4GWGA

Crystal structure analysis of 6-phosphogluconate dehydrogenase apo-form
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
469
structure length
467
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Phosphoglycerate mutase 1 coordinates glycolysis and biosynthesis to promote tumor growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 188
structure length 467
sequence length 469
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4gwgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gwgA01
2J5QA 3RKUA 1PGPA 2FPGA 5I8ZA 3L07A 2QRLA 1B26A 1XR3A 1N2SA 4W4TA 3FHLA 4IIVA 1HE5A 1YH3A 3HDHA 4XX0A 2YFQA 4CMCA 5IFLA 2OP1A 5EQFA 4TMFA 4Q3AA 3UVEA 5IZCC 4PLHA 3CZMA 4Q3NA 4TRRA 1RPNA 4XYLA 5F5LA 3OEWA 4B79A 3ZW8A 1U28A 4PG4A 4WECA 1V3TA 2HJRA 4FPXA 2J8ZA 2PWZA 1PJ3A 1LDMA 3IP1A 3NTQA 4RVHA 1E7MA 5CHEA 1NQ5A 1VL0A 4PG8A 1I3NA 3NUGA 1N1GA 3ANMA 5JW6A 1PZHA 1I8TA 1PU2A 1BW9B 3HNPA 1PJQA 3OEYA 2AE2A 4PN3A 4E13A 2I5PO 1T1SA 2O3JA 3C8MA 2Q1SA 2XF8A 3ZHBA 4W99A 3ZWWA 4FS3A 2HU2A 5G0TA 1GD1O 3JQ7A 2I76A 3JYQA 3ENNA 2WD7A 1H6CA 1PS0A 2JHFA 5IF3A 4M86A 2FPPA 1T2EA 1YONA 4ZD6A 4YYZA 5JYEA 1UP6A 2ZKLA 4FFOA 4PLCA 4ZQBA 2NU9A 2PGDA 3L4BC 4R54A 2B35A 4JBGA 2V6GA 4CUKA 3PXXA 4J0FA 2X86A 4BV9A 1JTVA 1U3UA 3K31A 3WXBA 1K2WA 4IDBA 5MDHA 5U1PA 1NFFA 1N7HA 4ILKA 1T2AA 4PLVA 1MFZA 2W8ZA 2DAPA 2Z1MA 1WMBA 4NBVA 3LF2A 3WQSB 4B3IA 1PL8A 4HUJA 1J49A 3ZNPA 4A10A 4EUFA 5C37A 2EP5A 2P4QA 2EW2A 4Y6PA 1DHTA 1LDGA 2DBVO 3DDNA 3OA2A 1B2LA 1DJNA 3LLVA 2ZTMA 4QO8A 4L74A 4TROA 5JPIA 1H6AA 3ZI0A 2AQ8A 1ENYA 4GX2A 1UZMA 4JN6B 3TJRA 4NBWA 1Y8QB 4JP3A 1RM3A 3B1KA 1NTOA 2JCYA 1TB4A 3GG9A 2A92A 3PJDA 3WGZA 4WPGA 3DQPA 1PWXA 1A7AA 1UUFA 3VPFA 5COAA 1M66A 9LDBA 3RFTA 3ZV6A 2AG5A 3Q9UA 1IULA 2GR9A 3JV7A 1SB9A 3X2EA 5KJEA 4HXYA 1ENPA 1LRLA 2YUTA 3Q6IA 5DF1A 3GRKA 2AEMA 4RVDA 1GQYA 4YJFA 1Y9EA 1WDMA 2D1YA 4NBRA 4CV1A 1KYQA 3PWSA 2PY6A 4OXNA 2B5WA 1X0VA 4Z0HO 4BS9A 1LLQA 4OOFA 4IMPA 1L7EA 3AOGA 1J5PA 3NAQA 3QY9A 3VZSA 4LISA 4LMPA 4PLWA 1KEWA 4RLHA 3GH3A 1XLTA 1IL0A 3DZJA 6LDHA 1Q1NA 3HADA 1R6DA 2HDHA 4KDFA 3WGIA 3GVCA 5CPFA 1YBVA 3PWKA 3KEOA 3UH1A 5JC1A 5T6BA 3FF4A 1VPDA 1DC3A 3LU1A 1A27A 4WK6A 4RORA 2ZTUA 4UVGA 1SNYA 3GVPA 1E1KA 1CQJA 4LSWA 1P3DA 1QV7A 4IZHA 3TFQA 1YJQA 2IZ0A 2SCUA 3DZBA 4L76A 3A28A 3PLNA 1ZSYA 1AE1A 1E7SA 1UXIA 1SPXA 3NTRA 1NWCA 3BHJA 1PEDA 4GMGA 1P1KA 4CMJA 1M76A 4O59O 3KHUA 2G5CA 1XA0A 3GK3A 1DDOA 1FDSA 5AOVA 4IGFA 4EUHA 5KVSA 2RH8A 4C7KA 3L6DA 4RVGA 5KIAA 2HCTA 2VWGA 5G4KB 1LSJA 2ILTA 1AN9A 3BMNB 3QE3A 5GZ6A 3S55A 4YT2A 2YDYA 1EDOA 4Q3CA 4IJKA 3I52A 4P4GA 4W7IA 2X4GA 2X1HA 4CLRB 4PLFA 5A9SB 4YRDA 3TNLA 4NFYA 1PS9A 5TGDA 1PWZA 3GG2A 2C07A 3BMCA 3OHSX 4HFMA 3RBVA 4YQYA 1U3VA 3JQ6A 5A06A 4YJGA 2EERA 4QSMA 1D7OA 3DBRB 4FDAA 5KVVA 3DBHB 4R69A 4JCOA 3PI7A 4IIUA 9LDTA 1GY8A 3C85A 4Y67A 1JDJA 1LEHA 1D1TA 1WDLA 4KZPA 4WGGA 5B37A 1LXCA 4GAEA 1KEPA 3WBBA 4E2ZA 1Y7TA 4BKOA 1U3TA 1P0FA 1RM5A 1B3RA 3AOEA 3WWZA 2E82A 2CZCA 2CD9A 1FDVA 5BSFA 1PJLA 4D79A 2WEKA 1ZUD1 3QHAA 1C1DA 4GX0A 4I9UA 4NU6A 3LT4A 1E7QA 1X0XA 1MP0A 2X7HA 3WMXA 2RHCA 2VHVA 3INRA 3VPGA 3K96A 4RPJA 3VOSA 3WJ7A 4MVJH 2QRJA 4FC6A 5A04A 2P2SA 1FK8A 3DZGA 1C1XA 3NGLA 3ZWBA 4RLSA 4E21A 1HLPA 4K6FA 5A3JA 2VRBA 4D3DA 3COSA 4XDZA 1Q7CA 2EGGA 5DT9A 1SEPA 1ZVMA 1SC6A 1SBYA 1MGOA 1IOLA 3NT5A 5AVOA 4RZHA 4BMVA 3DTTA 3CEAA 4YACA 1T4BA 4JJIA 4BO1A 3DOCA 3VKUA 2O2SA 2EWMA 1ISJA 3LSYA 4WNCA 3W8EA 5K6AA 1RYDA 3NDIA 1ZH8A 4CQMA 4U8GA 4DTIA 3LVFO 3O8QA 1B7GO 5F5NA 5G0VA 2YHIB 4G81A 5JE8A 3IOYA 3STHA 3OH8A 1ZNQO 1E5LA 2FZWA 2D5CA 1ZZEA 3L77A 4JJFA 5DDIP 4QTZA 3E1KA 3E9QA 3TZ6A 4QO7A 1Q2XA 3OBBA 1OC2A 3D1LA 4NJMB 1ZK3A 3MTGA 2NM0A 2PFGA 3V1YA 4ND2A 1T24A 2NVUA 1DBVO 1WWKA 3MOGA 1WPQA 3ETDA 3KSZO 4HP8A 4XWYA 4GWKA 1A4UA 4XYGA 1PJTA 2Y0DA 4Y98A 3IQDB 4NJOA 4A2CA 4N5LA 3GGOA 4LCEA 5L7YA 4PZEA 4AJEA 4JNKA 4H16A 4F45A 2VWHA 4NK4A 1ZSVA 5MGBA 5DN9A 5A9RA 1R12A 4CLXA 3HB4X 3ZN2A 4CODB 1TT7A 1NR1A 1I32A 2D0IA 4M8SA 1LSUA 1FDWA 4F6LA 2Q50A 3JD1A 3EZYA 2CVOA 2JL1A 3U0BA 3AY6A 3VDQA 5EERA 3GHYA 2GASA 1UXKA 4HNHA 1FDTA 4MINA 2WTBA 1XEAA 4FD3A 1GL3A 1VM6A 2BI7A 4JROA 1XU7A 3VAZA 1GR0A 4E2YA 1EFLA 3PIIA 4FFRA 2VTEA 1NVGA 3KRTA 4YXFA 4HX5A 5HA5A 3QP9A 3EUWA 3ZWPA 1E1NA 2D8AA 3R1IA 1WZEA 2QZZA 1Q7BA 3A9WA 4N5NA 4NK5A 4HFNA 3WMWA 4BNWA 3DOJA 4BUCA 5JFOA 3VZRA 1E1MA 3HSKA 4DC1A 3U4DA 4ZQFA 2QHXA 1KY5A 1UXJA 5L7TA 2Z95A 4AJPA 3DEYX 1T1RA 3D3WA 4BNTA 5CDGA 2HUNA 1EVIA 1UP7A 2JAPA 1I30A 3WJAA 3WTCA 2AHRA 4BNNA 4PLGA 1CYDA 2X58A 1MLDA 3KO8A 3ZWYA 4N54A 3QSGA 4IM7A 3Q2KA 4BKPA 2NU7A 2X0IA 5K0ZA 3OICA 4J90A 3S8MA 1QLHA 1QG6A 3BXXA 2DQ4A 2Y1GA 4I9NA 4IDFA 4EYEA 1BXZA 4DMLA 2WWRA 1R0KA 3E5MA 3WFJA 1PZEA 1V6AA 4GX1A 2FN7A 2W90A 4PLYA 1JU9A 3DMYA 1U5AA 4Y6SA 4A7PA 2EKPA 5EJ2A 1LSOA 2CDCA 4CM4B 4KTTE 3HZZA 4YJHB 4CMBA 3L4SO 3LC1O 4TRNA 1P0CA 2BFOA 2X0NA 1SOWA 1J6UA 3HDJA 4GI2A 4L75A 4TRJA 3DZHA 5EN4A 1LTHR 3KYDB 3WSVA 3I83A 2CF6A 2BF7A 1Y1PA 5DBIA 5IXSA 5I7EA 2YQ5A 1KC3A 2VYVD 1E7RA 3E48A 1SEVA 5HRUA 2DPGA 2YV2A 3E03A 2QYSA 4QQRA 4DYDA 