1G7RA 2HHLA 1ZJ4A 2WFLA 1XWFA 4I9HA 1HLGA 3H2BA 3L07A 2ZB7A 2OHJA 4LJ5A 4V0SA 1G8GA 1HLFA 2OM2A 3UHAA 2FX5A 1JAYA 1N8NA 1W94A 2RHHA 5F1PA 4XM0A 1RXIA 3VPCA 5GZ1A 3LBIA 1XC7A 2Q4RA 3DOOA 4ZAWA 1Z4NA 5IS2A 3D3WA 5LSAA 3NYWA 1H1LA 4OM8A 1Y8QA 1A9XB 3B3GA 4IZIA 5TQ0A 1MJ5A 1SJ9A 5ABPA 1ADFA 2IPAB 1JHDA 2C7VA 2WJVA 3DXYA 5GONF 2XB9A 5TT1A 1VJCA 3ECAA 2LZ0A 2QRQA 3EOAI 4XLLA 2ZIWB 1E6CA 4NU0A 5IWCA 2V6JA 3P0JA 4YK7A 5TS3A 2QTNA 2JG3A 5BN4B 3T1TA 1SVMA 1WRBA 1ARZA 1ZH0A 3GNLA 3KDAA 3EB9A 5AO9A 3VR3A 1C9DB 3WRYC 3I28A 4Y9SA 1KK0A 4IIJB 4CLRA 1HXHA 3OD5A 2PJZA 1GLVA 2JGIA 4OFWA 3SHQA 1EUDA 2P11A 5HILA 1XZQA 3V4RA 3TZLA 1UWVA 3PHHA 1VJ1A 5TT0A 4CV2A 3DHYA 1VHQA 4ZDKA 2H63A 1S7GA 1UZAA 3CGGA 3NIBA 5ILOA 1FMFA 3H1AA 2H8KA 4Q3OA 4QUDA 2Z04A 4DQLA 3NETA 4YDQA 1AQIA 1NV8A 3UJCA 1BN7A 4YAGA 3NV7A 2VDVE 1VDMA 3CZ4A 4L5BA 1Y9JA 1ZGJA 4OXIA 1S4MA 4U7TB 1RLIA 3VRHA 4V1CA 4G0PA 4AJHA 2BVNA 2B35A 4CM8B 2C59A 4DZTA 3K2BA 3DZIA 2GCGA 2IJGX 1XB2A 3L1HA 3LXXA 1RM0A 5BQXA 5KX5A 2ZBRA 2GEVA 3ELWA 5IBPA 2XQJA 1JQ5A 4WLFA 1JDZA 2VDKB 5EFZA 4I7EA 3AERB 4NICA 2FVXA 4YASA 3SQLA 2QVGA 3U1VA 2XB6A 4N76A 1CRPA 3F78A 3H9BA 2I76A 5EP4A 5AW7A 2NUPB 3B7GA 2GT1A 2F67A 2PJUA 4ZVQA 3ZK8A 3V6MA 3VNVA 1DBPA 2HDHA 3HN2A 3TZHA 4NJMB 3T7CA 1XZPA 2A9RA 3SSMA 2ZUFA 1BMFA 1CJTC 3SIWA 5FOTA 4HX9A 2WG2A 3AOEC 2GZSA 2OGZA 3UMJA 1ISHA 5LU8A 2CNOA 1FXUA 3OE7A 4QLOA 2VP4A 3O26A 3TW6A 5IN4A 1H2RS 3WNVA 6ABPA 5TPZA 3KEFA 3U4AA 2BUAA 1SOVA 1VKOA 2XD4A 4QU9A 4BBJA 4Z5XA 4D9CA 1S9HA 1UFOA 2QG6A 4MVJF 2OQRA 3FUVA 1E9AA 3AG6A 3Q8WA 3QU7A 4LVNA 5DGTA 3SSOA 3AKZA 3RNLA 1ZL2A 1V3QE 4ID9A 1PGJA 3OF3A 3ORSA 2BUBA 4KACA 4OP2A 4PCVA 3PXDA 1F9EA 2JFVA 4WNYA 4WOKA 3VR1A 4ETNA 3EW7A 1GFSA 5KHLB 2YMQA 1NFRA 2EKLA 2VBGA 4W8OA 2CBGA 1H2YA 2CXPA 4IG4A 4MWDA 3KOXA 3BMNB 1GU0A 2AUTA 2NWQA 4K9SA 3VO1A 1WV1A 1PYGA 2VQ6A 1KDRA 2I9PA 3PRHA 4QD3A 3D4OA 1FYDA 2C0QA 2HRQA 1ZNYA 4KN5A 2A0YA 3CA8A 4EPRA 2AFIE 4J43A 4J8PA 