3DFUA

Crystal structure of a putative rossmann-like dehydrogenase (cgl2689) from corynebacterium glutamicum at 2.07 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
228
structure length
228
Chain Sequence
b'QAPRLRVGIFDDGSSTVNMAEKLDSVGHYVTVLHAPEDIRDFELVVIDAHGVEGYVEKLSAFARRGQMFLHTSLTHGITVMDPLETSGGIVMSAHPIGQDRWVASALDELGETIVGLLVGELGGSIVEIADDKRAQLAAALTYAGFLSTLQRDASYFLDEFLGDPDVTSDIVMDSAQQFQALPSLDEVIAQYDSINNPGRQRLFRDLARRQAEISRAQDIELWAIQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized Protein from 6-Phosphogluconate Dehydrogenas
publication title Crystal structure of Protein of Unknown Function from the 6-Phosphogluconate Dehydrogenase-Like Family (NP_601885.1) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 2.07 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 74
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10727 Rossmann-like Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.40 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dfuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dfuA01
1I30A 2Q1SA 2J3HA 1M76A 1E3JA 4GX5A 4JIGA 5G0VA 1F06A 4IUYA 2W8ZA 3UH1A 4AJOA 3WIDA 1WP4A 4FD3A 4CL8A 5TT1A 3QVSA 3INTA 1WDLA 4IS2A 4DC1A 1C1XA 2DFVA 3EY4A 5KJCA 3LZ6A 1Y6JA 5A9TA 1MXFA 2EP7A 5IDYA 2A92A 3RC9A 3DBHB 1C1DB 1GZ4A 1CQIA 1WDKA 4PLFA 5JC8A 4ALIA 1UAYA 1MG0A 3VDRA 5JC1A 2FPPA 1WZEA 2P68A 1IY8A 1R4MA 1UUFA 2IODA 4EW6A 1M75A 3V2HA 2VOEA 2JAPA 2DTEA 3EC7A 1U9JA 4BNYA 4UVDA 1EBFA 3T4XA 4IXWA 1N5DA 2NNLD 4TZKA 2J6IA 1KERA 2Q2VA 3V8BA 4CMKA 3WGYA 4E5NA 2AE1A 5JO9A 3LLSA 2BLLA 4MVJP 4AJEA 2XXJA 1I0ZA 5EESA 4XIJA 4XEHA 3A9WA 1DRVA 2UVDA 3ZV6A 4XQGA 3RU7A 4WOJA 4J2HA 3AI1A 2JL1A 2R00A 3OJ0A 3OFSA 2G76A 1ENPA 4I1IA 3S2EA 1RJWA 3WFIA 4CM4B 2WM3A 5U9CA 3OP4A 4IMRA 1X13A 2FWMX 1MC4A 4R1TA 4OOFA 3KOUA 1UDAA 3ON5A 3HNPA 5TRTA 4E2WA 1IZ0A 3ETEA 1P74A 1JAYA 4ND1A 3DHYA 1NVTA 1HSOA 4WE3A 1MX3A 3ADOA 3DHNA 4FFMA 5COAA 4DUPA 4XJSA 1VL6A 4IS3A 3E5MA 1MA0A 3E9NA 3PQFA 4HBGA 4AJJA 5KNLA 3MJ4A 4EITA 1YBMA 5JMWA 1XR3A 4W6ZA 4OHUA 4IJWA 3IS3A 3U9LA 3CH6A 5CAEA 3O38A 1MB4A 3O9ZA 4K9DA 3M1AA 4J4TA 5L40A 5TNXA 3NDJA 4LW8A 2X8LA 2C54A 3GZ4A 3SC4A 4GVXA 2FMUA 1SCUA 2VYVA 2WSBA 1QP8A 3IAHA 2C2XA 3Q2KA 1DIRA 2FR8A 3B20A 5FI3A 4AL4A 3DAGA 3UOGA 2AEJA 1F17A 4DA9A 4KOAA 3AU9A 2PGDA 3BTUA 1VL0A 1PZEA 3ZHXA 3PYXA 3FR8A 3ZWWA 1E0DA 1QKIA 2HMVA 4QXMA 3ASVA 4XKJA 3AY7A 4XQCA 4FFPA 3MJCA 4IY1A 1KC3A 2EG9A 4L4RA 3D3EA 1T4BA 3PZRA 3ZWVA 1K6IA 3F9IA 1M66A 1GYPA 3GQVA 4FW8A 4YR9A 3WG9A 4XYLA 1ULSA 1ZMTA 1P1FA 3SBOA 2HQ1A 4I5GA 1KEUA 1DLIA 4CM6A 2NUAA 3CSDA 2PV7A 2HAEA 2VHYA 3I1JA 4G81A 2CVQA 2GPTA 3Q6IA 4CQLA 2W90A 2I65A 5HWSA 1TI7A 1IHXA 4LCJA 4BNNA 4XYBA 1A4IA 1PWZA 4WLUA 2O3JA 1SC6A 1FDVA 1KVUA 3HHPA 1C0LA 3OIFA 3WLEA 2Y1EA 4CODB 1J4AA 1HEUA 1YVEI 2VWQA 5JY6A 3FBTA 5F21A 3UW3A 2OO5A 1EVJA 4BNTA 1ENZA 3TL2A 4RO0A 4B7UA 4MIOA 4R5HA 5JYDA 5EINA 3TSCA 1HL3A 1GZ3A 1NFRA 1ONOA 1YOVB 4BO7A 3NT2A 2VRCD 2PK3A 3FCOA 1HDCA 4I9NA 1IOLA 4INAA 2CUKA 1S7CA 3L4BC 3PHHA 5F5NA 1Y8RB 5ICMA 4PLPA 1B2LA 1EBUA 4NHEA 5JS6A 1H93A 3RC1A 4S1VA 3DBRB 4CMIB 4OXYA 2DTXA 5T8KA 2C07A 1VI2A 2QRKA 3QIVA 5CDTA 4A26A 2QQ5A 2V7PA 4JLWA 5HS4A 2F1KA 2HRZA 4L73A 3UXYA 1ZSYA 3AJRA 4R3NA 3LLVA 1P1JA 3KSZO 5JDCC 3MJSA 1D8AA 4JN6B 3ZWPA 3EGOA 1PJ4A 3MZ0A 4MVJD 4C4OA 4K6FA 5C3MA 5CDYA 4W4TA 5HM8A 3DEYX 3JQ8A 5G0SA 5I9LA 3KYDB 1YWGO 1QG6A 2PD4A 3WR5A 5JPIA 1CRWG 5ENVA 2JD0A 5TGDA 5DN9A 2HUNA 2QG4A 2UUPA 4NFYA 1XSEA 3WGGA 1GYRA 1TB4A 4HUJA 1LDYA 4D3FA 4JCOA 1H2HA 1Y8QA 1PGPA 1DJNA 1M6WA 2ZB4A 4FB5A 1ZBQA 1NR1A 1J6UA 1KY4A 4YAGA 4P4LA 4FJ0A 1LA2A 2PD6A 3DZHA 2X0RA 4J6FA 2RIRA 4YB8A 2ZJ1A 3GDFA 5L7YA 5BNIA 3GNQA 2I5PO 4J7XA 1Q7CA 2OP0A 1VM6A 3AUUA 2NVUB 2H1SA 1I3NA 1VKNA 4CMHA 1G6KA 3H7AA 2ZQZA 3R3SA 4AJHA 4YJHB 4LRTB 4NBVA 3JYLA 3M2PA 2XAAA 3GC6A 2IZ1A 1BG6A 2FR1A 3GN2A 4CV3A 5IAAA 1LDBA 1LRJA 5U1PA 2BMAA 3FBGA 2C20A 4BNXA 2WYVA 2RH4A 4JP3A 3GVXA 3M6IA 4OQZA 2DBQA 4YT5A 1Q0HA 4OO3A 1TT7A 2O4CA 3SX2A 4DBVO 1FDUA 4PGFA 4PLYA 2CMDA 3DOCA 3G1UA 4RDIA 4QECA 3RBZA 5A9SB 4ZQGA 5TJ9A 1CEQA 1X14A 1HZJA 2O3UA 4BNJA 1UAGA 3H9QA 3OJEA 4ZQFA 3EVNA 1A5ZA 3Q2IA 3IUSA 2I66A 2O3TA 3VZPA 3OIGA 3TOXA 2ZYAA 4EI2A 1IYZA 3JQ9C 3RQSA 4J90A 4MVJE 3KYCA 5EL0A 2BH9A 1GV1A 2OXIA 1YDEA 1UP4A 4WKGA 3COSA 5CPBA 1XQ6A 4CJXA 3GMDA 1RM0A 5AVOA 4DIBA 5C7OO 2CD9A 3JQ6A 4OQYA 3MOIA 2VTDA 3AFMA 1HLPA 3JQBC 3DBLA 3JQAB 4AJLA 1SNYA 4UUPA 2CDCA 5GY7A 5KVSA 5F1KA 1I3KA 1E3WA 1FK8A 2LDXA 1ZXBA 2Y66A 3AI2A 2BD0A 2AW5A 3LU1A 3KZVA 4DC0A 4BNZA 4E2ZA 1LLQA 2I76A 4PVDA 1ZK4A 3RIHA 1J0XO 4XDZA 4BQPA 4JX8A 1B26A 1PZHA 1UP6A 3NJ4A 1P1IA 2HK8A 3FWNA 4E2XA 5A03A 1OI7A 2O50A 4RLSA 1B8PA 1Y7TA 3VC7A 3BMCB 3OETA 5A3JA 2B36A 1V3VA 4BV8A 4JJGA 2Y1GA 1LQUA 1YONA 1MC5A 1DRWA 2DUUA 4F45A 5MGBA 2X5JO 1L7EA 4JGBA 5F5LA 4EBFA 4XYGA 3DZBA 4K6CA 2DBRA 1P0CA 1R4NB 5BT9A 1HXHA 1I33A 2Y0DA 1OBFO 5B4VA 3JQ7B 1P31A 2OOSA 4E4YA 3HG7A 3KUXA 1E6UA 3WXBA 2QRLA 4D3DA 1EDZA 4WUVA 4EUFA 2BGLA 1X1EA 3E18A 1I2CA 1VLLA 2UV8A 4CLOA 2NU9A 2X9GA 3N74A 3F4LA 1LDMA 1BHSA 4Y9DA 3EK2A 2Q50A 1KC1A 3E5RA 4NFHA 3DZKA 4WLNA 5G0WA 4EDFA 