4PZCA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 from ralstonia eutropha
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
molecule tags Oxidoreductase
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzcA01
1H6CA 2Z95A 4HNHA 3OSUA 5IF3A 3UN1A 4DPMA 3X2EA 1GD1O 3O8QB 1AXEA 5C7OO 4J43A 3WFIA 4WLUA 2OMEA 2ZTMA 1PGPA 3KLMX 4KUGA 1NAHA 4B8ZA 5I7VA 3QQPA 5CDYA 1RM0A 1XU9A 3DZBA 2WYWA 4AJEA 2Q46A 4ROSA 3E8XA 5F5NA 3IDSA 3DZFA 1B26A 2FN7A 3EUWA 4WOKA 1QSGA 2VOJA 4GX0A 4CV1A 4MVJF 3Q9UA 3UW3A 1TI7A 5AVOA 4AJNA 1VE9A 2GZ2A 1YBAA 1PR9A 3CMMA 4B8WA 4TVOA 4A03A 1NR7A 2Z1MA 1C1XA 1UP4A 1T25A 4G5HA 3RJ9A 4DA9A 1A72A 3NDIA 4B7UA 4A7PA 1CETA 1O0SA 2YFHA 2NM0A 4K26A 4QO8A 4UEOA 4MOWA 2EKLA 3W4IA 3W8FA 1KERA 2DBQA 1HLDA 3DOCA 1F0YA 4TZTA 4UVDA 5G0TA 4BNIA 2HRBA 1VPDA 1U3WA 1VC2A 3HZZA 4BO5A 1TXGA 5T57A 1ML3A 2FY8A 3EVTA 3UOGA 3I9KA 1ENZA 3FHLA 3RVDA 4ALNA 1XR3A 5L4NA 1ONPA 2BRUA 2X9NA 3JQ9A 3GZ4A 2X4GA 3TRIA 4BHTA 2YYYA 3BHJA 2EW2A 1LLCA 3H8VA 4M87A 3MCVA 1UUFA 5FF9A 5L4SA 2RAFA 1JDJA 3NEPX 2POQX 5A9SA 4W9NA 4XIYA 4Z6KA 1PZGA 4MVJE 2ZYGA 1HYGA 2C20A 3NUGA 2HSDA 1H9AA 4JX8A 4YRDA 4EUHA 4G81A 4J90A 4B7CA 1W4ZA 4FS3A 4F45A 2YW9A 2RIRA 1B14A 2C2YA 2DFVA 4RVHA 5HS6A 4IDAA 3VZSA 4LVUA 3SVTA 1NYTA 4B4UA 4BO9A 2QZZA 4HADA 2I5PO 2C59A 1UXJA 2NU7A 3WICA 3M2TA 3FR8A 2EJWA 5JAIA 3FD8A 2DAPA 1PJCA 4NNJA 4D3SA 2I65A 1GPJA 1LRLA 1QKIA 1IHXA 4BKQA 3ZWOA 4CMAA 3UVEA 4TWRA 1F8FA 2PH5A 3PJEA 4BB6A 1WZEA 1E1LA 2O3SA 2OBNA 1QRRA 4PLFA 1I2ZA 1I3MA 2JJYA 2CVZA 3VPGA 1GFSA 1KEPA 4F46A 1WXDA 5IZ4A 4GX5A 4XYMA 1EFKA 4PG5A 1NPDA 5BSHA 1HDXA 3SJ7A 1DIHA 5TT0A 2JAHA 3S2GA 3OJLA 3DQPA 1NFQA 2JFFA 3Q2IA 4KP7A 4QO7A 4KUEA 1XQ6A 4WKGA 1A9YA 3R0IA 1EK5A 3GNQA 3ZN2A 4L4XA 2Y93A 3MTJA 3KB6A 3VZRA 4RZHA 2F00A 3AFNA 4R41A 3PYLA 3SBOA 2XOXA 1X7HA 3AFMA 5EQDA 3QV1A 5IZCC 4RLSA 1QYCA 1U3UA 2PGJA 3DDNA 5JDIA 4RL6A 1UP7A 4YAJA 3A4VA 5KVQA 4GX1A 4IPTA 3IS3A 1UXKA 4J1TA 2ZATA 2CNBA 4Z0PA 3MWDB 4RDHA 2PD4A 2D1YA 3OEYA 3QP9A 4IDBA 3H5AA 3D4PA 1GPDG 2HMUA 4A5OA 2DTEA 3OECA 4CQMB 4Y6PA 5IDXA 2X8LA 4XR9A 1LBEA 1R0KA 4X54A 3CINA 3H4VA 3QVXA 3AUAA 4IJKA 5L51A 2A92A 3MJVA 2VHVA 2HLPA 3GC6A 3ULKA 4MKXA 4TKMA 1P9LA 2LDXA 3WJAA 2VUSA 4NI5A 5CAEA 3A14A 2JCYA 1OZAA 3K73O 3TDKA 3KETA 2JAPA 1LLUA 4DYVA 1R4MA 3MOIA 3O38A 4J49A 1E3WA 2VNAA 3TFOA 5JXWA 3IKTA 4E5KA 3OJ0A 4AFNA 3KYCA 1PZEA 1CRWG 3WG9A 5BSFA 3DAGA 2E37A 1ORRA 2ZTVA 1BWSA 4NU6A 1PS9A 3H65A 4PZCA 3UFXA 1ENOA 1WMAA 1PGOA 5JCJD 1PQPA 1QG6A 2VN8A 3GDFA 5B1YA 2DPGA 1GCUA 4P38A 3ZZNA 3ZWCA 2Y0CA 1VKOA 1NQ5A 2Y05A 2HAEA 4I8XA 3ZNQA 5ENDA 4CLHA 2A9FA 4Y6SA 4ZU3A 3IQDB 8LDHA 3PIDA 3ITDA 4ALIA 1K6XA 4W7IA 2EGGA 4FFRA 4HKTA 1Y8RB 4IJWA 4YRAA 4XA8A 4KTTE 3JTMA 4RORA 5GY7A 3NT2A 2BFMA 1DDOA 4XR4A 2PH3A 3P5SA 2B4TO 4MVJP 3AUTA 1E1NA 2FOIA 3GEGA 3WGOA 4IIUA 5COBA 4R1SA 2WTBA 3PIIA 3OF2A 3OBBA 2NWQA 1C1DA 1JTVA 2R00A 4OHUA 4BV9A 1XDWA 4GWGA 2VUTA 1Q2XA 1RKXA 3ON5A 2IZ0A 1YJ8A 2VZ8A 3JQ8B 4DQVA 2O2SA 3H2SA 3F1LA 2GO1A 1MV8A 4Z9FA 4CM4A 4JBIA 3ASUA 4YACA 4GSKA 3WQRA 4HX5A 1B3BA 3RUDA 3NDJA 4GKBA 4PLVA 1P45A 3CTVA 3AI3A 4RGBA 4UUPA 2YHIB 2YY7A 5I9MA 3JYLA 3LK7A 3T4XA 4JJIA 4L73A 4AJ4A 2Q1SA 1I24A 2AG8A 2W90A 1I0ZA 4W6ZA 3I3OA 3WYBA 4CM7A 5A5EA 2JFGA 3M1AA 4RQTA 3VH3A 1RYEA 1LTHR 1CF2O 2IE0A 1T2FA 1SAYA 5H83A 4TSKA 5TIIA 2O48X 2IEDA 1SZJG 1U28A 1CQJA 1P0CA 2BI8A 4L9RA 3KEOA 4BGEA 3MOGA 2VTDA 4CR8A 4ZD6A 5KVSA 2AQHA 4GI2A 4W9NC 1B7GO 3C7CB 1ARZA 4HFNA 3RBXA 2ZTUA 2ZCVA 1E7MA 2ZYDA 4NHEA 3V2GA 1JA9A 3JD1A 3OQ6A 2NQTA 1FDWA 1Z75A 4UUOA 4WCDA 5EERA 2C7VA 3TZ6A 2OHXA 4BIIA 3JSAA 1AE1A 1MB4A 2C0CA 2B36A 2PNFA 3KEQA 3DHEA 2H6EA 1HRDA 4DREA 2XAAA 1ZUD1 2O2YA 4BO4A 1QLJA 2FR8A 3SLKA 1IUKA 3CMCO 5GMOA 1XLTA 2C82A 3KHUA 3AM5A 5EN4A 1LRJA 3V1UA 2QRLA 4NDNE 2GRAA 3O8QA 4PRKA 4GWKA 1SPXA 4FQ8A 2YJZA 5AXAA 3BMCB 4OM8A 5A05A 4Q3BA 3BXXA 1Q7GA 4H7PA 3L9WA 4YAEA 3H9UA 5A3VA 3DZJA 4CMIA 4BNYA 2X9VA 5L45A 1P1RA 4WLEA 5B4VA 3A1NA 2AQKA 4INAA 1ZNQO 3DFUA 5A9TA 1E3IA 3WYEA 3FBTA 3I5MA 4XX0A 4CLRB 1Y81A 4ZQGA 4CLOA 4E5MA 2E82A 1YQDA 3D3EA 1A7KA 3PLNA 4PN3A 3DBLB 3LC2O 2VHZA 4LRSB 4J9UE 4DC0A 4GGPA 4J7UA 1YE3A 3NGLA 4LN1A 2B4QA 3GMDA 4H15A 4PG4A 5KTKA 5ES3A 4CM1A 1X1TA 1Q0HA 4FSHA 1RM3A 4K1LA 5HS4A 2HRZA 4R5HA 5JYEA 3ZV4A 4DVJA 4E2WA 3NT4A 2CDAA 4IINA 4GKVA 4D42A 5ICMA 1P44A 3IC5A 2J3KA 2PV7A 3QIVA 4JJFA 3UF0A 3AJRA 1DIAA 4BOYA 1XHLA 3A28A 1HE5A 1EMDA 1BXGA 1N7GA 4NBVA 2AMFA 4E32A 4FD3A 4XJSA 2O23A 4OL9A 5CDUA 5EQFA 2O50A 4U5QA 2WD7A 5LCXA 1BHSA 3D4OA 3GY0A 2VHXA 5JDIC 3GGGA 5A9SB 3D64A 4YB8A 1GQQA 4WK6A 3ROPA 3WLEA 5K9ZA 3JQAD 2E49A 1IULA 3OIGA 4LMRA 5B4UA 2R6JA 1YONA 1ZK2A 1KETA 2NUAA 3HG7A 2Q50A 3JQEA 1QYWA 3C7AA 1R4NA 1HEUA 3QVSA 4ZRMA 4RF4A 3IJRA 4M1QA 3W8EA 3ZHXA 3LT1A 2PD6A 1VJ1A 4GLLA 1V3TA 1BVUA 3EY4A 4BKUA 4NBUA 1Z7EA 4XJTA 2DQ4A 3LC7O 3M2PA 5C7IO 1MG0A 1E3SA 1T2AA 1R16A 1W0CA 4YWJA 1IB6A 3WR5A 1E7RA 1DRWA 1SB9A 4RLHA 3E5RA 3VZQA 3VVCA 4PVCA 1H5QA 4FFMA 1VI2A 2RHRA 1EVIA 2PWZA 4KQXA 3PZRA 1ZSVA 3C24A 4J2OA 3IJPA 1WMBA 