4PZCA

Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 from ralstonia eutropha
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
SIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-Hydroxyacyl-CoA dehydrogenase
publication title Crystal structure and biochemical properties of the (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
pubmed doi rcsb
source organism Ralstonia eutropha h16
total genus 101
structure length 283
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2014-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4pzcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4pzcA01
4JXKA 1PS0A 3V1TC 3DBLA 1XA0A 1I3KA 1UDBA 4E5YA 4PG6A 1NQ5A 4TRRA 1GFSA 2C5AA 4QECA 4UUNA 3PWSA 2RAFA 4CQLA 2X0JA 2YQ4A 3MEQA 3QHAA 3ROPA 1V3TA 4PG5A 3ZV4A 1T2DA 4GX0A 3LDHA 1YO6A 4DYVA 3GEGA 4EJMA 2BKAA 1F8FA 4FW8A 1HSOA 4RVSA 2OBYA 4NJMA 1DDOA 4KUEA 1B7GO 2Y68A 2HO5A 2W90A 2I6TA 3AFNA 4FFRA 4Y6RA 5DDIP 1OMOA 5KVVA 4I08A 3WLFA 4D46A 3E18A 4EDFA 5BNIA 1BVRA 3PYMA 3ZNNA 1EK5A 3EY4A 4XA8A 2NUAA 1PS9A 2C07A 3JQBC 1NFFA 1T1SA 3IUSA 1U8FO 1MXFA 3F47A 4E32A 1HDXA 5JPIA 2UUOA 3NKLA 4S3MA 2NSDA 4Q3DA 4CJXA 3QQPA 2Y1DA 1MV8A 3E48A 1D3AA 5H81A 1CETA 3L9WA 4C7KA 1FXSA 4GLOA 5DBFA 4Y98A 1UZNA 5G0WA 4DQVA 5KJEA 2YV3A 3VDQA 3KBOA 3GGOA 4U8GA 2DBZA 3O4RA 1DFHA 2OOSA 4R1NA 2C7VA 1O9BA 2DBVO 4L9RA 3M1AA 5G0SA 1NP3A 1EDOA 3ETDA 4PLFA 3WTBA 3LK7A 3ST7A 1Z75A 4CV2A 4XR4A 4B7CA 3ADPA 4F6CA 2AEFA 1QSGA 5DCUA 3V8BA 5B4UA 4BO9A 1VRWA 2QG4A 5JAZA 1LLQA 1GCUA 4K28A 4E5KA 4EBFA 1YBAA 4RPGA 3MWEB 4WASA 1GCOA 3I4FA 5TJ9A 5K0ZA 4NR0A 1DPGA 2HMWA 4WPGA 2RIRA 3S2IA 4IDFA 1MC5A 1ENYA 1S7CA 2GCGA 1Y5RA 1XWFA 1GYPA 3DO5A 4IZHA 1QG6A 5DP1A 3STHA 1VPDA 3JYNA 3KUXA 3T7EA 4A73A 1ZFNA 2X7HA 1YWGO 1B8UA 1WVGA 2BFMA 5I7VA 1DRUA 2EERA 2V6FA 3F4BA 5L9AA 1BW9A 4YACA 1KEPA 3QV1A 1PS8A 1MB4A 3BMNB 2VNSA 4E12A 5DOVA 3H9GA 2PA3A 4Q39A 1PGPA 3QWHA 1JDJA 1LI4A 5IZCA 1LEHA 5L4LA 1SOVA 1S6YA 3EMKA 2O4UX 2X86A 4ALJA 1QKIA 5HBRA 2DKNA 3JQAA 4FIZA 4TQGA 4XB2A 4YQZA 4RO0A 1PGOA 1PR9A 4WEQA 4BNXA 4Y6PA 4XIJA 3K8ZA 4H16A 2G76A 1ZSYA 3DMTA 3DR3A 1XU7A 4PGFA 1F0YA 3AUAA 3LC7O 4KWIA 1U4OA 4HX5A 4D44A 2PZMA 5TS3A 3KB6A 4E2WA 1X7HA 4BIIA 1LSSA 3Q6IA 7MDHA 3X2EA 5JDIA 5HWSA 2JD1A 3DTTA 4B8WA 4LRTB 4PG7A 2DTEA 4JP2A 1E6UA 4NDNE 4XQ9A 5CAEA 2BF7A 1BHSA 3L4BA 1R0SA 2X5JO 3UN1A 3BMCB 4DC1A 4D3DA 4I5FA 3GGPA 4G81A 3TWOA 4WCDA 1ENPA 4E2XA 2WEKA 3RKUA 1E6EA 4NPCA 3G0OA 4PIVA 3F6YA 3JD4A 5AYVA 2DLDA 1DXYA 3ASVA 4ZICA 1ZK1A 2ZCUA 5A5FA 2F00A 4CMIA 5DBGA 4B3HA 4BB6A 1R16A 1T24A 4MVJH 3K9QO 3OEWA 2D0IA 4ZU3A 3ROMA 5L7TA 2Y05A 1F17A 3PJEA 3D3WB 4BO2A 2BFOA 3OETA 1EVZA 1E3EA 5CDUA 2ZJ0A 3RC2A 2P4QA 1H94A 5T64A 1XDWA 2GZ1A 2YHIA 2VZ0A 4UVIA 1NNUA 3AOEA 2VHWA 4BNFA 1W73A 4FB5A 4IJVA 3JQDA 2E82A 2HMUA 3VH1A 1YB5A 1U8XX 1GD1O 3H5AA 1H0KA 1NWCA 2O4CA 4E6PA 4DMLA 3MCVA 1MG5A 3FHLA 4LCJA 1E7SA 3ZWNA 3ZWBA 3N7UA 1AXEA 1H6AA 3MTJA 4QFDA 1Z73A 2C7GA 4D0SA 5EESA 3V2GA 3OFSA 3C1TA 3IKTA 5DOZA 1TI7A 2DTDA 5IN5A 1L7EA 2PV7A 3GDOA 2PY6A 3JYPA 5GZ3A 4CMHA 1KVUA 3WOHA 3JV7A 3FWNA 1HDOA 1EQ2A 2B83A 4O0LA 4BS9A 3RROA 2JAHA 3COSA 4BMSA 3OJFA 5TNXA 3PFFA 1DRVA 4NFSA 4GWGA 2OORA 4OM8A 4KQXA 2H63A 4RL6A 2Y1GA 2AW5A 4AJ4A 1P44A 1TVEA 3NV9A 4R54A 1V9LA 2BRUA 5CG2A 3AW9A 5G0TA 4BO5A 1HZJA 2EJVA 1PEDA 1VKNA 3HJAA 4ZD6A 1R0LA 5ILGA 3RBZA 4CM4B 1LRLA 1E3LA 1T4BA 3SLKA 3WYEA 1ADCA 2BLLA 2ZK7A 3ANNA 2PH5A 3CIFA 2GO1A 1RWBA 4WUVA 1NPDA 1MGOA 4RPLA 1U3UA 3IOYA 4A10A 2J6IA 4TKMA 1IZ9A 1PJCA 4HWKA 4OMUA 5DBIA 1PGQA 4GPD1 4YAKA 5KKAA 3AI1A 1XLTA 1I3LA 2W98A 3KV3O 4OIMA 4RF3A 1A71A 3QP9A 2I76A 2EEZA 1BDMA 2YV2A 4BKPA 1XGKA 1ZJZA 1IZ0A 2C2XA 3CMMA 3PQEA 1Q0LA 2X0RA 3GLQA 5JBIA 4KWHA 1W4ZA 1Q7GA 5F5NA 3TQHA 1U2GA 2VRBA 3JQ8B 3ZH2A 4BKUA 4ITUA 1XHLA 4HY3A 2Z1MA 3KO8A 4RF2A 1XCBA 4CLRA 2IYPA 4BGEA 4L76A 2J5QA 3U4CA 3I9LA 3CSDA 3GVPA 1YJQA 2ZQZA 3NTQA 3B1FA 2YHUA 1Q2XA 4CM5A 5L45A 4NH4A 3ZWVA 3GZNB 3L6DA 1HSZA 3GVXA 5G0VA 2D59A 4NMHA 2P91A 2WYUA 1LC0A 2CMDA 3W8DA 1BXKA 2R00C 3WSWA 3GHHA 2VWHA 1QORA 1ZSNA 2G5CA 3JYQA 4FFPA 3NGLA 3JQBA 4UVDA 3I9NA 2XPCA 3NT2A 4AJHA 3TZCA 1VL8A 2NU7A 2QIOA 1DRWA 2EV9A 2G82A 3NAQA 5I8ZA 3HQ4O 4CL8A 3WJAA 4RLHA 1DC5A 4WE3A 1EMDA 2CFCA 1ONNA 5AOVA 1GUZA 1PQUA 5KVQA 4ND4A 4BQRA 4E13A 1R6DA 3K30A 3AY6A 3OIDA 2JCVA 3VOSA 1V3VA 2EGGA 3IIEA 3LT1A 3F5QA 1VC2A 5CDYA 1N7GA 2BFPA 4TVBA 3N58A 1ZVMA 1D4FA 2NVUB 4YR9A 3C7AA 4UREA 2OP0A 1ML3A 2RHRA 1H2BA 4PLZA 1BG6A 4BO1A 1QV7A 3GRPA 4A5OA 5TSDA 1EDZA 2YW9A 1Z45A 1LRJA 4B7UA 1U1IA 3I9MA 3GDFA 2ZTMA 1E3WA 1I24A 3ICCA 2HSDA 1DJQA 4INAA 2PR2A 4FR5A 3WX0A 1ZEJA 4YAEA 1V6AA 2GZ3A 2W2KA 3WYCA 4ONEA 4OSPA 1BXGA 3FR8A 3ENNA 2BI7A 2VHZA 1I2ZA 3BMQB 3GEMA 4OXYA 1P33A 4W9NC 1X1EA 3OIGA 3QSGA 2DT5A 2C29D 4MVJA 4BNWA 4EGFA 4WCFC 3ZHZA 1E3IA 3PHJA 1D8AA 3TZ6A 1EUCA 4CV3A 2PFGA 1EBUA 3LF2A 2EXXA 3B70A 2WTBA 2NVWA 5HS4A 2V7PA 5C7IO 1LDGA 3TRIA 1AN9A 2WMDA 3IAHA 4A27A 1CF2O 3CZMA 1ENZA 3PPIA 2WD7B 4EYEA 3DBVO 1DIRA 1ZW1A 1HYEA 1WDMA 4IJUA 1N2SA 4BKOA 4DIBA 4GVLA 2Q1WA 4IUYA 1P1RA 5EQFA 1KC1A 