3ZHBA

R-imine reductase from streptomyces kanamyceticus in complex with nadp.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
289
structure length
288
Chain Sequence
EHTPVTVIGLGLMGQALAGAFLGAGHPTTVWNRTAAKEPLVARGAKSAGSVAEAVAASPLVVVCVSDYDAVHALLDPLDGTALQGRTLVNLTSGTSAQARERAAWADGRGADYLDGAILAGPAAIGTADAVVLLSGPRSAFDPHASALGGLGAGTTYLGADHGLASLYDAAGLVMMWSILNGFLQGAALLGTAGVDATTFAPFITQGIGTVADWLPGYARQIDDGAYPADDAAIDTHLATMEHLIHESEFLGVNAELPRFIKALADRAVADGHGGSGYPALIEQFRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords R-IMINE REDUCTASE
publication title Structure and Activity of Nadph-Dependent Reductase Q1Eqe0 from Streptomyces Kanamyceticus, which Catalyses the R-Selective Reduction of an Imine Substrate.
pubmed doi rcsb
source organism Streptomyces kanamyceticus
molecule tags Oxidoreductase
total genus 101
structure length 288
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zhbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zhbA01
4ZHSA 3DMTA 4ALKA 1LLUA 2JAHA 3GC6A 3KRTA 4BNMA 2HLPA 1E7RA 2HO5A 1PL8A 2FSVA 4CM9A 2EP7A 3WB9A 4JLWA 3K30A 2DU8A 4RQUA 3NGLA 3DHEA 3KYBA 4YJGB 3U4CA 4DBVO 1E7QA 2CVQA 1B8UA 5KJEA 2PY6A 1A27A 4GX5A 4IIVA 1XKQA 1L7DA 1TT5B 1MG5A 4ZGWA 1MG0A 4Z0PA 1H5QA 1VJTA 2YW9A 1XA0A 1O8CA 2GNAA 1EQUA 1PJCA 2IDZA 3BXXA 1XSEA 1DBVO 2H1SA 1C1XB 3MJ4A 4G65A 4HWKA 3U9LA 1FDVA 2FSSA 4XDZA 3PJEA 4P8RA 3RU7A 3WQRA 1SBYA 4KOAA 4HFMA 3CEAA 3DBHB 4PRKA 5FF9A 5T5QA 3O9ZA 3HFSA 2VWGA 4FW8A 4PLZA 4B7CA 4NNJA 2IYOA 4OXKA 2ZB8A 3P2YA 2X8LA 2B4QA 4II3A 3FWNA 2X7HA 3D3WB 3QVOA 5ES3A 3DZJA 3KUXA 1ISJA 1WPQA 1QRRA 2HMSA 2C59A 4TKMA 4TSKA 3D4NA 4XKJA 2Q1SA 4YJDA 3F1KA 4EJ6A 1NVGA 2P68A 4PRLA 2JJYA 2WYUA 1NAHA 2NU7A 2P4HX 4TQGA 5TT1A 3ZHYA 4XYLA 4I9UA 3LLVA 3ZN2A 4PLPA 3AI1A 3IC5A 3NDRA 5JCJA 3I5MA 5B4VA 1CRWG 2EKQA 4CQMA 1ZK3A 4M89A 2V65A 3VTZA 1U1IA 1NQ5A 1V9LA 4BIIA 1W8DA 5JAZA 4BO4A 3JQ6A 3AFMA 3PZRA 4FFPA 3QY9A 4BNUA 1NR1A 1ONPA 1GZ4A 2JCXA 4IMRA 3F3SA 4IZHA 4M55A 3QW2A 1W0CA 1HDOA 4BO2A 1WLYA 1JKFA 4OYRA 2QRLA 4B3JA 4D46A 5JS6A 3JQ7A 3WYCA 2BELA 2ZQYA 4ALJA 4CM4A 1P1FA 2ZKLA 2VCYA 2H63A 3FR7A 3DOJA 1P1JA 5ENVA 3UF0A 5JDCC 2YFQA 4BKRA 5AQ1A 5HWSA 3V8BA 4WCDA 5EL0A 3E9MA 1PJTA 1E3JA 2VWQA 2OHXA 1OC4A 2Q1WA 3L9XA 4N5LA 4RZIA 2B35A 3D1LA 4FR5A 3INTA 1PS9A 1U9JA 1E3IA 4BUCA 2QRKA 2R00A 1HETA 3JCZA 3TDKA 4IQ8A 3ONFA 1PJ2A 1U28A 1RM5A 3AI2A 1V35A 4KZPA 4QQRA 1XELA 1SB9A 5THKA 3KETA 3HG7A 3B70A 2QZZA 3BHMA 2D5CA 3VVBA 2R2GA 3GHYA 4IQ0A 4CM5A 3NT4A 3VZPA 5JY1A 2OL4A 2O3UA 3M1LA 1X0VA 5CDUA 2P4QA 2PKQP 1QYVA 1XQ1A 1ZW1A 1C1DB 1M2WA 4YJHA 3OECA 2OP0A 3CUKA 2VZ0A 3RU9A 4XYGA 4NZ9A 5CDGA 4YT4A 4HNGA 1H93A 4R5MA 2X9VA 3T7CA 1ML3A 4PVCA 2YHIB 4LW8A 3WGIA 1IOLA 2Q50A 1MX3A 4B7XA 4CUKA 3WGTA 3AY6A 3RUDA 1B3RA 1SEPA 2D4AA 2PNFA 1Y7TA 2PZKA 1F8GA 1EVYA 1YQXA 2DC1A 3GNQA 4IGFA 4BO6A 2X0RA 1G0NA 2O2YA 3FPLA 4IDAA 4ILKA 3JQGA 4EUFA 1JVBA 5MDHA 4CMIB 3V1UA 2GYYA 4B3IA 4FOOA 2PH5A 1WW8A 1CQIA 3GRPA 4MVJD 1HSOA 1PSDA 2RBEA 2Q4EA 1YDWA 2HKIA 4B8ZA 5IG2A 1X13A 1LUAA 4NU6A 1GPDG 2NU9A 3JSAA 1VL6A 3STHA 1V3TA 3AU8A 4R1SA 3PWKA 1ZK1A 1VKOA 2C82A 4IS3A 2A9FA 2NNLD 5L4LA 4OH1A 5DOZA 1PQWA 2NSDA 1M6WA 2EKLA 1A9ZA 1Y1PA 3GEDA 3MJCA 3R0IA 1LTHR 1ZH8A 5IDYA 4HKTA 4E2XA 2UV8A 5T6BA 3DL2A 4EUHA 4YJGA 5CDYA 3EZYA 3L6EA 1MLDA 4UVHA 4CQLA 1EMDA 3OQ1A 4U6SA 1PQPA 2DBRA 2VQ3A 4A5OA 2IZ0A 5KJCA 1TT5A 1AGNA 1MC5A 3A4VA 4H16A 4JNKA 3IQDB 1QV6A 2JCVA 4XYEA 1C1XA 2Q2QA 3DBRA 5GMOA 2RHCA 2AHRA 5G0UA 3G79A 3WTBA 3IMFA 3DBHA 2PD6A 5DP2A 1K6XA 4CLRB 2Y1CA 3VTFA 1U3TA 2IEDA 1NWHA 3O8QB 2EW2A 4OL9A 4TKLA 2G17A 3D3WA 1ISGA 3HSKA 5KJ1A 3NRCA 3WLEA 1P45A 1WZEA 2Y1DA 2GO1A 1A9YA 1E6EA 2ZATA 1EQ2A 3TOZA 4YRBA 1U3UA 3OJOA 4MDHA 5KNLA 4FQ8A 4F46A 1GADO 2GN6A 1ZSNA 3JQBC 3ZZNA 4R01A 3AM4A 4BNXA 4OIMA 3ZWBA 4R1UA 1DIBA 1ADFA 1NFQA 3G1UA 3OSUA 2ZB4A 1A4UA 9LDTA 4BNNA 1OBFO 5L45A 3JYOA 1LQTA 2AW5A 3I9JA 2GZ2A 1A5ZA 3Q6IA 4XQEA 1PZFA 1T2EA 2NQTA 4FCCA 3PJDA 3DAFA 2B5WA 4ESOA 1ENOA 2D0IA 3DAGA 4GL4A 1TXGA 1DC6A 3INRA 3WGQA 3GZ4A 3AW9A 2J5KA 1Z74A 2VZ9A 3Q3CA 5TC4A 4KQXA 3S2GA 3LSYA 3JQ8B 4A2CA 2PD4A 2Z1NA 3C1TA 3I9OA 3KYDB 5TJ9A 3VPXA 2WTBA 3SX2A 1M67A 4GLLA 2VHZA 3LC7O 3H5AA 2HRBA 4CM8B 2VUUA 1IY8A 3ZV5A 2PGDA 4CR8A 4Q3EA 1QMGA 5A02A 5L40A 1LJ8A 3OA0A 3I23A 4QX6A 1I32A 2G76A 4LN1A 3NV9A 4UREA 1NHGA 4FD3A 3EK2A 1XYGA 4YQYA 4IS2A 4R9SA 3AY7A 2C20A 5B4UA 4RVGA 3DZGA 3NAQA 4L4XA 3U5TA 4QECA 2AE1A 2VTEA 3OQ6A 3GA0A 1QORA 1PS0A 3AUSA 4EW6A 4MOWA 4MVJM 3QVTA 4OXNA 4DQXA 4AJ1A 3RAJA 1JN0A 5EJ2A 4JN6B 4E4YA 4ND5A 9LDBA 1WXDA 1DEHA 2X6TA 4IUYA 3OJ0A 4BNGA 4HFJA 2ZIZA 1C1DA 1E6WA 3OP4A 4IDGA 1O89A 1UZLA 1N2SA 2PKRA 1SCUA 5CDSA 2ZTLA 1VJ0A 1LA2A 3TSCA 1JA9A 4R16A 4L75A 4CMAA 2YHIA 1GR0A 3FBTA 1N1EA 3F9IA 1NBOA 1P1KA 3M2PA 3BHIA 4YT2A 1G0OA 4RLHA 4B8WA 2J3JA 4JBHA 3AK4A 4L74A 4XQGA 4H15A 1B0AA 1RM4A 3B1JA 1ZSYA 3OMLA 4CMIA 3LF2A 4D45A 2O3QA 3DDNA 1YBMA 2X0IA 2JAPA 3HUDA 3P2OA 4NBWA 5HTOA 1VLLA 4AJLA 1X1EA 3SEFA 4GI2A 2Z1MA 4RPHA 4K6FA 1KC3A 2IE0A 1NX6A 4YRAA 4OMUA 1C0KA 4E12A 3I52A 3N7UA 4TROA 1XEAA 2QYSA 5KCZA 4J4TA 2IXAA 1LI4A 3A1NA 5EPOA 3LT0A 