1ZEMA 4E13A 4N5NA 4D3SA 5FFFA 2YFQA 3LK7A 1TVEA 1DC4A 1HDXA 4HXYA 2FSVA 1NXQA 4BNHA 1LX6A 2FZWA 1HZZA 1K2WA 1KYQA 4E6PA 3DDNA 3PVZA 4J9VA 3CTMA 5G2OA 2TMGA 4AJNA 3MCVA 3GUYA 1DSSG 1LJ8A 3GN1A 1AHIA 4MPDA 1XELA 1F8FA 4YAEA 2CDBA 3L07A 4M87A 2GSDA 3H2SA 3ST7A 1UXHA 4OGWA 1XU7A 2YJZA 3UCXA 3L4SO 1Z73A 2ZTVA 4QEDA 3W6UA 4AJPA 3WLFA 1YB4A 4PFJA 3Q9UA 4NK5A 5IZCC 2BI8A 3RUFA 4BO5A 3GUCA 3GGOA 5GZ3A 3IL2A 4XQ9A 4RPLA 1C0KA 1PGOA 3HUDA 1KOLA 2Q1UA 4P22A 3WGHA 1ZKMA 2ZYDA 1DXYA 3CKYA 3VPGA 1GQYA 1W73A 3SLGA 4YBZA 4ZVVA 3I83A 2G0TA 3NGLA 3RUEA 3JQGB 4KUEA 3CUKA 3PI7A 2EGGA 3WTCA 3QV1A 1I32A 4BS9A 2YUTA 5L4LA 3PEFA 1DBVO 1JU9A 5JBIA 2NU7A 3DMYA 5B37A 1NPYA 3PHJA 4BUCA 3A4VA 1QYXA 5KJ6A 3FR7A 3I9OA 5FF9A 1HRDA 4XJTA 5T57A 3JYPA 2AEFA 4U6QA 5IN4A 2AQKA 4CQMA 4YJFA 1GUZA 4O1MA 2UAGA 4LCEA 4MKZA 1TEHA 1VKOA 3UHAA 2XF8A 5K6AC 1UZLA 4OKIA 3JYOA 3OQ6A 3FWZA 1O89A 4WCFB 1R37A 3DMTA 2V6MA 3K6JA 3WS7A 1EFKA 3BMNB 2GYYA 1C1XB 2VHZA 3PP8A 2PKQO 1ENOA 3FNGA 2GRAA 4IQ0A 1NYTA 4IXTA 3ZWXA 4YRBA 1E5LA 8ADHA 1T2EA 3RKRA 2VN8A 4GBJA 1E1MA 4BKUA 1DLJA 2BF7A 2PGLA 4CR8A 5T5QA 4RLHA 3IJPA 3C1TA 4YPOA 4CR7A 3TFOA 5KVVA 3OJOA 4TRJA 6ADHA 5L3ZA 4XCVA 3IJRA 1U5AA 2PZJA 3NAQA 1I5RA 3KEQA 4BHTA 5JCXA 1K3TA 1PS9A 2V65A 5AXCA 1Z6ZA 1N8KA 3AM3A 4K26A 4O6VA 4DYVA 2Y67A 5IDWA 1WPQA 1H5QA 2JFHA 2Q2QA 1YO6A 3WBFA 2VYNA 4W9NA 5DP1A 4CMCA 4IDGA 1KEPA 1V0JA 4E33A 3R3JA 3IC5A 3NDRA 4HADA 4R16A 4I5EA 2DVMA 2YHIA 3AUTA 4MOWA 3WB9A 4IIVA 4AJ4A 4IZIA 2PWZA 2NVBA 4DTIA 2Y1OA 3MWDB 3LF1A 2VWGA 3CPSA 5KCZA 3HADA 1BWSA 5A06A 2J3KA 3BMOB 3JCZA 4I8XA 4XRGA 1Q0LA 1YJ8A 2F00A 2Q46A 4H16A 5GZ1A 3KVOA 4PIVA 2WE8A 2JD2A 3GNTA 3TQHA 4DLAA 5C37A 3S55A 1HWYA 4OJNA 1CIVA 2NU8A 5B1YA 3VKVA 1LI4A 4DBZA 3JQAD 2J3JA 4YAJA 2OUIA 1VL8A 3PIDA 3IKTA 3ROMA 1AUPA 1QV7A 3MWEB 4RPGA 1JLLA 1DIHA 1X7DA 2H5LA 3FD8A 3VOSA 5HTOA 1PJLA 5DBFA 1UZNA 4P8RA 1V6AA 3HDYA 1TT5A 4PLHA 1ZEJA 1PS0A 3WMWA 4IGEA 5CEFA 3PWKA 1DJQA 2E49A 3AY6A 2EJWA 3ASUA 2EGHA 2R6JA 3N7UA 3JYNA 2PZLA 2EHDA 4M55A 2Z95A 5JMPA 1N7HA 4A10A 4DMMA 1U8XX 1T26A 3E82A 3BTSA 4NJMA 2P4HX 1RM5A 2PH3A 1U7TA 3DL2A 3ZHBA 1ENYA 4WLOA 1NBOA 1PL7A 2Q1WA 4NU5A 3U0BA 2CDAA 3UF0A 1GFSA 3VVBA 4IDFA 1AGNA 2B5VA 5IXYA 2HKIA 2Y1FA 3P7MA 4MKRA 1I01A 3AW9A 4YRDA 1ZUD1 3DOOA 4OSPA 3WTBA 1GAEO 1W8DA 4ROSA 2NU6A 1GPDG 3I4CA 2G17A 2VUTA 4ND2A 5KJ1A 2C59A 2J5KA 4Q3CA 5I7SA 2LDBA 1ZSNA 3PDJA 3RFXA 1SZJG 4I5FA 1IULA 1VPDA 4BMSA 1N7GA 3E9QA 3O8QA 2BGMA 3I6QA 1DOHA 5ADHA 1QV6A 1GEGA 3A14A 3P19A 4DLBA 1ADBA 4FFOA 1A7KA 4BO4A 1BRMA 1BW9B 1OZAA 3EZLA 4FN4A 5A04A 4HFMA 2PKRA 5T64A 1NQTA 4BO9A 1E3EA 4RF2A 4PG7A 5JSFA 3FNFA 4NH4A 4OH1A 4J91A 2NWQA 2B4TO 3RUDA 3MEQA 2Y1DA 3V5NA 4I9UA 4RF4A 2C5AA 2XXBA 4CM9A 4J49A 1PR3A 5JFOA 4R51A 3M2TA 3VZRA 1XIVA 3JV7A 3GHHA 1LXCA 4YXFA 3HB5X 1E5QA 1UXIA 2GLXA 3DHEA 3ROQA 3TNLA 4XGIA 2YV3A 2O7QA 1EDOA 4DYDA 4Q9NA 1PJ3A 1NX6A 3PXXA 4MVJF 1U7HA 2YQ4A 3QWHA 4CMGA 3UCFA 3ETGA 2B35A 3X2FA 5FWNA 3KLMX 3STHA 3ZW8A 1ZZEA 2GF2A 3ZWBA 1ZIDA 2W4QA 5KJEA 5H82A 4WCFC 4TRNA 4NG5A 5H81A 1T4DA 3K8ZA 1H6BA 2NQTA 5BQFA 5IJZA 4PRLA 1ADCA 3G49A 4R9RA 4D79A 4NMHA 2Y1CA 4DLLA 1YL6A 2QZZA 4YAKA 4XZ3A 5DULA 4Y8VA 3D3WB 1YRLA 1KVTA 1V3TA 3MTGA 2QZ9A 4Q3BA 4R68A 2P9EA 1YGYA 2W2KA 5EQDA 4NQZA 3B1KA 1MFPA 4GSLA 4MIEA 5CG1A 1GADO 3AI3A 1JKIA 2Q2WA 2NM0A 1EZ4A 2AE2A 3AFNA 2DBVO 4MINA 5A9RA 2D0IA 4B3IA 3HSKA 1YBAA 1KVQA 1XYGA 1YJQA 2WD8A 4IM7A 1H9AA 3JQFC 2NQ8A 3ULKA 5L51A 4OMUA 1XLTA 3IQDB 5B4UA 1Y5MA 1BXGB 4DQUA 4BB6A 5C7IO 1UZMA 3RKUA 3MJTA 4QQRA 4Z9YA 1U2DA 3D5TA 1MP0A 4TQGA 2P4QA 3T4EA 3ITKA 1UXJA 3GVPA 2X5OA 4KDEA 1ZSVA 4KWIA 4G2NA 4GI2A 5ES3A 2GD1O 3GDGA 4BKRA 1Z82A 1GQQA 3GFBA 4NPCA 5TLSA 1A71A 2RAFA 3P2YA 1JN0A 2AHRA 3SXPA 2PA3A 3PHGA 4LSMA 4B3HA 4ZJUA 4IIUA 1DDOA 4IMPA 3KYCB 2WMDA 1NAHA 4QUKA 4ALLA 4CUZA 3WICA 1GTMA 2HK7A 3NV9A 2QX7A 5BNTA 2HRBA 1PL8A 4O59O 3W8EA 3WWYA 3IDSA 4GVLA 4BO8A 4N54A 5LDHA 3S8MA 3HJAA 1YH3A 4LN1A 3Q11A 3ZN2A 1DHRA 3FNEA 3LC2O 4EZBA 5B4TA 3SJUA 3LQFA 4B8WA 3DQPA 2VZ0A 3H6KA 3TJRA 1PJ2A 3TRIA 4EEZA 3C1AA 1AXEA 4CM8B 1LTHR 4FCCA 5KKAA 3WQRA 4S3MA 2X58A 2ZCVA 2EV9A 2VYVD 4IINA 3L0DA 3EYWA 1JWAB 2OHXA 3FTPA 4GAEA 1U3UA 4QSMA 2HO5A 2X7HA 3DB2A 4GX0A 3GH3A 2EJVA 1PGQA 1ZCJA 2B5WA 4PG5A 2EEZA 4CLHA 3ZZNA 3ZV5A 3BIOA 2FP4A 2BGKA 5AYVA 1HDRA 2D1YA 3D5QA 2HSDA 3ABIA 4MP6A 1PJSA 2FPGA 1GEEA 3KSDO 1DB3A 2A35A 4QT0A 2Q45A 3IMFA 1LLDA 2O3RA 3RUHA 5CDGA 4F6LA 5IG2A 3FHLA 3F46A 4RPKA 4JP2A 3DZJA 5FYDA 2OMEA 1MLDA 1KS9A 3E1KA 1BDBA 1H6CA 3CXRA 4Q3EA 3GPIA 3GFGA 1V8BA 1LLUA 2D3TA 4RQUA 2FR0A 3GPDG 1RYEA 5KOIA 5AXAA 3WOHA 4R1UA 1PJCA 1KETA 2WD7A 1NQAO 2I3AA 1I2ZA 5DCUA 1SB9A 1HSZA 2NTNA 4P38A 3S2IA 5TT0A 4HFNA 1D4FA 4Z3KA 4F3YA 1I8TA 1NTOA 4KUHA 1DFGA 3ZHYA 1QLHA 3NRCA 5JDIC 1P0FA 4FC7A 4E32A 5I9MA 3D4PA 3I3OA 4MVJA 2JD1A 3F1LA 3PTZA 5I7FA 5DDIP 3L4BA 4BKOA 2P9GA 2H9IA 4J1TA 4ZQEA 3UAGA 1E7WA 3OQ1A 4O63O 4PCVA 2DUWA 3EVTA 3RWBA 1A7AA 2X6TA 1E7QA 3HFSA 3OA0A 1D1TA 4IDEA 5CDUA 4CMAA 5BSGA 4ALNA 4CM5A 3RBXA 3KSUA 4ALKA 1ZJYA 1OAAA 3F5QA 4ZHSA 2A9FA 4A27A 2FPIA 3PYLA 3F3SA 3MOGA 1SOWA 2AQ8A 2ZQYA 3IIEA 2B4RO 1NWCA 1GYQA 4FC6A 