3RSHA 2BGLA 3WNVA 1HDGO 1PZFA 1UXIA 1PU2A 3CE6A 1DHRA 2GSDA 4MP6A 4B3JA 5L40A 2D8AA 2PGJA 2PK3A 1EE9A 4BL5A 1U5CA 3BXXA 2FZEA 4GAEA 1WLYA 2H9IA 2HUNA 5A9SA 3WS7A 1C0KA 1I8TA 2YZ7A 1UJMA 9LDTA 3ZWWA 3PGJA 4CQMA 5I7SA 3IMFA 3FCOA 3QA9A 1PWXA 3IP3A 1MXHA 4D0RA 1AUPA 3I9KA 3U62A 3EK2A 4BO4A 3WWZA 3I23A 1HDCA 2CZCA 3GT0A 3ITKA 1H5QA 1FDVA 3ZGYA 4W4TA 3L4SO 3KEQA 3HFSA 2EKPA 2AXQA 2EKLA 1RPNA 3DOJA 5TRTA 1DIGA 3NUGA 5L95A 5L4SA 4CR8A 1LDNA 1SPXA 2O3TA 1KY4A 1NVGA 4CV1A 3RU9A 1NHGA 1RKXA 3GPIA 1XQ6A 4BV9A 4J91A 2FP4A 4RF4A 3W8EA 5L51A 4BO7A 2YYYA 2YDYA 3IJRA 3F1LA 4R9RA 1A7KA 2NM0A 4RGBA 2DPHA 1OC4A 5I7FA 1GZ6A 4HKTA 5C7OO 1NPTO 4PLYA 1U7TA 3DFUA 4PLGA 5L3ZA 3R3SA 3D5QA 2G1UA 4Q3NA 1SMKA 3Q9NA 4RCVA 4IMPA 4DIFA 2FZWA 4P4NA 1YL5A 4N7RA 3AU9A 5G0UA 2WWRA 1A9YA 1P0FA 2O2SA 4MVJD 5IDYA 3ZW9A 2BGKA 5BT9A 1SAYA 3P2OA 2V65A 1PX0A 1WDKA 3FPCA 2GYYA 3KLMX 5IF3A 1G0OA 1VL0A 3MJEA 1CYDA 3R1IA 4P8RA 5L7YA 3LF1A 3IS3A 1N1EA 3UFXA 2ZB7A 5EIOA 2FWMX 1BDBA 2NTJA 3OJLA 4JK3A 4OJNA 3WGYA 3G1UA 2VQ3A 4IINA 4KOAA 3OQ1A 5DZSA 3BTUA 3AU8A 1DLJA 1F06A 3HDQA 1EVIA 5AXBA 3F1KA 2CY0A 3KSUA 1YQDA 1X7GA 4R4JA 2B37A 4A2CA 1DB3A 4QX6A 5JCXA 5CPBA 1SB8A 1JAXA 1XSEA 4I9UA 1DO8A 4PCVA 3F9IA 3SJ7A 1R37A 4YT5A 2AA3A 2ZB4A 5CPFA 5JCJA 4CUKA 3PYLA 2NVUA 4CLXA 5CHEA 4CQMD 1GPJA 2X58A 2OHXA 1B15A 1Q0HA 4D45A 4R68A 3ONEA 4L75A 1EFKA 1U28A 5A02A 5F3RA 4YRBA 5T8KA 3DDNA 4XYBA 3DZGA 1LLCA 2RBEA 4FGWA 4IDDA 3WB9A 5H82A 1E1LA 4CMAA 3CUKA 4IPTA 2HMVA 3PDJA 5T5QA 4AJIA 3FNHA 3NYWA 3GAFA 1OI7A 3ZWXA 2SCUA 2HMSA 2JCYA 3PZRA 1R4NB 2Q3EA 2TMDA 1GL3A 4QO7A 5IAAA 4CL3A 3OP4A 4R3NA 1O95A 3ZZNA 4CMEA 5FWNA 4GL4A 4O59O 5GZ6A 4CR6A 3GGGA 2HMTA 3BMQA 3CEAA 3ORFA 3SVTA 2WYWA 1RJWA 1PQWA 2C54A 1N92A 3PTZA 3GZ4A 3ZV3A 2GLXA 3G49A 1ZXBA 3ZWPA 4GMGA 1UXGA 4A0SA 5KVSA 1DJNA 1ZJYA 2R00A 1EFLA 3E8XA 3OA0A 3I9JA 5KKCA 2Q99A 4OQZA 5CEJA 5JAIA 1ONOA 3DB2A 2I66A 3WIEA 1WXDA 3QLJA 3GNQA 4BO3A 2IODA 5T57A 1M75A 4YAJA 1Q7CA 1W6UA 2JD2A 5KIAA 3PYXA 3HZZA 1K89A 1GV1A 2VT2A 3KYCB 3E9QA 1HDZA 2O23A 4OKIA 4DREA 3G1TA 2OUIA 2P9GA 3VKUA 3DEYX 3PZBA 2JJYA 4NBRA 5TIIA 4J90A 4J0EA 4AJLA 3SEFA 1GAEO 2VUUA 1JVSA 5BSEA 4MVJM 4NNJA 3DTYA 1OBFO 2HK9A 2P9EA 3UUWA 3ZCXA 5HTOA 3V5NA 2QRJA 3UW3A 4W7IA 3P7MA 1O0SA 4H7PA 3BTOA 3NT5A 1N9GA 1O94A 1PSDA 2X9NA 4MOWA 4U7WA 4DQXA 2QRKA 1PZGA 2ET6A 3GH3A 1HETA 1VM6A 4TRJA 1PJBA 2GERA 4OOFA 3C24A 1DHTA 4NBUA 1XR3A 1U7HA 7ADHA 3OA2A 5F1OA 1HT0A 1B14A 1PIWA 1WZEA 1X7DA 2FOIA 2Y0DA 2EG9A 2O7QA 4DQUA 5JCJD 5KJ1A 4XGIA 1I2BA 3V2HA 1T2AA 1HZZA 1H6CA 5I9NA 4RF5A 3OEYA 1C0LA 2NQTA 4BB5A 3ZWOA 1F12A 4IZIA 1PJ4A 4AJJA 5CDTA 2H5LA 3HDJA 4ZQGA 4W9NA 4YJHB 5B37A 1H9BA 1HLDA 2H1SA 3E6AA 4UAGA 3WSVA 3UH1A 4AFNA 3JQ6A 4WCFA 2AMFA 3O26A 4TZTA 4XGNA 4CMGA 3BAZA 4YYZA 4QEDA 2VT3A 3OJ0A 4YDRA 4HNHA 3RC1A 5IG2A 1KC3A 5TC4A 3ZN2A 3I9OA 1KOLA 2X4GA 2D2IA 1JWBB 4BMVA 2HU2A 1C14A 3AUTA 1JAYA 1M67A 1YVEI 2P5YA 2VN8A 3GEDA 3HDYA 3QWAA 3EZLA 4RQUA 2GRAA 2LDXA 3UF0A 3UGKA 3ZI0A 5HM8A 3WGQA 3DBRA 1YL7A 1UZLA 3H2SA 2GGSA 4AJKA 4RV9A 4JROA 1PJTA 3AM4A 1C1DA 4KTTE 3AOGA 3BIOA 2HDHA 3DAPA 3IC5A 4R69A 1P1KA 1JLLA 1P1HA 1NASA 4IJWA 4F46A 1OZAA 1YL6A 4GKVA 3AM3A 3ON5A 1MFPA 4MKRA 1P1IA 1EQUA 1ZMTA 1E7RA 2O2YA 4JIGA 4N5NA 1R15A 3CTVA 4WKGA 4RLSA 2ZB8A 1ULUA 1QYWA 4R01A 4NK5A 4ALNA 1JU9A 2PGLA 4MO2A 4UULA 4YXFA 3LLSA 5CG1A 3QWFA 2Y1CA 1UAYA 3BHJA 4DRYA 4AJ1A 2BD0A 4B7XA 2PZKA 5CFZA 1V35A 2PTGA 2Q46A 4NJOA 3VPFA 4BO6A 4DTIA 4E5PA 2OZPA 2B36A 2W2LD 5EPOA 3DHNA 3OH8A 1KVTA 4BVAA 5BSFA 3FR7A 4F6LA 1TB4A 2XXBA 3OJOA 3WLEA 4BNUA 1GZ3A 3DAFA 1MC4A 4I5DA 5FI3A 1NYTA 1KY5A 1I33A 1A9ZA 1QYVA 4PFJA 4BO8A 1GPDG 1VSVA 1IPEA 1BWSA 3K2EA 2C59A 2Q1SA 1TT5A 3AWDA 4M89A 5DP2A 4A26A 1ZCJA 1IULA 1T26A 1VJ0A 4B4VA 3R3JA 4MIYA 4EJ6A 1Y8QB 4M86A 3WGHA 5IFLA 2JCXA 2FR1A 4I9NA 4O6VA 5K6AC 1WMBA 1Z7BA 1LDMA 2VRCA 3IQDB 4CM8B 5F5LA 1J4AA 3KYBA 4MIEA 1DLIA 1Y5MA 5IXYA 3B1JA 3O8QB 1B3RA 4G2NA 3FBGA 3I6IA 3FBTA 4UEKA 2XF8A 1Z7EA 4FDAA 3TFOA 4RORA 2XOXA 1I2CA 4FFLA 4QXMA 3ZNQA 4QSMA 5DF1A 4M1QA 5I9MA 3INTA 1IHXA 4IXWA 5KCZA 5HRUA 1X15A 2O7SA 2AQIA 3VZQA 4CUJA 2G0TA 2P9CA 2HK7A 2QYTA 3OICA 4W82A 3WJ7A 3GAZA 5CDGA 4UUPA 3WFIA 4O5OA 3E03A 4CV0A 4MVJF 1HYGA 4MVJE 5TX7A 2GR9A 2X1HA 4Q3EA 1YOVA 1ZZEA 3ETEA 1M66A 2X5KO 1LTHR 3FTPA 4ND2A 1FK8A 2EWMA 3MJ4A 3R0IA 5GMOA 2Q49A 1DOHA 4GWKA 1ZEMA 1E7QA 4AJ2A 1VL6A 3W8FA 3ZU3A 1ONPA 2GUGA 2DBRA 4O63O 5I7EA 2EGHA 3TJRA 1KBZA 3CTMA 3LYLA 1KETA 2V6MA 2Y0EA 4MKZA 3LLVA 4YJFB 3QIVA 4BKQA 4II2A 5TGDA 4YT4A 1ZUD1 2D4AA 3AK4A 3NJ4A 3ZWCA 5AXDA 3ASUA 3Q0EA 1Q0QA 5COQA 1XKQA 4I8XA 3RBXA 4GKBA 5KVCA 3A1NA 1P1JA 3ITDA 4ALKA 3OMLA 5EERA 4E3ZA 3HADA 5MGBA 1PWZA 3GC6A 4OQYA 4GX1A 1I10A 4H3VA 3WIDA 2EKQA 4IMRA 2BFAA 2CDBA 1JKIA 1V0JA 4RVHA 4L4RA 3BHIA 1GQQA 4LMPA 4H15A 3HHPA 4NI5A 4GI2A 3KEOA 3RJ9A 3JQAD 4KDFA 1T2FA 3VPGA 4CM6A 5DN9A 1OC2A 3AUUA 3INRA 4IDBA 1UP6A 3ROQA 1P45A 1J49A 3A9WA 2VYVA 3L9XA 4GQAA 1JTVA 4YJHA 3TZHA 1OFGA 3BTVA 2ZKLA 4HFRA 4BNZA 3ANLA 4JJFA 1Z74A 5G4KB 1VKOA 1EZ4A 2B4TO 1R66A 2DFDA 3K5PA 5LCXA 4HP8A 4BNMA 3DFZA 1FDWA 