1LU9A 3G1TA 3INRA 3WGHA 1PJ4A 2D4AA 1YWGO 1GZ3A 4RPHA 5DBGA 4WECA 3RUFA 3TZCA 1LDMA 2IYPA 3G79A 2QYSA 1ID1A 3STHA 5MGBA 3BHMA 4NZ9A 3GFBA 4R9SA 2V7PA 1GCOA 4EI2A 1BMDA 2C29D 1X7DA 3UCEA 5K6AC 4F6CA 4NIMA 1YOVB 2J3JA 3DZKA 5K0ZA 2O3QA 3ENKA 2VRBA 4DIOA 4U0KA 2AE2A 1GZ6A 1P1HA 2X5JO 3VH2A 4ND4A 2GNAA 2EEZA 2FWMX 4M54A 2B0JA 3ZV3A 5JO0A 3AM3A 4M86A 3CZMA 3HE3A 1EVJA 1PEDA 2V6MA 1U7TA 2IXAA 3ABIA 1KEUA 1IOLA 1E0DA 1ZO8A 5KIAA 3OFSA 2J8ZA 4NPCA 4A27A 5HWSA 4J4HA 4ZHSA 3F3SA 1GEEA 1CYDA 1PWXA 1YGYA 2JKVA 2PKQO 4DMMA 2VYNA 5ILGA 3TOXA 4YJGB 5EL0A 4PFJA 1EK6A 3MZ0A 4RV9A 5JS6A 4J1SA 1E77A 1YH3A 3Q2KA 1VSUA 2H9IA 3HFGA 1K5HA 4BO1A 3G1UA 4QUKA 1PL7A 2NVUB 3CE6A 3KO8A 3LSYA 1TVEA 3OJEA 1JWAB 1Q1NA 2NSDA 2HJSA 4CM8B 3DBHB 2GZ1A 4BNLA 1F17A 3OETA 4QFCA 5G0WA 3UGKA 1P1IA 5IDYA 1UR5A 4BMNA 1DLJA 3I9LA 2PGDA 3BMQA 4L0QA 5A04A 4NBTA 3O03A 5DF1A 4J9VA 3DZGA 4NK5A 3E5MA 1EBFA 4BNKA 1ZH8A 2QRKA 1J6UA 3LU1A 5EINA 4WLFA 4DLLA 1DBVO 1YL7A 2VYVD 1K6JA 4ZN6A 3JD0A 4MKZA 1M75A 1DAOA 2WJPA 1LDGA 2AQ8A 2J5QA 5F1OA 3AY6A 2BI7A 2DU8A 1TEHA 2X0NA 4DMLA 4OMUA 5L4LA 3AU8A 4GX2A 3TSCA 3RUHA 4I9HA 4D41A 5A1TA 5H82A 3N74A 2X58A 4Z0HO 1V8BA 1KVQA 2OBYA 2Q1WA 2RCYA 3PQEA 4BB5A 1T1RA 4IS3A 5JNLA 3DHYA 4XQCA 1RWBA 2JL1A 4E12A 3E1KA 3I9MA 3KYBA 1EE9A 1D1TA 1G0NA 2XXJA 4XB1A 2DBRA 4DGSA 1A7AA 2WYUA 1TT5B 3KBOA 1R15A 3R1IA 3K96A 5GZ6A 1HKUA 5TLSA 4J0FA 4HBGA 2Y99A 1X15A 3DEYX 5FYDA 3D7LA 4CMJA 4RPLA 4ZQFA 4MVJG 3ITKA 4XDYA 3VPSA 1LRKA 3UXYA 4O6VA 4EJ6A 2GERA 3FNFA 2D5CA 4MP6A 4FDAA 5KJCA 2OGUA 1QXSA 4URFA 1TT7A 3N58A 1PJ2A 1BGVA 3PK0A 4OKNA 3WBFA 4ND5A 2PZKA 3EAGA 5KNLA 2HMTA 4UVHA 3RC2A 5JY1A 1SC6A 4H16A 3JQAA 3GFGA 2Q99A 4CJXA 4DRYA 1ZKMA 5JYDA 1P74A 3V1TC 4CUJA 4J2HA 2Q4BA 1LEHA 1GQYA 4J4BA 3RSHA 4CM4B 1ZSNA 3CUKA 2FRDA 3U49A 1HF3A 1U5CA 3ZH2A 4CLEA 4LCJA 4LCEA 4B3IA 3ZDFA 3BAZA 3HB5X 4BGIA 5CDTA 1UZNA 1LLQA 3RI3A 4H3VA 3TN7A 4E3ZA 4BNZA 3L6OO 1DIGA 3UCXA 1HSZA 3H2ZA 2UAGA 4NR0A 1A71A 3AWDA 3F4BA 4J3FA 1JU9A 1KEVA 3QVWA 4YAIA 2Y0EA 4XWYA 3KZVA 2NU9A 4IDGA 5T8KA 5BNTA 1RJWA 5HTOA 1OC2A 1GUZA 4NMHA 5G4LA 3AY7A 3ZW8A 3EC7A 1ZCJA 1BDMA 1Z45A 2QX7A 1QLHA 1C1DB 1V9LA 3KM0A 5KKAA 1GEGA 4E4YA 4CMKA 3EK2A 4G65A 2JHFA 5TSDA 3RIHA 1VJ0A 4P22A 3WGZA 4XZ3A 1NHWA 2ZKLA 1YO6A 2C5EA 3CH6A 3EGOA 3DMTA 1YQGA 2QYTA 3WDSA 4FC7A 2HCTA 2SCUA 4B3HA 4XEHA 4CL8A 1QV7A 2DFDA 3ZHYA 5TQVA 5IXSA 3WJ7A 3L6EA 2O7QA 2J5KA 1LXCA 3S1LA 4D43A 1GTMA 4XKJA 3OIFA 2O3RA 3VKVA 4CV3A 1XIVA 2VYND 1R4MB 3LT2A 1GU7A 4HFMA 2BKAA 3RUCA 4PIVA 4CMEA 3ZV5A 9LDTA 3FWNA 2PY6A 4QXMA 5COQA 1PU2A 2YV2A 4AJHA 4R16A 3W6ZA 3GK3A 2HO5A 1PWZA 3WNVA 1GYRA 3LQFA 1UDCA 5T5QA 5JFOA 3DTTA 1MGOA 2PZLA 1A9ZA 3O26A 1HWYA 2P2SA 1YDEA 4GL4A 1P33A 4MIEA 4ONEA 1DIBA 1H2HA 3JQ7B 3HDHA 2ET6A 1HYHA 2X1HA 3G3EA 4RVGA 3WQQA 1NFFA 4YJFB 2EF1A 3VHRA 3INGA 5TJ9A 2HMWA 2FR1A 2X9GA 3QWBA 4LMPA 5ADHA 3OJFA 4LK3A 4ALLA 3FPLA 4TKLA 4GVXA 4W99A 4A26A 2BD0A 5CEEA 3F9IA 2NTVA 4IZHA 1AN9A 4U8GA 5AXDA 2G76A 2F1KA 5JDCA 1CDOA 1DEHA 1MA0A 2EKQA 3A9WA 5CPBA 2LDBA 5JAZA 1HDCA 1PGJA 4DUPA 3JQCA 1D1SA 3QW2A 2B5VA 4YDRA 1WZIA 4R01A 2ILTA 4DTIA 4FOSA 4MP8A 4CV2A 4BNUA 5I7SA 4PLHA 4I1IA 2BFPA 1IY8A 1F12A 3R3SA 1N1GA 4DYDA 3GDOA 4E6PA 1QYDA 1LA2A 1OAAA 4CMIB 1HTBA 4Y98A 1NX6A 3DONA 4FN4A 4BNVA 4LRTB 5GZ1A 3GR6A 2X5KO 1FDSA 1I8TA 1V3UA 3RC1A 2WWRA 1JN0A 3MWEB 9LDBA 1GQ2A 1Y8QB 1ISIA 2P4HX 2YHIA 3PI7A 4RF5A 1C3VA 4I08A 5JCJA 1JWBB 3DFZA 2Y0DA 4BQRA 5H81A 3ADOA 1VSVA 1GADO 2Y1CA 3GVXA 3H5NA 5IDQA 2EHDA 2O7SA 1RM4A 2CF6A 4RZIA 3JD4A 1L7EA 1PSDA 7ADHA 1PS0A 2QG4A 2JD0A 3OICA 4U0JA 3O9ZA 4XRRA 4YPOA 3SX2A 1X1EA 5I8ZA 4D7AA 4E31A 5BNFA 3PFFA 5EPOA 2X7HA 3NX4A 3SJUA 1NXQA 4RJTA 5KVCA 1QR6A 4UVGA 5IZCA 3L07A 4IIVA 5U9CA 4N5MA 1DHRA 1MP0A 5CG2A 5DOVA 5TJHA 3S2EA 2JCVA 4NFYA 1Q0LA 5B12A 2XF8A 1EUDA 3Q1LA 3CSDA 3DZHA 5JBIA 1XKQA 1DXYA 1NQOA 2HKIA 2VHWA 3G17A 4IGEA 3GF4A 4IMPA 4BS9A 5TS3A 1B3RA 1HETA 1P3DA 1MFPA 2ZYAA 5IFLA 3ANNA 1ZJZA 5FFFA 1SEPA 3NTQA 1E3JA 1T2EA 4XRGA 1PS8A 2EERA 3OEWA 4UEKA 3ZNNA 2G17A 2ZJ0A 2CZCA 4GLOA 1SNYA 1I2CA 3PWZA 3PHLA 1B0AA 3V8BA 1GY8A 3BMCA 3AM4A 4NG5A 2JFHA 4QX6A 2Q45A 5G4KA 3AY3A 4R4JA 1EVYA 1JLLA 4J0EA 3GUYA 3JQBC 4LISA 1NNUA 3VPFA 4Q3EA 2NVUA 1ZMOA 1U7HA 3HQ4O 3R6DA 4ILKA 4IQ0A 4E30A 1M66A 2PLAA 1VKNA 4GGOA 4CLRA 4CM8A 1ZEMA 2EXXA 2Y1DA 4YTEA 4ZA2A 3COSA 5HBRA 3ZWVA 4RF2A 1FXSA 2FHSA 4YR9A 4WOJA 5KJ1A 4J16A 3AK4A 2DC1A 3CIFA 5FI5A 1MXFA 3G49A 2AA3A 3G0OA 5DN9A 3WX0A 2VCYA 4RF3A 4IGFA 1LSUA 4JXKA 4CM9A 4YJHA 1NAIA 5ENVA 3GZNA 5DBFA 3OJOA 1EFLA 4LW8A 4YAKA 1Z6ZA 1T2DA 4FIZA 1H9BA 3FCOA 3ZGYA 4O5OA 4RVFA 1IL0A 1ADGA 3OA0A 2NV6A 2PK3A 2R2GA 3FNEA 5JC8A 1WLYA 1PJSA 1LSSA 1D4FA 1EUZA 2OUIA 1BXGB 4AJ1A 2AEMA 3WQSB 3C1OA 5C7LO 1N1EA 2GGSA 3GEMA 4PLZA 4BL5A 1PJTA 3I6IA 3SXPA 3H9QA 3KRTA 2HK7A 2FZWA 3I9OA 2FSVA 4O63O 5F1KA 3PLRA 3MJCA 1YJQA 3RC9A 4I5GA 2D8AA 3B20A 1HDOA 4YXFA 4R51A 3F4LA 4I9UA 1FDTA 4XGNA 4XQGA 4B4VA 4FJ0A 2P5UA 4BO7A 3WGGA 3DBHA 2CVOA 3R3JA 3OA2A 4II3A 2W4QA 4EGFA 3L4BA 1NVMB 2ZQYA 3PJGA 