3ZHBA

R-imine reductase from streptomyces kanamyceticus in complex with nadp.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
289
structure length
288
Chain Sequence
EHTPVTVIGLGLMGQALAGAFLGAGHPTTVWNRTAAKEPLVARGAKSAGSVAEAVAASPLVVVCVSDYDAVHALLDPLDGTALQGRTLVNLTSGTSAQARERAAWADGRGADYLDGAILAGPAAIGTADAVVLLSGPRSAFDPHASALGGLGAGTTYLGADHGLASLYDAAGLVMMWSILNGFLQGAALLGTAGVDATTFAPFITQGIGTVADWLPGYARQIDDGAYPADDAAIDTHLATMEHLIHESEFLGVNAELPRFIKALADRAVADGHGGSGYPALIEQFRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords R-IMINE REDUCTASE
publication title Structure and Activity of Nadph-Dependent Reductase Q1Eqe0 from Streptomyces Kanamyceticus, which Catalyses the R-Selective Reduction of an Imine Substrate.
pubmed doi rcsb
source organism Streptomyces kanamyceticus
total genus 101
structure length 288
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zhbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zhbA01
1KOLA 2OHXA 1GUZA 3MJTA 2ZIZA 3DFZA 4NU6A 5FI5A 2VRCA 3VH3A 5KWEA 1NAIA 1Q2XA 2D59A 2Z1MA 2FSSA 4DWVA 1N7HA 4OOEA 4YA6A 4FN4A 4E21A 3ANNA 4Q3EA 1P31A 5T57A 4EJ0A 3FR7A 4NIMA 1E6EA 4WCDA 4ND1A 2I3GA 2NM0A 5KJ6A 5DCYA 4YAEA 5HRUA 1NR7A 5DBGA 4DTIA 2AHRA 2DPGA 2OL4A 2ZTLA 4BOYA 4TWRA 1KY5A 4JQCA 2UVDA 4DMMA 1LQUA 2YJZA 3H2ZA 3NGLA 1JKIA 2NQTA 3AUTA 2O23A 3TSCA 4XB1A 1WW8A 2WM3A 3VPGA 4Z9FA 4JX8A 2PV7A 4FFNA 4QO7A 2IRWA 5EESA 5A02A 1O94A 2OXIA 4NI5A 3L9XA 1WMBA 3U3XA 1ADBA 4ZRMA 1R0SA 5TC4A 4Q39A 4DPLA 3DAGA 3VDRA 5T8KC 4ZJUA 3FCOA 1HE4A 4B4WA 5JO0A 1X1EA 4BO2A 1UXGA 1E7MA 4UUMA 4IJWA 5BSGA 1I24A 5ENDA 4ITUA 3JQ6A 2FN7A 1ZEMA 4R54A 4PG6A 4WECA 4J3FA 3WGYA 3AW9A 1FDSA 2RAFA 5I8ZA 5A06A 3RAJA 4EJMA 4CM5A 1JWAB 3B1JA 4BKQA 4IZHA 4UVEA 5T6BA 1FMCA 1C0IA 1M6WA 4YTEA 3UAGA 4JCOA 4JNKA 4OOFA 4D45A 3FPLA 3TZ6A 4RVFA 3W4JA 1O8CA 2J3HA 3UHAA 4INAA 4LRTB 1F8GA 3I23A 4BO0A 2QX7A 4WLUA 4GAEA 4ALLA 3PJDA 4GGPA 4BNIA 5IZCC 4C7KA 2O3SA 1HDOA 2AG5A 3ZI0A 4A27A 1NQAO 2G5CA 1HETA 1TVEA 1ZSVA 4I5FA 4IDCA 1R4NA 1V9LA 4FOOA 3STHA 3PYXA 4RVGA 4BB6A 5KVSA 2YFQA 3GHYA 2WD7B 2HMUA 1SNYA 1MV8A 1DAPA 1OC4A 1PZFA 4OGWA 1PR3A 2D5AA 4AFNA 4TSKA 3OJ0A 3OJEA 4IQGA 5AXBA 2GPTA 4YT2A 1FDUA 1V8BA 3BMOB 3CZRA 3ZWXA 4BKRA 3GFGA 3ZWMA 5CDUA 2W4QA 5JC8A 4IMPA 3PRJA 4XRGA 3P7MA 3KRTA 4F46A 1CYDA 3JQAB 3WIDA 3C7DB 1ZUD1 1PL8A 1SZJG 3W4IA 4XQCA 3OEWA 5ILGA 5A9TA 5JNLA 1T24A 1LDGA 2I67A 3LC7O 3DQPA 4Z9YA 1DRVA 1OFGA 5BNTA 2O4UX 2PH3A 4UREA 4DLBA 5CEFA 2ZATA 2DPHA 3MEQA 3ADPA 4IDDA 4M49A 1GR0A 5K9ZA 3DL2A 8LDHA 1D4FA 2X22A 1EQUA 4D3DA 3UKOA 2O50A 2J5KA 1NX6A 5DCUA 4W7HA 5GZ1A 