4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
1WMBA 2I67A 2LDXA 4F6LA 1GAEO 1E77A 2PFGA 5ITVA 5IXYA 1CEQA 2FPPA 1ZUD1 2FOIA 2W2KA 4FN4A 4NFHA 2NQTA 5G0VA 1FMCA 3VC7A 1AUPA 4IGEA 3ZU2A 4QXMA 1M66A 5JCXA 5TC4A 1MC5A 1HRDA 2O3JA 3H9JA 5B12A 1NWCA 4YR9A 5KJ6A 3JQ8A 4BO8A 4CMBA 4R54A 1E6WA 1TB4A 5CEFA 2NU7A 4D41A 3ROKA 2W98A 1EFKA 5EN4A 4IPTA 4RVUA 2G76A 1HE5A 3F46A 1UZLA 2YQ4A 4JX8A 4BGVA 4BO7A 3E9NA 4NNJA 1I10A 4D3FA 1Z6ZA 1ZNQO 1A9YA 4R3NA 1G0NA 4I8XA 4DYVA 1Z75A 3INRA 3OJEA 1T2DA 3U4HA 2AQKA 1OI7A 4BNZA 1PGJA 2EW8A 3LVFO 3SXPA 4YBZA 1SAYA 1Y9AA 4GPD1 4XR9A 2WM3A 1XDWA 1EK5A 2Z95A 2HSDA 2F00A 3GK3A 5KWEA 1GPJA 1IZ0A 3RU9A 4RVHA 1U2DA 3B1JA 1GUZA 4E2WA 2JAPA 4GI2A 4WLVA 4QFDA 5B37A 1WWKA 5JAQA 5L7WA 1LSJA 2GASA 2ZK7A 4Z3DA 2PH3A 3AM5A 4GVXA 2GLXA 3GFBA 4JP2A 1MUUA 4WLNA 2VHVA 4IS3A 2AQIA 2VRCD 4IQGA 4OIMA 4WLFA 3TQHA 2VYVA 1CQJA 1UXHA 5F21A 4PG8A 1FJHA 1DJQA 2Y1CA 3CXRA 4PG6A 3GLQA 3CEAA 4CM5A 3NEPX 4YQZA 5JLAA 5JC8A 3F3SA 4BB6A 4J1NA 1EMDA 4YTEA 3FR7A 3HDHA 3RC7A 4HP8A 4DGSA 1PZFA 2GUGA 2VHYA 2IYOA 4RPLA 3JQBA 1LDGA 3V8BA 2A92A 2B4RO 2D5AA 4FFPA 2J3HA 4UULA 1B0AA 3QP9A 4JNKA 3W4KA 1ZIDA 3GNQA 5I9MA 2GGSA 1DFIA 2X6TA 3KYBA 1KC3A 3NYWA 4AJ2A 3QY9A 1IYZA 1PZGA 2GR9A 2RBEA 2VCYA 4GLLA 1SPXA 1X0VA 1WW8A 2XPCA 2OBYA 1IY8A 4HFRA 3L07A 3OJLA 4CLOA 1DB3A 2WEKA 3PHGA 3TRIA 2C20A 2GO1A 1U1IA 4R1UA 3ENNA 3V1TC 1R66A 2FMUA 4R4JA 1T1RA 4DBVO 3PYXA 3G1TA 4BMSA 1ISGA 3GZNB 3ZV5A 4D3SA 4P4NA 1K2WA 1YQGA 2AE2A 4J4HA 4ZHSA 3GF4A 2WDZA 3CMMA 2VQ3A 4WLEA 4XDYA 1O0SA 4CV1A 3DTYA 4II3A 4CODB 1YL6A 1GCUA 3UH1A 1DLIA 3ZWOA 5F1KA 1ZZEA 2ZCVA 1DHTA 2ZJ1A 3IQDB 1A27A 3CZRA 4BV8A 1P1FA 1D3AA 5I7FA 1DRWA 3OJFA 3ZNNA 3DMTA 5FI3A 4Y6RA 4Z9XA 3ETDA 4XQGA 2NVWA 1HDZA 2VT2A 2DTDA 1HYGA 1KYQA 3KYDA 3K8ZA 3RKRA 1U3TA 3OSUA 1SB8A 2AEFA 1Z74A 4S3MA 3H5RA 5F1PA 4LMPA 4CL3A 4NBWA 3IUPA 3EDMA 2OFPA 4WJZA 5EQFA 1FK8A 3KRTA 2UYYA 3TJRA 3AY7A 5JY6A 3NUGA 1VLLA 4GX2A 3U49A 2CDBA 4E4YA 3R1IA 2NWQA 3WS7A 3A9WA 1I01A 3GVCA 1ZSVA 1GADO 3JQDA 4RF4A 1PS9A 4D0RA 3D1LA 1U2GA 3QVWA 4QEDA 4XB2A 1PS0A 4BQPA 1HT0A 1TI7A 4CV0A 2G82A 2HK9A 4E12A 3NTOA 4A5OA 1A4IA 3ULKA 1PSDA 4YA6A 3ANNA 3MWDB 1K89A 4PLTA 3B1FA 2BI7A 4N18A 1D8AA 3ZWVA 5JAIA 4IY1A 1F8GA 1LLQA 2C5EA 1X14A 4NFSA 3X2EA 2I3GA 4XX0A 2I3AA 3RCBA 3JD3A 3O8QA 5BSEA 1Q0QA 4PIVA 4DPLA 1QXSA 4D79A 3OQ6A 1PWXA 4ZQFA 3AOEA 3ETEA 5EINA 1SB9A 5CDUA 5I7VA 1K6IA 1HDYA 3GFGA 1KVUA 2BHLA 5TJ9A 4N5NA 2G5CA 3K2BA 2HKIA 1DOHA 2FPIA 4UUPA 3JQCA 3H3JA 1C1DA 3FI9A 4LRTB 3FR8A 3RWBA 3GRPA 2P68A 3WFIA 3JQFC 3RROA 4FOSA 4KWIA 2ZIZA 4GSKA 4C7JA 3I3OA 4LN1A 1H94A 4AJNA 4BNXA 4NH4A 4FW8A 1O95A 2QIOA 2FRDA 3BMCA 5IDWA 2YZ7A 3FNHA 1RKXA 2Y05A 5U4QA 4W4TA 3UCEA 1I2BA 1P3DA 1IOLA 1EUCA 3IP3A 4X54A 1CERA 1YS4A 1P1RA 2X0IA 4LGVA 4ALIA 1KBZA 3TFQA 4OO3A 2D0IA 2E82A 4IDAA 1JAXA 1GPDG 4BNJA 4R16A 4EDFA 2FSSA 2WD7B 4LCJA 4O63O 4CLDA 2O7QA 3RBXA 2NTNA 5COAA 5JXWA 1P77A 4PZCA 2HU2A 1HDOA 3OJOA 3S55A 1E7SA 4Z0PA 4KUEA 3DBRB 2R6JA 1JKJA 4MKZA 4RORA 2QRJA 3FCOA 1U8FO 4HNGA 2CD9A 3LC2O 3ZWMA 5IXSA 2B37A 3LDHA 3I52A 2PK3A 3WOHA 3LQFA 1KETA 4N7RA 2CNBA 3QLJA 4ROSA 1PZHA 4IJKA 3RUEA 1OMOA 5TGDA 1MG0A 2ZYGA 4GMFA 4Q3AA 2OOSA 1ZVMA 1RJWA 1QYWA 3ZCXA 1VI2A 1LI4A 2OUIA 3G1UA 3OH8A 4CUKA 5DULA 1R4NA 4NHEA 2DUUA 2WD8A 3NJ4A 5A9SB 1IZ9A 4Y6SA 3AU9A 5L7YA 1U3VA 3VZRA 3DHNA 4EJ6A 4EBFA 1GY8A 2ZKLA 3GUYA 4HX5A 3ZV4A 4MVJF 5DN9A 3UXYA 4JK3A 4DA9A 1WZIA 1VSVA 3V2HA 3C3XA 3PJDA 2W90A 3CPSA 1LJ8A 2POQX 4B79A 4FR5A 4HUJA 2I76A 3JQ9C 5L95A 2DFDA 3TL2A 3WGHA 4XZ3A 2P9GA 2P4HX 3CZMA 4NU5A 4J2HA 3VH2A 4MINA 3NAQA 3LC1O 4DBZA 3RSHA 2FPGA 3QQPA 1HE3A 3T4XA 1NM5A 3KUXA 1DBVO 1NX6A 2BI8A 3VH4A 4M54A 1A71A 2Y67A 3A4VA 4W9NA 5K6AA 3O8QB 4BO1A 4BO4A 1P31A 1DRVA 4MO2A 2EJVA 3ZI0A 5ILOA 2ZB3A 2O3UA 4EW6A 3AUTA 4L4XA 1LLDA 1SC6A 4QECA 3Q9UA 1R16A 2HMUA 2Y1OA 2EKQA 4RLHA 3OHSX 2Y1DA 4XQ9A 4ZRMA 4DRYA 4L4RA 4P8RA 5AXDA 3RUHA 2CY0A 2VHXA 1MG5A 2Y0CA 4KMSA 3MJCA 3DBLB 2CSUA 4NK5A 4QSMA 5JE8A 2J5QA 2VWPA 4D0SA 3AOEC 1N7HA 5AVOA 1ZJYA 4DIFA 2PZJA 2TMDA 2HQ1A 3O9ZA 1IHXA 2QRLA 4PRKA 4BNLA 2VHWA 2P5UA 3FWNA 4YPOA 2J8ZA 3C7CB 2Q2WA 1KEWA 5U1PA 4YJGA 4U0KA 4XGNA 5TF4A 5LDHA 2R2GA 1E5QA 3C1OA 4PLPA 2Y1GA 4RDHA 5I7EA 4J0EA 3BMQB 4RPKA 2O2YA 3HE3A 3E1KA 3E18A 2EV9A 5A5EA 5JMWA 3H9UA 1GQYA 4R1TA 2GRAA 1KEUA 3DXFA 3GGPA 2HLPA 1QLHA 4CMHA 5L4SA 3JD0A 3QHAA 1E3JA 3UAGA 1D7OA 4R69A 5GY7A 5BNFA 3L6OO 4XGIA 3RVDA 4OH1A 1NWHA 4OAQA 2NACA 1UR5A 1H6CA 3GGGA 1BSVA 1ISJA 5H81A 1L1FA 3ROQA 4Y9DA 2X22A 1GZ3A 5IN5A 1ZK4A 4Y98A 3A28A 1D1TA 4CV3A 1V8BA 3U4DA 1LDEA 4CM9D 3F47A 4FFRA 5G2OA 5A4DA 4CLRA 3LT2A 2CVZA 1ID1A 3AWDA 3AI3A 1U5CA 2DBQA 5KKAA 1I32A 1N7GA 1R37A 3HG7A 3GZ4A 4LCEA 2E6UX 3ICCA 3FPLA 4TZTA 1I33A 4KTTE 4R68A 4OSOA 3KM0A 3K92A 1R4NB 3CMCO 2PGJA 3ZV3A 3DZIA 2DC1A 4IQ8A 3LT0A 2NV6A 4BNHA 3QSGA 4CMIB 1TVEA 1ZSYA 3EZYA 4R51A 4P22A 2EKPA 1FDWA 2NU9A 2VNAA 5F3RA 4CM3A 3BMNA 3IL2A 1XYGA 4ZGWA 1PL8A 1W6UA 4B4UA 1UXJA 4BB5A 4Z0TA 2Z1NA 1AHIA 4EZBA 4R1NA 