3DFUA

Crystal structure of a putative rossmann-like dehydrogenase (cgl2689) from corynebacterium glutamicum at 2.07 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
QAPRLRVGIFDDGSSTVNMAEKLDSVGHYVTVLHAPEDIRDFELVVIDAHGVEGYVEKLSAFARRGQMFLHTSLTHGITVMDPLETSGGIVMSAHPIGQDRWVASALDELGETIVGLLVGELGGSIVEIADDKRAQLAAALTYAGFLSTLQRDASYFLDEFLGDPDVTSDIVMDSAQQFQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQDIELWAIQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized Protein from 6-Phosphogluconate Dehydrogenas
publication title Crystal structure of Protein of Unknown Function from the 6-Phosphogluconate Dehydrogenase-Like Family (NP_601885.1) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 2.07 A resolution
rcsb
source organism Corynebacterium glutamicum
total genus 74
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10727 Rossmann-like Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.40 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dfuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfuA01
1H93A 3TDKA 1EBFA 1GTMA 2IZ1A 1ISHA 3OIFA 5JDIA 4UUOA 4X54A 2J3JA 3JQBC 3PZRA 1BDBA 4YACA 3LYLA 1IPFA 1EUDA 1HE4A 5T67A 3ETDA 1LRLA 1RYEA 1FDVA 4BQPA 4PZCA 4YT2A 4FS3A 1WNTA 1NPTO 1KS9A 3DEYX 1Y7TA 4ZGWA 2XXJA 2EW2A 5KKAA 1PQPA 1X7DA 3PHHA 3PWSA 1L7EA 4R3WA 4OM8A 3JYLA 1E6WA 4E13A 4JBHA 1LUAA 3JQCA 4FFNA 3JD2A 2AQHA 3VPFA 2CUKA 5JY1A 5CDGA 1XYGA 1PX0A 4TWRA 4AJLA 3HWRA 3ZU3A 1Q0LA 3F6YA 1WDMA 4A2CA 1NFQA 4NZ9A 5A03A 3U09A 1LQUA 1VM6A 2UUPA 2UUOA 1PGQA 3PDUA 4BKPA 4YBZA 2ZJ1A 1NPDA 1PZEA 1ISGA 5CEJA 2D3TA 3OBBA 1EFKA 1GAEO 1D8AA 2Z5LA 3HQ4O 2JCVA 5CPBA 4NH4A 4JP2A 3KYBA 3LZ6A 2B37A 5KOIA 4FGWA 5A9SB 4WUVA 3S8MA 1PZGA 1OAAA 1E1KA 5COAA 1GY8A 4EJMA 3IP3A 3TFQA 1ULSA 3WJ7A 4ZA2A 1Q0QA 5KVCA 4DA9A 1I5RA 1YOVA 1SEVA 1XHLA 1GQ2A 2B0JA 1F06A 1MA0A 1K3TA 1SO8A 3KZVA 1ENPA 4R54A 2DFVA 3HDQA 2VNSA 2DUUA 4Y6SA 3UVEA 4RCVA 4D44A 4OQZA 1MXHA 1HRDA 4UVHA 1KOLA 2RHCA 5JAIA 4XRGA 5ILOA 1EVIA 5F1OA 2ZB8A 1DC6A 1NP3A 4GKVA 4FFRA 2NQ8A 2C0CA 2GN6A 4YT5A 1P1JA 1CF2O 1W8DA 1U1IA 1LLQA 2IXBA 4RL6A 1D1TA 1NR7A 2EERA 5H82A 2BH9A 3MJCA 2DLDA 2Q1SA 3AY7A 3SXPA 3VPSA 2QHXA 4BMVA 4TQGA 1A7AA 1E5QA 1U3TA 4RZHA 2ZYGA 4E2WA 1U4OA 4A7PA 3CXRA 5TSDA 1GEGA 1ZEJA 3AU8A 4LVCA 1Y5RA 2F00A 3UF0A 4CMKA 5C3MA 2GPTA 4FJ0A 4Q3NA 3DMYA 4R1NA 3I4FA 5EJ2A 2Y0EA 5KVQA 2R6JA 1T24A 4CQMB 3ROMA 4DIFA 5IXSA 2DBQA 1X15A 2DTXA 3JD4A 3DXFA 1M75A 3AOGA 4XB2A 1PJSA 4Z6KA 5IAAA 4M8SA 1VE9A 4L73A 3W8FA 1J4AA 3DWFA 1QORA 2E4AA 2WYUA 3IQDB 1WXDA 3V2UA 1UH5A 5GZ3A 3DAGA 3DZJA 4O0LA 3WMWA 1B8PA 1EBUA 2HLPA 4J91A 1PS0A 4W4TA 3RIHA 3JQFC 4K6CA 2YHIA 3K8ZA 3DZHA 1YDEA 1N1GA 3Q2IA 4NQZA 5CEFA 5JDCA 2NTVA 3RVDA 4F45A 3GK3A 3V8BA 3IDSA 4RZIA 4J6FA 4CUZA 3F1KA 4OKIA 2IEDA 4B4UA 1DEHA 1D4FA 1ZFNA 2C20A 1LU9A 3D4PA 4FJ1A 2SCUA 1DDOA 1VSUA 1UXGA 2BI7A 3I83A 4QECA 4YVFA 1VI2A 3TFOA 3C7CB 1NX6A 2Q1UA 4IY1A 1NWHA 3OJEA 2NVUB 4IM7A 3OMLA 1BVUA 1GZ6A 1BW9A 3OIDA 1I8TA 4L0QA 5G0TA 4TROA 2CFCA 4FPXA 2B35A 3HADA 1GCUA 3JQEA 4J1QA 2HUNA 4BNTA 1WMAA 1XQ1A 2I3AA 2PKRA 5KJ1A 3I9OA 3FTPA 3QWBA 1ADCA 4D3DA 4BO1A 4A5OA 4XEHA 3CINA 5L4SA 2ILTA 5BR7A 1P1IA 2JKVA 4PZDA 2NTJA 3W4KA 4ZVVA 1WPQA 4PVCA 3H2ZA 1T1SA 1OBFO 3KSUA 4IDFA 5A04A 3OHSX 4BNZA 4EZBA 3SC6A 4PLYA 3OJFA 5C7OO 2JAHA 1ZW1A 4ZQBA 1KEWA 1ZKMA 3AU9A 3KM0A 1PS8A 1UP7A 2D8AA 4LMPA 2NU7A 2POQX 4AFNA 4G81A 1A9YA 3QVWA 3S2GA 2D0IA 3RJ5A 3S55A 4BB6A 4JQCA 4E0BA 3FHLA 2NV6A 1HLPA 4JBGA 1YL6A 1VRWA 3M1AA 2Y1DA 3KETA 2WEKA 2O3UA 3G49A 4XYLA 1VL0A 1ZSVA 2J3HA 3NYWA 4LCEA 3KOUA 1ENOA 1YKFA 3O26A 3IKTA 1FDSA 3TZQA 5DNAA 3ZNPA 4AVYA 1DAOA 2ZCVA 1K6IA 4HNGA 4BV9A 3B1KA 2VT2A 2YQ5A 3DMTA 1NXQA 1GL3A 1Z82A 1XKQA 5DCYA 1NQTA 4GH5A 3EMKA 4NBTA 5DN9A 1VKOA 2PZLA 3NTRA 3FNFA 3D3EA 2NUAA 5TC4A 5CEEA 2P2SA 4BGIA 2AE2A 1YO6A 4IXTA 4FFLA 4NJMA 1ZMTA 1FDTA 1U3VA 4BNLA 3D7LA 4JBIA 4D42A 3G3EA 4GX5A 2AXQA 3VZSA 3GVCA 2B83A 1KVRA 4LRTB 5JS6A 4FBGA 1W4ZA 3FNHA 1GZ3A 3UCFA 4QO7A 1H9BA 1F0YA 3D3WB 3NDIA 5I9MA 3KB6A 4I5FA 3WIEA 1C1XA 4RGBA 4N18A 2YDYA 5DP2A 3SJ7A 3GH3A 3TZHA 4A10A 4XYMA 1RPNA 2YV1A 3VZRA 5K0ZA 2EKLA 4YQYA 1TLTA 4RDHA 4ZQHA 5C7IO 2AA3A 2GN4A 3B20A 4LMRA 1MG5A 2FPGA 4DWVA 3PIIA 4XR4A 4Y98A 4CMIB 2VWQA 4BKQA 4D43A 4B7CA 4N5MA 2VUSA 5AOVA 1HKUA 2VWPA 4PFJA 1DC5A 3BMNB 3K73O 4LVUA 3U5TA 1B16A 1ONPA 1ZIDA 3D64A 3UOGA 3G1UA 2WYWA 2QRKA 2J6IA 2YQ4A 4F6CA 4LN1A 1LQTA 4Y9DA 1G1AA 3OF2A 4H3VA 3P7MA 1QLJA 1PIWA 1OC2A 1DFGA 3ZV5A 4CMHA 3WWZA 1YJQA 4AJOA 4RVFA 3UXYA 2P9CA 1HETA 1P31A 4DIOA 2GCGA 3TQHA 2O4UX 1UXKA 3K5PA 4DMMA 5KWEA 3SC4A 2C29D 1R16A 4IDGA 5KJ6A 1M6WA 3P5SA 1KERA 1P1HA 3D0OA 1WMBA 3IUPA 3GRPA 4IQGA 3F5QA 4D79A 4BO0A 5CDTA 4E6PA 2G17A 5FI3A 1QXSA 4UREA 2OOSA 2X9GA 2H5LA 3R3SA 1HE2A 1BRMA 5AQ1A 5EQFA 3CZRA 1Y5MA 1K89A 4PRKA 1AXGA 1F8GA 4B8ZA 1PJBA 1LBEA 2VRCA 3MCVA 1GZ4A 5KNLA 4J2HA 1Z7EA 2IODA 1UZNA 5KCZA 2EEZA 4CQMD 1ZSNA 1ADBA 2QX7A 1HE5A 4Q9NA 4R1TA 3PJGA 2ZQZA 3P2YA 3U4CA 1NASA 1A7KA 3HE3A 2ZQYA 3OP4A 2X5JO 3JQAA 3JQ6A 2FWMX 5L7WA 1U5AA 2PD4A 4MO2A 1PWZA 4NG5A 4TMFA 1CERA 1VC2A 3EW7A 1BTOA 2C7GA 4F6LA 1OI7A 4B4VA 