4BNJA 4AVYA 2J5RA 1CDOA 3ENKA 5TT0A 4R5HA 1YS4A 5KJ6A 1LC3A 4LMRA 4OYRA 1MG0A 1U3WA 5KWEA 3P2YA 2V6GA 4YTEA 3SC6A 5GZ1A 3P5SA 5KOIA 3U49A 2ZYDA 3PXXA 2IXAA 4EW6A 3V2UA 1U9JA 3IJPA 3M2TA 1DIAA 3TOXA 1BRMA 1NBOA 2D3TA 3IL2A 2AG8A 3OECA 4XJTA 3C1OA 4I1IA 5J23A 1ADGA 3RJ5A 3DZFA 3VZSA 3W6ZA 5CP8A 4J6FA 4LVCA 1PL6A 1DC4A 3Q11A 1CERA 4RVGA 1OAAA 5COBA 1IL0A 4WLOA 5C5IA 2A35A 3KYDB 3QVXA 3RFTA 5TF4A 2UDPA 1ZSVA 2DQ4A 3JQ7B 4II3A 2V6BA 3B1KA 3VTZA 4DVJA 3GVHA 1E7YA 4MVJP 3ONFA 1IYZA 5TLSA 1DC3A 5AXAA 1DAPA 4XCVA 1IPFA 2HJRA 4NFYA 1PL8A 5K9ZA 4DBVO 4IIUA 2B69A 4A03A 4CMBA 2UUPA 5I8WA 4E21A 4IXTA 3HE3A 3DWFA 3BMNA 4MKXA 4HFNA 3S1LA 2GASA 3VDRA 1HRDA 1D1SA 4FFNA 4BKRA 3KSDO 3FD8A 1ZK3A 4MP3A 5A9RA 4URFA 3K92A 2I99A 5U1PA 2QYSA 3L77A 1LDBA 2DTXA 2NADA 3PJGA 1Y8QA 2NWQA 4IIVA 1E1MA 1PJSA 3DZKA 4XRRA 5ICMA 1QYDA 3K31A 4Y6SA 4BMNA 1JA9A 1I36A 1NAHA 2BELA 1NHWA 2UAGA 2VWPA 3AI3A 5BR7A 2Q4BA 3O8QA 2ZYGA 1N5DA 2HK8A 4KUGA 1JWAB 2IDZA 4QQRA 1H6BA 3HN7A 1A72A 4FCCA 1PR3A 3TDKA 1DAOA 3LVFO 3JQEA 4CLOB 4FJ1A 4QT0A 2OBNA 3AFMA 1QMGA 5FF9A 1Q7BA 2IYOA 1PGNA 2IXBA 5COAA 1YDEA 2IZ1A 2NV6A 3BMCA 3UAGA 4CUZA 1XELA 1R4MB 3VH2A 2O50A 4J49A 2HLPA 5JMPA 3DBHB 3FRJA 4LVUA 1G1AA 3H9JA 2GPTA 4XYLA 2C0CA 5BNTA 4UUMA 4DBZA 4MINA 5JAMA 1E7WA 3RBVA 4K6CA 3I3OA 3JD3A 3HDHA 2P2SA 4KDEA 2PZJA 4EEZA 1RM3A 5FI5A 4M8SA 1HE3A 1PJ3A 3TSCA 4CMJA 4DUPA 4FSHA 1AGNA 3OQBA 5DNAA 1YJ8A 3D4NA 1GU7A 4HV4A 4ZGWA 3LT4A 3WYBA 2HKIA 1SEPA 2IEDA 2O3QA 3D3WA 3S2GA 1BGVA 3GMSA 4BNIA 2Q1UA 4CR7A 2BHLA 1KS9A 3PJDA 2FPIA 2Y1EA 3TF5A 1N7HA 2I3GA 4YQYA 4BUCA 2WE8A 2ZTUA 3PHLA 1VE9A 5A5EA 3Q9UA 3GN2A 2VHYA 5CEEA 4E4YA 3WMWA 1GUFA 3KETA 3RUAA 2BI8A 1U5AA 2IEBA 4LRSB 3Q2KA 1YE3A 3E9MA 3ICPA 5GY7A 5K6AA 3QJ5A 4J7UA 5U9CA 4OHUA 4L8VA 3TZKA 3VPXA 3BMOB 1DFGA 1ADFA 3GK3A 3OQ6A 5TQVA 5LC1A 4PLTA 5B1YA 3U3XA 4IQ0A 1NM5A 4ILKA 4ND3A 4Z9FA 4W99A 2WJPA 2JHGA 1LJ8A 2P5UA 4M54A 4TRMA 1DBVO 3EGOA 4HADA 5IJZA 1PGJA 1P3DA 3CINA 1LLUA 4AG3A 2F1KA 3H65A 2X8LA 4HNGA 5JO0A 4DA9A 1LLDA 3VH4A 4MP8A 1LXCA 4B79A 3S8MA 3EHEA 5KJCA 3H5NA 4J1SA 4YPOA 4CM4A 4HXYA 1PTJA 4IDAA 5L7WA 3GR6A 5DT9A 3MJCA 2VUTA 3WBFA 3ZU5A 3NRCA 3L0DA 1Y7TA 2I9PA 3GRKA 1NR1A 1F14A 4NQZA 3WGGA 3JQGB 5ENVA 4GGOA 3E82A 4AJNA 2Q50A 3KVOA 3DAGA 2FY8A 1K6JA 1NTOA 3KTDA 4MPDA 3HG7A 1HKUA 1HXHA 4XQEA 3A4VA 1IB6A 4D3SA 4YA6A 2NU9A 3NT4A 1HWYA 1GEEA 2ZQYA 4CMKA 4J7XA 3DBLB 3JQ8A 3ZWMA 2VOEA 3EUWA 3ZHBA 2CDAA 2HQ1A 4RZIA 1QV6A 3FSRA 1TXGA 2OP1A 5A03A 1LDYA 4FC7A 4I5GA 3TNLA 4CQLB 4PN3A 3ZV6A 1JQBA 3D1LA 3F4LA 2YQ5A 5CEFA 3DHEA 3LC1O 3OF2A 1HTBA 4YAGA 2FSVA 1IY8A 5B4VA 1PJQA 1GDHA 1UH5A 4R3WA 3GPDG 2DC1A 1BXZA 2NTVA 3GZNA 1MUUA 1H93A 4RQTA 4NJMB 3GF4A 4JN6B 1UXKA 4XDYA 2C20A 3WR5A 3HFGA 5MDHA 1QLHA 5DCWA 3O38A 1LSOA 1ADBA 2LDBA 3KM0A 4NU6A 3MTGA 1M6WA 4JCOA 2PH3A 4PLVA 1N1GA 4U6QA 2R2GA 1X0VA 3QWBA 2I65A 4EJ0A 4Z0TA 2WM3A 2VZ9A 4NBWA 4N5LA 2DBQA 2WSBA 1I32A 5DULA 3RUEA 2RH8A 4IJKA 4Z9YA 3WQSB 2CSUA 4DPKA 2PKRA 2NVBA 1ULSA 1NVTA 3INGA 2FR8A 1HDYA 1XYGA 5KTKA 2DVMA 4JX8A 3UHAA 4BNVA 3AJRA 4EUFA 2QX7A 4OO3A 4N54A 3F5SA 4KZPA 1LQTA 3QVOA 3HUDA 2OMEA 4ESOA 2PGDA 4XJSA 2PD4A 1X0XA 1Y1PA 3RUIA 8LDHA 3PP8A 1QP8A 2VYNA 2X9VA 3ETGA 1EE2A 1XU9A 4J4HA 4C4OA 2FR0A 1WNTA 3JQ9C 4B4WA 4J4BA 1P0CA 3S2FA 3FN4A 3VHRA 5C7LO 2CD9A 3FNGA 3RC9A 1KYQA 4ID9A 1E0DA 4UUOA 1YQGA 3D7LA 5ER9A 4OOEA 5A3VA 3D4PA 1HE5A 3GY0A 5A3JA 3RI3A 3QWIA 4QFCA 4D79A 4NG5A 4AICA 1NQOA 4XGKA 3RKRA 4KP7A 1GV0A 4YT8A 4CMCA 4XR9A 4NZ9A 4BNKA 4DPLA 2ZIZA 4ZVVA 3BHMA 2PZLA 4BV8A 3RWBA 3GNSA 1G0NA 4D43A 4TMFA 4AJPA 4FFMA 2YDXA 4C7JA 3QVWA 1JN0A 1A4UA 4XYEA 1XG5A 4ROSA 4MDHA 1TA4A 1ID1A 1HF3A 3WG9A 4JLWA 3RUCA 1CRWG 2RH4A 5IDWA 4XRGA 4GLLA 3ZNPA 3UCEA 2NACA 4BQPA 3UOGA 3K73O 4HUJA 3G17A 1C0PA 4ALMA 3LU1A 4PVDA 1JKJA 2CF6A 3FNEA 1QYXA 4FPXA 2WD7A 4E5MA 3DL2A 2A4KA 3SXPA 3UVEA 2X0IA 4JP3A 4TVOA 1GYQA 1W0CA 4LISA 2DAPA 1R12A 3A28A 1VLLA 2AQHA 2B5WA 3VPHA 3HWRA 3PIDA 4DXHA 4BNTA 6ADHA 4G5HA 1YRLA 2EW8A 3FPLA 2FRDA 2QZZA 5JLAA 4R51A 1B3BA 4XEHA 3PLRA 1SNYA 4R1SA 2CNBA 1MFZA 1PZEA 2WD8A 3PHIA 3LC2O 1T4DA 3DHYA 3CH6A 4WLUA 3D64A 1RYEA 3G3EA 2EP5A 3W4JA 5ICSA 1SB9A 4GX5A 4PLCA 3L07A 1P9LA 1Q1NA 4XIYA 4ZQHA 4L74A 4R1TA 1O5IA 3WQQA 4L73A 4CMIB 2DPGA 4RDIA 3RUFA 4E30A 4WLNA 3ZNOA 3ZU4A 4RVUA 1KEVA 1F8GA 5EMHA 3I4CA 1WWKA 2DUWA 2VYND 2Y67A 4HFMA 4MVJI 4ZHSA 1QLJA 3ONDA 4FJ2A 3C8MA 4J1TA 5EJ2A 4LN1A 3MZ0A 1ZNQO 1D1TA 3GDGA 4RPJA 1KVQA 1GZ4A 6LDHA 3GA0A 4J2OA 2YHIB 2VOJA 5DCYA 3E9NA 1E3SA 2YV1A 3K2BA 1CEQA 3WFJA 2W4QA 1LSUA 4D3FA 4GX2A 1LSJA 1G6KA 4NK4A 4CM1A 3S2EA 1BTOA 4LSWA 1WZIA 3NDIA 4R9SA 5ENDA 5C3MA 5IDQA 4IS2A 4NBTA 3U4DA 3NTRA 3VZRA 2QZ9A 4UVEA 1E1NA 3VVCA 4YWJA 1NXQA 4WNCA 1P77A 3C85A 2X22A 4FOOA 4FN4A 5A9TA 2D5CA 3PQFA 2XXJA 1HYHA 2VUSA 2Y1OA 4E31A 1DSSG 4WOKA 2C82A 2CVOA 4JBIA 3TL2A 1YQXA 1CJCA 2J3KA 3PLNA 2WDZA 3D4OA 4L0QA 4OH1A 3TZQA 1T2CA 4XB1A 1HL3A 1YKFA 4YT2A 1U4SA 3GMDA 3LQFA 3FWZA 2JFHA 3IUPA 1WP4A 4WGGA 3RQSA 2Q2WA 4CLDA 1UR5A 5BQFA 4Z3KA 4XYMA 4J1NA 4FBGA 3RCBA 2JAPA 2CF5A 3OBBA 4PZCA 3PK0A 2B35A 2OXIA 