2B37A 3GAFA 5JDCA 2B0JA 4J1NA 1WZIA 3DBHA 1C1DA 2PTGA 3PDUA 4Q3DA 2BFPA 5AQ1A 3QVXA 4DVJA 4G5HA 4NR0A 4CMJA 3PFFA 1FXSA 2GCGA 1GUFA 1E1KA 1L1FA 4DQXA 3TF5A 4MKXA 3OECA 3TZQA 2JKVA 4TRRA 5G0TA 5DOVA 3PGJA 3K31A 4YDRA 3QHAA 5EMHA 4YJFB 2J5QA 4E3ZA 1DC6A 3FPCA 2AG5A 5TIIA 2D5CA 4ZICA 3ONEA 1QYWA 3GVHA 3H4VA 1P1HA 4FPXA 4UEKA 1YL5A 3CINA 3ANMA 4R3WA 1U3TA 4PN3A 2PNFA 1J5PA 4B4WA 9LDBA 5K9ZA 4XB2A 4BGUA 4Y6PA 5BNFA 2ZCUA 5KVCA 1MG5A 2ZTMA 3GEGA 4D0RA 4CM4A 4NBTA 1HT0A 1E3IA 5KVQA 2EWMA 4NBRA 4OYRA 3GOHA 2DPHA 1SBYA 3NJ8A 4WECA 2QYSA 2FOIA 3F4BA 4H15A 5DNAA 3RJ5A 3KLPX 4R1SA 5L4NA 3EMKA 1UR5A 1ZO8A 2J5RA 4GH5A 1OC4A 4IPTA 4K28A 3G79A 2DC1A 3NTOA 4IQGA 1GCOA 2JAHA 3U4HA 1P44A 1Z7EA 3JQ9A 1HE2A 1DHTA 3K5PA 3PFWO 3UUWA 1SB8A 2TMDA 2BFAA 1GPJA 5JCJD 1Y81A 4OXNA 4R54A 4UUMA 2YDYA 2C29D 4HKTA 1OC2A 1KBZA 3L9WA 4L74A 2D5AA 5HA5A 5TSDA 1LRLA 3ENNA 1UP7A 4YJGB 2VT3A 3D1LA 2HU2A 1H2BA 2JFGA 2DLDA 5IF3A 1H9BA 2EF1A 3UCEA 4LVUA 3ZW9A 3H2ZA 3JQBA 4A03A 1YS4A 2GN9A 3OJFA 4B4VA 4YACA 4BMNA 1H0KA 2BI7A 4FFRA 3ENKA 5I7EA 1V9LA 4NK4A 1FDWA 3VVCA 2EW8A 2IE0A 1GUYA 2GGSA 1T2FA 1I2BA 1GZ6A 1ADFA 3I52A 4WNIA 3AM4A 3RC7A 4OOEA 3UN1A 3WDSA 3AY3A 3LT0A 1XA0A 1IE3A 5G4KB 2VUSA 3B6ZA 4XB1A 1B7GO 3K92A 4HY3A 1T2CA 2D59A 2G82A 3H9JA 3VH3A 3I6IA 3HDHA 1LC3A 2C0CA 3ADPA 1JWBB 2E82A 5F3RA 3JD0A 2VZ8A 3ONFA 3QWAA 3ICPA 3JQEA 1V35A 1LSJA 3QW2A 5IDQA 1Y9AA 4AJ2A 4NFSA 4UREA 4YQYA 4CV2A 4TMFA 4CLRB 1N1EA 1VJTA 5TC4A 4CV0A 1T24A 2HLPA 2ZTLA 4HP8A 4J2OA 4B8ZA 3BZUA 3LVFO 2VRBA 4U6SA 2AQIA 4BNGA 1K6JA 1ZMOA 2NTJA 1N9GB 2ZKLA 3IUPA 4J43A 4CUJA 5THKA 4GLLA 2CF5A 3JSAA 2R2GA 3ZGYA 3HDQA 2NLOA 1LRKA 3UFXA 1PZFA 5HBRA 1YOVA 4FQ8A 3QWBA 4II2A 2BFMA 2C5EA 4RVGA 4EJ0A 1PQWA 2VQ3A 1OOEA 3O26A 4JBGA 2BHLA 1Y8RA 3E9MA 4WLFA 3HQ4O 3VKUA 2EKLA 1P1KA 4PZCA 3LT4A 4MVJI 3DBRA 4E12A 1J49A 4J4BA 1I3MA 4CMIA 3ZU5A 4MO2A 1Y9EA 3F1KA 4XA8A 2RHCA 3ZU4A 4ZQBA 4U0KA 1G0OA 4CLXA 1K0UA 1Q2XA 5L9AA 2G5CA 1GQ2A 4KMSA 2I9PA 3ANLA 4J0FA 2I99A 2AA3A 3DR3A 1IB6A 4RVHA 4MP3A 4X54A 4PZDA 4J7UA 3TFQA 4DQVA 1LNQA 5J23A 5JNLA 4E2YA 3ROKA 4NNJA 3INGA 1R15A 1BTOA 1PGNA 2FY8A 2ET6A 3H65A 2PY6A 4CM1A 5IZCA 4Q3AA 3BMQB 2RCYA 3GMSA 2JHGA 1Q7BA 4PZEA 4DL9A 1HLDA 3VPSA 1K6XA 4OAQA 1BXZA 4TVOA 1A9ZA 2VNSA 5DT9A 2OL4A 2WYWA 2UUOA 4RPHA 1TXGA 1XWFA 3ZWAA 3KRTA 2Z1NA 1LDEA 4R1NA 1F14A 3SC6A 4B4UA 1X0XA 1IUKA 3ROPA 2Q49A 2X4GA 1JAXA 2VT2A 2NTVA 4E5MA 4RF3A 1ZK0A 1QMGA 1SAYA 1QORA 2DFDA 2IZ0A 5I8ZA 1Q7GA 3G17A 1ISFA 1NFFA 3VZSA 3JD4A 3KETA 4HX5A 3TZHA 3WJAA 1H6DA 3U4IA 1DIAA 1XHLA 2C7VA 4XIYA 5ITVA 3ETDA 2H6EA 2UYYA 1TLTA 4Z0PA 3RD5A 4RJTA 4BGEA 4YYZA 2DAPA 3EZYA 1B8VA 4YJHA 4Z0TA 1RM4A 4KWHA 4YT8A 4Q39A 3OM9A 3GLQA 1R4MB 4C7JA 5CFZA 2X9NA 2VCYA 3TZKA 4R4JA 1H6AA 4IDCA 2YV1A 4CQMD 5A5FA 3JD3A 3K2EA 4MJLA 2W2KB 1QXSA 1HE3A 1MUUA 1HDGO 1LU9A 4Y98A 1A72A 3VDQA 4YQZA 3EUWA 4QO8A 2WDZA 5A9SA 1O8CA 3N58A 3WGIA 4ZGWA 4RF5A 1EQ2A 2PD3A 2AMFA 3JTMA 1MFZA 2BFOA 2O3QA 3IP3A 3PQEA 5F1PA 5JAIA 1B3BA 4FJ2A 3CMMA 2DT5A 4UVHA 1BMDA 3VPFA 3W8DA 1XKQA 1HDYA 4MVJH 4GL4A 2NADA 4BKPA 3FSRA 3SJ7A 2V6GA 2PZKA 2FSSA 1T1SA 2W2LA 3LC7O 2SCUA 2CSUA 4YWJA 4AFNA 4I5DA 4FGSA 3U4CA 5ER6A 4HFRA 1E7SA 1O95A 3O4RA 3ZI0A 3U3XA 1GL3A 1O6ZA 2HMWA 4BNIA 3QWFA 3I9NA 1ZH8A 3KO8A 3DWFA 1SO8A 1ZXLA 2X0NA 1C0PA 4IQ8A 4EYEA 2YFHA 3I9JA 2W98A 5L4SA 3ZNNA 4BNLA 1VC2A 4YT2A 5DF1A 3PZBA 2Y0CA 4TKMA 5B12A 1LLCA 1E7YA 1C14A 2VYND 1U3VA 3GDOA 1DAPA 3DAFA 4MIYA 3T7CA 1ULUA 5CDSA 3ZNPA 2Q3EA 3QE3A 4DIFA 5U4QA 4GWKA 5L95A 4N7RA 4ONEA 3K2BA 3PYMA 1N1GA 2ZB8A 4XR4A 4FGWA 3PWSA 3UVEA 4TVBA 2OBYA 4BVAA 1B15A 3BMCA 1GDHA 1M2WA 1ISIA 2FHSA 4YCAA 2OZPA 5THQA 5ICSA 1DC5A 1A9YA 2YHUA 3G1TA 4XR9A 5K0ZA 3QQPA 4HNGA 3ZWCA 3ZU2A 4LSWA 3AK4A 4YA6A 5CEEA 3V2UA 1QR6A 1R4NA 1AE1A 2IZZA 2IEBA 4RVFA 4BNUA 4EJMA 3JYQA 4EUEA 3GY0A 3L6OO 4FOSA 2YY7A 4L9RA 1PQPA 3Q0EA 1NWHA 1ZFNA 4R9SA 5IXSA 1EEHA 2E37A 4JJFA 5KTKA 1CQJA 5FI5A 1YDWA 5DBGA 4C7KA 3PPIA 4LRSB 3C1OA 3JD2A 1EQUA 4ILKA 2VHXA 3TN7A 3UKOA 5JY1A 3EW7A 3E48A 1R0LA 3AWDA 3GT0A 4CL3A 2P5UA 2QYTA 3P2OA 4M86A 2I67A 1BSVA 4GGOA 3VH4A 2J8ZA 3C8MA 4CQLB 5EJ2A 1SPXA 2QHXA 1E3LA 5CHEA 5KKCA 1V3UA 3S2FA 4CPDA 3BTOA 4NIMA 4PLGA 5T6BA 4U8GA 4D42A 3WFJA 1XU9A 3KM0A 3BHIA 2X23A 3H9GA 4CMEC 1U4OA 1XCBA 3LT1A 3LYLA 2WTBA 4L4SA 3OA2A 4UVGA 2B69A 1U5CA 3LDHA 1IPEA 1XGKA 4UVEA 5CP8A 2FRDA 4IGFA 4JK3A 4Y67A 2DU8A 2DM6A 2JFFA 3F47A 1HF3A 1QRRA 4AJ1A 4GKBA 4AJKA 3AOEA 2OFPA 2RBEA 4IDAA 2NSDA 2JJYA 1NP3A 1PTJA 3PLNA 3VH2A 3EDMA 3JQGA 4XYEA 4DPLA 1PIWA 5ENDA 3HDJA 2ZYGA 3DC2A 2VNAA 3QVWA 5EPOA 4IJVA 2DTDA 3R1IA 3WBBA 5JO0A 3A06A 2HK9A 4CM9D 1LQTA 2PKQP 5LC1A 4IJKA 1QSGA 3OIDA 2V6BA 3A1NA 3RFVA 1HYHA 2Z1MA 3OEYA 3JQ8B 4BQRA 4WLEA 4ZU3A 4BB5A 4RVUA 4BNKA 1H94A 1GCUA 2GR9A 4WCFA 1X7GA 3BMNA 4E5YA 4E5PA 1QYVA 4WJZA 3X2EA 1DAOA 1Y8QB 2C82A 3GVIA 1RM3A 1EFLA 1X7HA 2XOXA 2O23A 2NV6A 3I23A 3NYWA 2O3SA 3DTYA 4JBHA 4R69A 3ZNOA 2O7SA 4CM7A 3PJEA 3MJEA 1F0YA 4ZQHA 3PK0A 1WNTA 1YE3A 2YYYA 4A7PA 4U5QA 4GX2A 1CETA 3PQDA 4RVDA 5DCYA 2VZ9A 4W99A 5HS6A 1JDJA 5T67A 3ZH2A 3WGOA 3RSHA 4EEXA 4JROA 1R12A 2FN7A 3S1LA 1ZK1A 1D3AA 4CR6A 3BHJA 4BNMA 