4NBWA 3KSZO 1BXKA 3GG2A 3ZV4A 2DQ4A 1Y9AA 1HSOA 5KTKA 1R4MA 2WWRA 5TLSA 3GEGA 4J7UA 3AUAA 2GASA 3RAJA 4G65A 3GNTA 3I52A 3C3XA 1IY8A 3GNQA 5I9NA 2B5VA 3GMSA 1H6CA 1JWBB 4H15A 4UUNA 3C1OA 3RSHA 3GHHA 1IUKA 2GLXA 4ALIA 4MJLA 2DFDA 3PFWO 3PZBA 4BNFA 2PK3A 3LC1O 4CLXA 2FHSA 3MOIA 2BRUA 1A71A 1E1NA 5G4KB 3NV9A 1WP4A 1P1FA 1LC0A 3AUUA 3QRWA 5C5IA 1M2WA 4IDEA 5U1PA 2EJWA 1ZO8A 2GN9A 3WGQA 3I6QA 3I9KA 4PLPA 4U0KA 3SLKA 1X14A 2EIHA 1T2CA 4YCAA 3PWZA 4DLAA 4Z3DA 1RYDA 2CVQA 4F46A 1AHHA 1S6YA 4KZPA 3NTQA 2XF8A 2PH5A 2IZ0A 4D41A 3WGIA 5L51A 3CMMA 3CH6A 4S3MA 2O7QA 3HN7A 5FI5A 2IZZA 4OIMA 5I9LA 3H9GA 1E6UA 3RD5A 1YQGA 3WJAA 2HK7A 4S1VA 4NPCA 4BNXA 3ZI0A 1FK8A 1WDLA 2YV3A 3L4BA 3FPLA 3CTMA 1U2GA 3GAFA 1R0LA 4UUMA 1F12A 4FR5A 1YWGO 3AW9A 2ZB4A 3KO8A 2XXBA 1Q7GA 3RBXA 1IHXA 1LNQA 2YDXA 4IUYA 1KETA 1ZK1A 2B4TO 4KWIA 3UCXA 4A73A 4ALLA 4BMNA 4CLOB 2B4QA 2HAEA 3WS7A 5A06A 1C0IA 2UDPA 3KBOA 1UXHA 5DOZA 2Y99A 4CM8B 3ZDFA 5T57A 2P68A 1LSOA 3ANLA 3RUAA 5G4LA 3JQ7A 3S2FA 4MVJH 4QSMA 1UAGA 2JCXA 3KEQA 4XCVA 3KYDB 2RH8A 1B0AA 1H0KA 2P5UA 2VYVA 1JQBA 1U7HA 5GMOA 1PZHA 2QQ5A 1DXYA 2J5QA 4BQRA 5C37A 3PJEA 4CUKA 5DCUA 2BELA 1H2HA 2HDHA 4NU6A 4B3HA 4B3JA 1ZXLA 3I9JA 1ZBQA 3L9XA 1B3RA 4UVIA 1GPDG 3FF4A 1UJMA 4WLUA 4P4GA 1IYZA 3O38A 2X9VA 4LISA 4W6ZA 1ZK3A 3UGKA 1ZZEA 5T8KA 2C59A 4WJZA 5FFFA 4E31A 1VL8A 4WCFC 4GX1A 3ZWOA 2ZIZA 2PWZA 3B1JA 3IS3A 2YW9A 3WFJA 4DRYA 2EWMA 2VHYA 2NM0A 2WM3A 2G1UA 2O3QA 1ZK0A 2RIRA 1D1SA 3DB2A 4J1TA 2YFQA 3HDJA 4UULA 9LDBA 2HCTA 3IMFA 3WG9A 2PZKA 3HN2A 4OXYA 3RKUA 1Q0HA 4JXKA 4WLVA 4L74A 4E21A 3EUWA 1A72A 2EW8A 3ONDA 4P38A 1GUZA 5HTOA 3GGOA 3Q1LA 4ZHSA 2C2YA 4W9NC 4WGGA 4YAIA 4TZTA 2O23A 3QJ5A 1UDBA 3QWHA 1EVZA 2VCYA 4B7UA 3BAZA 3BTSA 5BQFA 3WGTA 5I7EA 2D59A 4RPKA 1LEHA 4D0SA 5IN5A 3PWKA 3U4HA 3FCOA 3H4VA 4FC7A 2X23A 3K31A 3VPGA 3D4OA 4I8XA 3ZWYA 2Q99A 3DBLB 1DIAA 5U4QA 4HKTA 3CIFA 3AI1A 3E48A 4UVDA 3EZYA 1EDOA 4MVJP 3NT5A 1NHWA 2X9NA 2ZB7A 1NYTA 2HO5A 4FN4A 1QV6A 4CODB 3O9ZA 4E2ZA 1UDAA 2CVOA 2X1HA 2NTNA 1LDBA 4JN6B 4KP7A 1PGNA 1SC6A 1EZ4A 2V65A 3DBVO 4YJHB 4PCVA 1I32A 1XU7A 3SBOA 4RPGA 1ID1A 2EP7A 5A3VA 3BHJA 3WMXA 3E1KA 1BG6A 3LT4A 4CL3A 2O2SA 3ZWBA 2G5CA 3GQVA 1X1EA 4WLFA 4YAEA 1LC3A 1BXGA 1LRJA 2W2LD 4IDAA 5IZCC 4YJFB 4H7PA 3EY4A 3JCZA 3ZW8A 3ANMA 2VWGA 1NTOA 3UW3A 2UAGA 2ZCUA 1R4NA 1YJ8A 4PIVA 3JQ8B 2GRAA 3NGLA 1H5QA 2O3SA 4R1SA 1ZMOA 3CKYA 3U0BA 4ZD6A 3ZZNA 3F9IA 2NWQA 4CLRA 3OIGA 4N5LA 2IXAA 3VPHA 1P74A 4XA8A 4YB8A 4TRJA 2O3JA 5JCXA 1E1LA 2Y05A 3O8QA 1DRUA 1Q1NA 1T2AA 3JQGA 1UXIA 4PLFA 3DZKA 3HNPA 1OFGA 2O2YA 1CQIA 5BSEA 2JD1A 1KEPA 4IS3A 1QMGA 1A4IA 2QRJA 4G2NA 2Y0CA 4U8GA 4WCFB 5TT1A 2VHVA 4ESOA 2YUTA 4PGFA 1DHRA 5F1PA 4PG4A 3SX2A 1FF9A 1RM4A 1VJ1A 4M49A 5CDSA 2NNLD 1DIGA 3OEWA 4YJGA 3W8DA 2R2GA 3HHPA 2V7PA 3HJAA 3PPIA 3QW2A 5EQDA 4NNJA 3ZW9A 1B14A 1E3LA 2BLLA 3H7AA 5IJZA 3ORFA 1V35A 4B79A 4ND5A 4JCOA 3NX4A 3OQ1A 4QTZA 2VZ8A 3PXXA 1ISJA 2JD2A 4HNHA 1DSSG 3HFSA 2Q2WA 3I3OA 3MWDB 5LDGA 2ZJ0A 2CZCA 1QLHA 3ZNQA 1FMCA 5HM8A 1XR3A 4GMGA 3VHRA 5ITWA 4R5HA 1KYQA 1LLDA 3MJTA 4NR0A 2WYVA 3H9JA 4ZRMA 4WEQA 4BNIA 5JW6A 1O95A 4RVSA 1XU9A 3NGXA 2H63A 4XIJA 1P0FA 1QKIA 4OQYA 4JIGA 3Q9UA 4B3IA 3AOEC 2I66A 2P4HX 2OO5A 4YAGA 4JJIA 4KTVE 1JKJA 4E30A 3AUSA 4BHTA 2B36A 2OP1A 3KYCA 3OA2A 4D46A 4KQXA 5A3JA 5JAMA 1QG6A 4FFMA 3C7DB 3VDRA 2GR9A 3F3SA 1XWFA 4ZQEA 1YDWA 2NU9A 1T2FA 1GQQA 1DPGA 3ENNA 3PHGA 3NUGA 3BMQA 3OSUA 5L7TA 1YL7A 3MEQA 1HDOA 4M86A 4PG8A 5C7LO 1GEEA 1SAYA 1TI7A 1BVRA 3MOGA 5K6AC 3ZCXA 3U62A 3ZWMA 1GUYA 1V3TA 5K9ZA 3ASVA 2HMVA 3GZNB 2P4QA 4NHEA 2W2KA 4GWKA 3GF4A 4BO7A 2FRDA 1N7HA 3FNGA 4L4XA 3TOXA 3RUCA 2DU8A 3RUIA 5HWSA 4L4RA 2W8ZA 9LDTA 1JLLA 1IL0A 5CHEA 3DBHB 1VJ0A 2PY6A 2FSVA 2GERA 1YB1A 2IRWA 3R6DA 2VNAA 2FMUA 2P5YA 5JMPA 4RORA 5F21A 3WGOA 4BGEA 4MKXA 3U4DA 4OXKA 5CP8A 4DLLA 1U3WA 1NQ5A 3NTOA 1ADFA 1RM0A 1SBYA 3Q9NA 1UXJA 3JD0A 2Q1TA 4TSKA 4Q39A 2V6BA 1I3KA 2X86A 2CSUA 4DC0A 1KC1A 3K9QO 5I8ZA 7MDHA 2FSSA 1MXFA 3HSKA 2BGKA 3DQPA 5ITVA 2FP4A 3A06A 3DDNA 4E5KA 4K9DA 1YQXA 4JX8A 2OBNA 1X0XA 4I08A 4Y8VA 4Q3EA 5BSFA 4FD3A 3W6ZA 4XDZA 4D45A 1WDKA 5AVOA 2X7HA 3DC2A 4YJDA 3TOZA 2JHFA 1ISMA 3UH1A 2FR8A 4IQ0A 5GZ1A 5BNTA 4W7IA 2HU2A 2TMDA 1ISIA 2Y1EA 3DO5A 5HRUA 3RUFA 1HSZA 4FFOA 4BS9A 5TF4A 1TEHA 3DOCA 1H2BA 1YVEI 5CG1A 2Y0DA 3BMOB 4IBOA 1NVMB 4ND2A 4XGKA 2I6TA 4GVLA 2E49A 3WNQA 3KUXA 4XJSA 2DUWA 1XLTA 3ETGA 5IZ4A 4ZRNA 4CV2A 3PI7A 3A28A 3TWOA 4CMGA 1PTJA 3DHEA 3LQFA 2VHXA 2WJPA 3C1AA 2FY8A 4J7XA 3H2SA 4CMEA 5CAEA 4KDFA 3VZPA 1RM3A 3PVZA 4K26A 5I7SA 4URFA 3CE6A 1T4BA 1F8FA 2CNBA 1QV7A 2ZYAA 3FBGA 4K1LA 3JQDA 1PJ4A 2X0IA 4B8WA 4QUKA 4AJPA 3PRJA 1JAXA 1Q2XA 3AM3A 4J3FA 3QIVA 3S1LA 3WICA 3AUTA 2Q46A 3H5NA 3NAQA 2XAAA 2V6GA 2BI8A 4QFDA 4NK5A 1J5PA 2GZ2A 2BFAA 3DFZA 2EG9A 3E18A 1LDEA 4WOJA 4BNMA 1WW8A 3FPCA 5A9SA 2R00A 2HMTA 2CDCA 4N54A 5G2OA 1UAYA 3LDHA 5L7YA 1QYWA 1FJHA 3D5QA 2RAFA 1ZJZA 3INTA 4CM9D 1PJ2A 3DFUA 4HFNA 3RI3A 4MVJF 1EQUA 4CQLB 4BO4A 4J2OA 2FOIA 2XPCA 2BHLA 5JE8A 5U9CA 5ER9A 4AICA 4EI2A 3PJFA 4BOYA 2NACA 3KEOA 5DBFA 3WYBA 4IDBA 5JAZA 3ZHZA 4CM4B 2UVDA 1I0ZA 4OYRA 4RVHA 5L53A 1PL6A 5J23A 