1F12A 1E3WA 1PGNA 3KV3O 3NKLA 2X9VA 1IE3A 1MG0A 3I3OA 4IXWA 2WD7A 1I30A 3O38A 3RKRA 1JU9A 4JLWA 2Y1FA 1I3KA 4FFRA 1YDWA 2PGLA 3WBBA 1L7EA 4HNGA 3B1FA 5DCWA 3JYQA 3JQGB 3I9JA 1N7GA 5LDHA 5G0TA 5DZSA 4GMGA 5EERA 1LRJA 3GNSA 2YW9A 4I9NA 5I9MA 4HBGA 5A3VA 4CLEA 1HTBA 4OXKA 3TRIA 3NDJA 5F1OA 4M8SA 4OYRA 3U62A 2X0NA 4Z0TA 4D46A 3ZHYA 3DMYA 4QO8A 2FZEA 2JCXA 3WMXA 3VH4A 2CSUA 4S3MA 5C5IA 4P4LA 4OL9A 1N9GB 2X4GA 2JFGA 5KVQA 2YQ5A 3P2OA 5DP1A 1ZCJA 1C14A 5I7FA 5TQVA 2GZ2A 2HK9A 2ZJ0A 1XA0A 3AUSA 3ZWAA 1EK6A 3FR8A 1WZIA 1ZXBA 4GI2A 1M6HA 3GVIA 5L7WA 2PK3A 5DNAA 1LLQA 3AWDA 1T4BA 1P1JA 2W2LA 2BGMA 2X9NA 3JQEA 1HF3A 4L76A 3X2EA 1I36A 2DQ4A 5A9RA 1IPEA 4IGFA 3V5NA 3C3XA 3GFBA 1SB9A 4WGGA 3NT2A 4NPCA 1ZK4A 4W7IA 1WWKA 1EUDA 1UXKA 3JQGA 4WE3A 2NQ8A 4BNKA 4G5HA 4R1NA 5JLAA 3X2FA 1RM3A 2P91A 3LZ6A 1B16A 2BI7A 3DB2A 4X54A 4XIJA 2IEBA 1KVTA 2EXXA 2H63A 4UUNA 3QVTA 3JQFC 2EV9A 2B36A 1JLLA 4RLSA 2Z5LA 2BFOA 5A4DA 1HZZA 5KVVA 1I32A 1R6DA 1QLHA 3WLFA 4IM7A 4DLLA 3GEDA 2YHIA 3UGKA 1LDNA 1P0CA 2AXQA 2EW8A 4QTZA 5BR7A 5TNXA 3AFMA 4CMBA 4MVJA 4G65A 4FGSA 4FS3A 4TRMA 1GYRA 3FI9A 1NWHA 3AOEC 5AXDA 2E48A 2W98A 5G0SA 2FZWA 3PLRA 3BMNA 1WDMA 1V6AA 1WMAA 2YFHA 3ITDA 3VPFA 1N1EA 1NXQA 2P4HX 5HTOA 2W8ZA 3D0OA 3ZV6A 1WLYA 3S1LA 3NTQA 4J2OA 4PLFA 3P2YA 4PVCA 5JAZA 3ZDFA 5KKCA 3LF2A 2GDZA 4IY1A 3RUIA 2GR9A 3OA0A 3RUCA 4YB8A 3H5AA 1EZ4A 1BXZA 1OC2A 5A5EA 1ZBQA 1S7CA 4CLRA 3E5RA 4IJVA 4P22A 1KBZA 3VOSA 5EINA 5F1KA 1HLPA 2NTNA 1U5AA 3V8BA 4RO0A 1HT0A 2J3KA 2C07A 9LDBA 1GYPA 4YAGA 5HS6A 1I33A 2X58A 1EE2A 1QMGA 4L0QA 1ULSA 5T67A 5JY1A 4XWYA 2SCUA 2Y1OA 1KC3A 4I5EA 1B14A 2B5VA 3I52A 3CE6A 4MKZA 4AJKA 1XSEA 2GO1A 2OGUA 4O0LA 3GN1A 5THQA 5LC1A 1GL3A 1MC4A 3GR6A 1B2LA 3ZV5A 1GV1A 3ETEA 1PGJA 3RBXA 1E5QA 1PQUA 1ONOA 2Y1GA 4IUYA 5B4TA 2EP7A 2B4RO 3K2EA 2EWMA 3ENKA 2OFPA 2QZZA 1OAAA 3DHYA 5G4KB 3OBBA 1GDHA 1UAYA 1Q7GA 1DFGA 3TWOA 4TVOA 4R9RA 3HUDA 2DTEA 1V3TA 1OMOA 1LBEA 2OBNA 2VRBA 3JV7A 1PJQA 3BIOA 4E5PA 5JXWA 2B35A 2F1KA 3JQ9A 4IXTA 4URFA 4BMNA 2JD1A 2I5PO 5B12A 4IDAA 3RU9A 3NT4A 1MA0A 3AY7A 1DFIA 4WCFB 1YONA 1NYTA 4NDNE 4IPTA 1MP0A 1DIRA 3S2GA 4CM4B 5H81A 4E5NA 5AYVA 4A26A 1YOVB 4PFJA 4KUEA 5JDIC 3H3FA 4BO5A 3FHLA 2O3RA 3I9KA 3ZNPA 3ZHZA 3CPSA 2DTXA 3PDJA 3WQQA 3JD3A 1T1RA 2BLLA 3RJ9A 1YB5A 4AJEA 3OF2A 4E6PA 5JSFA 1W4ZA 2YHUA 2V65A 2I65A 4LMPA 4CMCA 2OO5A 1QYVA 4IINA 4OKIA 4EUEA 5A5FA 4TZTA 5CHEA 1XCBA 1E3EA 1O0SA 2D1YA 2HQ1A 2NUAA 2ZTMA 2GERA 4J9UE 4CMIB 1EVJA 3VZQA 3B1KA 1D1TA 1PZEA 1E5LA 1YBMA 5JS6A 1YRLA 1IOLA 5L45A 4UULA 3BHIA 3NV9A 3I4CA 1H9AA 2I76A 1I3NA 3ANMA 2P9EA 