1LUAA 3OM9A 5BNFA 3MWDB 3ZW8A 5AVOA 3DONA 1E92A 1ZIDA 2YFHA 1DFIA 1EUDA 2XAAA 5ES3A 3NDRA 1PQPA 3FTNA 4J1QA 4A7PA 1UDAA 1AE1A 2UVDA 3P19A 2ZB3A 4D41A 5JAQA 2E49A 3L6OO 2CDCA 3EYWA 3CKYA 3W1VA 4ALIA 2WYVA 5CDSA 4Q3AA 1N8KA 1O8CA 1EK6A 1J5PA 2A9FA 3EVNA 5FFFA 1Z6ZA 3GFGA 2FPPA 1EVJA 5IZ4A 3D0OA 4M55A 3WWYA 2CVQA 2O3JA 5F21A 4X54A 4CLRB 1IE3A 3O9ZA 3DZBA 1J6UA 1SZJG 3VVBA 2P68A 4EUEA 1O89A 1R4NA 3DOCA 4RJTA 3WNQA 3KRTA 3PQDA 5EINA 3PEFA 4WJZA 4NU5A 1NVMB 2Q2QA 4K26A 2OO5A 4GSLA 5JY1A 1R0KA 2A92A 3BYZA 3HN2A 1T1RA 4E33A 3F3SA 1XQ1A 2JFGA 4JBGA 1H6DA 5THKA 4XDZA 3V1YA 4S1VA 1IUKA 1V3UA 3VH3A 1HE4A 1M76A 3NJ8A 2H6EA 3BA1A 3RC7A 1E1KA 1AHIA 3M1LA 4AJEA 4B8ZA 4JJGA 2FHSA 3KYCA 4MVJG 1I0ZA 1ISIA 4EUHA 3VC7A 1I3NA 4CODB 1NX6A 4BNLA 1CIVA 1V8BA 4NIMA 4IM7A 4I9HA 4K1LA 1BMDA 3B20A 1VJTA 4WEOA 5FYDA 3GUCA 3C7CB 1YH3A 2Y99A 4YB8A 4B3IA 2AQKA 1RYDA 1K3TA 3JTMA 3NEPX 5A05A 3IDSA 1ZBQA 1WW8A 3BTSA 2I5PO 4OXKA 4BNYA 1PJ2A 4W6ZA 5JE8A 5L53A 1L7DA 2B4RO 3H3JA 4J3FA 1E7MA 1KEUA 3U09A 3JQ9A 2Y66A 3JD0A 2EW2A 2C2YA 3AM5A 3NGXA 3H3FA 2X5OA 2NU6A 1E3WB 3M6IA 4IDCA 3RU7A 3SJUA 3T4EA 2D5AA 1DIBA 3DOOA 2PD6A 4RPHA 4Y8VA 4UEOA 2FN7A 5KJFA 4TWRA 2W2KB 5TT1A 1FF9A 4FFOA 1B2LA 5JDCC 5JO9A 3TN7A 1BXGB 4E5NA 1ISHA 2ZJ1A 3PJFA 2Y93A 3GN1A 2JKVA 5JC8A 4RDHA 4ND1A 4AJOA 1T25A 1LRKA 4PZEA 4J9VA 1YDWA 4LGVA 3W6UA 2PD3A 1CQJA 4EI2A 5JS6A 4FGSA 2VRCD 1JVBA 1ZK4A 1GQ2A 2IRWA 3VAZA 1P1FA 1O6ZA 1EUZA 4DC0A 3GVCA 3I83A 1NPYA 3JQFC 1CQIA 2YUTA 3LSYA 4JQCA 3X2FA 3H5RA 3QVTA 3V1UA 4R41A 1P31A 3E5RA 2J5KA 2JL1A 3NTOA 1FMCA 2GN6A 4AL4A 1QYCA 3MJTA 4ZQBA 5HS6A 4FOSA 5IN4A 2HRBA 1QXSA 4B4UA 9LDBA 1GADO 3GVIA 1W8DA 3C7DB 3O03A 4CLHA 3PIIA 2E48A 3GG2A 2ZYAA 3E5MA 2IZ0A 2PLAA 1AXGA 1ORRA 3HB4X 4QTZA 5JYEA 1VJ1A 4W7HA 4DYDA 1HE2A 3IKVA 4PRKA 4E2ZA 2ILTA 4OL9A 2NLOA 2PKQP 3AUSA 5A9SB 1B8VA 3JYOA 3SX2A 4DGSA 1LDEA 5A1TA 2VTEA 4J16A 1CWUA 4DIOA 2EJWA 4CQMB 2OFPA 1RM5A 4YRDA 1YXMA 3FF4A 4OKNA 1ZK2A 4N18A 1LBEA 1MP0A 3UCXA 4I5EA 1I30A 3Q3CA 2GZ2A 4WLEA 1K6IA 4XX0A 2FPGA 3GOHA 2QQ5A 3F46A 1ZO8A 2AEJA 3I6QA 4TRNA 1LU9A 4XQCA 3I5MA 5EQDA 5LDGA 5A04A 3ZU2A 4Z3DA 4BHTA 4HFJA 1NQAO 4IGFA 3WICA 3PRJA 5BSGA 5AXCA 1UXJA 2J3IA 1H2HA 3CXRA 1E3JA 1LX6A 5T8KC 3NDJA 4WECA 3UCFA 2DFVA 1U3TA 5H83A 2RCYA 3SLGA 4KQWA 1E5QA 1WMAA 4TSKA 3GUYA 1YONA 4XYGA 1PJLA 3DMYA 4YJGB 1NFQA 1I3MA 2FMUA 2TMGA 3T4XA 2DU8A 4XKJA 3QW2A 4CM8A 4Z6KA 3WGTA 1Y6JA 1BSVA 5IDXA 1EVYA 3Q1LA 2GD1O 2VYVD 4CMEC 1YBVA 1L1FA 4IQGA 1ENOA 8ADHA 2VWGA 3D3EA 2E6UX 3DQPA 2POQX 3WQRA 4ZQFA 4FC6A 1UZMA 3KOUA 3WGIA 1RM4A 1SC6A 1A5ZA 4PRLA 5JC1A 3KSZO 3ZDFA 2AE2A 3JSAA 3LT2A 3U4IA 4PVCA 3CMCO 1BVUA 1WDLA 4PLWA 1ARZA 2YY7A 3MJSA 4OXNA 5EN4A 3PHGA 2NTNA 3G79A 2Z1NA 2VWQA 4PG8A 3VPSA 1AHHA 1H9AA 3H9QA 2VZ8A 3WMXA 5ADHA 4DMMA 3BZUA 1VI2A 1FDSA 4BGIA 4D7AA 2O48X 4B4OA 3MOGA 4J0FA 2R6JA 4OAQA 4ZQEA 1WPQA 2ZCVA 2AE1A 1PZHA 4P4GA 3IP1A 4ZA2A 1KVRA 3EVTA 4XQGA 4CM9A 2NQ8A 3WXBA 4O1MA 4PLPA 4FD3A 1E5LA 1NFRA 5T67A 4RVDA 2RHCA 2DM6A 4WLFA 3KHUA 3T7CA 4CPDA 4YJFA 3RD5A 2I67A 3H6KA 1C0IA 2Y0CA 3EC7A 1U3VA 3JYLA 3RASA 4UEJA 1UUFA 4ZRNA 3AY7A 4BNHA 3RVDA 3K6JA 5A06A 5KNLA 1VSUA 1TEHA 3GG9A 4GMFA 2EIHA 1GEGA 4NHEA 3AI2A 5ILOA 4J7CA 1GR0A 2UV8A 1QRRA 3OHSX 3H9UA 1GTMA 1YB1A 1SO8A 3GFBA 1XEAA 2GN9A 2YFQA 4OGWA 3HSKA 4J4TA 3PDUA 3TPCA 3ZWAA 4RZHA 5ITWA 3A14A 5G4KA 4U0KA 5A4DA 4OSOA 1X1TA 2JFFA 3QVSA 3RFVA 2EHDA 1K0UA 1WAMA 4U5QA 3ZHXA 4F45A 5JMWA 4DLBA 2I3AA 1C1XB 4DL9A 1UDCA 2VHXA 3JCZA 4PG4A 4E0BA 2BMAA 1K2WA 1NQTA 3PHHA 4Q3BA 2HCTA 4DWVA 2IZZA 2UYYA 2QRLA 3H2ZA 3ZWYA 1A27A 3W4IA 4PLHA 1J0XO 1ISJA 5B12A 1DC6A 1FDUA 2ZTVA 1LA2A 2GNAA 3VKVA 3B6ZA 3DZIA 4Q9NA 4R5MA 4Y67A 2A94A 3LZ6A 4Q3CA 4M49A 2OGUA 3HNPA 4P22A 1E77A 4GH5A 1A7AA 1I5RA 3WDSA 5BSHA 3JQCA 2HRZA 3FNFA 4NFHA 4G65A 1T2EA 4Z9XA 1E6WA 3A06A 4BGVA 1FDTA 1N9GB 3KYDA 1U2DA 4JBHA 5B4TA 3JQ7A 4UVGA 3ANMA 4RVFA 4UVHA 4LW8A 4K6FA 3EZYA 4ZN6A 4JNKA 3FI9A 4DLLA 2GF2A 1I01A 2QHXA 2ZTLA 3JD1A 4CM9D 3ROKA 1TT7A 3EDMA 1Y8RB 4XWYA 5LDHA 4IDGA 4J43A 3JD2A 1B0AA 2VNAA 3PI7A 5G4LA 2PKQO 5ER6A 3OIFA 2AQ8A 2GN4A 1RM0A 4KTVE 2OL4A 4QO8A 4R1UA 4WNIA 4YAIA 2DUUA 3PWKA 5JNLA 4P38A 3MOIA 4JGBA 2WE7A 5JDCA 4GSKA 5T6BA 1SOWA 5IZCC 4WOJA 5THQA 1YGYA 2NU8A 1KERA 4M87A 2J3HA 3TOZA 4QUKA 1ZMOA 3ABIA 3KZVA 4BO0A 2B5VA 2CUKA 2AHRA 3R6DA 4K9DA 1HDRA 4ZRMA 3VZPA 3ZV5A 1KIFA 4WCFB 4YJGA 3DMTC 5F1KA 5G2OA 3U0BA 4YRAA 4FJ0A 3DZHA 5L4NA 1SCUA 3H7AA 1ISFA 2VCYA 4ALLA 2X6TA 3QRWA 2PWZA 4CM3A 2NNLD 3JQFA 4XZ3A 4P4LA 4WLVA 4U6SA 3PWZA 2Q2VA 1NWHA 1KVSA 1NAIA 3N74A 1ZK0A 4YBZA 1GYRA 5JDIC 1A4IA 4IQ8A 1SEVA 4CLOA 5JFOA 3DBRB 1JKFA 3W4KA 1X13A 5JXWA 3HB5X 5JYDA 1C1DB 3KLPX 3L4BC 5FEUA 1Z82A 3D5TA 3WBBA 2PNFA 1SBYA 3UKOA 3KXDA 1Y9AA 1EEHA 2VTDA 2J8ZA 1R4MA 2QW8A 3ADOA 2EF1A 1LQUA 3DC2A 3DBHA 5C37A 3MJVA 3U9LA 5AQ1A 2C5EA 2E37A 2Q45A 1DIHA 2P4HX 3L6EA 3C1AA 4LSMA 4IDEA 4EITA 4U0JA 3C3XA 3NX4A 3ZHYA 2JHFA 1P74A 2EP7A 2AEMA 3GHYA 2HAEA 4GBJA 3U4HA 4HBGA 1FJHA 2HJSA 3PVZA 4EEXA 1GUYA 3H8VA 4NBVA 2VHVA 3Q2IA 4DPMA 3VTFA 4TKLA 1JW9B 2X23A 5TJHA 3SC4A 1MX3A 1LNQA 