4BNUA 1O8CA 4BNVA 2O3TA 5T64A 2ZTLA 2BFPA 2Q4BA 4XD2A 3W4IA 4PLTA 3RU7A 4RF4A 4CR8A 2DTDA 2X22A 4ID9A 1A9ZA 1RM5A 3GGGA 3R0IA 4PLWA 2PZJA 4PLHA 5L3ZA 1PEDA 2DM6A 2XOXA 4BO9A 1I2CA 3I23A 5AXCA 3RKRA 4J90A 3H9EO 1ZH8A 4WNIA 5L4NA 1ZNQO 2Y67A 4EEZA 1U7TA 3L07A 4I9NA 5KVSA 3HFGA 4NDNE 3RC9A 1BDMA 3EVTA 3I9NA 1GCOA 1E3WB 1SNYA 3EDMA 1HZJA 3VZQA 1YBAA 2FR0A 4GQAA 4R16A 2ET6A 1E6EA 2C5AA 2OMEA 1N9GB 4IDCA 1BXZA 5JLAA 4YAKA 3JQ9A 4CQMA 4HY3A 4GAEA 4MPDA 2Q45A 3FWZA 1GUFA 5ICSA 3GN1A 5JAQA 4DMLA 4PLCA 4RVDA 3RCBA 3JQBA 4CLDA 4UEJA 3GPIA 2Y66A 3WTBA 4BVAA 4U7WA 4FGSA 1PJTA 3CUKA 3F5SA 3CPSA 3DL2A 3E5RA 2OUIA 2RH4A 3VVBA 4KMSA 4TRRA 3DAFA 5L40A 2PR2A 4M54A 3OJOA 1LSUA 4RLHA 5DOVA 1XG5A 2PH3A 2WDZA 2BGLA 3WXBA 4EBFA 3UKOA 4MVJE 3I5MA 2OP0A 4UAGA 4BGVA 3ASUA 1PJCA 2IEBA 2WD8A 3VDQA 4B4OA 5EIOA 2W4QA 3DHYA 1I2ZA 2RCYA 5B4VA 1BWSA 1MUUA 1ZSYA 4I9UA 4XWYA 1ORRA 1YH3A 4N7RA 3WGGA 4LRSB 4YRAA 4R5MA 2F1KA 4R41A 3V1UA 3P19A 1AGNA 3IJPA 1QYXA 3K6JA 3VTFA 3PHJA 2AE1A 3DBRB 1TT7A 2NVUA 3GFGA 2Q49A 1MV8A 2I5PO 4OJNA 3H6KA 3JTMA 1O94A 3DTYA 8LDHA 3JYNA 4GX2A 1UZMA 2EXXA 2Q2VA 1KBZA 4GKBA 3OA0A 3A9WA 4RPLA 4CV0A 3FI9A 1A5ZA 2RHRA 3LLVA 3QWIA 2NU6A 4ALKA 4MIOA 4LK3A 1P3DA 4R3NA 3E9MA 2Z1NA 1GDHA 2VZ0A 3H3JA 1HDCA 2PV7A 2DT5A 2OZPA 3ZU2A 4AJNA 4NJOA 2VUUA 1I33A 4NIMA 2GO1A 2JL1A 1JKIA 4KQWA 4BMSA 2NSDA 3INRA 1XCBA 1Z74A 4AJEA 3GEDA 2FR1A 4ZICA 2CMDA 5JBIA 3NJ4A 1NPYA 3LSYA 3H5AA 1DRVA 1B8VA 1HF3A 3GNSA 4JJGA 3DZIA 1DJNA 4OMUA 3BMCB 3GLQA 3K30A 4IQ8A 3DZGA 3LC2O 3NDJA 4E2XA 3MJ4A 1S7CA 1W73A 5B4UA 4R4JA 2DTEA 4BNWA 1MC5A 4RPHA 1O89A 1IHYA 3E8XA 4GLOA 4II2A 4QQRA 3PK0A 2HRBA 4ZN6A 2TMGA 2H1SA 4JNKA 3ZGYA 3H8VA 5A9TA 4YT8A 2DPHA 2O50A 4MKRA 4BO3A 5CDYA 3ANNA 1E3EA 1ARZA 3ZWVA 1HDGO 4OGWA 1PGPA 4UVGA 4EUHA 2BF7A 3BTOA 1OMOA 3TJRA 4DBZA 2VYND 1JVBA 2AG8A 3RC1A 2AQ8A 2QZZA 4ZQFA 3ZV3A 3Q6IA 3PLNA 4RO0A 3KV3O 5F1KA 1B3BA 4FJ2A 3C1TA 1DLJA 1KVTA 1KY5A 3GDOA 1DOHA 4ALMA 4IIVA 4FW8A 3FBTA 4U5QA 3VH2A 3JQFA 4A0SA 3C7AA 1QYDA 2BGMA 4J1SA 2EHDA 1MC4A 4E5YA 1JAYA 1E7MA 1KY4A 1LLCA 4INAA 5G0WA 2E82A 3WSWA 1QYCA 4R9SA 3RFXA 3ZWCA 4CM3A 5JDIC 1XQ6A 4IXWA 1KVQA 4D3FA 4R51A 3D3WA 3TSCA 3ZWPA 4AJ4A 4YYZA 2WE7A 4CR7A 4D0RA 3PYMA 4OH1A 4PG6A 2CF6A 2WD7B 2VTDA 1Y8QB 2OBYA 3A4VA 2NQTA 1TVEA 5JXWA 4YAJA 5IXYA 4KWHA 5DF1A 1CIVA 3L4SO 2JCYA 1SPXA 1SMKA 5LC1A 1GFSA 3C85A 2BFOA 3VH3A 3D4NA 5G0UA 2B69A 4CMIA 2VOJA 4XDYA 3IAHA 3W8EA 4J0FA 4HFMA 4E5PA 3ON5A 3BMNA 1Q7CA 4Y6RA 3VVCA 2ZTVA 4I5EA 4R69A 1D7OA 3M6IA 3K2BA 3QQPA 2O7SA 3KVOA 4MVJG 4MIYA 4MVJM 4KUEA 4GBJA 1C1DB 1MFPA 3N58A 1N7GA 5JNLA 3IOYA 3WLFA 1NQOA 1NNUA 2J3IA 3H3FA 3JYQA 3GEMA 2DVMA 1GYRA 4JP3A 3HUDA 4WLOA 4ND4A 4ZQGA 4HADA 4IJWA 1N5DA 1ZJYA 4J4BA 2VT3A 3E03A 3GVHA 1JWAB 4GSLA 2YYYA 3RROA 3L6DA 5A5EA 2EKPA 3F4BA 1UZLA 4IZIA 5MDHA 2HJRA 5ILGA 2EF1A 4PZEA 4HXYA 4XIYA 5DULA 3S2IA 3FTNA 4OAQA 3QVXA 3QLJA 3RJ9A 3ADPA 4YQZA 3ONEA 4GL4A 1DC3A 2PNFA 4QX6A 4TRMA 1V9LA 1E7WA 2CDAA 2JJYA 2VTEA 5DZSA 3T4XA 2Y1CA 1DAPA 2BMAA 5HBRA 2W2LA 2X0JA 2OGUA 4DPMA 2EP5A 4LW8A 4ALJA 3QP9A 4Z9YA 1HTBA 3I4CA 1E3IA 4BNHA 5CG2A 2V6MA 1MGOA 1E7QA 5B12A 1OZAA 3BZUA 4TZKA 1WLYA 3B6ZA 4I9HA 2H6EA 4IGFA 3T7EA 1TT5B 5AXDA 5THKA 1VLLA 4MP6A 1I3NA 4J43A 1P1KA 2E6UX 3GN2A 1NR1A 4RQTA 3HB5X 1P77A 5IN4A 3WX0A 2LDBA 4EYEA 1YGYA 3AM4A 1PJQA 1U9JA 2JFGA 3OJ0A 3QE3A 1LDGA 3QY9A 4WECA 1HL3A 3V1YA 4N5NA 4CM1A 4BO2A 2CDBA 3WIDA 3WSVA 3LU1A 1Z7BA 1PJ3A 2GUGA 4GPD1 8ADHA 4ND1A 3KTDA 1YB5A 4GMFA 4EJ0A 4XGNA 4R9RA 3WGYA 2X8LA 2A94A 4NFYA 3PFFA 3E9NA 1Y6JA 4EDFA 5JDCC 4DPKA 1UUFA 2I99A 1PL7A 3LVFO 3SEFA 2HSDA 1HT0A 2Y1GA 3B1FA 1DO8A 2Y93A 3LF2A 4C4OA 1P1RA 2EGGA 3H9QA 2IYPA 4RQUA 3UAGA 1ULUA 2I65A 5TRTA 1B2LA 1PQUA 3MJSA 4OO3A 3CEAA 2AW5A 1LX6A 1CQJA 5JC1A 3QVTA 1R0KA 1DFHA 3X2EA 5KJEA 2HMWA 3RFTA 5LDHA 4AJ1A 4DXHA 5G4KA 1V3VA 1JDJA 2I67A 4E2YA 3FNEA 2Z95A 3UICA 3WQQA 4HV4A 3OM9A 3SLGA 3AI2A 1MP0A 1IULA 3VC7A 2X5OA 5CFZA 3PP8A 2HK8A 4J9UE 4E5MA 4AJ2A 4DLBA 3ULKA 1YOVB 5BSHA 1H6DA 1PZFA 5DDIP 1PGJA 4PRLA 3GGPA 1HE3A 1I3MA 1T2DA 5LCXA 2HKIA 5I7VA 1MB4A 2R00C 3E5MA 1N2SA 1P45A 1I01A 3ADOA 4HFJA 1PU2A 4I5DA 2JFHA 2QRLA 1ENZA 3LT0A 4HX5A 3RUEA 6ADHA 3IIEA 4BNNA 3PGJA 3K96A 4L4SA 4BNKA 4LGVA 1DBVO 1N1EA 4MP3A 4U0JA 4XR9A 4XYGA 1WZIA 1BHSA 3GR6A 4YRBA 3PTZA 2PFGA 2QYSA 2QZ9A 4CLOA 2CVZA 4YEDA 4D3SA 3I1JA 3WOHA 5ER6A 3E9QA 4IGEA 4BKRA 3DTTA 4BO6A 4CM8A 1EFLA 5DCWA 3DR3A 5JCJD 4CUJA 1IZ9A 2PTGA 3GZ4A 2EV9A 2H9IA 4WLNA 4XZ3A 4IJVA 3KYDA 4KUGA 5ENDA 1XA0A 3DMTC 2JHGA 4W7HA 3RQSA 3FWNA 4XQ9A 1RKXA 2NU8A 5EINA 3WBFA 1WAMA 5FYDA 4RDIA 1PR3A 3GA0A 4YWJA 1YONA 1DIBA 4CMJA 3AK4A 1FXSA 1X7HA 2HRZA 1NFRA 1LDNA 1QR6A 1MFZA 5F5NA 4JLWA 4B4WA 3TL3A 3F47A 3BXXA 3ZU5A 1EE2A 4DYVA 2Q2QA 4ND3A 4Y67A 4BV8A 4D7AA 1C14A 1MLDA 2YHIB 4I1IA 1NBOA 3GPDG 5B37A 5A1TA 1JW9B 1ADGA 2D1YA 7ADHA 3WGHA 1P9LA 4DGSA 4P8RA 3M2PA 3BA1A 1DIHA 3AJRA 1SZJG 4BB5A 5EL0A 3ZHXA 4OSPA 1CETA 4Z0PA 4CMBA 2VUTA 1PSDA 4H16A 3NDRA 3VPXA 2J5KA 4UUPA 4IIUA 1G6KA 2G82A 4XRRA 1GR0A 3Q11A 4KTTE 1SB9A 3ZNNA 2D5AA 1XELA 2AEFA 4QEDA 4XYBA 4ZU3A 4WASA 1VSVA 3KLMX 3GDGA 1BW9B 5KJCA 4M55A 3VKVA 4L76A 