3AUSA 4YAFA 3ICQB 2G08A 4LHWA 1X14A 3TFOA 1G3UA 1M7HA 2ZUUA 5J40A 1SD2A 3IP3A 1DQYA 2YMMA 4GPEA 4JI2B 1JR3D 1JXMA 2YVLA 1UM8A 5K3SA 2R2GA 3E2PA 2E49A 3DMDA 1OREA 1QGUA 2NVUB 2NZ8A 5DLDA 1DCMA 1Q0TA 5BSGA 3THOA 4MWCA 4B4OA 3K7EA 4NS4A 5AI6A 5FFMA 3QEKA 1N0HA 2OO3A 2G83A 3V4PB 3H9UA 1QIFA 1HQDA 1KJQA 1G21E 1YBAA 2XOXA 3G2LA 1P18A 1MOSA 3USCS 4DMFA 4YFYA 2BKEA 1LWNA 5D6OA 5B6IA 4MQFA 3B85A 2AVDA 4NSNA 2FJUA 4DT1B 4WOCA 3RASA 5B6JA 3OZWA 1CG6A 3FTDA 4RKFA 2ECFA 2PQ6A 1ZOIA 5HJ7A 1R1DA 2R6CA 4YBRA 5EJ7A 2QZPA 3ZDYB 1OFIA 4DCVA 1YKFA 2VJKA 3GD7A 1C3OA 4UHEA 1R4AA 3BD7A 1YZ3A 4QG3A 2IS2A 5E6SA 3TH5A 5CR9A 4UU1A 1BCSB 4Y9UA 2BM9A 2I55A 1KWGA 2JKZA 1EXMA 1GEGA 4UUQA 5D01A 4EUHA 1WPGA 2XWQA 1TEVA 2R5NA 4OHWA 4ZQGA 5JCPA 2PU5A 1NP3A 1RMQA 3HU2A 4IS2A 4ESOA 2CV0A 5LZ7A 2QG4A 4LBYA 1TT7A 2EWMA 2FE1A 1YS9A 2WQZA 3ZG6A 4BMSA 1LV7A 3KUXA 2WIJA 3TPZA 3DNPA 3E0XA 4TTJA 3RT7A 3IAHA 1DFGA 3IC5A 3B13B 2K7ZA 2MU1A 4RKRA 4TS3A 3REOA 1BOFA 1EWVA 4KVFA 1YJAA 1U6JA 1N0VC 4U8HA 3LL4A 2D62A 4NYMQ 4OUDB 2ZBQA 1IIRA 2R11A 4RPHA 3WA6A 5C4IA 5JYCA 4IX9A 4NU6A 4I1UA 2BEUB 1GG9A 1GNPA 1DRJA 3WXBA 1S2GA 1FS4A 1UCFA 3RUHA 3Q9SA 4UNIA 4GMGA 3WLQA 4CT0A 5HR5A 3H5AA 5JH7A 1R0ZA 3HYNA 2EFGA 4CDRA 3UMBA 1ZVJA 3ETJA 2V96A 3E70C 4UUAA 4G1VA 1WF3A 1XZ8A 4FHDA 4KQ1A 4J7XA 2WKRA 4TKUB 4YUWA 1DG1G 3D8RA 1K4KA 3ZGNA 4R7TA 4PSUA 2HFJA 3TVTA 3G0GA 2Z6AA 4GI7A 1DTSA 3EA4A 4MWTA 1QTNA 5FAXA 4B3BA 2XODA 2GHQA 4BO0A 4CE6A 4MGEA 4NZNA 4NXMB 1PO7A 4GP9A 5KB3A 1K92A 1XIVA 1U0TA 2AD5A 1G98A 1UINA 1HNWB 2DKNA 4F85A 3E23A 1V5WA 5LOVF 1CDZA 4MITA 1MVNA 2HUPA 3WL6A 1VSQA 1M1NA 2AR7A 3PFNA 3CU5A 4FS3A 4KSBA 3GEMA 3L4KA 3RRZA 3CX7A 4ZQCB 5SY4A 1WZ2A 4Y2UA 1ABFA 4E13A 3SR3A 3JR7A 3ITEA 4LYJA 4QSHA 3WBBA 2VQSA 4JR2A 5LKRA 2ZT5A 2VQDA 4KUEA 3WGKA 3WYDA 1U4OA 2HXYA 2LGJA 4N9QA 4MDEA 1DB3A 2QQFA 3GJ3A 3WHPA 3F47A 4PHHA 2FEMA 3P9PA 4QKQA 1ZK4A 3D8HA 4EJSA 1KHTA 1T36B 4HGRA 4N39A 5FI5A 5TE9A 5LVAA 5DBOA 