3WNVA 4NJOA 1OFGA 3GZNA 3DFUA 2R00C 3FI9A 1T2DA 1X1TA 2ZTUA 4B7XA 4KDFA 5EQFA 4GKVA 4WEOA 5GMOA 1E7RA 4E21A 2D2IA 1EUCA 3LF2A 3CMCO 5BSHA 1JKFA 1LDNA 1AN9A 3HN2A 4J1SA 4KUGA 1KEVA 1DO8A 1WVGA 3DFZA 3JQFA 2AG8A 1WLYA 4WOKA 3EAGA 1B3RA 4D45A 4NZ9A 3GAZA 4GMGA 4LISA 4ZRNA 4TKLA 3VH1A 4HWKA 2P5YA 1B16A 1PX0A 2GO1A 3BAZA 3C3XA 3AUAA 4YVFA 2GUGA 3GF4A 3I5MA 4Z6KA 5JW6A 5COBA 2X86A 3OJLA 3QVOA 3BMOA 2GZ2A 2IEDA 4LGVA 3RI3A 4O0LA 3R6DA 1HDZA 2P91A 4UUOA 4PG8A 2GN6A 2X1HA 3E6AA 3GNSA 8LDHA 1BVRA 1Q1NA 2PFGA 3D0OA 4N5LA 3B70A 3GA0A 2PR2A 1K89A 7ADHA 4I08A 4PLTA 4L8VA 2VHVA 4H7PA 4D0SA 3JQCA 2P2SA 3UICA 1Z75A 3ZDFA 3DBLB 4ITUA 4CMBA 4BV9A 1LSUA 1NNUA 2IRWA 4RPJA 5JE8A 3E8XA 4BNVA 1PJBA 1U1IA 4D44A 4D7AA 3PIIA 9LDTA 1E3WB 1SEPA 2C7GA 2Y99A 2IXBA 1NM5A 4HNHA 4M89A 4U0JA 1RKXA 2A94A 3WNQA 1WMAA 3FTNA 1YKFA 4TRMA 4AVYA 3K73O 3C7DB 3AOGA 3GK3A 3ZNQA 4ZN6A 4L0QA 1ONPA 2I3GA 2QRJA 4IDBA 3PJGA 2UDPA 5TS3A 1I36A 1OMOA 2YW9A 4LMPA 4BMVA 3QA9A 1M6HA 2VUUA 3KEOA 4YJDA 2EP5A 5A4DA 3ZHZA 1EVZA 5A05A 1KIFA 4OIMA 1U3WA 3F6YA 4GLOA 1HYGA 2GNAA 4J4HA 2D4AA 4XX0A 4CM3A 4PLWA 5CPFA 1U2GA 5KJFA 5KWEA 1NHWA 2IYPA 2ILTA 2VRCA 1YL7A 1PJQA 1CWUA 1MV8A 2ZATA 2POQX 4JNKA 4MVJG 3U5TA 1X0VA 3FF4A 1ID1A 2WYUA 3TZCA 4UULA 1NASA 1Z7BA 1B14A 1JQBA 1N2SA 1PU2A 3MJVA 4PVCA 1BW9A 4BO0A 4J1QA 1EE2A 5DOZA 3OICA 4CLOB 1O9BA 5A02A 1HTBA 1PR9A 5L45A 2CZCA 3PWZA 1SEVA 1AHHA 3W4JA 2JCYA 2IXAA 2CNBA 2O2SA 4OM8A 3LT2A 1NR7A 2XPCA 4YRAA 1ZJZA 5T8KC 3RROA 3WQQA 1O5IA 4II3A 1HE4A 4WK6A 2HJSA 3SVTA 2CVOA 4HV4A 3SLKA 2BELA 1E7MA 2GN8A 5H83A 4DPKA 4MVJM 2O4UX 4PLZA 1VJ1A 2QW8A 5JDIA 4GSKA 3M1LA 3NX4A 4GWGA 4QFDA 4WEQA 4XDYA 5EN4A 4E5KA 4BO2A 4BIIA 3CIFA 3U09A 1RYDA 1NHGA 3WIEA 1FMCA 1EMDA 3EHEA 2IYOA 3K96A 5ILOA 5C7LO 2WE7A 3RU9A 4PG6A 1C3VA 1XEAA 1R0KA 3QY9A 2ZK7A 2PGJA 1ISJA 1UXGA 2HJRA 4KTTE 3IP1A 4UVIA 3LSYA 4E30A 3RJ9A 4YEDA 3D3WA 2GERA 3ONDA 1GD1O 1UJMA 2E6UX 2EIHA 1LSOA 3D4NA 2FZEA 4MP8A 4OKNA 4A2CA 3H3JA 3GGPA 1DRUA 1ZVMA 1B0AA 3KB6A 4R41A 3U49A 4CQMB 1FDSA 2Q99A 4RORA 1G1AA 4EJ6A 4FFNA 1U4SA 1P1RA 3GRKA 2GZ1A 4DPMA 4URFA 4GMFA 3DZIA 3GEMA 1QYCA 3GHYA 4RVSA 3L9XA 3H5AA 1ISHA 2C2YA 1ISMA 3PRJA 1T2AA 4R5MA 4BNFA 3RAJA 1DC3A 1M67A 1JW9B 3B1JA 1S6YA 2X0JA 3H5RA 4D46A 1Z74A 1BXGA 1DFIA 3K9QO 4FBGA 4XWYA 3NDIA 3ORFA 4BNWA 4D41A 1EK5A 1R16A 4P4GA 4WCDA 4FSHA 3TL3A 2GZ3A 3NT5A 3V1TC 5HRUA 4DIOA 2Y0EA 3CZRA 3AU8A 3GRPA 3OH8A 2AEMA 1EUZA 4IBOA 1F8GA 1YXMA 5TX7A 3RUCA 3DOJA 3QLJA 2WWRA 3R0IA 4RZIA 3ZWMA 4XGNA 4BO3A 4WPGA 5JAZA 1I10A 1JVBA 1YB1A 2HMUA 4OL9A 4W7IA 5JCJA 3WYBA 3ZWYA 4A5OA 5A5EA 5JAMA 4RL6A 3OEWA 3GEDA 2OBNA 1HDOA 1LDGA 1NFQA 5TJHA 3RFTA 3D4OA 3IKVA 3KXDA 4P4NA 1HE5A 2EKQA 4Y6SA 3VHRA 5L7WA 1PZGA 2BRUA 1JVSA 4A73A 1IZ9A 1WWKA 3DTTA 3NUGA 1EVIA 2YHIB 3VZQA 4BL5A 2GASA 3FN4A 4PLVA 4Z3DA 4DWVA 3G3EA 5CG2A 1W4ZA 2NACA 3QSGA 4FR5A 3H9EO 1T25A 4Z0HO 3JQDA 2Y93A 2JCXA 4K1LA 1ZNQO 4TZTA 4GQAA 1BVUA 4XQEA 4WASA 2EKPA 2PLAA 3WYCA 1UH5A 3P5SA 3K30A 4ND3A 1TA4A 4AJIA 1P3DA 1YQXA 4QO7A 1NQ5A 1RWBA 1UDBA 1JKJA 3H9UA 5DBIA 3W6ZA 1E6WA 4CM8A 1SMKA 3BHMA 4ND5A 1K5HA 2NVWA 2P9CA 2ZIZA 2VWPA 4GX1A 2Y05A 2DBZA 2ZB7A 5ILGA 3H5NA 3HFGA 2VTEA 4W82A 4LMRA 4DMLA 1CYDA 3L6EA 4ZA2A 4KQXA 3ANNA 3QVTA 4ND4A 1TT5B 4TSKA 4J16A 4D43A 4UEOA 4BGIA 1E77A 4HFJA 3U62A 4E31A 1F12A 5EERA 2YZ7A 3VAZA 4YTEA 4RV9A 1GY8A 3TWOA 4KTVE 1NVMB 2HCTA 3E03A 3DO5A 4NJMB 2EW2A 2PH5A 2BKAA 1ARZA 3DAPA 4WNCA 4BO6A 5C5IA 3HWRA 3PHLA 4AICA 1R0SA 1VSVA 1PS8A 5AXDA 1EVYA 3W1VA 4FJ1A 3TZ6A 1NVGA 4B7CA 3WGQA 3RCBA 3RASA 2EERA 2O48X 3AM5A 3CZMA 3LC1O 4Z9XA 5IFLA 3V1YA 2B4QA 5MDHA 1PJTA 3A28A 5DZSA 3B1FA 4I9HA 4ALJA 3KBOA 3BA1A 1ONNA 3TDKA 4BKQA 1CDOA 3TOZA 4J0EA 4DREA 7MDHA 1VRWA 4JQCA 1EUDA 1EE9A 4NBUA 3U4DA 3O8QB 1ADGA 3OQBA 3NTRA 1LEHA 1E6EA 4L75A 3ZU3A 1E1NA 1XG5A 4N5MA 3WJ7A 3AUSA 1YB5A 3SEFA 1DPGA 3ZCXA 2E48A 3O03A 1WMBA 2O2YA 3WSVA 5COQA 4JXKA 4UAGA 2H63A 3KYBA 1DFHA 2G1UA 4XD2A 3D64A 1W6UA 5DP2A 1E92A 3DXFA 5KIAA 5ITWA 4LK3A 5JXWA 2CF6A 3GVCA 3KYDA 3I9KA 3F5SA 4WGGA 3KHUA 3W8FA 1GV0A 3L6DA 2YV2A 3WX0A 2CY0A 1ZK2A 1MXHA 3D7LA 2GN4A 4J7CA 1CERA 4RQTA 3W4KA 2DPGA 3WQSB 1DIGA 2CVZA 3WGTA 4YAIA 4H3VA 5IN5A 3H8VA 4B3JA 3Q9NA 5AOVA 3T7EA 3CE6A 1ZK3A 5IDXA 1KEWA 2OORA 1JTVA 3DZFA 4J9UE 5G4LA 1A27A 1NPTO 2NVUA 3HB4X 1HKUA 4PRKA 4XGKA 4BGVA 1WW8A 3DMTC 3HE3A 1IHYA 1DIBA 2D8AA 3QRWA 5BSFA 3Q3CA 3I9MA 2X22A 3GGGA 3CEAA 3INRA 1Y5RA 1FDTA 1U28A 4L4XA 4TROA 3V1UA 5I8WA 5K6AA 5FEUA 4UUNA 2JCVA 4JBIA 5A1TA 2DQ4A 3OHSX 3H3FA 4M8SA 1A4UA 5G0UA 4XRRA 3RUIA 3S2GA 4IDDA 4M1QA 3HN7A 2Q1TA 4KQWA 3DONA 4UEJA 5I9NA 1YBVA 1BDMA 5I7VA 1Y1PA 2JHFA 4ESOA 2WJPA 2I6TA 1BGVA 5JYEA 3C24A 1YQDA 4Z9FA 1KY5A 5BR7A 3FNHA 3NGXA 3WYEA 3FRJA 1G0NA 3GR6A 4NDNE 4NI5A 1AXGA 2AQHA 2IDZA 4EGFA 5DCWA 4WLVA 3C7AA 3ZV4A 3G0OA 1VE9A 4ID9A 3BXXA 2EXXA 3NKLA 1B8UA 1KVRA 4Y6RA 5ER9A 4QFCA 1PGJA 4DRYA 4DXHA 1XDWA 4NU6A 1FF9A 4W7HA 3RUAA 4MDHA 4M54A 2Z5LA 3QJ5A 4OSOA 4W9NC 4E0BA 4EUHA 1LUAA 3GZNB 3PJDA 3WMXA 4NBWA 1LSSA 1ML3A 1P9LA 1KVSA 3WSWA 4FS3A 1FJHA 1JA9A 1P45A 3JQAA 1IL0A 4FIZA 5CEJA 4CV1A 3BTVA 2HMSA 3FPLA 3PJFA 3I9LA 3KV3O 4N18A 4OXKA 