3IP1A 5COBA 5GZ6A 4E3ZA 1B26A 1Y1PA 1W0CA 3JYPA 3AY3A 1Y8RB 3HZZA 5JO9A 1LSSA 1QYVA 2Q3EA 4G5HA 3BTVA 5F5LA 2Y1OA 1HYEA 1I30A 1PGOA 3GT0A 4BNYA 3AM5A 4XQGA 3GDFA 1DLIA 5A4DA 1YE3A 2O4CA 5FWNA 4M89A 2PKQO 4FQ8A 5TT0A 2HJSA 4U6SA 3DBLA 1E0DA 1I2BA 3NEPX 4IPTA 4IMRA 3UCEA 1QP8A 2DC1A 3GG9A 2X5KO 3ICPA 1VJTA 4YR9A 1LTHR 5DP1A 1P0CA 1YL5A 3QWFA 1UR5A 1ZXBA 3Q2KA 1O5IA 3FSRA 4JGBA 1A27A 3PJDA 1WWKA 2A9FA 1X1TA 4HBGA 1IPEA 1VKNA 5FF9A 3RFVA 3BHMA 3RASA 2Y1FA 3LK7A 1EK6A 4GI2A 5F3RA 1ONNA 3BYZA 4YJHA 4QT0A 3VTZA 3WLEA 4MVJD 1J49A 1HZZA 2GSDA 2ZYDA 3GHYA 1YB4A 4XKJA 5TJ9A 5THQA 3ZHBA 4L9RA 3TZCA 4B7XA 3I9MA 4FOOA 4GVXA 2HMUA 1ML3A 1C3VA 4K28A 4YJFA 5DBIA 3ZH2A 2DKNA 4KDEA 4YDRA 4CM9A 1XEAA 1NM5A 3WQRA 1TB4A 3JQ8A 5KVVA 3SVTA 3KLPX 1NAHA 4RVGA 4JK3A 2ZKLA 4DYDA 5EERA 1I36A 1O0SA 2J3KA 2B4RO 2AEMA 1R15A 3JSAA 2I9PA 4R1UA 5ADHA 1CWUA 2FPPA 3FR7A 4BKOA 3DONA 2PGLA 4NJMB 3ITDA 3ZNOA 1J0XO 1E77A 1CDOA 3QSGA 3GAZA 3TF5A 1LDMA 5GY7A 4MIEA 1ZUD1 3GOHA 1NVTA 2EGHA 1ZVMA 3KXDA 3LLSA 2VN8A 4NBRA 1AHIA 4O6VA 4WCFA 1HEUA 1PR9A 3H5RA 3N74A 5JC8A 3TN7A 4UVEA 4Z0TA 4E5NA 1JU9A 2EKQA 4WE3A 4YTEA 3ZU4A 1LSJA 1R6DA 4GSKA 3VKUA 4WNCA 3HDHA 2JFFA 4PG5A 2OHXA 1C1XB 1KVSA 4RVUA 4IINA 4PN3A 1M6HA 1R66A 4PLZA 1E7YA 3PDJA 3FD8A 4P4LA 4E12A 4M1QA 3IC5A 4P4NA 1AXEA 3U3XA 2CY0A 2BD0A 4Q3AA 4W9NA 3VAZA 1U5CA 4P22A 4DIBA 5IDWA 1DHTA 4LCJA 4OL9A 3V2HA 3N7UA 1Q7BA 4FIZA 3ROQA 4BUCA 3WNVA 4NBVA 3OQBA 1GD1O 1KVUA 3PHIA 4LSMA 4OKNA 2PLAA 4NI5A 4UEOA 4CM5A 1MG0A 4CV1A 3EVNA 4U6QA 4J7CA 1E92A 1OOEA 1GYQA 5BNFA 1Y8RA 3NRCA 3PQEA 4ITUA 3R3JA 1C0LA 1XDWA 1NHGA 4TKLA 2JAPA 1LLUA 2AG5A 2V6FA 2YV2A 3EZLA 3O03A 4DQUA 3ZWXA 3ZWNA 4FDAA 2QIOA 1A4UA 5L95A 3MTGA 3STHA 1FDUA 3GVIA 5JYDA 4IS2A 3GMDA 3VH1A 1CRWG 2O3RA 3UHAA 4FOSA 4XQEA 4DUPA 5IZCA 3L4BC 3T4EA 2HQ1A 3E6AA 4L8VA 4HFRA 3ZHYA 2UYYA 5IFLA 3K92A 1JA9A 1GPJA 3GZNA 4O63O 1Z6ZA 2GF2A 4RLSA 3MZ0A 2Q50A 3FRJA 1I10A 1P33A 1PWXA 3DBHA 3JD1A 2VHZA 3KHUA 4L75A 1T25A 4MDHA 4GLLA 4GX0A 1I24A 2AHRA 2O48X 3MTJA 3HG7A 1HXHA 4AJKA 2C07A 4M87A 3SJUA 2VQ3A 1VL6A 4CM7A 4BO5A 3RC7A 3JQAB 1N92A 3PIDA 1DIRA 5TQVA 3WWYA 3L9WA 4PLGA 3X2FA 2CD9A 1EDZA 5KKCA 3H9UA 1E7RA 1EQ2A 4J49A 4CPDA 1RJWA 1E7SA 4J4HA 4Z9FA 2YZ7A 1F17A 3PYXA 4XGIA 4YA6A 1DB3A 4YRDA 3F1LA 4EEXA 2E48A 1HWYA 2DPGA 3R1IA 4PG7A 3L0DA 4R01A 4YPOA 1R4MB 2C5EA 5COQA 1AUPA 1U28A 4KOAA 2NVBA 5T8KC 1SEPA 4C7KA 4ROSA 4XJTA 4OSOA 1F14A 4LSWA 1VPDA 1Z75A 3ITKA 2CF5A 3F4LA 3RWBA 2G0TA 3EYWA 3ZWAA 4KUHA 4QO8A 4AL4A 1WZEA 2VYNA 3E82A 1M76A 4WKGA 3QVOA 5AXBA 3QHAA 4Q3BA 1CYDA 3RU9A 4BO8A 3BMOA 2HK9A 1LXCA 2FZWA 4BNJA 1AE1A 5A02A 4II3A 5HA5A 2E37A 5TGDA 1BGVA 3EGOA 4FFPA 5TNXA 1EUZA 3LT1A 1FDWA 5BSGA 3IJRA 3AOEA 1N8KA 3RUDA 1HDRA 2WE8A 1H9AA 5A05A 3ENKA 3FN4A 4GGOA 2FPIA 4J0EA 4ALNA 3MJVA 2WTBA 3LC7O 3TZKA 3PQDA 4JROA 1R0SA 4J16A 4BIIA 1R12A 5CPFA 1PS9A 3BHIA 3O4RA 1DFIA 2D5CA 3VOSA 1LI4A 1L7DA 1IOLA 3QWAA 1JKFA 3M2TA 2BKAA 2ZATA 5L45A 1U2DA 2HMSA 4MVJI 3U49A 4IDDA 3OICA 4RF2A 4NK4A 3WB9A 5K6AA 1H6BA 1SB8A 3OECA 4GGPA 3GUCA 3NT2A 4E33A 3RBVA 5A5FA 1EK5A 3G1TA 3UN1A 5G0SA 4XYEA 2WMDA 3WQSB 2PZMA 4Z3KA 3ST7A 2UV8A 3EC7A 4BNGA 4CJXA 4NFHA 5T5QA 1E1MA 1H94A 2X0RA 2P9GA 1UDCA 2FZEA 4CLHA 1U8FO 3QA9A 2A92A 1IB6A 3CSDA 3ZWWA 1Y9EA 4NFSA 5JY6A 1H6AA 4CQLA 1SOWA 4GWGA 2YHUA 3H65A 5JFOA 4DQVA 4EJ6A 4OOEA 1B8UA 5BT9A 5B4TA 4O1MA 3V5NA 3JQ7B 4RF3A 4CM4A 4ZJUA 1T2EA 3AWDA 1ONOA 3EAGA 1U3UA 3C24A 1DRWA 1YRLA 2GYYA 3G17A 4A03A 3JV7A 4RJTA 3GUYA 1EVYA 1NVGA 3U4IA 4OOFA 1B7GO 2GZ1A 4EUEA 5IF3A 1LJ8A 1M67A 2OFPA 5AXAA 2NVWA 5ICMA 3D1LA 2Q4EA 5EPOA 5IDYA 1V3UA 2DBRA 4J9VA 2YFHA 1YXMA 3L6OO 3AFNA 4BGUA 1HDZA 1I3LA 2DBZA 4C7JA 2J8ZA 5IDXA 1UP4A 1E3SA 2YY7A 4TRNA 3GFBA 3TNLA 2C54A 1YBVA 1E3WA 1IZ0A 4I5GA 3L6EA 4WLEA 4DL9A 5EN4A 1LRKA 1OC4A 2B5WA 1N9GA 3OFSA 3ONFA 5A9RA 4QXMA 2IE0A 5ES3A 4A26A 2GGSA 2G76A 3D5TA 2IYOA 4IMPA 1ZK2A 3DZBA 4K6FA 3LT2A 1V0JA 2OXIA 2X0NA 3ZV6A 4CR6A 5I7FA 5EESA 2LDXA 3WTCA 5IDQA 3PHLA 1NQAO 2EJVA 2PGJA 1C0KA 3FR8A 4WPGA 3WDSA 5MGBA 4OXNA 2VHWA 1T1RA 4ONEA 2P91A 3COSA 5DBGA 3KRTA 4QFCA 2VZ9A 3WYCA 3WR5A 5TJHA 2GZ3A 3IUSA 2VRBA 1EMDA 3TRIA 5FEUA 5JO0A 4A27A 4Z9XA 2Z1MA 1V6AA 5DT9A 2AEJA 3W1VA 5B1YA 4EUFA 3GRKA 3AFMA 3ROKA 2GDZA 2J5RA 3GVXA 2NADA 1TXGA 1V8BA 4E32A 2OORA 1HYGA 1ZCJA 1DC4A 3AY6A 3DBRA 3L77A 2BFMA 2IDZA 4XQCA 3PYLA 2I3GA 3WYEA 4AJJA 1HDXA 5JMWA 1X13A 4TVBA 4RPJA 1SCUA 4FCCA 2QG4A 4FSHA 5JYEA 3WGZA 3OJLA 1JTVA 4CV3A 1G0NA 2AMFA 3LF1A 3M1LA 1JN0A 3EHEA 2RBEA 4AG3A 5L9AA 3T7CA 3KSDO 2D4AA 1BXGB 3UFXA 2VOEA 4FC6A 2VRCD 2W98A 1EUCA 3GC6A 2WSBA 4IZHA 5TIIA 4MKZA 1GADO 3PGXA 4DQXA 1R4NB 1KEUA 3BIOA 3G79A 3NKLA 1L1FA 3K2EA 2PD6A 2ZTUA 1W6UA 1B15A 5H83A 1WVGA 5KJFA 1G0OA 4CLRB 1P44A 3IL2A 1HDYA 4HUJA 1GV0A 2DAPA 4RF5A 1BSVA 2GD1O 2D2IA 1HLDA 3F46A 3JQAD 3O8QB 3JQGB 4OHUA 4EITA 1YQDA 1K2WA 2AQKA 1E5LA 2PKQP 3NJ8A 3BMCA 1X7GA 1EE9A 4DREA 4AJIA 4NMHA 3RC2A 3OEYA 2Q1WA 2ZTMA 3Q0EA 3U9LA 4IJUA 2JD0A 6LDHA 2W90A 5BNIA 2NLOA 4F3YA 2PGDA 4DBVO 3ABIA 2A35A 4WEOA 3TPCA 3INGA 5TX7A 2C7VA 1K6XA 4YJGB 3OQ6A 2PA3A 4EW6A 5I8WA 1PJLA 1YS4A 3I9LA 4EGFA 3CZMA 4CLEA 