1DEHA 5FEUA 4A7PA 5IZCA 3OA2A 2BELA 5COBA 1HETA 3GG9A 1UP7A 3RC9A 4J7UA 1ZKMA 1QYCA 1LLUA 4WCFC 2AE1A 3U09A 1V35A 1RYDA 1Z7EA 3KYCA 3WYCA 3L9XA 1SEPA 2IZZA 3KSDO 2O3TA 1QYXA 3ABIA 1A72A 1Q7GA 5JDIA 1B7GO 4IJUA 3E48A 3S2FA 3X2FA 1PJ2A 1GCOA 5H82A 4A10A 2JL1A 3H7AA 4TRJA 4RJTA 3BHMA 1XIVA 5A05A 4BGIA 1ML3A 1R0LA 3GA0A 1LC0A 1E92A 3OEYA 4YVFA 3WQRA 4NR0A 1O89A 2BGLA 1HDGO 1CRWG 3DZKA 4OQYA 3C7AA 2O23A 4J9VA 2VUSA 3IMFA 3F4LA 4H3VA 1OC2A 4IZHA 5A9TA 3PHIA 2BGKA 4NJMB 2JD1A 4K26A 4R5MA 1NR1A 1UZNA 2HK8A 4XYLA 3WGQA 5JDCC 3DR3A 4NBRA 2J6IA 4KZPA 2P5YA 1YH3A 1DIBA 1NVTA 2IZ0A 3JCZA 5T8KA 1YBVA 1XLTA 2WYWA 4ESOA 1VSUA 4Z6KA 5C7OO 4PG7A 4PGFA 3RI3A 1NFQA 4YT4A 5B4UA 1V9LA 3KV3O 4TRMA 3KLMX 3PIDA 3K6JA 4KOAA 4NZ9A 3DBVO 4XA8A 2YV1A 5C7IO 2G17A 4OKNA 1FDTA 2H9IA 3F1LA 2GCGA 2PZLA 3JQBC 3DDNA 4BO3A 2QHXA 3U3XA 1LX6A 4WK6A 3WGOA 4JBIA 4HFNA 1DC3A 1EK6A 3GG2A 1F17A 1EBUA 3JSAA 4RVGA 1T24A 3JQ7A 3K2EA 1LRKA 2Q1UA 1D4FA 4ZA2A 3FBGA 2VRCA 1LSUA 3CTVA 2VWQA 3K31A 4CM4A 1WDLA 2NSDA 4GX0A 2HRBA 2B0JA 2V6MA 4Q3BA 4OSPA 1I8TA 3T4EA 1P1KA 2C2YA 1XELA 4CMCA 4QTZA 4D44A 1JN0A 1O9BA 8ADHA 4ALJA 3M1AA 2VTEA 5TS3A 3ZWCA 4GL4A 4CMIA 2ZB4A 2WSBA 5BQFA 1KEVA 5DDIP 3AY6A 3G3EA 1Y1PA 3OQBA 3ANMA 4LSMA 4TROA 4E2YA 4AJ1A 3E82A 1P44A 3MZ0A 3OQ1A 3V1YA 3ZHBA 4BNUA 1I36A 2EGGA 4FGSA 1FXSA 4AL4A 4WE3A 1PJ4A 3BTOA 1SEVA 5G0WA 3S2GA 1OBFO 1TEHA 3ADPA 2DM6A 4XYMA 4E2XA 3PP8A 5HA5A 3TZ6A 3GPIA 3N58A 2X8LA 1NQAO 5IZ4A 3DWFA 3LLVA 2Y1FA 4P4GA 1K6XA 4IDGA 3RJ5A 1UP4A 1U8XX 1ENOA 1GEGA 4JJGA 4CLXA 3S2EA 3CIFA 3KSZO 2QG4A 3PQEA 4DXHA 5BNIA 5IFLA 5A3VA 1E3IA 2PWZA 2H5LA 3T7CA 3UF0A 4TQGA 1H6AA 4C7KA 2EW2A 3F1KA 4F45A 1ENYA 3NT2A 1Z82A 3IDSA 1ZEJA 1VL8A 2QQ5A 1WP4A 1B26A 1PR9A 1GDHA 4G65A 1KVRA 1YB5A 2ZCUA 2UUOA 2DBVO 2ZTMA 3DEYX 2JKVA 1EUDA 1UAGA 1HDXA 4OOEA 2CFCA 3ROPA 2FR0A 4UVGA 2AEMA 4YACA 4AG3A 1T1SA 5CDSA 2B69A 2BFMA 3HWRA 2DUWA 1MXFA 2I99A 3EHEA 4ND5A 4OXNA 1NFFA 3JYPA 1XCBA 2CZCA 3QV1A 3UKOA 5CDGA 3ZHXA 4GSLA 2BFOA 1QYDA 4Q3DA 4B7XA 4D42A 3WMWA 3ZZNA 3KB6A 2ZJ0A 1GZ6A 1BMDA 2AMFA 1BWSA 1ADFA 2PLAA 5CEEA 2CUKA 4XIJA 1XWFA 1YJ8A 2RAFA 1C3VA 4R9RA 4Q39A 2DLDA 3IUSA 2OZPA 4L8VA 5DOZA 4BMNA 3DOJA 3EAGA 1XQ6A 4WCFA 2YHIB 4CMEA 4TMFA 3QE3A 1C1XA 4DC1A 2C54A 5BSGA 1ZK2A 1RM0A 2A9FA 4JXKA 4O1MA 3HDJA 1Y9EA 5F5LA 4ZD6A 3FF4A 5JDCA 1ISHA 3BHJA 4J7CA 1I5RA 1P33A 1U28A 2H6EA 4TKMA 1H6BA 2Y99A 1MGOA 3JQ7B 1S6YA 3MCVA 4J4TA 3PZBA 2OP1A 2HUNA 3DHYA 2WWRA 3ZU3A 3ZWPA 4WEOA 4XGKA 3ZW9A 3LF1A 2W2LD 5U9CA 1I24A 4IDEA 3BMOB 3BTSA 4J91A 5JW6A 4A73A 3FRJA 5K0ZA 4J4BA 3KZVA 1UXGA 4EEXA 5TLSA 4FPXA 1CF2O 1P9LA 4YJHB 4QQRA 5FYDA 2X86A 2NM0A 1I3KA 3C8MA 1ENZA 3MTGA 1C1DB 1P1HA 1YL7A 3NJ8A 4EEZA 3H9QA 1A7AA 1UZMA 2BFPA 3FNFA 4Q9NA 3PHJA 2D1YA 3AUUA 4JLWA 3RKUA 1H6DA 4ID9A 1G0OA 3H3FA 1QKIA 5DF1A 5FF9A 3WYEA 4DMMA 3BMCB 1N1GA 3VPFA 3P5SA 4J3FA 3U4IA 4NBUA 1GL3A 1WLYA 1JAYA 2X1HA 3EMKA 3HHPA 4I5GA 3I9JA 5JBIA 4DQVA 2BGMA 1PJQA 4JQCA 4AVYA 3KLPX 4FD3A 3VH1A 2Q45A 3LZ6A 3RBVA 2X4GA 4BKQA 1QSGA 2GZ2A 3KO8A 4FBGA 4PZEA 5F5NA 2ZTLA 2GZ1A 1NYTA 1YRLA 3ZWNA 1UDAA 5JNLA 2EWMA 3ZNOA 2PNFA 1O94A 2C2XA 2CDAA 3LU1A 4DPMA 3OF2A 1BW9A 1MV8A 2X58A 1I0ZA 4OGWA 3Q1LA 3R0IA 4BMVA 5B4TA 4ND3A 3PWZA 3AU8A 3CSDA 3DBRA 3GEDA 3BMNB 2HDHA 4E0BA 3TSCA 3WGZA 5HS6A 1NAIA 5JYDA 3KETA 1WDMA 2PZKA 3QVSA 3BAZA 2V6FA 4KUHA 1JVSA 2YJZA 4U7WA 3O26A 4PLZA 5COQA 3VOSA 2PD3A 4CMGA 5BR7A 4E13A 3L4BA 4LVCA 3RU7A 2PKQP 4PLHA 4IBOA 7MDHA 3H5AA 3GHYA 1Y8QB 3W8FA 1TLTA 5DNAA 3TDKA 1PTJA 4AJIA 1LC3A 5K6AC 5C3MA 1GV1A 1WXDA 4YDRA 3IJPA 3CUKA 3PFWO 3PDUA 4MVJM 3PEFA 4E33A 3RIHA 3GVXA 3MTJA 5JPIA 3VPGA 1T2FA 2G0TA 2OP0A 4MIEA 1Q7CA 3JYOA 1LQTA 3JQAD 4FOOA 4I9NA 1SOVA 3PI7A 4RVFA 1JVBA 4OJNA 3WGYA 5BSFA 5DCWA 2DVMA 2X5OA 1BXGA 1EFLA 2XXBA 3ON5A 3Q11A 1C0LA 4AICA 1LLCA 3OFSA 4RCVA 2YV3A 3PGXA 3EZLA 3ETGA 4CQMD 1DIHA 1PWZA 3B6ZA 2W2LA 4CMAA 2QX7A 1ZFNA 1CWUA 2PTGA 4WKGA 1PJTA 1VPDA 3NX4A 1LDBA 1IUKA 2C5AA 4RDIA 2O48X 3PGJA 1O6ZA 2J5KA 3SEFA 3RUCA 3O03A 2I9PA 3WDSA 1OAAA 3WIEA 4RF2A 2H1SA 5L53A 3HB4X 3FTPA 5GZ3A 2Q4BA 5DT9A 1RM3A 2X9VA 3OIGA 4AJJA 1ZXBA 5AXBA 1BTOA 1BVUA 4ILKA 3WJAA 4IJWA 3JQFA 2EJWA 3BZUA 4CQMB 1GZ4A 1KVSA 1YO6A 4IIVA 4NBVA 2FSVA 1N5DA 3WB9A 1PGOA 1IB6A 3PWKA 3UHAA 3WIDA 2YY7A 1L7EA 3ZHYA 1NVGA 1YBAA 5DP1A 1OZAA 5J23A 3GAFA 2OXIA 3VH3A 5JAMA 4U5QA 4BO6A 3U0BA 1KS9A 2PGDA 4BUCA 1V3TA 5L3ZA 4R5HA 3VKVA 5A3JA 1NAHA 2W4QA 2QYTA 4I08A 4UEOA 4B4WA 4N5LA 4MP3A 5BSHA 4LSWA 2G1UA 3K96A 4NMHA 1KVQA 4PG4A 4ZQHA 2C0CA 1HZZA 2Q1WA 3DL2A 4DWVA 2BKAA 1QP8A 3QW2A 2ZATA 5B1YA 1VKNA 3PQDA 4B7CA 3DONA 2IE0A 4QUKA 2CMDA 1PJCA 4BKRA 4ALKA 4YJGB 3GR6A 1AGNA 3I6IA 4CM8A 5HM8A 4OOFA 4ZQEA 5GZ1A 3F6YA 3SC6A 1YB4A 2JAHA 4WPGA 2VYNA 1X13A 5EQDA 1QG6A 2HRZA 4HY3A 1BRMA 4CR6A 1U3WA 3TOXA 1PJLA 2VOJA 1L7DA 2RH4A 4OQZA 1EVJA 1Y5MA 1KOLA 2F1KA 3JD4A 2NNLD 4RV9A 2O2SA 4EUHA 2Q99A 3PYMA 3UUWA 3DB2A 2H63A 1GEEA 3NT4A 3PK0A 2CDCA 2GN9A 5AXAA 2HCTA 3AUSA 3DMTC 3LK7A 2JFFA 3P7MA 3ZU5A 4B4OA 1E6EA 3K9QO 