1TJ4A 2JGEA 2NO9A 3FJOA 4X1IB 5CRIA 3GXOA 4GWKA 1OW3B 1JAHA 3AYXB 4TXHA 3SE7A 3V1YA 3WICA 4K0KB 2OZKA 3JQAB 5CM9C 1EFPB 2E55A 5LXTB 2VA8A 1OYWA 3OFKA 2PZAA 2YVQA 1PT8A 3GRVA 2ZYAA 3O8LA 3IHTA 1G17A 3BUSA 1O94C 3OCYA 4KXLA 5EA2A 3JWJA 5A6SA 4FQ5A 3STYA 1I3KA 4MI3A 4HF7A 1PR9A 2MHCA 4A1FA 3PYMA 4C7KA 1J42A 1K7CA 3NUZA 1Z62A 3PDJA 4JU9A 5ILGA 5ES4B 1RHJA 3KEGA 1T5OA 1VL5A 1X13A 3ZHSA 3CE9A 1WLSA 1ZA2A 4OQQA 3KR9A 3H84A 3TIFA 2EP5A 2G71A 3SG0A 1N5KA 3RC2A 4EHLA 1JIIA 2Z8XA 3GLFE 1CEYA 3FCXA 4E46A 5CJPA 3DVSX 1C8VB 5CLHA 1X7XA 5ESXA 3SEQA 4AKGA 3I61A 4HRAA 4LJ6A 3RC7A 5DV9A 3Q3GE 2QPAA 5C4GB 2AKYA 2ONZA 3BTUA 2J9GA 1TO6A 4QPNA 1I3CA 4XH9B 4QC2A 2DHCA 1Q0RA 2EJUA 4I2VA 2IF0A 4P7JA 2ZRPA 3L0ZA 3P4UA 4DCSA 5BRJA 3LQ1A 5H4GA 4L3OA 1RI4A 3BEDA 1BEUB 5L45A 1SXPA 1ST2A 1TDJA 4QA9A 5KTNA 1EINA 5JJBA 1C1XA 3QSYA 4IICA 3HJNA 3BJRA 2EJBA 4FFLA 4F1WA 2IE0A 4L7VA 1Q83A 4LJ8A 3GHHA 3W5JA 3PHBE 1SUWA 4KQFA 1TYDE 4R2MA 4LISA 4U6QA 4UNNA 3STTA 3CVVA 3EZGA 3ORHA 1UMDB 3RTAA 3H1GA 5E0KB 5INTA 3FMOB 3WYAA 3P45A 4PNHA 4F71A 4J0HA 4HLUA 1NZFA 1B8NA 3OC0A 4OH1A 3ZCPA 4EMBA 1U2QA 4H77A 2J0SA 1JDBB 3U7QB 1ZIPA 3UGJA 1E3MA 4HUTA 3N1UA 3DFUA 421PA 2IX3A 3ZQJA 2OCKA 1ISJA 3NAZA 1JPUA 2RGWA 1XL1A 1OH6A 5AHKA 1E2GA 3O8QB 2J3LA 3ZZ1A 5CT5A 3EPLA 1DQSA 4URUR 3ZZ0A 1A8SA 3PJEA 3F7MA 1EJ6A 3GGOA 1I2BA 4CCAA 2YX1A 1ND5A 5A62A 5JU6A 1SVKA 1M5UA 2O8FA 3K15A 1IQ0A 1U5BB 1IQUA 2DHRA 4DIUA 1E1QA 3ZVLA 2HZBA 3ZV5A 1N2XA 3FIUA 2Q9AA 3GLRA 3VR6A 5JXIA 4EG0A 2DTXA 4RPLA 1KAHA 3GGGA 1SUCA 2XQGA 4X5OA 4YP5A 1NVVR 3AEQB 1P31A 5CXQA 1M0EA 1RQNA 1AD2A 3DA8A 3L4BC 1U9CA 2Z5FA 1RCTE 1L5QA 1DIGA 1G3MA 2DG2A 3IB3A 2WPDD 4LYEA 4MDYA 3TLAA 3UBTA 3AKYA 1XNQB 1DX4A 3ICCA 3KQNA 5EE9A 1FJXA 2QIPA 2CSUA 4C87A 3QX7A 4QULA 5KC8A 2JJYA 3MGBA 1HNXB 3DZHA 2GBCA 1J22A 1M1YB 4Q1AA 1AN9A 4Y0NA 4E08A 1OZGA 1YJ5A 4J0FA 1O97D 2DSNA 4NZ9A 2QORA 1M8GA 1HE4A 4OQNA 5EE5B 4BQFA 2V6GA 3PXGA 2EW8A 4KAXA 5A1TA 1GVHA 5A3QA 