5DBIA 4DPLA 1R0SA 1U2GA 1HDYA 1M67A 1PIWA 2OOSA 5CDGA 1OMOA 1PJLA 2JD2A 1ZZEA 1GYQA 4XYGA 4YRBA 1N92A 5JCXA 2X0JA 1PJQA 1A4IA 3C1AA 4Y8VA 5DZSA 4F3YA 5TX7A 3CKYA 3MJSA 2A35A 1ZIDA 3FF4A 4CLDA 2TMGA 4CM6A 3GAZA 3VKUA 3ZWNA 1A5ZA 3U09A 1EDOA 4QTZA 1GZ4A 2P91A 2NU6A 3ASVA 2DBZA 4CMHA 4PCVA 1OC4A 2PZJA 3X2FA 3GHYA 5G2OA 1O6ZA 1DJNA 1NR1A 1NQTA 1N5DA 5LDHA 3WS7A 3K92A 3HSKA 1B16A 3CPSA 2HK8A 1KVRA 2UUOA 3WGYA 1FDUA 1DHTA 3DBVO 2UUPA 1F8GA 4UAGA 3GRPA 3W6UA 3S2FA 3E48A 4XYLA 3GH3A 4FJ1A 3IAHA 2IYOA 3UAGA 1C0LA 3L77A 3IP3A 4LSMA 4WCFC 3E9NA 5CG1A 1JVSA 3IUSA 5DCYA 4TQGA 5IDWA 3QA9A 3ETDA 4HP8A 4IZIA 3MJ4A 4F6LA 3RU7A 1XU7A 3K5PA 4JCOA 1E1KA 1ZBQA 1MFZA 3TPCA 2WE8A 4R9RA 4GPD1 1X0VA 4HFJA 4D44A 4DL9A 1I10A 2H5LA 4MVJM 3MEQA 4L74A 3VDQA 3ZNOA 3E82A 4O59O 4DLBA 4P4LA 2X5OA 5JLAA 3EZLA 5DCUA 1N2SA 2YZ7A 4ND2A 3WSWA 2WM3A 4ALJA 1H6AA 5A9RA 2AEJA 4E2ZA 1XSEA 1ZK4A 4O0LA 3KYDB 4CMBA 3AI2A 1C14A 3D0OA 1KOLA 1ZK0A 3BMQB 2O3UA 4OXNA 3HDJA 2H63A 1K6IA 3B70A 3JV7A 1MG5A 3RJ5A 1W73A 2VRCA 1DLIA 1W6UA 3IP1A 3K2EA 2AE1A 4LSWA 1XG5A 5AQ1A 4PLGA 3PRJA 1YRLA 2D0IA 4IDFA 4QQRA 4CV0A 1YBVA 3L4BC 3RAJA 5HA5A 4J1NA 2BH9A 1DOHA 2PKRA 2ZB7A 4B79A 1Y9EA 1I32A 1T26A 3I83A 1GAEO 2B37A 1QORA 3VTFA 3OH8A 1KIFA 2UYYA 3K30A 3HUDA 4NJMB 2NVBA 2PZMA 1A4UA 4MVJI 4J7XA 1IHYA 1IZ0A 1NWHA 1T1SA 3MTGA 4N5LA 2UDPA 5ITWA 1LC0A 2OO5A 1J5PA 4OQYA 1H6BA 1T4BA 4FGWA 2RH4A 2YDYA 4WLOA 3H3FA 1PR3A 1E6EA 4U6QA 2QHXA 4UVIA 4EUFA 1TT5A 1UAYA 4JROA 3D4NA 1K3TA 3I9JA 1L1FA 1ZEJA 4BV8A 5BSGA 3IMFA 4EEXA 4PLWA 2I3AA 1YB4A 3HHPA 3INTA 2YQ4A 2FZEA 4D46A 3EMKA 2OXIA 4RO0A 4RPKA 3RUIA 1U5AA 3NAQA 2VTEA 2ZK7A 1ULUA 2XPCA 3LYLA 1P1JA 4BMVA 1SMKA 3PVZA 4L75A 3SC6A 3U4HA 4YT2A 3LF1A 4MPDA 2DTDA 4RDIA 2WE7A 5CP8A 2QW8A 2RH8A 1O8CA 4B4OA 1H6DA 1DO8A 2VYVA 5TT1A 5I7EA 1B15A 1P77A 4HWKA 4MVJD 1GDHA 2Z5LA 3BTVA 3IKVA 5G0VA 3ROKA 3ETGA 3JYNA 1ADFA 4OJNA 5L7YA 3PHIA 3EVNA 4OQZA 3VTZA 2G5CA 3V2HA 1LI4A 4BNJA 4K6CA 3AOEC 3ZV6A 3JQBA 3DBLA 3JQ7A 4E2YA 2D2IA 4CR6A 4AJPA 4YJFA 3VDRA 5FEUA 1OFGA 2O4UX 3Q11A 4OOFA 4DQXA 4BNGA 2X22A 3NV9A 2EWMA 5DOZA 3IIEA 2YDXA 1LNQA 2DVMA 3ZU3A 5BT9A 3H7AA 4A2CA 4A10A 4E5YA 4D0SA 4ITUA 4UVEA 2X0RA 2Y68A 3HWRA 1HZZA 1PQUA 1FJHA 4FFNA 1VL0A 3MJEA 1HSOA 1M76A 4BKOA 1IE3A 1M6WA 4BNXA 4S3MA 4NFHA 1QP8A 5KJEA 2J5RA 5C37A 5IN5A 1PZFA 2Q1TA 5J23A 1U1IA 1Y6JA 2I66A 1LDNA 3ZW9A 1IPFA 1VL6A 4QSMA 5I8WA 4UUNA 3S2IA 1U8FO 1YB5A 2DUUA 4EDFA 2X6TA 3WMXA 4IXWA 4YQYA 1G0OA 4NH4A 4KZPA 4OSOA 3C85A 4ND3A 1K2WA 3PQFA 2HMVA 1R6DA 3RQSA 1Y8QA 1UDAA 4TRJA 1I3KA 2ZB4A 2FPGA 2EW8A 4NQZA 3ZCXA 5I9LA 5JW6A 1B8UA 1V0JA 5B37A 1E5LA 1GUYA 3CXRA 4JQCA 4EEZA 1P31A 3ADPA 2FMUA 3BTSA 4OYRA 3ENNA 4YBZA 1QV6A 2NVWA 3WBBA 2HMSA 3RBZA 3ZWAA 4RCVA 4CUZA 3PJDA 1MLDA 4N18A 2XXBA 3DB2A 4JBHA 4MIYA 1C0IA 4XYBA 4WASA 1KY5A 1R66A 3KVOA 3P7MA 3U62A 4TRNA 1KYQA 2WSBA 4AG3A 2B5WA 3NTRA 4WGGA 4BNWA 4YT4A 4Q3AA 5ICSA 3GT0A 5IAAA 4P4GA 4IM7A 1ZK1A 2BLLA 1NTOA 1K89A 1N9GA 5T67A 3GA0A 4OO3A 5DP2A 1G6KA 5CEFA 1HT0A 3ANMA 4JK3A 6LDHA 2GF2A 2GYYA 2QRJA 5U4QA 4EITA 3E9MA 1RM5A 4Q3CA 1XYGA 1C0KA 2CY0A 2PTGA 3Q9NA 4CMGA 5DDIP 2GR9A 4WNCA 4CQLA 2VWHA 1NVGA 2JHGA 4BGVA 2AW5A 3JCZA 5DCWA 3EZYA 5JE8A 4U7WA 1WPQA 2Y1OA 3ORFA 3V2UA 4R1UA 5EMHA 1YL6A 4ALMA 4ZJUA 1DFHA 5HRUA 3ONDA 1UH5A 4PRLA 4JNKA 2C7GA 3S55A 4ZQEA 3FTNA 4CR7A 4JP2A 1X0XA 3PHGA 2UV8A 4UEJA 2NADA 1LQUA 3ETEA 5ER6A 4HNGA 4BNHA 3QY9A 4PLPA 3A06A 3EHEA 2WDZA 3RCBA 2V6GA 1Y9AA 3ONEA 4CL3A 2WD8A 4C4OA 4B4WA 5DULA 4MIOA 1FF9A 1N8KA 3DOJA 4TVBA 2B83A 2PR2A 1YQXA 2ZQZA 5F1PA 4MKRA 5L9AA 5L40A 4G2NA 2YUTA 1ISGA 3VVBA 3FPCA 3GZNB 3NT5A 1V35A 4U6SA 2O3TA 4DBVO 1V6AA 1ZSYA 1EVZA 4BVAA 4I9NA 3FN4A 3H9JA 4HV4A 3DAPA 4M55A 3PZBA 2HU2A 3HNPA 2QIOA 1AGNA 2YV3A 3KLPX 4IUYA 4PGFA 1LDEA 1DAPA 1T2CA 4DBZA 1ZXBA 4JP3A 5LC1A 1WNTA 1XA0A 4BNMA 4BO0A 3Q0EA 4BKRA 3LLSA 2BGLA 3GEDA 4L8VA 4Q39A 3I4FA 3WOHA 3ZU4A 1DC3A 3U4CA 2D59A 4XYEA 1BW9B 3JQGA 4YCAA 4WCFB 1MUUA 3ZU2A 1E7SA 4YT5A 1J0XO 4MINA 3PTZA 5AYVA 4KWIA 4J4TA 4YQZA 1AXGA 4BNTA 3DOOA 1ISJA 1R0LA 1UZLA 3QVTA 2G82A 3RC7A 5HM8A 1ADBA 3I4CA 4XGKA 2DLDA 1JAXA 4YT8A 3T7CA 3VPXA 1TB4A 3QWIA 4W82A 4NFSA 4N54A 2IXBA 3H3JA 5CEJA 4AICA 1A27A 5TC4A 1GL3A 1U4OA 5JPIA 3OIDA 3JQAB 2WMDA 5L7TA 4OSPA 4ID9A 5EIOA 1S6YA 2H1SA 3FWZA 3BA1A 1E3EA 4QECA 1HLPA 2DM6A 4ND1A 2G1UA 2B69A 3CZRA 4E13A 1VL8A 3P19A 5G0UA 4Z3DA 3WYCA 4JIGA 4R69A 1XCBA 4RVDA 1KVUA 3RROA 2VOEA 2AG5A 1MC5A 2DPHA 5IXYA 1QYVA 1FDVA 3DAFA 4OGWA 3I9NA 5A5FA 2D5AA 2E4AA 1WVGA 2W2LD 5IJZA 3QHAA 2BELA 1K0UA 3PFWO 3D3WB 1ISHA 2FPIA 4IJUA 4HY3A 3K9QO 3RBVA 4GAEA 3FR7A 1ZVMA 1Y7TA 3C8MA 4IS2A 2BMAA 2CF5A 4R3NA 3VC7A 1B8PA 1LJ8A 3HB4X 1IYZA 4NJMA 4N5NA 1E3LA 3GOHA 2GDZA 3H9GA 3PGXA 4E5PA 2GN6A 4AJLA 2E48A 4KQWA 3OP4A 4YVFA 3TOZA 1MX3A 4FB5A 2ZJ1A 4KUHA 1D8AA 4EJ0A 4CMCA 1CIVA 4BNFA 1BVRA 4ZQBA 1O89A 3BMNA 4XQEA 4E5NA 4XCVA 3U5TA 5THQA 4WJZA 5C5IA 3IUPA 1FMCA 5KJFA 4AJJA 1SEVA 3IOYA 1C0PA 1UXHA 3Q3CA 3K2BA 3C3XA 1D7OA 1R37A 3GHHA 3UH1A 4BO3A 1YXMA 4D0RA 4FPXA 