4NIMA 1ADGA 1NVMB 5KVSA 5HS6A 2PZJA 4BKUA 3GY0A 5T67A 1T4BA 3JQDA 4J90A 4WLOA 3PQFA 1EUCA 5TS3A 3SBOA 4CM1A 1Z6ZA 5BT9A 2DKNA 3KLPX 3GPIA 3GT0A 1AUPA 2JD1A 5JLAA 5EN4A 4IDBA 5AXDA 2X86A 4QO7A 4L4SA 3GK3A 3NTQA 1ULUA 4TMFA 2NM0A 5I9MA 4RGBA 3BTVA 3ZV3A 2YFHA 4FJ0A 1ISHA 3K2BA 4Z9XA 5JO0A 1I30A 1JTVA 4GBJA 1KETA 1DO8A 4W6ZA 3VKVA 4ZN6A 1DAPA 1IPFA 4TRRA 1ZIDA 4I9NA 4RZHA 1HYHA 1LEHA 1UUFA 1XG5A 2HMTA 4CLRA 1LSJA 4QTZA 3S2EA 4IINA 3KBOA 3O8QA 3RUAA 1RKXA 3TZHA 2RCYA 2Y66A 4CMHA 2VT2A 2JKVA 3KSDO 4F3YA 4E0BA 7ADHA 2A35A 2OP1A 1VPDA 3DHNA 4LSWA 3GUYA 4UUNA 3DMTC 3GN1A 3TWOA 3TZ6A 3ZU2A 3W8EA 3KV3O 3IS3A 3KEOA 3L0DA 4NQZA 1XR3A 2UVDA 3HDJA 1HYGA 4P22A 5JC8A 5A9SB 1KBZA 3PLRA 3QQPA 4DQVA 4PLTA 4GAEA 2E48A 3P7MA 3PXXA 3GUCA 4MPDA 1CERA 1WDKA 4FC7A 2EP5A 4EJMA 4RF4A 2VZ8A 1M76A 4FOSA 4PGFA 2YYYA 3FNFA 2V6BA 3NKLA 4W7HA 1LDGA 4JP3A 2OXIA 5DBFA 4CV1A 1DSSG 1NPYA 8LDHA 4BQPA 3H9JA 3JD2A 3KLMX 1Z73A 1I01A 1LDEA 3VPHA 4Q3NA 3VAZA 1SPXA 3RC7A 1KVUA 3ETDA 2EERA 4CV3A 3JQ8A 2I6TA 1U3WA 3KYDA 4WASA 5DN9A 4BHTA 4MVJI 5L53A 1EDOA 3KVOA 5AXCA 5KOIA 3RUIA 4TRNA 1YB5A 4CM8A 5IZCA 1EUDA 1WDLA 2SCUA 4KTTE 5I7EA 2POQX 2O7QA 3LYLA 4II2A 4R51A 1DAOA 3ZH2A 3CE6A 4DBZA 1KVRA 4DC0A 2HMVA 3H7AA 2X58A 5IFLA 3I3OA 3VOSA 3RUCA 2FWMX 2J5RA 3U62A 1E7YA 1NPTO 2GPTA 2WDZA 4OGWA 1ENZA 4GKBA 2A4KA 4Y9DA 3EVTA 3DWFA 4FC6A 4BNYA 4D42A 3JQAD 2I99A 2EXXA 2NWQA 5BSFA 1BWSA 4IM7A 3FR8A 1EVJA 3K9QO 4NU5A 5TT0A 1UR5A 3NDIA 3G1TA 1EE9A 4K6CA 2HDHA 3HADA 2C54A 4JP2A 2LDBA 3H4VA 3V2GA 1Y9AA 2VWHA 4GVXA 3NT2A 3E9QA 4YDRA 5JAQA 4CMEA 4RVUA 3U09A 4YB8A 2W4QA 1G1AA 4I5EA 3D7LA 5A4DA 2G5CA 1RYEA 5DP1A 2NACA 3JD4A 4BMSA 3OICA 1R0LA 4G5HA 4JXKA 3WX0A 1MFPA 4N7RA 3N58A 3U4IA 1D3AA 4J1QA 3JYLA 1GPJA 1EK6A 2R00C 5HS4A 5IF3A 2DPHA 2V6MA 1ADBA 1F8FA 2G0TA 4OOEA 3GG9A 4OAQA 2BI8A 5ER6A 4WOKA 5KJFA 2CF5A 4ALMA 4RF5A 1UP4A 3K96A 4N54A 4P4GA 4URFA 1N7HA 2CDAA 3H9UA 3ZI0A 3E8XA 1GFSA 3K8ZA 4LVCA 1I2BA 1JW9B 3HB4X 4AJOA 3MTJA 4BMNA 4IGEA 1MFZA 2AQ8A 2E6UX 3S2FA 3OJFA 3IL2A 3LU1A 5DCYA 2DT5A 2BHLA 2IZZA 3GNTA 1CQJA 5A9TA 1CDOA 5B37A 1I10A 3PRJA 3DAPA 4ZQHA 4NI5A 2AEFA 2FPGA 1GUFA 3DB2A 1DJNA 1PJBA 1W73A 4IPTA 3CPSA 3KXDA 5JBIA 3ETGA 4UAGA 1BXKA 1PWZA 2BD0A 4GX0A 2ZTMA 3RFXA 2DUWA 2R6JA 1Y81A 2X5KO 3TQHA 1KYQA 5EESA 1DLJA 4HUJA 3SJ7A 2O4UX 5A04A 5U9CA 4WLNA 2EWMA 1F14A 4OKNA 1NVTA 3GGGA 3WG9A 4S1VA 1K89A 4BO8A 2CVOA 5TSDA 1MXFA 2G82A 1H6CA 1YXMA 4K9DA 1Z7BA 2AG8A 1U2DA 1YVEI 4LISA 3DZBA 4U5QA 1F06A 2UUPA 5KTKA 4OQZA 3RBVA 3OQBA 4TZTA 4UULA 1M75A 3WICA 3Q2IA 3FN4A 1PZGA 4NFHA 4E5MA 3OJEA 3H5RA 4I9HA 3F4BA 4AVYA 3ULKA 3PHIA 3D0OA 1ZXBA 5TGDA 3G0OA 5G4LA 1H6AA 1T2CA 4AJJA 1J5PA 3RD5A 3JQGB 3NYWA 3VZRA 5A9SA 2NTVA 1DHRA 3LK7A 5G0VA 4TRJA 2AEJA 1DIGA 1I3MA 2BGMA 2X0NA 2OBYA 5JC1A 3PYLA 4WGGA 2WM3A 1DC5A 1U5CA 2FZEA 5FEUA 4GMGA 2JFFA 2EV9A 3RKUA 3WYBA 2ILTA 3OBBA 3ZHXA 1HTBA 4YCAA 2VNSA 5JSFA 3B1KA 3I9NA 2P91A 1HSZA 2B5VA 3COSA 4RDHA 3D4PA 4RVDA 2F00A 2V6GA 1PGOA 3GQVA 4CLXA 3OJLA 3PQDA 4AL4A 4E5NA 1ZEMA 1Y6JA 3RJ9A 3AOGA 3K6JA 1BSVA 4RVFA 3ST7A 4MVJA 3T4XA 1NYTA 3F1LA 4E2WA 4CQLB 1GV0A 5KKCA 1IZ9A 2EGGA 4IMPA 2CVZA 4JQCA 3RROA 1DC3A 4XYBA 4DMLA 4U0KA 4NJMB 1Z7EA 3FPCA 2CY0A 5ER9A 1U4OA 1P0FA 4PLFA 4DLLA 1RWBA 2EJVA 3OM9A 4FGSA 4NJOA 3QE3A 1RPNA 3DBRB 3FCOA 2VRCD 5JXWA 2UDPA 4O1MA 2ZCVA 5GZ6A 4H3VA 1DC4A 3PYXA 4PZEA 1T1RA 4M1QA 4D0RA 3ON5A 1SB8A 3HN2A 3ZDFA 1EBFA 1DJQA 3S55A 3FNGA 4DWVA 5KIAA 1NPDA 1IL0A 3RBXA 1PTJA 2PWZA 2JHGA 4TWRA 3V2UA 1M6HA 4EGFA 4ALLA 3F4LA 1Y5RA 4BNTA 5JAIA 1J6UA 1ENPA 1LC0A 4NR0A 5LDHA 3A28A 3M2TA 3NX4A 5KVQA 5F5LA 4E5YA 1KERA 3PP8A 2O4CA 1PGQA 3RI3A 1MB4A 3FSRA 3H6KA 1I2ZA 1G6KA 1LXCA 1P77A 4JROA 3I9MA 2CNBA 1UDBA 4R9RA 2BFAA 2FPIA 1UXHA 2YQ5A 3WBBA 1YKFA 2FHSA 2NUAA 2PGLA 3HJAA 4ND3A 4XRRA 1ONOA 3D3EA 4E2ZA 4E21A 4DQUA 4M8SA 2AMFA 1VM6A 4YAGA 4JIGA 1LBEA 3LVFO 3Q0EA 2IXBA 1Y8QB 3OIGA 1HWYA 4U8GA 1R16A 5DF1A 5G0TA 3WQQA 1ZFNA 3PWZA 5F1PA 2C7VA 4O59O 4E3ZA 4O5OA 3EYWA 3PFWO 4O63O 4HADA 1AHIA 3BAZA 3SXPA 1DFGA 3K5PA 3GG2A 5G4KB 3FHLA 1SMKA 3E1KA 1Z82A 1A72A 4ND1A 1ZMOA 3MOGA 4TVOA 1HDXA 4U0JA 3RCBA 4U6QA 3TNLA 1HT0A 1PJ4A 4OJNA 4IY1A 3FF4A 1C0LA 3BYZA 2CD9A 4FFLA 3MZ0A 2HUNA 2J3IA 3IJRA 3RFVA 3O26A 4QO8A 6ADHA 1HXHA 1ZUD1 5A3VA 4OM8A 3NTOA 1BGVA 1D1TA 2PTGA 4YT5A 3KSZO 2NVWA 1ZMTA 3ENKA 1X1TA 1XU7A 4MVJF 4FS3A 7MDHA 3JQEA 1EEHA 2NV6A 2Y93A 2Y68A 1WWKA 3O03A 2W90A 4J4BA 1X7HA 3DZKA 4H7PA 3MJTA 3JQ9C 4D3DA 3BMOA 4Z3KA 1V6AA 2B37A 4LVUA 2WYVA 3UUWA 3NDJA 3TPCA 2CZCA 1TLTA 4OQYA 3IDSA 4R1NA 3BIOA 4PN3A 3GFBA 4G81A 4HV4A 4XB2A 1YB4A 3GN2A 3RASA 3JQAB 1NQOA 3H5NA 1GUYA 3CSDA 3DZFA 1K0UA 2IODA 1F12A 2OUIA 2PA3A 3WFIA 1U5AA 4QT0A 3OIDA 4XYMA 2NVBA 3RUFA 1X0XA 3QWAA 3QA9A 1NP3A 1X7DA 3O38A 4OXYA 4HFNA 4IXWA 4R4JA 5TJHA 1L1FA 2P5UA 4UEKA 1KIFA 3ZGYA 1ZSVA 3AY3A 1I8TA 2UYYA 1O94A 3BZUA 3ZHZA 1HDYA 1FJHA 3I4CA 4BNIA 3EUWA 5AXBA 5BNIA 5A3JA 1D7OA 4YXFA 1YBAA 1E7SA 2EG9A 3BHJA 4HBGA 4PCVA 5COAA 5T8KA 4QFDA 3OH8A 3ZU5A 4CMKA 2AXQA 3LT2A 5JE8A 4KDEA 4RORA 3WWZA 2W2LD 3N74A 1I3KA 4R68A 4MO2A 4N5NA 4BNJA 2O3JA 1LDYA 1QLJA 2WWRA 1RM3A 2X0JA 4BOYA 