1AXEA 1ZK1A 4GVLA 4XB2A 5TSDA 1MXHA 1NP3A 1PWXA 3A28A 1SB8A 3D7LA 4YAIA 4U7WA 5IDYA 4B4OA 3PHIA 5JCJA 1LXCA 1LDEA 5L40A 3NX4A 1GFSA 2P9GA 1WDLA 2DFVA 4RZIA 1KETA 1Z75A 3FBTA 4WCFA 4Y98A 5L4NA 1GU7A 1EUZA 1U8FO 4Y9DA 3DXFA 3LT2A 3L07A 3RWBA 1I5RA 4LGVA 2GN4A 3GG2A 1AHHA 2QW8A 1YBAA 3C85A 3RC1A 3SJ7A 3CH6A 2WYUA 2BMAA 4PLYA 3O26A 3B20A 3UXYA 4KP7A 4DREA 4YPOA 3RROA 4PLGA 1CETA 4CMKA 2OOSA 3ZNQA 1NQTA 2P68A 1YL6A 3FN4A 4TROA 2DT5A 3JD1A 3RC9A 4YXFA 4J7UA 5HM8A 4AJOA 5KJCA 3G17A 5HBRA 2EJVA 3DMTA 3P19A 3QWHA 5BSHA 2D8AA 3C1OA 3CUKA 3E9NA 3GT0A 2FR1A 3D5QA 2C7GA 2D2IA 2NLOA 3FNHA 2PD6A 4DVJA 5L7TA 2EHDA 3PI7A 3EAGA 3AY3A 3JQCA 1O9BA 4P4GA 3BTOA 1R0LA 3IDSA 3OJFA 3DZBA 3Q9UA 1K89A 4CV1A 1BDBA 4BQPA 3K9QO 2GD1O 3LVFO 3A1NA 4FOSA 5COBA 1WNTA 2J8ZA 3PZRA 2PWZA 4HXYA 2Q1WA 3BTVA 4WNCA 5EL0A 4UVHA 4BO1A 2HMWA 3I9LA 2VT3A 2BFAA 4OIMA 3ZWBA 1GYQA 1X0VA 5EQFA 2PGDA 2ZYGA 3I9MA 5F3RA 4K28A 4AJIA 4AJ4A 2POQX 1YL7A 2PKRA 1VC2A 1YWGO 2QRLA 3EZYA 9LDTA 2NVUB 1AXGA 3TQHA 1Z74A 3BZUA 3F4LA 5IFLA 3S8MA 4RPJA 4B4VA 3H9QA 3F4BA 5T64A 4JK3A 4EUHA 2RH4A 3EK2A 3F1KA 3B6ZA 3IL2A 2I9PA 1Z45A 1LSSA 4Q3CA 2NWQA 4UEKA 5A04A 3RFVA 1UUFA 1HE2A 4UUOA 1FJHA 2VT2A 3PQEA 4RQUA 2LDXA 4MP8A 3WNQA 3PWKA 1PSDA 1O89A 2QHXA 1H6BA 3U49A 1HDGO 3WYEA 2O4CA 3IIEA 4HUJA 1NPYA 3M2PA 1N8KA 1PJLA 1IHXA 2J3IA 3HB5X 2EKLA 1YB1A 1R15A 5DOVA 1PS9A 1GEGA 2VWHA 1H93A 1H2HA 5KJEA 4BHTA 3FNFA 3UCXA 4RZHA 3UUWA 2C2YA 3COSA 2HRBA 3OA2A 3OSUA 4TKLA 5LDGA 5C7IO 4L4XA 4EGFA 2PR2A 4HFRA 4DYVA 2A94A 4FDAA 2NTJA 3C8MA 3KETA 5IG2A 5ILOA 3K92A 2DU8A 1KVRA 2Y99A 3WB9A 2BF7A 5C3MA 4ND3A 3T7EA 1ZMTA 2WE7A 3PWZA 1HXHA 1PTJA 4L9RA 5FYDA 3ZH2A 3KB6A 1JKFA 3I1JA 3TF5A 1RYEA 4AJLA 1DB3A 4II2A 5JAMA 1U3UA 3WMWA 1YQDA 2P4QA 4R16A 5HWSA 2O48X 2O3QA 5DF1A 1Y5MA 1ZMOA 4AJ2A 3CSDA 4RPGA 1Y81A 4MDHA 4OAQA 5IJZA 3DDNA 4NJOA 3NEPX 3VAZA 3WGHA 3ETGA 3UCEA 1KVQA 3SJUA 4B3IA 4ZQEA 4KTTE 1XU7A 4J1SA 4J90A 3C1AA 4F6LA 4CQMD 4NJMA 3OECA 4P8RA 1LI4A 4GPD1 2B4TO 3DAPA 2PZMA 3RC7A 3H5RA 4IIUA 1DPGA 4NFSA 3DHEA 4J0EA 1LC3A 3RUEA 1Z7BA 2Q50A 4A5OA 4J1TA 4NFYA 4BNTA 3LK7A 5ITWA 3VZSA 2UV8A 2OBYA 4NBVA 2GGSA 1A9YA 2CDCA 2X86A 1YDEA 1JVSA 1SPXA 2D0IA 3D3WB 3E9MA 3RKUA 3DONA 1ZK3A 1DAOA 1LDBA 1DXYA 3MJ4A 1GZ4A 4J2HA 4J16A 3UICA 4B8WA 3V2UA 7ADHA 5IXSA 5TJ9A 1RJWA 1O6ZA 1CEQA 4B7CA 4D44A 4J7XA 1ZIDA 4RORA 4KUGA 3WTBA 3PIIA 5BSFA 4O63O 1OZAA 2D5CA 3GZNB 1H6DA 4CMEA 2D3TA 3C7AA 4PG4A 1B0AA 1E3SA 1A71A 1ARZA 1Q0QA 4OJNA 3JCZA 1BVRA 1HDXA 3OQ1A 1KC1A 4M89A 2OP1A 3WQSB 3EY4A 3KOUA 3GEGA 1HZJA 4EI2A 4OQYA 1A9ZA 1IHYA 1EVZA 3OH8A 5L51A 