2B37A 1RM0A 2GRAA 3T4XA 1IPFA 1PJ4A 3H5AA 3HG7A 2BHLA 5L53A 5F1PA 2PK3A 1LBEA 1DEHA 1U7HA 3WGQA 1QYXA 1YQGA 4OSOA 1X13A 3H4VA 1KERA 3ZU5A 3UCEA 3O03A 4WEQA 3KM0A 1YS4A 2IYPA 1PTJA 3FPCA 3INTA 4DGSA 3CMMA 4LRTB 4UAGA 2GSDA 1C0IA 1O8CA 4R9SA 3A4VA 5I8WA 3H5RA 3PDJA 4O6VA 5JMWA 1VJTA 3KBOA 1P44A 3A14A 3DMTA 1Y8RB 3JQFC 4RVSA 3SLGA 4Q39A 3PFFA 4WLVA 2FY8A 2O4CA 3D3EA 1GZ3A 4NZ9A 4D45A 2OXIA 4PRKA 3CTVA 1RM4A 3W4KA 5DULA 2HAEA 3F4BA 4BNJA 1HE4A 1V0JA 3DTYA 4XJSA 2NU8A 2EP7A 3WGHA 1R66A 2JHGA 4RZIA 4HV4A 2W98A 1LRKA 4J6FA 3FN4A 4CQLB 3G79A 1K6JA 4JBIA 3AI1A 2B4RO 4ZJUA 1R4MB 1JQBA 4RPLA 1LDEA 3G49A 3I3OA 7ADHA 2PKQP 3ZWVA 1WVGA 1A72A 3QWAA 3TRIA 1AXGA 3PHIA 3WYCA 1B8VA 5CEFA 1EE2A 5GZ1A 3JQCA 2B83A 3KZVA 3RIHA 2H1SA 3KB6A 3C1OA 5L95A 3M2TA 4OJNA 2VZ8A 5ITVA 2A94A 3WNVA 1R15A 2C0CA 4XZ3A 1YKFA 3VVBA 5JDIC 4N5MA 1IHXA 2D5AA 4E2XA 3GUCA 5IN4A 4LVUA 3NT4A 2B36A 3JTMA 2IXBA 5B1YA 3L0DA 1ENOA 1ULUA 1IB6A 2FSSA 1IZ0A 2HK9A 4CMIB 4MJLA 5JY1A 5EQDA 5EINA 1QSGA 1N7GA 3WIDA 4B7UA 4KP7A 2X22A 4XR4A 4EEXA 3JQ8A 4DBZA 4IDDA 1DO8A 4Z9FA 1T2DA 1E3LA 1R4NB 4GKVA 5A02A 1ISGA 3UF0A 2CVQA 4YJDA 5HTOA 3HUDA 4EDFA 2Q45A 2UV8A 3HE3A 1O95A 4RF3A 1UR5A 3KOUA 2C59A 1ULSA 4ALKA 5T5QA 4WCDA 1CF2O 2DU8A 1ZJYA 2R2GA 4OO3A 4KWHA 4G5HA 3EC7A 3H9QA 5H81A 2H9IA 3KSUA 4R51A 3RC2A 3WIEA 4CR6A 4E5PA 2UYYA 3Q9NA 3UAGA 1G0OA 3EVTA 4MKXA 4F46A 3OIFA 4FCCA 4HFRA 1GV0A 2ZCVA 3ANLA 5AXCA 3G0OA 1HDZA 1N1EA 4ZQHA 3S2EA 1RWBA 4BGVA 2NTNA 2Y0CA 2Y1EA 4NBTA 4QT0A 2P9GA 4D41A 2PV7A 3QJ5A 4IS3A 3UHAA 3RC7A 2EKQA 3EVNA 3OP4A 3I5MA 4II2A 5F1KA 4PLPA 4RVUA 5HWSA 4OMUA 2ZYGA 3W1VA 1NVTA 1E3WA 2JD0A 4DLLA 2NWQA 3ZV4A 1HEUA 1DHRA 2HMWA 2YQ4A 3ULKA 2XXJA 3ZWMA 3KYBA 5CDTA 5KWEA 2VWQA 4OGWA 1ISHA 1ZBQA 4PGFA 1EBFA 2BLLA 3SJ7A 1AHHA 3AU9A 5AXDA 4TQGA 5BSHA 4E4YA 2AE1A 3W6UA 3GA0A 2X9VA 4RPKA 2W2LD 3Q11A 1WXDA 1I0ZA 4RF2A 2O2YA 4BL5A 5JO0A 3RUEA 4R01A 1OMOA 4D0RA 2JFHA 3W4JA 3E82A 5L45A 3Q2IA 3MWEB 1PGQA 2FHSA 3V8BA 3KXDA 3LZ6A 4XGIA 2ZQYA 1ORRA 3I6QA 2XAAA 4GPD1 1JVSA 1Z73A 5CG2A 4WJZA 3I9LA 4KQWA 4RVFA 3E9MA 2O23A 1NX6A 1X14A 3K6JA 1PQPA 3PWZA 4GGPA 4FFMA 3JQ7B 3W8FA 2PZLA 4TRMA 3HWRA 4CMEA 3WR5A 2FOIA 2I3GA 2DTDA 2OORA 1MXHA 4ITUA 1GDHA 1ZK0A 1GFSA 2HKIA 2ZB8A 1LUAA 4DA9A 3U49A 4UVDA 1VSUA 1SCUA 4RQUA 2GZ1A 4LGVA 3SXPA 5I7VA 5IZ4A 1I01A 1E77A 1V3UA 2ET6A 2PZKA 3D4NA 2V65A 4XD2A 4CUZA 3WTBA 3PRJA 2I3AA 4GLLA 1QYCA 3OJ0A 3S1LA 2PTGA 1Y5MA 3MJ4A 4G65A 3UFXA 4YVFA 4CV0A 3VVCA 2UUPA 4U6SA 3PEFA 4ND4A 3FWZA 3ZU4A 1TEHA 5IDYA 4ZU3A 1GUZA 4ONEA 4CLHA 4XRRA 3ABIA 4I5EA 5L7WA 2DC1A 2WYUA 1GYRA 3OIDA 1P74A 2F00A 2BGMA 1TVEA 4FB5A 3RCBA 1E6WA 4MVJF 1KVTA 1GPDG 1CRWG 2OP0A 3QVTA 4IJWA 3U4CA 3G17A 4LSMA 3L9WA 2X9GA 1EQUA 5TJ9A 3ZWOA 1EZ4A 5IDXA 2B4QA 3IL2A 4D7AA 3CXRA 4PLTA 2OHXA 4LK3A 4FFPA 4INAA 2NTJA 4PZCA 3ZGYA 3OJLA 4I08A 2Y1CA 3IAHA 1PJSA 3GDOA 3LT0A 5JCXA 3GGPA 2X6TA 3OA0A 1IY8A 4YWJA 4R4JA 1I3KA 1Y9AA 4YJFB 2GDZA 5TNXA 4QX6A 4CL3A 2X8LA 3NX4A 5JCJA 4IS2A 1HDYA 3FR7A 5G0UA 4J4HA 1GCUA 1UJMA 3JYLA 1YL6A 3PJFA 4GVXA 2AEFA 3OIGA 3BYZA 4A03A 4M54A 3R3JA 5DOVA 2EIHA 1KVUA 4O1MA 1JA9A 4JLWA 2VYVA 3AUTA 2AQKA 2GCGA 3CE6A 1G1AA 1Y6JA 4PCVA 2G0TA 4UREA 3ICCA 3ZU2A 3H3JA 4RL6A 3MTJA 4X54A 1NXQA 1DPGA 3O38A 3RUDA 4DPLA 2GZ2A 2D59A 2FMUA 1S6YA 4D3FA 2CNBA 2VUTA 4RF5A 2YHUA 3ZHYA 1EFKA 3AOEC 3M6IA 4BNZA 1DSSG 4QFCA 2Q46A 1MA0A 4OM8A 1TT5A 3H9JA 3RKRA 1C3VA 2EHDA 3BMOA 3WFIA 4BGIA 3AFMA 4AJOA 1H93A 3CKYA 1HDRA 4OIMA 4YT8A 3LC7O 5T57A 3TZQA 3INGA 3AI3A 2EV9A 3AJRA 2OBNA 4ALMA 3CPSA 4BO0A 5G2OA 2NUAA 3D7LA 1BDBA 4PG6A 1VI2A 4OSPA 1CIVA 1PJCA 3TL3A 4CM6A 2PD3A 2O3UA 2PD4A 1XWFA 1P31A 1VC2A 2PZMA 2PR2A 2QW8A 3LLSA 1ID1A 3AI2A 4DPKA 5FF9A 1BTOA 3HN2A 3BMCB 3G1TA 1BHSA 3ZWXA 1K89A 4D42A 2ZYDA 5TX7A 1U8XX 4YJGB 3B1JA 3UICA 2P91A 1IYZA 4BMNA 4EJ6A 1GQ2A 5K6AC 3GNQA 2ZTLA 1KBZA 2DLDA 3FBGA 1A9YA 1RJWA 5C7IO 4QFDA 4F3YA 1W8DA 4NFHA 1YQDA 4GGOA 2AMFA 1UZNA 3I23A 1PGOA 1WLYA 4R3WA 3TQHA 3B20A 1Z45A 2UVDA 1P1RA 3JQAD 1Z75A 1YB4A 3PYXA 3IUSA 4ZQGA 2P9EA 4WUVA 5BSGA 3KTDA 3QIVA 2YV1A 3S2GA 1C1DB 1I33A 2V6FA 1ADFA 1F12A 1ZO8A 2VYND 2ZK7A 5JDCA 3ZH2A 4MP3A 2VOJA 5B4TA 4BKUA 2JKVA 1V8BA 2YZ7A 4R16A 5F21A 5JAMA 1BVRA 2HK8A 4U0JA 1SZJG 1E7YA 1JN0A 4XYBA 2AQIA 1MFPA 1C1XB 1B14A 3I9JA 1WZIA 3RQSA 3E6AA 2P5UA 1PQWA 2G1UA 1JKJA 2O3SA 5KTKA 2DUWA 3KETA 1K6XA 1ZFNA 3RROA 4FGWA 3I6IA 3FWNA 2J3HA 5C5IA 2GNAA 3ONFA 3ZNNA 4KUGA 2ZIZA 5JY6A 4P8RA 4HY3A 4Z3DA 3ROPA 5H83A 3GVIA 4IDCA 3FBTA 4R1UA 4UVHA 1TI7A 2YW9A 3SEFA 4Y9DA 5A1TA 4CQMB 3D4OA 3MWDB 2QIOA 2RHRA 3EAGA 3ZDFA 1IUKA 1XYGA 2CMDA 1M67A 1NQAO 3GPIA 4ALIA 2TMGA 1ARZA 1RKXA 3K30A 3QW2A 4UVEA 1T26A 4J1SA 1S7CA 1KETA 4IQGA 4L9RA 4B4WA 1I10A 1HZJA 4BIIA 1GEGA 1TLTA 3ASVA 3CTMA 4MKRA 3HJAA 4OKNA 3OFSA 3VZPA 4B8ZA 1WMAA 4CMAA 3VH2A 2NVUB 1SAYA 2PGJA 3H6KA 4DREA 3NT2A 2Y1OA 1T2FA 3QV1A 4XGKA 2VHYA 3AU8A 1NPYA 1F8GA 3DBLA 4CJXA 3JSAA 4FN4A 1YVEI 4PLZA 3O9ZA 1OC4A 2VNSA 3GOHA 2QQ5A 3FNEA 1LC3A 3V5NA 2NLOA 1AHIA 5T8KC 4H7PA 3FR8A 1E3SA 2Y68A 3PJGA 4GL4A 1YOVA 4CV2A 5IJZA 1Z7BA 4XQ9A 