4JLOA 1CFZA 3VR4H 4ZGGA 1AMUA 1HDGO 4IEEA 3D5QA 1EBUA 4LYDA 3T3HA 3CO5A 4IDFA 4B4UA 1YZQA 4IV5A 3DUFB 1JDPA 3IE2A 3LO5A 3QLTA 2A0KA 3JARA 2AI3A 1PDVA 2H48A 5BQPA 3VTZA 3DBVO 3PWTA 1HEUA 2Q28A 1GGFA 1XO1A 3K0FB 5CDFA 4WJZA 1JMVA 4IGIA 5ER9A 1U3TA 2IDJA 1L4HA 1TKCA 3FJ1A 4XB6B 4DLYA 2BP7A 1SNYA 2WICA 4V1CI 2V74B 4S2UA 2ZRFA 1SKBA 3UMCA 1CZRA 1WDKA 3KVYA 3EHEA 3LD9A 1XZNA 5H1YA 2I91A 1P9RA 4YRDA 4Z4QA 5LWHA 4BLRA 4BNDB 2HWYA 1JU4A 1N6OA 4NQZA 3AUUA 1U2GC 4FE3A 3K0CA 4RHTA 3X1JA 1NXPA 2H1OA 3MILA 4BAUA 5EKDA 2G7MC 1YONA 4AMZA 6GPBA 3W3AH 1ORHA 4GO1A 4ARAA 2V6BA 2ZRLA 4NZYA 1B2RA 4X9XA 1SU6A 3ENVA 2EBWA 1NMZA 1GARA 3VISA 2RFLA 4IGEA 4RMNA 4C2UA 4X1KB 4QBGB 1Z0DA 3QVWA 1SU8A 3B1KA 5K0LA 1MOPA 2QRPA 3P0HA 2ZIXB 3BXEA 5CW1A 2VJMA 2V6FA 1GGNA 3V4FA 1JDSA 1QRRA 4D7AA 4N1AA 5CYGA 3NTVA 2XNJA 1SQFA 1RQGA 1LU9A 1YKGA 2CLSA 1UXJA 2GBGA 3DMNA 2IYVA 3QKSB 2XSZA 2JFBA 1C2TA 4TMVA 5A02A 2A30A 4JENA 5JNRA 3R7BA 4QRHA 3SDBA 1T5TA 1IBKB 2QYTA 3HM2A 3E5MA 5DM1A 4HPWA 3O2SB 1E9FA 4QOHA 4F3RA 1OBCA 2VNIA 5IKMA 3RUAA 1Z8FA 1HDYA 4Y6OA 2HT1A 1SIBE 1SVSA 2Y6UA 5J2UA 1YS7A 2J3KA 4GXRA 2RARA 2GN9A 5C3UA 3CISA 1Z5OA 2N1MA 3DT9A 4HH1A 1NV9A 2GBPA 2H00A 2PX0A 3REGA 4B2IA 4Y0AA 5IDQA 1P9WA 5DK4A 5HCUA 5J2TA 3PDIB 4JJ6A 2GGSA 1EK5A 1FY2A 3EQ2A 2IZ6A 2OV1A 3EE6A 4JI7B 4YREA 4UMFA 4FZVA 4OGWA 4YJ2A 3FLAA 4H4EA 3EVCA 1PNRA 3L1VA 2QMEA 3I72A 2C3MA 4DRYA 2JAUA 1C9EA 3BMOA 1E5QA 4WN3A 2W6JD 1IWPB 3KKEA 4HFNA 4KG7A 1PT9A 5K3CA 3MTGA 1DWOA 1EFVA 1ENOA 1XDWA 2B4RO 3OAAA 4KH0A 3O8DA 4Q00A 4XFKA 3WRXC 4PO3X 1RZRA 4F5WA 2ACEA 2HCRA 4UZSA 4B32A 2V4ZA 4AUEA 1E2MA 2Q1UA 4B3JA 2P4SA 5H82A 1PTJC 4KPUA 2DFLA 2ZIUB 4IP0A 4IBOA 1B3BA 3L1JA 4BO7A 3IPYA 4H6PA 5TQVA 1R4NB 2ZVPX 2Y05A 3WIOA 4GR5A 5IC4A 2VAWA 2MSKA 4FGZA 3FI9A 2W2NA 3BWDD 3KLNA 4U0KA 4JB2A 4WNAA 1G55A 3KTAA 3M7IA 4YGYA 4HQRA 4J9UE 4FWTA 1MOQA 2VJDA 4TL8A 2HM7A 1CPYA 3KV3O 4MVJD 2D0DA 3QBDA 3R0VA 5HZHA 4D1YA 1UJBA 1VXOA 3BREA 