1C0LA 3CIFA 5L7YA 3FWZA 1LRLA 3V2HA 1KVSA 3MWDB 3R0IA 4DPMA 1P1IA 4PZEA 1XU9A 1UZLA 1XHLA 1ZJYA 4M54A 1HRDA 2VN8A 5DP2A 3T7CA 1HSOA 4YDRA 1FK8A 5C7LO 2JKVA 2VNAA 2FRDA 3GGPA 2VWPA 1HDCA 3H65A 3KEQA 4YRAA 4GX5A 3QP9A 1XQ1A 2V6BA 4JROA 4ZQBA 4LISA 5AXCA 3PVZA 2B4QA 2I3AA 3OETA 3ROMA 2XF8A 3KEOA 2EGGA 4FFPA 3DBRB 3UVEA 2BGLA 4HY3A 4MJLA 4Z0PA 4CV3A 4TRNA 4ZGWA 2GSDA 1ULUA 6LDHA 3GZNA 3QSGA 3WFJA 4RPHA 3UN1A 4CM3A 3I6QA 3GDGA 1GZ6A 1Y9AA 3QIVA 3ZWWA 2I99A 2B5WA 4ND2A 4W6ZA 2Y93A 4D3SA 2HKIA 3PJGA 4JJGA 4XQ9A 4E32A 3F5QA 1ADCA 4L4SA 4DQVA 3AU9A 3I9OA 4D41A 3L6EA 4PLTA 4EITA 5KIAA 1UDAA 1I3LA 1ZXLA 3GZ4A 3A9WA 1H6AA 1IYZA 3TOXA 5A9SB 3P5SA 2A35A 3OHSX 1NFRA 4EEXA 3DBLB 3U9LA 4FFOA 4CM9D 1YB4A 3DZJA 2NV6A 1U2GA 3PHLA 4IQ8A 1PGOA 2C2XA 3EGOA 4U0JA 4BNZA 3QV1A 1I0ZA 1ZW1A 4WLEA 2QYSA 1KEVA 1B8UA 2IZ0A 4MVJM 1OBFO 3D64A 4XZ3A 4RF3A 3DBRA 2RBEA 3G49A 2VQ3A 3IJRA 4M55A 1U28A 1I3MA 4R1TA 4YT5A 2FR8A 1UP7A 3L77A 5U4QA 2VWGA 4CMHA 3HFGA 3AM5A 3ORFA 4UAGA 4AJ1A 2CF5A 2WDZA 3K8ZA 2P9CA 5BQFA 1Z7EA 3PYMA 1E7QA 3QW2A 3JTMA 3AM3A 1HDRA 3O03A 5H82A 5TIIA 1P44A 1YXMA 1GCOA 3L4BA 5TS3A 3ZU3A 2P5UA 4OQZA 3SC4A 3HDYA 2CY0A 2P2SA 4E2YA 3WIEA 2BHLA 2UDPA 1KVUA 4GGOA 4ESOA 4FJ1A 3GAFA 4BNJA 3PLNA 2AG8A 4J1QA 4E5MA 4DIBA 3IUPA 1YGYA 2VOJA 3VH1A 1UP4A 4ND4A 1RM0A 2V7PA 3S2IA 3H9UA 4Y6RA 5BT9A 4BO3A 5FWNA 3OM9A 1T25A 2BELA 1EDZA 1R16A 3PYLA 2EIHA 1RKXA 4K1LA 2QG4A 1ENOA 3RU7A 1TT7A 1AHIA 1LU9A 2DLDA 3MOGA 4CR7A 2GN6A 1EDOA 2Q46A 3IP1A 3TFOA 2G17A 1NHGA 1Y5RA 4J43A 2FY8A 4JBGA 4WLNA 4ZQFA 2E49A 2X9GA 2PZLA 1DO8A 2BH9A 2GUGA 4Y6SA 4PRLA 3NT5A 1CIVA 2X5JO 3WSVA 1ZEJA 3PJFA 1DRUA 1PJ2A 3G0OA 4WK6A 1YL5A 2C29D 4FFMA 4XJTA 2UYYA 2EJWA 2HK8A 3CZMA 3DZGA 3KVOA 3RUAA 2Q2QA 1XQ6A 1D3AA 1E3LA 1N5DA 2VRCD 3H7AA 3TL3A 2ILTA 3WWZA 4QXMA 1T26A 2OP0A 1TI7A 3IKVA 4N54A 4PLZA 5ES3A 4Q3AA 4JBHA 4JIGA 1PS0A 4KWHA 4MP3A 2NNLD 4BNVA 4BNYA 5KOIA 3QJ5A 3Q1LA 5MDHA 4MIYA 3KHUA 4DBZA 1Y8QB 1C1XB 4KMSA 3BMOA 4ALKA 4Y8VA 5AOVA 3NYWA 1ADGA 1T4DA 2DFDA 3VPSA 3K96A 1HL3A 1DBVO 3GEMA 2DUUA 3TL2A 3HDJA 4ZQGA 1NFFA 3AM4A 3JQAA 3ADOA 1K3TA 3K2BA 2X7HA 4OKNA 5GZ3A 1Q1NA 4RDHA 1IB6A 3E18A 3TDKA 1S6YA 1PJTA 1LLCA 1MGOA 4IS2A 2NSDA 3GH3A 5TRTA 2FOIA 3TZQA 1F8FA 1C0PA 2O3JA 4CMAA 5AXAA 1DC5A 2A92A 2O3UA 1HKUA 3CTVA 4ZHSA 3W4KA 5IAAA 3WGIA 4XCVA 2C54A 3R3JA 4R5MA 2XXBA 1O5IA 3WGOA 4A73A 1SOWA 2CF6A 2YYYA 5HA5A 1PGQA 3AFNA 1U8XX 3WOHA 4XGIA 1Y7TA 3ZV4A 4HADA 5K0ZA 1GEEA 1I2BA 3E48A 3GY0A 4Q3BA 3F46A 2O2SA 1SOVA 4RVSA 4FBGA 2AMFA 4BS9A 1DC4A 1Y8QA 1Q7BA 1PQPA 3DMTC 3EVNA 4KDEA 2CD9A 4Z9XA 4FW8A 4MVJE 