3PZBA 1GV1A 2W2LA 4BNIA 1FMCA 3G1UA 4A27A 3GZNB 5G4KA 4DIOA 1MC4A 4UUMA 1WDKA 1LDBA 1OFGA 3GEDA 2DVMA 3D0OA 3JQ9A 2W2KA 4J2OA 3RAJA 5JYDA 1I3LA 3PQDA 3ZWCA 1OOEA 2A9FA 1Q7GA 2JD2A 3EDMA 4YTEA 1WNTA 2VRCD 3WDSA 3WSWA 3PHGA 1VKOA 4CM5A 1ZXBA 2D2IA 8ADHA 3CSDA 4HNGA 4OOEA 3T7CA 1O89A 2HRZA 3BHIA 3UN1A 2CVZA 5ENDA 2F1KA 3DBRA 3WYEA 1VL6A 1XIVA 2ZATA 1SOVA 4BHTA 3O26A 4Q3EA 1PJBA 3D3WB 2JCVA 1D4FA 2DFVA 2NSDA 1KIFA 2QX7A 3SC4A 4E5KA 4YB8A 1GZ6A 1H0KA 3E5RA 1F8FA 3ETEA 1HDOA 2YY7A 5L40A 2B0JA 2Q2VA 1NNUA 3AM3A 4UEOA 3FNGA 4AJJA 1PGNA 5A3VA 3ZWAA 4I8XA 1ISMA 4QXMA 1JAYA 1XGKA 3BMQB 1U2GA 3WGGA 3C7AA 1PL6A 4E6PA 1DC4A 4IZIA 3DFUA 6ADHA 3DMTC 5IAAA 2LDBA 3DHYA 1EE9A 2ZCUA 5TQVA 1XSEA 3BTVA 4DQUA 4D0SA 5IXYA 2BKAA 3DB2A 4O0LA 3IKVA 4CLOB 1M6HA 4H15A 2BELA 4NPCA 2E37A 3A1NA 1PQUA 4DPMA 5J23A 3PHHA 3ASUA 4TKLA 3H2ZA 4BNFA 4M1QA 1VL8A 1P45A 1JKIA 1DB3A 3BTOA 3ZU3A 2UDPA 3VH1A 1HSOA 4DXHA 2O3TA 4ZHSA 7MDHA 5ICMA 1MG0A 1UXHA 3AUUA 2DPHA 1U5CA 3H3FA 3H9UA 1F17A 4OQZA 4YRBA 2CF5A 3U4IA 4WASA 3M1LA 4R5HA 4OL9A 4DUPA 4XQEA 3JD4A 3WOHA 3F5QA 4CMGA 4D43A 1EDZA 3KLMX 4KMSA 2E49A 2RAFA 2YHIA 4RF4A 3IJPA 4ZN6A 5EESA 1IPEA 4TVBA 1QYWA 3TN7A 5AQ1A 2X0JA 2C54A 2ZJ0A 4FQ8A 5JBIA 2EW8A 3WGYA 4KTVE 1RYEA 5L3ZA 4IINA 3AK4A 4OXKA 5DBGA 1O0SA 1PL7A 2I65A 2AQHA 1FXSA 2B69A 5I9MA 5T8KA 1C14A 2VQ3A 3QWIA 3U9LA 3WWYA 1LLUA 3ADOA 1G6KA 3F5SA 3SJUA 1BXGA 2GZ3A 4EI2A 1XELA 3D4PA 1GAEO 2ZB4A 2Q1UA 1GYQA 3EZLA 3RUHA 2VHZA 4U7WA 5JCJD 3RD5A 4AJ4A 1F0YA 3GPDG 1OZAA 3GEGA 4DLAA 4FSHA 1I2BA 1CEQA 3JQBA 1NBOA 4G2NA 4J16A 3S2FA 4WOKA 2G76A 4CR7A 4FJ0A 1NFRA 1VKNA 3X2FA 2RBEA 4MO2A 5FWNA 1EUZA 4JXKA 5HM8A 3RC9A 2D4AA 1BG6A 4BO9A 5KJCA 2I99A 2R00A 1FF9A 3D64A 4ZVVA 2IZZA 4IY1A 4FJ2A 2IXAA 4JQCA 1DIRA 3B70A 1HT0A 3IS3A 5FI3A 1ADCA 1P1FA 1IHYA 1V35A 2FR0A 1M6WA 5BNTA 3GN2A 3GN1A 3RUAA 1ZMTA 3B6ZA 4DMMA 4TZKA 1VJ0A 4LW8A 5KVQA 2A35A 2HJSA 2XOXA 4RV9A 3UCFA 4B8WA 1UAGA 2NNLD 4EGFA 5T67A 4DVJA 1VRWA 4J9VA 1I36A 4BQPA 2YYYA 4YT5A 4XJTA 3TDKA 4MOWA 2WMDA 1A7KA 4AJLA 4L8VA 4IQ0A 3PK0A 1K0UA 1X7HA 1P33A 5COQA 4CM9D 1JW9B 4ZQEA 3SBOA 1X1TA 1X1EA 2W4QA 3QVXA 1NHWA 1E0DA 4DQXA 2OZPA 2NU6A 4FR5A 2WE7A 5BQFA 1HTBA 3NJ8A 3OJEA 1BVUA 5TT1A 2X9NA 1EUDA 3QWFA 1YGYA 5ILGA 1W6UA 4NG5A 5JNLA 1R16A 4Z9XA 3JQAA 2FP4A 4A5OA 1NM5A 3NKLA 3LK7A 4ID9A 2X0RA 3T4EA 1JWBB 4MP6A 2DBQA 3SX2A 3Q3CA 1K3TA 4YJHA 4EBFA 3H9EO 5EL0A 1UH5A 4IBOA 2VYNA 3ORFA 1YBMA 5CEJA 2LDXA 3RSHA 2DUUA 3EGOA 2FR8A 4I5DA 2CDAA 3U3XA 3RBZA 1B8PA 5LCXA 1PGJA 3VPXA 1JAXA 4MKZA 1HDCA 4BO4A 3PQEA 4BKRA 1C0PA 4DRYA 1BSVA 1KEUA 3PYLA 4EITA 1NR7A 5KKCA 4BNHA 4IJVA 2O50A 3FI9A 4CMEC 2O3QA 3I4CA 4NQZA 4WLEA 4BO6A 1ZXLA 1ADGA 3TPCA 2C7VA 1E3WB 1UAYA 5I7FA 2HRBA 3LYLA 2B4TO 3HB5X 1ML3A 4BQRA 1ONNA 4J2HA 3DFZA 2BFPA 5BSEA 2BGLA 3RASA 3I9OA 1YBAA 3AUSA 3EYWA 4URFA 3UW3A 2E48A 1XQ6A 1H9AA 3LC2O 1ZK2A 4AJIA 1CERA 4CM8A 4EZBA 4ND3A 2EF1A 1KEVA 2Y93A 4I5GA 1O5IA 4XKJA 2OOSA 2C2XA 2RCYA 5DCWA 3GEMA 4DLBA 2EXXA 4GVLA 2C7GA 4FBGA 1ZK4A 2UUOA 3PDUA 1LQTA 1EUCA 2IE0A 4AVYA 3AWDA 2C82A 3ZHXA 4JP2A 1DIBA 1X7DA 2G82A 5F3RA 3U09A 5CDSA 2H5LA 4KDEA 3GMSA 4L73A 3QVOA 4J43A 1BMDA 1R0SA 2OGUA 1M75A 3M2PA 3RJ9A 3K2BA 3R6DA 3RUIA 4A0SA 1XHLA 2UAGA 1D1SA 3KYCB 1U3WA 4J9UE 2D3TA 4NR0A 4PG5A 1T4DA 5JXWA 1CQIA 4DBVO 1E3IA 3WB9A 3C7CB 1O9BA 2V6MA 4NBUA 5JO9A 4CPDA 1UDCA 4W6ZA 4PFJA 3VDRA 1DIAA 4ALLA 5TLSA 4AJHA 1ENZA 1ZW1A 2VZ0A 3DAGA 4GSLA 3LF1A 3DC2A 4IDGA 3TZKA 2X5OA 3ON5A 1TA4A 2Q1WA 4PG7A 3LT2A 3GC6A 1E92A 4CMIA 4AJKA 2VRCA 4J91A 5DCUA 1EK6A 4AL4A 4NI5A 4YCAA 1H94A 5U9CA 2NACA 1UDBA 3FSRA 4IMRA 3W4IA 5BR7A 2O3RA 5G0WA 5I7SA 3GUYA 4KOAA 3UXYA 4J1NA 2I67A 3WG9A 3GFGA 3JQGA 5KOIA 3IIEA 1DLIA 4XIYA 4E5YA 2JFGA 2WYVA 1P1HA 1CJCA 2WD8A 1A5ZA 4KUHA 5THKA 5DP2A 3AM4A 1HETA 2HQ1A 3K2EA 4CM3A 4R1TA 4GBJA 1NVMB 3GT0A 3ZV5A 4R68A 2WJPA 2C20A 3JD0A 3GHHA 1H6BA 2YJZA 3JCZA 4B3HA 2WD7B 5AXBA 1NPDA 1ZEJA 1PZGA 2VWPA 5K9ZA 3WQRA 3BTUA 3IUPA 1IZ9A 5L51A 1XCBA 2FZEA 4DQVA 4Y8VA 4J4BA 2C5AA 2ZQZA 2Q3EA 5A05A 4E30A 1DFHA 1DXYA 4CLDA 3GR6A 2Z5LA 2HMSA 1Z82A 3EY4A 4W9NA 3QVWA 3C1AA 4YAKA 4JK3A 3V1UA 2BRUA 1QKIA 1QV6A 3FD8A 4IXTA 2GLXA 4JBHA 2V7PA 1PS8A 1T25A 2X5KO 3BA1A 1LNQA 1MG5A 1A71A 3D5TA 3H65A 4DC0A 5IDWA 2X23A 4JGBA 1KY4A 3IMFA 1MXFA 1EVYA 4EJMA 1XQ1A 2HMVA 3H5NA 3QLJA 3VTZA 4A26A 5IG2A 3OECA 4K9DA 1AXEA 4WOJA 2P9CA 5TSDA 4BNMA 3IDSA 2QYTA 4WCFA 3TOXA 1XKQA 3JQEA 3C7DB 4Q3DA 5H82A 4L4RA 4YBZA 5COBA 3NGXA 1NPTO 3QWBA 4FOSA 4A73A 1H2BA 1LLDA 3U62A 3DBVO 5TC4A 2I66A 4OKIA 3JYOA 4GMFA 4AJ2A 1EEHA 4K28A 3UOGA 2O7QA 4HKTA 4XA8A 1MV8A 1Q0LA 1BXKA 3I9MA 1ADBA 3OQBA 4WLNA 2GN6A 2CSUA 1KOLA 3HFSA 2OFPA 4BNUA 4N7RA 4NNJA 2O7SA 3ROMA 4RDIA 4GQAA 3ZHZA 1GZ4A 1TT5B 3MCVA 4E3ZA 5BT9A 1CWUA 3BMOB 2TMDA 5CP8A 4WE3A 1XG5A 1EVJA 5JDCC 3RI3A 3NTOA 3CIFA 1EVZA 4GX5A 3QA9A 1CDOA 3FPLA 3RFXA 4YAEA 4CL8A 2Z1NA 1ZJZA 2HSDA 4Z9YA 4MIOA 1N9GA 1HLDA 4DYVA 3W6ZA 4I5FA 4J3FA 5JMPA 4DWVA 3OJOA 5KJFA 4GH5A 4H3VA 3PIDA 5BNFA 3C24A 3MJEA 4XGNA 3V2UA 4RO0A 1DAOA 3K9QO 3HDQA 4E5MA 2JAHA 3GFBA 2X5JO 4XEHA 