1G1AA 4AJKA 4UREA 5FI3A 2VT3A 3U0BA 3AUSA 4FOOA 2Q3EA 4XQ9A 2NQ8A 2EJVA 1EQ2A 3GNTA 3WIEA 1VM6A 1Q7CA 2I9PA 3SC4A 3DL2A 3DZIA 1E3WB 1XQ1A 4CM9D 3NGXA 4PLYA 4YEDA 1UAGA 5T8KC 1F14A 1Z7BA 1I30A 3W4JA 2DUWA 2IODA 5THKA 3TZHA 3TWOA 4ZICA 1GV1A 4R1TA 4IQ8A 4E0BA 1WWKA 1E7YA 4KOAA 4GMGA 4RVUA 1JW9B 4MJLA 4CPDA 3DWFA 1P0FA 3TJRA 2G0TA 1IPEA 2JD1A 3M1LA 3I6QA 4FJ2A 2BFAA 3I23A 2W2KA 4BO2A 4QEDA 3VPHA 5IN4A 2NTJA 3LC1O 2QQ5A 3KXDA 4WUVA 1HDZA 2FPPA 3DMYA 2O3JA 4GMFA 4CQMD 3NJ8A 4EUEA 1ENYA 3GGPA 3GUCA 4K9DA 5KVVA 2I3GA 1LDBA 1BDBA 4CM3A 2EIHA 3C1TA 4GQAA 3LDHA 5DNAA 2Y67A 2J3HA 4BNNA 3WGQA 4C7JA 3LLVA 3U3XA 1PL8A 1I36A 7MDHA 3LF2A 3PGJA 2CFCA 3QJ5A 1KBZA 2CSUA 5A4DA 3E6AA 1BRMA 5L53A 5K6AA 4NJOA 2NLOA 3PDUA 3RFXA 1M2WA 1SOWA 3QWHA 2VWQA 1PZHA 4TMFA 3PEFA 1LSJA 2NTNA 3BMOA 4PVDA 2P68A 1LUAA 1RYDA 3ZWXA 3DXFA 3AW9A 3F5SA 2RHCA 2W98A 2HUNA 3O4RA 1O94A 4XB2A 3TZQA 4BGUA 3I1JA 3KYDA 4J91A 2D3TA 1DFIA 1X7GA 1O5IA 4TRMA 1DFGA 2V6BA 4C7KA 4FR5A 2Y1FA 3L9XA 1UXGA 3GLQA 5IG2A 3JQFC 3D5TA 1SOVA 3CTMA 4PZDA 5BR7A 1XGKA 3GVIA 4WLVA 2GUGA 4WE3A 1ZXLA 1HDGO 4LVCA 5TNXA 5JMWA 2OZPA 1NM5A 3KUXA 5JC1A 2J6IA 4KDFA 4M89A 3GPDG 3OQ1A 3ZHZA 1GR0A 4P4NA 2W2LA 2AHRA 2VZ0A 3E18A 1UJMA 2P5YA 4KDEA 4E33A 3L6DA 1E5QA 3JYOA 1LSOA 1UDBA 1VJTA 4I5FA 4NK4A 3RFVA 5A03A 2PA3A 4JGBA 4K28A 3RD5A 1YDWA 4OAQA 3V1YA 2GASA 2VNSA 2O4CA 2I76A 3VH1A 4MVJH 2WEKA 1HL3A 1YL5A 1GYPA 2AQIA 2HK9A 5KWEA 4XD2A 4CM5A 4IDDA 2PD3A 5G4KB 5TGDA 1ZMTA 1ISMA 2FP4A 2Q1UA 2PGLA 4R68A 5F3RA 5MDHA 2VRCD 2VT2A 1TLTA 4KWHA 4D3FA 1LLDA 1ULSA 1DPGA 3HDQA 2OORA 2E6UX 2P9EA 2GPTA 3FRJA 4FW8A 1I3NA 2YV1A 4FFOA 3DBRB 3HADA 5JO9A 5L95A 5BQFA 4YYZA 1NWCA 1PL6A 3ANLA 1ZFNA 1ZJYA 3RKRA 1R12A 4DXHA 4RQUA 1C1XB 4A73A 1U9JA 2GN8A 4QFDA 1OOEA 3E9QA 1ADCA 2V65A 5B4TA 1KC3A 3NYWA 2VQ3A 1JAYA 3WNQA 4W7HA 1DRVA 2Y1EA 3ICCA 1GV0A 1ISFA 1HE4A 4YJHB 3N7UA 1E92A 3TQHA 1T24A 3U4DA 3WFJA 4GVLA 3RUAA 3S8MA 3UICA 3DMTC 1EBUA 1X13A 1YKFA 3D1LA 4IQGA 1D3AA 1ZK3A 4DIBA 2BHLA 2CDCA 2R00C 2I6TA 3FBGA 4WLNA 4Z0TA 5ILOA 4CQLB 4XGIA 1E1MA 3DC2A 3EYWA 4FFLA 1UXIA 3B1FA 2W8ZA 3AOGA 4YA6A 3WMWA 4L4RA 3FNHA 1NHGA 3GNSA 1O95A 4IY1A 3LZ6A 4R5MA 4IDEA 1I3LA 4W4TA 1P1KA 4DQUA 3AOEA 4CMEC 1QYXA 1H0KA 3JQFA 4DPKA 3BTUA 3GVCA 2WD7B 3CEAA 3QVOA 4II2A 3EW7A 2B4RO 3QLJA 2GLXA 2VUUA 1YBMA 2CD9A 4R3WA 4B7XA 4DC1A 1BW9A 5GZ3A 4CQMA 2IZZA 4MVJA 4CUKA 2CVQA 4JN6B 1I2BA 4ALKA 1QMGA 3DTYA 3ZWPA 1YVEI 1WW8A 4AL4A 1LDYA 4D45A 3OM9A 2IZ1A 3C7DB 3P2OA 1AHHA 5T64A 1RPNA 3HN2A 3AI1A 3GAFA 3H6KA 4GH5A 1J4AA 1GUFA 2GCGA 2Q49A 2TMDA 2C2XA 4A0SA 1SCUA 2EG9A 3WLFA 1OBFO 5C3MA 2C07A 4FFPA 4RPGA 4D79A 2HJRA 3DO5A 2HQ1A 4IJVA 1WDMA 3PJFA 5JSFA 3KYCB 1VLLA 3W8DA 4I5EA 5L7WA 4L4SA 4OIMA 1YS4A 3PXXA 3LT4A 3F47A 5JAMA 4LGVA 3AU9A 1KY4A 2P4QA 2OP0A 4L76A 3ZWBA 3RU9A 1DIRA 4BO6A 3BZUA 1DJQA 4PLTA 4OKIA 1N9GB 2OL4A 1F06A 2OP1A 1YOVA 2X23A 4IBOA 4ZVVA 5KJ6A 3K8ZA 3ZWYA 5BNIA 1UZMA 2RBEA 2PKQP 3VH4A 3VOSA 2DBVO 5FWNA 3WTCA 5JAQA 2EGHA 3WTBA 1Z82A 2ZB3A 3PDJA 4BUCA 4M49A 1X14A 3H9EO 1I5RA 3GG2A 3WGTA 2Q2QA 3TFQA 4MO2A 4Z9YA 5A06A 4UULA 5F21A 2I99A 4XIJA 1E6WA 3JQ9C 4JLWA 3SEFA 3WB9A 3RKUA 4QT0A 2P9GA 2IEBA 4GBJA 4FGSA 3ZWWA 1U8XX 1Q7BA 2DTXA 1LC3A 3ZWMA 4ESOA 3KSUA 4YJGA 3ST7A 1M6HA 3ONFA 3JYPA 1MC4A 4WNIA 5G0SA 4NBWA 3WXBA 4RVSA 4AJOA 3GPIA 5KKCA 1KVTA 1NVTA 1HYEA 3TF5A 4PG6A 1BSVA 4FCCA 3NKLA 3WGIA 1LX6A 4KTVE 3ZNPA 5CHEA 1JKFA 3M6IA 3PYXA 5KOIA 4MDHA 1V3VA 4EZBA 2WYVA 3U9LA 3JYQA 4E2XA 2VWPA 1U4SA 3NTOA 1N7HA 3GVHA 3OMLA 3JQ6A 3SLGA 4MP3A 1ENPA 2GSDA 5KCZA 1PTJA 4AJ2A 2NNLD 5TF4A 2Y1GA 3ICPA 5DP1A 2FR0A 3KOUA 1YB1A 3OHSX 1SB8A 2GN9A 5LDGA 2I67A 3KTDA 3KSDO 2JCXA 4BMSA 2IDZA 3HFSA 1LQTA 1Y1PA 4PG7A 1W8DA 4O1MA 3F6YA 3D3WA 1WDKA 1T4DA 1Y5MA 2BGMA 4IMRA 2Q4EA 4WEOA 1JQBA 5EJ2A 4R1NA 4OXYA 3PWKA 3RUEA 3NJ4A 2IRWA 3TL3A 1H93A 2J3IA 2AXQA 4FBGA 1WP4A 2CDBA 1HXHA 1HE3A 2Z1NA 5EESA 1NASA 3KSZO 1H94A 2EP5A 4YAGA 3PYMA 3PPIA 4OH1A 4I5DA 4ZGWA 1HE2A 3WWZA 3BYZA 3BIOA 3JQGB 5JDCC 4EW6A 4WCFA 1B8VA 1EE2A 2VHYA 3P2YA 5I9NA 3GN1A 5CFZA 1Y8RA 2B35A 1KVSA 4N7RA 4DLAA 8ADHA 3QE3A 4TZKA 3LT0A 1BTOA 4IXTA 3ZHBA 4E21A 1DC6A 2GD1O 4OXKA 4JBGA 1XEAA 2CMDA 3DHNA 5DT9A 1VRWA 3HJAA 3L0DA 2X0IA 5AXCA 5A02A 4Q3NA 3DR3A 2EP7A 2Q2VA 1DSSG 2CUKA 2QZ9A 4DWVA 3FSRA 3UHAA 4BKPA 2BGKA 2C5AA 3B6ZA 2FSSA 3PP8A 1DC4A 3AUUA 4J7CA 3JQDA 1NBOA 1CEQA 2A94A 2DKNA 1MXHA 3BMOB 3GMSA 1OI7A 3I52A 4CLOB 1E7QA 4CODB 4WEQA 4XDZA 3TNLA 2Y66A 5I7FA 2V6FA 1UP6A 2YQ5A 3V5NA 2GN4A 1U2DA 1I33A 4JJGA 1PX0A 2VZ9A 2AEFA 3GVPA 1E6UA 1KC1A 4BO8A 3JD3A 2ZCUA 1CJCA 1U3TA 1Z74A 4NU5A 1NFRA 3GN2A 4ZQHA 4P8RA 1E7WA 2NACA 5L3ZA 1XWFA 3F46A 3TZKA 1O9BA 1NPYA 3UUWA 4J6FA 4PLCA 4Q3DA 3K31A 3W1VA 2Q2WA 4AJIA 1BXZA 1EQUA 4S1VA 3GGOA 5TRTA 6ADHA 4D3DA 4HFRA 1CQIA 3GRKA 5BSEA 3HN7A 1WDLA 1KS9A 2PFGA 4J1QA 4Z9XA 1NQAO 2VWGA 2DT5A 4M8SA 4Y9DA 3ZI0A 1SO8A 1I01A 5COAA 3VZPA 2BF7A 3ROMA 3K6JA 1IZ9A 3QRWA 4KMSA 4Y6RA 3IL2A 3WWYA 4DIFA 5T6BA 3F1KA 3ROQA 4RPJA 4HUJA 1L7DA 1J49A 1EDZA 2YFQA 4EYEA 3FNGA 4TRRA 