4RHFA 4Z4EA 4RTOA 2BT4A 2TMGA 1FFXA 4HFMA 5AJTA 5KTYA 1YFZA 5KHOC 3LXUX 2MTBA 3U4HA 3UA4A 3ZHZA 3OFVA 4FE4A 2H7VA 1OZFA 1RXEA 1XTKA 1M1YE 5HIMA 3MYRA 2ZAMA 2GEBA 3LT5A 3G23A 3M6WA 1AKEA 3NHKA 3BB3A 4DUGD 1QLJA 3H0CA 2JHPA 2QX6A 5AK6A 2BY4A 4CKBA 1UBNA 3QFCA 5EEHA 1R0WA 3M6LA 1XF1A 3CEPB 4PZLA 1RRFA 4KSCA 4EMSA 2VL7A 1LLDA 1VHWA 3Q6IA 2XVZA 3K9FC 1ZWKA 3HUDA 4M0LA 3H8JA 3NC1C 4IRXA 2FH5B 3W5AA 1FRNA 3E3MA 3MWKA 2FJPA 1U2ZA 1VI6A 2OCGA 3UQYS 1WCV1 5CIQA 3HN6A 4BNWA 3CYFA 3GN1A 1JB9A 2JLWA 3UCFA 1YC2A 3CRQA 4C3OB 3RSOA 4GGMX 4B1FA 2IGBA 3HYRA 1P3Y1 3IQIX 2PKRA 4EVSA 2OR3A 2JCBA 4P1ZA 3C8UA 1PEDA 3OQIA 3ZJ4A 2YWDA 3N6RA 3RE1A 1Z83A 4QFBA 2WFLB 4DQKA 1ISIA 5KDLA 5F4BA 5FCDA 1LBSA 2GZDA 2UUOA 1PK9A 3MJHA 3OIFA 3SX4A 3SICE 1RYEA 1DLJA 1UC4B 2JJ1A 4ZXPA 3U7EB 4AJ2A 4BC0A 4JI1B 3U9TA 3VOAA 4AY6A 1ATIA 4KWEA 1E5TA 3A1FA 3ZS9A 2B7CA 4RFLA 1T8PA 1HQKA 1U3GA 3O8OA 1X87A 2VP9A 4MV8A 3SVLA 1G20B 5E1OA 3PUYA 1JP7A 5C8YB 1X70A 3WDSA 4QGBA 3DMYA 2B25A 4RO0A 4B3XA 2Z2KA 5CVVA 1YASA 1KSFX 1SG6A 1S3GA 2PPVA 4CG3A 4AI6A 3B8EA 4XWGA 1TB4A 4RSRA 1NQUA 3MOIA 5AWFC 4KPEC 1W34A 1ENZA 4LV8B 3RH0A 1EXWA 1IXKA 3FPGA 3ME5A 3BIFA 4OQLA 1JE1A 3WWEA 3E22B 4PG6A 5JPCA 4URXR 2VDQB 2Y9PB 1JQ3A 1XKLA 3LX6A 4L3WA 4XQ0A 5DX0A 3G59A 1U2SA 2ORIA 2QRLA 5BVHA 1Q3HA 1AHNA 4GICA 1TVMA 2EJCA 2GBLA 3DE7X 3LCUA 4ETWA 2H5EA 4Q4LA 1BXZA 3UMFA 3T7KA 1AQUA 5JW6A 2PLAA 5M3BA 1WWKA 4M88A 4C6HA 1U8FO 4NR0A 3MGKA 3RYHB 1USUA 1H4TA 4D0RA 1KJZA 1AX9A 2X23A 5C0OE 1ODFA 4COOA 3S40A 1FSSA 2WWRA 5HX7A 2NUBA 1H9AA 3KZOA 4O02B 2POCA 1XQ9A 4HAUA 3D8TA 3QOXA 1U1DA 4JBLA 3DE1X 3GQVA 2ZUSA 2V54A 2RGGA 3JD2A 2O59A 5K1ZA 1MNAA 3WY9A 3HP4A 4FW9A 4I99A 4GRIA 2W6JA 3CMCO 1MPTA 4O4LB 1S8FA 3N0XA 1DHRA 3DDWA 2C9ZA 5IRCD 4K9QA 1P19A 4BN0A 3G9TA 3IFSA 4A2PA 4AN4A 1TKRA 2C4NA 3RS5A 2RONA 5B30A 2GQ0A 3KQWA 5AM3A 3NBXX 2RIPA 3BULA 3OCZA 4ARSA 1JQLB 4EL5A 1J5XA 2P69A 3HKBA 1FTSA 1DC6A 4QBIA 1KGSA 4FDVA 1PWZA 3A4VA 