3JYNA 5KKAA 3VTFA 2QRKA 3UUWA 2YV3A 5HS4A 3RUCA 5FEUA 4XB2A 2BGKA 5DZSA 4WNIA 5C7OO 5TIIA 1FJHA 3DAPA 5BNIA 2OO5A 3WLFA 3FCOA 1N8KA 1DFGA 2C5EA 4FOOA 5DP1A 1YE3A 1GUFA 5JAZA 5L4LA 4EUEA 1LA2A 4K26A 1MC5A 2Y1DA 2V6BA 1WW8A 1E5QA 5JAIA 5ENVA 1K6IA 4IUYA 4YAJA 1EMDA 4OYRA 4P22A 4EW6A 4MIEA 3OQ1A 3DHNA 3RVDA 4IPTA 5CDUA 2HMTA 4OXYA 2VT2A 1NP3A 5TJHA 2EGHA 1BW9A 2VHWA 4XQCA 5CG1A 3PLRA 4NFSA 1P77A 2I9PA 3DXFA 3ONEA 4BO8A 3ST7A 2PKRA 3PHLA 1ZIDA 3EMKA 1B0AA 1NAIA 3ENKA 4BNYA 4BV8A 2AW5A 2VZ9A 5EIOA 4CM9A 4B4UA 1Q0QA 4RPGA 2IDZA 2GF2A 2G17A 4GWGA 1W0CA 5A5EA 3ZWNA 4WLOA 5I9NA 3IP3A 4KUEA 3NDJA 4L4XA 1D8AA 2ZB7A 1DC5A 3OF2A 1QYDA 3H2SA 4J49A 4YDRA 2HMUA 4MVJE 4FIZA 1HF3A 3FNHA 3P2YA 4NDNE 2GPTA 2PH3A 2XPCA 4Q9NA 3ZCXA 4E0BA 4CMHA 3TFOA 4KWIA 2WYWA 3L9XA 3JQ9C 2PA3A 5U4QA 4BB6A 4U0KA 4WKGA 2PGLA 1CETA 3TOZA 5HS6A 4I1IA 5IZCA 5FI5A 1W4ZA 2EG9A 5KJ1A 5I9LA 1C0LA 1I5RA 3I1JA 1MX3A 2WM3A 1H5QA 1SO8A 3AY7A 3FTNA 3PGJA 3PTZA 1DFIA 4ESOA 1Y81A 5LDHA 4M49A 3AUAA 5JS6A 1DAPA 1YRLA 1QLJA 5TT0A 2POQX 1W73A 2P5YA 1QP8A 3MJTA 3PP8A 2IZ1A 1EBUA 3T7EA 1E7WA 1HDGO 1Y8QA 3R3SA 4LVCA 2HK7A 1E3EA 3ZV3A 2J3IA 4C4OA 5TF4A 1NYTA 4ZRMA 4OAQA 3VKVA 1AUPA 3HHPA 3DBLB 2IYOA 3UKOA 3L6OO 1E6UA 1YJ8A 3EK2A 4I9HA 3TSCA 1EK5A 2ZTVA 3P7MA 1ISFA 4ALNA 1VSVA 4RJTA 1ZK1A 4BOYA 3WS7A 3L4BA 5JAQA 1L1FA 4B4OA 3F9IA 1H6DA 5DBFA 3IJRA 4Q3BA 3V1TC 1YOVB 4DIFA 3KEQA 1GADO 2BI8A 3OQ6A 3S2IA 1YO6A 2W2KB 4XRGA 3KLPX 2C2YA 2PH5A 3O8QB 1KVQA 4J0EA 2Q1TA 1YXMA 1YL5A 2CDBA 1YL7A 1XU9A 3ROQA 5KVCA 5THQA 4RDHA 3GRPA 3Q1LA 1SB8A 5L4NA 3K8ZA 1GPJA 4CLEA 2GERA 5EPOA 5CPBA 4YT4A 4ALJA 3HFGA 3F3SA 4CUJA 4YA6A 1BWSA 2EKLA 5TS3A 1K5HA 1UZLA 4IGEA 4QECA 3P5SA 1LQUA 4E12A 4E5NA 2GD1O 1E1LA 3AM5A 3KSDO 4AG3A 4AJ1A 3DO5A 3GGGA 2Y05A 2RIRA 4BO7A 1OI7A 2DTXA 2FRDA 2GGSA 4ND1A 1PR3A 3HDYA 4BNLA 3ZNQA 2PLAA 5JSFA 3DAFA 2AG8A 3PYMA 1O94A 3PFWO 1H2HA 3KUXA 4TZTA 1GUYA 4J1TA 4U6QA 3W8DA 4MP8A 3DL2A 1FDUA 3BAZA 4HWKA 4ZGWA 5A5FA 1N5DA 1ZSNA 2NADA 3OJFA 4QEDA 1MB4A 3OETA 4YQZA 5IDQA 4R5MA 3BMNA 4J7UA 4BVAA 4D44A 2E4AA 3GAZA 3F4LA 2E6UX 3WICA 3EW7A 4CLRA 1HYEA 1SMKA 5A9SA 2DTEA 2P68A 3DONA 4O63O 4XQGA 4YEDA 1HL3A 3VH4A 4BO2A 4D46A 3GAFA 3JQBC 3G3EA 5IN5A 3GVHA 3NJ4A 3IKTA 3UGKA 3CMCO 3DZIA 5GY7A 3ROKA 3MOIA 4FW8A 4P38A 3DBHA 2JJYA 4WLFA 3GDGA 1ZKMA 2OUIA 3ITKA 5KNLA 1U4OA 5C3MA 1P1JA 3SLKA 2R00C 2WSBA 4GKBA 3OSUA 4UEJA 4R41A 4QUKA 2CUKA 3NEPX 4BO3A 2JCXA 5A4DA 1HWYA 5LC1A 2EEZA 5T64A 1VJ1A 4BNGA 4NHEA 5TRTA 4IJUA 1HE2A 1C0KA 3MJVA 4WLUA 4BO5A 4UUOA 4BNKA 1X7GA 2IEBA 3I4FA 1B8UA 4HADA 4BNXA 3GQVA 1BXGB 2CY0A 4C7JA 4MVJD 4LCJA 4PIVA 1DLJA 4M89A 1LJ8A 1QXSA 4IQ8A 4P4NA 3NYWA 1KVRA 2QZ9A 1U1IA 3CZRA 2GO1A 3ADPA 1H9BA 2CFCA 3DR3A 5DOZA 1OAAA 4K6CA 1VE9A 3E18A 3GMDA 1UP4A 2DBZA 1N92A 2DT5A 2O48X 2VOEA 1DOHA 1U7TA 1ZCJA 2Q99A 4NU5A 3V2HA 1Z7EA 1DC6A 3GZNA 3DOOA 1D3AA 1HYGA 1LX6A 4CR8A 2FSVA 3DWFA 4E32A 4BMSA 4JJGA 2IEDA 4MVJP 1NFQA 4L4SA 2J6IA 1P9LA 2GYYA 5B4UA 1L7DA 4PZDA 5EMHA 1GYPA 5KCZA 3MJSA 2GN9A 3PPIA 4U5QA 4NJMA 4MVJM 3N7UA 4BB5A 1GCOA 1HZZA 3F46A 3C3XA 3A06A 4GSKA 2JFFA 5CEEA 4R3NA 1DIGA 3RJ5A 1I3MA 1U4SA 1WAMA 3DHEA 4MDHA 4YPOA 3QVSA 3U4HA 1P1IA 2OBYA 4PRLA 3K5PA 3R0IA 4IDAA 2VUSA 1U2DA 2J5KA 3GDFA 5C7LO 3FTPA 4J4TA 1MUUA 1E3JA 2FR1A 3ITDA 3LQFA 3PZRA 1QMGA 3VPHA 3L6EA 3GZ4A 3TWOA 4D3SA 2DBRA 3FRJA 2J3JA 1YDEA 1LU9A 1LI4A 1G0NA 1HE3A 3BMQA 3H9GA 1J0XO 1XDWA 3WX0A 5L9AA 4NH4A 3WQQA 3FNFA 3WLEA 4R9RA 3RBXA 1BDMA 1ONPA 3DZFA 3O4RA 2FPIA 5DCYA 1R0LA 5JLAA 2GUGA 2Y99A 2BD0A 1DIHA 4YAGA 3CH6A 3JQAB 1QORA 1LLCA 4CLOA 1KS9A 2VCYA 3ONDA 4ROSA 1QRRA 3HN7A 3RFVA 3AFNA 3RU9A 5G4LA 2C29D 4B7CA 3JQDA 3NDRA 3H7AA 3GNTA 3I9NA 4J7XA 3BHMA 4K1LA 3ETGA 3F47A 3C1TA 3QRWA 4N18A 3TF5A 3VHRA 2VN8A 2IODA 1YB1A 3GY0A 3Q0EA 4EEZA 3TL2A 5CFZA 3ZZNA 5ES3A 3RC1A 1ZMOA 4J1QA 4XCVA 2HO5A 2P4HX 5GZ3A 1M2WA 2XXBA 1LSSA 1V3VA 3CINA 4PVDA 4XDYA 4J7CA 3JQ8B 1HXHA 1IE3A 3DZKA 3V2GA 3PJEA 4RQTA 3ZNOA 1PIWA 3ICPA 2JD1A 3F1KA 3ANNA 4LN1A 4MPDA 3RUFA 3P19A 4OHUA 3GLQA 5CAEA 4M55A 2WE8A 1HYHA 4HFJA 4CM8B 1I2ZA 4F6CA 1A9ZA 1JVBA 4GLOA 1PR9A 3JD3A 3MEQA 4HBGA 3LT1A 2Y1FA 2J3KA 2VTDA 1DRVA 2NVBA 2B5VA 4IDEA 4P4LA 3CUKA 4B3JA 3ZW9A 4CM4A 2YDXA 3QWHA 4AFNA 4E2WA 1J4AA 1YB5A 2NVWA 2Q2QA 4B7XA 2I6TA 1B16A 5G0SA 3GNSA 4ZRNA 3UCXA 2BFAA 1LC0A 2OL4A 2Q49A 4JX8A 4Y6RA 4UUNA 1F06A 3KYDA 1AGNA 2RH4A 4UUPA 5AYVA 2PD6A 2J5RA 2VNAA 3P2OA 4UVIA 4E31A 1Z74A 4XYEA 4M87A 5FYDA 1HRDA 2BFMA 3B1FA 1O6ZA 2IRWA 4EJ0A 1PZFA 3JYPA 3GF4A 3WNQA 1I24A 4XR9A 2PZJA 4BGUA 3KVOA 2ZJ1A 1HDXA 4W82A 4UULA 1YDWA 3AW9A 2EJVA 4S1VA 4W9NC 1LDYA 3IC5A 3RWBA 4CMKA 2ZYAA 2OMEA 3BIOA 4CV3A 3M1AA 3TZHA 1DJQA 1Z6ZA 1EQ2A 3MJCA 2QG4A 4Z6KA 4DIBA 2Y67A 2BH9A 4RCVA 5DNAA 1NQTA 1OBFO 3WYBA 5HBRA 3GVXA 1Y8RA 3BTSA 4R1SA 3LDHA 4UEKA 3OM9A 3WGTA 1DRUA 4CM1A 5A9TA 3NRCA 3VC7A 5ILOA 1TXGA 4RGBA 2NQ8A 1GQQA 2AA3A 4XIJA 1KC1A 4IXWA 4WCFC 1JWAB 4YR9A 5JC8A 3JQGB 3MZ0A 4LRSB 5AXAA 4CQLA 1B3BA 4Z0PA 4KQXA 2Q4BA 1R4MA 4NIMA 1HSZA 2NTVA 4FFNA 1U8FO 2NV6A 5KJ6A 2VT3A 4TSKA 4S3MA 3H8VA 5ER9A 1VLLA 1Y5RA 