1QR6A 4PZDA 2Z5LA 4WK6A 1BW9B 4D42A 1OOEA 1TLTA 1ZH8A 1GQYA 1MLDA 1UP4A 4J9UE 3AOEC 2O3SA 2CVZA 1HEUA 3M2PA 4JJIA 4E2YA 1ZKMA 2Q4EA 3CZRA 4TROA 1TT5B 4EZBA 4GVXA 4ND5A 2G17A 3JQAB 3QE3A 4IGEA 3K96A 4DLAA 1PL7A 1ISGA 4J2HA 3OJEA 2O3RA 4BNNA 1ZXLA 2BH9A 4N5MA 2X9GA 4KUHA 1C3VA 5JW6A 4FS3A 3RIHA 4BNGA 4F3YA 1M2WA 3UXYA 3BMOA 3TFQA 4L4XA 4YEDA 1MA0A 5I9LA 5JY6A 2E4AA 3U5TA 3PFWO 4YJDA 2IE0A 1XIVA 4CM7A 2ZATA 4BGUA 3AY3A 3RAJA 1B26A 4FQ8A 4Z0PA 3UICA 1YBMA 1YB4A 4GGPA 4ZJUA 5U4QA 2GDZA 4Z0HO 4YCAA 4L4SA 1NR7A 1UP7A 1K6XA 3RUDA 4LCEA 3DXFA 1C1XA 3RFXA 1DEHA 3SBOA 2W8ZA 2AG5A 2O3UA 2Y1FA 3E1KA 5F1PA 1YOVB 3EW7A 3ULKA 2BGMA 2FSSA 2D1YA 4RPKA 4IY1A 1M6HA 2J3JA 4MJLA 3TL3A 1HLPA 1Y81A 1IHYA 2Z95A 1K5HA 3WGZA 3PGXA 1GY8A 3QY9A 2B0JA 4YVFA 4TZKA 2YJZA 3H4VA 3LT0A 1EBFA 4LK3A 4R16A 3WGOA 3JQGA 1B8PA 2X0NA 5HA5A 5JSFA 4BOYA 1Y9EA 4Y9DA 5ITVA 2B4QA 2W2LA 1KEWA 3DZJA 3H9EO 3CPSA 4XD2A 3WTCA 5IXSA 1X14A 2JD0A 4IBOA 2Q1TA 1IOLA 4CLEA 1UXHA 3GNTA 1UAGA 5EL0A 1B16A 4KMSA 3RUHA 3GQVA 1Y8RA 3EAGA 1D7OA 2GN8A 3OSUA 3S55A 4MIOA 3I52A 4IS3A 3I1JA 1ISMA
chains in the Genus database with same CATH superfamily
2J08A 4ZTZB 1JDSA 3FROA 5D86A 1UDBA 4PHTA 4Q18A 2FE1A 2VP6A 1GFSA 1E96A 1N5JA 3I2YX 4QECA 3U40A 1YVDA 2HCJB 1S02A 2Z8ZA 4ZVKA 1OFUX 2H29A 4GZLA 1DJPA 1ZBDA 3LQQA 1T2DA 4F6RB 3LDHA 3S2YA 1DARA 3GEGA 1XD8A 2BKAA 2LTAA 1GN8A 2ZB2A 1OFCX 2W6ID 4FW8A 4RHCA 1TO1E 3OTQA 3AXTA 2H7YA 4KPUA 2G9VA 1WMEA 2Q6TA 1MX5A 2QN7A 1DELA 1KYYA 3AFNA 2RGAA 4NCNA 5K2MA 1ZITA 2WOJA 2AXPA 4AQDA 4AMVA 5JYBA 1G1MA 3LQYA 3E81A 4H1TA 2WK1A 4AB1A 4F38A 1RW4A 4F7WA 3EY4A 4UHFA 4KBFA 2WTXA 2LD4A 4Z7QB 1QHIA 1A0OA 1K5GA 4X7RA 1NFFA 3A70A 1T1SA 3IQHX 1U8FO 2RK4A 2L69A 4TV9B 1D1QA 1Y98A 2UUOA 4PYIA 4ZVNA 4ABYA 4Q3DA 3B1XA 3ONVA 4JQZA 4CJXA 5DNCA 1NRIA 1BN7A 5H81A 1D3AA 5C32A 5LXTA 2GZRA 4C7KA 2IY9A 2R66A 4FYYA 3UOAB 1A9QA 1V1RB 3R7LA 3OE7D 2VQDA 5IHPA 1XHEA 4Y98A 1SC1A 2JGLA 4UNPA 5CMLA 3C5WP 5C3UA 1VB3A 1USGA 2IXDA 3PD0A 4DQVA 1RYNA 4JI0B 2R8RA 1N0UA 1W2HA 4NS1A 3FA2A 2C7VA 4KIJA 4WZAE 4ZDWA 4B43A 1O9BA 2WUEA 4ESHA 4C3VA 1GA6A 3FGNA 5G0SA 3L8FA 2AK3A 2F6RA 1JQAA 1EDOA 4C6SA 1ZD9A 4CV2A 1Z75A 5IBCA 1OA1A 3GPBA 4B7CA 4OA5A 2V7BA 3NVKI 3QXCA 3DUWA 1QSGA 1RHJA 2H31A 4V2IA 1NJSA 5JATA 2PHZA 3EWIA 4UE2A 1JNYA 1Y9ZA 4EG6A 4QJ3A 3U6KA 3BULA 3DOIA 4JX9A 4E5KA 4EBFA 3IR6A 5JR3A 3OM0A 3MWEB 1G5PA 5TJ9A 4NR0A 3VBCA 4WPGA 3AX6A 3QUSA 2D8MA 3S2IA 2F62A 1MC5A 1VMDA 3DO5A 2QTRA 4N6OA 1DAKA 1RWQA 5HCIA 1SUBA 4ZIRA 1VPDA 1JG3A 1M6YA 3JVEA 1JAIA 3HTXA 1YZ3A 1PJZA 2RI0A 1XJ5A 3T7EA 4A73A 3SC2A 5I7UA 5I7VA 2UZ3A 1X8KA 2PYIA 3R4VA 4FMBB 1OWMA 4KLNA 1T36B 2EERA 3F4BA 2IP2A 4YUWA 2KM1A 1QBGA 5DOVA 4YP6A 3W5SA 2VNSA 1NSTA 5DHPA 4Q39A 5A7HA 3IQEA 1JDJA 1MVLA 4HYTA 1L5HB 5L4LA 3N0RA 3WMFA 3EMKA 4INOA 4JBWA 1X80A 3OU6A 4DDUA 2X86A 3F71A 5DBEX 4ALJA 3BWCA 4KBGA 3VXKA 5BWMA 2ERXA 4TQGA 2C8JA 5CM9C 2UVPB 1CR4A 4XIJA 3K8ZA 2WAOA 3MBIA 3ZWKA 1T1EA 2GFIA 4HQ6A 3VTAA 2JFUA 3AF5A 1NI3A 4B3XA 4ZV7A 1VKJA 1JG1A 3K9NA 1ZU4A 5JWHA 3VI4B 3W0LB 3GEPA 1CE8A 1XU7A 3AT1A 1YMUA 3CC8A 3SGLA 2VT6A 3AUAA 1NONA 2QRHA 3CA8A 4YJ2B 2FPMA 4Q9HA 4D44A 1T10A 4CFSA 5KS2A 1MW8X 1J0BA 3S4YA 3ZY2A 4E70A 4PO9A 1NL3A 4BJHB 1ZOSA 3L6BA 4LJAA 4E2WA 1VXOA 3D1VA 2AJCA 3Q6IA 1DAFA 4LV6A 1L7OA 4AP9A 5HUJA 1TRHA 3IIJA 5AM3A 4PC1A 4B8WA 1KBOA 5CFMA 2P8SA 2RHHA 1Z56C 4JP2A 2BF7A 1LPBB 3CNNA 4TPKA 3PS9A 5FP0A 2PRYA 1Q7EA 4JZYA 4BC0A 1XRLA 3GGPA 1LBQA 3ICWA 3ISTA 1X87A 3W8RA 4E2XA 2WEKA 3RKUA 3CR8A 5D3KA 2C5GA 3G8CA 2R86A 2V74B 4PM4A 5BQOA 3ZDBA 5F51A 1R4ZA 3P32A 2EP8A 4PQYA 4AZ3A 3JD4A 4D80A 2W8BB 1CY1A 1LK7A 2B21A 2C3UA 2C3PA 2EWVA 4RESA 1DXYA 4ZOCA 2HPHA 5JZMA 2ZYHA 5DM60 2V7QD 2X4LA 4BX9A 1ORWA 1NG9A 1K8YB 5A5FA 4RX1A 1RQPA 2YH2A 4MITA 1JP7A 4CMIA 5JAOA 1TTTA 2BTQA 2A5FA 1M0EA 4B3HA 1O97C 2GXSA 1UPXA 1ZRNA 4TN5A 3WL3A 2J3EA 1ULBA 2Q3LA 1I5EA 3LHKA 4ZU3A 3ROMA 5AJYA 4EK9A 3GLFE 2ID8A 5CGZA 4BO2A 4V0SA 1F4VA 4J3JA 5KTNA 1DCKA 2C97A 4FDVA 4PF1A 5CVUA 3ZK8A 3UMCA 2F3QA 4KHZA 3RC2A 4CDRA 2WMOB 2GZ1A 4GPBA 3IURA 3W2TA 2PVCA 4ENPA 5EJ9A 4PNEA 4OK3A 1DKRA 3OY7A 3UTDA 4CETA 3V1NA 3P20A 4BNFA 1J9GA 1A5BB 3TLAA 1TGYA 4P84A 4IH4A 4OFBA 3M5WA 4HH4A 1C30B 3N87A 4PZPA 3V4FA 1BJRE 1GD1O 3H5AA 4JENA 1NMXA 3HKDB 3H0KA 3AH8A 2JGRA 1ODJA 3ZWBA 1E7SA 4QBHA 5D7NA 3V8QA 4Q66C 1AXEA 3MTJA 4X7BA 1UBCA 4KR3A 1ICEA 4LNUB 1Z73A 3G1WA 1E63A 4EA6A 2H0AA 4JVSB 3L7IA 4B5KA 2ZRLA 3KD3A 4Q7LA 1JIVA 4FEAA 4RC9A 2FSVC 3OFSA 5LLSA 4F6RA 4B3CA 2QZJA 1RYYA 2EFCB 2PMFA 4EATA 1USVA 2Q4TA 5BVHB 2UU9B 1C4KA 5KSPA 5DWQA 4ZCIA 5GZ3A 5KIAA 1UCFA 5KDOA 3JV7A 3FWNA 2BV3A 1HDOA 1EQ2A 2GPJA 4ASUD 4B33A 1T5TA 2FA9A 3RROA 3ZD6A 3FSGA 4DLNA 3COSA 1FUYB 2FEXA 5TNXA 3PFFA 1DRVA 4GWGA 1P72A 2OORA 3EPPA 3K20A 4KQXA 3TQFA 4HWPA 2AW5A 4I36A 5BOVA 4AJ4A 4R54A 4DEYA 4RSGA 4JITA 2B1GA 2WG0A 3PTLA 2XYQA 5CG2A 1TPZA 2IPOA 4BO5A 3OKPA 5IT0A 2QEQA 4ACAA 4HC4A 3E8SA 1L5YA 1V1RA 5DK6A 1J00A 1NDUA 2ZI7A 4RL4A 1X1DA 3PR3A 4Y6LA 5CVCA 1JLHA 3T61A 5C18A 4P3KA 2C9YA 1MOPA 1V8PA 1ZISA 1XMOB 3MWDA 4B35A 4D4GA 1RWBA 1BCSB 1AQYA 