1OI7A 2ZTUA 4G81A 3BXXA 4HP8A 4CUJA 2ZTVA 2C59A 1LSUA 4CQLB 1JDJA 2HK7A 4IDBA 3OEYA 4CLDA 2ZB4A 3GA0A 3WXBA 4K6FA 4EW6A 2P5YA 1SBYA 1T2DA 2O7SA 2PKQP 3GUYA 4B4UA 1NBOA 3E03A 1N9GA 3Q2KA 4ZD6A 3RD5A 3JYOA 2BFPA 2CFCA 4RF5A 4ZQHA 2EF1A 4NH4A 4U6QA 3WLEA 4P38A 1PX0A 1ISGA 3GAZA 1BG6A 1I8TA 3ENNA 4LSWA 1NASA 3LLVA 3ITKA 4ZVVA 5JMWA 1UXHA 1GV0A 1FDTA 4KQXA 4WPGA 5TT1A 1PJ3A 1JQBA 3KLMX 4CMJA 3JYPA 1VJ1A 4RCVA 4TZKA 2GF2A 4BIIA 3DO5A 4TRRA 3WQRA 1E7SA 2Q45A 4IS3A 4MKRA 1KS9A 2C82A 1F0YA 2Q1UA 2V6GA 4MOWA 2PZKA 3LDHA 3LT0A 4OMUA 2FPPA 5DBFA 2Q2VA 3D3EA 4XDYA 5JMPA 1ZSYA 3ZN2A 1D8AA 1VSVA 1Y9EA 4BNLA 1XWFA 2Y68A 2R2GA 4CQLA 1L7DA 1P1HA 2X0IA 1SMKA 4YQYA 1G6KA 2JHFA 2X5KO 1DLJA 2VYVA 4YEDA 1ZK2A 1LSOA 1ENPA 5G4LA 3A14A 5U9CA 3GC6A 1PJ4A 3VPHA 3FRJA 4I1IA 2JAPA 4BNFA 2HRZA 5IZ4A 7MDHA 1KERA 1DC3A 3INRA 4BGVA 2HDHA 1G1AA 4J4TA 5I9LA 5L9AA 2YV2A 3Q9NA 3RC2A 2ZB7A 4R69A 3AJRA 3H8VA 4BNNA 5CDTA 4D43A 1U1IA 2EGHA 3A06A 4R3NA 3KSDO 3ZNNA 3HDHA 1A7KA 1RYDA 1XYGA 4FSHA 4AJNA 1H5QA 4YJHB 3QVSA 1YVEI 3ZHXA 2VYNA 3OIGA 3T4EA 5CEEA 2IYPA 1CWUA 1XIVA 3A4VA 3CXRA 3RUHA 1DIGA 1K6XA 1IL0A 3RFTA 5EPOA 3W8FA 1ZK0A 1SO8A 3DOJA 4J91A 4MO2A 1LEHA 3ZHBA 3RASA 3UOGA 4YYZA 4L4RA 2HJSA 2C0CA 4ZN6A 2CDAA 4LCEA 2JD2A 1Q7CA 1VL0A 1N1GA 3GQVA 4XX0A 5EMHA 4Z3DA 2JL1A 3EYWA 4BNWA 3D1LA 1WZEA 4QX6A 4EBFA 1E7WA 3S55A 3WS7A 1LC0A 2D4AA 1AE1A 3I9NA 1B7GO 2ZQYA 1W6UA 3KO8A 3GRKA 4J6FA 3PK0A 1GZ3A 3JD0A 2W2LD 3RBZA 3WGZA 1MC5A 2NTVA 5DULA 3MJVA 1ZH8A 1YE3A 3UW3A 1D7OA 1AN9A 4ZA2A 2DVMA 1EQ2A 1XEAA 3DBHB 2GN9A 3INGA 4BNGA 5G4KA 5IXYA 4AICA 2O7QA 5TX7A 5ER6A 4KTVE 1IPFA 4YT8A 4YJHA 2GLXA 4XDZA 2VUSA 1LTHR 4KZPA 1E1NA 4EDFA 4HFJA 3SEFA 2DKNA 4NHEA 4E4YA 3GPIA 1U4SA 5A05A 5TF4A 3F5SA 3WGGA 2PA3A 1EE9A 1IZ9A 4CUKA 4W9NA 3QWBA 4CM4A 1NQOA 5G0UA 1T2AA 2F00A 4N7RA 3JQBA 1TT5B 2Y66A 3PGJA 1YOVA 4I5DA 3WX0A 3SX2A 1Z82A 4YAKA 1E0DA 4CLOB 2O3TA 4F6CA 1MXFA 3MJEA 4MVJD 2B69A 3O8QB 3U5TA 2VHYA 5FEUA 3QVWA 4CMEC 4BO4A 4NBWA 1UDBA 3FBGA 1Y8RB 5COQA 4BB5A 5KJ1A 4RF2A 4UEOA 4BO6A 4N5MA 5G2OA 5A03A 3SLGA 1DIBA 3RBVA 5CDGA 3PWSA 2W2KB 3ROPA 1GTMA 3TZHA 4YR9A 4CMIA 3MTJA 2EW2A 3IP3A 5TLSA 1PIWA 3HFSA 5JDCA 4KDFA 3H9GA 3GVCA 1BHSA 4MPDA 1U2DA 3PPIA 1HYGA 4OXNA 3K6JA 2AEMA 4DC0A 4GX2A 3RQSA 4DQXA 5COAA 1R37A 4IDEA 4YWJA 1NAHA 3ZU5A 3SVTA 2JCVA 3QQPA 5TT0A 4BUCA 2JHGA 1RM5A 4E33A 3S2FA 1MUUA 2RH8A 2YUTA 3EUWA 3GK3A 1H0KA 4IQ0A 4E2ZA 1UZMA 4HKTA 2Z95A 3ABIA 1B8PA 3JQFA 1T2CA 4MVJI 2WEKA 5G0WA 1VJ0A 4I8XA 1HDZA 3CMCO 1I10A 5AVOA 2QQ5A 2VTDA 2DTDA 1YH3A 1Y8RA 4PG8A 3ZW8A 2ZQZA 4BKUA 4GSKA 4W99A 4DGSA 