1T2CA 2GN4A 2EJWA 1JKFA 3RU7A 1WP4A 3HQ4O 2GN8A 1LRJA 2Q4EA 4L0QA 2AEJA 4MIYA 2PNFA 4FC7A 2AXQA 1V9LA 1UXGA 4E33A 1YWGO 4LMRA 1HKUA 2Y0EA 4TKMA 4BGEA 3JD2A 3VPSA 4XYMA 4Z0TA 5GMOA 2A4KA 4ZA2A 1PJ2A 4YRAA 8LDHA 1NHGA 3K92A 3F6YA 2DM6A 1NQOA 1E6EA 3PHJA 4TVOA 5A03A 1X15A 4R1NA 4CM7A 3AY3A 4ND5A 1GEEA 5ER6A 2Q2WA 1ISIA 1F14A 3JQFA 4II3A 2H63A 3N74A 4O5OA 2H6EA 2NQTA 5CDYA 1R37A 1PSDA 3OMLA 3U5TA 4MVJI 1LDNA 3E8XA 3SC6A 4MVJG 3E9NA 1DRWA 1A4IA 1NAHA 3NV9A 3VZQA 1BRMA 4OH1A 4WCFB 4B4VA 5ADHA 3WBFA 1R4NA 3PVZA 4WEOA 3D5QA 4RPHA 1U9JA 3WGOA 5LDGA 3QQPA 5L4SA 1GTMA 3K73O 5FFFA 4FGSA 4BNVA 4PVCA 1NWHA 2PKQO 2WDZA 3F1LA 1QR6A 2VHXA 4AJNA 1PX0A 3N58A 2ZB3A 1I2CA 3EHEA 1Q0HA 3KV3O 4JIGA 4TWRA 4W7HA 1ZEMA 4NMHA 2Y66A 4CQMD 4Z3KA 1NASA 3PQFA 4XB1A 1JLLA 5B12A 1UDAA 1QYVA 2YFHA 5F1OA 5ICSA 4DL9A 5ITWA 4YAIA 1ONOA 3BZUA 5B4VA 3TZCA 5JDIA 2O4UX 4OQYA 3VH3A 2DFDA 1YQXA 4MVJA 4ZICA 2R6JA 3SVTA 1B15A 3KYCA 2VUUA 3PGXA 4BKQA 1GU7A 2HLPA 1KVSA 4FFLA 2FWMX 4FJ1A 1N9GB 2DKNA 4AICA 2BMAA 1BGVA 3I9KA
chains in the Genus database with same CATH superfamily
3ANYB 1UPAA 1HFJA 3OCZA 3T9CA 5D85A 1GL9B 2CLDX 3PR3A 2A7QA 4XLZA 4MLZA 3C14C 1JIIA 1WVIA 2FPGA 2FV8A 3L07A 1E2KA 5A7HA 4W4TA 3HCBA 2VSXA 2QN9A 2ZYSA 5LD2B 3QMVA 2H1OA 2XITA 1ZI8A 4HZGA 1I7SB 4CMCA 2R5WA 2H2IA 1XZHA 4DT1A 5EQFA 4TMFA 2DYKA 1IN8A 1LTQA 1T10A 3CZMA 4PLHA 4Q3NA 2GPNA 2IPLA 4TRRA 3TMAA 3WGMA 5F5LA 5B2ZA 2PAAA 1P3Y1 3AJDA 2ZUTA 4R7TA 1MRZA 1U2QA 4HAIA 5DKFA 1I5OA 2PKYX 4FPXA 2J8ZA 2PWZA 3MRVA 4Q37A 1PJ3A 1E1RA 2F67A 4JDPA 5KSWB 1NN0A 1E7MA 1MTZA 1Z4JA 2BKUA 1R9GA 1NQ5A 2IYQA 3MWEA 1RHRA 4OHKA 1J5XA 4DQ0A 2V7UA 3H1FA 1N1GA 1GVHA 2JFZA 4GXQA 2BP7A 1NVBA 3D6HA 2BM0A 3ETLA 5JSKA 1FP4B 4XWKA 5JQGF 1SUBA 2AE2A 4E13A 1AZWA 1T1SA 1XL1A 4LTDA 2AN9A 5CIQA 3UGQA 4W99A 5DSZA 3BRWD 2HU2A 1F8XA 3VNAA 2QIPA 3JQ7A 3P97A 2NUAB 3I05A 2ZRCA 4HC4A 2FRVA 2WD7A 1OUMA 4V0NA 3UGJA 3QPUA 2JHFA 4PONA 5CIYA 1K8ZB 2EFDB 1M2KA 3LY7A 4YYZA 1UP6A 2ZKLA 3UAYA 4C1NA 3AJAA 3GROA 3HJGA 2IELA 4PLCA 5HM8A 3EPJA 2L82A 4YMSA 4R54A 4EQ6A 5BMOA 2IYXA 1XAJA 3ZDZB 3W78A 2V6GA 4B6RA 2GQ0A 2X86A 4Y0NA 5ECGC 3G2HA 4HPXB 1JTVA 2RGXA 3UWKA 1HA3A 2VS1A 2XKAA 1U3UA 2HA6A 3JPYA 1K2WA 3K31A 4TUYA 1SOUA 3GLHA 3WDLA 3RYHA 4ILKA 2KW5A 4ITRC 1Y7IA 1WB5A 2FZ4A 2R97A 4KPFC 2CV2A 4EB8A 2OWEA 4HZIA 2OC9A 1OHHD 1PL8A 4HVTA 5ALFA 4EUFA 2GYVA 3W3AH 1Z7GA 1DXQA 1ESCA 1DHTA 1LDGA 1TQ8A 4NTZA 1XK7A 3OA2A 3WB2A 3HZRA 1X1BA 2ZSFA 1E2GA 3LLVA 3PC8A 1CZRA 2DPYA 2ZTMA 2V8OA 3OOYA 4YJ2B 2OAGA 4TROA 5JPIA 4MLDA 3OP1A 5AFSA 2Z8ZA 1H6AA 3LGSA 5LN1A 4M9UA 4GP7A 5E7MA 3TSYA 2EHJA 3COZA 4Z0NA 3ZI0A 4ZZIA 1UZMA 3OF3A 4YJ3A 2EATA 2BLNA 3AP2A 3BD9A 3VO8A 1OYOA 2JAXA 1QBGA 2GLTA 2A92A 3GG9A 3PJDA 1JP7A 2J31A 4FFWA 4M0PA 4UAVA 3ESCA 4WPGA 4A16A 3PJRA 5IJXA 2OA0A 1NF9A 1OFIA 3RSFA 1GLVA 4GS5A 2CNWD 4Z7NB 3VPFA 3GZTB 2WINI 5JUWA 4JUIA 3TX6A 4ZYVA 3RFTA 1T29A 2DKFA 5IVKA 1O94C 3HPQA 3ZV6A 3IAM1 1UBMS 1W34A 4KGDA 2V6IA 1SB9A 4L8YA 3ER6A 1QPGA 2YY6A 3LHKA 2FZVA 4MR7B 4MUJA 3PHBE 1T9GR 4WW0A 1N5OX 2H08A 3GRKA 4YROA 1KH3A 3N8HA 5KQGA 1GITA 4KXWA 2V97A 4TXNA 4DR4B 1KYQA 4DCNA 3K0HA 2PY6A 3PDCA 2GHRA 1E2EA 1XN1A 2XQIA 3X1MA 3PEEA 3PNKA 1CJSA 4D56A 3QU9A 1LV8A 1YCDA 4QYXA 3VR6H 4ETWA 2GEDA 1NA5A 4Z0HO 4OOFA 4MI1A 2GCOA 1TVCA 1SXIA 5LXTA 1M34E 2C58A 3Q5GA 3VNRA 3BK1A 3NAZA 1NLFA 1J5PA 1TYAE 3QY9A 3PICA 2XWSA 3MT7A 2VH2A 4FGKA 3SHOA 3VZSA 2YXDA 1ZR2A 4OUDA 4AYTA 4OU5A 3N2GB 3K15A 3GH3A 1X77A 2ZJ6A 3EXFA 3KU4A 1IL0A 1ZGBA 4DJEC 3N2KA 1E5TA 3WHPA 2FZCA 4DA8A 3FJOA 4UHBA 6LDHA 5I9IA 3OT1B 3UMYA 2JF0A 3O8OA 2HDHA 4KDFA 3WKEA 3WGIA 4RS3A 1GARA 1YBVA 1AQLA 3H1BA 4RKYA 3KHKA 2VJPA 5DMHA 3UH1A 1UMBA 1AKEA 2EZ9A 3PFCA 3RYTC 1ILEA 4ZQIA 5HBGA 4UTNA 4QXQA 2AWOA 4RWEA 2BEVA 1SUPA 2XVAA 1NLMA 2YZNA 1GLNA 2WI8A 3L41A 1ORVA 3CG4A 2G09A 2P41A 2ZSAA 2NZXA 3M1IA 2IZ0A 1TUGA 2R8OA 4A92A 4L76A 4NE9A 4TTAA 5FEMA 3WAKA 2RGWA 3LPAA 4EOGA 3SIPA 1RACA 1E7SA 1CX9B 3AW8A 3G6WA 3NM4A 4LF8B 4KR3A 3UTCA 1WU8A 1PEDA 4GMGA 5F4ZA 2X19A 4BLTA 5SICE 3PC2A 3KHUA 1VHJA 1XA0A 3GK3A 1DDOA 2BISA 5E95A 5AOVA 1RQXA 2V9CA 3HCEA 3L6DA 4RVGA 5KIAA 3AF5A 3BK2A 1MAWA 5K3CA 1ESEA 1VYUA 3M49A 5J59A 3TW8A 1AN9A 3BMNB 4O4LF 5LA6A 3S55A 1IFXA 2CN1A 4RM3A 4ZT3A 2YDYA 3DUWA 5C80A 4IJKA 3KL2A 1JYEA 2X4GA 3LW7A 1JUDA 5A9SB 1J25A 1JDPA 1SXJC 1UJ2A 2VBFA 2GHTA 5J63A 4NFYA 1PS9A 3BDVA 4I99A 2B7BA 2HFJA 4K6GA 2GM9A 1XVUA 3RBVA 1BFKA 4YQYA 4YJGA 1CP3A 4QSMA 1W36B 3QTLA 2CVPA 1OX4A 4OI1A 4EY6A 5BUSA 3L06A 5KVVA 2IH5A 3R7BA 4JCOA 5KI6A 1WHTA 4UHCA 1FU4A 2ZJOA 2WB4A 2YHSA 2ODTX 1BU8A 5FPQA 1JDJA 3SS9X 1ORWA 4KZPA 1XEXB 3AUYA 4YFVA 1LXCA 3B9PA 3EBOA 4GAEA 3K94A 5A4KA 2H52A 1Y7TA 3MM4A 4BKOA 1U3TA 4KC0A 4EFMA 3OTOB 1KZGB 1B3RA 3L1KA 4RYDA 3WWZA 1FDVA 1WKVA 2EFGA 5FPKA 1XPJA 2V74B 1V8FA 2VLBA 4GX0A 4QVIA 2WV7A 1ZS9A 3LT4A 1F5SA 1GN8A 3GUHA 2QRUA 3FPFA 1ZWKA 1O97D 4X7RA 3L8MA 4X60A 1LZKA 4HWSA 3U26A 1SXPA 2B8JA 3T6KA 5K4HA 3STYA 4EPYA 3VPGA 2P7HA 4ZAFA 4MUYA 4FC6A 3ZYZA 2CT8A 1T5LA 3FOWA 1NW7A 3OFND 1HLPA 1WXEA 2CJYA 2YXPX 2A14A 5A3JA 2REQB 