1YONA 1YWGO 2HQ1A 3WFJA 4QUKA 3ZNOA 5DNAA 4P4NA 2P9GA 4UEOA 1PWXA 1VI2A 4GWGA 1N1GA 2ZJ1A 3MJEA 4NJMA 3EAGA 4ZQBA 2A92A 4B4WA 5CEJA 1E77A 1ZK2A 2AA3A 4FFMA 4MIYA 3JD1A 4TVBA 3LQFA 1E1LA 4OSOA 3U49A 3WLFA 2D2IA 1O95A 3MJVA 5I8ZA 1FF9A 3WGZA 2PD3A 3IOYA 4RDIA 2YDXA 4CUZA 4NG5A 3M1AA 4XJTA 2WJPA 1FDWA 5A05A 4I5GA 3M6IA 4JX8A 5KVVA 2PK3A 2Y1OA 3MEQA 3ROMA 3F47A 3RIHA 1T24A 5F1KA 3BTOA 1WNTA 1SOWA 3HQ4O 5F3RA 3ZWWA 1I2CA 4DLBA 4BO3A 1GU7A 5H83A 4L0QA 2J6IA 2BFOA 4W9NA 3E5MA 2VYVD 3AJRA 1H9BA 3E18A 4BGIA 3GEMA 3Q11A 3SC4A 5L4SA 5JMPA 2AG5A 5C7LO 3WIEA 5IZCC 4TRMA 5JAMA 1JKJA 2O7SA 2X1HA 2I67A 3L4SO 3OHSX 5G2OA 4W7IA 2DBVO 4WNCA 3R3JA 2Q1TA 2AE2A 4E6PA 5CG1A 3WXBA 4D0SA 1YL6A 3GGOA 3RSHA 1UP7A 4JJGA 3WBFA 1H9AA 5H82A 3D64A 1LQUA 3ZNPA 2G1UA 3JQFC 3ENNA 4XQ9A 3ZNNA 1Y8QA 1IPEA 3QWIA 4YAIA 1WDMA 3W8FA 4Y6RA 2BLLA 4OHUA 4IXTA 4E5KA 1IHYA 1UZNA 3C85A 3ASVA 4J6FA 1HF3A 1K5HA 4XJSA 2X5JO 1Q0QA 2ET6A 1FMCA 4RO0A 2XOXA 4AJNA 2YQ4A 3HB5X 1HDRA 1YS4A 2WSBA 1P1HA 5G4KA 5CP8A 4K26A 5EIOA 4RLSA 4E32A 2Z95A 3UHAA 3E6AA 5DBGA 3CMCO 2GGSA 1GEEA 3UCEA 3LF1A 3QHAA 1I3NA 3FBGA 4LGVA 4XWYA 3WJ7A 4XEHA 3UAGA 3GDOA 1MUUA 5CG2A 3NJ8A 4L73A 1D8AA 2VUSA 1B8VA 1C3VA 1ZK0A 1U8XX 1B15A 1O5IA 3EW7A 3QWFA 5U1PA 1VSVA 1R37A 1HDGO 1V3UA 1MV8A 1SO8A 3ZWVA 4ZICA 3LDHA 4YPOA 2XXBA 2FR0A 2D8AA 4U7WA 4XGKA 4YAEA 1XHLA 4Z0HO 3ZV4A 1HYEA 4ND2A 1MP0A 4GSLA 2FZWA 5DULA 1SZJG 1QLHA 2X23A 4JCOA 3F46A 4E33A 5BSEA 2GDZA 1Q7BA 3AM5A 1UDAA 4E30A 5TQVA 1VC2A 2BFMA 3QLJA 4R3WA 1GL3A 1LU9A 1BMDA 4ZA2A 3ZWYA 1AXEA 1JAYA 2GRAA 5JDCA 4J16A 3JQAA 2OORA 3QRWA 5KJ6A 1O6ZA 5IDXA 3NUGA 1T25A 4HXYA 1LSSA 1IZ0A 2XPCA 4CMBA 1F17A 4WLUA 4QFCA 2ZJ0A 3PQEA 3BMQB 5CDTA 3G17A 1ULSA 3FTNA 1BVRA 3ZCXA 4BO5A 1GAEO 3MJSA 1H6DA 4JJIA 2NTNA 4EEZA 2NVUB 1RM0A 3L77A 1EVIA 1I36A 4DIOA 1UXJA 4FN4A 3ZW8A 1NWCA 3WNQA 4J7UA 2O50A 5U4QA 1NQAO 4JK3A 5EERA 5JDIC 4XQCA 1R66A 3KSUA 4KQWA 4FGWA 1ID1A 1VL8A 3QWBA 2JD2A 1ZXLA 4PLGA 3P19A 4J2OA 4P38A 3VDQA 4GSKA 4O0LA 1KY4A 1LRLA 2VN8A 3W4JA 4BB5A 4CLOB 4GKVA 4FFRA 4WLVA 3GFGA 1QYCA 3U0BA 3C3XA 1PJLA 1M66A 4RPJA 3VPSA 3HDQA 2B4TO 4Z9FA 1ZO8A 1PZEA 3AOEA 3DZHA 4JBIA 2QQ5A 5IDWA 4Q3DA 1N8KA 3IP3A 4ZQGA 5L7WA 1H94A 3HDYA 1E3LA 5JPIA 3FI9A 1A71A 4I8XA 4YAKA 4WCFB 5T64A 3MWEB 3B6ZA 3D5QA 3SVTA 2HCTA 2I3GA 3PHGA 2P9EA 4DXHA 1YH3A 3TRIA 5HA5A 5AOVA 4WE3A 1DFIA 4HY3A 3EHEA 3ZNQA 4W82A 2QX7A 4ZQEA 3AU9A 4J1NA 1DHTA 1R4MA 4MKZA 4WLFA 1PIWA 3CH6A 4EZBA 2C5AA 4A73A 3QVSA 1Z45A 1JKIA 1DLIA 5ITVA 3E5RA 1VRWA 3DBVO 1LC3A 4LCEA 3AFNA 1JDJA 1LLQA 1GUZA 3VH1A 1LX6A 5BQFA 3UCXA 4DMMA 1GYRA 5THQA 4RVSA 3L07A 1KVSA 5DCWA 2DFVA 3HZZA 1H2HA 4R69A 3S1LA 3GVCA 1XGKA 3U3XA 4CM3A 3SC6A 4KUHA 5L7TA 1CWUA 1XIVA 3V1YA 4PFJA 3TOXA 3S2IA 3VPFA 1GYQA 2J8ZA 4F6LA 4BV8A 1L7EA 4J1SA 4J49A 3WMWA 2VHYA 2FN7A 1I0ZA 4YACA 5GZ1A 2GERA 4KTVE 1CYDA 3JQBA 4BNHA 2DFDA 1BRMA 4CV0A 2EF1A 5IN4A 4WKGA 1HLPA 3GVIA 2H5LA 1GTMA 4MP6A 3WOHA 4IDFA 1Z75A 4E31A 2ZTVA 3EGOA 3AM3A 5EINA 3WSWA 1NASA 2HU2A 1B16A 2DQ4A 5CPFA 1IHXA 1PL7A 5COQA 1VSUA 4KMSA 2B36A 1NR7A 4X54A 2TMGA 3LT1A 4EJ0A 4YT8A 5BSHA 1HE3A 5DT9A 4CLHA 3PJGA 2GZ3A 1DPGA 2B0JA 4XCVA 1E3EA 2VRCA 3FRJA 3WGGA 1K6JA 4Q3BA 4RVHA 3UICA 3C7DB 1KEUA 3ABIA 4Z3DA 4Y8VA 2ZB7A 5CEFA 2HJRA 2RH4A 3ORFA 4LSMA 4J43A 3KTDA 3W6UA 3JD0A 4IJUA 2O23A 3DC2A 1C0PA 5CFZA 2OZPA 4UVIA 3BMQA 1N7GA 3ZU4A 2BGKA 5A03A 3SLGA 3AUAA 4UUMA 4XGNA 4I1IA 5C37A 4RL6A 1YDEA 2PLAA 1Y5MA 3RFTA 4C7JA 3H9GA 3PHHA 4B4OA 2ZTUA 1J49A 1S6YA 3ANNA 4AJPA 4XB1A 2EEZA 4DUPA 3GF4A 3KM0A 1Y8RB 1E6UA 2NVUA 1E92A 4PLCA 1P33A 3GEGA 4PZDA 3BMCB 2D5AA 1UZMA 4BGUA 4DL9A 3MOIA 2YV3A 4EDFA 5HM8A 1YBVA 3ZW9A 4MVJG 1UAGA 4A27A 5KKAA 3DMYA 3DZIA 4IJWA 4BKPA 2F1KA 1B7GO 2VRBA 4IDEA 1OMOA 2Y1FA 4BGVA 5BR7A 4CLOA 2X4GA 1R12A 3EC7A 4B7UA 2GASA 1NAIA 3RVDA 1LSOA 3W4IA 4JJFA 1KOLA 4DIFA 3WR5A 4A0SA 4ALNA 2AQIA 3ICCA 2DBZA 4LMPA 1A7KA 1EZ4A 3TL3A 4BO1A 2PZLA 3MWDB 1B8PA 1CEQA 5TLSA 4K28A 3GAFA 2OFPA 3R1IA 1V0JA 1FK8A 2P9CA 5L4NA 3KHUA 3WMXA 3JYNA 5A5EA 1P74A 3BMOB 2CFCA 4ROSA 1UDCA 3CMMA 1AXGA 1E7MA 2FY8A 4D41A 2BH9A 3U4DA 4WCFA 2EHDA 2W8ZA 3GDFA 4UUOA 4UEJA 3KYCB 3DHYA 3CZMA 3R3SA 1QYWA 4CPDA 1BXZA 1NFFA 2DUUA 4DYDA 4ONEA 4G2NA 5H81A 4QEDA 2EGHA 4EBFA 1HE4A 1E1NA 2GF2A 4E2YA 1QP8A 1Q7GA 1TB4A 3AUUA 3I9KA 3LT4A 4YTEA 3X2FA 1P31A 1BVUA 1QKIA 1U7HA 4BO0A 4NDNE 2Y1GA 3PK0A 2OO5A 4BL5A 3KO8A 1B14A 2PV7A 2Y05A 1LLCA 3EMKA 4FDAA 3ROKA 1P3DA 4WK6A 4Z0TA 4D7AA 3WGOA 4YWJA 5FWNA 2OBNA 2Y1EA 3MTGA 1EUZA 1PX0A 2ZK7A 5A1TA 3ZWPA 5CEEA 5ADHA 3EDMA 4K1LA 1GCUA 1QYDA 4L9RA 5HRUA 5JO9A 3GZNB 3K92A 1DIRA 3H65A 3GH3A 1LNQA 3PFFA 1BDBA 1U4SA 4MINA 4W9NC 3NT5A 5DCUA 1HL3A 1DRWA 3I6QA 3OA2A 3A06A 3QV1A 4E5PA 5A5FA 1R0SA 3UH1A 2BGLA 3H2SA 3DR3A 3PIIA 2GR9A 3E03A 4D3SA 3S8MA 5IDQA 5TX7A 1UP6A 2O48X 2C29D 5ICSA 2W2LA 1QG6A 3EY4A 5K6AA 4EYEA 1HE5A 5AXAA 3WS7A 1GQYA 2I66A 3ITDA 5IZ4A 3QJ5A 1JWBB 2JL1A 4Q39A 4B4VA 3QVWA 4NPCA 4RPLA 3Q9UA 3GR6A 4BO7A 4I08A 1GD1O 1NNUA 2Q3EA 4C7KA 5MGBA 4B79A 2ZB3A 1HEUA 3DO5A 3LC1O 1Q2XA 2QIOA 3ROPA 4D43A 2VOJA 4CMCA 5JMWA 1IE3A 1VJ1A 1ZZEA 3WNVA 2RH8A 2IYPA 5I7SA 5IXYA 