2QW8A 3MJ4A 2PGLA 3KVOA 4YT8A 3OIFA 4NIMA 1C14A 4CLRB 3ZDFA 4UVDA 3Q3CA 3TZQA 3U9LA 3PVZA 4KWHA 1K3TA 4WUVA 4CUJA 2HJSA 4A03A 3F5SA 5KJCA 3VKUA 3WFJA 3GN1A 4GAEA 4P4LA 3DTTA 1HDRA 2DU8A 4L74A 1RM5A 2GN6A 4MP8A 2GERA 4WGGA 1YONA 1UP6A 2OORA 3R3SA 5DCYA 3K5PA 1M6WA 2WD7A 4IUYA 1PZEA 1BXGB 3C85A 3INGA 3JQGB 3AM4A 1BXKA 1WZEA 2VWHA 4E2ZA 1DC4A 1PQWA 4M8SA 4J9UE 1ZMTA 5LDGA 3INTA 4LW8A 4FDAA 3ONEA 4JGBA 4J49A 1B8PA 1XU9A 3ZGYA 1YOVA 1VL6A 1X0XA 4YEDA 3O38A 3WQQA 3P2YA 3EUWA 4D45A 4MVJD 4WECA 3F9IA 3TFOA 1OC4A 1RPNA 3D5QA 2RCYA 4XCVA 3ZNPA 4EITA 1R4MA 4YCAA 1N2SA 3B70A 3AUAA 3LSYA 4ND4A 5A9RA 4PLYA 2FHSA 3R6DA 2GPTA 1YQDA 1ZH8A 2CF6A 5A9SA 3PYLA 3L4BC 1U7TA 5G4KB 5ILGA 1RWBA 1I3NA 3JTMA 4TRRA 2GYYA 5H83A 1P45A 5L51A 4J6FA 5T6BA 4JIGA 3NDIA 3DZGA 1LDNA 1NPTO 4L4SA 1UDBA 3HJAA 2R00C 1W8DA 1XU7A 3Q9NA 4WASA 4IJVA 1XA0A 3I1JA 3DBHB 3UVEA 4DPKA 3B1KA 5CG2A 4N54A 1PJBA 4GX1A 5JAZA 2NU6A 1DIRA 1ZMOA 5G4LA 3WR5A 3BIOA 4ND2A 1CYDA 4ZQGA 3VDRA 3WG9A 2XXJA 3RUFA 1QMGA 3F5QA 4I9HA 4EJMA 1PR3A 8LDHA 2Q49A 1LRJA 5JS6A 4AFNA 2JCVA 5AXCA 3WSWA 3VAZA 2E37A 1ZBQA 4IQ0A 4J7XA 4WNIA 1NXQA 3H5NA 4DLLA 4NDNE 4U6QA 4L73A 1HLPA 1PEDA 1ISMA 4B3JA 3E6AA 3FD8A 5A02A 2EF1A 1I3LA 1NNUA 1S7CA 4E31A 1QV6A 4XRRA 4BOYA 4DMLA 1GTMA 2X5JO 4R41A 4ONEA 3E8XA 4BNVA 1JLLA 1EE9A 1AE1A 5JCJA 2EP5A 3CTMA 3C1AA 3V2GA 5C37A 2O3SA 4BO0A 3DZJA 5I7SA 2DAPA 1TT7A 3BXXA 5T57A 4AJOA 1P1IA 2I6TA 1E1LA 1WAMA 4KQXA 5GMOA 4E30A 3BTUA 4JJFA 3FPCA 5ES3A 3JD2A 2AG8A 1U4OA 2JHGA 1NASA 4MVJG 1U9JA 5JC1A 4P38A 1IULA 5G0SA 4FFNA 4L0QA 3NDRA 4RLSA 4Y67A 3WBBA 2NLOA 1P74A 3HN7A 4HBGA 3ORFA 4YJDA 2RIRA 2B5VA 4XDZA 4BV9A 4DQXA 4O59O 3D5TA 3JQGA 1Q1NA 5I9LA 4B3HA 2XOXA 1YGYA 1C0PA 2EEZA 3Q6IA 2BFAA 4GWGA 3QVOA 3V1UA 1X1TA 4BGEA 3MJTA 4W7HA 4DUPA 2IEBA 3JYQA 4DTIA 3E5RA 4PLCA 3ZW8A 4G2NA 4PRLA 1BG6A 4BGUA 1Y8QA 1GUYA 3CH6A 2DPHA 3G79A 9LDTA 2BLLA 1GU7A 1A5ZA 2OO5A 1KC1A 4R1SA 2FZEA 2GN8A 5A1TA 1E1NA 2ZB7A 4XRGA 3IKTA 4J16A 3AJRA 4UVEA 4DYDA 1NHGA 1EVYA 4FFMA 4DC0A 3NGLA 4ITUA 4CLEA 3WSVA 4F6CA 4BNFA 5JFOA 5FFFA 1LA2A 1ADBA 4XQCA 3H6KA 5G4KA 2GSDA 3D4NA 3GOHA 4GKVA 3GEMA 3FN4A 4IMPA 3DFZA 1H2HA 4KP7A 2DFVA 1M76A 1B16A 5JO9A 5FWNA 2VWGA 3TL3A 3GDGA 4BO9A 3HZZA 3DBHA 3H9EO 2WTBA 5JCJD 5KCZA 3QIVA 3MJEA 3JQ9A 4DLAA 5EESA 2Q2QA 1ZJZA 3JV7A 5CFZA 1VRWA 4BNKA 1X7HA 3GAZA 2YUTA 1MXHA 3ASUA 4QT0A 4ZJUA 3WWYA 5AQ1A 5ENVA 1KIFA 4WOKA 4AJ4A 1E6UA 1Z73A 4CQMA 1K6JA 2B35A 3NDJA 4MVJH 3H8VA 3EC7A 2LDBA 5LCXA 5I8WA 3M2TA 1HYHA 3NT5A 1X7GA 1PX0A 4BKUA 6ADHA 1RYEA 4I5DA 1ONPA 4EUFA 2YHIA 1P1JA 3M2PA 2CF5A 2IRWA 3IC5A 4KUGA 1MLDA 5B4VA 4I5EA 2D8AA 4BNIA 1Q0LA 1CQIA 1FDUA 3BYZA 2EGHA 1J0XO 3IKVA 1EQ2A 1FDSA 3W8DA 2UUPA 4CM6A 3M1LA 4NJMA 4CPDA 1B14A 1ZEMA 4GWKA 1EBFA 2IXAA 1EUZA 3WNQA 4UUMA 5KVSA 1E3EA 2DBRA 2C7GA 3OMLA 4MIYA 1T2AA 1H2BA 1QORA 3PRJA 5MDHA 1NPYA 4NQZA 7ADHA 4R3WA 4M87A 3I4CA 4RGBA 2IODA 3ANLA 3L77A 3C24A 3D7LA 4WOJA 3TZHA 3D3WB 2GDZA 4BO2A 1G6KA 3I9KA 4E32A 1SZJG 2B5WA 1J6UA 4RF5A 4FSHA 2HMSA 3BA1A 1YQXA 4O5OA 2YHUA 4Q3EA 2DTXA 3A1NA 5T64A 2HK7A 4YJHA 5KVQA 1NQTA 2PZMA 2JCYA 4RPJA 1W0CA 4CM1A 3QVXA 2PD4A 3TOZA 3WGTA 1H93A 1R12A 4JN6B 4C4OA 4YRDA 4D46A 3COSA 1LSSA 1PL6A 4A0SA 3DFUA 4D43A 4FFOA 4UREA 4YAJA 4LK3A 1N92A 1NQOA 3PJEA 1W4ZA 4BO5A 4KDEA 3ITDA 1PGNA 3WTBA 3DAPA 4LMRA 3OBBA 3ZWYA 1HE2A 3DAFA 3GVHA 4CMKA 4CL8A 2X9GA 2SCUA 3I23A 3P2OA 1ADCA 3W6ZA 2J5RA 4XJTA 2AA3A 5CDYA 3S8MA 1PS8A 1HDCA 4TSKA 1NQ5A 3PZRA 2YDXA 3EW7A 1U4SA 2E48A 4Q3NA 2X9NA 2GD1O 4NFYA 2PV7A 5A04A 4M49A 4NG5A 5KNLA 4J0FA 2D5CA 5L45A 1CJCA 4XYGA 2HJRA 2PY6A 3ITKA 3QWFA 5TRTA 4YAGA 1KERA 1NVMB 1Z7BA 5ICMA 4EYEA 1LNQA 3H2ZA 3DZHA 2NTJA 4HFJA 1JA9A 2VT3A 1ZW1A 4E21A 3PIIA 4RZIA 5EERA 3VHRA 1LU9A 4OYRA 1E7RA 3PHHA 1DC5A 2WJPA 3I9LA 4M89A 9LDBA 4K6FA 3KOUA 2WE7A 3D64A 1BDBA 5TT1A 1R4MB 3DOCA 4LRSB 4D3DA 3D0OA 3JQEA 3VVBA 4OXYA 1Y5RA 4DVJA 2B4QA 2RHCA 3DO5A 4YJFB 1JU9A 4M55A 1CETA 2UV8A 2VYND 3GY0A 1ORRA 4QO8A 5KJEA 4Y6PA 1P0FA 1B3BA 1UJMA 2E4AA 2YFHA 2DKNA 3D4PA 4I9UA 3WXBA 1DJNA 1QLJA 2NQ8A 1JKFA 1Y81A 3OP4A 2EIHA 1IPEA 1GYRA 1I3MA 1R0KA 3MWEB 2I5PO 1VE9A 3S2IA 4AJEA 3VPHA 3KEQA 2O3RA 4XYEA 3DZFA 3PHLA 3KEOA 2EHDA 4TRNA 3ONDA 3HN2A 5JMPA 4YWJA 4PN3A 3JQAB 3CE6A 2PH5A 2IDZA 3VZPA 2ZQZA 5A06A 4IDFA 2BMAA 4H15A 2WE8A 5CAEA 4PCVA 3W4IA 4DQUA 4HKTA 3OEWA 2GN4A 3D3WA 4XR4A 4MVJP 3RASA 1ZK1A 4XYBA 3W4JA 2CVOA 3UW3A 4FCCA 1D1SA 3FHLA 3I83A 1E3WA 1GYPA 4INAA 4E5YA 4GGPA 5IDXA 3DHEA 3UFXA 2JHFA 1ARZA 1DFHA 4RVSA 4WCFB 1BGVA 3IS3A 5JYEA 2D3TA 4IMRA 5T67A 4EGFA 1C1XB 1JWBB 2AG5A 4F46A 5G0UA 3WWZA 2Z1MA 4JP3A 1V3UA 4PLVA 2FR1A 5C7LO 2ZYAA 4F3YA 4AJLA 4CLOB 3D3EA 5F1OA 3SLKA 5LC1A 1NBOA 4MVJA 4CJXA 1TXGA 5G0TA 1XEAA 1PU2A 3LT1A 3PXXA 1V3VA 4XJSA 1ZXLA 3SJUA 2AHRA 3QWIA 3LLSA 4NK4A 3VZSA 4YT2A 5KOIA 4W7IA 4IGFA 4DL9A 4FC6A 2EXXA 3GT0A 3JQ6A 3HNPA 5MGBA 4CM8B 2X0NA 4R9SA 1QRRA 2DT5A 3BHIA 1I2ZA 1U7HA 3BMOA 1F14A 1YL5A 5HWSA 4GGOA 4DIBA 3W6UA 4NU6A 3WLEA 3E03A 4J90A 4YXFA 1G1AA 3TZKA 4FGWA 