3NEPX 1EK6A 4YJGA 2A4KA 3NT4A 4RGBA 1XQ1A 5LDGA 1QLJA 4CLDA 2Q4BA 4QX6A 2PZMA 3ZV3A 5TF4A 1UXKA 1E3SA 4YT4A 3NTQA 1T1RA 4FFLA 4LVCA 5L53A 2W2LD 3OSUA 4KP7A 2OP1A 4GPD1 2B83A 3ZWNA 1YQGA 4GGPA 4CUKA 3KTDA 5L7TA 1U8FO 4RDHA 5GZ6A 1PEDA 1C0IA 4ZRMA 1WXDA 5A3VA 4ALMA 1IPFA 1BXKA 5G4KA 6LDHA 4RZHA 5IZ4A 4IZHA 2RH8A 3ITDA 3GG9A 4PG4A 3OBBA 1I24A 5LCXA 3UGKA 1O94A 2YDXA 1NQOA 4FDAA 4B4OA 1E1LA 1VJ0A 3JQ7A 1W0CA 1SOVA 2X0IA 4O5OA 3RC2A 1VSUA 2HDHA 1NAIA 3PGXA 1MGOA 3WWZA 1NPDA 3BYZA 2GDZA 4TWRA 2Q4EA 4CLRA 3C7CB 4L76A 4U7WA 2VHWA 3I4FA 1N92A 3QWIA 5TQVA 1GU7A 3ICCA 4PLCA 3VTFA 1ISGA 2QIOA 3L77A 1CF2O 3C85A 4RCVA 5JAQA 3TPCA 4F46A 4DGSA 2AXQA 1N9GA 1R66A 4G65A 2Y68A 1RPNA 2VWHA 1WDMA 3ZWOA 4KZPA 2E4AA 3JD1A 3OMLA 3DBVO 4XYMA 1ZW1A 3RVDA 4IJUA 4Q3NA 1LC0A 1D7OA 1I3LA 1DEHA 2V6FA 4R01A 3GG2A 1R6DA 5EIOA 3RBVA 1Q0QA 1WAMA 2CFCA 3VPXA 1Z45A 5AXBA 3HZZA 3VPHA 1UDCA 3QP9A 3W4IA 1P33A 1HETA 1PL6A 2VOJA 3MTJA 1GR0A 4QTZA 1HYEA 3IOYA 3WGZA 4BOYA 1PSDA 4CLEA 5JLAA 1QYDA 4AG3A 4B79A 5BSEA 2WD7B 4ZD6A 1CJCA 1LBEA 4CMEA 1O0SA 2OGUA 2DKNA 4JJIA 3AOEC 4J3FA 1PWXA 4FOOA 3V2GA 3PHIA 3OF2A 1D1SA 4M49A 2RHRA 2HMTA 1PQUA 3PLRA 2J3IA 2ZJ0A 4BO1A 1X15A 2ZB3A 3BMQA 5F1OA 4A0SA 2X9VA 4F6CA 3DZGA 1ORRA 1P77A 1L7DA 2X5KO 2YQ5A 3Q1LA 3VTZA 2WEKA
chains in the Genus database with same CATH superfamily
1C1YA 4DC9A 3VR4A 4EQZA 5EMLA 1K7CA 3Q7PA 4UAUA 4B3BA 4JR0A 1K2VN 3KSRA 5DTIA 5BSKA 2W8ZA 4GW3A 4AJOA 3WIDA 5K1ZA 2GK3A 4CL8A 4G4GA 1JSXA 4G25A 1GAWA 1QIEA 5B3JC 1IXZA 2FPIB 3AZQA 3T52A 4FYPA 1UC8A 2ZIGA 1B41A 1K5GA 4CT4B 3I0ZA 1JI0A 4HAZA 5K3FB 1UMCA 1Y6JA 1TGVA 3EG9A 1T5LA 2C9MA 2EP7A 3K1JA 4Q21A 4ER3A 3RC9A 4DCOA 4EHHA 4PLFA 3W9UA 2XIQA 5JC8A 2GAFA 4FR0A 2WWTA 3T9CA 3JVVA 1NN0A 2V7GA 3EIOA 4H4DA 4K0RA 4RTRA 3IT3A 2PO5A 4HDKB 1T9BA 3SHOA 5JC1A 1LVHA 1NZFA 4YREA 1EX1A 1R4MA 2E1RA 2IODA 4EW6A 2GPAA 2VOEA 4LWZA 1D9XA 3SC3A 5JANA 4C4AA 2JIOA 3TVYA 1XTVA 4UVDA 4HYTA 1TUEA 1J07A 2VL7A 2HA0A 5LIRA 2Y8EA 1ZI6A 5DGHA 3NVKI 2XD9A 5DTMA 3AR6A 1YI1A 5ALNA 2VYFA 4URUR 4COOA 4C6TB 1L7AA 4E5NA 4C0LA 2VZEA 4QDKA 2BLLA 2NN3C 2XXJA 4JLAA 1OXVA 1KI3A 3TFWA 4DQLA 1NI4B 4HB4A 4XEHA 3MT0A 4L2IA 1GZ5A 1IDN1 2PQ0A 2XDWA 4DDWA 3EEOA 4WFKA 4H60A 3I6ZA 2QL7A 4R8LA 2ZVQX 2R00A 2MYTA 1C9NA 1ENPA 3S3TA 1RJWA 3L5OA 1KJWA 4Z9BA 2BMFA 3I2GA 3N8NA 2PR7A 2XYHA 2HCRA 1KH1A 3DF7A 5IC4A 2JBAA 2ZIEA 1F8XA 4Y6LA 4CG3A 1T35A 2MJLA 3UAVA 3CR8A 3W3AH 1L6IA 4K9NA 3GLRA 1UDAA 4G0YA 4ENVA 3GPCA 1RWQA 4KYIB 1MABA 3ZQUA 2YMQA 5DEOA 1P74A 4ND1A 3UMJA 2GPBA 3WRXC 5B1EA 1EB8A 3LUCA 3CRVA 4HZGA 4OAOA 3P4YA 5DHTA 3LXRA 4XJSA 3A25A 1GNLA 4IS3A 4XXHA 1MA0A 3AH8A 3JSXA 1NQUA 4O08A 3AP2A 3TX6A 3PQFA 3MJ4A 4NRDA 4YAOA 4JOQA 3A6KA 3FWKA 1X42A 1NLYA 2BEWA 2GEKA 3BSWA 3OY2A 1XMVA 4FYXA 4KX5A 5B1DA 2Z3ZA 1ZJ6A 4OP2A 5T4BA 3NUQA 1MO3A 2A8YA 2XCQA 2WVJA 4XUCA 1KA9H 2OXEA 3O9ZA 3M1AA 5IHPA 2X76A 5TNXA 2V74B 4W1SA 4LW8A 5AHWA 4JT9A 1PFGA 1N2JA 2C54A 3GZ4A 1ZIOA 2XE8A 2PBLA 3SC4A 1N0UA 1RNLA 2FMUA 1DOAA 3DUWA 2C7PA 3Q2KA 2ZRNA 4FILA 3R5JA 2GZSA 4GP6A 4MI1A 2WFAA 5LUBA 1JXQA 1OCEA 1NM5C 2PSSA 3ESAA 3M49A 1IN6A 5ERGB 4GPAA 5KSOA 3DAGA 2OSVA 3B5JA 4F3KA 5A6SB 3AF6A 1DAIA 3CEMA 3DZ8A 4EFLA 4OQLA 4DA9A 2BGIA 3AU9A 3M3PA 1N77A 1MH9A 4MVCA 2D5IA 4EIWA 1DUIA 5F7XA 5B53A 3AJDA 2YC2C 3MRTA 4JLBA 1N2CA 3C3JA 4EVSA 1CIPA 4ZMSA 2HMVA 3T0FA 3L18A 4ARZA 4XKJA 4HAXA 4XQCA 2NO6A 3KXKA 4C30A 5B55A 2GAJA 2J7PD 5I7OA 4LYYA 3GOQA 2OZVA 3BRSA 5JRJA 3WSTA 2AN9A 1XEXA 1SBHA 3D3EA 2H8GA 1TUBB 3PZRA 4JLPA 4L16A 3RE1A 4DR3B 3L0YA 1U8UA 3F9IA 1M66A 3GQVA 3PQ8A 5KOJB 2G71A 3WG9A 4RJKA 1U4NA 3LWNA 2A5GA 2ZZMA 3SBOA 1OXMA 3LQRA 4CM6A 1M83A 4HNQA 2FMFA 1A1VA 2FKNA 4OLFA 4BMPB 1J7JA 4OM7A 4CQNA 1CY2A 4G5FA 3ZVLA 2BGRA 3CSDA 2VHYA 5CNJA 1K6EA 5B30A 2D1QA 2IZ5A 1XFDA 2G0AA 3EGDB 5EP4A 1E0KA 3MILA 5EKSA 1IHXA 3QXGA 4LCJA 1N2BA 1TO2E 5KTNA 4MMZB 1YQ9A 4AY5A 3IERA 4BNNA 4XYBA 1A4IA 4ND6A 4WLUA 1ATZA 2O3JA 3DCIA 1CVLA 1XXHA 1FDVA 1W4BA 2B98A 2HSWA 3JASA 1C0LA 5IC6A 3GLGB 2Y1EA 4QUGA 3BN3A 3RRNA 4P1ZA 5EYPA 1CRQA 1YVEI 1BMTA 2BFEB 4Q6BA 5K2MA 3UW3A 3KVNA 2OO5A 4OU4A 5AK3A 4OA8A 4C21A 3EGCA 2WA1A 1OBVA 4H7FA 1Z68A 3AILA 4NTZA 5LA6B 5TB5A 4V0OA 2J7KA 3EGVA 1KZGB 1ONOA 1HDEA 1VSBA 3U7IA 4BO7A 4OU5A 1RVV1 3F6EX 1IU9A 4I9NA 1AK1A 1WX1A 3QKIA 3I39X 3L4BC 4ZO8A 1G7CA 1MN6A 3BREA 1Y8RB 4TV9B 4PLPA 4D9HA 5ALVA 3ZE6A 3JZIA 4F86A 1EBUA 2VAVA 1H93A 2IQIA 4IHJF 1N3IA 5HOEA 2C07A 1EHYA 4UD6A 5IMBA 4KC0A 3TIGA 4AN1A 5ITZA 2RAVA 8GPBA 2QRKA 3Q7RA 3NBMA 3W34A 2BE7A 4WACA 4A26A 4LOHA 4RTOA 2IW3A 3L0CA 4URYR 3TLYA 1EJ0A 4QU5A 5HS4A 4MS1A 3I5UA 3UXYA 3P2MA 4TTVA 3G2IA 5AR1A 3X3HA 3AJRA 3B7GA 4WESB 1U3CA 4EVIA 3KSZO 3C3AA 3WK9A 4RMJA 5DHFA 2OGZA 3EPRA 4B5LA 4JN6B 3EGOA 4TXJA 1PJ4A 3MZ0A 4MVJD 5DW3A 2DH6A 2HCBA 3B89A 3COYA 2C2OA 3D2LA 1L5NA 4GQIA 3FYHA 5G0SA 3OQIA 5I9LA 4NS4A 2F7SA 4WCVA 13PKA 3BD9A 1KRHA 4I1RA 4B75A 5LM3A 1J1UA 1BN6A 2WK1A 3K4HA 4KPUB 4KN6A 1E9SA 1BNCA 3DTVB 4HUJA 3RC3A 2I2DA 3ITNA 3JWHA 3T9DA 2A2ZA 2I4LA 5AHRA 1M7HA 2R48A 5GGYA 2FQQA 4UM9B 3THYB 2NSHA 1ZOOA 1OTYA 2JLSA 4UCQA 4FGJA 5A5DA 1CHDA 2GBPA 3VR1A 3QMPA 3UV7A 5CFPA 4YAGA 