3C7AA 1ZJZA 3IUPA 2CDCA 2O3TA 1OOEA 1GZ6A 2VHWA 4BNFA 4E13A 2Q49A 4BMVA 3FD8A 1ZEJA 1JU9A 4CL8A 1KEWA 4KUGA 5C7IO 4BO9A 3CZRA 3DFZA 1LRKA 4Y6SA 3OETA 1RYDA 1SOVA 5L9AA 3EZLA 3NGXA 4MVJP 4J2HA 5GZ3A 4WEOA 2VYND 1T2AA 1T1SA 3HFGA 1QV7A 1ADCA 2VYVA 3HWRA 1PEDA 3ZWNA 4UVEA 4OKIA 4DYVA 3HHPA 2E37A 4AJIA 1Y8RA 5B4TA 4OO3A 4J3FA 3QVXA 3V1TC 3BMCA 4KWHA 4I5DA 3Q1LA 2O3RA 4PG6A 5JW6A 3W4KA 3H9QA 3G49A 2NU8A 1N5DA 4RPGA 4BQRA 4Q3AA 1T4DA 4CM6A 1YOVB 3HN7A 2BI7A 1VKNA 4DVJA 2V6FA 3GDGA 4MVJH 4PIVA 2JFHA 5JNLA 1NTOA 2P2SA 4FBGA 1GEGA 5L7YA 1ZNQO 3PDJA 2GN4A 1H0KA 3L9WA 3ZHBA 4INAA 3VHRA 3OFSA 3I1JA 1EFLA 2E4AA 4PG4A 1PGPA 3ANLA 4KP7A 3ASUA 1WAMA 3UCFA 5JY6A 3GMDA 1K6IA 2CDBA 3EVNA 3CTVA 2YUTA 5ITWA 4WECA 3RC1A 1BW9B 3W1VA 3GVPA 3WWYA 5C7OO 2I76A 1B3BA 2VHVA 3C7CB 1U7TA 2Q2WA 3B1FA 2DTXA 5K9ZA 5C5IA 4NH4A 3WDSA 3QIVA 2GD1O 4R3NA 3WYEA 1YB1A 1JLLA 1H6BA 1K3TA 1UXIA 3ANMA 5DOVA 5LCXA 1DB3A 3KYCA 3VC7A 1GV1A 3DONA 1ZCJA 4HFRA 4FJ1A 3PDUA 4M87A 2HMWA 2I3AA 5LDGA 4AFNA 4YA6A 5ICMA 1MC4A 3V2HA 4RF2A 4BNKA 4XRGA 1FDTA 3A14A 5AVOA 2FP4A 1AE1A 2O2SA 2WD7B 1FDUA 4LCJA 5G0WA 1E3WA 1YRLA 3PYMA 2XF8A 4LRSB 3BMNB 3WIDA 5TF4A 1R4NB 3B20A 1FXSA 1ISMA 3CXRA 3L4BA 2BKAA 1H2BA 3KOUA 2OOSA 4KDFA 1KVTA 4GX2A 4MIEA 4J7XA 5EQFA 5BNFA 4DLAA 4EI2A 1A4IA 3F6YA 1D1SA 4DC1A 1V3VA 4CM9D 3PLNA 4CUJA 1GY8A 1LLDA 4ZRMA 3VVCA 1OZAA 3AOEC 4HP8A 2I65A 4IIUA 3RBZA 1UAYA 2GCGA 4Y6PA 2PZMA 3CKYA 4PG7A 5FFFA 3JTMA 5FI3A 5JFOA 1C14A 4XZ3A 3GZNA 4DA9A 1P44A 2NU6A 2QHXA 1T2FA 4WOJA 4N18A 3I6IA 1TT7A 1E5LA 2GSDA 3DTTA 3JYQA 5C3MA 4D79A 5A9RA 1E5QA 2CMDA 2PFGA 1I3LA 1PS8A 3ITKA 3ZWCA 1ARZA 1J0XO 4BGEA 5FI5A 4YJFB 1E0DA 1ZJYA 4YYZA 2XXJA 4ZD6A 1PR9A 2CF6A 4XA8A 3VKUA 3GNSA 1I24A 2C0CA 3QWHA 2DPGA 4AJKA 4YQZA 4Y98A 3GVXA 4IDDA 4NFSA 2I9PA 1ZK4A 3KB6A 4NHEA 4CLEA 2GN9A 3BTUA 1T2DA 2JHFA 1HKUA 3RC2A 1O0SA 2B4RO 3H9EO 2ZYDA 3WGHA 3JYPA 3GRKA 1J4AA 5B12A 1VL0A 5JCJD 1BXGB 2C7GA 2NADA 4XR9A 3UFXA 1YJQA 1XDWA 4CQMD 2Y99A 2Q4BA 3WSVA 5F1OA 3TF5A 1I33A 3PJFA 4P4LA 1B2LA 1EBUA 1E1KA 3ICPA 1P0CA 1R4MB 1JQBA 4IBOA 4ZRNA 1MA0A 3TFOA 3PHJA 4B4UA 4ND4A 4UUPA 3PI7A 3R6DA 3ROQA 2FOIA 4LMRA 1EFKA 1LRJA 3D5TA 4NBRA 6LDHA 3LZ6A 3DQPA 1AN9A 2FR1A 3K31A 4LK3A 1NFRA 2B83A 1YGYA 1X15A 2HRZA 3X2EA 4WJZA 4AJ2A 5KVCA 2O3SA 4J9UE 3GLQA 1GCOA 1HZZA 4FIZA 1B26A 1P9LA 5JYDA 4A03A 3F5SA 3OF2A 4FFOA 1DDOA 1SAYA 1E3SA 2X9GA 2PGJA 1CETA 4IJKA 4Q3CA 1BHSA 2VOEA 5CHEA 5DDIP 4CMEC 1EK5A 1KVQA 1AHHA 3RKRA 3E82A 4BNLA 1LDBA 4GMFA 3K73O 4I5FA 2D1YA 1DRUA 3GGPA 4S3MA 2I5PO 2OMEA 4R1TA 3TZKA 3PPIA 1YOVA 3UKOA 4D3FA 1I5RA 3U4HA 2AEMA 2E49A 2W2KB 4YVFA 2Q99A 1P1IA 1PJQA 3UN1A 3CTMA 5K0ZA 4C4OA 4FB5A 4BNZA 3FWZA 4XIJA 1D4FA 3PGJA 4EEXA 2BRUA 2ZYGA 1U8FO 4DPLA 5I8WA 3TZQA 2HSDA 3VH2A 5I7FA 1Q0LA 2Y0DA 4AJHA 1PGNA 1DFHA 3ZWMA 4FSHA 4AG3A 4PLHA 4CM7A 2BF7A 4XR4A 1BW9A 2C2YA 3DBLB 3GVHA 2HJSA 2BFPA 2YJZA 4AJEA 3O4RA 1NQTA 3RJ5A 2LDXA 3LLSA 4QSMA 4NBTA 1KS9A 1EDZA 3BA1A 4Y67A 3RWBA 2FRDA 2GUGA 1NHWA 3KEQA 2YZ7A 3GOHA 3P5SA 4UVGA 5DZSA 1K2WA 4CV2A 2Y67A 4BKOA 4N5MA 4YEDA 2EIHA 4Q9NA 2W98A 5ENDA 1JAXA 1Q0HA 4J9VA 1E7WA 1DXYA 2WD7A 1CJCA 3OEYA 1PR3A 2P5YA 3FNHA 4CMJA 5ILOA 5CPBA 3BMNA 3IAHA 4WLEA 4A26A 1E1MA 3HDHA 1R4NA 1MXHA 4CMGA 4L4RA 4NBVA 2C2XA 1OI7A 2HAEA 1PJ3A 2IRWA 3V5NA 2DAPA 5BNTA 1WMBA 4PG8A 2D3TA 4ZJUA 4ZU3A 5IN5A 2OGUA 1ZKMA 1C0IA 1YQGA 2Q2VA 1UXKA 4M54A 2AQKA 4W99A 2VUTA 4D44A 2JFGA 1KEVA 3DOOA 3DXFA 4ITUA 3UOGA 3I83A 1Q7CA 5FYDA 3DTYA 1JVSA 5JCXA 4WCFC 2DTDA 1GQ2A 3QSGA 5EMHA 3H2ZA 4DRYA 5HBRA 5F21A 2QRJA 5JYEA 1R15A 3JQ9A 2J3HA 2DTEA 2UAGA 1KC1A 3ADPA 5TRTA 4M49A 3Q2KA 1UJMA 5F5NA 1ONNA 1QYXA 3Q9NA 2EJWA 4GGPA 3ZWAA 1MGOA 3ADOA 4Z6KA 4DPKA 1W4ZA 3H3FA 4YBZA 3DEYX 2Q45A 3T7EA 4YJFA 1X7GA 1SC6A 5B1YA 4UVDA 1LSUA 5ILGA 2Y0CA 3TJRA 4DPMA 4EUEA 1Q1NA 2GZ1A 3AI3A 5T57A 4Z9YA 2VNAA 1CIVA 1TVEA 3ZV6A 3K2EA 4DGSA 4L8VA 1QR6A 4A10A 1BTOA 3H8VA 1SNYA 3T4EA 4OSPA 4PLWA 3PZBA 5TIIA 4R5HA 4DIBA 3RUEA 2DLDA 3RC9A 1BXGA 1U2GA 3UVEA 4CJXA 1LDNA 2EKPA 4ZVVA 1LDMA 1W6UA 2VTDA 1OFGA 1UXGA 3UGKA 3IUSA 3D4OA 3KZVA 1YQDA 3VDRA 3VPGA 1HRDA 1N9GB 1WZIA 2WMDA 4BNWA 5J23A 1HDCA 2J3KA 4AICA 1IULA 3WQSB 2VT3A 4ALIA 1ENYA 4NBUA 3VH3A 1PJSA 2CSUA 3PGXA 5DBIA 2DM6A 4RJTA 4GWKA 2DBQA 5GY7A 2Y0EA 3I9LA 2EW8A 5K6AC 4IJVA 2FPPA 4R54A 3ONEA 1R0KA 3W8DA 1HZJA 1VE9A 4B3HA 1N92A 2YY7A 3C24A 2PH3A 5I9LA 3ZU3A 3DFUA 2GN8A 3DOCA 3L6OO 4PLVA 3GPDG 3W6ZA 2IEBA 4W4TA 4BKQA 4RQTA 2C5EA 4FJ2A 2WD8A 2WYWA 3E9NA 3JD3A 8ADHA 2ZQZA 2A94A 2FMUA 1DRVA 2TMDA 4CR6A 4XDYA 2WE8A 2QW8A 2YDYA 4KUEA 5I7VA 1HLDA 2CUKA 2IZ1A 3F5QA 1V8BA 3PTZA 4HX5A 4OOFA 4CR7A 4MIOA 2H9IA 4BNVA 3JV7A 2W2KA 4YR9A 1ZBQA 3AUTA 3A9WA 2HMUA 3PHLA 4XIYA 4AJ4A 4NFYA 1NM5A 4XD2A 1XQ6A 1GDHA 4ZQFA 2HK7A 3VZQA 1PQUA 1Y9EA 4YAJA 2Z5LA 3I4FA 1DIAA 2V7PA 2QG4A 4RCVA 4EITA 4J91A 2WEKA 4WNIA 3DBLA 3BTSA 4XX0A 2YHUA 4IDCA 4NK4A 2PKQO 2NTJA 3JQFA 2Q1UA 3PVZA 4F45A 2NLOA 2HK9A 5L51A 4MKRA 1DIHA 5COBA 1TI7A 2VHXA 2B69A 1GYPA 2UUOA 4MP3A 3FTPA 4A7PA 4DREA 1YO6A 3WJAA 2X22A 2E82A 1XLTA 5IXSA 4RPKA 1RJWA 2YV1A 5I9NA 4MJLA 3ZWOA 1DOHA 3IIEA 4DTIA 3WGYA 4MVJE 4CQMB 4BV9A 