3JQ8A 1JKJA 3VAZA 2OFPA 4EBFA 3BHIA 3BMNB 4YJDA 3D5QA 3EDMA 1HZJA 3OQBA 5JMPA 1R4NB 4AVYA 1ONOA 1JKIA 5U1PA 3PWSA 3JD2A 2NU8A 1WAMA 4PZEA 1TA4A 1ONNA 4EJMA 2ZTLA 3F5QA 3KV3O 3UCFA 3RASA 1PGQA 3Q6IA 1DRUA 2HDHA 5AOVA 3RWBA 4BQPA 3BTOA 3H5RA 3QWAA 4IDCA 3HDYA 1XELA 3MJTA 3PHHA 4TROA 1Q0QA 3L4SO 1ZW1A 4B3JA 1FK8A 4OOEA 1JVBA 3T4EA 5A3JA 1CWUA 2ZB8A 1H2BA 5ITVA 3B1JA 2BFOA 2GZ3A 1DC5A 3E03A 4CLXA 4HXYA 1Z73A 3TL2A 4Z3KA 4WPGA 3PHJA 4K6FA 2EV9A 4ZRNA 2P9CA 3LVFO 3QSGA 3T7EA 4PG8A 1SBYA 3DBRA 5AXBA 1CERA 3GQVA 1BG6A 4Q9NA 1AHIA 3B1KA 4R54A 1P1FA 1EZ4A 1U3VA 3PQDA 1DB3A 2EKPA 4Y67A 2X86A 3UKOA 1S7CA 1PGNA 1EEHA 2A4KA 5CPFA 3FTPA 1EUCA 3NDRA 1PQWA 1BXKA 1B2LA 4GSLA 3GDGA 3FI9A 4NBRA 1HDRA 5CDSA 4UUMA 2W2KB 1NPTO 3NRCA 5F5LA 2YHUA 1NP3A 2C54A 5JY6A 5ER9A 3U4IA 2UVDA 2ZIZA 3QWFA 4FC6A 3ZU5A 1AUPA 1PJBA 1PJ3A 3W4KA 3WSVA 1Y5RA 3GG9A 3WIDA 1KEWA 3RFTA
chains in the Genus database with same CATH superfamily
2F90A 2GWHA 1L3BA 1B23P 2EL9A 5E2IA 2Z57A 2EYUA 2DMRA 3IILA 3PUXA 4KW7A 3TDMA 4F93B 3CEMA 1W2GA 3O8QB 1KWGA 2V7VA 1AXEA 5C7OO 2ZDHA 3OTQA 2AYZA 2OMEA 3Q7IA 2PPLA 4J43A 4ZCMA 3U6KA 1KO7A 3R2JA 4LDNA 4O4IA 5CNJA 3VJKA 4KUGA 5I7VA 3VU9B 1NBEA 1S1CA 1RM0A 3OJCA 3UG7A 3UHJA 1RAGA 4FWBA 2QTVA 4I1RA 4A0HA 4AJEA 2Q46A 1R6XA 4US1R 2CNLA 2D2EA 3GEBA 3E8XA 3DZFA 3NPAA 4RKQA 2FN7A 1AF4A 1BA2A 2VOJA 4UDYX 4WOKA 1QP7A 1JQJC 4NENB 4MS4B 3F97A 2A0XA 1FLDA 2WDPA 1E1DA 1VE9A 1W88B 3GFTA 4AKIA 3BXHA 2F1JA 3DKIA 1YCFA 4REOA 2FN8A 3E05A 3WXMA 3MWEA 4TYNA 1K8RA 2QSUA 1KR5A 5KVAA 2JI6A 4A03A 1NR7A 3Q3JB 5B3AA 4HQLA 2HHJA 1A72A 3NDIA 4EMSA 3HFRA 2G1KA 1O0SA 4A7PA 2YFHA 3FKQA 4QO8A 3KOWA 4EY5A 2YXDA 5LNK6 2PU5A 1Y5IA 3GMTA 3FA2A 3N7AA 1Z06A 1G5RA 2HPZA 3O4GA 2P9FA 1KERA 1XCGB 2ENWA 1MEOA 1F0YA 1FUYB 3DOIA 3DOCA 4UVDA 4ZARA 1T9DA 3JWEA 3ZHUA 1YBFA 1TF2A 1UBJS 2R4UA 4OHWA 1VC2A 3H42B 4BO5A 2FGJA 5IKMA 1UMBB 2W2QA 3UPTA 4MGIR 5FEMA 2J6BA 1OYWA 1ML3A 1WPXA 1ENZA 2OV3A 1Y8ZA 3IKLA 1V1JA 3JARA 1ONPA 3C3MA 3IB6A 3SC4A 2HJVA 4XFJA 4QLBA 4BHTA 2EFGA 2YYYA 2EW2A 3K2QA 2PBLA 3RIYA 1WXWA 3BK2A 4QBTA 3H9BA 3Q12A 3QFFA 5EHZA 1KP2A 1Z5NA 1CJUC 1NRIA 2OHIA 3VJRA 4MJ7A 3F6RA 4L7VA 1SVWA 4Z0NA 4GEKA 4W9NA 2HZ7A 4LDZA 5HJ2A 4FT4A 4NZYA 3DUFB 1UKVY 1F51E 1ZBDA 1HYGA 1AF7A 2FPUA 2QDXA 3C3YA 3NUGA 1W5TA 3OE1A 4YRDA 5B53A 1KAHA 4G81A 1CTQA 3JRNA 3P26A 2BHTA 2QN3A 4J90A 1TMOA 3OEEA 4XW2A 2XR1A 3DO6A 5KTTA 1P2BA 1UOPA 4F2GA 5KYYA 1QVAA 3LY7A 4U7HA 5TEVA 1CT9A 2BE7A 1WTCA 4ETNA 2JGNA 4LVUA 5FP0A 5H59A 3SVTA 2RI1A 1FXWA 3FNRA 4BO9A 4HADA 3D81A 2AOUA 4MV6A 4TWBA 1VHQA 2EX0A 4WV3A 4OQEA 4CKBB 4ZK2A 5ITZB 5IT9A 4W5TA 2EJWA 1JHXA 2DAPA 2RI6A 3NEJA 4QODA 4XCXA 1KKUA 4PICA 3RSQA 3QEMB 3H99A 5ESXA 4QELA 4WMLA 3ZC3A 1GPJA 5HKAA 1LRLA 4BLQA 1NM5C 3I61A 4FMBB 3WL7A 3TLMA 3BIJA 3VYSB 3PDIA 4HX9A 2Y6VA 3TAXA 2HRQA 3UVEA 4I99A 1E1LA 5FA6A 3UKDA 1A95A 2O3SA 5JT1A 1IOVA 3GL9A 2VF5X 2ZJ7A 4WXHA 3SZUA 2NOAA 3O8BA 1GLGA 4HPWA 3BWXA 5A6SA 1CUDA 4CI0B 4P35A 3OCYA 4MCIA 1YAJA 4O2LA 1WXDA 2H7XA 2IELA 4XYMA 4BLTA 5IHXA 3F9RA 2UUBB 2YVUA 3ZJYA 4GI1A 4D92A 3O2NA 4TV8F 3EIWA 1C8BA 3OD1A 1F6WA 5TT0A 1OFCX 2E1RA 1TIKA 4PXSA 3S2GA 5F9HA 5K3BA 4KP7A 1NP6A 3T54A 2YICA 1E9VA 3UXHA 3NETA 3L49A 3R0IA 1EK5A 4L6CA 4HLUC 5BQ3A 2JFQA 3FCUB 3WNZA 3E7XA 1V26A 3A37A 2Y93A 2Z04A 3OT1B 2XNHA 3MQFA 4ATNA 2IHKA 1QFXA 5E4YA 2WMNB 3OX3A 2DPXA 1UFVA 2WM8A 3ZE7A 3AFMA 5EQDA 2ZITA 4EHDA 2B8TA 1C30A 3HYTA 3QV1A 5IZCC 4CKZA 1K5PA 1NRWA 3EZFA 3M81A 2P69A 4YN3A 3C39A 1UP7A 3MS2A 3QFRA 3NBXX 2YWXA 2I2AA 3E9DA 4QPJC 4H1HA 2FMFA 2B25A 1R0CA 1G7CA 2C4KA 2Q8PA 3BF8A 3IGFA 5YASA 3W6OA 3LHKA 1ZIYA 4K9KA 2SHKA 2PKCA 3L8MA 4ADSG 3MWDB 4BEJA 1L8OA 2XUZA 4D02A 4IDBA 3KNZA 2WY2D 3H5AA 4IH4A 4J3JA 1GPDG 1RVDA 2HMUA 1N0VC 2JLBA 1V45E 3ZCPA 2QVYX 3ZYZA 4YIKA 2P3LA 4IVNA 4RADA 3RGGA 1MJHA 3E15A 1K4KA 2ZOSA 4JUAA 3WIUA 3A10A 4FEGA 2QL7A 4G36A 5D5HA 4B32A 4Z4FA 3ZGNA 5B7GA 3MJVA 1BFDA 1UBFA 2B34A 2IVFA 2VPZA 2B9EA 3LYAA 4Q12A 4B82A 6PFKA 3KETA 3A14A 1OZAA 3WRVA 2RHDA 3L1KA 4MW2A 1R4MA 2I2BA 3UPUA 3A4NA 3PEVA 5CFLA 4JMLA 1TYCA 4LZWA 5IAEA 2IY9A 3UJHA 2WWXA 4KO2S 4L5YA 2PH7A 4RABA 1E3WA 2BEUA 1ACJA 3OX2A 4QVKA 4NL4H 3D2CA 3TW8B 5JXWA 3TFOA 1JG1A 1TX4B 2HF8A 1H22A 1Q84A 2O2CA 3PCXA 3QX7A 4CKEB 4MGKR 2WWTA 4V0MA 5BSFA 5LQNA 1WQ4A 1S3FA 2E37A 2J3QA 2C7PA 4H3SA 1V7CA 1O03A 1ORRA 4MNTA 2FPLA 1FQWA 2A9QA 1JDZA 5LKAA 3RJMA 3EZNA 2Q3CA 5FYQA 1VP3A 1ILWA 3J7TA 4U9HS 5ETJA 4NAVA 1WMAA 2AOXA 4DKJA 2BMVA 5EXXA 3GDFA 3FNIA 4P38A 4E22A 3C2QA 3V7YA 3VR3A 3QU2A 4ER5A 5KNCH 3DTVA 1VKOA 1DRJA 1YB7A 2BKUA 2HAEA 1BWQA 2OC9A 3A1DA 4I8XA 4P4SA 4G0WA 1C4WA 1EX7A 4ZU3A 1IHUA 3IQDB 8LDHA 5JFTA 1VZ3A 2OQVA 5LSAA 4W7IA 1N3IA 4A5SA 4V24A 2EGGA 4OHVA 2OG1A 3I2HA 4R9UC 5IJAA 3SHWA 4JT8A 3PWTA 3CB2A 3JVEA 4ZVRA 4JR2A 4XA8A 4KTTE 3DDUA 1RTTA 1GNSA 1VI6A 3ZCVA 4U5XA 2IEGA 2JIRA 4OJKA 2ZI9A 3P5SA 5KOYA 4HUQA 3GLIE 1Q12A 3MT0A 2A14A 4OA5A 5KO2A 1CQXA 2XMQA 2FPXA 4DQKA 5TQ2A 5KYWA 5KUTA 5EE1A 2AVNA 2A9KA 3WB2A 2QTFA 2QJFA 2X2PA 3CBQA 2NWQA 2W11A 1R3DA 