3AU8A 3DOCA 1VKNA 5CPFA 1LNQA 4B79A 2DBVO 3DBVO 4XRRA 4L8VA 4LSMA 5I7VA 4R1UA 3LF1A 4HX5A 5ADHA 3MOIA 2OUIA 4IDFA 1NNUA 4C7JA 4WEOA 3FNGA 3LYLA 3HB4X 4A7PA 1BRMA 2I6TA 4PIVA 5BSEA 3W6ZA 3BHMA 1JA9A 3JYNA 4FFLA 4OXYA 3AI2A 3OICA 4RVHA 3KYCB 1VPDA 4YACA 3RI3A 3VZRA 4E2WA 5JCXA 3FWNA 1NM5A 1NTOA 1LLUA 2FPIA 4BKOA 4R4JA 5KTKA 2XAAA 1ISJA 4O5OA 4J49A 1ID1A 3PXXA 4ZRNA 4DXHA 2NU7A 3H5NA 4H7PA 2NVUA 1M66A 1E77A 1NVMB 2X8LA 4CJXA 4DRYA 2VCYA 4ZICA 5IN5A 3WJ7A 3L4BC 4PLWA 3I5MA 3E5MA 3GF4A 1EBFA 4BVAA 2B0JA 5JCJD 3OMLA 3NTRA 5ER9A 3N58A 2DBZA 4R41A 3TJRA 3RJ5A 3VHRA 5CAEA 4UEJA 1BSVA 5CEJA 4J4HA 1CQJA 3BMCB 2PH5A 4IBOA 1BXKA 3V1TC 3H9EO 1U9JA 1H6CA 5F21A 3EHEA 3OP4A 3WBFA 2QRJA 5AQ1A 1EVIA 2Q2WA 1UH5A 3PQDA 1CDOA 1YO6A 1VKOA 1QYCA 4Z3KA 2GNAA 2YQ4A 5JY6A 2Y1CA 1A5ZA 5JYDA 4N5LA 3TOZA 4WUVA 2EERA 3KYCA 4L74A 1AGNA 2WMDA 4DYDA 4H16A 4Z0HO 2QIOA 3I4FA 4CR8A 3AI3A 5DN9A 1UAGA 4MKXA 3ZW9A 2FP4A 1QSGA 4JP3A 3ICCA 4PZCA 1B26A 5JC1A 1PWZA 3VVBA 1SC6A 2JD0A 4RGBA 3GNQA 4HFMA 1UP6A 3NTOA 1WPQA 1ONPA 1PR9A 4CODB 2CVQA 1K5HA 2R6JA 1X7GA 1B3BA 4CUZA 3M2TA 4XQGA 3HN2A 4RLHA 4WNIA 1HE5A 4CM1A 5CP8A 1R4MB 3LLSA 1MFZA 1T1SA 1VRWA 3LU1A 1PQWA 2GYYA 3QHAA 5JW6A 4Y6PA 2BI8A 2Y67A 1E6WA 3WFIA 1NVTA 4I9UA 1X13A 4DL9A 5C7OO 1D1SA 3RUDA 2Q4BA 3OJOA 3ZCXA 1LUAA 3ASVA 3BMCA 1ZFNA 3ICPA 2JFHA 4M87A 4CM6A 2RCYA 2BGKA 3C1TA 3MWEB 3D4PA 1H94A 1GQQA 1NPTO 5B4UA 4LMRA 4K6CA 1GPDG 5B37A 2B83A 4E12A 2AA3A 2BFMA 3F47A 4YBZA 3QRWA 4P4NA 5K6AA 3ETDA 3DTYA 4E5KA 2A4KA 2PNFA 1ENZA 3NUGA 3GVHA 2I66A 5I7SA 3KYDB 3GNTA 4J4BA 4JBIA 2PFGA 1JTVA 4NBUA 3K73O 1ZSNA 4PN3A 3QWFA 4PRKA 1VL8A 3GLQA 4HNHA 3H3JA 1XELA 2WYWA 3OIFA 5G0VA 5L3ZA 3W1VA 5B4VA 1TA4A 1WAMA 3QWIA 4QQRA 1EBUA 4J1NA 1R4MA 2HU2A 4IJUA 3D3WA 2B37A 5GY7A 3U4HA 2VHZA 4FB5A 2CVOA 1ZJZA 2C5EA 3M6IA 1EUCA 4NK4A 1ZZEA 2AQ8A 3EW7A 4PLVA 5JO9A 3U4CA 5JAIA 2WE8A 1U4OA 2WSBA 4RVDA 2Y05A 3HJAA 3QY9A 4FCCA 1B8VA 3D4NA 1J6UA 2BRUA 4YQZA 1P0FA 1PEDA 2FPGA 3ROQA 1ADFA 1P1RA 4XKJA 1QORA 1GAEO 2HCTA 2HJRA 1U3TA 3ONDA 4QSMA 1QV6A 4PZDA 3G3EA 1YJ8A 1TXGA 3E9QA 5GMOA 1E1LA 4HV4A 4O59O 3HWRA 1F17A 3E6AA 3KYDA 3R1IA 1QYDA 1J4AA 5FF9A 2QRKA 3H2SA 3QWAA 4XYMA 2V6MA 3UF0A 3VC7A 4JN6B 1BMDA 2X6TA 2E82A 3DTTA 4Q3NA 3AK4A 3F9IA 1HWYA 1ML3A 4UUPA 3TPCA 5CPBA 4KUHA 1M2WA 5C37A 1Q0HA 1T2EA 4FC6A 1GUFA 1X7DA 4YRDA 5MGBA 3DZKA 3O4RA 1QKIA 4M86A 4LRSB 4D7AA 3HNPA 1C0KA 4BNXA 3GMSA 4GKVA 4U8GA 4B8ZA 1VL6A 3N74A 4XYGA 4RF4A 4RPKA 1R4NB 2E6UX 1GUYA 2QZ9A 3KM0A 1ENYA 1PJBA 4PVDA 1VLLA 4RPLA 3G1UA 4AJHA 2GN8A 3PFFA 3K31A 3VKUA 1KY4A 2IXAA 1F14A 1T2FA 3W8EA 