3ETEA 3NJ4A 4KWIA 5G0SA 4BS9A 2D59A 3E48A 1YL5A 1PGJA 4GH5A 4FFNA 4JGBA 3PWSA 1IB6A 1IUKA 1OC2A 3NEPX 3OEWA 1XCBA 1YJ8A 3GMSA 3TFQA 5LC1A 1GQQA 3FNEA 4YRDA 2X5OA 4TZKA 3SJUA 1ISIA 3TN7A 3JQ7B 3HE3A 4WUVA 1WVGA 4CM4B 4M86A 4QXMA 2VYNA 2QYTA 3C1AA 4R41A 1KEPA 4RV9A 3IKTA 4GLOA 3WTCA 3LC2O 3PIDA 3AWDA 2ZYAA 1OAAA 2PR2A 2RIRA 3VH4A 1IYZA 1PZHA 1U3VA 3CIFA 2J5QA 3C8MA 4F6CA 4GVLA 3SLKA 4CLDA 4JBGA 1ZVMA 1ORRA 4CL3A 5IAAA 2FR8A 4GGOA 3ZWXA 4CODB 4WEQA 3QP9A 1TA4A 1YE3A 2JD0A 3HNPA 1WP4A 2X9NA 1S7CA 3L4BC 1FDSA 3GHHA 3NTRA 4MP8A 4XGIA 4WPGA 3RUHA 5CAEA 5IJZA 1EE2A 3RQSA 1X14A 1P1RA 4NMHA 2DVMA 5T8KC 1BG6A 1NXQA 2JCYA 4PG5A 4J7CA 3IKVA 4PZCA 3MCVA 2ZCUA 3G3EA 4IQGA 4J0FA 3UW3A 1PL6A 1EVZA 4GQAA 1KY5A 4YJHB 4BVAA 1T26A 3IP1A 1F0YA 3GAZA 4J0EA 4GPD1 3L6DA 2BMAA 3PEFA 1GZ3A 4MKXA 1N9GA 1XWFA 5JDIA 3H3JA 1E3WB 3OIFA 4LRTB 3ONDA 5L3ZA 1XU9A 2AQHA 2Q46A 2VWPA 3TL2A 1SEVA 3C1OA 2YV2A 2RAFA 4PLYA 1WMAA 4ID9A 1JWAB 1HDZA 1PU2A 1TEHA 4L76A 4NK5A 2HK8A 5L95A 1UH5A 2H6EA 3IJPA 1BDMA 2QZ9A 3JQCA 4HNHA 4IZIA 5A06A 5BSGA 4RF3A 1A7AA 1HE2A 4BB6A 3CINA 3VZSA 2NQ8A 4GX1A 4J4HA 4O6VA 4PVDA 4J1TA 1O9BA 1QSGA 3INGA 5KWEA 2WE7A 2RHRA 5EQDA 1ISFA 3UXYA 1CF2O 1R6DA 2XAAA 5AYVA 2C07A 5TNXA 3TZCA 1YL7A 2GLXA 1QXSA 4FPXA
chains in the Genus database with same CATH superfamily
3RRZA 1V1MB 1YJ5A 3IURA 3MQFA 3RTDA 4ALKA 1LLUA 1SN7A 3QVKA 2XD4A 4QBGB 3Q8MA 1NT4A 1NC1A 2ENWA 3GXBA 3VC1A 1PL8A 4CM9A 4G0WA 1U7WA 1RHKA 2IPMA 4JLWA 4G3XA 3T3PB 3WB9A 3NV7A 1IQ0A 4P0TA 5EJ6A 3NGLA 2J0EA 5TGZA 4MYCA 1OXBB 3U4CA 4AW9A 1Z6XA 1BMTA 4DBVO 4RADA 5FAKA 4XTRA 1BQEA 5LMZA 2D1TA 1VTKA 2DZDA 3FJOA 4BTEA 1B8UA 4N5HX 1OI2A 1EWTA 3BHNA 2L18A 1YAJA 3C39A 4I46A 5AICA 5AUQA 5K3FA 4GX5A 4X3OA 3MAAC 1MABA 5EHZA 2BZSA 3T5GA 4ZGWA 4DV1B 3KQSA 1SWVA 5BQFA 2IDZA 4D57A 1PJCA 1U0RA 2HRCA 1C9EA 1XSEA 2H1SA 1C1XB 3D0QA 3WK7A 4A4DA 2F64A 4XDZA 1SQ6A 3H3XA 5CEFA 4P8RA 1CJTC 2GCOA 1P9RA 5D2CA 5JJKA 3CEAA 2IX9A 2ZSFA 3RYCB 4XIGS 1UM9B 2ETVA 2WT4A 3D1JA 4NNJA 4B7CA 1IXYA 1U9CA 2CEKA 5LN1A 4AY6A 2OC9A 3IPYA 1NN3A 2X8LA 2HNKA 4II3A 3FWNA 4W1PA 2OB2A 1XAGA 2VAVA 4LJKA 4E46A 4ABTA 5CXSA 4B0OA 4NRDA 1WPQA 3MGBA 5AWFC 4TKMA 4BB9A 4RA9B 4QQKA 4TSKA 2IYEA 1FYFA 4YRZA 2Q1SA 2F2TA 1J07A 1FYWA 4MLPA 1NVGA 4PRLA 1TJ3A 2JJYA 4BPBA 3TLEA 1U0NA 2H4ZA 4G1CA 1MDFA 4CNQA 3SSOA 5TT1A 1KHHA 3ZHYA 4WX2B 4JT4A 2LKCA 2H2WA 2QTRA 4LY3A 1M2VA 4PLPA 3ZN2A 2LGJA 3NDRA 4HH0A 4NYJR 1OHHA 5A2GA 5H80A 4Q1CA 2PPLA 4K6OA 1CRWG 5B4VA 3BCRA 1E1CA 1JL3A 1DZ3A 2GEVA 2P0YA 2P7HA 1IRXA 4B6QA 3HVJA 4NBNA 1U1IA 4KGXA 1W8DA 4BO4A 1JALA 3JQ6A 1EG7A 4S35A 3NOVA 5FCDA 5GINE 1IK6A 1GA6A 4BWGA 4JL8A 1ORTA 1PZNA 2P77A 2P2LA 2IUTA 4I50B 4CE6A 3IB6A 2ZVQX 1XJQA 1ZAYA 2VFAA 3QW2A 5DBOA 3MCZA 2PX5A 4Q7MB 1HFKA 3G89A 3IO3A 3R7NA 1S8FA 3KDAA 4D46A 2Q2OA 5JS6A 2R5WA 5JPCA 1RZVA 2CHUA 2BELA 4ALJA 3FPBA 3LUHA 4UOQA 2ZKLA 5F33A 4B76A 5BSKA 1H66A 2CDRA 3DQQA 3S7ZA 2QTVB 4BKRA 1S9HA 3QPBA 2CJXA 1E6MA 1YDGA 5GADl 2H52A 3C6QA 3E9MA 4HTFB 5J63A 2WUFA 3DBOB 2GD6A 1FQJA 1I9CA 2XI4A 1JJAA 2HSWA 2Q1WA 3EGWA 4N5LA 1BHJA 4PCUA 4RZIA 4FX2A 2GPBA 3ZHQA 3D1LA 1Y3DE 3TECE 4UMEA 1UDRA 2Q5JA 1D0SA 4FT2A 4XPZA 3RSFA 4UCQA 1N0IA 3VX4A 4F5DA 1PS9A 4YRJA 1N2CB 4TSRA 1E3IA 2AIRA 5A71A 4DA6A 3JCZA 3MTEA 4JOQA 2LCFA 4NYJQ 1YCDA 2XVYA 3QSYA 3QYJA 1PJ2A 3OEED 3AJ9A 4JELA 1BXRA 1UPUA 1XL0A 4XJVA 1L5GB 1RM5A 2GEUA 4MEJA 4A82A 4B3SB 1BU8A 3RIGA 1SHUX 4QOSA 5KTYA 3KETA 3ZDAA 2QZZA 3GB9A 4QLBA 1T9GR 3L3BA 1ZM9A 1YE8A 1G2PA 2BEVA 5LJLA 4G0QA 2IJGX 3QF7A 2C92A 1JTFA 5FTKA 1ZNZA 3VZPA 2OL4A 4P0QB 3IAAA 1X0VA 1CX9B 1QOZA 2FF5A 2X14A 1ZN2A 3NBKA 3D6AA 4O3MA 5LB4A 4LF5B 5E3HA 5CDGA 4QODA 4US1R 1YTUA 4BJ1A 1PR2A 4RIGA 5EJMA 3T7CA 1U1GA 3V8EA 3EHDA 2A7XA 2WZQA 1KAHA 1IOLA 1P3JA 1MX3A 2Q50A 3EUAA 4ZT4A 1J21A 1GL9B 3RUDA 3WGTA 3WNZA 2QW1A 3KKZA 4HEJA 1IJBA 1L7NA 2KSQA 2GQ0A 2Z56A 3GNQA 2GZAA 4DILA 3RC8A 2PYDA 4UPEA 2VPPA 1KXJA 1O6FA 2D1SA 2R9VA 4AC9A 4EUFA 1JVBA 4CMIB 3HV0A 5E6RB 3RVOA 2FXVA 1U0BB 2PH5A 4ER5A 3GRPA 4N01A 3BF7A 2IP2A 3JWIA 2WSYB 5BYAA 3RSCA 2Q4EA 2VT6A 1YDWA 4NJEB 5CH8A 3TE6A 4AY2A 4IUCS 4MV3A 3S81A 1US8B 4ND8A 4QXRA 4I0WB 5JH7B 1LLFA 3AU8A 1VLMA 3PWKA 3LYUA 4QASA 5GAJA 1ZK1A 4IHQA 1YR6A 3NHKA 4L9AA 5L4LA 1QONA 4TX1A 5ERGB 2VK8A 1H4QA 1DXOA 3ONVA 4QJ5A 3RNOA 1V1MA 4XVRA 4AUEA 1XCGB 4E09A 1EVQA 4HDKB 1TK9A 5IJAA 1VPLA 1S5PA 2CLKB 3OE1A 3R0IA 5ALXA 3TQSA 1QO7A 2NXWA 4E2XA 2A6PA 1HLGA 3PGVA 1WCIB 2F1JA 3SIWA 3DL2A 4YV2A 5JQGA 3HR8A 3QFSA 1ZI6A 3MJHA 3PEEA 4IV5A 3HTXA 4CQLA 1T43A 4WBNB 7REQB 3O84A 4U6SA 1PQPA 2VQ3A 2WINI 3B9PA 3FOAA 1FRVA 2QXYA 2W6OA 3HJCA 2HK6A 3IR5A 4IYRA 5CB8A 5KJCA 2ECQA 2JCVA 4XYEA 4CI0B 1NF8A 1C1XA 3WADA 1R8SA 3WK4A 2RHCA 4QC2A 5G0UA 3UXHA 2CLOB 3WTBA 2XT6A 2G1JA 3KJIA 4L8FA 5AESA 2R8ZA 3FWPA 4MR7B 5CB0A 2OZEA 4Y9UA 1ZGGA 1P0QA 1YULA 3HYNA 4HLDA 4JFRA 5LZ7A 2J9FB 3D02A 3X2SA 3SQWA 2CE2X 1SHKA 2P9FA 3RYCA 1C7RA 1UM9A 1A8SA 1U3TA 2IEDA 2Y1CA 2YIVX 5CH5A 4AURA 3O8QB 4JZKA 2WJIA 1IVSA 4EY6A 4NV0A 1TKRA 1T5SA 2GJAA 1UKZA 2I4RA 3WLEA 4IKOA 1EP1B 4RA9A 2WG1A 1E79D 2WSIA 2Y1DA 1E6EA 3V4OA 5IJWA 1EQ2A 2ZUCA 3GLHB 4YRBA 