5JCJA 4FB5A 1T26A 4NU5A 4RV9A 4Y6PA 3VH4A 3V2GA 3TL2A 1J6UA 3ROPA 2X4GA 1DJQA 4BKUA 1CJCA 3PLRA 4UEKA 1Y81A 3P2OA 3UUWA 4MP8A 4WOKA 3DOJA 3ETEA 4CM6A 3I6IA 4NBUA 3A14A 4DTIA 2FN7A 4PLVA 1X0VA 4IJKA 1NWCA 4Q3CA 1RWBA 2ZB3A 3V1TC 1GYPA 1ZEMA 3NT4A 5L4LA 1E3JA 1QSGA 4DVJA 4XB1A 3DOOA 3HB4X 3DAPA 3JYOA 4TVOA 4CL8A 3AI3A 3OH8A 1NAIA 2I76A 2P9EA 1IE3A 1KC3A 1YBMA 5TS3A 2WD7A 4ILKA 1Y8QA 2YJZA 3KYCB 4E4YA 1KIFA 2ZK7A 1LDYA 3DHNA 1QRRA 3HDYA 2DBVO 3OETA 3MWEB 5IG2A 4CMEC 1GV1A 4BL5A 3CMCO 2QYTA 3DZFA 5CDUA 5ENVA 4W82A 3B70A 4J1NA 5KIAA 4MINA 1EVJA 1KEVA 3BMQB 1BMDA 4YXFA 3QVSA 4HP8A 3WBBA 4Z0HO 3W4JA 1Z73A 1TA4A 3W6UA 4XX0A 2X58A 3EK2A 1GU7A 1XSEA 2GNAA 3ICCA 1SOVA 2PD3A 1XIVA 5AYVA 3GVPA 1ENYA 1UP6A 1T4DA 2W2KB 5G0VA 5JSFA 2A4KA 1K5HA 1O9BA 1CEQA 3C8MA 1C1DA 4R68A 1D3AA 1HYHA 1O6ZA 4CMCA 3MJEA 4W99A 2C82A 2VYVD 3BTUA 1M66A 4WCDA 4PVDA 2VWHA 1JVSA 2X6TA 3PEFA 1U8XX 1ISFA 3RBZA 1NFFA 4AJHA 3QV1A 1Z45A 4MVJA 5T6BA 1EEHA 1ZK4A 4DC1A 1K0UA 2C2XA 1LA2A 4MOWA 4CMAA 3Q3CA 3GY0A 3IKVA 3S2EA 3WFIA 4Q3DA 3G0OA 5HS6A 3TZ6A 4O59O 4TKMA 4O5OA 2OL4A 3JD3A 4DPLA 1XGKA 4WK6A 4YT4A 4JJFA 1PL8A 1AN9A 3PQFA 3ZN2A 3RUHA 5EMHA 1PQWA 4HWKA 1C0PA 5JPIA 1U4SA 5H81A 1TT5A 1K6JA 5HS4A 2AQIA 1MX3A 2GN8A 4J4TA 1GQYA 2QW8A 3JQ9C 3A1NA 2Y68A 1R37A
chains in the Genus database with same CATH superfamily
1WXQA 3PPWA 1C8BA 3TDKA 1GTMA 2F3QA 3L1UA 3OIFA 3CNOA 3P9RA 2J3JA 4YACA 4MXDA 1BDBA 3SZOA 4YMSA 3WYFA 4ESHA 3PTAA 1T6XA 1W88A 2C1ZA 3BXPA 3ETDA 4KEAA 4WH0A 1RYEA 1FDVA 4PZCA 4KXNA 5E2AA 3O93A 1NPTO 3DEYX 3LBFA 4GNRA 3OLCX 2QV7A 4WBNF 4X66B 1Y7TA 1WR8A 5BW6B 2GPAA 2EW2A 3MWYW 2VJDA 1PQPA 1X7DA 2IEZA 3PWSA 1Y1SA 5ARCA 3NONA 4R3WA 4X6UA 1E6WA 3K70D 4E13A 3A6GA 3HCFA 3JQCA 3N87A 3JD2A 4FFNA 4JBHA 4JLKA 4P92A 4QDZA 1SZDA 5CAEB 5UKDA 2G9QA 1N2CA 1A2OA 1ZHHA 4D4HA 1N9ZA 1MHTA 2PKEA 4Q4LA 5KTTA 1YQTA 2IX9A 3NFRA 1VM6A 3PSHA 4KQJA 1PGQA 2YZKA 5K6TA 2OD7A 4BKPA 4MUMA 4F92B 2ZJ1A 2H3EA 3SSOA 1DZ3A 2I2BA 5I47A 3UIEA 3F74A 4NF2A 3N5KA 1A9PA 1D8AA 4LHYA 3HQ4O 5H9VA 4NH4A 2UZ1B 3EIQA 4C08A 1G4AE 3NAGA 4MNTA 5IFKA 4FGWA 4FM9A 1B43A 3EDRA 5EWJB 4DZRA 5KOJB 3CNBA 2AFHE 1GAJA 4EG6A 3HO1A 1SK9A 4EKGA 4MLDA 5KDDA 4DTCA 4WINA 1OAAA 3F5FA 4J16C 1N0IA 3ZZMA 1GY8A 3KHKA 1N75A 3IHKA 3IP3A 4ON9A 4X1IA 1ULSA 3TSAA 4EJMA 3FZGA 3WJ7A 1V1MB 1H0SA 1HFEL 1Q0QA 1S96A 4NOJA 4DA9A 1G41A 4C2TA 2CDNA 2J9GA 5JS2A 4UMDA 1TZBA 4HWSA 1T0HB 5ETJA 1LTKA 3DL0A 3VZCA 1F48A 3GJ3A 3NBMA 4OBXA 3ZX4A 3EIXA 1SO8A 1MA0A 1E79D 1K3TA 1Y3IA 3K0FB 2DFVA 2PYIA 4Y6SA 5JZMA 4ZDIA 4HNUA 1WPRA 2REXB 3IEXA 3TYXA 3NIGB 4D44A 4OQZA 1Z2CA 4QEKA 4LBVA 1E6KA 4BCCA 1GRCA 3HJTA 5FUQA 4R40A 2ZG6A 4QU0A 4RTRA 5JAIA 3GLGA 4EGAA 3WISA 4AY6A 2ZB8A 3KC2A 2J0EA 1HQCA 4HDSA 4U7TB 2GEUA 3R9XB 1IY0A 1H2AS 4HLUA 4WBXC 1JXQA 4H3HB 4RL6A 1D2EA 3A2KA 1C29B 2EERA 1L8QA 3OZVA 3AY7A 4BVHA 1PUIA 3Q7SA 3GFFA 3FXAA 1A7AA 3MAJA 4N7MA 4TQGA 4BMVA 4DAEA 3CN7A 4MHTA 1U3TA 2WTNA 4Q5IA 1E9VA 3GEHA 5IWAB 1PEYA 2VYFA 2JGDA 3MCWA 4DCCA 1JHYA 3QF7A 4CU5A 2COUA 1Y5RA 3PFCA 4TYMA 2B82A 1JFFB 1H8HD 2O0JA 4P34A 3BIXA 4Z54A 5IAOA 2GPTA 3NHZA 4FJ0A 4MSUA 4Q3NA 2IHBA 2Y0EA 5KVQA 2R6JA 3UFBA 2VO1A 1EJ2A 4DIFA 4TKZA 2WM9B 2C5FA 5H8WA 3JD4A 1NQVA 1M75A 1U8AA 1T2VA 3T1QA 4WFJA 4EX7A 1GPLA 4M8SA 2AJLI 1BYIA 4C3UA 3NWJA 5B7QA 4L5YA 5DV9A 4OL0A 3WLIA 1QORA 1QZTA 1VA4A 3AJAA 3SAJA 2JZOA 3TRDA 4R0MA 1RWKA 1UH5A 5GZ3A 1XD9A 2W93A 4QYIA 3QBEA 3CUEF 1EBUA 1TQHA 2AKYA 1KZ1A 3H99A 3PXAA 2WWIA 4IX1A 1TUIA 4QRDA 1WUKS 6PFKA 2V6JA 2W4MA 1MPXA 2C31A 3KX2A 3DZHA 1YDEA 1Q0PA 3D0KA 3Q2IA 4F85A 4NQZA 4AS3A 5JDCA 4MRMA 3B89A 2QQGA 4KZKA 1M2FA 2PUTA 1QH9A 1XTQA 4N47A 3P9CA 1A8PA 1LD3A 4RZIA 1RKBA 1TKCA 3FIUA 2XOEA 1ZNWA 2GUWA 4GPTA 2IEDA 3LUBA 5DXFA 2G6BA 3NG1A 3VNSA 1NLYA 3CLRC 5B64A 1D4FA 1N6HA 1LU9A 9ABPA 1OJ7A 2DCUA 3RIYA 3EPLA 2V7TA 3VGJA 1UDWA 1EJ0A 1KYTA 1Z0JA 1PR2A 2HFJA 4Q3OA 2WOJA 3TW0A 4M7RA 4EI9A 4YDHB 1UXGA 2PUVA 3ML1A 1WM1A 1K7XB 1YJAA 3DV0A 3KQMA 3C7CB 1NX6A 3TM5A 3I73A 4YRQA 3WWCA 1KOFA 3OJEA 5DM60 3OE5A 1GZ6A 1BW9A 4EOGA 5EFOA 1VHDA 2VPWA 4QLAA 2VQEB 4FPXA 4AN4A 2B35A 2WHPB 1GCUA 4J1QA 3K4PA 2HUNA 2NYRA 4TMVA 4XQ0A 4KMOA 4PC6A 5KTYA 2I3AA 1RAAA 2GHQA 5KJ1A 3I9OA 3F3MA 1YA4A 5MFPA 4Y9UA 5JTTA 3WNCA 4A5OA 2VAVA 1PL0A 4J94A 4BO1A 1Q14A 4EY7A 3HA2A 2ILTA 5BR7A 4OQNA 2Q29A 3I37X 1VQ1A 1A50B 2WZBA 5DX0A 3W4KA 5I7HA 2P0EA 1WPQA 1GPYA 4PVCA 3AONB 3WADA 4DT1A 3RYCB 4IDFA 2TRSB 5A04A 1G1MA 4KV9A 5J63A 1FUIA 2PHZA 3ZEAA 3OHSX 4HRXA 4EZBA 3O8CA 3RADC 4OYHA 4H17A 3OY2A 4FE3A 1RHQA 1L4KA 3FMVA 4FZ5A 2JGLA 3BRQA 3NHWA 4LMPA 3R7DA 4CG0A 1CFJA 4TWIA 4AFNA 4OCZA 4H60A 5DB4A 3CVWA 4C4TA 5K8UA 4MZDA 1SVLA 2D0IA 3A9SA 4BB6A 5FPYA 4B3FX 1LV8A 2NV6A 1JS1X 4YPVA 2O5EA 1HLPA 2Q27A 2Y1LA 3R44A 4MS4B 1Z56C 1HA3A 2Q3MA 4ZPXA 2W2NA 3M1AA 3LRPA 5FPQA 3DE1X 1XRJA 2WEKA 4RA6B 3WKAA 1M1YA 3G49A 2G28A 2NZ8A 1S2MA 2J3HA 2I29A 5AVQA 3KOUA 2J87A 1ENOA 1DXQA 4D4IA 5B3KA 3JU3A 2XQKA 3IQFA 1Y48E 4RABA 5K0LA 3RTBA 2GI4A 1UMKA 3PNVA 2E7ZA 1C3OB 3ZNPA 1B6GA 2ZGVA 4P7BA 2ZIEA 1SC9A 1ZIPA 3MCTA 4TV9F 3SQMA 3W2TA 4BV9A 4Y6GB 2J9YB 4EY6A 3QE9Y 1GKKA 4WXRA 1Z82A 1BX0A 2OAEA 3HFRA 2IP1A 