4Z9FA 5IG2A 3AW9A 1X7DA 4XQEA 2X7HA 4DREA 4GQAA 5CPFA 1DAPA 4B4VA 4ALNA 2O3QA 3ZN2A 1T25A 3HADA 3A06A 1HE4A 2VOEA 4OKIA 5TNXA 4K28A 5CEJA 3GPDG 4I1IA 2NUAA 4RVDA 3RAJA 3EVNA 5GZ6A 1Z45A 1ONNA 5TIIA 4CQLA 1UH5A 1K0UA 2OMEA 4J1QA 4YAKA 3UICA 3I5MA 3L0DA 3RFVA 1TT5B 3FNEA 3GQVA 4HNHA 4QFCA 4E3ZA 1A9ZA 2E49A 1HWYA 4U0JA 2BD0A 1VM6A 6LDHA 4IXWA 1MA0A 4BNWA 4RZHA 4RQTA 2I65A 4GH5A 4MVJI 4YJFA 5HTOA 4K6CA 5JSFA 1QYVA 3DOOA 4GLOA 2Q3EA 1BW9B 4AJHA 3RQSA 2Y68A 2TMGA 2WYUA 3RJ9A 4W6ZA 4UEJA 3HUDA 1PJSA 1ADGA 4KTVE 4WCDA 1A7KA 1UAYA 3FBTA 2GNAA 3IIEA 3TF5A 1QR6A 3WGIA 4S1VA 1YOVB 4UAGA 3UOGA 4HXYA 4HV4A 1EVIA 3M6IA 1H0KA 5A03A 2FR8A 5BNTA 3ZWBA 4L9RA 2ZTUA 5TX7A 3E9QA 2AQ8A 4OXKA 1ZCJA 1HZJA 3EK2A 1ULSA 2YDYA 4UUOA 3H9GA 2OBNA 2X23A 2NVBA 2YQ5A 3FWZA 3W1VA 1F12A 4D7AA 3IJRA 1O5IA 2HO5A 3ZWXA 2D59A 3JYLA 1E3SA 2Y93A 3VVCA 3NRCA 1E3WB 1UUFA 2C7VA 1OOEA 1JQBA 5L9AA 1DRUA 3GH3A 3KTDA 5C5IA 3RD5A 1VL0A 2Q50A 2RH8A 2FP4A 4E5NA 3TPCA 1V0JA 3AI1A 1HYEA 4BKPA 3OIDA 3C1TA 3V2UA 3MEQA 4PG5A 1VJ0A 3QA9A 2B36A 1UXIA 5EJ2A 3SBOA 1XR3A 2DQ4A 3KHUA 4FC7A 2PD6A 3DZBA 3K30A 2AW5A 2A94A 4FS3A 3QJ5A 4AJKA 3EY4A 4E6PA 4J1TA 2JJYA 4OL9A 5CG1A 4PLGA 4EUEA 4MP6A 2JFGA 4BNGA 3Q2KA 3MOGA 2ILTA 3WGGA 5IDYA 3SVTA 2C07A 2VNSA 4GVLA 1LSOA 3RBZA 5KVVA 3VZQA 2JCXA 3S1LA 3WYBA 3U5TA 5TT0A 3PFFA 1F06A 3QWBA 2WYVA 5TQVA 5CP8A 2V65A 5KJFA 5AYVA 1KY5A 1W73A 2EP7A 4W99A 1ZK0A 2QRKA 4IS2A 5I8ZA 1RM4A 2QYSA 4XB1A 1DDOA 3NTQA 1WNTA 1M6HA 4W9NC 3I9MA 4UVIA 3TN7A 4YRAA 1J5PA 1ULUA 4JBGA 3SX2A 3DC2A 3AM3A 3IOYA 3HSKA 3GMSA 2A4KA 1B15A 1N1EA 2A35A 1CDOA 2O4CA 3TWOA 2VZ8A 1YE3A 4MDHA 3HDQA 1VC2A 3NGXA 1JTVA 3WTCA 2YFQA 4PLFA 1SNYA 2XF8A 1LEHA 4BQRA 3GZNA 1PGPA 1GYQA 1JWAB 3PDJA 1IHYA 2J3JA 4BNTA 1R6DA 3B20A 1I2CA 4O6VA 2O7SA 4DIOA 5EL0A 2Y66A 5CHEA 3PJGA 4FIZA 2EKLA 3ROMA 3UN1A 3T7EA 3LC7O 3QWHA 4R01A 3FTNA 3VTFA 3VDQA 1PQUA 4G5HA 4A26A 1E1MA 4ZN6A 1HLDA 1B8VA 3P19A 3GVPA 4Z3KA 5BT9A 4B8WA 3RUDA 4IDCA 3RFTA 1VJTA 4I5FA 3A14A 1B2LA 4XIYA 1E7YA 3O4RA 3CKYA 3I9OA 4J1SA 5AOVA 2YYYA 3GDFA 3PPIA 4RL6A 1HKUA 4IXTA 2X0JA 4WEQA 2DTEA 4WLUA 3G17A 3KYDB 3GN2A 4JJIA 5DOVA 1NP3A 4CMJA 5THKA 4CV2A 4CMEC 2XAAA 4J43A 1LDYA 1HSZA 1B3RA 2HMWA 3IAHA 1X1EA 4BNMA 4NI5A 1C0KA 2Q4EA 1H5QA 3ZV6A 1E3LA 1U3UA 2EERA 2RHRA 5DBIA 1NPDA 1NTOA 2WMDA 1EVZA 2EG9A 4FJ1A 3AFNA 2VUUA 2VTDA 5HS4A 2V6BA 1ZK3A 4MKXA 1NHWA 1H9AA 1T2EA 3DMYA 4FQ8A 4ZRNA 1BHSA 1B8UA 3ONFA 3QVTA 4IZIA 1YB1A 5L4NA 1E0DA 2NTVA 4XKJA 3WX0A 1ISIA 2VUTA 4TKLA 5DBGA 3RUIA 3HQ4O 4LISA 2NU8A 1YBMA 4K1LA 4BS9A 2Z5LA 5TSDA 3WBFA 1XKQA 5KTKA 1LQUA 3DQPA 3MOIA 4NPCA 3GUCA 5EIOA 1DFGA 1IE3A 1LXCA 4Q3CA 3BMQA 2J3KA 3RUAA 4B7UA 5L4LA 3I9NA 2P9EA 3GC6A 4YB8A 1H9BA 2R00A 5IJZA 4PVDA 1QV7A 1PQPA 4BKOA 4CR8A 2AQHA 4E5MA 2PR2A 2D2IA 3G0OA 2P9CA 2UAGA 3STHA 3GNTA 2DBZA 3EGOA 4EJ0A 5ICSA 5DCUA 4CLHA 2QZZA 1Y8RA 3WQSB 3ST7A 1XG5A 3H65A 5T8KC 1SCUA 1DPGA 1ISFA 2GZ3A 3AFMA 2P91A 4PFJA 1DLJA 1DAOA 3QRWA 1XQ1A 4ZICA 1F0YA 3OICA 3H2SA 1I30A 1V6AA 4M1QA 2JD2A 5KKCA 3OETA 3Q2IA 5EMHA 1MC4A 1DIAA 1AXGA 1YDWA 4GKBA 4Z0HO 3KBOA 4TZKA 3ZH2A 1JW9B 1T4DA 5DBFA 2X5KO 3RC1A 5K9ZA 1SOWA 4MJLA 1X15A 2DPGA 4N5MA 2FWMX 1BDMA 2J3IA 1DHRA 1SBYA 3DAGA 2YW9A 4O0LA 3W8EA 3NKLA 4H16A 3OM9A 1SO8A 1U5AA 3NTRA 3UGKA 4E5PA 4IIUA 3GRKA 4NBTA 1GR0A 3CINA 3L6DA 1P0CA 2C59A 2AEJA 3PJFA 3UCXA 4KDFA 1YWGO 2D4AA 3VPXA 1AHHA 1T26A 1T2CA 5JO0A 3EYWA 3UCFA 1M2WA 2OGUA 4AJPA 1HTBA 2YV2A 1LTHR 5CPBA 2NVUB 5IDQA 4TWRA 4PZDA 3PTZA 4WLOA 2PKRA 1Q2XA 1BVRA 1Q7BA 3L6EA 3QWAA 3F4BA 3HFGA 5KJ1A 5TJHA 4URFA 2ET6A 1VKOA 4MOWA 4MKRA 2ZYDA 1GQQA 2W8ZA 1PGQA 4IDBA 4U8GA 4K9DA 4OM8A 4FJ0A 4JBHA 1KY4A 1EDZA 3PQFA 1EEHA 1IL0A 4NJOA 1JDJA 4ND1A 1GV0A 3PWSA 3ZWWA 1XGKA 2BRUA 2B4TO 3JYNA 3RC2A 1MFPA 1TT5A 2FY8A 5ITWA 2JFHA 1SMKA 1YKFA 3GEGA 4U6SA 4BHTA 2Q46A 3SLGA 3EVTA 1DC6A 3HFSA 4YAEA 3ZU4A 4A27A 5IN4A 3BTVA 4LVUA 4A2CA 2X0RA 1BXZA 1ENPA 3MJVA 1XSEA 2VN8A 1GQ2A 3ADOA 3OA0A 1ZO8A 4MIOA 4RPHA 2BH9A 1GFSA 1PL7A 2OL4A 3WNVA 3AY3A 4IDDA 4ALMA 1IPFA 3GNSA 5IAAA 4UUNA 4CM9A 1YDEA 2HMTA 2Y1EA 3GDOA 1EQUA 5ENDA 4DLBA 5T5QA 1MFZA 1ZSNA 2UVDA 1JKIA 3D4OA 3ZWAA 5ER9A 1E7QA 2NADA 4Z9YA 4BL5A 4XWYA 1DXYA 1N9GB 3I4FA 1AXEA 3ZNQA 3WICA 4II2A 4JCOA 4QO7A 1E7MA 1Y8RB 3AK4A 4L76A 2IZ1A 2PKQO 1AN9A 3KSUA 4ALLA 1DSSG 4XD2A 3SJ7A 3ZHZA 5HRUA 3DBLA 3ENKA 2O4UX 1MP0A 3LYLA 5EPOA 4RQUA 2IYPA 2W2KB 4MPDA 4EI2A 4YT5A 1FF9A 1LBEA 2IEDA 4RO0A 5THQA 5CDTA 3TNLA 4BNYA 2JD0A 3GMDA 4CM4B 4E5KA 1WDKA 2Q1SA 2VHZA 5ER6A 4HWKA 4YYZA 3JQ8B 1YJQA 3N7UA 3V5NA 1VJ1A 3LT4A 5L7TA 1GUFA 3E5MA 1PJ3A 1C0IA 1T4BA 2HMVA 2QZ9A 5DZSA 1M75A 2GF2A 4YQYA 5KIAA 1PIWA 4UVHA 2Y0DA 2ZQYA 4CUZA 3H4VA 4ZQBA 3AI2A 2FN7A 3JQAA 3HB5X 3WMXA 1R15A 3K73O 3VTZA 2C29D 5JDIC 4W82A 2I66A 2ZB8A 1TA4A 1UDCA 4FB5A 3GHHA 1LUAA 1XHLA 3IP1A 4TVBA 2UDPA 5KVCA 3NV9A 1DO8A 1OFGA 3OECA 2ZTVA 4WNCA 4XEHA 5HBRA 2Q1TA 3U62A 1EE2A 1N8KA 3E9MA 2V7PA 1J49A 3PLNA 3L9WA 1CIVA 4MVJE 4RPGA 1MB4A 4Y8VA 2PA3A 2Y0EA 5ADHA 2NVUA 4YRBA 1WMAA 