1P2UA 2J9RA 2KPOA 4RK4A 2PD6A 2QN3A 1C4OA 5SY6A 4Y9RA 2B78A 2J59A 3VNQA 2QRNA 2I5PO 3COVA 3IUJA 4KSYA 3RFUA 1Q7CA 2OLEA 1VM6A 5J59A 3A1DA 4U00A 1VKNA 4WFJA 4DE5A 3TZEA 2YRFA 1N5JA 3P9ZA 5CT4A 3VR2A 4G0MA 3UJPA 3JYLA 1XP8A 2GM4A 1V71A 1SCQA 3M2PA 2LWIA 3FYUC 2NAFA 5E4FA 2C20A 3EXHC 4MICA 3PGKA 3V4LA 2RH4A 4JP3A 3M6IA 5D7BA 1SVIA 3DE6X 1Q0HA 1LD3A 1RRPA 1RCFA 4AC9A 5KNBD 3H04A 1FDUA 4W7SA 4WMLA 1MAUA 3V80A 5L3RA 4QECA 5IVKA 3PUHA 2PKCA 2FMHA 2YJ4A 4TTAA 1YIDA 4ZQGA 4ZI7F 1X14A 2Y9PB 1HZJA 3GEHA 3RYFB 3OJEA 4ZQFA 3DWGA 3Q3HA 4DG5A 3EVNA 1MTZA 2QLTA 2AYXA 4V0ME 4OB8A 3C2QA 3VM6A 2GRJA 4KEAA 2VDMB 2ZYAA 4OHBA 4EI2A 3KR9A 4J90A 3SQLA 3T7RA 5CT9A 3BE8A 3VR6A 2CVHA 3L8EA 2JVIA 4Q4AB 1UP4A 1ZD9A 3COSA 2HIHA 3CG4A 3THXA 2RGRA 1UKBA 2CXTA 3H87A 4M0KA 3OAAD 2GN2A 4EEKA 2PQ6A 5AVOA 1W44A 5C7OO 2HC9A 2WUWE 1H5NA 3IR6A 4NQRA 4A36A 2HQRA 1KEZA 1QO7A 3OLWA 3IDZA 1M1NA 3KQQA 3AFMA 4QPZA 2ANBA 4KE8A 1HLPA 4IFBA 3DBLA 2PRIA 4IYRA 5CGQB 1SNYA 5AJZA 4UUPA 4AJLA 5IJ0A 4B09A 1AUOA 4UBJA 5EJGA 3KCNA 4ZCIA 5F1KA 4LYEA 5KVSA 2XVYA 2IF0A 2ZJ2A 2XX3A 3ZCVA 4F2HA 3PV0A 2LDXA 1ZXBA 2R4TA 3QKRB 1J7KA 2F67A 5A7HA 3RHTA 1A2BA 2BD0A 3AI2A 3AO0B 3TLBA 1JT2A 3V8NA 2AW5A 1KBQA 3KZVA 1QIJA 4ML3A 5K0LA 2QENA 1RCTE 4GXNA 4DC0A 4BNZA 2I76A 4CKCA 4DAOA 5F9FA 2ZJAA 2FPUA 4NJEB 5ALYA 3OQJA 5ED0A 3QKSB 1G4UR 1JEYB 3NWEA 3LV8A 2VR1A 4DDVA 3O82A 4Z7JA 1LPNA 4OLBA 2J3QA 3GCDA 4Z7OB 2HK8A 1UOOA 4G5GA 2VDUE 5A03A 5EJ8A 2A0WA 2G5TA 2WM2A 1NNEA 4MUMA 2IPLA 5ELLA 4J16C 1B8PA 4QU8A 2E85A 4DGQA 2PBRA 3BMCB 5A3JA 3RHZA 4V2IA 3VDXA 2QMQA 2WIAA 2HHLA 5HF5A 4B34A 1MC5A 2WU4A 1Z07A 4ZVTA 1YASA 2H29A 3L1IA 3RS7A 5ECDA 5MGBA 4F45A 1EPUA 5CT8A 3QOXA 5KINB 1P0CA 3T1YB 4OBXA 2G5PA 4J0JA 1CTQA 1LTQA 3NWJA 3JVEA 4AUNA 2C5FA 1OBFO 1ONSA 3NTVA 3PUZA 1ZHOA 4HMOA 4R7ZA 2PKYX 1CU1A 3GFPA 2OWEA 4WOPA 4DLKA 3WXBA 1L6RA 1CQJB 1EDZA 1T9ZA 4N1AA 2WG1A 2WG0A 4WUVA 1DO0A 3ZBTA 4BP1A 2IZ6A 2ORYA 4EUFA 1FS4A 2BGLA 2CXRA 4GYJA 3HS3A 4PONA 2Q7DA 1GWNA 5JWOA 2X2PA 3WGJA 2W6PA 3N74A 4B76A 2W2NA 4AD8A 1PI3A 1LDMA 4B7ZA 4Y9DA 2XGGA 3EK2A 1TZCA 1L3IA 3E5RA 4NFHA 3Q7QA 5G0WA 2NV0A 5G3YA 3DAHA 2JLQA 1N6RA 3Q3GE 2OYRA 1JFVA 3UYLA 2F3SA 1QRUA 4AP6A 1C9EA 3TRJA 2CXSA 3CH7A 5AM5A 1XCJA 4XWKA 1HV8A 1KKMA 5FLEX 3H1AA 2Q3CA 4PQEA 4TYNA 2I3ZA 4E6PA 2HGZA 2WV7A 5DLDA 4LZNA 4KVGA 2R8PA 3PITA 3PU6A 3N2NA 2JGDB 4O3FA 3VYSB 3FOBA 1YMVA 4G0XA 4NV0A 5IU6A 1WQ1R 1HLFA 2PJZA 2QQ0A 4ZI2A 1BCSA 1XELA 3WLJA 4RZQA 4UDOA 5EXEA 3E1GA 4JBYA 2EZ4A 4YGYA 4NESA 3TD2A 2ZTSA 4G5XA 1UXHA 1LFAA 1EKXA 1UPAA 4OGWA 1SHKA 2YCLA 3W3AA 1GT91 1MB3A 4F3TA 2C2MA 1ZH4A 2ZTVA 1IVSA 4HBZA 2CV0A 2FEOA 1G98A 1T9HA 2ZT6A 3EVGA 1N9KA 4NK5A 1QH8B 3MSCA 1YKSA 3GGOA 5GZ3A 1W36B 1JZTA 4G26A 1C0KA 1PGOA 1ESCA 1GTVA 3HUDA 1KOLA 2J3DA 2QNIA 3V1LA 3LFUA 5LZ9A 3WGHA 3UV6A 3AV3A 4DHEA 3IPCA 1JFFA 3TR0A 3E22B 4O2AA 3I83A 1JNYA 4Z3OA 3JQGB 5CIYA 3CUKA 3PI7A 1W85B 3PCRB 1V39A 5D5HA 2VHQA 4DSOA 1I32A 2PX0A 4K9SA 2AT1A 3ESZA 3PEFA 3ZHOA 4PBTA 4TWIA 2B99A 2NU7A 4TGLA 3CONA 1DC7A 1S01A 1KYXA 1VB3A 4JUAA 1RWWA 3A26A 3UMCA 2BLNA 4BUCA 5KJ6A 1GAQA 4PXSA 1EHCA 2AEFA 3ESRA 1WEKA 1XB2A 3VYVA 3D02A 5IN4A 2QQEA 2QMEA 1GUZA 4NCIA 4X71A 3IULA 3MIZA 3T94A 1VE3A 4N5IX 2OKGA 2XF8A 1WCXA 3IDFA 4QXAA 4QATA 4HTFA 3RVRA 4LPSA 3IVMA 4PO3X 3QELB 3K6JA 2W83A 3E3OA 4L6AA 4V2UA 4EAAA 1A9PA 1O03A 1EFKA 3FZGA 3GFSA 3SM3A 4A1FA 1JLMA 3PNOA 3PP8A 5I8PA 1N0HA 3O4FA 3NS7A 4HNVA 3GLGE 4TKVB 2RFLA 3O2JA 3PFBA 5KC9A 2DUJA 2Q9CA 3URMA 4B2LA 5MN5A 3W0LB 1SIUA 5E9JA 2OR3A 5DHSA 1RVDA 3L6BA 4RA6A 1T2EA 3H0EA 2HOQA 4GBJA 1WV0A 5DBHX 3QUSA 1LPAB 1UQUA 1DLJA 2CYCA 2QE6A 1FTSA 1YVUA 4MTCA 4BKUA 5A2GA 3PB3A 4CR8A 1V7PC 2PUCA 4F92B 4HAIA 1CSEE 2XNDD 2C2HA 4YX9A 4YPOA 2IUEA 5AW0A 5K0FA 5ELXA 1EUYA 4OHYA 2GPSA 1Z88A 1YB2A 3TFOA 3OJOA 4TRJA 4I2VA 2NO4A 2BGTA 3IJRA 1SKYB 2C4KA 5LQCA 1OIXA 1CDZA 1L5GB 1Y0BA 4OMDA 2YIVX 4HWTA 4F5YA 5IAOA 4ETMA 3GXBA 1H65A 1N8KA 3CNQS 3EVBA 4O6VA 3GH1A 3ILVA 1O95C 2Y67A 4QGBA 4Y30A 4AM8A 5IDWA 2BJWA 3A04A 4JBWA 3ZUGA 1YO6A 2J5XA 2WAOA 3WBFA 1RYMA 1P61B 4EPYA 4CTMA 3C6ZA 1MBZA 5K8CA 3CZCA 1PUXA 1CR1A 4R16A 3NDRA 1VP9A 4MYHA 1J8FA 2AYZA 2EFHB 2QD4A 4F5WA 2YHIA 4TMKA 1R8SA 1SGWA 1KJIA 1FUEA 1QE5A 2IPMA 5BR8B 1MW8X 3LF1A 1G5RA 2VWGA 4TWAA 2GOYA 4L78A 3IPYA 2VDWA 4DLSA 5KCZA 2WNIA 3A6PC 2GUWA 3AETB 3C5VA 3BMOB 3B60A 4I8XA 1P18A 2IYWA 2WAYA 2H59A 1X19A 4HVTA 2P6MA 2Q46A 2O8CB 3BRWA 4H16A 5TGZA 3KVOA 2FF7A 2QG6A 4P93A 4DLAA 4WNAA 2YHBA 4IDOA 3TQHA 3UB4A 5C37A 1LW6E 3PRKE 3MJDA 1VZ2A 3FOFC 4U1RA 4X44A 1T2UA 3JQAD 1NUUA 1VL8A 1K4KA 4JITA 2J0UA 3ROMA 1UC9A 4FP9A 4RPGA 5CAEB 4Q1AA 3KKOA 1G6Q1 1T34A 2WWVD 1FRNA 3SE0A 2P75A 4Z4GA 2WHYA 1PJLA 5DBFA 1BWRA 3K4PA 1V6AA 3MQ2A 1TT5A 2FNAA 4PLHA 3B6JA 2VQDA 5JD5A 3B3GA 1P0MA 4LPKA 5DX1A 3PWKA 1DJQA 1MU0A 4MAMA 1WXGA 3IVAA 3MS4A 3NWOA 3ZHVA 2IW1A 1IWPB 3KJZA 3AXSA 4RESA 3JYNA 2ZYHA 3MLBA 5LQKA 4TS3A 4NG4A 4X6LA 4L72A 4HEQA 1OU4A 1U8XX 4WV3A 5JJCA 3QPAA 1NATA 2NT4A 3REGA 4NJMA 4BATA 3HCDA 4EY5A 2BW0A 1RM5A 4PAOA 3DL2A 4ZU6X 1ENYA 4OF4A 2GEVA 3TCKA 2YCBA 1B1CA 1FMJA 1SKQA 2PUWA 2Q1WA 2MSLA 4R2JA 4WZ6A 4F85A 2D1SA 2M6KA 2VF8A 