3AHCA 1QHYA 4RLFA 3WJ1A 4BV9A 4GWGA 1DWPA 3UGQA 2I91A 4LF6B 4EM6A 5A5VA 3BSWA 9ATCA 1VCMA 3I1IA 3A8TA 2GO1A 1MV8A 3QF4B 4JBIA 1SD5A 5AK4A 1U0RA 2C8JA 1ISPA 2AFRA 2Z5FA 1BMFD 3RUDA 3WBKA 2OHFA 4PLVA 4YLYA 1P45A 3ZEIA 1SIBE 3UJCA 5AHOA 4ARCA 3W34A 2YHIB 4X1YA 1WP9A 3G5TA 1IK4A 1YGPA 1KDVA 3ZG6A 4UPVA 1KY3A 1M8GA 3MILA 2Q1SA 2EATA 1I0ZA 1VL5A 2N0SA 4LJ8A 3THXB 3I3OA 3BCRA 5A5EA 1SKBA 3EIFA 4PZAA 3R3ZA 2B21A 3EEQA 3H8WA 2R7NA 2VDWA 5IM5A 2WHRA 2GYUA 4QSHA 3FIUA 1QIEA 4YASA 5H68A 4YAUA 1G1MA 3NKVA 1G4HA 1SZJG 2IEDA 2CEKA 1U28A 1CQJA 1H0RA 2BI8A 2WJIA 5BYJA 4B9AA 3ZGVA 4CR8A 1CUVA 3IEMA 3DDCA 2AQHA 3FTCA 5F64A 2E55A 3ZZMA 1OXTA 3C7CB 1ARZA 2DR0A 2WD9A 3MQ2A 4GLFA 4NU0A 4YJKA 5BW5A 5IVKA 4ZT3A 2P2CA 4KGXA 3UXEA 1E7MA 5SZKB 2ZBFA 3B85A 13PKA 4NHEA 4MUHA 1NJ8A 4MHSA 2ZUVA 5GIPE 1R50A 3JD1A 2ZZKA 1FP2A 2AVDA 3OD5A 1LNZA 3Q3HA 3LWNA 1CKEA 2C7VA 2YVLA 4I50A 4JL5A 5EERA 4BIIA 3JSAA 3Q5GA 4U7JA 4JI5B 3RRMA 3S1SA 2DQSA 4A2WA 4P86A 2C0CA 4JYZA 2IYUA 3HKCB 1HRDA 5K4AA 1C41A 4QRIA 3QFTA 5HIMA 2OM6A 2OOKA 1YZFA 1QK4A 2FR8A 4J75A 1IUKA 3CMCO 3GNLA 5IWAB 1IZ7A 1KQPA 1NJ2A 2WU8A 3KHUA 1JIUA 3OKPA 4R40A 2HCJB 4YRKA 4D81A 1DKPA 4NDNE 1KO1A 1PR4A 1UWVA 1Q0SA 2OD9A 3O8QA 1SPXA 5ADWA 3J7AC 1ORVA 4G0ZA 221PA 1JIXA 1G5TA 2YJZA 1U8CB 4P1ZA 2D6FA 1JHPA 1E18A 1KDRA 1SVSA 1T10A 3A6PC 1Z3CA 2MTBA 3T9EA 4Q3BA 2OFXA 4ISBA 3W5UA 1FMJA 1FXWF 4RSRA 4U9UA 4RXMA 5E7JA 3JZIA 1E1RA 2PUEA 3DJFA 3D7RA 3DFUA 5A9TA 1AK2A 3FBTA 4XX0A 3WYEA 4BP3A 4CLRB 7REQB 1NE7A 5AUPB 2Z3ZA 1WDWB 2Z83A 3MT7A 1ZONA 3DBLB 4LY6A 3PIRA 2OBLA 1UOQA 4GGPA 4G0MA 2EOAA 5TQ0A 4BDSA 2ZUEA 4B84A 3NGLA 5CM2Z 4IKOA 5CXUA 2B4QA 4PG4A 1NZFA 4D97A 5KTKA 3H5LA 4B6SA 4JI8B 5FORA 4Z51A 2IPNA 2XWPA 3NHPA 1G4UR 3EQ9A 2DJ5A 3VO8A 2R66A 5T4EA 4YFYA 1G21B 5AVTA 3AR4A 3IO3A 3M6XA 1NUPA 1MTOA 1JEQA 3BJZA 4M0EA 4DVJA 3FMIA 4WX2B 3VNBA 1H66A 1QK3A 4GKVA 1XQXA 4LGMA 3NBUA 2BHSA 1UMBA 2AC2A 4Q1VA 1E2PA 3MWYW 3PC3A 4EMUA 3SIXA 3V4FA 2H1CA 2XMGA 3QIVA 5CDUA 4JOCA 2QRVB 4D0LB 1T6NA 1T3ZA 4L16A 4B6FA 5K01A 3UV7A 1E2LA 3FHTA 1J2RA 5AI9A 4YYZA 3VUFA 3F71A 5CK4A 3W2EA 2F48A 1TW3A 1V1MB 3QLVC 5EQFA 3G6WA 1YDHA 1BHSA 3RH0A 1DMRA 2XRZA 2WF9A 4NSNA 4ETWA 3C3WA 1IHDA 4FNGA 5JDIC 2R0QC 3GGGA 3D3QA 4ZYVA 2J4CA 4Y6GB 2WHPA 3WLEA 4EZIA 2WM2A 1OROA 4LMRA 3DL4A 4N8EA 1KZGB 4RTPA 2J9RA 1ZK2A 3JQEA 3LUAA 1VHJA 4UM7A 4D9FA 4G3XA 3ZK8A 3C7AA 4F06A 5JASA 4RF4A 3OPYA 2BZ1A 1D0VA 5T7BA 2L17A 2C1EA 4KGZA 2SNIE 2QRGA 3OWXA 4P4UA 3GAMA 2CWWA 1Z7EA 4OQQA 3PFGA 3WB0A 3LC7O 2DUJA 1QMPA 3ZKWA 2C84A 3DWIA 1F1JA 1IB6A 1QTRA 3AYXB 1Q83A 1DRWA 4K9RA 3MCZA 2REOA 4N0PA 4WT7A 3WISA 5BW4A 1DWQA 4GM1A 3Q3GE 3GIWA 4P53A 3C6XA 4FFMA 2W2VA 1WEKA 5E3IA 2RHRA 5B3LA 1FYEA 2PWZA 4KQXA 3EXEA 2EJBA 1V37A 4G5FA 2X2EA 1CNEA 1M2VB 1WMBA 3JR7A 3RNLA 2F64A 1LU9A 1L8QA 1MT3A 2OYSA 3G1TA 4FKBA 1JLRA 2IDKA 1Z2NX 2O07A 4BQSA 2C7OA 5GONB 2NPOA 4K9LA 4RPHA 4Q7MB 4WECA 5DBGA 1S96A 3TZCA 1NQWA 4BJ6A 2QYSA 1P80A 5IRCD 5MGBA 2JDIA 1J25A 3ODGA 3I76A 3R7LA 1ZNYA 5LJIA 5CCBA 2V7PA 1USWA 2W9XA 3CNQS 1X7DA 1MX1A 1VGRA 3UCEA 3T5DA 4F6CA 5K6AC 2XVXA 4P0TA 5ALFA 3UUEA 3KPVA 2VRBA 4U0KA 3P9XA 2PX6A 4KB5A 3FTQA 2AXNA 1GZ6A 3UJ7A 1DG9A 1P1HA 2X5JO 1WD7A 3DEFA 1IXRC 3P8ZA 2GXAA 1S0UA 4FM9A 2EEZA 3I32A 3A04A 3CY6A 3IFSA 5HE8A 2I9KA 4FQ5A 2MMGA 4F9EA 1ORDA 1Z8FA 3K5IA 1TEZA 1XFDA 2FWPA 2OO3A 4M86A 2XOKD 3DXXA 4YALA 4EVIA 2QR3A 3NHJA 5A4JA 1KEUA 1TCUA 2HZBA 3A2LA 3HCRA 5CCEA 5JBQA 1IOLA 5LQJA 3CB4A 3OFSA 2Y1LA 4J4HA 3VSCA 3GT4A 8GPBA 3DSRA 2BFCB 1Z5UA 1PWXA 1S8AA 3ZVMA 1O6GA 2PXAA 1P81A 3TOXA 4DMMA 2Q3MA 5EL0A 3I2FA 2HW8A 2B94A 1NOJA 2GQ0A 2JJQA 2GN1A 3LY5A 2GEFA 3PC6A 3L0YA 4KKVA 3RODA 3A4LA 1QOZA 2X4IA 1SCNE 1WD5A 3D0KA 3O3MB 4GECA 4BO1A 3M49A 2NVUB 3CE6A 5FKJA 2WZDA 1SJ9A 5JR3A 1TVEA 1A8UA 1M1NB 1RWWA 1ZM7A 2P7IA 2XQGA 3OJEA 3R4VA 1SD1A 3CO5A 4LTDA 4UC0A 3T1NA 1EHCA 2JCBA 2RGAA 4YP6A 1F17A 1JNXX 3O7MA 5G0WA 3QYJA 2XI4A 2DCMA 4KYTA 1UR5A 4NV3A 4OLBA 5SZHB 4ZCTA 1ILEA 5AM4A 5LWQA 2IXFA 2ZI5A 4E08A 1I3CA 1RYFA 3RDPA 3O03A 3KOXA 5DF1A 4MDEA 2PQMA 1UIMA 4JWKA 3HGMA 1EBFA 1ZH8A 5KC9A 5KX5A 3HR8A 4E4TA 4BMCA 3EPPA 5CT9A 3OQOA 3LBHA 1FX0B 1QX4A 3U1TA 4DLLA 4RANA 4ZN6A 1K6JA 1XZNA 4O2AF 1ECLA 4OYLA 1AGPA 1UJCA 4Y2VA 1S2GA 3DDZX 5BN3B 2H5JA 4JKOA 1M75A 3VDXA 2WJPA 5JWOA 3U1BA 1P8AA 1H2FA 1YVRA 3B48A 3RK0A 2J5QA 3KXLA 3AY6A 3MTEA 2RDMA 4JLJA 1TEHA 5KHOC 3AU8A 2NZWA 1R4AA 5BRAA 2ZRFA 2QVBA 1S9DA 3KKNA 5H82A 5K6RA 2X58A 1V8BA 3B38A 3MS4A 4MRMB 1PG5A 2H7YA 3AF2A 1TQ8A 4NYJR 3DVAB 3MWDA 4N3BA 4ZZ2A 5BWNA 3AY0A 5EAIA 1OE0A 2ZIXA 2YKGA 1B93A 1AMUA 2XD9A 2QQEA 4ESHA 5E1BA 3ZE8A 1VKRA 3G2MA 3T9AA 1GWNA 3R1IA 5DNYB 4YAFA 2V6IA 2ISQA 2Y99A 3X1KA 4ARAA 5C9ZA 1VPVA 4JUFA 5DHQA 4RKRA 3UK2A 1Z3IX 3V8RA 4CMJA 4QKQA 4RY9A 3U3RA 3KQPA 4FYKA 5J3JA 1YIOA 2HRCA 4IXNA 4JJ4A 3IOEA 1OWMA 4Q4HA 4DCCA 421PA 2VQFB 4CKBA 4MUEA 2PLWA 3W8RA 1Q1QA 1FTQA 4WNYA 3UAXA 3IPRA 5ITZA 1U80A 4RIFA 1KYVA 1IJKA 3DFMA 3KU4A 1RWOA 4IDQA 4I55B 4MP6A 4CRWB 5FPYA 3ISJA 1JQEA 2BHNA 3BDAA 3IKMB 4EA8A 3ZD7A 