3OJ0A 2HAEA 4FFLA 3GGOA 5A5FA 4BVAA 1YVEI 1LDMA 3Q0EA 1HEUA 4G81A 1EZ4A 3R3JA 4PVCA 1HSOA 4GX5A 1M67A 2IXBA 4B8ZA 4IM7A 2BF7A 4GBJA 1WVGA 4RF3A 3AOGA 1KVTA 1O8CA 2Q2VA 3I6QA 3LF2A 1FDVA 5I9NA 2CVQA 4IINA 1LRLA 4OMUA 3FNGA 3KXDA 1HF3A 3G49A 3WLFA 1WPQA 4BIIA 5L40A 5IZCC 3SC4A 4H7PA 4ZU3A 1F8FA 1J4AA 3FSRA 4OHUA 1K5HA 4QX6A 1DIGA 1GD1O 3RFXA 3WJ7A 4JROA 3GVIA 2VYVD 4M86A 4BNNA 3U4CA 2P2SA 1E5LA 3VPSA 3KYCB 1UXKA 4KQWA 4J2OA 4HADA 3ICPA 2VZ0A 2V6GA 4HFMA 3HDYA 2VRBA 3JD1A 1MX3A 4GMGA 1R0SA 1A4UA 3N74A 1NR7A 1Y6JA 3L4SO 5DP2A 4B3IA 5FI5A 1HL3A 4CR7A 1ONOA 4FJ2A 4YAIA 2OHXA 4TVOA 4ZVVA 1NFRA 2AXQA 4L75A 4CM7A 4CQLB 2P4QA 1Y7TA 1E7WA 1KEPA 2FZWA 1YXMA 1N9GA 1Q0HA 4UEKA 1EDOA 2VZ9A 3MJSA 3PLRA 2C82A 3TZCA 3ASVA 1HXHA 1E1KA 4PLWA 3C7DB 2O50A 5JY1A 2B83A 5IF3A
chains in the Genus database with same CATH superfamily
4ZKDA 5B58C 3UAVA 2VH5R 2EJCA 4FLFA 4OD0A 4QD3A 3TTWA 4HDRB 2LRHA 3EXFA 1REQA 1ZUD1 3BCHA 4G01B 4ZPXA 4EHFA 3ROFA 4NXNB 1UFQA 3KAJA 3QTBA 3OPNA 2GXQA 4MV1A 4JJZA 4PAGA 4WY2A 2XB9A 5G0VA 4XXHA 3GV0A 4QXMA 1M66A 3ECAA 1MC5A 4Y1GA 1H5UA 3ZZ0A 2H5IA 1F4LA 3ANYB 1P6XA 5AK0A 4BO8A 5CEFA 2IDMA 1XMVA 1NKSA 5DEIA 3G59A 4G4GA 3ROKA 2GS9A 4FU0A 3E2IA 1C7EA 1EFKA 1RHKA 2A8YA 3CVOA 3OLZA 4LZJA 3BK2A 4YRTA 2IWRA 3SZLA 4IPTA 1DO2A 3RWMB 3VPCA 2G76A 4JX8A 1YQWA 1KFJB 4DIUA 3OPYB 4FFWA 1XVIA 4DQ0A 1PLJA 3FCCA 4NNJA 1SVSA 1Z13A 2AGVA 2ES4A 3S44A 1A9YA 1FRZA 1G0NA 1NI4A 2BR4A 3FSGD 3IDQA 1L4GA 3UV3A 4GM4A 1LBQA 1UJ6A 2AQKA 4MWDA 3I1IA 4PFSA 4UBLA 3ZZUA 4X66B 4AWBA 2JFOA 1BS2A 3O2NA 3QEMA 3SXPA 4YRGA 2B4YA 3N75A 4QKQA 4GPD1 4XR9A 4M3NA 3MMNA 3KX2A 3SHQA 1EK5A 3HBJA 3ZU6A 3ENZA 2Z95A 4EB8A 5AM3A 3TZBA 3P8ZA 4BX9A 1TKRA 1IUPA 3JSXA 5KNDH 3G6WA 4KEAA 3ADDA 2K6GA 2IY9A 3KPWA 4HDSB 3THSA 4JLOA 3RU9A 2WHXA 4RVHA 2JAUA 4XEUA 1FTQA 2HWUA 3HVHA 1RPJA 3NAMA 3P9YA 4L0MA 4EENA 3ZLTA 3B1JA 1KDPA 1GUZA 5KYYB 1H8HA 3BJEA 4WLVA 5HKKD 5B37A 1CUWA 3MC1A 4O4IB 1JDBB 3LW8A 5L7WA 2GASA 5J2UF 1M8JA 5DM70 2J1LA 4PHCA 4JP2A 3GFBA 4L3VA 2W2TA 1M0WA 5FR1A 4YV7A 1XQXA 1ZIPA 2VRCD 3LJKA 3MINB 4HAIA 1NW8A 4KX3A 4OIMA 1J70A 2VYVA 1UXHA 5AUPB 4R83A 1NW4A 3T7DA 2MSCB 1R8SA 3B89A 3CEAA 3OY7A 1B8NA 2ZTSA 2RAUA 1V7CA 4L78A 4YQZA 5FBRB 2RE8A 3HVKA 2ZGVA 5JLAA 2UYQA 3LXRA 4B3BA 1KO5A 4OHOA 1GN8A 1RQGA 1D4OA 2BZ1A 4J1NA 3M49A 4WOPA 2MYNA 4NOKA 6PFKA 3OD1A 1VCOA 1ND6A 3OT1A 4GI3A 4NAUA 3SFZA 4CCAA 1KI6A 3VQTA 2YC2C 2VYQA 4ZI7B 2YQZA 3BL8A 1GIAA 2VYFA 1G6Q1 1IEQA 4G1CA 5H68A 2BFEA 4DFDA 3S81A 3RGGA 4ZVMA 2J3HA 5FQNA 4UULA 5EXXA 2XD4A 3QP9A 3W4KA 1ZG3A 2C95A 3GNQA 5E1MA 1GNRA 4BEJA 1LNZA 5I9MA 1Q95A 2PR7A 4EFMA 4OFXA 3KYBA 4LNUA 1KC3A 3KB1A 4AJ2A 3A58B 2GR9A 2Y9YA 2XPCA 1JHRA 5KQGA 3L07A 4DV1B 4X9XA 4CLOA 1DB3A 4FVTA 3ZGOA 4NYJR 3TRIA 1JECA 5C5CA 1P7PA 1SXQA 5CB4A 2GPSA 4QEKA 4JOCA 2IOHA 2KBEA 5FTJA 3V1TC 2FMUA 3GQBB 4DBVO 3MTEA 1H3EA 4MUHA 1JA1A 2LNDA 2VSFA 4B48A 4W8HA 2IFTA 4P0PB 4FNAA 1ISGA 2I4LA 1F7VA 4KLCA 4D3SA 3D0QA 3E5HA 2MWMA 4IHQA 1XWWA 1QG4A 2AN3A 4MCAA 4WD3A 4WY5A 1YQGA 2C88A 4QYXA 5D1HA 1QFMA 4ZHSA 3GF4A 1SULA 2W70A 5AVZA 2BKUA 4NYMQ 4XDYA 4AO7A 4CV1A 2Z4RA 3B7GA 4D3XA 4RAOA 4CODB 4D9NA 2BGGA 1RLMA 1GCUA 2QTBA 2R4UA 4JODA 3UH1A 5F98A 5F1KA 1ZZEA 4HGPA 4IH4A 5GONF 4AY2A 2PJZA 1NBAA 3Q72A 4PAWA 1UWLA 4M99A 4F3NA 4RETA 2M6LA 1XRLA 1KA9H 1U0OC 1SVIA 1UEXC 2O52A 1K4YA 3HB1A 4V1CB 2L0XA 1Q1ZA 3DMTA 1EGVB 3FDXA 4HF7A 4M0PA 5GQSA 5FI3A 4Q7JB 4Z9XA 3W6OA 3EPRA 2NVWA 4QAQA 1FOEB 5LZ7A 1OIWA 4MUMA 2RIPA 4RH1A 5PGMA 2NTEA 3KYDA 2ZXFA 4HO1X 1JHPA 1X19A 2WU1A 1ZJ4A 4WBNF 1P4AA 1RXVA 4YIKA 3RKRA 1CJUC 2PXAA 3NM6B 2L82A 3DVQX 3HCEA 4OHYA 2A6PA 2XDWA 4S3MA 1BMFD 1QHYA 4NBWA 4EOGA 1EHYA 2ODWA 1M7GA 5SY6A 2OFPA 2YYZA 3C5WP 4O4LF 1BROA 2R6DA 4NY1A 3JVVA 4QOGA 1QUFA 3U49A 1XN1A 2VUIB 5U4XA 3VBEA 4DLNA 4E4YA 3NRBA 3ZDDA 3QE0A 1I01A 2H57A 3GVCA 1GADO 4EFDA 1RQRA 2YFKA 3D1LA 3OCVA 1L8AA 3CLUD 3DD1A 3QVUA 3QVWA 4KKVA 3NIBA 3CZPA 2WIAA 1Z08A 3H0KA 4QEDA 4QXQA 4RMJA 4BQPA 2G82A 2O2XA 2ZROA 3FMVA 3ACBA 5FI0B 1C3EA 3AF1A 4OI2A 2GN2A 1C9DB 3ANNA 1P5HA 3NKVA 5IJ9B 5HKKA 4C0XA 2BI7A 4L5JA 1D8AA 4HL6A 1NURA 1JEQA 3GFFA 1P7VA 3TQRA 1F8GA 1LLQA 5C8YB 5HIKA 3HGTA 1X14A 4RESA 3U7FB 3IYLW 3QLEA 4CDRA 1FFHA 2EC5A 3ZE1B 3RCBA 2WHQA 1M2OB 2VQDA 2ISCA 3MWGA 1Q0QA 3O8QA 1EI9A 4KGXA 5K3AA 3RFUA 1N2CB 4CTNA 3IT2A 1PWXA 1P0IA 3ETHA 3AOEA 2CFIA 4NCHA 1C3OA 1SB9A 3M5PA 3VBCA 5I7VA 1K6IA 1HDYA 2V9PA 2Y3IA 3GFGA 4JBNA 5K01A 2I6UA 3O83A 3GGCA 3EQ2A 5K6TA 5K3EA 1A9QA 3D3JA 1NW6A 4MV5A 4C6HA 4I55A 1FLNA 4OB7A 1MT3A 3K9FC 3H3JA 2BL4A 1BO6A 3FI9A 3FR8A 2GSWA 3KV1A 4IGAA 3AEUA 5CM9C 2HA5A 5AICA 2AD5A 4M53A 1QJ4A 4HTAA 4KWIA 4DVGA 4DC9A 4HWGA 3ESQA 4B6PA 1Z2NX 1TTPB 4D92A 4P6VF 1RIFA 1RYBA 3QPBA 1XEWY 4NH0A 4FW8A 1T1JA 4Q82A 2QIOA 3BMCA 3TLBA 4LTDA 1MKYA 3DJYA 5U4QA 3UCEA 1I2BA 3MCAA 5KTNA 1V95A 2DUNA 5JALA 1UPBA 1SC3A 1ECLA 1EUCA 2GJ8A 3OF3A 4QFBA 4RMHA 5CH5A 5AK5A 2GX6A 5H3CA 4DIMA 1QNFA 4JP8A 2PMCA 3H1GA 3HS3A 2Q4DA 4JU8A 2I55A 3PUZA 4G1MB 3CEPB 1KBZA 2KE5A 1JDPA 