1PFKA 3RAFC 2FJ0A 1JEYA 1R4AA 2V7XA 3C3PA 3NT5A 4RJJA 4ZT5A 4F97A 3FHOA 4YACA 1T4BA 4YRJA 2RGDA 4TMKA 1RFGE 2HD4A 4I66A 3DWEX 4DMCA 5ALJA 3P9XA 1TOAA 3EQ6A 5CFLA 2EWMA 5GGXA 1O54A 3NRBA 4WADA 1J90A 1YZVA 1SWVA 3E1GA 4KFTA 3GRAA 3UUGA 4DTIA 3TMKA 4CQMA 3L02A 4IHJB 2NVOA 3LVFO 1S89A 4MRNA 4NMMA 4RSRA 5AW7A 2P67A 5CM9C 5J1SB 3AV3A 4G81A 4Q9NA 4ID3A 5KNCH 1GNQA 3IOYA 3OPMA 3STHA 4KYTA 1GQRA 3FDZA 3UATA 2FZWA 5KZMB 5GVRA 1GZ7A 1ZRMA 4QGHA 1KYZA 2B2XA 3TSZA 3P20A 2IHKA 3TLGB 1OLUB 1X6VA 2QVZX 4QTZA 3E1KA 3E9QA 3DCYA 1GSHA 3LBHA 1DBIA 2NM0A 1FFAA 1K0FA 2F9MA 1Z56C 1I3CA 1IVNA 3M6VA 4IEIA 4F1WA 1L3BA 1ULTA 2OCAA 5TPWA 1UKAA 1XNGA 1TMKA 1Q16A 3ETDA 3L6UA 4MQEA 3DCJA 4XWYA 1PR1A 5AHKA 1MIOB 2DPLA 5TR9A 3STVA 4QL3A 1YZUA 5FBHA 2Z5GA 3HUTA 3IXMA 2G77B 4A2CA 3BXOA 4JEIA 4AMYA 3RO7A 4G37A 2WVAA 5L7YA 3OY7A 2Y6VA 1SKYB 4BEBA 3CKMA 4NK4A 4NZPA 4HX2A 5A9RA 3F96A 1R12A 5E9AA 2VRNA 1V95A 5BSRA 4MH0R 4S0XA 3ZN2A 3THSA 3HACA 2X0KA 1G16A 4Q4DA 5TQ0A 4BU1A 1QO9A 2E89A 4XVHA 3SZMA 4EMSA 1N36B 4V1CB 3W5AA 1Y6ZA 4KQGA 1BS1A 1PAUA 3O4GA 1QVRA 5HUJA 1KR5A 5IK2D 1UPBA 1CUCA 2GASA 5AUNB 4BBJA 4HRAA 3RS9A 1FDTA 2LTAA 2WTBA 4ZREA 1JSRA 3KQNA 4OY3A 3FUTA 3NZEA 3IKLA 2V45A 1X1AA 1ESDA 2PX6A 4D02A 2DUNA 3GWGA 1W1WA 1P8JA 4XUEA 4Z99A 5HA5A 1GRCA 1BHO1 3RDPA 1YOBA 5EMMA 4Z7OB 2Y1WA 4G5YA 3MOSA 4UDNA 4FS8A 1Q7BA 5ECWA 5ENZA 1I4LD 3L8HA 3WMWA 3DOJA 4DLRA 1OIWA 5JFOA 5D3MB 3RSLA 3HSKA 2ZAIA 4FHGA 3U4DA 5JXIA 5DNYB 2SICE 1R8JA 4S2UA 4ZQFA 3ICVA 1Z4QA 2H9YA 4QRDA 2HSZA 3OLVA 4AJPA 1QPBA 1T1RA 4BNTA 1U0LA 2EDAA 1ACMA 2HUNA 3EZ2A 4BWGA 1U0BB 1OTXA 5JEDA 1I30A 4W9RA 1L2TA 1H85A 3G1WA 3HP1A 1TTHA 4QASA 1KEKA 3VSDA 2H0AA 1U9ZA 3ZWYA 3QSGA 2G1AA 2XUJA 3BF8A 2X0IA 3TL6A 2B6HA 5CB0A 2ZIXB 3LMKA 1EJ0A 3OICA 4J90A 3NGMA 3BXXA 4I9NA 4IDFA 4EYEA 3ORRA 4LXHA 1GGEA 1BXZA 1XYYA 2Z0MA 3L49A 4NP6A 3DPUA 3BSFA 3T06B 5I01A 4U1RA 4GP9A 1Y6FA 5M04A 2I62A 2M6LA 2R6HA 3VX4A 3VKWA 4ZKEA 5CLFA 3A9CA 3ZUGA 4WUTA 3DMYA 4FIDA 2B8TA 1U5AA 1ZN8A 3FUWA 4Y6SA 2RI6A 1VP9A 2WWIA 4AP9A 4KIFA 4IV5A 3BVPA 4GRIA 3SE7A 3W9SA 1MHTA 2XBLA 2CDCA 1RXYA 3A6ZA 1H2FA 1RHKA 2PEYA 3DP7A 3JQPA 3KV1A 2XD4A 5TB5A 4CM4B 4EF5A 4L6AA 5JD5A 2QVYX 4OMCA 2W2TA 3WVNA 2VBIA 4C78A 1IWPB 3LW8A 3QU4A 5H3CA 2VSOA 3BGVA 1CDZA 2E3JA 3PITA 2R2AA 5EN4A 1LTHR 1C8KA 2IGBA 3D5EA 3GFVA 4PHGA 2ODPA 1Y1PA 3QUCA 3FLMA 3KYIB 5DBIA 3D7MA 3IHWA 3FOFC 3ACBA 5DHFA 5KWIA 4MICA 1KC3A 2VYVD 3UMVA 2R60A 1E7RA 1JR2A 2HIHA 2QDKA 2WA2A 4ZCTA 3E03A 2QYSA 5EXTA 2HWUA 3VXKA 5JT1A 4C7XA 2FXIA 3T4XA 4IJ6A 1OCEA 3HUFA 2OZKA 2BHLA 3AZPA 3ET4A 3HG7A 3LLUA 3QA3E 2A8YA 4UUAA 4AD8A 5L53A 4NONA 1AQYA 1WSDA 4F86A 3E9CA 3Q10A 3QEMA 3WGQA 3TXXA 3DXYA 1Y1TA 3IKJA 4OSOA 4C07A 2IP1A 4JLMA 3D1JA 3D6AA 4QU8A 5T3UA 1IOWA 3UCEA 3O03A 3KDAA 3QXCA 3AESB 1Y5LA 5E0OA 4LHWA 4PZLA 3RODA 4A0QA 1NRJB 4HDKB 4DGSA 2HJWA 4HH4A 5FPPA 1GG5A 1JXQA 4FHZA 1ZRHA 3FWHA 4HRXA 5B2FA 4Y1FA 1G42A 1II9A 5EIEA 3NVKI 4OREX 4ANFA 3PDJA 1G64A 4O6VA 2J3DA 3A14A 4NZMA 1Y8RB 5HKLA 4RVSA 4DCJA 2F1JA 1JEJA 3PFFA 4Q39A 3Q8KA 1C3OB 4WLVA 1MBZA 1K5GA 3NNNA 2A78A 3ZS8A 2FW8A 1GZ3A 4NZ9A 2AZMA 2BBTA 1Q7RA 4H3KB 4HATA 3I1IA 1XC7A 3CTVA 2YIDA 1SIOA 1Q7TA 1T9GS 4FYVA 5GONB 1NBMA 2HAEA 5DULA 2OXRA 1HE4A 3W4KA 4A6EA 4PS1A 4B0OA 5IDVA 1IATA 4X92A 5FL7D 1R66A 1FNDA 2JHGA 2PQ6A 3CZ9A 4J6FA 1LRKA 4GM0A 4CQLB 4D0NA 1MRSA 3G79A 1K6JA 2QQEA 4JBIA 1H8EA 1EFUA 2IHTA 1LDEA 3KJQA 3G5MA 1HL7A 2F62A 2J5XA 2R84A 3NWPA 4MVCA 4GGMX 7ADHA 4Y2RA 3P2JA 4RD3A 5CW1A 2H1WA 1U7OA 1XLVA 2I80A 1GTZA 1OX5A 4B82A 1B8VA 5H4GA 3G0IA 4KXXA 1OXBB 1NRWA 2WZQA 3KB6A 5SY4A 3Q8WA 4UTPA 4HR7A 4JEUA 3GLGE 1F0KA 5H8WA 4MUKA 1KYVA 3HXLA 4WXMA 1SXJE 3UJ9A 2E2WA 4A8JB 3A1CA 5J4LA 4EGSA 2WSIA 1WPGA 1LFDB 1NDQA 3KPVA 3RRFA 5JDIC 1GTSA 4G4GA 4N5MA 4D4KA 3CJRA 2W2QA 5JNRA 2QK4A 5F98A 5IKMA 3BL8A 2NUBA 4P2BA 4RHXA 1YRQA 2ZSEA 5EP3A 2OXTA 1D6JA 1IB6A 2XWPA 2JGNA 2QZJA 2I8CA 3CVVA 1T0UA 4Q12A 1ZJJA 1C3LA 2PUAA 3TR0A 2G71A 4NEGA 1SR8A 1OVGA 2C57A 4OBWA 2DCUA 3IUYA 1NLZA 1Q1QA 4INJA 4MPTA 4TT3A 2FLWA 2G8LA 4XR4A 3JQ8A 3NHFA 4MUBA 5FT9A 2XNCA 3EDOA 4YR7A 4JI4B 4OSEA 2J4DA 4LV8B 4RTQA 1WXFA 4NOJA 2ZUBA 4P98A 3RRJA 3ERCA 3IB6A 1TD1A 4HWPA 2GPSA 1NXOA 4B3SB 1E3LA 1R4NB 2D74A 2NO5A 1ISGA 2DHQA 2CVQA 5HTOA 1EHIA 2P8SA 3B3FA 3JATB 4MWTA 1R0ZA 3QG5A 4N40A 4NYIR 1SOMA 2ZDGA 3HE3A 4K0KB 1CS4C 4B3XA 2BDEA 5FTLA 1TK3A 2FSFA 2VP6A 3O2QB 1FFGA 2GVNA 3OPYB 3RLIA 3IHKA 3K16A 3KP1A 3RVMA 5NULA 4WCDA 1CF2O 2GVDC 1Y9JA 1W1UA 4KWHA 4G5HA 4WIAA 3HJHA 4CR6A 5LP6A 2Z6VA 3KSUA 3THXB 2FN8A 4M8LA 1MJGM 1SA0B 1IU9A 3LQ4A 4YCLA 1CKEA 2CDRA 4DNOA 3L01A 1G8GA 3A27A 1KPGA 3A1UA 1GV0A 1WP9A 4FCCA 2ANCA 1KAMA 4DSAA 4F5DA 5ABPA 5AXCA 5C5IA 3S2EA 1YRHA 5KU1A 1HMYA 2QX8A 1Y80A 3B2NA 4HGOA 4XCQA 2Y0CA 2WTXA 5KHAA 2QLJA 4JEHA 4OJTA 2JA1A 2ESRA 2Y1EA 2P9GA 4QT0A 3FPGA 3MWFA 5G40A 2J5BA 1A5TA 4NDAA 4RAOA 4ENWA 5BV0A 5IJ0B 5JQGB 1OLXB 3ES9A 3TKAA 4AS1A 2ORYA 3I5MA 2ZS7A 5B7NA 4N4AA 5AK5A 2SKCA 5HWSA 4J8PA 1E3WA 4LJ5A 3W04A 2O2ZA 2YC4C 1CT9A 4LS3A 1X7ZB 3KSAC 3R9IA 1X86B 1U9IC 4ER3A 2JIOA 1HEUA 