3CHYA 2ZJ4A 4F96A 1GGFA 1NPDA 1UC8A 2GPBA 3PI6A 4QG7A 2QI9F 1IVSA 4IVNA 1FYVA 2DWOA 4A10A 1ODTC 2OLKA 4OMUA 1D6NA 2FDXA 2PGOA 1SQFA 2X6RA 4COKA 2F3RA 5F73A 1JHXA 2DPLA 5IM4F 1NYRA 5DRTA 4BRWA 1I3LA 3SZUA 3DXYA 3TQIA 5FWAA 1ESDA 1VJ5A 1V8DA 3I8OA 1G7CA 1BDMA 4BN5A 1KKLA 1ZJZA 3MWEA 1IZ0A 1GIAA 3RDPA 2FUNB 4YCNA 4GF5A 1CUFA 4KFSA 2YCLA 3KYIB 1KR5A 1T3HA 1W4ZA 4KWHA 4OHMA 3TQHA 5E3JA 3P9XA 1U2GA 2EAUA 2HREA 3IR7A 3ZH2A 4ITUA 3RUPA 1XQ9A 4Q4CA 3KQYA 3T9BA 2G1PA 3KO8A 3TNFA 1XCBA 4EVSA 5M34A 2IYPA 1E2HA 1QGAA 2XE6A 4RVNA 5SYNA 1TW2A 3RK0A 3B3FA 4EL5A 1LD3A 1RYMA 3I9LA 3Q5GA 5TQ0B 3EIWA 5FKJA 4ZCLA 1YJQA 3W77A 1L1EA 3LTNC 1C9NA 1NQVA 2ZT7A 3CNOA 3GZNB 4L95C 4QASA 5JS2A 2R1VA 1GTSA 1V2GA 3ZBUA 1M6VB 2D59A 3GLIA 1RMYA 3ENZA 4QFBA 5TV2A 3OC6A 2CMDA 3I9FA 1BXKA 4WY5A 5EXPA 2B82A 4I1VA 5LYYA 4YRCA 4AQ7A 3EFOB 3SZOA 3WNDA 1L7QA 2Z3ZA 2NTEA 3DLTA 3PXUA 3GP5A 3NOVA 4FNOA 3CNLA 4FFPA 5JJKA 3JQBA 2IHKA 3NC1C 4YJ2A 2IS2A 4MCIA 2Y6VA 4M53A 2BPOA 4R3UC 3RE1A 3SU8A 4XXHA 3TZCA 1NC1A 1OXUA 1M1YB 5CLJA 3ROZA 1ZN7A 2ANBA 2Y2VA 3NAQA 2KBFA 1XJQA 2WMYA 1KY3A 2FG7C 4CL8A 1KGSA 2R7KA 2RAVA 1C3OA 5KQGA 1GL9B 5A0VA 1ODKA 2CFCA 2QN6A 3NRBA 3UO8B 4H3SA 1YBHA 1GUZA 3MYYA 3THYB 1PQUA 5KVQA 4ND4A 2R8OA 1YZFA 2L2QA 3AY6A 3OIDA 5E6SA 1MVOA 5ENZA 1YS2X 3S6JA 1V3VA 2EGGA 2UXCB 3LT1A 3U80A 1RBMA 2EJBA 3W78A 5CDYA 5CB8A 3QX3A 1ZVMA 5IXJA 5DLQC 2J09A 2XYPA 3VHXB 2E4VA 2WSSD 2W8BA 1ZAKA 3A6JA 1ML3A 2RHRA 4GHWA 1FFYA 5AJUA 4HAOA 2C4UA 3PT9A 4DLWA 3HRKA 1MO3A 3B2NA 3GRPA 3QF7A 3TW0A 1K8QA 2ETXA 2NUTB 3TVDA 1YCDA 2HWXA 2YW9A 3OIVA 1EP3B 3UPTA 4GOND 1DT5A 4B7UA 3I9MA 4J03A 3QVUA 4F8EA 3RR2A 4W1QA 5L3VA 4EHIA 5JBNA 3QOYA 1W48A 4EUEA 1FFGA 1SBIA 2W6JA 3KQVA 4MS1A 1D03A 1V6AA 4JLSA 2ZUDA 3CE9A 3KPWA 2GZ3A 6CHYA 4EJSA 2PT7A 4ONEA 4MS3B 4V24A 2P0AA 4E09A 4YV0A 5ICGA 3NV7A 2QG9A 3P2IA 4FDUA 1RAFA 4MV3A 3URKA 3I2KA 2VHZA 1CUXA 4NZOA 1WG8A 3GEMA 2IL1A 1ISRA 4W9NC 1PF7E 2PRZA 4DY6A 4P36A 1C30A 1HYBA 1N57A 1VLJA 2C29D 3EDQA 2RHLA 3IEXA 4BNWA 3HK2A 1ZQ1A 1J42A 3ZHZA 1E89A 2TECE 4PCLA 1D2MA 3O0TA 1EUCA 4CV3A 2CJPA 5J9FA 2EXXA 3B70A 5IUKC 4GYWA 3CH4B 2JLBA 5FNVA 5HS4A 1NBWB 1WW2A 4TYNA 4LNUA 1Z7GA 2QTWB 2WBLC 5FPSA 1KSFX 4AN4A 4Y9TA 3MQ4A 2O2IA 3H0EA 1CF2O 5CNKA 3CZMA 4BMOB 3PPIA 1DBSA 2WD7B 3CJRA 3DE3X 1NXVA 2W2VA 1PNRA 4EKIA 3GMIA 2PXAA 1N2SA 4WBXC 2DY0A 3RVQA 4KO2S 5TEWA 1F4LA 4D9FA 3E9RA 1B1CA 4TKVB 5CDFA 1IEQA 5ALWA 3VYVA 2JFNA 2O1SA 4TMTA 3WNVA 1L6IA 1FA9A 2MWMA 4MDFA 2W48A 4EVRA 3CE6A 4DCGA 2JH8A 4F2PA 3UHOA 4BZQA 1DHRA 2GSDA 4Y0AA 4BFZA 3FFBA 3HKBA 4K6MA 4OA8A 5E4TA 5HF5A 4Q4JA 4ARZA 1AKQA 2PK3A 3L6UA 2MHCA 4E5UA 3C1UA 2OVFA 5FT9A 4ZOAA 5EP1A 3IILA 1JR4A 1SGWA 4BX3A 5B3JC 5J4YA 2QTBA 4R40A 1Q7TA 1F1BA 2BKUA 4F21A 1IHPA 3WS7A 1C0KA 1I8TA 2BZ1A 1P9OA 1T9CA 5LBIA 5D5QA 4QICA 3OESA 1YHZA 4MUEA 4DR6B 4CQMA 2RGRA 1NVUQ 3FCOA 1U1GA 2H1FA 1PWXA 1TTQB 2QROA 3NC0C 1MXHA 1DG1G 2NYAA 4P0TA 2O5CA 1M2KA 1MEJA 1PFGA 3I23A 1BFKA 1W1WA 2IVFA 2HLNA 4ND8B 4O2BF 3LXRA 1BCSA 2ENUA 3B6EA 4B47A 3HEAA 4D4IA 3HFSA 3K6KA 4DKXA 2AXQA 5LQMA 1F48A 5TRTA 2WJVA 4IVPA 1KYWA 2QGFA 4XVHA 1DIGA 2X8BA 4ZOLF 5BVGB 2I6FA 4K1XA 5L95A 5KAPA 1FYXA 1KY4A 4XIIA 1S8FA 5EYPA 1EJBA 4ARVA 4CV1A 1RKXA 2H4YA 1XQ6A 3TR0A 3OQHA 2WKQA 4BV9A 4XD7A 5ALPA 3GLSA 1RQRA 2ZIUB 3FUVA 3NIFB 4OXRA 4AC9A 2YDYA 3IJRA 1GGMA 3KQUA 2ZRIA 1IVNA 4M36A 2ACWA 4N12A 4PAOA 3WK9A 2XDQA 4RGBA 2DPHA 5DM0A 4OXIA 1GZ6A 1NVAA 2N9UA 3JAWB 1V37A 5C7OO 4G0OA 5EA2A 2YWGA 4MA0A 1S2OA 2YC4C 1FSPA 2AOWA 1M5TA 3H2YA 2PUHA 4E4TA 3O73A 1DZ3A 4L0MA 3RVLA 4E4RA 1VI6A 4XPIB 3DF9A 2G4CA 3IEVA 2FZWA 1ZM2A 2R4QA 2C2MA 3PL1A 3AU9A 1KJZA 2P7HA 4N7RA 1CVLA 3ZW9A 1P0FA 3T95A 4MVJD 2OO5C 3EXHA 1A1SA 1KKMA 2XD4A 3KZNA 2WHEA 4D8UA 2GYYA 3KLMX 3PENA 3OEED 1VL0A 3MJEA 4WFKA 1A7JA 1U1EA 1CYDA 2PFSA 3NHBA 4KN5A 2ODEA 2OZVA 3H3XA 4ZO6A 4ZYTA 3LF1A 5IK2A 2ANCA 3GFOA 2HB6A 3IS3A 4MKFA 3EFOA 4UM9D 2XGOA 1YA4A 5EIOA 3DP9A 4CU5A 2OCPA 5LQKA 3L6CA 2NTJA 4CGZA 1MO6A 3ILXA 4JQSA 4FP9A 4OJNA 4UHHA 1I13A 4WDQA 5JNTA 3G1UA 4L3WA 4WDRA 3UH0A 3A9SA 4B34A 5MGNA 3EPJA 1U0GA 2VRWA 1JH9A 4X63A 2HD4A 3BTUA 1C2TA 3DL4A 2A57A 3AU8A 4MCJA 1F06A 1N3IA 4NYIR 3SR3A 4QVIA 1B23P 1EFPB 1COWA 1C9JA 1YQDA 2CL5A 2B37A 3I09A 2MCFA 4HD8A 1DB3A 2IYEA 4TSFD 3QOXA 1W581 2ZKIA 1GZ5A 1DIOB 2Y1WA 1MV5A 1O4VA 5EAIA 4I1OA 1KY2A 5FWXB 3OD5A 1RKQA 4C0HA 3BSSA 1Z12A 3F9IA 3L40A 5J2UB 3TXAA 1LF5A 3P9QA 3PYLA 1IY1A 3ZZ1A 5FRDA 2KQUA 4CUKA 2MT9A 1B15A 1MQ8B 1Q0HA 3A1VA 2HRCA 3QEMB 4CT4B 3ONEA 4W5OA 1EFKA 1XLWA 2H00A 5LQJA 2J6HA 3LW7A 4A3SA 3RABA 1SZPA 1UWLA 4XFDA 4F7DA 3TSYA 4WADA 1LFDB 4MKHA 4M8LA 2GB4A 2ZIWB 3R5XA 3QW4B 3VC3A 5B58C 1LLCA 2O8DB 3Q7TA 3KDSE 4JSYA 4MVCA 3B78A 4PPQA 2HMVA 1VCMA 1AKUA 3ZV7A 5KNBH 5T5QA 3ETJA 5MN4A 3FNHA 1Z0DA 3K0AB 2P69A 2SCUA 2HMSA 4ARUA 2AT1A 2J9FB 3EVEA 2TMDA 2WU4A 4HDKB 4EI7A 5IAAA 3ZC3A 5KQSA 4B3SB 3IUNA 4LDNA 3AG6A 2AMLA 2FAXA 5FWNA 3OUUA 3A1CA 2IYZA 1EAMA 3VHQA 4H60A 3ND8A 3BIJA 1CF9A 2C54A 1ST2A 4FOPA 3ZV3A 3OAAA 3Q3GE 5BP7A 1ZXBA 5ALSA 1JPNA 4MWDA 1QK4A 3USZA 4Y2HA 4RZ2A 3SYRA 3WV4A 2FPLA 