1DEXA 1VMKA 3HL0A 1JHYA 1GADO 3WMFA 2G06A 4PHFA 4MITA 4R01A 4B40A 4G8CA 2QW0X 3AM4A 4BNXA 4F8YA 3K9GA 5E4JA 3QKIA 1GLVA 3M4JA 4IH1A 5AIAA 3VKWA 2NAFA 1WJGA 1DIBA 3A31A 3FROA 3OSUA 3FWKA 2A3RA 1A4UA 4Y30A 3LW8A 4BNNA 3W5UA 3MB8A 2ZW9A 4IJQA 2AW5A 2WJYA 4KRFA 1A5ZA 3QVVA 3R5HA 1T2EA 2NQTA 4CEHB 4BYMA 4QICA 5FAXA 4FCCA 3BDVA 3DAFA 2H3EA 3PSAA 1MRNA 1N5IA 4ESOA 2F9MA 2N3ZA 2OUKA 3O8NA 2J7PA 2LNDA 1TCUA 3E8SA 1GO2A 1ORVA 2LIVA 4UASA 2RC6A 1DC6A 1T5HX 2VF2A 3INRA 3DCJA 2WMOB 3AW9A 3WGQA 4EHBA 5AOBA 3CSUA 3HBLA 2HNAA 1YE5A 1SZPA 3TKLA 2J1LA 3Q3CA 3PNMA 1D8TA 2AFHE 1A2KC 1GGKA 3JQ8B 1AQNA 1VP9A 3VSCA 4JI8B 2R8PA 3I9OA 1EFCA 3KYDB 4C7VA 1RLIA 3G2KA 3RRJA 1L5WA 2QTVA 3QKWA 1G3MA 3SX2A 3VPXA 4F8EA 1M67A 2VHZA 2H1RA 1VSTA 4UHFA 5FLYA 3UFBA 4HTFA 3SHWA 5K0FA 1YZFA 1EUDB 3IBCA 2RC5A 3QEMB 3QLVC 4G0ZA 1BKSB 2PYIA 4PEVA 4QQ8A 4HUQB 5IUKC 2ZUTA 1BRTA 4D9EA 3I23A 3PT9A 3NV9A 3QU2A 4L7VA 1C9YA 1F4VA 1N2HA 2QTLA 2JGKA 3JXEA 3OZAA 2RHDA 1N2CA 1QQAA 5UKDA 4IS2A 1T8TA 5B4UA 1ANKA 4RVGA 1VYHA 2C3YA 4P93A 3RLFA 5EJ8A 3U5TA 1FLDA 1NVWQ 3WLQA 4KLCA 3OQ6A 4ARBA 1A2OA 3GA0A 1UOOA 4PQRA 3T7TA 1PLJA 2XVAA 4UDNA 5HXAA 1YFJA 1EP2B 1VCHA 5EWJB 2JI9A 2F3TA 3RS4A 3HYRA 2I34A 2DF8A 1W4BA 3DNPA 5I7HA 4JN6B 5L3RA 2JLAA 9LDBA 4ZIRB 3EQZA 1DEHA 2KHZA 3HU2A 1UMBA 1ES9A 4ZWNA 4XSVA 3O90A 1O89A 1P2SA 2PKRA 4JKYA 5BPHA 1KDPA 3HXPA 3VYRB 5CDSA 4L22A 1NXSA 2FLVA 1YAHA 1VJ0A 2R8BA 2G28A 3OC0A 4KXNA 4LOAA 3A6HA 1JA9A 1XYYA 2C9DA 2YXPX 4QGSA 3Q8LA 3H2GA 3O21A 3WYAA 2ZWOA 4RTKA 4EMSA 5FBHA 4RFLA 3ZJYA 2VDUE 5ED4A 1SOMA 2A0WA 3CNLA 3EPRA 1E2KA 1T2VA 2R4TA 2HREA 4BWYA 5SY4A 3CRQA 5B3KA 4P7BA 3AF6A 1R8XA 2FSPA 4JBHA 3O8CA 4JGIA 3ZEIA 3AHEA 1QPZA 2MINB 1ZSYA 3OTHA 4CMIA 3IBYA 2O3QA 5E6RA 3RS8A 5DIZA 4RAOA 5JCOC 1JG1A 3ZCPA 4CIYA 1YBMA 2G9QA 2JAPA 2YXLA 1XD2B 3N53A 5HTOA 4C06A 5IWAB 1ZM4A 1W0KD 4AJLA 4NJEA 4B87A 4EFDA 4LV5B 1AY0A 4QVGA 4RNCA 3H42B 1U4NA 4B6FA 5FOUA 1TF2A 1UK8A 1US8A 3GJ4A 4M9SA 4AYWA 2IE0A 3A2LA 4KE8A 5F9MA 3ORQA 5FOXA 5JH7A 1CQPA 4OMUA 3I52A 2IH4A 2Z6QA 2QYSA 2EJTA 5KCZA 3E2PA 1YA6A 2HPVA 3LT0A 2ENUA 1O95D 1H2WA 5KVSA 3G6KA 4DR5B 1NW9B 3AYXB 3HY6A 2FFRA 2I6SA 1CQJB 1T4BA 2VKQA 4HDKA 1DQSA 1E8DA 2JEZA 3DLAA 4G89A 2PEYA 2H7CA 4GVPA 1W4CA 4TQ9A 3L8GA 2DKNA 1NBAA 1QIDA 1SBTA 3GT0A 1WCIA 1JX6A 1ETHA 1RXUA 4JYCA 1THZA 4KO3S 4NY1A 1B6GA 4DT1B 5AXDA 4HVTA 1KQOA 4KXQA 4QO7A 4L4SA 1JB9A 4WBNA 3GK3A 1R50A 7REQA 3NTQA 4HI0E 5HUHA 3FWYA 4DB4A 1AV6A 5C8XA 4NL4H 3FUUA 3BTVA 5BSUA 2P2DA 1Q44A 2YFHA 3I53A 3LG2A 4FJ0A 4G41A 3WRYA 3QEJA 5KOHB 3BL6A 4MV7A 5HZHA 2J3MA 4GBJA 2Q3FA 3E27A 4W6ZA 621PA 5JWOA 4EYKA 4O1IA 1HO3A 1BHO1 1DAPA 1G17A 2EL9A 4TQUS 4MR7A 1NNEA 3BK7A 4RZHA 5DHTA 3NG1A 2FFAA 2J9FA 1ZINA 2V5AA 2HMTA 4HS9A 4KQIA 4ZYUA 4QTZA 3S2EA 3NDPA 3U81A 4RL4A 2O8BA 2AYXA 3O8QA 5F2KA 3MIIA 2GBCA 2WT8A 3RUAA 3T3DA 4Z54A 3KSDO 2IOHA 3L4EA 5LQRA 2XR1A 1H2ZA 2A35A 2OP1A 3L0SA 5TGTA 3W2IA 5BWNA 1UWLA 1XAHA 3TAXA 5EZSA 4UUNA 5B7GA 1KMQA 3TWOA 1KAOA 3K9HA 3GLHA 3QXSA 3IO5A 2ARKA 2FLKA 3O83A 1OUMA 4OFZA 4OFWA 4NQZA 4W9RA 1XTIA 2B4AA 4RKWA 1MDBA 1U2PA 1UKCA 1NW7A 2QU8A 3HB9A 4I3GA 2VP0A 4S2EA 5DGHA 4K9KA 4PYRA 1RLTA 1ULZA 3Q3HA 4DQVA 3NIDB 5JATA 4DSNA 2E48A 3A6KA 1VPWA 4YUVA 1G4AE 1ZL0A 5JZMA 2G70A 4FC7A 4FGJA 1TKAA 4CEHA 2R79A 2FYTA 3CR3C 4Q15A 3NKLA 2ECKA 1LDGA 1SC4A 4JP3A 2OXIA 4Z51A 2CK3A 1I7QB 1JHDA 1S3IA 4FYHA 1ISSA 3PDHA 2HIMA 3H9JA 1LPPA 3JD2A 1KAQA 3O3MB 2ONCA 4GT1A 3KLMX 5CM9C 1I01A 4AMYA 4R8MA 1GRQA 1NURA 3EVZA 4LBYA 3H0CA 5B3AA 3VNQA 2AD5A 3KOXA 2QLMA 1BE0A 1RQ7A 2EERA 3JQ8A 2I6TA 4CV3A 4B2LA 2NN3C 2R8EA 4QULA 1NG1A 3G5MA 4IKEA 5DLYA 4PX2A 5EHQA 1G16A 3HCWA 3KYDA 4L28A 2XYVA 4JNCA 4LJ8A 3DEKA 2WKQA 5IC6A 4QPDA 2QMUA 1CQXA 4CKYA 1RWKA 3RUIA 1CR2A 1LVHA 4A0QA 1YB5A 4QZVA 4C7OB 4HNRA 2ZE8A 4AWXA 1EUDA 1TCVA 2C1ZA 3QEMA 5IZCA 3D2CA 1WDLA 4G6ZA 3JVVA 2POQX 4AKIA 4R51A 3P0JA 1D6MA 3CE6A 3MRTA 4HUQA 4BVKA 3MTDA 4DBZA 1KVRA 2CFRA 1NBME 2HMVA 3H7AA 4DC0A 1M34E 3CLTC 3PQ7A 3ND5A 1QGAA 4ID3A 1V71A 1BAPA 5LU8A 3FKQA 2PDAA 4ZI2A 4TN1A 4ARSA 1MIHA 3L05A 2M9MA 2VF8A 3GRYA 4PRYA 4XLLA 3U62A 2VXOA 4IEFB 1L5RA 1TGYA 3VYSB 2QG6A 2GPTA 4LBVA 1UBCA 5DSZA 1ODCA 3AJEA 3EXAA 1FSPA 1ENZA 1N8SA 1GRRA 4QYXA 3RTEA 2CCKA 3S0JA 5IMBA 4G4SP 4BNYA 5EWJA 5HW0A 3O8OA 1NYRA 1JFTA 1G2IA 2EXXA 2ZB2A 1XTKA 1BWSA 3FMPB 3H8SA 1EVJA 3AEXA 4ZIRA 4PZ0A 2UYCA 2VBCA 3BJRA 3HADA 3E22B 1HFJA 2ZBFA 4ZEOA 2AF4C 1RKUA 2WV7A 3A3OA 1NY6A 2GEKA 3H97A 3I92A 4H2DA 4URUR 1GIAA 3E9QA 4Y2JA 3PC3A 4GR9A 1O97D 1PF7E 2P41A 2Z2JA 3CF4G 4CMEA 5KWVA 4LZJA 2EYQA 4O4JF 1JIKA 1TJNA 1WXIA 3ACCA 5LLTA 2KYRA 4C2AA 3LHSA 3JD4A 3IE1A 2GJKA 2EZUA 3OICA 1XTJA 5JARA 3KIPA 1SXJD 1T5LA 4G5GA 2Q4OA 1N5JA 3PDCA 1WEKA 2JZNA 2IHVA 2QMOA 4KZKA 3U4IA 2QTGA 3BM5A 3L0IB 5E38A 4BC0A 2BJVA 2MINA 3DOEA 1JU3A 4C0JA 1ADBA 3MYYA 1CDEA 1EWKA 1TQHA 1FPMA 3VGPA 1G3QA 5THXA 3W9UA 1WUYA 1HTWA 1QDUA 1UP4A 1XD2A 4KH1A 4N54A 4P4GA 5A62A 1KMMA 3F96A 4KL8S 1GFSA 3QGMA 3MM4A 3EXHB 2HSGA 3C3KA 1TU0A 5JQGB 4WZBE 1T9HA 3O4FA 2GNPA 4AJOA 3WZMA 1YS1X 2HYIC 3P0IA 3SC2B 3A1CA 4ZT3A 1N2IA 1I7LA 1LS1A 2BHLA 2VA9A 1CQJA 1R5OA 4PYNA 1EK1A 