1PJ2A 3PK0A 2G6TA 2J9GA 3CRQA 3WLHA 1F4PA 1KAMA 1XROA 2PZKA 5KNLA 3PITA 2G3YA 5E6UA 4CNQA 5BOSB 1N2ZA 2BONA 2Z9DA 5JY1A 1CPYA 1SC6A 1W76A 2BGRA 4H1UA 4YV7A 5FTLA 1VL2A 1N4AA 4BLRA 3L4JA 1K3FA 3SBEA 4DRYA 2BSAA 2QUBA 2NU6B 1I13A 4D3XA 1LEHA 4I46A 4J4BA 5IX8A 4CM4B 3RYHB 1FVOA 3AR5A 3CUKA 4KRFA 1YQEA 2FRDA 3U49A 4AS2A 1U5CA 5FV4A 2JIQA 3BWMA 4LCJA 3FVTA 4MB0A 4JUCA 2FWJA 3HB5X 2YYAA 3G0CA 4UFOA 5CDTA 1UZNA 3UK1A 5B30A 1LLQA 1A5BB 1NX9A 1SXJD 4GRIA 1FBTA 3KKQA 4MUIA 4G0VA 4KVAA 3L6OO 3F9CA 2EDAA 1E64A 2CT8A 3N76A 4FBMA 4RA9A 2J7KA 3EUAA 5JEDA 1A71A 1MPXA 1SU7A 3AWDA 3HGTA 3SQOA 2KYRA 1QHHB 1YZ3A 1JU9A 4YAIA 2V5VA 1R6AA 2HL6A 2NVOA 3V4SA 4DZRA 3UJNA 2KLBA 4FZ5A 1VMAA 4YHHB 3ZK7A 4MMYB 5BNTA 3QOYA 4LJKA 1CC1S 1GUZA 1MHTA 4MYRA 5ESWA 2YJ3A 5KYWB 3ZW8A 1ZCJA 2QNIA 3AFHA 1M72A 2C4NA 3IQHX 4DJJA 2FN4A 2QX7A 4LFAB 1QLHA 1VXOA 1C1DB 4JI1B 4E4YA 2IPAB 5CRIA 1YFKA 2J30A 1U6IA 2HT6A 3BWBA 3AIOA 4FNAA 1QS0A 1VIYA 1W0JD 2FB9A 4M1SA 4WXYB 1QC5A 1M34E 4P0PB 5JSHA 2OD7A 2P1ZA 1OGYA 4A4DA 3HGQA 1ZOOA 2ZKLA 4ESVA 4ZZ1A 3EGOA 3DKKA 1TO2E 1YQGA 1RLTA 1KZHA 1ZQ1A 4CNBA 1WG8A 1EG2A 4KXFB 4CWAA 1QV7A 2Q9AA 3E2MA 4UTXA 5IXSA 1L4EA 4GLJA 3I2IA 3L6EA 3DW3X 3OCUA 4FSXA 1GTMA 3T34A 2ZIAA 3OIFA 2VYND 1R4MB 3OCWA 4GSYA 1DKQA 3D8NA 1S1MA 2HDOA 1G7SA 2I80A 4PIVA 1COWA 1TO6A 3DVSX 3GT7A 2Z09A 3ZV5A 4CMEA 5IH7A 5DLDA 4HXFB 4QD3A 2YV2A 4F0JA 4R16A 3T7RA 5AOCA 4AZ3B 1Z6GA 3Q3IA 1PWZA 1W1UA 5L3SA 3UWSA 1OZHA 1R18A 2OG2A 5DN6A 2VNIA 2NT4A 2NO1A 4CETA 5IT4A 2O1EA 3MGCA 4ONEA 3TQQA 4DLKA 1YC5A 2WFLB 3DCIA 1U3DA 2ET6A 2X1HA 2YZNA 4MLDA 2F4VB 1G59A 3OOHA 2CN1A 4TV8B 2I8CA 4YJFB 3INGA 3SVLA 5GGXA 1JEEA 3IJ5A 5KTOA 3EPRA 1X7ZA 1OA0A 4BQEA 1J5EB 4LMPA 5LR6A 3VPBA 4LK3A 3IT2A 2IYWA 4PSUA 4AECA 2R1TA 3H13A 3JALA 3ZPXA 3UY4A 2VNKA 3GEEA 1UKCA 1RXWA 2MSWA 1ML4A 1P6UA 1AN9A 4IWYA 5E6RA 4CKYA 4UNSA 3HKDA 4Z8YA 5EZ5A 3UHPA 4LF4B 2I6XA 1QK5A 4IV8A 4NS1A 1MA0A 2EKQA 1QVZA 1HDCA 3JQCA 4ZYLA 2IU4A 4HUQB 2B5VA 4LXTA 1U2GC 4R01A 2B78A 3MWKA 4BJHB 3WQHA 4BKMA 2ECPA 4A9AA 4DGQA 3ROPA 4BATA 3PENA 3QENA 1TA0A 1TU0A 4L22A 5LMUB 2QTVB 4QYSA 2WJ6A 1IY8A 1F12A 5JHGB 5AKEA 5UKDA 3N0TA 4ZEOA 4EFNA 4IGKA 1GU0A 3GDOA 2HA6A 2Q2NA 3NHLA 3ZEAA 4PXYA 4X64B 3OX4A 1RJFA 5GOTA 3TCKA 4BNVA 1QQBA 2YHBA 5EMMA 2X5KO 2CBGA 3WWPA 1I8TA 1V3UA 3RC1A 4WY8A 7REQA 3P2MA 3VC3A 9LDBA 1LH0A 1GQ2A 3EOBI 5ES4B 1ISIA 5ULLA 1EFDN 2QUIA 1N2OA 1WXEA 2P4HX 3PI7A 3GJRA 3RIGA 5K45A 2AN1A 4GPEA 3VNUA 1SU8A 1RYYA 4UPDA 1ZVVA 2Y0DA 2H2AA 1URPA 3B2NA 5ICEA 3GVXA 3H5NA 3O8LA 3UA3A 5IDQA 2O7SA 2XMPA 4RZIA 5CLGA 4YMVA 2ZE6A 4G24A 4LKOA 4ZU1X 3VU0A 2H4ZA 2HRDA 2V0CA 7ADHA 5HUJA 1Z35A 3SKYA 1SOMA 3OICA 4LYGA 2QPOA 1IOWA 2H4JA 5DSZA 4D9MA 2GHQA 1GNVA 1I14A 4Q47A 1QJCA 2OHHA 5ECGC 4WZBA 4HEHA 3RYTC 5KVCA 3L07A 5U9CA 4AS1A 5D1NA 5JCOC 4U2KA 5CG2A 1IZ8A 5DOVA 4JENA 3S2EA 3FMFA 5AVZA 4TYWA 2OGZA 1MR3F 1MC1A 1JKMA 2YWRA 3AVOA 4ZOLB 4LOJA 2CYCA 2FXIA 1EUDA 2YJ4A 2ZWMA 3H1TA 2K6GA 2QPLA 4RMNA 1C29B 3DZHA 2CUTA 1DTSA 3OM0A 5AW1A 2Z43A 3G17A 2B1QA 2P6MA 3JVVA 3UT5A 4RTLA 1NDHA 2QQGA 1Z9BA 5ALIA 5EZYF 3OBIA 4QLAA 3ZTTA 4ZIRB 1Z63A 3SE0A 2CE7A 2NMVA 1B3RA 1I7NA 1QZ3A 3QMMA 1SCBA 3TZLA 3DLHA 4DCNA 5IFLA 3VNRA 4LQLA 1T1JA 1SHZA 1TJ3A 3BGWA 3R23A 4K05A 4X91A 5JCOA 4DM7A 3M34A 1MRSA 2JLVA 1DTEA 1T2EA 3SJZA 5BWCA 2PBRA 3EXHB 3WMFA 2EZ9A 1AKTA 1U7ZA 3BD9A 3MJRA 5EMNA 3ZNNA 4BIMA 5C53B 1NMYA 1FUKA 3PXEA 4Q37A 5CTJA 3PWZA 3PHLA 4KJZA 4NG5A 4EKGA 3O74A 4QX6A 2D1RA 4ID3A 4R4JA 4HB2A 3JQRA 4J0EA 1FRZA 1SY7A 3C6QA 4R2MA 5BURA 5LQMA 2V58A 3GUYA 4E5SA 2CLSA 4HQ0A 2ZPAA 4NE9A 3M6VA 1P6QA 1NNUA 3WV5A 3WDMA 4F86A 1ZMOA 1U7HA 2A7XA 3HQ4O 2QZJA 1VLJA 3D6NB 5EJ7A 5I7AA 4I50F 4DR4B 1K75A 4A23A 2FQYA 5H3HA 2F1RA 1X19A 3LAWA 2EXXA 3N0XA 4OBWA 1E2MA 2PKEA 1JHUA 3EDOA 1CUBA 4QOJA 1JVNA 4ZA2A 5LP6C 5HOQA 2A1TR 2FN3A 4RF2A 4YR9A 4IOKA 4NHOA 5JZOA 4MQUA 4V0RA 1T43A 3STWA 4EG6A 2HA0A 3WHLA 2IYAA 4MR9A 3MVEA 5GONF 1M7BA 4JAVC 3H1BA 3ZE0B 2VCYA 1NJGA 3JZMA 3O1HB 5ENVA 4P7FA 3KD2A 2FSPA 1Y34E 1JHZA 4XGQA 4S35A 2R3SA 3P0IA 4YAKA 1WR8A 4MKHA 2OCBA 2FZ4A 3VXKA 1SG6A 3CW2A 3LXRA 1ADGA 1EAMA 5HOEA 5JC8A 1C3JA 4OQMA 2PUGA 4RU1A 1EUZA 1N1DA 1DP4A 1SHTX 3OJWA 3KZKA 3GU3A 5BO5A 3BRWA 2EZTA 2ZUCA 3C3BA 3DEJA 5C7LO 2OENG 3K1YA 4PU0A 2Q28A 4H17A 3G7SA 3KQNA 3H9QA 1TC2A 2HK7A 1BS2A 2PUWA 1D8TA 3FGPA 1T2VA 2COUA 1BD4A 4BFSA 3PLRA 1XDDA 4LQ4A 3C45A 3OZBA 4D9JA 1HT2E 1Y4UA 1LV7A 1OFVA 3B1XA 3KKZA 1FTNA 4YXFA 3UWMA 4B4VA 4FJ0A 1YULA 3IYLW 3LQRA 4IQ4A 2GKGA 2AG0A 3UJPA 3HM9A 2D2XA 2X6RA 2W4QA 3RTEA 4MRVA 4IYJA 1UFRA 3M5DA 2OC4A 1JLSA 3L4BA 3PJGA 3ZXYA 4DPLA 1NT4A 1OBCA 2XY4A 1FFYA 2Q5HA 1GGHA 1DCKA 1JSCA 5CDGA 3EG9A 3EPJA 2K5UA 2PQ0A 1GYQA 5D85A 2WICA 4ON9A 7YASA 3ZJ4A 5IFKA 4N03A 1N92A 2QRUA 2VZEA 2DFKB 3GUUA 3PT9A 2BFDA 4DMFA 1LF0A 2CL6X 1T0BA 4EDHA 1A4IA 4Y8VA 4QGAA 4C0AC 3HWX1 2QE6A 2BZGA 2OORC 3E5HA 3M6LA 4LBYA 4W1PA 2A35A 5MFZA 3FF4A 3BQ9A 4AP9A 2JLUA 3TQOA 4HCJA 3ZWNA 2PN1A 1DKRA 2XQJA 3JX9A 3ME5A 5CLFA 1Z8NA 1VP9A 4QTZA 2P91A 3ASVA 5AHXA 1CW2B 2DBZA 