1QE3A 1NQTA 1GSAA 3LPDA 1M1UA 4Z8YA 2PZLA 1ILEA 4D0LB 2UVPA 1Z38A 4NSNA 4KXWA 3EA5A 1O96A 2NUAA 4ZCQA 2XNHA 2P2SA 3Q6MA 4C05A 3OPXA 2MSDB 5JNVA 1XDDA 2UYQA 4IXTA 1O6CA 4OXRA 1IHOA 4NJMA 1ZMTA 1TK2A 4R9UC 1FDTA 2ODPA 2ORYA 5DLQC 3D7LA 2RHMA 4IFBA 4JBIA 4B6RA 4X95A 3O8LA 3T94A 1ECPA 1JFRA 1KH1A 4LXGA 2IFTA 2DY0A 3EYAA 4HAIA 5K8CA 2B83A 4Y2JA 1KVRA 3EZGA 3KEMA 1WNFA 4I46A 4IV5A 4MA0A 2VPZA 5A7FA 1QH0A 4H3SA 3G8DA 1PWHA 2CJFA 3AVOA 2EQAA 3RVSA 1NMYA 4F7DA 4FYWA 4BY9E 3SJBA 2XAUA 4I1RA 2R2AA 4AF6A 4I99A 4R2IA 1L8LA 3U19A 2YDYA 5DP2A 4C9BA 3GH3A 2QD2A 3QMWA 1R64A 3VTAA 1NONA 3U37A 2C4VA 1CZHA 1NC1A 3SIWA 4XUEA 1BOFA 1JDNA 4I36A 1JHXA 3P1JA 4WK4B 4UJ3A 3DV2A 5REQB 1BU5A 1U0GA 3P0FA 4YQYA 4RD6A 1SH7A 3SQLA 1N8NA 3HCOA 5C7IO 1OI2A 4C0XA 3ZK7A 1Z6TA 1YHNA 1FYEA 4AZTA 3PIIA 1K9VF 2O2HA 4RVCA 4JJ6A 4DG5A 5CX1A 1U9YA 4D43A 4B7CA 2YFKA 1M1NA 4AWBA 4G67A 3L93A 1HKUA 2QN1A 4P33A 1KI4A 5MN6A 4ZALA 5AOAA 1AKRA 3N3AC 3R23A 2QYHA 1CQPA 3L43A 1B16A 1ONPA 1ZIDA 1DEOA 3CRRA 1W96A 3D64A 3PCXA 4HN2A 3UOGA 2WYWA 2ZWVA 2QRKA 2YOHA 1EHCA 4LN1A 1VPTA 1SIBE 4MW2A 1G1AA 4Y9DA 4H3VA 3UA3A 1OLUB 4R3UC 1XMQB 4HAOA 4JA0A 3AR6A 1DAGA 3WWZA 4AJOA 1T3ZA 3KAJA 2HWWA 2XIQA 1WCV1 1QQBA 1K7CA 3UNXA 1W0JA 1QUFA 2B25A 2VSOA 3E05A 4G5RA 4QOGA 4EG0A 1R6VA 1ZM4A 2CFOA 4AULA 5IJ9B 2FW7A 5DWVA 3BRWA 4HLCA 2Q3HA 3D6HA 2MR6A 4IDGA 3WNZA 2FTKE 3VYTB 1KERA 4UFOA 1QS0B 1P1HA 4PGAA 3RODA 5KSPA 3I76A 5EXPA 1NV8A 3W5CA 1AN0A 3VFDA 2V8BA 1QG2A 3MW8A 2QA5A 5CDTA 4OHKA 4E5UA 3SYMA 1EWQA 2VDJA 1KS2A 1QXSA 2X9GA 3NIDB 1OLSA 2H5LA 4TWBA 2CNDA 3I4LA 4BN4A 3I0MA 3IODA 1BRMA 5CGZA 2WMOB 4JOCA 1XNJA 2ZRCA 3J7TA 5EVCA 1Y5MA 1ML4A 2C9ZA 5EQFA 4HD8A 5B58T 3OWOA 4F2PA 4F86A 1C7ZA 1KMIY 3TD6A 4B8ZA 1PJBA 4ZJZA 5EJ8A 1ZD1A 3F6CA 2X77A 3BB3A 4X3OA 4Z1MD 1JA1A 1ZM2A 4ZCPA 2G06A 3NAMA 3BFPA 4CQMD 1GA1A 4CZ2A 1XI2A 3NBQA 3W2EA 3CNQS 3HC7A 3MAGA 4WRRA 3CLVA 3P2YA 4MYTA 4NCHA 3PGMA 1Z3IX 4ZAXA 1VPVA 1X9GA 3IAUA 4PU0A 1NASA 3GJXC 1OZFA 3NHUA 5LXTF 1AS3A 2PLFA 1CE8A 2BEVB 1K6EA 4TL8A 3VJLA 4TTTS 4QU8A 5EXXA 2JK1A 4W8HA 1JEJA 3BXEA 4HB0A 2PD4A 3C3EA 3S7TA 4WCVA 1Z17A 1YVRA 5ITSA 4A15A 1ZJWA 1KYVA 1IEWA 1ECGA 4QU5A 3DG9A 3PDCA 1OTYA 3I45A 4IV8A 1YR7A 4B44A 5DJ5A 3KR9A 1MOPA 3I9V6 4B4VA 4ACAA 4I55F 4B40A 4FYJA 3WRXC 5JJBA 1Y9AA 1AV6A 2GA9A 2QZSA 4KXQA 4DB2A 2ZSJA 4J7UA 3TKAA 4X7MA 1FL9A 4BJ5A 2OB1A 3RAJA 3I52A 2WHXA 2FUNB 2GBFA 3C3XA 3C74A 3RU3A 5L3VA 4R2KA 3TQIA 3BERA 1UMDA 4UM9B 5EJEA 2H51A 3LWDA 1T8RA 3K9HA 2EW1A 1VHLA 4TTQA 3GPCA 4UUNA 1VL1A 5BP7A 5HKLA 4MEAA 5FKJA 4C87A 2GLXA 5K8TA 1TW3A 1FZTA 2B92A 2YVUA 1J33A 4ALIA 3T5GA 2JGEA 3EFOA 4ZI7B 1ZUHA 3PFWO 2Y9ZA 3A4MA 3PZBA 4OI1A 5LJLA 3HKEB 4NYMR 2FWPA 2ZI5A 3MOIA 4PZLA 4UBLA 5EMKA 3W78A 1PNOA 3H17A 3QIAA 4MTCA 4ZODA 5FULA 2IW3A 3WVNA 5AVSA 5G4KB 4G0XA 5KTOA 3GAMA 5LPNA 1LC0A 3QRWA 5C5IA 1M2WA 2YJGA 2EJWA 3FPSA 4BMCA 4MITA 1ZO8A 3WGQA 5KQGA 4FNMA 3I1FA 1VOTA 2EIHA 3OLQA 1YZKA 1RLJA 4BFUA 2BZSA 3MMZA 3PWZA 1CS4C 1OFIA 1QFSA 2ZANA 2UKDA 3LY5A 1SQ5A 3RYTC 3DHVA 1AHHA 2XRFA 2JGJA 3QXHA 4UNSA 5EAIA 2NSLA 1ZOLA 4ARZA 3U6BA 5IBCA 5IS2A 4NEHB 4W5JA 3CMMA 1Q22A 1JXOA 4OUDB 1QHHB 1XL0A 3MLEA 1VFNA 4NV3A 5JBQA 5FI5A 5IK2A 1M2EA 2BFEA 3B3JA 2CVHA 3ONNA 3H9GA 2PSJA 1E6UA 1R27A 1YQGA 2WFAA 2ZE8A 3WJAA 1Y5IA 2AVDA 2HK7A 1XVTA 1E2NA 3LYHA 4PZ0A 4QLBA 3MINB 3Q10A 3L1JA 5BSVA 3A9VA 4QFBA 5F9MA 4P32A 2AXPA 4Q4JB 1MABA 1KI3A 2ENWA 1TLLA 3TLZA 4W1PA 1D6SA 2ZUDA 1J0BA 4GP7A 5C1DA 4MICA 1G3MA 1IHXA 1LNQA 2O7VA 2YDXA 1KETA 2A0XA 4KWIA 3ZX5A 1C81A 4QVGA 1MRZA 3HKDB 2UDPA 3KXIA 1P8AA 1UXHA 4JJKA 4PYMA 5JZVA 4CM8B 1AUVA 1Z5GA 1LPBB 5DGXA 5T57A 3ZDFA 3ANLA 3K6RA 2H1VA 3FE2A 1CS0B 1JUDA 3CBQA 3JQ7A 3S2FA 2I6FA 4DNXA 3IKJA 3R9WA 4JH0A 4MAFA 1FNMA 1ZA1A 3KEQA 4AKEA 2RH8A 4RM3A 5ERGB 1R6XA 1KKLA 5M34A 3II6X 4NZNA 2J30A 4I4IA 5D3QA 3WWPA 5M29A 2P5UA 1MW8X 3P97A 1U7HA 3TG2A 3NEJA 1ZIXA 3O75A 3S2ZA 1CJKC 5HMLA 2J5QA 1P7CA 3AF0A 4C6TB 1QIKA 2B3DA 3D6VA 2BELA 2PKWA 1G59A 1D0VA 3FPEA 1H2HA 3JZAA 3RNLA 2CXPA 3ISTA 4O4LF 1T6ZA 5HK8A 3I9JA 3V48A 1W46A 4BV3A 2VDWA 3EGIA 4UAJA 5K0BA 5F3DA 1GNRA 2C94A 4G1BA 4GMDA 1NVUQ 1MNAA 1UJMA 3D81A 4P4GA 4WLUA 5JXGA 4I81A 2X9VA 2CB0A 3CLRD 2JLCA 1ZONA 2PT6A 2M6KA 1LPOA 1NBMD 1G3IA 2XMCA 2HHHB 4COOA 3B1JA 3IS3A 1DTWB 1MKYA 2W71A 2YW9A 2XZDA 2NM0A 4M22A 4DBLE 4DRYA 1GVNB 2RMKA 5KSZA 1W7AA 5AI4A 3ICWA 1KI9A 1LKZA 3Q3GE 5B1DA 5D7NA 4YRZA 5JANA 3QX7A 4N48A 1QANA 2EFDB 5GWXA 3A1TA 2D1SA 2WM2A 3R7LA 3SQWA 1VE6A 5COQA 3LQ4A 1K8ZB 1TCUA 1TU3A 2PZKA 2OQVA 3IV9A 3TTYA 3RKUA 3JWPA 1Q0HA 5DTRA 4LJ4A 4L74A 5IKOA 3HVRA 4E21A 2ZROA 4WY2A 1A72A 2P6PA 1NXSA 2CZQA 4UQOA 1GUZA 3NASA 3IV7A 3GGOA 3OZDA 1D4ZA 1MB3A 1YS1X 1Z36A 3CX8A 4XFKA 5C32A 7REQB 3STUA 4TZTA 2P8JA 3QJ5A 4WQMA 2VCYA 4PANA 5TXGA 3F8WA 4V0MA 4RM2A 2JBAA 5IF9A 3DUWA 3VC2A 5C0OE 1BGWA 1ONBA 1V3QE 1PNVA 2D59A 4N76A 1YZVA 1L4NA 3EZ6A 3PWKA 4WZBA 2DMRA 2VKQA 1WF3A 4FWBA 5BN5A 1CDEA 1FLVA 3F67A 1UMBB 4WY5A 4I8XA 3X1YA 2PUEA 3HCCA 3ZWYA 3ETHA 1DI0A 1H8EA 1Y3BE 2Q99A 3QENA 3NHLA 4GGMX 4HKTA 4YRMA 2PDAA 3E48A 3ILSA 4FZVA 4EARA 3B60A 1J1UA 3KFLA 5ADWA 4B6QA 5ARBA 2ZSKA 4ND6A 4F71A 