4AG5A 3H2JA 2P2ZA 3E84A 3I9JA 3AY0A 2CK3A 2GWHA 3KOOA 4WXHA 1AHPA 4BMXA 4MLZA 1GJRA 1ONOA 2QX9A 2JLAA 5DI3B 2MJLA 4O4JB 3PXAA 1XT6A 5C8VA 1FL9A 1W6UA 4ENVA 1KAGA 5BN1A 2QZPA 4K6GA 3EUFA 1GV1A 5J5VA 3BERA 1EXMA 1HDZA 2JIBA 2O23A 3DKRA 3E9QA 3LUPA 4HAWA 2F3TA 2X42A 3LOUA 2OUIA 3AVPA 4ZT4A 2ZI5A 5H3HA 3PU6A 1UMDA 4J90A 4AJLA 3QSYA 2GXQA 2O2ZA 1DCFA 3NIBA 4NZPA 3EDYA 2ZJ5A 1GAEO 1EUYA 2HHLA 1YZYA 4NNJA 4X71A 4D8YA 1DKUA 1Y89A 2HK9A 2ZUEA 2O52A 1ZH2A 5CLHA 5HTOA 2QRJA 3G59A 3P7MA 4OI4A 4H7PA 3ZE0B 1V2HE 3CZPA 1JZTA 3A4NA 3W7AA 2JLYA 5K0FA 1R5BA 4U7WA 1YKGA 1F20A 2CHGA 4P98A 2QRKA 3GH3A 1M0TA 4GZ3A 4H3HB 2GAFA 2ZRCA 4BQNA 4AYXA 3G23A 4MVYA 3PT5A 4OOFA 2PSHA 3QF4A 1L7MA 4G97A 5B1SA 4XWAA 3X1ZA 4D1YA 4EUKA 3T4PA 2O54A 3GO4A 3UB2A 3OA2A 4DC0A 1HT0A 2FOIA 3CNHA 7MHTA 5JCJD 2Y0DA 5KJ1A 1U7DA 4YRFA 3THSA 2Q6LA 2GN1A 2E3JA 2VDQB 1I2BA 2IVZA 3DJYA 1RE0A 3V2HA 3A3YA 2BMFA 1T2AA 1E58A 1HZZA 2OENG 2PH7A 3EF1A 5JISA 4JI3B 1H6CA 4QJBA 1YI8A 4RF5A 3VPDA 5I9NA 5AOCA 5E2IA 3UV7A 1YCGA 3GJ6A 1F12A 1XOIA 2B8JA 4IZIA 4P32A 5LB2A 4ZPJA 4DABA 1M1NA 1G9XA 1P7YA 1QIHA 4QAQA 2EJTA 3VO1A 2WU8A 4L3VA 1YZUA 3ACBA 3HDJA 4ZK2A 2DXIA 2I91A 1CQJB 3ZVRA 4YJHB 1CZUA 2NV0A 4JC0A 5B37A 2H2HA 4UFPA 4UAGA 3AQ4A 1BFDA 2IU6A 3JAWA 4JEIA 2PAFA 2ZU0C 3MRVA 3MUEA 4WQMA 3QFTA 4WCFA 2RGEA 2AMFA 3O26A 3UH1A 4AWXA 2BMVA 4TZTA 3FCSB 2JCGA 4CMGA 2FI1A 2EYUA 4P35A 5LKRA 3HYTA 4GP7A 2VQEB 1POXA 1GSAA 2N75A 1WMDA 3E9CA 4UTVA 3SIPA 2G8NA 5IG2A 3LLUA 2XGMA 2FW8A 5KWEA 2X4GA 4RV5A 1KJQA 1QF9A 1XE3A 1ZVKA 4XFKA 1K75A 2G83A 2O2GA 3RTEA 1JAYA 1M67A 5GQSA 1IBCA 1VPTA 2P5YA 2Y4OA 4LRYA 4RQUA 4G23A 3RLFA 4O33A 4DEVA 4F4HA 1UBGA 3ZGOA 1A76A 3DBRA 5BMOA 3BB1A 3J7AC 1E9EA 1LJLA 1UZLA 4JHLA 4AF6A 4AJKA 1J8DA 5DHTA 2WYOA 1V96A 3BIOA 3IC5A 4DNPA 1CZLA 3A25A 1IM8A 4IMJB 1RYFA 4DIKA 1CS4C 2R6GA 2ZBRA 1JLLA 4ZCMA 1NASA 4IJWA 3TIIA 3CF6R 1C7ZA 4RMNA 1C4OA 1N8TA 1W29A 1FDIA 2F7SA 2A7XA 4X64B 3GLIE 2ZRMA 4MKRA 3CZ5A 3FMPB 5K3FB 1E7RA 1SVWA 2JGFA 3H8WA 1I1QB 3JW8A 2IPLA 1EFPA 2ZB8A 4R01A 1JU9A 2NT4A 3ZGLA 2NO5A 3FLMA 3LLSA 1FFBA 3GFFA 4I1RA 1UAYA 3E7FA 3T9DA 4YXFA 1TKBA 3BHJA 5IVIA 3WB1A 3DW3X 3U3DA 4B7XA 1W0JD 1AKYA 1MB2A 2PSFA 2VH2A 3KHSA 3QPDA 5AVUA 1R64A 2BM1A 4ZI7A 4BP9A 5LP6B 1V8FA 4RENA 4G37A 3T5MA 5C35A 3DHNA 1G21B 5SICE 3SSAA 5J2UA 3WGVA 2O1WA 3BD6A 1ZW6A 4RZQA 3ZDQA 4F6LA 2QUJA 2JRCA 4B6SA 3M9XA 4RW0A 3U4MA 3OJOA 3V8PA 2WU0A 5IULC 1T5OA 4DV0B 1ILWA 4KFUA 4KR0A 3EQ7A 4I5DA 4KR2A 4BPRA 1KY5A 3D43A 1QYIA 1GPDG 1T5BA 3FYUA 3IOCA 1VDMA 1M5RA 4RMHA 2XMZA 3QIAA 1BWSA 1MRSA 2H59A 4U7DA 4BEWA 2AF3C 2JJMA 2WG1A 4Q37A 2EZTA 3AIMA 1ZCJA 4RA6A 4B4VA 4BU0A 4DGQA 5BW6B 2JDID 2QK4A 3FVTA 1MOSA 2PEZA 2JCXA 4H7FA 2OYSA 2Q27A 2RI6A 4EFKA 1KZGB 4WXYB 1KBQA 3M6WA 1WMBA 1KH1A 1LDMA 3DLAA 3IDZA 3FLEA 3N05A 1Z4KA 4PYQA 3QYFA 1MU0A 4I4IA 4L57A 2DLNA 3PPYA 4MIEA 3PFCA 3GLHE 1Y5MA 2BSQA 3OI7A 3MWGA 4ATNA 1RWXA 3KR1A 2WV9A 4NZZA 3D5EA 2HBRA 2IV3A 3I6IA 5KTTA 3FBTA 4IRMA 4UEKA 4G4SO 4S1WA 1D0SA 1UBUS 1Z7EA 3GD5A 4WKBA 3OFKA 3RVPA 3SBXA 3T5GA 3OCUA 4BVKA 3ZEIA 4QU8A 4QXMA 1QQAA 5BR4A 4Y18A 5I9MA 4QOFA 3INTA 4W8OA 1DBRA 1KXZA 1N2XA 4P7JA 2VI5A 4IXWA 4KGDA 2B8TA 2IDJA 2NXWA 5KCZA 3V4SA 2LZ0A 1X15A 1YBFA 2I1WA 2LV8A 4D5GA 2RK6A 1S3FA 3PFNA 1U7ZA 4CUJA 2G0TA 1OI2A 1IWBB 1H2RS 2P9CA 1TJ3A 1Z2PX 3MG9A 4FHFA 3QTTA 3WJ7A 2OFFA 2VYFA 5EIWA 4D98A 2EVWX 5DI3A 1Q11A 1HQCA 4O4JA 4P08A 4CV0A 4PPFA 4R98A 3V9PA 1OXSC 4B81A 1U2SA 2G7ZA 1Z6XA 2CL0X 2PKWA 1OIWA 4N8DA 1B6SA 1Q83A 1RU3A 1OLUA 1G3RA 1SIWA 3VR6D 4PSVA 1RLIA 1JQKA 4PR3A 3HDTA 1XMJA 1Q6YA 2VAPA 2C4MA 4Z0NA 1E2PA 3F6CA 4AJ2A 4K8RB 1NYLA 1Y7PA 4UBOA 1UKCA 2GM4A 3SSNA 2HHJA 1Z4IA 2Q6KA 5I7EA 1LTKA 3KOZA 2NZUG 3O31A 2X6QA 4YMGA 1Z3CA 3RIEA 4DARA 3NONA 2FB9A 1KETA 3LYLA 2V6MA 4CYMA 2Y0EA 4KACA 4H4CA 3RV4A 4OUDB 5TMBA 3UC9A 3W06A 2EQAA 3TBKA 4II2A 3M4NA 1ZUD1 1WW3A 2D4AA 2H5EA 2SKCA 3NJ4A 5C8YA 3F5FA 1I51A 1NN3A 1TCAA 3N6RA 4U2CA 3WHIA 1R0BA 4PFSA 5COQA 1JHDA 3BAFA 3EXEA 2H3HA 5EHZA 1XKQA 3DZ8A 1GXSA 3MTIA 5IK2D 1ZGZA 1ZHHA 4UZEA 3ELUA 3VDMA 1P1JA 1WKCA 1FP6A 2XYGA 1WXQA 2I71A 3ITDA 4NAHA 5AICA 5HMLA 4IXMA 5HIJA 3HADA 4E3ZA 1L9XA 1XZDA 3B9QA 3NHJA 1XQVA 1L5WA 1LZKA 2CZGA 3WIDA 2RJOA 1CYEA 5K1ZA 3STXA 2BFAA 4RACA 1JKIA 4RVHA 3WWCA 3GDWA 4F5EA 1WUJS 4L4RA 4UDNA 3PTAA 1GQQA 5JFTA 6NULA 1RWNA 4NI5A 5AI9A 1LTQA 2HJHA 1BVHA 2ZJ2A 3KEOA 1DEOA 2HPZA 1N5KA 1UFOA 3JQAD 3TQSA 1ES9A 1DDIA 4M1YA 4YIHA 4RTSA 4K81B 3RT1A 2EC5A 1OC2A 3VPGA 1VDZA 1G5QA 1TZ2A 2FSPA 4XIFA 3L1UA 3PEUA 4OGKA 3ROQA 1J49A 3EZ9A 4DUZB 2GK6A 3M4JA 4GPIB 4YJHA 1OFGA 2ZKLA 4WESB 2H5JA 4TT3A 4BNZA 3DULA 2Y1KA 1WEHA 1Z74A 1FRFS 2B4TO 3ADKA 2BEKA 5KWJA 2DFDA 4RS3A 5LCXA 1U0OC 4HP8A 1CY6A 1DG9A 3MUOA 4G0QA 2J5RA 1CDOA 3CF0A 2DQYA 3TB4A 2HRRA 1G55A 1HNNA 5KPJA 3ER6A 1KR2A 1LC3A 2XE4A 3UHFA 1KTIA 4TLAA 3P2YA 3VFDA 1CVRA 4B71A 5GZ1A 3P5SA 3PDCA 2QTFA 2O8NA 2QI9C 1TQ8A 2QQEA 2OCKA 2IXAA 3E27A 3PXXA 3O8BA 1OFTA 3X1KA 2ATCA 3WHPA 3ZK7A 1FMLA 1BRMA 4WMLA 3UFBA 2FR8C 1ZRMA 4OD0A 4IHAA 3MIIA 1P9NA 3LQ1A 4AKEA 4KHPB 4NMMA 1M2VA 3C1OA 5A7GA 3OUTA 