2BCEA 4DNFA 1T6ZA 3C0KA 1ECFA 1DS6A 4Z8XA 1ZG3A 2AEFA 3O95A 4NBLA 3GWGA 4DT1A 2IHKA 3QUQA 1K63A 1K9SA 1TYCA 4XLZA 1PJBA 1P9OA 1BX3A 3W04A 4BTVA 1MB0A 2ID9A 3N8NA 5AVJA 4E14A 3OE5A 3SBEA 2LRHA 3VNAA 4ML3A 3BREA 2CT8A 3COPA 1K98A 4Y0NA 5KDLA 3OQVA 3P1JA 3PENA 4H7DA 3RFXA 3BT7A 1S96A 3E9CA 3QW4B 1YS2X 3JQRA 5KOHA 4EKIA 1PSWA 3TQHA 4BBJA 2BE9A 2GZSA 1BJRE 3O1IC 4M53A 3QX7A 4X84A 1DLJA 1JKXA 2AOWA 3UV6A 2SHKA 3SJ7A 1ZVVA 1U8AA 4WLNA 1UBRS 3G23A 1E63A 1Z9BA 3HO1A 1F14A 3H83A 3GGGA 4I8IA 3R7DA 1A0OA 1K89A 3RHSA 2CVOA 1TAHA 1WRBA 3OIVA 4KIGA 2G82A 3EIEA 4QGAA 5K8IA 1PE0A 2AG8A 1U2DA 2PFSA 4V0ME 1YVEI 4LISA 1EJ2A 5E0KB 3TIXB 4HAIA 3H4MA 4U5QA 1F06A 2UUPA 4XIFA 1LH0A 5GJWC 4II7A 4Q7QA 3RBVA 5KTKA 5HSGA 1ECJA 3M6FA 4TZTA 2YIJA 3LDUA 1DUVG 3P94A 4GKAA 1U7DA 4RETA 2CK3D 2AC4A 3AVVA 5H68A 4AQDA 3NEYA 1OVGA 3OJEA 3QOWA 3F4BA 4QPCA 4EOGA 3DLCA 3I8SA 4R05A 4E7OA 1RE1A 5IJXA 3PHIA 4B34A 2UZIR 1SKQA 3BQ9A 3GJ5A 1K27A 2RGCA 4Z7OB 1NV9A 1Z4NA 1J5PA 4AJJA 2WF9A 5BXYA 4LFBB 3USES 3WNBA 1XP8A 1EQAA 3VI4B 1DHRA 3HS3A 3TQCA 3V4SA 3LK7A 3D4IA 4TRJA 4U7GA 5PNTA 3R8CA 4I1SA 3K0HA 2CFIA 3E3MA 1XRLA 4QOGA 2WWHA 2GAFA 3HWWA 4Z86A 4RANA 2JCSA 3BX1A 2FZEA 4MB6A 4JHXA 2B98A 2DUNA 4KN8A 3RKUA 2H0QA 3NANA 4XPIA 3KR1A 4UMVA 5JMTA 1B4DA 4BRSA 1DXHA 3LT5A 3GA5A 4BPRA 3F67A 1M6EX 4IWNA 5EZYF 5AIBA 3BRWD 2Q27A 2BI4A 4IUBS 2Z4RA 3DWGA 3FFXA 4RDHA 3GX1A 2KLBA 4LTDA 2V6GA 1QHHB 3BXGA 4M0UA 1IJEA 2VJMB 5CFQA 3GYGA 1W0JA 1QIKA 4AL4A 1ZEMA 4X6UA 4C7OA 2ISQA 3W2FA 3K6JA 2EFGA 3LOQA 2CBZA 3ZGOA 3HBNA 1DI0A 2RGUA 1ZOLA 3CLSD 3FIUA 1G1MA 1PFQA 3LLMA 3LUKA 3GFVA 4PWZA 1CJVC 3O6VA 4IXDA 4W5HA 4XYBA 4YBRA 1FX1A 3RK4A 3VTAA 2AD1A 4F12A 2GM9A 4PLFA 4DLLA 3OM9A 4FB4A 2MOKA 1F38A 3FDZB 5EIWA 1B1AA 1SUWA 3DNFA 4ZZ3A 2QY6A 3U6KA 4Y1FA 5FL7A 4BLSA 2TRSB 5GZ6A 3ROEA 4BEWA 3PYXA 1T1RA 1JXMA 3M8KA 2Q0QA 2XRZA 2C4KA 2F67A 3EH2A 3TX6A 1Z8NA 1NLMA 3OCXA 4ZTZB 1PWHA 1NPDA 1VMAA 2G5TA 4D4IA 1V96A 2VNJA 5I9TA 2O07A 2FFHA 1JHZA 4C0HA 1M6HA 3QELB 1WMDA 4EGFA 3PFCA 1FDRA 2VP3A 3E22A 1QYIA 3UYKA 1EUQA 4X7PA 5KQGA 4H1WA 4OI0A 3N8HA 3NNNA 2CHVA 3M2TA 3NX4A 3QYAA 1LTKA 2EFDB 1PCXA 1KO5A 2XQIA 4GKKB 5D86A 3C3JA 3AB3A 1R6VA 4XTCS 2OV8A 1SXHA 3NHPA 4FBLA 5DE3A 2GD0A 2R62A 1G6KA 1LXCA 4RTNA 2GM3A 4MQLA 1ZCFA 4BLWA 3DP7A 4R9RA 2BFAA 3C5CA 2CEAA 3WK9A 1NXTA 1AH2A 2YQ5A 2Q0HA 3WBBA 1L2TA 5KQSA 1QU2A 3G8CA 1WV1A 2HSJA 8GPBA 2P69A 4XRRA 4IOLA 3RRXA 4JEUA 3OX4A 4DQUA 4M8SA 1Y33E 2AMFA 3TOCA 4EKGA 1LBEA 3A3KA 3S2UA 3EXHA 4X94A 1R16A 1L4BA 5L6MB 1XK7A 5JNRA 5CCXA 4E3ZA 1M1UA 4O5OA 5C52B 2QYHA 3SC2A 2QM0A 4JBYA 1TM5E 3Q5DA 1YJCA 4LJ5A 2ZRQA 3PJRA 1A1SA 1DFGA 2ERCA 4BFZA 4GU5A 4BKMA 4HRAA 3FHLA 1FXWF 1SWWA 2CJYA 4S1WA 4HWGA 2YYZA 2W2QA 3T9BA 1MBZA 3V3TA 1NJ5A 2DR3A 3GEHA 3QVLA 4TVOA 2G7ZA 3II6X 5A4IS 3RCBA 1WXQA 3AR5A 3T34A 2ZBPA 5CLIA 4LY9A 4U7DA 3FF4A 1C0LA 2OZKA 1EJ0A 2B1RA 2WVAA 3Q3JB 1K4KA 3FNIA 4LWOA 4MUKA 4XQ0A 3EY9A 3G2MA 2OT3B 1SBIA 1L5QA 1UK7A 3L8YA 1ZUD1 2ZJ7A 3NTOA 3L0CA 5FPPA 1IXRC 1O54A 4YT5A 2NVWA 1ZMTA 2EAUA 5AFSA 4QNNA 3LKDA 3ZDXB 4FS3A 1H8HD 1RCUA 5FV7A 3CYFA 1KL7A 4D3XA 5JNVA 5KYKA 1RW4A 4JJ4A 4UW9A 2PZBA 4UNSA 4Q48A 1WWKA 4JLKA 1FNMA 3JWEA 1X7HA 1S8OA 3QOXA 5TDHA 3KKNA 3VJMA 1TQDA 2ZS8A 1CQZA 3IGFA 4L15A 4B5LA 1AF7A 4QQNA 3MWFA 1HPLA 4XM1A 2GCEA 2PX2A 2ZLBA 3TPCA 4XDGA 1C7QA 3SYLA 2PAAA 1BZYA 4BJ5A 4ZDKA 1LK5A 3VU1A 2R6R1 5B64A 4R40A 3BIOA 1OAOC 3CWZA 4CBVA 1RPTA 4IH9A 4XB2A 3GN2A 2ONYA 3FVRA 4Y6OA 5KDOA 2W42A 1V16B 1GUYA 4K6GA 4LC9A 3MD0A 1R5JA 4UNIA 2OUIA 4HCJA 4MV1A 1TD9A 4QYTA 3ZX5A 3M6UA 2VT7A 3KOWA 4QXAA 3OIDA 4MQEB 3U48A 3URKA 3VR4H 1VKZA 5BW6B 3EFOB 2C4VA 3EBOA 4JLNA 3DFMA 4TSFA 1NP3A 1X7DA 1PNVA 1RACA 3WRYC 1RTKA 4HFNA 4Y2GA 3TE7A 1L1FA 2P5UA 4GLJA 4RESA 1KIFA 3AY3A 1X1SA 2UYYA 1XRPA 4BRWA 2PUWA 1J39A 3BZUA 2YBDA 5BNIA 1M6YA 2ZKIA 2QTWB 2PXHA 3OWXA 1OXUA 2ZIEA 2XUKA 4OXQA 5LXTF 4X7RA 1J0BA 4YXFA 1IM2A 5KTOA 2EG9A 2C5HA 1Z0ZA 4OK6A 5GV7A 1DKQA 4UM9B 3LKVA 1ECLA 3BG5A 4RABA 2NUTB 3R75A 5BYKA 2XGMA 5JE8A 3B38A 3GUHA 3CRW1 4RORA 1QHHA 3WWZA 1PW5A 4R2MA 4R8SA 4BNJA 4WSOA 5KYVA 1FIUA 1QLJA 4OQNA 4MIKA 2WWRA 1A5TA 2V4MA 1RYNA 2HU7A 3IDZA 4YCLA 3J81k 3SJAA 3RIMA 2YYAA 3ZNOA 4IIJB 3M1IA 1FTYA 4MYSA 1Q17A 4C4TA 1J0AA 1XZMA 2NZUG 1VI2A 5D6NA 4AQ7A 4XFJA 1S2MA 4RXMA 5DISB 2A92A 1S8AA 4HH1A 3BXHA 1E77A 3ILXA 1XLWA 3HGTA 1E66A 5K05A 2HWYA 3FDZA 3JD1A 2XIJA 4A15A 3DCNA 3LQFA 4KYUA 3FZYA 4OSOA 2I03A 4HZIA 2D2IA 3BIJA 4R9NA 4RQAA 2RKOA 5T41A 4DUGA 5KNCD 4PS0A 1GT6A 3KJXA 1XDSA 4MV8A 4NG5A 3WNDA 2AFHB 2AFIE 1VE3A 3M33A 4Z1MA 1GNLA 4ABYA 4OLJA 5DRTA 1PTKA 5I45A 1NL3A 1FDWA 2REQB 5A05A 1Q95A 3UGJA 5BR1A 4JMPA 4PPQA 2V7EA 4JS0A 5F1KA 3VC2A 1IN8A 4O1HA 2QAJA 1JAHA 3QELA 3RJMA 1RAFA 1TKCA 2RHMA 3I2GA 5K2OA 5CIQA 5CLHA 1GKLA 2VAWA 2L2QA 4G5YA 5EP2A 4QOFA 5KTNA 5J47A 1UDWA 2BFOA 5C5EA 1WB9A 4A2QA 1J5XA 3E5MA 2VYVD 3MGGA 4BWVA 1QB8A 2XT9A 1H9BA 1WHSB 3E18A 4G5OA 1ZWLA 2BPOA 3GEMA 1A95A 1BYUA 1WG8A 2AG5A 5GOTA 5IZCC 4KVGA 2ON6A 1MB3A 3DF7A 2Q5OA 1RE0A 3ESYA 1QM5A 3TMYA 3PNKA 1V4VA 2ZRKA 1U2SA 2QJRA 5I6DA 4Z4CA 3H1GA 2E7ZA 3EEFA 3VDNB 5G2OA 4BLTA 4DHWA 4Z2YA 