2FPKA 2LIVA 4KH1A 1DOZA 1OLXB 3O9ZA 3X1ZA 4JYZA 4G0WA 2PSEA 1PZXA 2H00A 2X1HA 4QREA 1EZ4A 3AF2A 5DI3A 3DBVO 4OAOA 4YJHB 5KWVA 5CLFA 4DJTA 1DU4A 2TMKA 1FSSA 4U00A 2O8BA 1D09A 3BH0A 4BWYA 3HY6A 4JLVA 4RY9A 4UHHA 3RVLA 5A3VA 1MTOA 4FFBB 3RSSA 3HUUA 3M81A 3WMXA 3T3DA 2WWGA 3PC6A 4CL3A 3ZWBA 3FUXA 2UXDB 3GQVA 3VUEA 2ZR7A 2W2LD 1I6MA 2V5VA 4OUKX 5EP4A 2W7TA 3C39A 2OZKA 3MRXA 5EYPB 2JIOA 5DTIA 3UW3A 2BSXA 2UAGA 3HRKA 3L7BA 3CVXA 4DSAA 3FNBA 1TQ8A 3Q1KA 2QV0A 3MGGA 3NGLA 1H5QA 3O2NA 4R1SA 5P8WA 1ZMOA 3U0BA 4BNDA 1K8RA 5DGTA 3F9IA 2A1UB 2NWQA 2HPVA 2PUBA 1JJIA 3REFA 1XV5A 2VNKA 2WUWE 4LZAA 2O3JA 3W6OA 4JLDA 1ZI8A 2YWRA 1DC8A 3JRNA 2JKYA 3O8QA 5K51A 2C2ZA 5K3EA 3UV7A 3ETNA 3DZKA 3P9QA 4EGJA 1CQIA 1GT91 5AJZA 5E6UA 4F9GA 5BSEA 1HT2E 4HHEA 5IUNC 3DGFC 3BE4A 5LFAA 1A4IA 2A9OA 4G2NA 4ZC8A 2Y0CA 4WCFB 4CDGA 4IDPA 4MEBA 5TEWA 3LQQA 3R3YA 1P75A 3QUAA 2R0QC 1V48A 5D5QA 2X8JB 3TX6A 5C51B 4QUDA 3P9XA 3CCBA 4XX1A 3FCUB 4UNQA 3AVVA 1K1EA 4M49A 1WPGA 3EXFB 3RG8A 2NNLD 3OEWA 1KRWA 1EK1A 2QEQA 4ARIA 3AZPA 4XDHA 1FCJA 3LP6A 2XUAA 3ZW9A 5D87A 4H35A 4ZCLA 5ITZA 2BFDA 3M0EA 2PQ6A 3FAKA 4PAOA 3VXKA 5KAMA 2I1QA 4HH4A 4QAJA 4HGZA 1P19A 1W87A 2DX7A 3HP4A 3FOFC 1L3CA 3OZRA 5FA8A 1CUSA 2C2MA 1IXSB 2AWNA 4QTZA 2VZ8A 3FPAA 3VR5H 3DF7A 1BIFA 1UBUS 2F17A 4JU9A 2V0CA 2GD2A 1VCIA 5AVUA 4XLLA 1PNRA 4HI0E 2H4WA 2OY0A 1CVIA 3ZNQA 1XR3A 4BBZA 3AEQB 3VHRA 1GFIA 2ZAOA 1GGVA 1P2UA 5AH0A 5H16A 3SHFA 3UY4A 3MJTA 4NR0A 4M76B 4C4YA 1NVXQ 2P6MA 4EAQA 1O95A 1EVEA 1GTL1 4KQ1A 3NGXA 4XIJA 1DUIA 3WLNA 1P0FA 1XYVA 4GEKA 3VPDA 1XMIA 1NYLA 2BGJA 3E7PA 4US1R 3ZY4A 2P4HX 2OO5A 3MSXA 4YAGA 1R8YA 2QTBA 1OWNA 2B6NA 4KTVE 1VCNA 2C5HA 1C8LA 1PHPA 3WA7A 1I4TD 2XB4A 4KQXA 2CXOA 3OUZA 5AIAA 5FFNA 5H0IA 3C7DB 5JS7A 3VDRA 2KLHA 1XWFA 3DNMA 1YDWA 5FJJA 5B1HA 5CVCA 2NU9A 3FZNA 1M8GA 3I0NA 3OHMA 4IILA 5DNVA 5HF6A 1Z3CA 3M9WA 2OXRA 4FGKA 4Y9RA 3TXAA 3L0CA 3E9DA 3S7ZA 3AHGA 4J03A 5CNIA 3MEQA 1HDOA 4IIJF 3RDPA 3T0GA 4B8YA 3TTSA 3FUCA 4PG8A 3BKXA 1E2IA 1GEEA 1C7FA 4W5RA 1C8VB 1JSXA 1WZNA 3RANA 4ZVLA 4X84A 4I1OA 4F4UA 4KIWA 4G1EB 1V3TA 2DF8A 1AB6A 2C9DA 3KJXA 5AVKA 3QKRB 3RFUA 4MAMA 4F1JA 4IUDS 1Z0IA 3TVTA 1JHDA 1LNSA 3RS4A 3UJ3X 2FRDA 3PT9A 3WKEA 4IKPA 1H2YA 4OB8A 2Q3LA 1BA2A 1Z37A 1VJ0A 2PY6A 3LPCA 5IBQA 4RTMA 3LT5A 4FE4A 3CH5A 1ZI6A 4Z99A 2AVNA 1GHTA 2BCJQ 3DJYA 4IWXA 6CHYA 2VNAA 5K0CA 2H4FA 4MCAA 4RORA 3VOTA 4DRXA 4MKXA 5BR1A 5AVYA 4K03A 4HG2A 1P2DA 1U3WA 4GF5A 3KHSA 5BQOA 3PXGA 1SBYA 4IJ5A 9GPBA 5E6SB 2QOEA 3I01A 5AUNB 1SQSA 5TPZA 3U81A 3DLBA 4CGYA 4Q39A 3PKIA 1RS0A 1MO2A 1EP3B 1L5ZA 2F1IA 2OCBA 5EZ5A 5FOTA 2A6PA 1DXOA 1T6YA 1DBSA 3HSKA 3WLSA 4C06A 2AOTB 3EVGA 2Z8YM 1T9GS 3DQPA 3T7IA 5ITVA 3OAAA 2AOUB 2BEWB 2Y27A 4K9DA 1FU8A 3IILA 3TIIA 4YYEA 5IKMA 4TYWA 1KSHA 4I08A 1N77A 1FYXA 1RI1A 2EKDA 3RNOA 4YMUA 2H9AA 3W6ZA 3GJZA 4L7VA 4XDZA 5LZ8A 5AVOA 1IQ0A 3DC2A 3HDVA 3TOZA 2JHFA 2XGOA 1XQYA 1ISMA 4JLMA 2FR8A 4IQ0A 3C7KA 1PVDA 4W7IA 5IYZB 2PIDA 1ISIA 1FC0A 1IZ7A 4DDTA 5EIWA 4PRZA 3BB4A 1EWYA 3L8HA 1P4RA 5BV2P 4I3FA 4P93A 1P5FA 3AUJB 1LK0A 1DRKA 6GPBA 2R7NA 2LE0A 1PDWA 1ZG3A 2M2IA 2Y0DA 4D9HA 2I6TA 1W1UA 1TDJA 3UB2A 1J5XA 1QQAA 2NUBA 2QTHA 2DUWA 4XJSA 2BE7A 3ETGA 3GEIA 1J9EA 2FJPA 1L2TA 2YUIA 4ZRNA 5FFMA 3WBKA 1VCMA 4U39A 4A0GA 1XP8A 3HI6A 3CPEA 3ZBPA 3ZD7A 1A77A 2NGRA 5JPDA 1KZYC 4XB6B 3I8SA 5JNRA 1U1CA 3EZ7A 1W5BA 3LXRA 4RDCA 2WJPA 1NW5A 1XDSA 3C1AA 3WL4A 1J8VA 2JGKA 3I1IA 3KB8A 3NAZA 1P6XA 4KXMA 1ECFA 3KQYA 3H2SA 3MWDA 2YIJA 4S2UA 3BREA 5CAEA 1R0XA 3L0YA 5H9WA 3PVZA 4K26A 1T9CA 5CD1A 3P9IA 1T4BA 1F8FA 1QV7A 1GRNA 2NZUG 1N6IA 3FBGA 2J32A 4R2JA 5LP1A 1PJ4A 2X0IA 3UYLA 4HVCA 1NVVR 4YHBA 1G5FA 4US0R 4EGSA 1KJ8A 2Y4OA 4J3FA 3MRSA 3SC3A 1R5BA 5BN4B 1JBEA 1RYNA 2Q46A 3NAQA 2YHSA 3EFHA 4ZAZA 1J5PA 4MRVA 2UZ1A 1WQ3A 1DO0A 2VP6A 3CEHA 5IXJA 5EWJA 1VG9B 3FPCA 3QBDA 5E95A 1WO8A 2IL1A 3SZMA 2R00A 4BFZA 5KOJA 1SUCA 3E3AA 3PL5A 3CZ4A 2B7LA 5G2OA 3T9BA 4YIHA 3SXUB 5KTRA 2OBFA 1YZTA 2GHRA 1QYWA 1FJHA 2LCIA 1B1CA 2VAMA 3NFYA 4G56A 1ZJZA 4LXHA 5C80A 1V1MA 4CM9D 4DJJA 5HQTA 5JVDF 2RAUA 3R6LA 4IR7A 2FPSA 4CQLB 2FOIA 2BHLA 4DEYA 1QRTA 1Z4JA 2FZCA 4Q4AB 4ZV4A 3ODGA 3LY8A 2NACA 3KEOA 2XCTB 3TKYA 2WF9A 3K0FA 2GDJA 2G4VA 4OYRA 3AXSA 1L7VC 3HN6A 1AM4D 3MXOA 3FCCA 5J23A 4KK3A 4KRYA 5ECYA 2O3TA 1WSDA 4BNVA 2E3JA 5KYKA 1NULA 3KSRA 3RR2A 1G5RA 4PN7A 1QHXA 1W5TA 2Q4BA 2J0SA 2X7JA 4XD2A 1NI5A 4PLTA 4F21A 2IZ7A 5ALHA 2GVZC 3M34A 2DTDA 2RG1A 3R9XA 1F8XA 1M33A 2RAVA 3TS1A 5ANRB 1KDTA 3ZWNA 4PLHA 1PEDA 4BN0A 3W04A 2FQYA 1I2CA 5LNK6 3RKRA 2R1ZA 4J90A 4ZEVA 3B6EA 1P5ZB 1YNOA 3ZZTA 5L4NA 3DQQA 3L07A 4FYPA 4TTJA 3ZY5A 5KVSA 4E5VA 1WMEA 4NDNE 3RC9A 1SNYA 2OHFA 4WNAB 2ST1A 1JFFA 2C5AA 1MQ8B 2OAQ1 2JANA 3ISJA 4TYNA 2OCKA 1R00A 2ZOSA 3JQ9A 1PN3A 2PJRA 3FWZA 1FSZA 4BGDA 2I87A 3GN1A 2BDTA 3RCBA 4OGLA 3JQBA 2Q4DA 4DGQA 4DV7B 4Y9TA 1NT2A 3GPIA 3TFWA 4K9SA 5ES4B 5B3JC 5FCDA 4U7WA 4GP6A 5LQUA 4G4IA 4FBLA 4GR4A 4Y2UA 1RYZA 3DOHA 1N25A 2JIBA 3DL2A 4YJ3F 4L4YA 4DCOA 1QTQA 1RZRA 2C04A 2OUIA 3IQZA 2C3YA 2ASVA 4TRRA 5L40A 1INLA 1Q6ZA 4M54A 1Q16A 1YQ9A 4RLHA 2KW5A 1J1IA 1WCWA 1JDVA 3KJFA 3KVVA 1M3SA 2OP0A 1R9MA 1S3SA 2F48A 