3O4GA 3R5TA 4KV7A 1KAEA 1Y4AE 3UC5A 2G4VA 1IWOA 3R7WA 1BCRA 5IXYA 4CZ2A 1WJGA 2QAJA 2Y1FA 3JTEA 3T34A 1I1NA 4P7BA 4AXBA 3AW9A 4WK0B 3SYKA 4OSPA 4C04A 5FPQA 1KO7A 1GPDG 2ACWA 2VUTA 4D6PA 5ALJA 1LK5A 2C59A 4MQFB 1SA0A 3NONA 3THSA 5JPCA 1ZSNA 2B2NA 2OBLA 3T54A 1PF7E 2BCJQ 2C61A 4A1OA 3WL5A 4ZQCB 1P7PA 1ST2A 4UDXX 4BLUA 5KTPA 2VQ6A 1GEGA 4WNYA 2CNKA 4LOIA 4BO4A 1XPRA 4QOFA 3KQOA 1FYDA 3EZLA 3HO1A 1KZ4A 1NT2A 1W4RA 2HHCA 3BX1A 4EA7A 3ZJUA 4DA8A 5IT4A 3NRBA 3TQQA 4GE3A 2VH5R 5FV4A 3Q0IA 1IBSA 4LF9B 3K16A 3UT5A 3CEPB 3MCWA 1TEXA 2YYAA 2Y1DA 1W94A 3R75A 2Q3JA 5GQSA 3TSAA 1QIFA 5EQJB 3IOMA 4WFIA 4RF4A 2XXBA 4CM9A 4Z8YA 5JFOA 3EE6A 3GJ0A 4BEJA 2ZGVA 1R64A 1W52X 4C3OB 3UZUA 1EFPB 2ONJA 2QRMA 1XQYA 2B4YA 1SCDA 4YXFA 1F5NA 2M1ZA 2J67A 3UIEA 2BF4A 4XGIA 5AVZA 2WWGA 3FETA 4ZOLF 5CH3A 1RI1A 3HCPA 1FP6A 4BBAA 5T4EA 4C43A 4F1KA 3PXXA 5BSVA 3TRDA 4F9TA 4BEVA 4DT1B 2IYLD 3EXIB 4IXDA 2UZ4A 2QVXX 1U8EA 2E4ZA 2GBLA 2R5FA 3P0EA 3X2FA 5FWNA 2KLBA 5JNUA 4FZ3A 1WPRA 2H5EA 5ALKA 4DEYA 2B92A 1JQ5A 5LZ4A 2LR0A 2FW1A 5H82A 4WCFC 4X62B 3FOCA 1OXUA 1OZFA 2J33A 4NG5A 3SDSA 3SLRA 3K8QA 1O2DA 3K8ZA 3T5TA 3G89A 4G3XA 1TAQA 1C8VB 3DDOA 3NB0A 4PRLA 3T3OA 1ADCA 5DI9A 3I92A 1YQWA 3NORA 1JAHA 1YL6A 4NOMA 2EOAA 1QNLA 1U9ZA 2CFTA 1WSAA 1HPLA 1MO6A 1LV8A 2H4ZA 3HBJA 3NYIA 4XZ3A 4Y8VA 5CLQA 3D3WB 4ZMBA 1ANKA 1I4EB 1V3TA 2V3CC 3THWA 4R68A 4R0MA 1ADJA 2FX2A 1YGYA 1SUIA 2JGLA 4PR0A 3VR4D 3MERA 3HJNA 4MW9A 2IX9A 4G97A 5CX1A 3TOVA 1COZA 5K3OA 2BBWA 5ALUA 4YMGA 4FQ7A 4A0FA 5CG1A 1POWA 5JYCA 1ZX1A 2OCIA 1DJLA 3V9AA 1OFUX 3AEKA 2XMSA 3LO5A 4MINA 5A9RA 1JSRA 2A88A 5MHTA 4RC9A 5DWVA 2Q0QA 3GYGA 3HSKA 3KOYA 4GLFA 3RAGA 3W90A 4N40A 4F38A 1Y34E 1YJQA 3LUJA 1XD8A 4MR9B 1BU5A 2OK7A 4UHEA 1RI5A 1IM2A 1Z13A 2NQ8A 3ROTA 3B8HA 3FUVA 2IIVA 4DADA 1XLTA 4GICA 1QK5A 4I4TA 5A6VA 1YDFA 2HLNA 2EZTA 2HXSA 3T1QA 2QRGA 2XNSA 4WBSA 1K4MA 1IC6A 1S2IA 4U3JB 3CTVA 1FFYA 1J9GA 5C52B 3RKUA 1ZU5A 3H86A 3NOVA 4H1VA 4Z9YA 4GLBA 1WA5A 2R96A 1LS6A 3PXCX 1XKXA 5BXQC 5CLFA 1GSHA 4C2UA 1MO5A 3NRJA 4JI0B 4KWIA 3FTEA 2ZSBA 4G2NA 2V4MA 5K8IA 2GD1O 3GDGA 3BHNA 4FKZA 2PLWA 4US1R 5DM4A 1X80B 4P84A 5BR1A 1Z82A 1YHNA 2VLIA 3MUFA 1THZA 5TLSA 1NI3A 2RAFA 3GGSA 4M1OA 4C78A 5ELMA 1TM1E 2QLLA 4MCHA 1OV6A 4UE6A 1UBMS 3SFTA 3GUHA 1CNEA 3RGWS 3AQIA 2G77B 4M7PA 4B3HA 3D8TA 5AUNB 2XCLA 4QGGA 2WTAA 3F2VA 1T0JB 4IO1A 3KYCB 4PFSA 1G3UA 2VYCA 4I2NA 3MOSA 4QUKA 4F6RA 3KC2A 4CUZA 4NCJA 1H2FA 1LNZA 2QWXA 1OI4A 3T3HA 4P7FA 5JASA 4F12A 4HZUB 3CYFA 1UOEA 3TXYA 4HAYA 3WWYA 9ATCA 3HCRA 3SEAA 3Q9LA 1H4QA 4GVLA 4O2BB 4N54A 1A88A 4DMFA 1XN4A 3S8MA 4JP8A 2RHTA 4M8NE 2OCKA 2BMWA 1JSCA 4EKYA 1YRWA 5IH7A 1HNWB 1DHRA 2QRQA 4CEHA 3D2CA 4DDMA 2HR1A 1L5HB 2WUGA 4X1OA 1H05A 3LBHA 4KG7A 4B8WA 4G0QA 2ZWIA 3DQPA 1REQB 1Z35A 3CR7A 1JKJB 5A71A 5AW8A 2DSTA 5SICE 3TRIA 4NOKA 1DV2A 4HEA1 1LTHR 5KKAA 1IN5A 4P98A 2ZTHA 4UPEA 2C8VA 1DX9A 5HMLA 3RTAA 4FOPA 4KWTA 4EF5A 4S3MA 4AZ0B 2EV9A 3SSOA 4RMHA 2HWWA 2O8DB 4K8OA 4R71A 1W1UA 1EFAA 5T6MA 1AS0A 2HO5A 2AD5A 4E6EA 3COWA 3DB2A 3TG2A 2GBCA 2EJVA 1MAAA 5CLLA 3T9EA 1YR6A 4PG5A 3B38A 5J1SB 2GN1A 4I1UA 4KH0A 4OFZA 1SKYE 3C6MA 4D8TA 1HDRA 4R2LA 2D1YA 3D5QA 2HSDA 3DEJA 3N3BC 4HB0A 1T10A 3R3HA 4TV8A 3UT0A 4PYJA 4JQOA 5ALHA 2ISQA 3BF7A 4U02A 4Y7DA 3A9SA 1U9CA 4C14A 5HP4A 1R0RE 4JJZA 4KXWA 1JEOA 5E1MA 3FHLA 3M3HA 3OTQA 3F46A 4QPCA 4RPKA 3AY0A 4XGRA 5EKUA 1IZ7A 3DZJA 2OMEA 1PDOA 4D8VA 1Y9ZA 5FTWA 1P5RA 2PIAA 1VJDA 1N33B 3N0XA 5C9ZA 5HIAA 1H6CA 2PSJA 4DV4B 4JZKA 1NW5A 4Q3KA 4IIYA 3GPIA 3EG5A 1IONA 1QVRA 1EX7A 3F6CA 4UHFA 3I42A 5EUBA 5KWIA 2FR0A 4IWNA 2IIQA 1XXLA 4O4HF 1XTZA 5AXAA 5JS8A 4G5YA 2B8WA 3WYAA 3HLKA 1YZKA 2R66A 5D3ZA 1SBCA 2X2EA 1NXSA 221PA 1RQXA 3TGPA 5CFRA 1SB9A 3CS3A 3MUNA 3N5KA 1GL9B 2BIFA 4ZEMA 3S2IA 4RL4A 4DSUA 3LHSA 5TT0A 2O5RA 1YRYE 3FXAA 2YWGA 1DQRA 1D07A 2R4QA 3MN1A 1KDZA 5IVHA 1NTOA 1CZHA 5CJ2A 1QLHA 1CUAA 3WOVA 3NRCA 4MO9A 3O8OB 1P0FA 4TV9F 2KBEA 4C0XA 4Y1RA 4W1RA 1EXMA 1R74A 1M10A 2F9FA 4KDRA 4I50A 5FOQA 2ACKA 4QDXA 5HMMA 3U3KA 1Z8NA 3ZW7A 5K0CA 1P7VA 4PCVA 1U1GA 2DUWA 1J2RA 3L7AA 4RKRA 3TB6A 4G0NA 1NBAA 3RWBA 4BVJA 3HFSA 3ETJA 4V1CI 3LRPA 3LECA 1J25A 2P6OA 1D1TA 3HK2A 4NCNA 4NMLA 4MA0A 3REQA 3VR5H 4CMAA 1KL7A 2I6GA 1OVGA 1WMFA 2FW0A 2HJWA 4ALNA 4K9LA 1DEAA 3E2IA 1PE0A 3OFVA 4TSFA 1VKHA 4N01A 4A27A 1SXJA 1PFWA 3Q7IA 3E35A 1JPVA 5JSYA 3R8XA 2PS1A 2ZQYA 6NULA 2J9ZB 2JLVA 1L1RA 2B4RO 1U0LA 3GAFA 2B0JA 2ZJFA 1TMYA 3K1AB 4J1NA 4ZVQA 1C1DA 1ECFA 2QR3A 2PUDA 4JL6A 3C97A 4Q3DA 5K0TA 3GLHA 5AQ1A 3O7MA 4D57A 4G5HA 1W29A 3SQNA 4ZOAA 4NR0A 3PFFA 1GGHA 3SIPA 4AWXA 1SG9A 2V5VA 2QUJA 4JHXA 4V0QA 2OMKA 3HU5A 2WZBA 2WZQA 4HNSA 4M1TA 3WL7A 2ERCA 2ZIXB 4MKXA 4NBSA 1PFKA 4U4AA 5CT5A 1CJUC 2P41A 2ZR8A 3BJRA 3TZQA 3UUEA 2HH9A 4KLCA 1Z5UA 3K31A 2YN0A 3BH0A 3NH6A 4YDRA 3NDBB 4XARA 2OFXA 3FMFA 3L41A 1XHEA 3PFKA 5I01A 5TIIA 1TCVA 3ZHQA 1QYWA 1N6OA 1QOPB 2GYVA 2RHWA 4TZ0A 1P1HA 4QZVA 1MRZA 4QAJA 3G2HA 3ANMA 2ZYWX 2WQ6A 1TM5E 4C4TA 2NYAA 4BZQA 9LDBA 5JSZA 3C1UA 4QTYA 4E4RA 3KEGA 4EK9A 2IHTA 4QUJA 4RZ2A 3HPQA 2C9DA 3E3AA 1IK6A 1ZNXA 4GQBA 3QYPA 1MG5A 3P45A 5BQPA 3GUUA 5KOHA 1BOFA 2JLWA 1HT0A 2GCPA 