1VSTA 4IWNA 1K2VN 1QCYA 4G9EA 3LX4A 3RJ5A 1JYSA 2QTMA 3ETNA 3VU8A 1QO9A 3LX8A 3T99A 1XVTA 1Q15A 3QBVA 4RVGA 2GEKA 2ZROA 2BIFA 5IJAA 1F6DA 1GTVA 2C9CA 2H85A 3C5HA 1TECE 4WLOA 1XAJA 4X95A 2A35A 4ZI5A 5C5IA 3OZWA 3QVXA 4RYLA 2JGDB 4TTSA 3KG2A 4CTKA 2QD5A 3L79A 5K3FA 1KHTA 1ZWKA 3IBSA 5AUPB 1QH1B 5D2CA 1UANA 2V6BA 1U65A 2D1SA 3B1KA 3F6EX 4F1JA 3T3PB 3VTZA 4DVJA 3FYTA 4MVJP 1XCGB 3DLPX 4O4LF 4PTZA 3TG2A 1DAPA 1XTRA 3EEFA 1IPFA 1GGNA 1XVLA 1PL8A 5EIFA 4UU0A 5IVPA 2B69A 2DQKA 1P80A 3DCYA 4RK1A 3W9YA 3JAKA 4A03A 2B4AA 1XK6A 2YVLA 5ISMA 2WKSA 3DCNA 1UKYA 1RJEA 2ISCA 4LBYA 5I8WA 2C9MA 4Z4CA 3MRXA 1XKLA 4O2LA 5KYUB 2B78A 3DWFA 3ORYA 2RONA 5H5JA 4FGUA 3S1LA 3SQXA 1YFKA 2B2CA 3OE4A 4G0YA 4LHXA 1HRDA 1D1SA 1S9DA 4P3XA 5JCOC 2WYHA 1PT6A 2AOUB 2B2NA 3BN3A 2ZSIA 3DE1X 3IEKA 4GMHA 4EO7A 1MQ9A 1U2TA 2EL9A 2HXYA 4K9NA 1GQFA 1GLNA 1UDRA 1RAEA 2ZJZA 4JLPA 4MP3A 4QOJA 2I99A 2QYSA 4URYR 3OU2A 2J5XA 1FVXA 1W5SA 2NADA 4L5AA 3ADBA 1Q17A 3DL7A 1NBME 3DKPA 5EZQA 3DZKA 1LS6A 1O96B 3RYIB 4ZJZA 1H65A 1RLOA 4OB7A 1SQSA 4H4EA 3HACA 1QCDA 2I6XA 3K31A 3HZOA 2B2XA 3EH1A 3T54A 1VPLA 2DPMA 3AI3A 2Q4BA 4FTWA 4NCHA 4R8RA 1H22A 4UMVA 2ZCJA 2EYQA 1N5DA 1V26A 2F3UA 4PZAA 2HK8A 4KUGA 1JWAB 3HJFA 3B1YA 2IOFK 3C6BA 3OOWA 1J24A 2J0UB 2V0NA 2HSZA 2XB4A 3NU1A 1KI6A 3KZ1E 3DD1A 3LBAA 4L7VA 2PWPA 3JQEA 3TAHA 3IELA 2OBNA 1H0HA 5DYTA 1MCZA 4QYIA 4O1IA 4PNPA 1J21A 3K9CA 4L5CA 1PGNA 4FEEA 3TW4A 3U4QA 5IC4A 1M1UA 2V3WA 1LPSA 4CUZA 2QUBA 1RI5A 3AESB 3GCGA 3VH2A 4OLJA 2N42A 4RHFA 4AZSA 1DV1A 2WA1A 3SEZA 1H3FA 1CY4A 4PX5A 2GPTA 2HA7A 2R6DA 3GT7A 2P90A 2VDKB 1RRGA 1FUEA 4S12A 4DBZA 4KXFB 4E08A 1WB9A 1UK8A 2RC5A 3EFHA 1AT1A 4M7PA 1ZLYA 4K6CA 2IXTA 4ZZ0A 5LYJB 1KU6A 2ZETA 2GRJA 2YJ4A 4M8SA 4DG8A 3QKSA 4X65B 1JFFA 1FSZA 1PJ3A 2DETA 3LQ4A 3N3BC 3T06B 4DG5A 4FSHA 3OQBA 1FW6A 4KVZA 4BASA 1AO3A 2C3OA 4ROTA 2HKIA 1SEPA 2REXB 2O3QA 3CG0A 3E0XA 1TIBA 1BGVA 4I19A 2V54A 3DMHA 1T6YA 2JFQA 5KOHB 3F49S 4EGAA 5BXQC 3PJDA 3OTGA 1RP1A 1IU9A 1L3IA 4HAXA 1IONA 3ZVLA 3P0JA 1OYOA 1ABFA 5ESWA 4BUCA 5BSMA 3Q9UA 2VHYA 2WJIA 4Q6WA 1PT9A 2Q6OA 4IAOA 4O1HA 1Y6RA 4WINA 3T4UA 3KQOA 1WUIS 5ICCA 4C2UA 4MMYB 1YMVA 3LT5A 2NGRA 3PBKA 2AZDA 1UZAA 4IMIB 4Y2TA 1QKKA 2XUFA 2VJNA 1QHXA 3GJ7A 1V1MB 3KJGA 5BQ5A 4BE9A 3SNHA 2WTAA 4J7UA 1YZKA 5IF9A 4MVWA 1XAIA 3ID6C 1T0UA 5IANA 2WWTA 3JWEA 1QVAA 1FFSA 3BL8A 4L8VA 1PHPA 3BQNB 5NLLA 3NMUF 3RS7A 3FPKA 3GJXC 1BAPA 4FOTA 1ODFA 4DANA 2DPYA 2RBKA 3B5JA 3GK3A 3KWMA 1N34B 4J29A 3P2KA 5TQVA 3QLUA 1NURA 2XZDA 3M6MD 4IQ0A 2JCSA 4WESA 2CKDA 4JAVC 1H2EA 3COWA 3LKDA 2IYFA 2QVGA 2QQ0A 3TEMA 3W79A 4D4JA 3COYA 1W36D 3WLQA 5KYYB 4G0UA 1Y1KE 1PZMA 1RZVA 5GOZA 3SICE 4BX8A 3BXOA 4EY4A 1DBVO 2WU3A 4KGXA 1KI2A 1WTCA 1HT1E 3E3LA 3SC3A 4CDNA 1OBHA 3CINA 1LLUA 2YRFA 3IMCA 4MRMA 4DBLE 3H65A 5E6RB 4DQLA 2HBYA 5IC5A 1HL7A 2VEDA 1V16A 1J0EA 3EDOA 5AR1A 4A15A 5FBVB 3NGMA 1LXCA 4B79A 2XUHA 3S8MA 1TO2E 3FNQA 1QNFA 5DO9A 1JMYA 1Q1QA 4TTTS 5AM1A 3B3GA 4AECA 4HXYA 3R7AA 3E3NA 3E3MA 3GR6A 4N47A 3T5AA 5H4HA 3WBFA 4O25A 1TM4E 1XZJA 5JI3E 2J9GA 3IVCA 2VBGA 3B5EA 3EAQA 5K4HA 2CEAA 5FL7A 3RSOA 1CQWA 3HUTA 2PWAA 1ZQ9A 3JQGB 4JSTA 4EYSA 3B3QA 3HRIA 4Q7QA 3I2GA 4GGOA 4BFWA 5BUSA 3KVOA 2EKDA 4E7PA 2GCNA 3OZFA 5CH3A 4C0WA 4N76A 5KC8A 1NTOA 1T8PA 3KTDA 4MPDA 1TL7C 1HKUA 4TUYB 2NO0A 4F3KA 1DBIA 2QAGB 3LDFA 5JI2E 5M7EA 2QDXA 3CLRD 4D3SA 1O7JA 1UK6A 4MR9B 4TXNA 4W6QA 3GFPA 1A7UA 1D2AA 1OUMA 2C58A 3IQZA 2HWUA 4P58A 4QEZA 4UTOA 4CMKA 4REOA 2FF5A 3JQ8A 4MI9A 1DINA 1RJDA 3GJ0A 4QELA 1XZEA 4ZK6A 3RYHA 5CB4A 5K3AA 4QWWA 4JVMA 4FC7A 4QPDA 4MUMA 1CUEA 4PN3A 1IBLB 2ZYUX 4DLTA 1X94A 4P5PA 1JQBA 1SQ6A 2GKSA 3DHEA 1PFVA 1GP2A 2A5DA 1ZGGA 1NLZA 2FSVA 3FDXA 3QOFA 1PJQA 4R3WA 3PNPA 4K6OA 2ZSJA 1YJAA 3GPDG 1BXZA 2NTVA 2IX9A 1MUUA 3B51X 4PGMA 5DTRA 4NJMB 3GF4A 4JN6B 2C94A 1VMKA 2MSEB 1QLHA 5DCWA 1ZA1A 1GKLA 3O38A 4CEJB 4WZZA 1OGIA 1LSOA 1NKTA 1M6WA 4B7AA 2H57A 3JXEA 2OFWA 4HN9A 3RYIA 5EQTA 2OKCA 2F8LA 5LA6B 3ZI7A 3KSBC 3J7TA 4ZAFA 2X3UA 4U5XA 5EJAA 1X0VA 3QBTA 2I65A 1OSNA 4X41A 4RNCA 5FV7A 3DHWC 1R50A 1LBIA 2B30A 2GF9A 2YIDA 3NBKA 4YI3A 2OQVA 4BFYA 5I7WA 1B1AA 3K0SA 1SKAA 2JFZA 3BRWD 1KMCA 2WSBA 1TGVA 2VBCA 3RUEA 4C0AC 2GD6A 2H2DA 4P5EA 4IJKA 2X2PA 2R79A 4Q6BA 4Z9YA 3N0VA 3LUJA 3A3KA 1EB9A 1BGXT 2XCQA 2IYUA 5EGSA 1HDYA 4N03A 5EHNA 2C7QA 1WKVA 1IUPA 2VF7A 5IMBA 4HQKA 5KTKA 3AJRA 2QX7A 1SKYB 3WL7A 4FGKA 1XI2A 3KE8A 1Q0TA 3F5SA 3OFVA 4KZPA 2GEBA 3AESA 1QC5A 1WZCA 3QVOA 4MARA 2UYQA 3DMDA 4MYHA 1XNJA 1GT6A 2IYTA 3H5WA 2CFRA 4HH0A 3RTBA 4D4MA 1QHYA 4ESOA 1WZ2A 4LDZA 4DLUA 4Q34A 5HOQA 1ECGA 1QONA 2G04A 4AT1A 1UEIA 4MRPA 4G5YA 5AW5A 3U13A 3G89A 5JU6A 1WQ4A 5JLJA 5LYJA 3VHRA 5C7LO 3R76A 3V6MA 3R6LA 2AG0A 1KYQA 1JZSA 1E0DA 1M0SA 2GCEA 4NOJA 3F6RA 5AM5A 3RV3A 3RI3A 1D5WA 1DXQA 3QWIA 4RY2A 4X93A 3H5OA 2CBZA 1VOTA 3OJCA 4QUDA 2HQOA 4CMCA 3GGJA 5JJBA 2Z09A 1VYHA 5KOHA 1I6MA 3KHTA 1G18A 121PA 1FCJA 1I4TD 1N3YA 3EVGA 3ODPA 4NZ9A 4ZVVA 3S40A 4YP7A 4U7FA 2G88A 4MUJA 2OFOA 2P2YA 3QMPA 1NUPA 1A4UA 2HLDD 5HSGA 1EGMB 4ROSA 7GPBA 2IOQA 3M3PA 4TQUS 1EHCA 2G9ZA 3KB1A 1OWOA 3DWGA