5K0TA 2HN9A 2CNKA 2JLRA 1DX9A 4UU8A 1OI3A 1CB0A 3W6UA 4MH0R 3KWLA 4RH1A 3QLUA 3K6SA 4LJSA 1M73E 5LYJF 1OXSC 5HUJA 2IUEA 3CIFA 3GY0A 2JLCA 3ZWPA 1KRWA 5KUTA 1S01A 2PZEA 1J2JA 3B2NA 1E7QA 3O4GA 4UVEA 3ZQUA 3KZXA 4UPVA 1ECFA 3A70A 4M8SA 1A82A 3ESZA 3LG2A 3OZGA 4U9UA 4B34A 4C08A 1L7BA 1O6ZA 5EYPA 3ZHBA 1PZNA 1ZUHA 4JGGA 4JP5A 2HGZA 3IAS6 4IJUA 5KREA 5BVGA 2UUBB 1LJ8A 5LQMA 4DUGA 4LOIA 2VCHA 2W2TA 3C16C 4RQAA 5I6DA 3WFJA 3D6AA 4UM9D 4Y30A 4GKAA 3SIPA 2VH1A 3I9LA 3N0VA 1FNBA 1HE5A 3N2GA 3OOSA 2I4RA 4INAA 3NNSA 4MUEA 4S24A 1C9NA 5F12A 5TF0A 4BQSA 4DBVO 5K8JB 3RYCA 3U44A 2ZYUX 4B33A 4DMLA 1JKFA 1TJPB 1GPBA 5I7UA 2QTLA 4NYIQ 4XJTA 4EY5A 4AKHA 3IDOA 2JVIA 4FD2A 4INJA 2JGRA 4XXHA 4FBGA 4OI4A 4V3CA 1DEKA 3Q7SA 5LQAA 5KJ6A 3KS9A 4LYHA 3F49S 4M37A 3GI1A 1LC0A 3PNBA 4BLSA 1XD9A 1L6RA 2VBCA 1NA5A 1YL5A 3HP1A 1LSSA 2W2QA 2FFJA 5AP9A 1V6CA 3CIOA 4D8WA 5KOHB 4EGAA 1Q1QA 5I45A 1E5VA 4HNSA 3BRSA 3U4IA 4FFSA 9ABPA 1ZN8A 4KQEA 2WMDA 1GKIA 1YE8A 4QNNA 2XMSA 3B1VA 4RM2A 3PUXA 3IKMB 4F84A 1J39A 2O5VA 2HD4A 2J9YB 1KVTA 1TZJA 4KAJA 1IQRA 1GG5A 2FG6C 4TYQA 5IVIA 2R7KA 1HKHA 3DBIA 2VHJA 5JZSA 2I3GA 2JLXA 4KBYA 4O5AA 3IV6A 1SIOA 1W19A 3KXIA 1OFHA 1Z18A 3BJZA 4R8LA 1XJ0A 3T41A 2WWGA 1P7VA 3EPKA 4MV3A 1CF4A 3RAFC 3Q0EA 1PD0A 1MORA 4NNOA 4UMVA 1ZL0A 4CLDA 3IA2A 4R2JA 1I3MA 5IXYA 2B8TA 2YNMC 3AU8A 2CW5A 3FPLA 3TNDA 3BORA 4FUQA 2PUAA 4Y1RB 3CXUA 2GB4A 2QXTA 3RNOA 4DWVA 1L9XA 1ZHHA 3O4VA 1K6IA 3IPRA 4FONA 4Q9IA 4J0GA 1TUBA 3GP8A 4GR4A 5FR2A 5KCMA 3MJDA 1NF2A 3RRFA 4N3AA 3T3IA 3TTTA 7MDHA 5HJEA 2P3OA 2Q27A 2P6MA 4K8OA 2BBSA 4NFYA 3U39A 4OFZA 4AQYB 2WIKA 4PVCA 1USWA 5F7OA 3GP3A 1XDZA 4GVLA 1I24A 5JQWA 1NC3A 2UKDA 2BD0A 3GCWA 3GT4A 1CT9A 1JHAA 3GPCA 4DMMA 5JTUA 5IVKA 3Q6NA 1UKAA 2VZ0A 2NZUG 3EMBA 3OY7A 4H3SA 4ZRMA 5EZ5A 1VLMA 1WVGA 3DLCA 5LBIA 1VJ0A 2HPHA 4O4IA 4U6NA 1U8AA 3Q8XB 4BMNA 4RIFA 5A9TA 1XQYA 1QX3A 2XCQA 3B9RA 4PZCA 4GSLA 5EY5B 4GZMA 3TSAA 1Y3BE 5F7ZA 5PGMA 1P9OA 