3WA7A 3RADC 4W7IA 3AVXA 2H4XA 3NBXX 2DBVO 4WNCA 3W5CA 2BEWB 1IEVA 2JH8A 3VKFA 3GGOA 3T1TA 3MGAA 3VR0A 1QIGA 3IIKA 3KT3A 1I51A 1OREA 2ZWVA 2D06A 3D64A 4JP1A 1DU4A 1YZUA 4WADA 4JI6B 1Z33A 2Z2XA 3ZNNA 1RXVA 1TJPB 1V6SA 1P7YA 1A9RA 3QWIA 4MPJA 4FZ3A 3H5WA 3W8FA 4DJAA 5AKGA 5JSQA 2BLLA 1D6SA 4IXTA 5AKYA 4J6FA 2I9KA 1K5HA 4XJSA 4EJFA 2ET6A 3C5HA 2XMGA 2ZT8A 1L5MA 5FTJA 2JLXA 3BICA 3SYTA 1HDRA 1HNNA 1YS4A 2BKXA 1FMJA 1MB9A 1EAMA 2H0RA 3E6AA 2UZ3A 4TWJA 2N1MA 2QPOA 4IOJA 3A6JA 3UCEA 5EXPA 2PGXA 5L3SB 5IM4F 1YVPA 2A2ZA 2ZEJA 3L46A 2CLFB 2Q3LA 2VDQB 3MUNA 3T7RA 5AP9A 2PAFA 4XEHA 3GDOA 1MUUA 4B32A 2AW3A 2O8VA 2ZJ3A 4L51A 5DRYA 3BXOA 2Q29A 3ICQB 4BE7B 1B8VA 4JOBA 4MUMA 1JHVA 3AERB 2BBTA 4D8VA 4AXXA 1U8XX 4RS4A 5U1PA 1T0BA 1TFRA 1GGFA 2AUNA 1JZSA 5BW5A 4X97A 1R37A 4MQ5A 1HDGO 4V02A 3U7RA 5DJ5A 2A88A 1H0RA 4KR3A 2JAOA 2I6QA 3MLBA 4ZXFA 3TVDA 1CUDA 2FR0A 3WKBA 5A4KA 1Q84A 3KAJA 3QE9Y 2JS7A 4MUGA 4Z0HO 3ZV4A 1P4AA 3I37X 1G8JA 5JIBA 3BKXA 4IV0A 2BJHA 2FZWA 2YXNA 2DB3A 2FPRA 3EIUA 2PKXA 5DYYA 1RP7A 2BV3A 2QN3A 4JCOA 4RX1A 5FNZA 1U2RA 1N8NA 3C6KA 1JYEA 3F46A 4LDJA 4GO1A 4E33A 1TM2A 4PSAA 1L7XA 1ZMRA 3AM5A 2G7MC 4Z7QB 2JBAB 3UPDA 4FFWA 3MMSA 4DLWA 5DO9A 2PWAA 3K0BA 1LU9A 2MYTA 1BMDA 4OJYA 4DMCA 5J5AA 5JDCA 4BEVA 4E08A 2VA8A 1V16A 1Y8ZA 1AHPA 4CRWB 4COKA 5KJ6A 4HJXA 5IDXA 5SY6A 3CG4A 1N2ZA 1M1XB 4D5GA 1T25A 2AF3C 2RGWA 1ZA1A 4W8GA 3DP9A 2JGIA 4NE7A 4MQEA 1KFJB 2V5UA 3B6JA 3EFOA 4QFCA 3BB4A 3K2IA 2JAXA 3D2BA 3K4QA 1ZD4A 2ATCA 4NNPA 3RDPA 3WLNA 2JEOA 2FPXA 3IPRA 5HG0A 3LWZA 1ODFA 3S4YA 4DIUA 3UUGA 5EHNA 2NTNA 3OOYA 3NC1C 4N48A 1RI3A 4CU2A 4C03A 1GSOA 1L4HA 2IPOA 2Q5EA 2ZT6A 1GPKA 1XRRA 2H0AA 4TKUB 2NUTA 1FRFS 4YH1A 4F0JA 1NWCA 4W5TA 3E0QA 4J7UA 1H2XA 5U4QA 3SF0A 1XMPA 2R6ZA 4XQCA 4B6EA 4ZCIA 2VQSA 1VL8A 3HYTA 4OQEA 3QWBA 4XSHA 1JKMA 3GFRA 4OHZA 1G8SA 3AGQA 3NVDA 1E9FA 2W2VA 3P96A 4J2OA 5M2QA 1VE5A 5FBKA 4V3BA 5GV8A 4DV6B 1NP7A 3E3LA 4IIJA 3RBAA 1Z28A 1NLFA 2CNLA 1CUXA 5AKJA 1ORDA 2O8FA 1Q1QA 2AG6A 5AVYA 4CLOB 4GKVA 2GEJA 3SNHA 3G9XA 4WLVA 3FJ1A 1XMOB 1LF5A 5D7BA 1QVRA 1HH4A 2A33A 3U0BA 1MEEA 2W2TA 3AH8A 5A3QA 3O74A 3UEOA 1RWVA 1M66A 4NH0A 4RPJA 5DLQC 2CXRA 1KFBB 3HDQA 4KLAA 3D8RA 2AFHA 4IRMA 4U9IS 3UTCA 1PZEA 3RVSA 3MWLA 2REQA 2YIMA 1L4GA 4OMDA 4ENTA 3FB1A 3M34A 4Q3DA 1Z08A 5KC8A 2J7KA 5DNDA 5L7WA 3ILSA 4HXEB 2HF8A 1G42A 5JPIA 3FI9A 1GDDA 2OV2A 3E7DA 3M81A 1C8BA 1AA9A 1TVKB 2A57A 2DX7A 3B6ZA 3D5QA 3GO4A 3FNRA 5I9BA 4V1CI 5K8LA 4DXHA 3CCBA 3VR6A 1JXOA 1M34B 1I4EB 2ZBEA 1WB5A 4WE3A 1WHSA 2BMWA 5NLLA 3T9AA 1NUUA 1KPHA 1WQ1R 3OTGA 5D87A 5IJ9B 5GJBA 3L5OA 2QX7A 4W82A 5JT1A 2RONA 3ADBA 4J1NA 1DHTA 1CD5A 4JJEA 1L7RA 2W6NA 1JIUA 2C2GA 2BDTA 2NO6A 3GLGE 4EZBA 4KQGA 3D7KA 1VPVA 3V4PB 4L4YA 5ELXA 1V8FA 1Z45A 2BEWA 1YHYA 1PEKE 5ITVA 2E4VA 2C31A 1R64A 1VRWA 3DBVO 2W58A 2OCIA 2ASEA 1WCYA 2PZ8A 3GT7A 3QXGA 5DBHX 3U4GA 3H2HA 3JWGA 3H6GA 5CCBA 1SM4A 1GUZA 2P1DA 1U02A 1XTSA 2EQAA 2HGZA 3WL3A 1ATZA 4DMMA 1QCZA 3E23A 3ET5A 5THQA 4RVSA 1KVSA 4PSKA 1DQPA 4IMIB 2X9LA 3AEYA 5REQB 1EE1A 1H2HA 2AL7A 3S1LA 2VCEA 2O1SA 4MMZB 1XGKA 1ZXXA 2ZI4A 3PD0A 3SGLA 4KUHA 2QUJA 3H16A 1G8AA 2CLCX 4MI9A 4PFJA 4PS1A 3BOSA 5L3SA 2C58A 2OO7A 5ALLA 5B55A 3D6JA 1G2OA 2CLLB 2V3VA 1FUIA 1RVDA 5FEMA 3TFWA 5L8VA 2ISSD 1DX9A 1GKIA 1N0WA 1Y1KE 2QVLA 5DN6A 3RF6A 4BEJA 2DKFA 5FTMA 3TSYA 3UAYA 4GRAA 5LVAA 4K3VA 2VHUA 3KKMA 1Q16A 2YHSA 3IDOA 4E07A 1RLMA 3AERA 1PNQA 2DFDA 4CV0A 1JECA 3U80A 4WZBB 2EF1A 1DX6A 2QWXA 4HGPA 3TLXA 5IN4A 3GVIA 2XRFA 4Q16A 3M5PA 3HACA 2JLUA 3EGOA 4HPJB 3FAKA 3G5TA 3CEJA 5JJ5A 4A8HA 1Z2DA 4LDQA 3EB9A 2HU2A 4JB8A 1D1PA 3AI7A 1PFYA 3EXHC 1IHXA 1PL7A 1Y1SA 2EX0A 3LL7A 1JLKA 3NB0A 2WB4A 3T1HB 4RK7A 1DJOA 2COUA 3UHPA 4YT8A 4EJ0A 2A14A 1FFGA 4CLHA 4TMWA 1ONSA 1J2TA 1I2DA 3FPEA 5A7FA 5K45A 3AXTA 4DB2A 3C3AA 5BWBA 3HWX1 3EGCA 2JBAA 4HVAA 2H06A 2P3QA 4V2IA 3ZJ4A 2QMHA 2WAYA 4XARA 3NHYA 5H9VA 3C7DB 1U04A 4NZNA 1QKKA 3G88A 1KEUA 1CUCA 1WVMA 1Z5ZA 2B7BA 2JB9A 2YINC 3ABIA 2J59A 2XYHA 1JHOA 1MTZA 2HJRA 4Y8VA 5IC5A 3SHQA 5C7YA 1QZTA 2Z0MA 5F3DA 3UIEA 4J43A 1Z6TA 1DL5A 1PR0A 4UM7A 2FK7A 2GZHA 2EWVA 4S1OA 1GXSB 2O23A 4URYR 5CFZA 1LJLA 3AZOA 4KPGA 2Q62A 4LDRA 1HEYA 2P11A 3GJXC 1U9ZA 1N7GA 3HCBA 1N3BA 1HR0B 3OT4A 1NN1A 3PUYA 1SBQA 2P2NA 1EX6A 4EUKA 4IHKA 1YDEA 2PLAA 4PYMA 3R20A 3ZE1B 3OZSA 3H9GA 3PHHA 3FYHA 4M1WA 1MV5A 1P2BA 2GAJA 3KZCA 4MS4B 4B4OA 2EEZA 3N2EA 1UMDB 2NAPA 4ETIA 1T5BA 4N8EA 1UINA 4UTRA 1E6KA 3KM0A 3HXQA 1NKSA 3S5UA 1X8LA 1XHEA 1P33A 2R6AA 1ESNA 3GEGA 3MG9A 4RD1A 4TKUA 3QU7A 4LPSA 3NU1A 3GJQA 4ZC8A 3BMCB 1NW3A 1QWOA 3FUCA 4LG1A 4Y2PA 1P80A 5DPMA 3RTAA 2J0QA 2B3DA 3R77A 1D0VA 1JJ7A 3H5OA 3HSSA 2IOFA 4JB2A 3EQ6A 5ANRB 3UO8B 4DARA 5HM8A 4HQFA 4NCKA 1K7EB 4A27A 4C6TB 3DZIA 3G6WA 3L1JA 3PFNA 4KWCA 1Z4MA 2CKMA 3WLKX 1VLZA 4PYQA 1EFRA 1DOZA 1HK7A 3ELUA 4KSCA 4GIBA 4BGVA 4CLOA 3BB1A 3EC7A 5T6MA 4EB0A 1GGVA 1NAIA 2OLEA 1D2CA 4M0KA 5P21A 5KO2A 4KPFC 3WR5A 2Y0BA 3ICCA 1MOQA 1WD7A 4FNAA 3L8HA 5HJ7A 4QDJA 3CY6A 5FLKA 2QTAA 2WA2A 2RMKA 3TL3A 3HO8A 4WMLA 2PMCA 2FDRA 1KNQA 3C3DA 3CUTA 1FP7A 4K28A 3QBJA 4QRDA 4K2AA 3KS9A 3IVXA 1T8WA 4OBWA 3GAFA 4CIVA