1QH8A 4QYMA 1RWOA 4OO3A 3T3DA 4C07A 4Z4GA 1PAUA 4F85A 3OZCA 4IDAA 2YV4A 1JAXA 4RGQA 4R16A 4F4JA 1ULZA 2EYQA 3UV6A 3GFVA 3JY6A 1GPLA 2FSSA 4IFTA 5JZMA 4ZIRA 1TW3A 1W1UA 1CHNA 5COAA 2EDAA 2ZUUA 4PZCA 4PSKA 2AIRA 5A3RA 1GQSA 4N01A 3S55A 5J4HA 4DB4A 3RJMA 1CVRA 2J87A 1G20E 3DBRB 1EFHA 1JKJA 2AOTA 5DYTA 1TU4A 2FZVA 4LOIA 4NP6A 4D9FA 3H5IA 3WWEA 2O7RA 2D1TA 2IKQA 1QRAA 4CW7A 4HNGA 1N8TA 3LC2O 1J97A 3CWCA 3LDHA 4LYYA 3I52A 1UBEA 3WOHA 1F0NA 2AMVA 2KQUA 2VPZA 3H2IA 3D9QX 5BPFA 5CDHA 1JMKC 1R27A 3QLJA 4ROSA 1CCWA 4ZOQI 1PZHA 3QBEA 5GOTA 5AVYA 5IEJA 2G5PA 1BKDR 4QRIA 1UKAA 1J0BA 1IDOA 2W6QA 2X3FA 2XVYA 5TGDA 2ZYGA 3A9SA 4H0NA 1U9ZA 4KFCA 2JFNA 1ZCFA 2P65A 1M2VA 4U3JA 4P34A 3ZCXA 4Z5XA 1VI2A 1LI4A 3D6MA 1QIDA 2H1VA 3PNVA 5LNK6 4LCBA 5DULA 3TUJC 1R4NA 1DKRA 4NHEA 2BJHA 3GARA 1B1AA 3RTAA 5A9SB 2AOWA 4N3AA 1IIRA 1J7KA 1XLTC 1DBWA 4Y6SA 2DLCX 5DYGA 3A1FA 2CCJA 4EBFA 1GY8A 4HX5A 1YBFA 2HCFA 3EMVA 3MVEA 3S1AB 3EG9A 2XD9A 2GETA 1PG0A 4HQKA 1G5IA 5DN9A 1QBKC 3UXYA 3YASA 3ZE8A 4DA9A 2YJGA 2RGWA 1RXWA 4AY6A 1NZFA 1II9A 1W85A 2QTMA 3BXFA 3C3XA 3EUEA 2W90A 1FXWA 1LJ8A 4TTJA 4MW6A 1E8MA 1TNDA 1J99A 3IB6A 4WSOA 1EUDB 2CE7A 4AO8A 4IX1A 3FOBA 5L95A 3PCRB 4RK6A 1PBNA 3GUVA 2P9GA 2FLVA 2P4HX 4J29A 3PNSA 4Q4LA 4ZT4A 4J2HA 3VH2A 3NAQA 3Q3IA 3LC1O 4EUKA 1UBNA 1E2KA 4B6OA 5LU9A 5FEMA 4DBZA 2FPGA 4WXEA 1N75A 3EW9A 1PSZA 2HSZA 1NBHA 5H9WA 1GKYA 5J9FA 4BQOA 1A71A 3W5CA 2XADA 3A4VA 3NPAA 4XX0B 5EMNA 1N0IA 4O3MA 4IIJB 2NZYA 2O2DA 4QTXA 2ATCA 1RNLA 3JWEA 2WWTA 3DL7A 1AX9A 2XUOA 3AONB 1JTFA 4CKBB 2O3UA 5IUKC 2C2BA 4EW6A 4DV7B 3AUTA 4GYJA 4O4HF 5IBPA 1J1UA 2D3WA 1R16A 4LAFA 5ERXA 1WR8A 2Y1OA 1USWA 2EKQA 4EBBA 3FYSA 2PUBA 2FUCA 3CHYA 2I9KA 5LU8A 3HJFA 3UGQA 1VDZA 4AF8A 3QLUC 4XQ9A 4WBSA 3RVQA 1AQNA 2ZR7A 4P8RA 1R8YA 5FULA 2CY0A 1QGDA 1MG5A 4KMSA 4QSMA 1RI5A 3T3OA 5JE8A 2B7BA 4JLNA 4M46A 1N7HA 5AVOA 1L7AA 5LP6C 3TRKA 2BP7B 2HQ1A 2BGNA 2HQOA 1KGDA 2QYHA 2ZS7A 3KOZA 3O9ZA 4LC1A 4PRKA 4BNLA 1BEZA 2MSDB 3AHDA 3K72B 4XFJA 1WHTA 3DLPX 5DE3A 4S05A 2VK8A 4MX8A 4YPOA 4W8GA 3OZWA 4AS3A 5IRCD 5DK4A 2VFAA 5U1PA 1UBFA 3H6HA 2BDUA 4JR0A 4YJGA 5TF4A 1NT2A 5LDHA 4PLPA 4BU0A 2PVPA 1M1NA 3BMQB 3O8DA 2J3DA 2O2YA 3ISVA 3H5LA 4JDPA 4N3GA 4RPKA 4ZU1X 3SOZA 1C50A 1ZI8A 3E18A 2EV9A 4MHTA 3KKEA 1GQYA 3HM2A 2MYTA 3HYNA 5SYAA 4QXPA 2GRAA 2NO9A 1CVLA 2Z2JA 1NUSA 3DOHA 3DXFA 4CMHA 5EVJA 1MTZA 2YZNA 3JD0A 4YROA 3QHAA 4RPIA 4TV9B 1YF3A 1E3JA 5GY7A 2E85A 5K20A 5KWSA 4X1KB 1OIXA 1BE1A 3RSCA 1YIOA 1L5YA 2IS2A 1PTJC 4GIBA 3S2SA 4QDZA 3UMMA 2PYIA 3R77A 4R8SA 2GHTA 2HCRA 4LUCA 4G1BA 2XNDD 4FDTA 4I3FA 3MMXA 4YAOA 1X9HA 1ZK4A 2Q5JA 4Y98A 5HP4A 5HIIA 2CFSA 3CT4A 3A28A 3VOBA 1V8BA 2CJWA 3HDGA 3U4DA 2V55B 4KVFA 4CM9D 1SCIA 3H16A 2AJ8A 5A4JA 3VYSB 1T5HX 1ILEA 4G25A 2CW5A 3LT2A 2CVZA 5DK6A 2FKNA 4C2TA 3AI3A 3QOYA 3JARA 2DBQA 2NX2A 2EVWX 5EIAA 3ZY4A 4BIMA 1WF6A 3PGVA 4RK0A 4UEQA 4JEIA 4LCEA 4DA6A 4C1NA 2DR2A 3SQWA 1OX6A 4MUBA 3ZVNA 1PWYE 2RI0A 2JGLA 3FPLA 3EEFA 3FTEA 2Q29A 1DNPA 4Z4FA 4PXAA 2H48A 3K92A 4J2TA 3UTCA 1NR5A 3ESYA 3CMCO 2PGJA 3TLZA 1QPZA 1A76A 2V98A 2EWVA 2RHOA 3C7TA 2B61A 3DZIA 1FUEA 3ELDA 3ZXXA 4BNHA 3QSGA 3EVFA 4CMIB 3ACCA 1TVEA 1ISRA 1ZSYA 5AT1A 3EZYA 4J07A 5JWHA 1OYWA 2NU9A 3RTBA 1PEYA 3CUWA 5F3RA 1DDIA 1AXRA 4WA8A 1YR8A 1WDWB 2Q1YA 4ZGWA 2Z57A 2MSNA 4BB5A 2D0DA 4Z0TA 3U4QB 1JPUA 1OHHA 1M2EA 3SIWA 2PGAA 3KOXA 5C1PA 1SBHA 4U4AA 4XVQA 3FHJA 2LKCA 3KT3A 3OA2A 3O8BA 2CKMA 1HETA 2ZJAA 3GG9A 4QBIA 2WJ3A 4J7UA 4LDQA 4RYLA 3CVJA 1ZKMA 3RC9A 4DKXA 2AE1A 2F3RA 3U09A 1M1XB 2V9CA 1QIHA 3E22B 1AJEA 1SUWA 5GGYA 2KM1A 4KPUA 1W1WA 1VB5A 1SEPA 2IZZA 4ZO9A 2QYOA 1V8PA 3GLFE 4ISCA 3ABIA 3ODGA 4ZC8A 3UXMA 3ADCA 1GGMA 1B7GO 3UB4A 3OC6A 1GCOA 1RJ9B 2WWFA 1T9HA 3G0IA 4TRJA 4RJTA 2PPVA 3IMCA 3WYNA 3UJNA 1W48A 2R6R1 3RIEA 3M4JA 1I9GA 4UXHA 4M7PA 3OMXA 1E92A 4G0PA 4NR0A 4P81A 3ID6C 3FROA 4LV5B 4WK4B 1ABFA 3HPQA 5KO2A 4A36A 1P91A 1Y3DE 5CD1A 5IKPA 4J9VA 4MXDA 1OC2A 2PH7A 2WIKA 4KMMA 3F73A 1T2VA 4TS4A 5KNCA 3IV9A 2BGKA 2LWIA 3FCYA 4Z4EA 4B6RA 2NZWA 2B2CA 2CZQA 1LBHA 1RFLA 4NC9A 1UZNA 5CVEA 4F92B 2ZWMA 3LBFA 4NZOA 2RGEA 5ALJA 3WGQA 5JDCC 1QGUA 5ULLA 4KE6A 3FGOA 3TJMA 4ZFNA 2ZDHA 4C7OB 4HX9A 1EA5A 3KT8A 3PSHA 4BEVA 2IZ0A 3PNKA 3VVMA 1CR4A 2NPOA 5J2TF 2F8LA 2WYWA 2XTZA 1OZ0A 1SXJC 2QU8A 2WF9A 2Z1DA 4N6NA 5I48A 1D4ZA 2QROA 2WHPA 4DGQA 4YMSA 3RI3A 2QI9C 3GRZA 3TRJA 4H1HA 3KV3O 4MKIA 4OBXA 5E6RA 1RADA 3LE8A 3OE5A 3MUOA 2QG9A 4DLUA 5C7IO 3LP6A 1E2HA 3W5UA 3WZLA 4EHAA 4EX6A 4ZVKA 1I0IA 2PS0A 3HMKA 4LGYA 1P1BA 1YRWA 1FDTA 4RD4A 3T0GA 3V7YA 1G21A 4YRLA 1MAAA 1EFVB 3RG2A 2PZLA 3EGDB 1SBCA 2P6UA 2UYGA 3DDNA 1FSFA 1YMUA 4KG7A 4NCNA 5EHNA 1TECE 2HA3A 5FADA 4ZZ2A 3NRJA 5IVDA 3U3XA 2PRIA 3JWHA 1DC3A 3MT7A 2ZIXA 5FTMA 4I9FA 1EBUA 3U81A 3UFBA 1LRKA 1YBHA 2Q1UA 4JA2A 3T7KA 3LKBA 4FE4A 3WGKA 4C3ZA 4ZI3A 2VWQA 4KSYA 3CZAA 4GQBA 4ND7A 4BTLA 3K31A 4Q3KA 4CM4A 1LPNA 1NBEA 2NSDA 2GXUA 2JLAA 4IRUB 2B4AA 5SY4A 1KFEB 2OT3B 2ZJBA 4PNEA 2G06A 3IBCA 3MIZA 4Q3BA 3OHPA 4E70A 2CL0X 4FT2A 3T4EA 