4IHJF 1HLFA 3KD2A 4O29A 1SUSA 4DG8A 5BOVA 4Q1CA 4AIRA 3ER6A 3N3BC 5EA2A 4DV2B 3OF5A 2HJVA 4I9UA 2IV3A 1E2GA 3H1BA 3HLTA 4K0KB 1ORRA 2QTCA 4N7RA 3WGGA 3EBOA 4LRSB 2VBGA 2XE4A 4R5MA 5NULA 2WF6A 3HU3A 2R8YA 2PVCA 1V6SA 3K6JA 3VTFA 5EQTA 4P0QB 2AE1A 3ANSA 5DNYB 3RTAA 5AFSA 1NDQA 1G7CA 3M9XA 3DEHA 4LF9B 4TS4A 3SIXA 2F3TA 2FJ0A 1ZMRA 1MV8A 3R24A 5H80A 1KDRA 4NESA 3A2MA 2R6HA 4EW2A 3JTMA 4UARA 2WHPA 4R1OA 4V0QA 3FNRA 5DN6D 4D9NA 5CB4B 5FNZA 3UJPA 1BCRB 2V7QA 1E58A 3P26A 2X7XA 4LYAA 3I53A 1YKGA 1XLWA 1D03A 1KBZA 1ZNZA 2CBXA 4PC2A 1J7JA 3SIRA 2RGUA 4EM6A 5LQCA 1FLDA 4RPLA 1DOAA 2PJZA 4NBKA 3CZPA 1RADA 4I4TF 4FXPA 1MW9X 3KJEA 1NRIA 4ALKA 2CLIB 4LK3A 1Q1QA 5LZ2A 2IBMA 3E9MA 1T36B 2Z1NA 4ZAWA 3RYCA 3FH0A 1YR2A 2RHGB 3K0AB 3NHFA 3QXGA 1XPOA 2IV7A 2YWEA 1IU9A 1JYFA 1UKZA 4AJNA 3CO5A 1QKJA 2GFIA 1NZJA 2J6HA 1SHLA 3IH5A 4I2VA 4KQWA 5DASA 2W6NA 2FP3A 5FBZA 1F1BA 3RK0A 1PK9A 3INRA 5EOVA 3SN6A 4AJEA 4YGXB 2FR1A 5GONF 2B1IA 2MCFA 1OXUA 3V4OA 2FUCA 3L40A 3FUWA 5DNUA 1DRVA 1B8VA 4LYFA 1Q12A 3K9LA 5ICCA 3BMCB 4MS4A 3QVJA 4IQ8A 3PE6A 4HWTA 2QVGA 1RT9A 4PBTA 3KHTA 1E2KA 1FDOA 3NDJA 4L2IB 4RA6A 2XODA 3R3HA 4G01B 2X3UA 4E2XA 5B4UA 5HA5A 5K4HA 4BEVA 1GG2A 1SKQA 1UOQA 1D4OA 3PX2A 4X91A 4DM4A 1DKNA 4HH3C 4UNIA 4RPHA 1E99A 1WKVA 3UHFA 4Z7JA 1NQWA 4ZN6A 1ZLXA 4GLOA 2RHWA 2ORED 3PK0A 3PUYA 3I64A 1C3OA 4G5OA 1J23A 1CR6A 1WMSA 2Q7DA 2TMGA 5FA6A 1PFUA 2H1SA 3BK2A 4JNKA 4TZ0A 3H8VA 2HLHA 4OATA 5A9TA 2DPHA 4MW4A 1UBCA 2H4HA 1ARZA 4DMRA 1HDGO 2YWXA 4PYLA 4NZOA 3NIWA 3PGA1 1NMQA 1V7ZA 4CF7A 3GJRA 2P35A 1NN1A 2VYND 3VR4D 2X2FA 1SKBA 1B41A 2CNLA 4HLNA 3Q6IA 5EE1A 3KV3O 4HN4B 4EL0A 5LBIA 2XGSA 3REQB 3GDOA 2B0CA 1UIRA 1OW3B 3JQFA 3C7AA 3WL6A 5IVHA 2PM8A 2YJ4A 1MC4A 3VOAA 1MAVA 2C78A 3GEPA 3OT1B 3EAFA 4UAVA 5G0WA 2E82A 2FEXA 1QYCA 1ZDMA 1NSFA 3CW9A 3PHBE 4V1CI 2E4UA 2D7CA 3FJYA 1S01A 2XUFA 4KPFC 4R51A 1GA6A 3DTVB 3NWBA 4FNAA 4OQQA 4M9RA 3SR4A 3M83A 1U8TA 2HHCA 2WE7A 3AB7A 4JC0A 4CR7A 1CDDA 1O7JA 4QJ4A 4DNOA 4I6EA 4PG6A 4EPXA 2IGTA 3KEFA 3PE4A 4IDHA 4BKMA 4RZUA 2H0QA 3LS2A 5JXWA 2F1HA 2ZJAA 4WUTA 1AJEA 3EX7C 2R6GA 5IXYA 2WQ7A 1UK7A 1CIVA 1FVOA 3M7IA 3VPBA 1SMKA 5REQA 2BFOA 2QKYA 4TT3A 1M0TA 3D4NA 3VH3A 5JV5A 5G0UA 2HHLA 4O02B 2VC2B 4QODA 4QPJC 3W79A 2RGNA 2V5AA 2G9ZA 1CB0A 4P36A 4WBSA 1CUCA 4X92A 1FFWA 1R3UA 3LQ2A 4ZHQB 5K4GA 1PJAA 3KWFA 1K5DA 3NPAA 1GPNA 4J0FA 1W8IA 2GVNA 1AKYA 5CT5A 3TOSA 4US2R 4E5PA 1IPHA 1WEHA 1HMPA 3FPBA 1P9RA 4Y6RA 3CCFA 2Z09A 2YICA 5BYJA 2HJHA 4C0WA 3O3NB 4R69A 3U7JA 2HNKA 3A26A 3K2BA 2I4LA 3K2IA 3L8MA 1HPLA 2OQRA 2A67A 1IBRA 1OLUA 2JDID 3P52A 5ABPA 4MVJM 4OQLA 3GZTB 2XBLA 5KWJA 5KNCA 1ZU4A 1ZOIA 5EHNA 4EFDA 3TLBA 2APJA 2P2ZA 3IEKA 1AF4A 3ZI4A 4GI3A 5HKOA 4BX9A 2RHJA 3URKA 5BWNA 5IJ9A 3O9VA 4ND4A 1QU3A 4H3KB 1GZ5A 1N5DA 3TOVA 1U8UA 3RVMA 4F60A 2J7PD 1FQWA 1JWAB 2V74B 4S05A 1IN4A 1QS0A 4K9RA 1ZI9A 3F4BA 3JASB 1UZLA 3L6RA 4TX1A 5CTJA 1PZNA 2EF1A 4H31A 3F2VA 4XIYA 1AGPA 3S2IA 1QRAA 4HO1X 3VVLA 4OAQA 3WHPA 4NENB 3QLJA 4XVUA 1T0PA 1JL3A 4S24A 3ADPA 1V1RB 2QQEA 2FETA 3AP3A 4Z4FA 1F4PA 1KBOA 2V7UA 3C87A 1N5MA 3E5HA 1E7WA 3FY4A 4HLUC 5DM70 3HZRA 2ZUBA 1DAPA 1DT3A 2E89A 9MHTA 1I4LD 2PA0A 2MYPA 2WMNB 3MQ2A 4DPMA 2B7CA 2P4SA 4ALJA 3OUUA 2WAOA 2C4UA 1E3IA 1UOPA 2HRRA 4DQXA 4YX9A 2C7BA 2XWSA 1Y6GA 4RFLA 3P4YA 3M89A 3PQCA 1WHSB 1CZUA 2DJIA 4JODA 5B12A 4DR2B 2VF7A 2FN4A 3AF6A 1P5JA 4I9HA 4IG4A 4IGFA 4OKSA 3WGNA 4BX8A 5AXDA 4HAXA 5THKA 1YE5A 4EDHA 5KX5B 4J43A 2E6UX 3KE8A 4B81A 2BEVA 4XCXA 5E0OA 2ZBEA 4RESA 4EYEA 4BX0A 2JAWA 1PJQA 1BQ4A 5I01A 1NE7A 2JFGA 1JSZA 1I4DD 1LDGA 3QE3A 4WECA 1HL3A 5FJIA 4N5NA 3V1YA 4EY5A 1PE0A 1OREA 1JYEA 3WJ1A 3SS9X 4M36A 4AKHA 3EG5A 4NBSA 2GUGA 4GPD1 4N5DA 1UKBA 4M1ZA 2PZFA 4ICIA 8ADHA 2ZBQA 1WOYA 4U2GA 3KTDA 1VHWA 3C8DA 3KJZA 4XGNA 2CK3A 4C5CA 2HBYA 1W94A 2VSQA 3ZZ1A 4C89A 4KG7A 3N0VA 4EDFA 3QPBA 2JLQA 5JDCC 4DPKA 2QMEA 3T3GA 1UUFA 5JECA 3COZA 1KTVA 2R66A 3I12A 3LVFO 4J0KA 4Q9HA 2ZYSA 3OZBA 4YRKA 5BR8B 1HT0A 5KC9A 1KI7A 4KYUA 2J0UB 3LF2A 4BAUA 4C4OA 1OFHA 1IBKB 4KNYA 1U9ZA 2ZYRA 3H5TA 2IYPA 1HTTA 3H9QA 4A4DA 1Z0AA 3JQPA 1PNTA 2WMYA 3UAGA 1RW4A 1SJ9A 4PGHA 2I65A 3QPAA 5DYWA 5SYMA 1L4YA 3CEJA 3DB1A 4M9UA 3ZTWA 4DCVA 3FF1A 1Q0ZA 3CEAA 4ZI7A 4YRNA 2QVXX 3HKEA 4INPA 3IJEB 3MT8A 4DMUB 4FMDB 5EPEA 1AUQA 2CMHA 2A9RA 3K1AB 5G4KA 1VHJA 1Z2OX 3FNEA 2Z95A 1OXMA 3WQQA 1R8SA 1HTWA 4HV4A 3JPYA 5JCPA 4B71A 1E9AA 2PS3A 4ZMBA 2R1TB 3VISA 3A70A 3AERB 3VC7A 5LR6A 1NOJA 1EJ6A 3I62A 1G20B 4V2UA 5CJ2A 3HK2A 3PP8A 2HK8A 2IP4A 3JALB 1J2EA 4FU0A 4E5MA 4AJ2A 1IWBB 2HRDA 1YOVB 2PRZA 3FDJA 4MW0A 3EC1A 4Q1EA 1H6DA 3T7DA 4C1BA 1EFCA 2R1VB 4DR4B 5DDIP 5ELLA 4BFTA 5K3DA 2XOKA 1P29A 4OUDA 2FFQA 1QHHA 2W6JD 2J4FA 3BXFA 1HE3A 4LPSA 1XAHA 4OI2A 3KZ1E 3IKMB 1NRWA 3RC8A 3DOIA 4JKOA 3UOAB 1Z5UA 1A9SA 1KP9A 3LNCA 1CUYA 5LWQA 3AM1A 3Q6NA 1DJPA 4NH0A 3WL3A 4RKWA 3U3OA 1YVUA 3SBDA 4ZOQI 3OKCA 1XUOA 4I5DA 2I1VB 2XZOA 1NW6A 3MINA 4W5OA 4C7OB 1M2NA 1ENZA 1OZHA 3E3OA 3H7IA 4HX5A 3U9SA 4AKSA 5HW0A 2QD4A 4Q4JA 5KNDD 5LN1A 4U0JA 2FE1A 1R8XA 2OZVA 2WQZA 1ZJ6A 3F5DA 3HMKA 4F2DA 5T41A 3U17A 5AVXA 1K7SN 4IV0A 5FTNA 4C76A 5BRJA 4HATA 3BSYA 2EFGA 4Y2PA