1GNPA 4PXAA 1P3JA 1SHJA 5CNIA 3S0JA 3U31A 2O8NA 3G7UA 2HEIA 3PNLA 3QYAA 1P6UA 4WECA 1SUPA 4D1YA 2Q4DA 2B8TA 1ILWA 3VR2D 1KDRA 2KLHA 4D81A 1ULBA 1II8A 4WBXC 2ACEA 2XE7A 3GLKA 4J07A 3RJ5A 1OB2A 5JZ9A 1H3NA 1Z2OX 4R1SA 4ZK6A 5L4NA 5EZYB 1K5DA 1Y4ZA 4GH5A 2J5RA 4LOKA 1OC4A 1ZA2A 1F2TA 3N07A 4IQGA 2OG1A 3W5CA 4OBWA 1V7QA 4XWAA 3UPTA 2XQGA 4JOCA 3WAKA 1ORTA 1DHTA 5MN6A 3BRCA 3A58B 5DJ5A 1KMCA 5JCJD 1Y81A 2Y0PA 2IE8A 2CJPA 4F91B 1TKRA 2YDYA 4C4SA 1ORIA 1V1MB 3L9WA 3O8NA 1U8AA 4EO4A 1AZLA 4X41A 2EIXA 1RKBA 1RQGA 5HA5A 1LRLA 1UP7A 2VT3A 2B2CA 1M8GA 3GP5A 1H2BA 3GUZA 2JFGA 2DLDA 1M1XB 2VQSA 1D6JA 4WWHA 4YI5A 5FD8A 3VR6D 3UCEA 2ZI7A 3ZW9A 3S1AA 5F3DA 1CDDA 3H2ZA 4G24A 3R6WA 4IZ6A 1YS4A 3NHJA 4MLDA 1RXCA 3FCSB 5C1DA 4YACA 2OECA 2ZSIA 3GJ3A 3RVMA 4FFRA 4IDHA 1V4BA 3D2BA 1GRRA 3L4JA 1S8FA 2ZSDA 2EW8A 3WYNA 5JSUA 2IE0A 2XD4A 5DMXA 3G2LA 1GZ6A 5EI5A 3IA7A 1G3QA 2RGGA 2I4RA 3VMFA 1OLOA 3UN1A 1F4VA 4MJXA 1YS7A 1XTUA 2JC3A 1JPUA 2WF6A 5HDBB 1DCTA 2VUSA 3FVRA 4RTSA 2VNJA 4XB1A 2Q3MA 1B7GO 1MT0A 5CYGA 3K0CA 1QVAA 4KXUA 3VH3A 3I6IA 4QTXA 1G66A 3B53X 5F3RA 1Y1RA 3QWAA 5FQOA 3RTDA 2H48A 3CSUA 1RABA 3RC8A 1QOZA 1YAJA 1X7XB 2NO0A 1R00A 2F17A 4FX5A 2LKDA 4XQ0A 1Y9AA 4JR1A 4PQGA 5FR1A 4AJ2A 2XEXA 2V58A 3HJHA 1X74A 1FE8A 2XF2A 1XD2A 5JNTA 3HY3A 3A11A 3OCUA 4MQ5A 1XTKA 2KQUA 5TC4A 1QGUA 1VJTA 4CIAA 1AX9A 4J2OA 4HP8A 4LNUA 3B1WA 3ZCQA 3BZUA 3K8YA 4KNVA 2VRBA 3JU3A 4RAOA 5B6PA 5C2JB 3K9NA 4JWKA 3SICE 4BNGA 2A84A 4JKOA 4MUHA 3PGMA 2BZSA 5HDQA 1YS9A 3CO5A 1EFHA 3H6GA 4G9GA 4K3VA 5THKA 3S8EA 1PZMA 4CKWA 3ZGYA 5HKLA 1AB6A 3UFXA 1F6BA 4GOMD 3L7CA 1Z22A 4GR4A 2G4LA 2OA0A 4IHJA 4FQ8A 2C5EA 2X8AA 3D8BA 3EXFA 3SCZA 1PQWA 1L7QA 1OOEA 2AOVA 2BI4A 2CEAA 2VQ3A 2YBEA 3O26A 1JLHA 1MOPA 1KMHA 4G1EB 3N7TA 1CUSA 3UT6A 4TSRA 3T4UA 4JI3B 2HGSA 3FKSA 3M4YA 5I7WA 1TW2A 3D7KA 4I7EA 4MVJI 1J49A 4OHXA 1GFWA 3RHFA 4CMIA 4F4IA 5A4KA 2E5WA 1NJSA 3LP8A 3ZU4A 5FL7D 2OO7A 3N8HA 4HOYA 1G0OA 4MUXA 1K0UA 1GNQA 1H1LB 4RXMA 3IKJA 4CLXA 1D4ZA 1WUTA 1YFJA 2J0QA 2G5CA 1GQ2A 4KMSA 3U7JA 4ZCLA 4J0FA 2WKPA 3LC0A 5D84A 4RVHA 4EKGA 4DQVA 4LQCA 1XZFA 1RPJA 2A3NA 3WLTA 3VSAA 4ER6A 4E2YA 3CRRA 4RD1A 1DI0A 5DXAA 4MV6A 3ZXYA 4BFVA 4W5QA 4DWJA 3H65A 1BTOA 1PGNA 1L4UA 2ET6A 1Z6QA 3MNFA 4DRYA 2P77A 5B6JA 5IZCA 1MKYA 4QKQA 3G02A 2FZ4A 3BMQB 4PZEA 1Q7BA 3QH4A 4GI1A 1WBJB 2P3LA 2GA9A 5D87A 1WSWA 3OM1A 4O25A 1GL6A 5DT9A 2OL4A 2WYWA 3SC2A 3W3AD 2XQKA 4XUDA 4RPHA 3I9FA 3NFRA 1GA4A 3KJNA 3RVSA 3ZWAA 4R1NA 3GAAA 4M0LA 4K5QA 5B3LA 1XRRA 3HYLA 3L1KA 1RFLA 1JAXA 5H70A 1U28C 2NTVA 2VT2A 2O5VA 4HEJA 4E5MA 4JB0A 1M7BA 3QOYA 1QMGA 1EAYA 1Z4IA 2DFDA 2XWPA 5I8ZA 1LCIA 1VSTA 1YCFA 4L08A 4YAWA 3FYCA 1AK9A 3U4IA 1CX9B 3AUYA 3STXA 3DLCA 5ITVA 5DFAA 5BY2A 4REQB 3RD5A 1B23P 1EIZA 3GJ5A 4OKSA 4RNCA 3EZYA 3IE1A 4CI9A 3GEEA 4ZZ3A 3LWDA 5BSTA 3EMVA 2XT6A 3FPEA 5C8VA 3WGUA 5KZMB 2HWUA 1OXBB 4UPVA 2P90A 3NHZA 2HHJA 2OXFA 2FPPB 3JARB 3QUBA 4FNMA 1F20A 4MYDA 2QN1A 4Q39A 4C7JA 4ZI7A 4LVOA 1CUHA 2IEIA 2V1XA 3AX6A 2RBGA 4AUKA 3CZ5A 2OXRA 3JD3A 1TGYA 4ZVPA 5ADVA 4KPFC 2ZSEA 1KU6A 1QXSA 1J8YF 3UW1A 2SBTA 1LU9A 1XMJA 2IC5A 1A72A 5C5DA 3PEEA 5A9SA 4GE0A 2A1IA 5LDHA 1O8CA 3O75A 2XR1A 4BC0A 4BWVA 3U0VA 3WGIA 3OUUA 1E59A 3P9PA 3QVGB 1G5QA 4AF7A 1QGZA 3OQOA 2LUOA 3ABQB 4GNKA 2PD3A 2UVPA 4WDQA 5K3AA 5JHGB 3AVWA 4BFUA 2Q5LA 2VNKA 4UVHA 3VPFA 1V1JA 2J9FB 3SHTA 1HDYA 2HTFA 1K75A 3G5UA 4YRNA 1KYTA 3SXUA 4BKPA 4LDQA 3SJ7A 2V6GA 1OW3B 1GZUA 4P36A 4WH0A 1T1SA 2DFPA 1JQAA 3TJMA 3HGMA 2QT0A 3WKEA 2DKFA 4MWCA 1YA8A 5TMEA 3HV2A 4I5DA 3U4CA 2QJFA 2FMIA 3T5GA 1XKLA 5SYAA 2YXNA 1GL3A 1NJ2A 4XPIA 1NA5A 2PLNA 2F62A 3KO8A 3DPUA 1CCWA 1DKMA 2QL9A 2HRQA 1ZXLA 1C0PA 1CUJA 1THTA 4IDNA 4X3OA 2AKAB 1LX7A 4R98A 1Z38A 1S3IA 2XZOA 3D4LA 5L3VA 4MPPA 1AQYA 1TM3E 4QLAA 3ZNNA 4BNLA 4PNEA 4YT2A 1QTNA 4KGVA 1NOJA 2H4YA 5B12A 4LUCA 4KN8A 5DTJA 3T3PB 5F7OA 1XI2A 2E4UA 4D02A 1IZ8A 2YNMA 4DLUA 2H1FA 1JJFA 3R3UA 5HUJA 4QM7A 2JJQA 1DAPA 2QL5A 1ULUA 2EW1A 2YIDA 4M9SA 3WGNA 2Q3EA 2IOHA 5U4QA 1E60A 1Z37A 2JBWA 5L95A 2A9QA 4N7RA 5DGXA 1W2GA 3DNPA 3ROEA 2ZKIA 3VC2A 4MEAA 1I6MA 1Q84A 3E1SA 1CY7A 4QWMA 1PG2A 4IGIA 4BRUA 4W5OA 3II6X 2QNRA 4WERA 2VH2A 3BRWD 1E8DA 5HJEA 4YCAA 1SKBA 721PA 1FQJA 4QELA 2IGBA 4ZGBA 3HB1A 1YTLA 2CHQA 4MI6A 4PSDA 5DKFA 2HYDA 5BXYA 1V26A 3L3BA 3ZU2A 3RSLA 4LSWA 3AK4A 4YA6A 2YKGA 3D6AA 2O06A 3W7AA 2WAAA 1R4NA 2PWPA 1AE1A 2AJBA 1YR3A 2IYUA 2OAEA 4KL8S 3W2IA 3BXPA 4RVFA 4BNUA 3JYQA 3EMBA 4LHWA 4LNAA 5ITSA 1O77A 4X1KA 1Y9JA 1Z06A 1ZQ1A 1OAOA 1NWHA 1ZFNA 3Q0EA 3OTIA 1BE1A 4KSCA 4JJFA 1EM8A 2COKA 2E37A 3TIFA 1FRFS 2AZ4A 3IT0A 1YZTA 4I1YA 4UNPA 3HA5A 3PPIA 3QEOA 4C7KA 4YXWA 1MNQA 4OJTA 4HDQB 1IXRC 2JIZA 3AJ9A 1PHRA 4UUQA 1ZY2A 4WSOA 2YL2A 3EW7A 3OZ7A 5JY1A 5HILA 1R0LA 4D9NA 3CCCA 5JXIA 3A27A 1W4CA 4CL3A 1XFAA 2P5UA 3BJEA 1EG7A 2EJCA 3EQ7A 4IYJA 1M2VA 4YBZA 3PXGA 2I67A 4D97A 2FWNA 4GGOA 4GOKA 3VH4A 4B2PA 1WABA 2XITA 1RBQA 4FE7A 4F1WA 1BJTA 2YV5A 1HR0B 2XMDA 1E3LA 3LKBA 4HRVA 4R2MA 3HO8A 5BWNA 1OBHA 1V3UA 2LZ0A 1NUTA 3D0QA 5JZBA 1PVOA 4CPDA 5J1TB 1SH7A 3NAMA 4G8JA 1BJRE 4U8GA 1E2UA 1G4AE 1HL7A 3H1PA 1SKAA 5EUCA 3A7DA 3WFJA 2XMPA 4BP9A 1XU9A