1KJNA 4ZO8A 2VF5X 5I4CA 1DRJA 5JSHA 2C2YA 2WI8A 1KTVA 1ONSA 2XDAA 1F2TA 4DBLE 2C61A 4D44A 1JN0A 1TCVA 2IYLD 5LMUB 3RHZA 4OQLA 3AYXB 8ADHA 4OU5A 1N78A 3FHTA 3UWDA 3M1AA 3V3TA 1JFVA 4I4TA 1U1GA 2G9RA 1OYVA 3AY6A 5D5HA 4AXBA 2J45A 4ZVUA 2BKLA 3KU1A 4TROA 2QQ0A 4NABA 2FRDC 1PFKA 3PR2B 3KHSA 3RHFA 4CEIA 2YRFA 5J4LA 3ZHBA 1GPBA 4JLMA 4D9HA 1GDDA 1I36A 3INYA 1T1IA 2RMKA 1T4CA 4OQPA 1SU8A 1DTSA 1L4KA 1TC1A 1JPVA 2Y1XA 2YYAA 3AUFA 2WWIA 3GWGA 1SEVA 1S8OA 2CKDA 3LY8A 5G0WA 1OBFO 2RHTA 1XU4A 1NMZA 3L92A 2BGJA 2WG1A 4TSFA 1IC6A 2RH9B 2BZ0A 3TQFA 3PP8A 1HFEL 2ZITA 1CZHA 3GPIA 3OE4A 5HA5A 3TMAA 4E2XA 1XN4A 5G41A 4F7WA 1NQAO 3FOZA 3EAQA 2GBCA 1AZLA 4ZQIA 1G3IA 2FG7C 4NTZA 4PGMA 1YE5A 3IKLA 1U2TA 1QG0A 3A1VA 3HR7A 4IG9A 1K6XA 5EVCA 5JCOC 1BYUA 1ZVQA 4JJGA 1USIA 3R0XA 1P4SA 1JU4A 1MNQA 2R6HA 4Y2SA 3S2EA 3HK2A 1FZTA 4M88A 4B3RB 1MIHA 1US8A 3F6BX 2DR0A 3FHCB 5E1DA 4BWVA 3F4KA 3P20A 5A3VA 3R76A 1A77A 4IO0A 5ALKA 4L9AA 2AG1A 1XA4A 1YULA 4Q1EA 5CLLA 1XNGA 2AZXA 1H6AA 2VXBA 4C7KA 5B1HA 4F45A 3PX2A 5KWIA 2X2EA 2X40A 5A62A 2VBGA 1Z82A 3JVIA 3ESBA 1XE3A 2ZR9A 3DV0B 1QZXA 1E2GA 4KPFC 3VU0A 3CKKA 3G2QA 4AZTA 5CFOA 2ZCUA 3DEKA 3GLHB 1QU2A 4MDFA 1WKBA 5H0IA 3FKSD 4YJ2F 2JKVA 2PBLA 4G24A 4MR8B 4OI0A 2CFCA 2J08A 5CCXA 5JWOA 3NHKA 3PHCA 5EP2A 2QN1A 1CPYA 2BFMA 1I4OA 3HWRA 1YD7A 2CHEA 2I99A 3GLKA 2YWHA 4MB2A 2BFNA 1QB8A 3UM9A 1XCBA 3IEKA 3G23A 5EZYA 3ZZTA 1Z16A 2E7ZA 1EM6A 2FW1A 1L8OA 5LB4A 4YMHA 2BFOA 4Q3DA 2IHVA 4LYDA 4K46A 5ECWA 4EY8A 2O1WA 4G84A 2K7FA 4IVRA 4ZAWA 3RARA 3WV5A 3HWSA 1YJ8A 4RXUA 2RAFA 4KK3A 1C3VA 1BXRA 1FSZA 4D80A 2PJDA 1Y82A 4BWFB 3IUSA 3DPSA 4L8VA 4LQCA 4TLBA 1BEUB 4WCFA 5DOZA 5SY9A 2PRKA 2Y6UA 4BY9E 1G8AA 5P21A 1H3FA 5DI3A 3UAOA 2O1EA 2R8YA 3C45A 1Y9EA 2V5VA 4MITA 2NSYA 4RIGA 4ZD6A 1OW3B 3BHJA 1W4BA 1XRJA 2H6EA 1H6BA 2X4DA 3SHVA 3VC1A 5TPZA 3JQ7B 4LYAA 1BVYF 2PL5A 1V1RB 1XQ9A 2V7TA 2SKCA 3HNRA 3NH6A 4J4TA 4JBLA 5ALWA 1TVMA 2OP1A 4CCYB 3R8XA 3DHYA 1N2XA 2WWRA 3T9CA 1L5HB 3A6LA 3TSZA 2I2CA 5L3RA 3PNYA 4YJ3F 4RULA 2C7PA 2Q9UA 4IYJA 3ZWPA 3GL9A 1VL2A 3ZW9A 1E2LA 2CMHA 3M9XA 3FWHA 1KMCA 3L40A 2B6NA 4IDEA 4L57A 3ZJYA 3WLSA 4B31A 4J91A 4F12A 1NZJA 1Y6ZA 3LG2A 1LB1B 1OBCA 3FRJA 3ET4A 1MGPA 1TJ5A 3NNDA 3OPYA 1THZA 1K4KA 2ZE6A 3KZVA 4LE0A 4Z8YA 5AKYA 4D8TA 4W5QA 5BV1A 4CGZA 5EIEA 1D2EA 1ZIOA 4X93A 1A4XA 4MRAA 2NM0A 1MO4A 2P9ZA 4X63A 4YFYA 1C1DB 1P1HA 1J0EA 1TO1E 2OCGA 5B3JC 1NM5C 1NIPA 3NJ8A 2BFPA 1W4RA 3FNFA 2J31A 1CDDA 4KQ2A 4HNUA 1OKKD 1HL7A 1XCMA 1Y0BA 2PKWA 3PNBA 2E4ZA 2Z43A 1QCZA 4JLWA 4L8WB 2G04A 3MHTA 3K0FB 4Y0VA 1G0OA 3H3FA 1QKIA 4QZVA 3FBWA 4UXIA 4XM0A 1Z5ZA 3TBFA 3U4IA 1S01A 1QWOA 3K1AA 4DTCA 1JAYA 3EMKA 5JNWA 4I5GA 3I9JA 5JBIA 3PC6A 4DQVA 2BGMA 5EIHA 5LZ4A 1K5PA 4C08A 1JBEA 3CPHA 2ZRLA 4BKQA 4S1WA 3RS2A 1IBRA 3R7BA 3T7SA 3AHCA 3W8NA 3ZWNA 2N42A 1RZRA 2EWMA 3C6BA 3DE6X 3ZNOA 2W6JD 4N82A 2ZVQX 1UC9A 1VKRA 3LWDA 3WQBA 1IOVA 1T0PA 1I0ZA 3N5CA 1HG1A 4Q7MB 3T1NA 3RAFC 5AHRA 4BMVA 3EDQA 1KZ4A 5DTQA 2GDJA 1VLZA 3AU8A 5GONA 2GCOA 3E9RA 2B92A 4PYJA 3GEDA 4E0BA 4ZHQB 5KNBH 4XQ0A 3VR4A 3WK7A 3TSCA 3VGJA 4LVOA 3WGZA 1TEXA 4FYHA 3BAZA 3KLNA 5HCNA 2XYRA 1UPTA 2QR5A 4KUHA 3EVDA 4UPEA 2BFEB 1E61A 2GM5A 3O26A 1F2UB 1RWPA 4PLZA 1ZR2A 4JI8B 4E13A 1XZPA 4ZQCB 3RU7A 1T6BY 2PKQP 4IBOA 1LS6A 2WFAA 4IFEA 3ZEAA 4C2BA 1Y8QB 1XZMA 4GS5A 1W49A 3C98A 3PKZA 5DFAA 3TDKA 3U0VA 2VIIA 1ZZGA 4TN1A 2FW7A 2GD0A 2GJ4A 1LC3A 4DG5A 4OPMA 2A59A 1GV1A 1HRKA 1Y7HA 4M60A 5T6MA 5C3MA 2H59A 5JJIA 4HZUB 3CRRA 3CUKA 3O4HA 3PDUA 2QT9A 5DYNA 1G8KA 3DKRA 3VPGA 3SYKA 1T2FA 2G0TA 2OP0A 3CF0A 2FAXA 5DO9A 3T5TA 1RKVA 4FOOA 2FWJA 4I9NA 3N2LA 4IV8A 4ND6A 4OJNA 2QTVA 1G3QA 1T3ZA 3TNDA 2X5OA 1BXGA 2A88A 1UBUS 2WJYA 3EIWA 1C0LA 3PT5A 2W00A 4JITA 3ZHUA 4BVBA 1O1YA 1QV9A 2VBCA 2YV3A 3HYTA 3DEHA 4UBKA 3U7EB 1YAHA 2CWWA 1DIHA 3MT0A 3PXCX 4XARA 3UAYA 2AFRA 3THXB 1ZFNA 3AR3A 2PTGA 3BX1A 4GLBA 1E20A 2AMLA 1E2IA 3A6FA 3BGWA 1XTPA 4MZDA 1R0CA 4RDIA 5T4EA 6YASA 3FOEC 1HNWB 3SEFA 3RUCA 3LQ2A 2ZWPA 4JQSA 2OCBA 4OGLA 5CYOA 4A9AA 4ZK2A 2Z6VA 2PEZA 5DASA 1SKQA 3SSNA 2Q3MA 1OAAA 3WDSA 1IEXA 4IVNA 4FLEA 4RF2A 3PLAE 3KYIB 2Q4BA 4DNXA 4YI5A 4IWNA 4BNDA 3E53A 1OT3A 2R5FA 2F64A 1ZXBA 3Q12A 1CQPA 3W3AA 1BTOA 5AXBA 1SKYE 4Z54A 3CYFA 1O0CA 1DQYA 4ILKA 2P67A 2AZMA 5EE0A 1Z0FA 4IOLA 5EWJB 2E4VA 4RGVA 3FLMA 3TXYA 3CUSA 4IIVA 4FYWA 3AETA 4NBVA 2YNMA 3PWKA 1IB6A 4QBKA 1QO9A 1Q1AA 4QJ5A 3UHAA 4C88A 3L5OA 3VDNB 3P0RA 4PQYA 2O14A 1N5KA 2QZ4A 3AR4A 4C4AA 1WXIA 5CDGA 3PPWA 2AEEA 5J23A 3OT4A 2HU7A 2VH2A 1TIPA 3GAFA 1BDIA 2G71A 3E5NA 4NNPA 2IYAA 2NSLA 3U0BA 4BUCA 2HBQA 2PBRA 2I87A 4RJKA 3HU3A 3PGLA 4UBJA 1YZQA 4R5HA 5BSHA 4KQ6A 4MP3A 1JA0A 1L8QA 4LSWA 3UJHA 1L4LA 3NBAA 4UTPA 2QXUA 3VOAA 2BEVA 4Q9IA 4AZWA 2O1SA 2BGIA 1BKYA 1NDUA 1ZGAA 2Q1WA 5G53C 3DL2A 3ONVA 2HXYA 3O0TA 4PPYA 2VJBA 2H0QA 2X0KA 1YOBA 4QHTA 2OBFA 4DWVA 5KNBA 1GVHA 5HKBA 1N4DA 3AYZB 2CNDA 4F72A 4MW4A 3QW2A 4BC1A 1XJ5A 2IH5A 1IDN1 3SF8B 5IJ9A 3PQDA 5KYUA 3IPLA 4KV9A 1UWVA 3KR1A 2IE0A 4BKRA 1PJCA 3T61A 1UFRA 