4M1TA 1Y8RB 3WLRA 1PT7A 5AVXA 1Z22A 1W9MA 4UJ5A 3SIRA 3OJFA 3DO8A 4ZREA 3M1YA 3SFTA 3X1YA 2XXBA 3LPMA 4K05A 4WGFA 4KPFC 3RLIA 2QMYA 5ALOA 5L3SB 3OBBA 5H81A 5HW0A 2V3WA 3GGDA 2NU8B 4UOEA 3V7NA 5BNIA 1AV6A 4EKYA 3I83A 1QSGA 2X22A 2ZANA 1GAEO 2I8LA 1L7QA 1XL0A 2NZ2A 2QYOA 4I4TA 4ENPA 3GELA 2GKGA 2E21A 1KYIA 1A9YA 3OM8A 3PRKE 1N2JA 1Z4IA 4GVXA 3RBAA 3EFHA 1NLMA 4DEXA 5CLFA 4I46A 3KLOA 5BOVA 4LCJA 1DKNA 2A0FA 3ACCA 2OBLA 3T3EA 4NY1A 3AF1A 3HSSA 1TX4B 3JVVA 3HPRA 5JIBA 2BKXA 4WLEA 4AUMA 4KBGA 4Q03A 1EGQA 2NX2A 3ELBA 3I2GA 4Q4HB 4CIDA 2QVXX 5JZOA 2GFQA 3FHJA 1MZPA 4B79A 4TLDA 1EDBA 1NWHA 2FWJA 3NNNA 1RYDA 4MIEA 2JKYA 4W1SA 2OZEA 3DC2A 1MEEA 1G8YA 1ZICA 3E6AA 3PLNA 3AEYA 2XNDD 3G1WA 2RK4A 3CBQA 1OB2A 1SKAA 2AV6A 5T41A 4EA6A 2HSWA 3GEEA 2LDBA 1MX1A 2Y9YA 2FW9A 3FSEA 1XMOB 3ZWQA 2AFHB 1OF1A 4AYTA 3MEQA 4BNKA 2ZXFA 3A14A 2AX3A 4JEHA 1IULA 4UXJA 2QUBA 4CFZA 1UJNA 1C30A 4Q93A 1JIKA 3ETEA 4LPSA 4PCAA 3PFGA 1DBIA 4D9IA 4ZVKA 4Q7QA 4LYGA 2FZVA 2YYYA 4JXZA 3DTVB 3SNKA 3D4LA 2XYRA 4S0XA 3NNDA 4X1YB 4AJOA 1ZD1A 1O96A 2W4QA 3A36A 2IHNA 3KP1A 4RD3A 5A4KA 2NYVA 3HRHA 4M0MA 4I3HA 4RTMA 2PX4A 3P94A 1UKYA 3SHOA 4Q34A 2O5EA 2VDNB 1CLEA 3TMKA 1GU1A 1K8XB 3AF0A 2P78A 1QH0A 3N75A 4AG6A 1KYXA 2VIIA 5D87A 2OEPA 4Q24A 1X1BA 1Z4JA 1IH8A 3DLPX 3SLRA 1WDWB 3F5DA 1EXVA 4DV5B 1DWUA 2H3EA 2H9IA 3JY6A 3LSTA 4F92B 3JD3A 3QLVA 3HU1A 4UAGA 3LDAA 1R10A 1JR2A 1Y4DE 2NU7B 3I37X 5DHUA 1JLKA 3W6NA 1Y9EA 3LDUA 4JYZA 1B16A 4XYGA 4GBED 5CB4F 3OZTA 5T5QA 4M1YA 2IYQA 1WXDA 1I1QB 1T9HA 4L2IB 3ZWNA 4CF7A 3H99A 5AKYA 4CUKA 3MS7A 2I80A 1QH1A 1WCYA 1MTOA 2FPXA 1PQPA 2NM0A 3C8DA 2WI8A 3ZHCA 3G2QA 4HPXB 2BTOA 1SBZA 1V41E 3CKYA 1FNSA 5DU2A 4L9WA 5B7GA 1BQ4A 1L8XA 4ZVTA 5LLTA 2DEUA 2O8DA 1BD4A 3S44A 1HO3A 3G9QA 2YHSA 1ECBA 3MMNA 3S5UA 1U0BB 4WFIA 1BGWA 1JB1A 3PA8A 3R4CA 4AWXA 4FR2A 2P4HX 1K66A 3QJYA 1UOOA 3CLUD 3DLIA 2BKAA 3H5IA 4JOQA 3RVRA 3AF3A 2ZVDA 1VSUA 1OPRA 4DIMA 3KJXA 1IRIA 1DCTA 3HJTA 3FTNA 