5A1TA 1GD1O 3DZHA 2YY7A 1JAXA 1E7YA 3N7UA 1K6JA 2J5QA 1SAYA 3PP8A 3TZKA 4CR6A 1DC6A 4E3ZA 4KQWA 4CV2A 1LSJA 4AVYA 3ZWNA 1CERA 4NFHA 4PCVA 3WWYA 1V3UA 4UVIA 3BHJA 1RM4A 3H6KA 1R12A 4CL8A 4S1VA 4LVCA 2DBQA 1ISMA 4NZ9A 1Q0LA 4FIZA 3ANLA 4XJSA 4NG5A 1W73A 3IQDB 3IKTA 1P33A 1OOEA 5ITVA 2GZ3A 5A9SA 4R5HA 3DAFA 2WJPA 3DBLA 4R3WA 1ONNA 2CUKA 3KSUA 1L1FA 4A10A 2AQKA 4DIOA 1XDWA 4WLVA 3IMFA 4MP6A 5F5LA 4MVJP 3LT1A 4H3VA 3HADA 1ZKMA 5BNIA 1ISHA 5L4SA 3FD8A 2VZ8A 1E3WB 1LA2A 3IS3A 4TMFA 3ONFA 4NBTA 4MVJG 2CDBA 1E1MA 4LCJA 4K9DA 4DQUA 3DC2A 1QV7A 1PJSA 3PTZA 3GPDG 4JP2A 4XYEA 1W0CA 2H9IA 3ZV3A 1I01A 1K6IA 2GZ1A 3JQ9C 4C4OA 4XYLA 4FPXA 1SEVA 4DUPA 4BNMA 2X23A 2X0JA 3QVXA 1MLDA 4YJDA 1PL6A 2AQHA 1NVGA 5ICMA 3BAZA 3NDIA 3WJAA 4FR5A 4BO7A 4D3FA 3WYCA 4LW8A 1WDKA 2R00A 1TEHA 1JVBA 1GY8A 1VE9A 3HG7A 4GWGA 2PGJA 1PL7A 5DT9A 4DA9A 4GL4A 2J5RA 1QYWA 1PZGA 3DFUA 3IAHA 1I2CA 3T4XA 1BWSA 4BNHA 1XLTA 4FD3A 2RHRA 4XR4A 1A7AA 5L95A 1CQIA 1H2BA 4GMFA 4WASA 3I6IA 4K26A 4BMSA 4U0KA 4DBVO 4JGBA 2VOEA 4WEQA 1H9BA 5CDYA 3NJ4A 3ULKA 4XGNA 1FXSA 3Q0EA 3Q3CA 3R3SA 4ALJA 3ZWCA 2EEZA 3H4VA 2G0TA 3K5PA 3LT4A 4YVFA 5JBIA 3CINA 3BTUA 3DEYX 3E82A 4FJ2A 1HYEA 1NFQA 4OO3A 4WCFC 1PJCA 4W9NC 2PY6A 4CLXA 3O9ZA 5IN4A 4FC7A 2JAHA 3V1YA 5A3JA 3ROKA 3VH2A 1CRWG 3JQBC 4L73A 3PJEA 3WNVA 3JQ7B 3QE3A 4JXKA 5I9NA 2ZYAA 4PLPA 4LK3A 3KBOA 4RQTA 2A9FA 3MTGA 5HS4A 4BGUA 5F1PA 1U5CA 5I8WA 1W8DA 4I08A 2VUUA 2O2YA 1QG6A 3G1TA 2YHIB 5JAQA 6ADHA 4R9SA 2ZK7A 3KSZO 4WJZA 1DHTA 3GDOA 1C1XA 4JJIA 1KEPA 3OIDA 3UH1A 1J5PA 4EEZA 4Y67A 3WG9A 1GADO 3VVCA 3BMNB 5JDCC 1MFPA 2Q49A 1VI2A 3BA1A 5THKA 4EUFA 2FR0A 2IZ1A 4PLHA 2Y1DA 2ZB8A 1NPDA 1EMDA 3V2GA 3U09A 3ZWVA 2UAGA 2OORA 3KTDA 4QEDA 4HWKA 4KOAA 4GWKA 1JWBB 3OQ6A 3AUUA 4OM8A 3OFSA 1B15A 2VZ9A 2HAEA 3GUCA 3EDMA 2BKAA 2TMGA 1BVUA 3MJCA 2C20A 4RVUA 4CLRB 1LJ8A 2IXBA 3L6OO 1MG5A 3VTFA 3JQ7A 4PG7A 5KJFA 1X14A 4ROSA 4F45A 3R6DA 3FNEA 2J6IA 2ZCVA 3UCFA 2IODA 2E37A 3KYBA 5T8KA 1GPJA 3HN7A 3HQ4O 2NU9A 4NR0A 3QVOA 4Z6KA 1Y1PA 2BD0A 3UFXA 3EVTA 4U6SA 3PFWO 2DAPA 4IGEA 3M1AA 2XPCA 4B7XA 4WLOA 3HSKA 4BGEA 2GRAA 1B3RA 3RFXA 3LSYA 3MZ0A 3GGGA 1Z6ZA 4QFCA 1A4UA 2VWQA 1QR6A 2HMSA 1N92A 2VHVA 1UXJA 2NU6A 4GQAA 2HMTA 3HE3A 3GHHA 4YAJA 5ENVA 1XR3A 5KNLA 4ALNA 3PHGA 1HE3A 1WP4A 1CF2O 1M75A 3BYZA 4IZIA 4AG3A 3GN2A 1X7HA 2H1SA 3PHHA 4B7UA 4DLAA 2X5OA 1PGPA 4WOKA 4E30A 3D5TA 1C3VA 5IZCA 5CDSA 4QFDA 2NVBA 1ISFA 3I83A 2NVWA 3G79A 1Z73A 2XOXA 3IOYA 1E3JA 3AI1A 1LX6A 4OSPA 1U3WA 1YS4A 4E5YA 3MJSA 3JQDA 4FGWA 5T5QA 5JE8A 5ICSA 1EK5A 3F6YA 5KKAA 1G0OA 3SBOA 5JYEA 4OHUA 1KYQA 1M67A 