1CU1A 4PCUA 4EW3A 4UTRA 5LJLA 2FF5A 4G0NA 2PZJA 1W5BA 3GHYA 2ZRDA 3CZAA 3KELA 3VZDA 5IJ9B 4AS3A 3WIOA 1N57A 2GTPA 3JASB 5LDHA 4DDWA 4PBTA 3RSLA 3GFRA 4H4EA 4LZJA 3HSKA 2CJYA 4BJ3A 2UUOA 1M0TA 2KJQA 3ECCA 4N8DA 1V1RB 1K88A 2FPOA 3W6UA 2PBZA 3EXG2 2GD2A 3COZA 3HNOA 4FJ1A 4JL6A 4QU5A 2W6JA 3E0XA 3I37X 1TQHA 4INPA 5I47A 3EGIA 3UFXB 1U2EA 4UXJA 1CHNA 1AB6A 1U2SA 1XZPA 2APJA 1G63A 1P1CA 3EZ7A 1TF5A 2E2WA 5J5CA 1KEEB 2YIDA 4GVPA 4TQGA 3IUMA 4TQUS 5HF8A 1IG3A 3ETDA 3N2NA 1OB5A 4OP2A 1F3LA 3P52A 1AGXA 4NCXA 4C2BA 1XU7A 1XQWA 2R8ZA 4TS4A 1JIVA 1ZBQA 3I6YA 4JJKA 1MFZA 2GFQA 2WA1A 4C14A 5AVYA 2O8NA 3FWYA 1U98A 2ETXA 3FZQA 1QTIA 2NU9B 1P73A 3U9SA 4D44A 2BR3A 3P9IA 5BQOA 3VU8A 2RGDA 1VFNA 2H5LA 1C3EA 1J0DA 3T35A 1ODSA 1DUIA 4L74A 1KDTA 3E82A 2ONKA 2A0WA 3GH1A 1QPBA 3HCWA 3RTCA 4DLBA 2VTBA 5JLAA 1D6JA 1QR2A 2GBCA 2PZAA 1Q0UA 4UOEA 4I19A 5JNVA 1AGYA 1JJFA 3UO8B 3ZIUA 4JUBA 3Q15C 3GLVA 4U7DA 3R7BA 2IPOA 4EFMA 4MMZB 2X7JA 1CYEA 1CUYA 2UZIR 2CLFB 1PVVA 4DR3B 3PL5A 4GR5A 2LR0A 1C9JA 3O91A 2QLMA 1ZK4A 3WLPA 3GGSA 4F38A 2Y8EA 4O0LA 4IW3B 4FFDA 3BGSA 3K3PA 2Y92A 1C14A 2EHJA 2FW9A 3D0OA 4CMBA 5BV0A 5AOAA 4L5AA 5AKXA 1OVMA 5JJKA 4ETIA 2O8FA 1XKLA 1MG5A 4ZO4A 3CM0A 1PQYA 2EL7A 1L4UA 3RVRA 1NW3A 1TM7E 2BOVA 2VVTA 2VRCA 2DG2A 1DLIA 5DWVA 3IP1A 3K2EA 3CW8X 4HXGA 4LSWA 2J67A 3SR3A 4IIJB 3RIEA 5AQ1A 3PRJA 1ZOPA 4IFBA 3DXZA 2BH9A 3HACA 1QVVA 3VTFA 1I32A 5DYYA 4GE3A 5F76A 1MJGA 2Z6VA 1KIFA 1L4FA 2UYYA 2AG6A 4RZ3A 4Y6LA 4ZC1A 1W46A 1U7WA 4NJMB 4RXUA 2NVBA 2PZMA 1ULTA 1A4UA 1M2HA 2J0QA 1PQ4A 1IHYA 2ERYA 1J99A 3IV7A 1NWHA 1AC5A 3D6TB 3GAAA 1UBRS 3KQTA 1NJ5A 3MTGA 5EUCA 5T3YA 5B6JA 4PAMA 3CHYA 1HTTA 1KQNA 2JKYA 3RQIA 1N2XA 1G2PA 3ZBUA 4OQYA 4EJFA 1M2OB 2RH4A 3GRUA 4AF8A 3H3FA 4HDKB 4N65A 1PR3A 1E6EA 2VDJA 3CRNA 3GCGA 4TT3D 5AI0A 2TECE 4IHJF 4PN7A 2J85A 4N76A 3RS2A 1CK4A 5LA6B 1UAYA 3OZGA 4I55F 3UJDA 3N6XA 3D4NA 3I9JA 3NTUA 4U63A 3WKEA 4KQHA 5KCMA 4BMZA 5BSGA 3ZJUA 3V7NA 3IMFA 1YB4A 3A6EA 3VKWA 3BD6A 3FYTA 3D8RA 1A97A 3D3KA 3HKEA 1ZD4A 3EMKA 4HGNA 2OXIA 4D46A 4RO0A 1QRAA 3RUIA 1PYOA 3R7SA 1SKUA 1PR1A 1Q17A 4LYEA 4HJXA 4JT9A 3PVZA 4BLSA 4L75A 3CNNA 1PP4A 1PR6A 4OBEA 1GKKA 4LJLA 2BFBA 2ZJ2A 4MPDA 4MW4A 5AKZA 4YT2A 1N6PA 3WYGA 5JIBA 2XXAB 3QMWA 2RH8A 1XEWY 1UBGA 1H6DA 1HEYA 1RWVA 2NAPA 3UOWA 1B15A 3K6RA 3LRXA 4LRQA 4QTYA 4RMHA 4WN9A 2JI9A 5GWXA 2INGX 1SUCA 2GBFA 4H08A 4BEBA 3VMFA 4OJNA 3QA3E 4TV9F 4JNCA 5K3CA 4GPAA 3UH0A 4C03A 4KGVA 5BVHB 1L4BA 3AOEC 3H5WA 4UTVA 5CFMA 3JQBA 1UM9A 2H2DA 3B9QA 1C5KA 4CR6A 4AJPA 3PUYA 4YJFA 3H17A 2O4UX 3IODA 4ZOAA 4OOFA 1CUWA 3V3TA 1NTRA 4ZCLA 1LPPA 2OV2A 1KXZA 3R7NA 5AIBA 3EA0A 4UHDA 4ROTA 3L41A 4RJIA 3SF8A 1MMFB 4B47A 4BV3A 1JXAA 4IGAA 5BT9A 5CXSA 5LD2C 1LJUA 3H7AA 3G9XA 4A2CA 1C0EA 1TM1E 1WU7A 4B48A 4GC5A 1WE2A 3VJMA 4LF8B 4UMDA 3RG2A 4BKOA 1OCEA 1T0PA 4AX4A 2BTQB 3SN6A 1FP1D 1QP8A 1DQZA 2QTZA 4KN6A 1QV9A 2MSCB 3ABRB 4QDJA 4ZMSA 5IN5A 3WE7A 3CT6A 3NHYA 2B1JA 4H7IA 3KJQA 5J23A 1RI5A 5CX4A 5CBPB 3S70A 4ZVOA 5CYOA 4QSMA 5CVJA 2GHRA 4ZAVA 2ZWPA 1Y8AA 2ZJAA 4M98A 3TEJA 4UUNA 3S2IA 1U8FO 1YB5A 3WYNA 4A6DA 5H9WA 4L2IA 1J24A 5FBVB 1XPUA 1G0OA 4AZVA 5IAOA 4FR0A 3IOBA 1DQYA 4OSEA 2B2XA 3SHVA 3GGJA 3E3MA 1THZA 4NBKA 4OQXA 3CBGA 4RC9A 4B31A 1SXHA 5AO9A 1GRCA 2HMVA 3BZWA 4IL5A 1ORWA 3RQSA 1CXZA 1WM1A 2PMBA 1RJGA 4M7WA 3HEAA 5ED0A 2QTTA 2BBWA 3RYFB 2ZB4A 3SBXA 4DQDA 3OF3A 3ROFA 1HT3A 3RYIA 2C96A 1UKEA 2GBPA 5IK2A 2Y71A 3EXHA 4FMDB 1V0JA 5C35A 1BX3A 1E5LA 1XD8A 4QHYA 1E0JA 1N9KA 2YOHA 3CSUA 1FDIA 2HYDA 3GYGA 1BKYA 4HH1A 4I1SA 1KJYA 4G86A 1N8TA 3FDJA 2FMUA 3BTSA 4FI3F 2HQRA 2VSFA 1QV6A 3BMXA 2BT4A 4NYMR 5LB2A 3RBZA 4KGDA 1TGVA 5AKKA 3RTAA 1BE1A 1NONA 5JCZA 1GGNA 1I4DD 3I58A 2XH8A 1L5QA 2OCAA 1GZUA 4MR8A 4QUIA 2R1ZA 1MEJA 3P7MA 3FCEA 2REQB 1D6NA 4J8PA 5KTSA 1CE8A 3L04A 1KYQA 4MQMA 2O8CB 3F67A 3H4TA 4HAWA 5KC8A 3PU6A 1OX4B 2B5WA 1BFUA 2RGEA 2YY6A 4WGGA 2OE2A 4Q3AA 3ZWKA 3A25A 3HBLA 4Z7JA 4IM7A 2BLLA 5IAAA 1T9HA 3NYIA 1N9GA 3QUAA 1RJEA 5GAJA 5T67A 5JROA 1G6KA 1HT0A 3ANMA 2Z2JA 2GYYA 1U5BA 2D74A 2G5TA 2QRJA 4S2EA 5DEOA 4EKEA 2Z6UA 3E9MA 2BEKA 1U9IC 1JJVA 2YJNA 4LWOA 1ZRMA 4YI5A 3ZY6A 1DE0A 4ZZIA 5CFQA 1H8HA 3QOWA 8ATCA 5KTNA 1BE8A 4DWJA 4FZJA 1XZFA 3Q9NA 3G2OA 4CMGA 1HL7A 1Z25A 1UBOS 4Q24A 5KBYA 3EZ6A 4BFCA 4AAYA 4WNCA 1P9WA 3K09C 3OQPA 4MITA 3DYBA 3JAMA 2I6QA 4C9BA 4P5EA 4NNPA 4FMCF 5DRTA 2AF4C 4BGVA 1E1QA 2W0SA 3JCZA 5DCWA 4EPTA 3SC2B 5F4ZA 4RQBA 2YUIA 5DM4A 3AR2A 2Y1OA 3FPKA 4X41A 1MO3A 3WSTA 4ZJUA 4O2BF 4KR3A 5HMMA 1JPUA 1KI7A 4XCQA 3T9CA 5E3JA 4DMHA 3CNHA 1KO4A 2JGKA 1VE1A 1XPJA 4L5CA 5LQSA 1JHDA 4HYEA 3QBJA 2CXOA 4KLCA 1RBQA 4QTUB 3RSCA 1GRQA 2R11A 4NXMB 2ZRKA 3HXQA 3PHGA 2JS7A 1ZITA 3SDZA 5AW0A 4EARA 3SJBA 5ER6A 5AIAA 1KFBB 3I1FA 3DEIA 2ZJ5A 1EA7A 3QY9A 2YL2A 3ILHA 3Q4GA 2V6GA 1Y9AA 2DUMA 4LE2A 4QBHA 5KPJA 1OWLA 2BBSA 2WD8A 1AMNA 1N32B 4PHCA 10MHA 1FMFA 3T5AA 3CNEA 2PG3A 3MMSA 5EG5A 4DYHA 4Y9RA 2OZLA 3DOJA 1A9QA 1WB5A 4Q1BA 3D31A 4YFVA 1RMQA 5A71A 1R2QA 3S2YA 4BDTA 5LLTA 1A5SB 1U90A 3QX3A 2PEYA 3PXDA