3DMRA 3NDJA 3KYIB 4IXDA 5CHYA 2FGKA 2RH9B 2JFQA 5TMPA 1HKUA 1QPZA 2SECE 3TYXA 4PQRA 3N9IA 1Q16A 3ZK9A 1KPHA 2RH8A 5T7BA 4TS4A 1PZXA 7ADHA 4V02A 1MW8X 3ANTA 4BB0A 1SR8A 2DBVO 4WXPA 3TJRA 5FD8A 2ZJ8A 4WK6A 1M2NA 2ZJBA 1CEEA 1TM2A 3QVMA 1N7HA 2RGNA 1IZZA 1FVHA 3NDPA 4RWEA 2VP0A 4JNKA 4B3CA 2QHXA 2I29A 2QQGA 4UHJA 3A9UA 5BSUA 4MMZB 2R7LA 3EUWA 4BV9A 2EJWA 1RHUA 1U7HA 2CWWA 1P1HA 3OTIA 4IVRA 3O9MA 4J7UA 1E69A 5B1SA 3T9AA 1L4BA 3UV3A 4CTMA 4U3JA 3ETLA 4J2TA 1SOMA 1Y7TA 4CRWB 3II6X 4M0EA 3W3ZB 3MT7A 1D9XA 3HV2A 4RGBA 1CR2A 2HK6A 4ICIA 1Q0LA 5H3CA 3ETGA 3MJCA 5K3BA 4F9FA 2MYPA 1TU4A 1ZI9A 3HQ4O 1MG5A 3U4MA 4EHDA 1N0WA 4G8JA 3SXUA 4RCYA 1GCOA 4ZIRB 4F5DA 3FW1A 1MIOA 2UZ0A 3IAM6 4MVCA 3V1MA 1LVUA 1OU0A 4QTZA 1CZHA 1EP3B 4OI2A 3D3JA 3P9YA 5AVYA 1RR6A 5EHGA 2YJGA 2IVZA 1O58A 4MUXA 1NQTA 1IONA 1PX2A 2PAAA 1GQQA 1AE1A 2PS1A 4LHYA 1NLZA 3LPAA 3LT1A 2YWCA 4D3FA 4KZPA 3JQBC 4PGGA 4TS1A 2WWXA 4TVKA 3VU9A 1FRFS 2OE2A 3L7LA 1T35A 3GLTA 3UGTA 1LXCA 2VP3A 3VAAA 1R8JA 2EC5A 4HPJB 3Q85A 2VT3A 4A26A 4Q7LA 4P4NA 2GNAA 4DCPA 3EIOA 4Z4IA 1R64A 4BO1A 3H5VA 1ZXBA 2JBHA 1BA2A 2Q6VA 2V7BA 2OFPA 2V97A 4UQOA 2JFHA 1CUGA 5ERYA 3A9WA 2WQ6A 4KFTA 2AXNA 1V11B 3KCNA 3RJMA 3NRCA 2KYRA 4KQXA 2GZHA 2AFHE 1U3CA 2NGRA 2RD2A 3CRNA 1M7BA 4P81A 1CUIA 1QUFA 1R5NA 4L50A 4EB0A 5MN5A 5MN4A 3PR2B 5K3DA 1PR5A 2GM3A 4A2WA 1E20A 3OCUA 4R2KA 2F8MA 3G3EA 1H4SA 2F3SA 3MCVA 4YBZA 3ZJ5A 4B46A 2EFHB 2E4XA 5LDGA 3A37A 1OWNA 5D5PA 1MO6A 1VC2A 2FSIA 1NJ6A 1ACMA 4K6FA 5IJ0A 3WL4A 3GFPA 4FEAA 1PRYA 1QLWA 3LUHA 2ZBFA 3EGOA 1MAWA 2VHWA 3HJAA 4PLZA 1E4VA 3ZNOA 1GOTA 3W6OA 1N92A 4WX2B 1V1RB 2A0UA 2JAXA 5ALMA 3SC3A 2YQ5A 2C4TA 3KE9A 3NOVA 4OLBA 1VHJA 3G8CA 1SKYB 2Z6VA 4J6EA 2H07A 4GXNA 5FBQB 3SQDA 1EYZA 2WYVA 5FIUA 2PTGA 3EZFA 2C95A 1WUIS 3D54D 3IVGA 1D1PA 1PHPA 1WD7A 5B3AA 1X92A 1ETHA 4YJ3A 4ZO6A 3JRWA 2X8AA 4MVJI 2HQBA 1EVIA 1KU6A 1NI4B 1ZH6A 2RCNA 3R0XA 1CY4A 5AW4A 4G4IA 1YMVA 3RVLA 1DO0A 1G7SA 4JXJA