1IY9A 3SY8A 5B6PA 1QVAA 1TZJA 2BTQA 3I30X 4V1CI 1EG7A 3AJDA 1YI1A 2AYZA 2I1VB 3F6YA 3IVMA 1YB4A 1T3SA 4FYPA 2C2HA 4H7IA 1N1MA 3OOJA 3VR3D 1FU7A 4EMBA 1S1MA 1BRMA 1DAFA 2Q3DA 2YWJA 3KU4A 3LCCA 2XLCA 4P3NA 3TOXA 3GLFA 5ESWA 4M0UA 1P72A 2QD4A 2RH4A 2AFIB 4UTRA 3H4MA 2IHTA 2FE1A 3RAEC 1XMQB 4X6LA 5CNMA 1Y5MA 2OO5C 1P2VA 2VQSA 4PAQA 3T9FA 3DEFA 2A4MA 3JD4A 2O2SA 2PTHA 2GRJA 3TZEA 5B3LA 5ALOA 1KSJA 1B2RA 2ZYHA 4QA9A 1KQFA 4TOIA 3UUWA 1V8DA 1GEEA 3K0AA 2XUQA 2A1UA 3KUCA 4KQHA 5LP6F 4L6AA 4A8TA 1V45E 2JFFA 2QPOA 3P7MA 16PKA 5ALTA 3RNOA 3ZU5A 3ZVRA 3E9YA 2QW8A 3FOWA 4PE5B 2XOKD 2DHDA 3KVOA 4PICA 3T38A 4Z0NA 4LFAB 1YZGA 3L02A 3UXEA 3VR5H 5EJ5A 2F8SA 5DH9A 1EP1B 4CLRB 4CEHB 3TZQA 3PVZA 4KWHA 4GDFA 3T3GA 3VKUA 4P7KA 3MG9A 1SVUA 3AO0B 1E0SA 5CLHA 5C1OA 4B3GA 2H2FA 4F6RB 4Y6LA 4EVIA 5JNVA 2YR0A 2QTHA 2QX9A 4PQGA 1UP6A 4BV3A 3LFHA 2NT3A 2OORA 2YZ2A 3BREA 3CBQA 3D8TA 1AK1A 1U7PA 3K5PA 4P83A 1M6WA 4S24A 4CN9A 5H8WA 1PE0A 4QYSA 1G4AE 5M04A 5JNSA 3EULA 4MRNA 1C4WA 1JUDA 5I9BA 3GP3A 3C85A 1OROA 5GIOE 3BXEA 3ZTWA 2Z2ZA 1BXKA 3R24A 1KU0A 4OQDA 1DC4A 4PNZA 3P4UA 1K8YB 4J9UE 4M8SA 1JKJB 4Z9AA 5LDGA 1UBTS 5DT2A 4CGYA 4FHDA 2G9UA 1SPBS 1YRQA 2Q9BA 1Z5NA 1B8PA 3ONEA 4FDAA 4IKPA 3VNSA 5F7ZA 4DSOA 2IYNA 1NKVA 1VL6A 2IV2X 1CV2A 3O38A 2I2FA 2OBBA 2JIMA 2F9FA 2OHOA 3AR5A 1HK7A 3EUWA 4XCQA 4WMLA 4ZVNA 4ZMRA 2DHRA 3EVAA 2R1TA 4R2JA 4WWHA 5F2OA 3F9IA 1NVUQ 2IHKA 2IYXA 4U8HA 5EPUA 3QFRA 3P2IA 4HLQB 4BFCA 3ZNPA 1YA4A 3N2IA 4YCAA 1BMFA 1ONBA 3HR8A 2IQ5A 4BFVA 2P9HA 1LV7A 3B70A 1MH9A 1W5FA 2VLIA 3OLXA 3LH5A 3LSYA 4HUQA 4Y3UA 3D3QA 1KH2A 1S3FA 3R6DA 4TTPA 2GPTA 2XRFA 5A9SA 1JX6A 3PYLA 1TTTA 3IVRA 1U7TA 5I7RA 1D03A 1H1LA 1U5BB 2AXNA 1UPAA 5C5EA 3ZVKA 2BAGA 2GYYA 1P45A 3CH4B 3R9XB 2C03A 1NXXA 1E4EB 3B6IA 3H75A 4IZ6A 4UU8A 3IULA 4JGIA 1M5RA 2P9JA 2ZSHA 3TLKA 2R85A 4RAQA 1AVTA 3HA7A 3DZGA 3LUJA 4Q1AA 3WRXC 1ORHA 1E5TA 4NPAA 1RJFA 1UDBA 4EIWA 4H7EA 2R00C 3NOQA 4HAXA 1XU7A 3H83A 1E4YA 3OZEA 1WCXA 3BHNA 1UJCA 3CKLA 4IJVA 2OHIA 4Q24A 3SU8A 1VSQA 1BX1A 4JCCA 2F9LA 3GLSA 5BSRA 1T6YA 3K9NA 3ANXA 4LXQA 3HV0A 2RJNA 5IBRA 4N54A 4ZARA 1F5SA 1HTWA 1NXSA 5FBQB 3KQTA 1SBNE 2MHCA 4OREX 1VA4A 4GXQA 4HPXB 3HXTA 1F6DA 2R8ZA 1S02A 2NU6A 5JAZA 5EIFA 2R1UA 1VZ3A 5EZYF 3WR5A 3TDNA 3WG9A 1W46A 1QMGA 2XTAA 3B36A 1Z83A 4C7BA 1WPGA 1P6UA 1FUUA 1A2BA 5JECA 5JS6A 4OGGA 1ZGZA 4FM9A 1RC8A 2AWNA 4D4JA 3VMMA 1OVMA 1BE8A 1GTVA 4JT8A 4J0CA 4UUAA 4BMXA 1C8LA 1KSHA 1G2OA 2I8LA 4L73A 4QASA 2FN9A 3FD8A 4EPXA 2VCHA 1I3LA 2XOEA 3F6RA 4RW0A 4M38A 4E31A 1QV6A 3B1YA 4IHAA 4AS1A 1EK2A 5EJ9A 5EUCA 4DMLA 2X5JO 5J3JA 4JL8A 5E1OA 3WZ2A 3E8XA 2H2GA 4BNVA 5BUZA 3C6QA 2L2QA 2QSZA 1EE9A 1FX0B 1WLSA 5DM0A 3D8BA 1CUGA 1O97C 3V2GA 5C37A 2O3SA 1QOZA 4M9SA 1TUEA 1L7MA 2QPTA 3IHKA 1XRPA 3MN1A 3GD7A 2DAPA 1TT7A 3ORRA 3OTHA 3V33A 4O1IA 2I6TA 3C5HA 4MPTA 1XZDA 3C3DA 5GMOA 1E98A 2GTPA 2GLUA 3EPLA 2ATIA 1STOA 3LXXA 4ZYYA 2QM7A 1K4MA 2AG8A 2CB0A 3K0HA 2JHGA 1AM4D 1ABEA 1DXQA 2HLNA 3LFUA 3HKEB 1U9JA 3UPUA 4ZVLA 4P38A 2V74B 4C6TB 1CB7A 4L0QA 4RLSA 4Y67A 4Z9BA 3L8GA 1XXHA 2NLOA 4YJDA 3C14C 3WBBA 2D13A 2DKOA 2RIRA 2B5VA 3KLBA 5BYKA 4BV9A 4DQXA 1JF8A 2ADOA 4OQMA 3JQGA 3IKMB 3NXSA 1ICIA 1Q19A 2H7YA 2QSUA 4JSRA 3VNRA 3E4DA 4N3NA 3ZYCA 2XOXA 1UEJA 1L5KA 3AF2A 2ZWVA 3EEYA 1C0PA 2FFHA 2EEZA 2MSKA 3MXOA 4X5OA 1Q1QA 5AKXA 4BUJA 4GEKA 2H4JA 1HFKA 1JQ5A 2NOAA 2NO6A 3E3NA 4U2EA 4ZYWA 2JBAA 4BGEA 1I80A 5BMOA 2VNJA 4EKNB 1U9IC 1TIBA 3AR9A 4NCIA 1N5OX 1T9GS 2QMYA 4C0SA 1V5GA 2OQRA 5K0NA 3ZW8A 3IV6A 1R9GA 1A7JA 1VPVA 1WCIA 2PL9A 3SQNA 4MLPA 4DKJA 2QI9F 5AJZA 1IWBB 3HV2A 2P7IA 3CH6A 2DPHA 3INNA 1FP6A 1KPIA 2OO5A 4FB4A 1KC1A 3QLUA 3H18A 1E2UA 1U4NA 3N8DA 1A96A 4GOLD 4UHFA 1DUSA 3OC0A 3ICVA 3MELA 3THOA 3H1PA 2FXVA 4TYYA 1XTKA 1EB9A 1RFGE 3FYHA 1NYQA 4F6CA 1R6UA 3DLAA 4QPNA 5FFFA 2ZT5A 5GIPE 4XQCA 5DLYA 1ZPDA 4OQNA 2G9NA 4E07A 2KSQA 3D4NA 3EVCA 1XMSA 3B9QA 3H9BA 3KVNA 4GKVA 4KGDA 4P3OA 4G0XA 2ZRBA 3WLHA 1Q0RA 4M9XA 1OX5A 3HKDA 3SHTA 4DILA 1L4BA 4UTVA 1ADYA 4I66A 3IX7A 2GNPA 1B16A 2B9VA 2Q27A 4RJLA 1C1HA 3A2LA 2PBZA 3F3MA 2I6SA 2OUKA 2VWGA 1L5FA 4BO9A 3HXLA 4L95C 1JHZA 3CNQS 4K6KA 3UJPA 2WAMA 4QATA 1PR6A 3BJMA 2DHCA 2Q5LA 1T5LA 4WDQA 2C9BA 2X3UA 1VHLA 2Q2QA 1I7NA 1PNTA 2F3SA 1VRWA 2OC9A 3GAZA 3QKSA 2YUTA 3T52A 3ND9A 3VI3B 4KPUB 3VKFA 1DARA 1D0VA 2H5JA 5AQ1A 1FBNA 1Q7EA 4KXFB 4CQMA 2WUEA 3NLLA 4AUKA 2B35A 1GZHB 6Q21A 1G3MA 3H8VA 3VR6H 5LCXA 1RJ9A 1QO0D 5EIBD 5DCLA 4YRNA 3NT5A 5CXUA 4K6MA 4BKUA 5IEBA 4IFBA 3CUEF 2UVQA 2X9LA 1DKPA 1WOMA 1O9GA 2OQIA 5FUVA 4EUFA 4ZCIA 1DJMA 1FYWA 1PJRA 4WA7A 3B51X 3LPDA 5F12A 3O1LA 3ME5A 5J47A 5LD2B 3QXSA 4YASA 1A7UA 4BVEA 5SZIA 3KSBC 3BYZA 2Q3CA 1U9IA 1ZXXA 3IKVA 3I2HA 3IHTA 3ZIUA 1V7QA 1Y6RA 4TWAA 1X9GA 3OQOA 2UUPA 5A3SA 4UJ5A 2JRLA 1B14A 2PPLA 4Q1VA 3AIMA 3ZY6A 1EBFA 2HBRA 1RXUA 1V8OA 4KREA 4ERXA 5HZHA 4D5EA 2DBRA 1G41A 2C7GA 3OMLA 1MRZA 1T2AA 4JVLA 1GRVA 1SCAA 5B1EA 4NQZA 7ADHA 3G5AA 1TEVA 4WESA 2P3OA 2CL6X 4M87A 3T3PB 4RGBA 3I0NA 1P7CA 3L77A 2D54A 1YZVA 1L5NA