1N1MA 2PYZA 1DHRA 2HMWA 3JZAA 3T3GA 3S27A 3ULKA 4RIFA 2UVPB 1JIQA 3ZWMA 3KYBA 1GM5A 3FCAA 4AY2A 3L8EA 4OGWA 4AF8A 1XJCA 1VCNA 1EBFA 1KDRA 1K98A 4P7GA 2A58A 2JKYA 2BLLA 4MRVA 3SJ7A 5JXHA 3AU9A 4RAQA 3WNZA 1JZTA 2AE1A 3W6UA 3GA0A 4ZPXA 4E4YA 4UQOA 2X9VA 4XSHA 1JT2A 1O58A 5NLLA 3UEOA 1RRPA 2JJQA 2BFCA 3LSTA 3PUWA 2PZFA 3SHFA 1QOZA 4AYWA 2W2LD 3ETCA 3GLSA 3DNFA 1X8KA 1IY2A 1G5FA 3AEKA 4HLUC 3Q8MA 5FUMA 2FHSA 2ECKA 5AW5A 2ZQYA 3A1VA 1ORRA 5FPTA 3WGLA 1PR5A 4C22A 1JVSA 4ILEA 1Z73A 1AVTA 4LZJA 3UJCA 3UJPA 3RVPA 4KQWA 1HQDA 3VOTA 1WQ4A 4BZZA 4EO4A 4MUEA 2DFLA 4GMDA 4ARIA 2ZAOA 3PWZA 2INGX 2PZLA 1NMQA 1VIDA 4TRMA 2FEAA 1T0BA 3WR5A 5I4CA 2I3GA 2D7DA 5CYOA 2OORA 4EPRA 1ZK0A 3FX2A 3NBAA 3X1WA 4DA9A 3KX2A 1DQRA 3Q3VA 3U49A 4CT5A 4UVDA 5IEBA 3GARA 4LJKA 3WKDA 1GAWA 4BQNA 3GP8A 2AD5A 2G9UA 3KSRA 2Q3JA 1PI3A 3E84A 4LGVA 4C7OB 3NM6B 3SXPA 3G8BA 4O02B 4PGHA 5IZ4A 1V3UA 1U0FA 5I7RA 3LPDA 3T0FA 3V4FA 4C5CA 2QGNA 4NPHA 3QLUA 1V8PA 4L07A 3F4KA 2HO4A 5CH8A 1D2CA 4KVAA 1UBFA 3K0AB 4QWMA 4B6JA 3L18A 4LF4B 3TFWA 5FWXB 2XUIA 4U5XA 1E1CB 4E11A 1OR8A 1P61B 3D6JA 3W5IA 4R8SA 4G65A 3GQBB 3I72A 1A9QA 3PU6A 4HEA1 5FXMA 4ZU3A 4PQEA 1A77A 5EP2A 1EDEA 3C8HA 1UFVA 2IV2X 1RJEA 1HG1A 2VFAA 2N0SA 4G4SO 4IILA 3RSOA 4RY0A 5DM1A 2KJQA 3S3TA 3D0KA 2YWRA 1PLJA 3RCBA 1E6WA 1OXKB 4AI6A 4S04A 4Q00A 3G8DA 3TAHA 3P0HA 3C2QA 4MHSA 3QVTA 2YVKA 4IJWA 4YI3A 5EE5B 4EA9A 3CKLA 3G17A 2PMKA 3L9WA 4DMFA 1XU4A 1L4KA 3R5HA 5GJWC 4M0DA 2IUUA 2GZRA 1G6Q1 5KU7A 1SCIA 2GI4A 4D7AA 1DKMA 4MARA 2IXTA 1ZN2A 4QUGA 1S96A 3QFTA 3DT8A 4FFPA 2ZJ2A 4PZCA 1I4DD 1S2DA 4GQIA 5CNJA 3W5JA 3PSHA 3FGZA 3U3ZA 3WI7A 1OH5A 1WL8A 3VSBA 2DSTA 5DYTA 2XTNA 2B1JA 3LT0A 4FOLA 3DTVA 4WV3A 1V9SA 2C3OA 3IMCA 1ZH4A 2P0AA 1LW7A 2RDMA 4YR9A 3CRVA 1IY8A 4HQOA 2XQJA 4QQKA 2PFSA 4YWJA 2GD2A 5KPDA 1Y9AA 3G5AA 4M60A 2O54A 2GDZA 4P5PA 1YJAA 5DGTA 3H42B 2VHCA 4HDCA 1CR2A 3R0JA 5JZBA 2UZ1B 2IOQA 3L7CA 3ZE0B 2GLUA 1XZBA 4F5YA 3HB0A 3GLFA 2WA1A 4LI0A 3FR7A 3C0KA 4ZDKA 5G0UA 3C4QA 5KMGA 3NBZC 3PJFA 3A2MA 3LNTA 1W25A 4HN4B 4O4LB 4CFYA 5FL3A 2AEFA 5IULC 2XMGA 4N7MA 4A03A 1QF7A 4KK3A 4M54A 1WSWA 2RK4A 3AVXA 3HM2A 4LQ4A 2DQZA 4D9MA 3IPXA 3LDUA 2B78A 5HJ5A 3I73A 4KO1S 3U5ZB 2AQKA 2GCGA 3QOXA 2CV0A 3CE6A 4F72A 1W30A 4DG9A 1UM9A 1QDUA 1TJNA 2WUGA 3HO8A 3NG1A 1D6SA 4JL5A 4P33A 5EWLB 3T7JA 4AZ0B 4YECA 2ZBVA 4K8RB 5LBUA 3RVRA 5LU9A 4N3BA 2AF4C 4G0PA 5ESWA 3EODA 1DPGA 3O38A 5BR4A 2XZLA 3QOWA 3RAGA 1PKEA 5HUHA 1QP7A 4UCWA 3TOCA 1KNQA 4MXDA 2D59A 1WABA 1VHQA 2WU4A 1RRKA 3CUUA 5JALA 1JMVA 2VUTA 4DMUB 2FN4A 3DLIA 1GRQA 3AOEC 1GZ5A 4WZAB 5EMKA 5DLYA 4Q4JB 1IVYA 1NE2A 2SCUB 4FEEA 2Q2OA 2Q46A 4JWTA 3ZG6A 1TT5A 1C8LA 3AC0A 2YVQA 3ZTYA 3RKRA 4DCTA 2EHDA 4MLPA 4N0EA 3LFUA 4LPSA 4CYMA 3WFIA 2YFYA 2O7NA 4Z9AA 1H93A 3L2OB 2FUG6 1QNLA 3CKYA 4OIMA 1DRKA 3W2FA 3KSBC 4I1PA 3URMA 1Z5WA 3FDFA 4PAGA 3INGA 2QTTA 4ZZ0A 5TMPA 2EV9A 2HX1A 2HOQA 2HPHA 2QN7A 1IZZA 1TU3A 4E1AA 4FNOA 4QZVA 1EGVB 2PSDA 2NUAA 1BROA 1LPOA 2R7NA 3AZQA 5G2OA 4BO0A 2WB2A 4YXWA 3LVBA 4M1EA 4ZO4A 3WWPA 2PD3A 4CKCB 2O3UA 2I6XA 3N87A 4Q1VA 1SHTX 4YP0A 2CW5A 3NCHA 3KJHA 1D2AA 5KOJB 4X65B 1T8WA 3LLSA 1ID1A 2ZYIA 3IT1A 2HRDA 1F6BA 4HYYA 3HN2A 3BMCB 3ZWXA 4AMVA 2JFYA 4K46A 2PWPA 4D42A 1U8XX 3BPSA 4MCIA 2C5SA 4Y6QA 1SU4A 1KQOA 1F2UA 1V7CA 2P91A 2V5UA 4ND8B 1DEAA 1XL0A 4BMNA 2P2NA 2HN9A 1M6VB 3JR3A 3QBDA 4DXAA 2B61A 2ZTLA 4J94A 3LWNA 1FSFA 5EKXA 2DLDA 3GJ5A 4R8KA 1AB5A 2X2PA 2VPYA 2YRWA 3N0VA 1VSTA 3OD1A 3G85A 3IUMA 1S7GA 4FSDA 3VO9A 4F3TA 4GGOA 3TLCA 2BHNA 1PGOA 4R3WA 4IG4A 3B20A 4KQKA 2VXCA 1ZBDA 3IOEA 2PT6A 1Z75A 3G7NA 1NX9A 3FFBA 2A1IA 2IBSA 4WUVA 3IV9A 5EZQA 5BSGA 3KTDA 2KBEA 3S2GA 4RNDB 1PFWA 3VHQA 1C7IA 2OFWA 2AOWA 2YOHA 1RHUA 5L3SB 1OKKA 1F12A 1H8HA 2E85A 3T41A 1ZO8A 1QC5B 2CXQA 4DLNA 5GIOE 5JDCA 3KZNA 4BX0A 3ZH2A 3GH1A 1GJRA 1ZNYA 4I14A 4B1FA 4BKUA 2JKVA 1QRUA 4X63A 1NMYA 4JD5A 1BVRA 4KODA 4U0JA 2QTVB 1E7YA 1JN0A 1P1CA 4ZXFA 4PNEA 5B53A 1XXLA 2CNNA 3VGJA 2PX2A 3FJYA 3E6AA 3H7IA 2DJ5A 3NUZA 3A6DA 4H1HA 2GK3A 1GUDA 5KTKA 3PR2B 2DUWA 3ZLJA 1ZFNA 3RROA 1W29A 5A0FA 1TA0A 2X1MA 4C08A 1V25A 1Z0FA 3ONFA 1J23A 1QB7A 3ZNNA 4P0QB 5KVAA 4KUGA 5BUZA 3ZCTA 1TLLA 1V43A 4HY3A 4AKGA 1VLVA 4JYMA 4P93A 4J6EA 1H2YA 4AKTA 1WO8A 3RHZA 1USWA 4XSGA 2VDKB 4XH9B 4YRKA 1UZAA 3IE1A 1YUMA 1QTNA 4UC0A 4NHOA 3BQNB 2DERA 5HPYB 3EBLA 2IW1A 4JOCA 1WLSA 2IIVA 4Q9JA 5E0KB 2O2EA 2QEQA 5FOWA 4CQJA 3UB4A 1KETA 1L3IA 3LUKA 4L9RA 5JSYA 4B4WA 2DBYA 2I29A 1Y4SA 1YI8A 4DG5A 4Q0MA 3U9TA 5CAEA 4WY8A 3HJAA 2HPZA 1V4BA 1VKRA 3FYUC 5IBRA 3WK8A 4QXRA 1SVKA 3EPKA 2AOTA 4RKQA 2PGJA 3EIHA 3NFRA 4GOLD 1DT5A 1YS2X 2V4ZA 3LK6A 1UCFA 1FOEB 1Q92A 3AKEA 2POCA 4KGVA 5LQMA 3HGMA 3HL0A 5H16A 1JE1A 1JF8A 2ZFUA 3AU8A 4OLJA 1YCFA 3DBLA 4CJXA 3JSAA 3NHPA 5HGJA 4FN4A 2F8MA 4BFVA 3HYCA 4UBOA 3B12A 5A62A 1U7ZA 2QLTA 2VNSA 1W4CA 2AXPA 1TDJA 1JB9A 3VYWA 5FD8A 5J40A 3V5NA 4EPXA 3HCCA 4O4JF 1CEYA 4XJVA 5I9TA 3WXMA 1JIVA 4KXFB 5JTUA 2IT1A 3B51X 3BKWA 1QHEA 4JB0A 5T8KC 4C04A 4RXUA 2QMOA 5A4FS 3PJGA 2FMHA 2H16A 2QZSA 3DJFA 3QKWA 1XZCA 1P6XA 1GV1A 2KS6A 3E8SA 3SM9A 1S8OA 4BNIA 3G1UA 4RLFA 1XNHA 2FQWA 3ZHUA 1Q14A 1FX0A 2WHQA 4G5GA 2W2KA 3ZV7A 3SP1A 3A7EA 4YTEA 1EDBA 1WNTA 3WDSA 4O2AB 1OWOA 3WSWA 1M5UA 4QWWA 1WCXA 4BVKA 4CM5A 2DFPA 4EKNB 3U60B 3VA7A 4K87A 3I8OA 4H31A 3O7WA 3HLYA 4MW4A 4JC5A 5F9HA 1YZNA 3CSDA 4ER0A 3WRXC 4D9NA 3M5DA 3HBFA 4PC2A 3T7CA 4PX9A 2MSWA 5AW9A 5JZMA 3MIZA 2FPXA 5ENDA 2GYUA 4XIIA 3BFVA 2F1KA 2BDTA 3AL2A 1VL6A 2NX2A 4PTYA 5LNK1 2ZATA 4JH0A 3PFKA 3QQ5A 4HH0A 3O26A 3D3WB 3NBFA 4P08A 2WQZA 5BV7A 1FDIA 1ZUHA 2H1CA 2NSDA 2QX7A 4WN3A 1P80A 4IDNA 1CU1A 5EHNA 2W6ZA 3GLKA 1IRIA 2WWVD 3ADBA 3QBVA 1Q95A 3ETEA 1NDUA 4NVRA 1PJ8A 2X4IA 4WK4B 2CC2A 2YY7A 4DADA 2B0JA 3EXHA 1NNUA 1QS0A 4UEOA 1WW2A 4XUCA 3SICE 3STXA 3IVRA 3L4KA 1E1DA 4WD3A 1PGNA 3AVVA 3UFBA 1QAOA 1ODJA 4D8TA 1W2WB 4MVWA 1Z4LA 5BYKA 1PTJC 3PCXA 1ZM2A 1KZ6A 2LKCA 3K6SA 1JAYA 4HDOB 2R7KA 3T61A 4P3YA 1OLOA 1XGKA 1U2GA 3BCHA 1DC4A 2VJDA 5DWQA 4AWXA 3QSYA 3DFUA 1NW6A 4JQZA 4PYQA 6ADHA 4AU1A 3IDZA 1W59A 1GNPA 4QYMA 1EGHA 1ZLXA 2QVGA 2K2QB 3NM5A 3AB3A 1XSEA 2F43B 3LFHA 3PEVA 1RQ7A 1NUQA 1X19A 3DB2A 1G2PA 2G4CA 3IKVA 4HAUA 4D0SA 1NJ2A 4WFKA 4BATA 3K8QA 2BKEA 3LX4A 4ZO9A 3EXG2 5DNEA 5J23A 2X5NA 2D2XA 2R6CA 1CHDA 1XDDA 3ASUA 3CNQS 3CR8A 3EDCA 4N3CA 4V03A 3A6JA 5LMUB 5FWYA 3DLHA 4M1QA 1MJHA 1P45A 1JKIA 3NEAA 3AM1A 4IQFA 2UDPA 5HUQA 1R7RA 4ZHSA 7MDHA 5ICMA 1UXHA 2DPHA 1U5CA 2BCEA 3FTQA 3H3FA 2XKBA 3VTKA 4OQZA 3TS1A 5JJKA 1V11B 3SC2A 3SF8A 1YCGA 1S2IA 3I4LA 3IVAA 2V96A 1RVDA 3L8CA 3M1LA 3A0RB 4I55F 4M7RA 4XQEA 5AKLA 3JD4A 4DUPA 1B0UA 3E05A 4IHJA 2QORA 3IALA 1GVNB 1JR4A 2E49A 1UEIA 2N3ZA 2FKNA 2O2CA 2PLRA 2NN3C 3I32A 1NQVA 3PXBA 2AZ4A 2UVQA 3WJ2A 1QYWA 5I7AA 4YHHB 2BIFA 3FOZA 2ETVA 2X0JA 2AFIE 3FM9A 5IM4F 2CBZA 2J9FA 2G70A 3SWWA 2BBOA 3HPRA 3QJGA 2QRMA 3PDWA 4NNOA 4IINA 1BKDR 5AMXA 1CR4A 1O0SA 4O8CA 3CGWA 2B69A 5T8KA 1WOMA 1QDEA 4KQMA 3QWIA 4PAOA 3RPEA 1J7KA 1LLUA 2WKRA 2HDNB 1KU6A 3ZI7A 4NNPA 5DFAA 3THRA 2ATVA 3PRYA 5IXJA 4OATA 2PGXA 4BZQA 3MA0A 3VMMA 1MPTA 1HOXA 3BWEA 4BQOA 4ZTUB 2A5YB 5HJ2A 1MU0A 2VT7A 3PKJA 3LOPA 2VHZA 1MB0A 3Q8LA 2ZRIA 3S7TA 4TYNA 3BG5A 5F12A 5CA1A 4KXVA 3N05A 4V1CA 1ODSA 4WVLA 4X61A 2ATIA 2DWUA 4QPDA 3JQBA 5CLJA 1NBOA 3E7FA 3DBOB 1BN6A 2QRVA 1IJEA 1O95C 5HCIA 3FTFA 1VKNA 3BWBA 2EEPA 2A30A 2I33A 1C7QA 4FLEA 4BFYA 2QP4A 4J76A 5HZKA 5MFZA 3CZAA 1BG6A 1ND6A 2KB0A 4BO9A 2I99A 2OCKA 1QFZA 2R00A 1FF9A 3AF3A 3KZCA 4ZVVA 4CDNA 1C7JA 2IZZA 4JUBA 2YWCA 2WDPA 4KR6A 2XI4A 3DO6A 2CXSA 4BDTA 2QAJA 2WLSA 3HS3A 1N5RA 3JX9A 1E8NA 1W5FA 3V48A 4XM2A 1DARA 1Z5ZA 1QQTA 1EFPB 1P1FA 1TZMA 1M2OB 5FI3A 1IHYA 3X1DA 1Q0ZA 4ECAA 3QM1A 3W05A 3GN1A 3NWEA 2JGFA 1VJ0A 2NSLA 4ARVA 1WA5A 4WBNF 5FA5A 5J2UF 5JH7A 4FYMA 1L4LA 3D2CA 1XNQB 1YZTA 4PYLA 2CUZA 4Q9HA 5SZIA 4DVJA 2G9QA 1BX3A 2PMCA 1YCHA 1G55A 1OSNA 3DO8A 2WJGA 2YYYA 4F3RA 3SKYA 1Z62A 3KWLA 2YJ4A 4MOWA 4DDHA 2VJOA 5EZ6B 1OW3B 3SZUA 4ZYLA 5C1DA 4L27A 1EESA 1K0UA 3A4MA 4HPJB 4ZQEA 3T5TA 1DCKA 1BKSB 1X1EA 2W4QA 3QVXA 1NHWA 1E0DA 4PYMA 4I6JA 4PFKA 1VGQA 3ETJA 4GMHA 4F1KA 5BQFA 2ZOSA 1CHNA 5A6SB 1WS6A 1A8HA 2FETA 5ALMA 4B47A 4TSFA 3ISJA 2JVIA 2W37A 1RJ9A 1UK6A 4BEJA 2LV8A 3HVUA 2WVJA 3E3MA 5EEHA 2Y9ZA 2A7XA 3KXLA 4Z9XA 3RS0A 3IFSA 1DCFA 4MP6A 3M4ZA 2XQGA 4TV9F 1XCLA 4Q4AB 3SX2A 4D81A 1XPRA 1K3TA 1K8QA 3W2GA 3BRSA 3G0GA 1QQ7A 4ZIRB 1UH5A 4P34A 4FWTA 4W5OA 4QG3A 3ORFA 1YBMA 3L7OA 5CEJA 2O52A 2LDXA 2WM9B 3B8EA 2BMWA 3CW9A 3P8ZA 4LJ9A 4W9MC 3U7HB 1SK9A 4KPGA 3RBZA 4DR6B 1FYWA 1TIKA 3VPXA 3KJIA 1RZ3A 1JAXA 1MIHA 1XZEA 2ZR0A 4JP5A 4OD0A 4V0QA 3RTGA 5JHHB 1OE0A 1XTSA 2O0KA 4FK8A 1BSVA 1AXRA 3HU5A 5B57C 4DNQA 3K9GA 2NZUG 4G89A 1XTTA 1H2EA 3UBTA 2ZWIA 3FI9A 5EGNA 1XRNA 4N7JA 4BEWA 4WLEA 2BE9A 4C5BA 2B25A 5FTWA 1ZICA 2I2XB 1R3DA 1GTG1 3IA2A 3UHFA 1NKVA 5ALXA 5K2MA 4BQRA 2RHWA 3BH0A 1ATIA 2GT1A 5C5EA 2OESA 4G0WA 2BFPA 1XEFA 2BGLA 3FLEA 2J09A 2JI7A 3RASA 1V96A 1YBAA 1GUAA 3I9OA 3TM4A 4URFA 4ZGBA 2E48A 1XQ6A 1NRXA 5AW6A 1ZK2A 1SZDA 2WJIA 2ZIEA 2HA7A 3MT8A 2YOFA 4AS3A 4ZCMA 1H2XA 1Y4ZA 4XKJA 3F7NA 3EH2A 2CXUA 2HGZA 3G23A 1ZJWA 4LC0A 1BS9A 4F9EA 4MLCA 1J7JA 5ITZA 3UKDA 1MJ5A 3HBNA 4YGYA 3RQIA 5TV2A 5JOQA 5K4GA 1QR2A 2F17A 2GESA 1ZK4A 2BM1A 3G9UA 4GZ3A 2HCJB 4I50F 1EUCA 4YDSA 9GPBA 3AWDA 4M99A 3FZQA 4URHA 1WBJB 3L43A 3JAWB 4J07A 1DIBA 2HLHA 3CUSA 1T4MA 1UOOA 2G82A 3UHJA 5CDSA 2H5LA 4GWLA 3GMSA 5KYWA 4CEHB 4BN0A 1JJFA 4J43A 3ZE7A 1Z2CA 3NPMA 4CTOA 1BMDA 3OPQA 4XWWA 1R0SA 2QAGA 3CPEA 2WWFA 2RGGA 3RUIA 1N8NA 3EXAA 2UAGA 4KAFA 2VDLB 1F9EA 2FVYA 1PR0A 3C3KA 3NHYA 4MKGA 2BGGA 2FSPA 2NT4A 4H60A 5EYPA 1L9KA 3OO0A 1T4DA 4ZDJA 4PQFA 4TTIA 4LSZA 5LJLA 3HJTA 4Z7QB 3WB9A 3RIEA 1KI7A 1Z6XA 1UDCA 2COUA 2IY9A 2VI5A 3OOJA 2IUSA 4EJ2A 1BDHA 4W6ZA 4X0EA 1E6LA 4PFJA 1OZHA 4TS9A 4ALLA 1HLGA 5BSUA 2VZ0A 1KSFX 1P7VA 4OL0A 1IOVA 4KFUA 5EE3A 4MSUA 4EF4A 3OC0A 2FZLA 4LK2A 2X5OA 2Z9BA 3LCJA 3AQIA 3ON5A 4YP1A 2Q1WA 1T9AA 3A37A 4PG7A 1ODTC 1J1ZA 3GV0A 1O94D 2VPPA 4G4IA 3DE4X 4QXAA 4CT0A 3NWJA 3UXEA 2VRCA 3CH7A 4J91A 1SD5A 4AL4A 4NI5A 1PDOA 4RZ2A 3NHLA 2IS4A 1S02A 2ZI3A 1UDBA 3KOWA 1Z4IA 4N5HX 2O3RA 3VX3A 4B5LA 2GM5A 4DEXA 4FGUA