3KXDA 3WYBA 3F3SA 3ZWYA 2AW5A 3MCVA 4E0BA 1QYXA 3HZZA 3B70A 3U4IA 2ZCUA 1R0KA 2J3JA 1P1KA 2IDZA 2Y0EA 3JQAD 3K30A 5U1PA 5EIOA 1EEHA 1FF9A 3AUAA 4NBRA 1N2SA 3PQFA 5TJHA 4DC1A 4CMGA 2NACA 1XKQA 1IUKA 3AY6A 1JN0A 2G76A 3SC6A 1CJCA 2IE0A 3DHNA 5EN4A 4B3HA 1DFHA 4J7CA 1DRWA 3H9JA 2Y1EA 4QUKA 2AE1A 1JAYA 4II3A 1VSUA 4F3YA 3VPXA 1VM6A 4O1MA 4CM8B 5I7EA 1X0XA 3INTA 2IEDA 4EYEA 2WD8A 4RJTA 1DDOA 4GLOA 4KWIA 3VKVA 5KVCA 4BV8A 1BDMA 2NADA 2YV1A 3Q11A 1QLJA 1E6UA 4LN1A 3NAQA 3F1LA 4GH5A 2DM6A 2Q1TA 4J9VA 4LVUA 1YBVA 4MINA 3ZNOA 2HO5A 4YRBA 1NR1A 2FHSA 3JQ8B 4XGKA 4AJJA 4JJFA 1P77A 3SLKA 3RCBA 4U5QA 4CQMB 3DZIA 1XGKA 3CEAA 3CTMA 1E7RA 1PS8A 2WWRA 3ON5A 1DSSG 4G2NA 4GX0A 1GCUA 1R66A 1UDCA 4MVJF 3RVDA 5F5NA 1FDVA 5FI3A 2DUWA 3WR5A 2EKQA 4TVBA 4CPDA 2CNBA 4NMHA 2YV3A 2DC1A 1Y6JA 4GBJA 2YZ7A 2PLAA 1HEUA 4Q9NA 4CLHA 1UZNA 3VDQA 4ONEA 4CM8A 5DOZA 2ZJ1A 3ASUA 4O6VA 3FTPA 1BGVA 3EMKA 2H5LA 1K2WA 2FSVA 4A03A 4IDGA 5K6AC 1KIFA 4UVGA 4YJGB 3NRCA 2YDYA 1QRRA 2Z1NA 1GQYA 2VNSA 1HLDA 3BMQB 3M1LA 1DIAA 3FSRA 3CMMA 3IJPA 4XQEA 3JD4A 1V3VA 4D0SA 4ND5A 3GDFA 4XYBA 1E1KA 3S2EA 4A0SA 2GASA 4DMLA 3DBHA 1J0XO 4ID9A 3IUSA 1IULA 3JQ8A 2PTGA 4CQMA 2ZB3A 3EC7A 4NU5A 2IYOA 1NWCA 3JYLA 4I5GA 1HYHA 3DOOA 2TMDA 2C5AA 2VHXA 1V35A 4R51A 2VYVD 4PGFA 4DPKA 2EP5A 3GRPA 5LCXA 3RUFA 4RDIA 5IDWA 1TT5A 3W8DA 2WYVA 4R68A 3RSHA 1V0JA 1O95A 4CLOA 4GX1A 3O8QA 3GVXA 3V1UA 1RWBA 3WGTA 3QLJA 1U3VA 1G0NA 5BNFA 4CM7A 3FF4A 4BMVA 2AQIA 2Q4EA 5EQDA 4YJGA 3AOGA 1YKFA 3BMQA 2VYND 4DIFA 2W2KA 5IF3A 2OZPA 4YJFB 4TQGA 1TB4A 2FMUA 3L9WA 1YQGA 1DJNA 3AOEA 4J0FA 3ZGYA 4HFNA 2X1HA 4NQZA 4WLFA 3WSWA 5CG1A 2PKQO 1A27A 2HUNA 4ALIA 2Y0CA 3FTNA 5IDXA 1DIHA 2OMEA 2JFFA 1X15A 3U0BA 1SCUA 4GVXA 2UUOA 4RL6A 1DLIA 1WXDA 4N5NA 3OQBA 4BO8A 3ZZNA 4FQ8A 4B3JA 3L0DA 5L53A 1WVGA 4BGIA 2VTEA 5DBIA 1DHRA 3WICA 4D42A 1BW9B 2YDXA 2WTBA 4WOJA 4BL5A 4H15A 2CZCA 4ILKA 4XD2A 1EFKA 2JCYA 5EJ2A 1P45A 5CFZA 3ST7A 1X1TA 2NU8A 3KLPX 1DEHA 4EZBA 3C24A 2G82A 1J49A 2CMDA 3DZFA 1LQTA 4OH1A 4M1QA 2EG9A 1NHWA 1DOHA 5H83A 2W90A 4CV0A 1QXSA 4E2XA 3Q6IA 2AEJA 3WTCA 1JKJA 4FJ0A 1PZHA 4NJMB 3VZPA 3ZWPA 5IDQA 4YJFA 2Q3EA 3D4OA 1YQXA 4YT4A 1SEPA 4L75A 3U4DA 1TLTA 3TFQA 1C1DB 1JW9B 4XIYA 3QA9A 2G1UA 4R01A 4R1SA 4N18A 2DBRA 4OSOA 4GLLA 1E3IA 2ZYDA 1HSZA 4A2CA 1YJQA 4YCAA 4QT0A 3LC2O 4GSLA 2VUTA 2LDBA 4AL4A 4EJ6A 1ORRA 2ZKLA 1U7TA 2AE2A 2EKPA 1M76A 3ZU4A 3RIHA 4I9HA 3Q2IA 3WDSA 2Q1SA 2V6FA 3VTZA 4MIEA 8ADHA 4E31A 1ISIA 3LC1O 3IC5A 4BV9A 3PZBA 1IY8A 1ZVMA 2ET6A 1LDMA 1P1FA 1BW9A 1QP8A 4WKGA 5GZ6A 2PZJA 4IMRA 3NJ8A 1FDWA 5B1YA 4CM9A 3L6DA 2RHCA 1LDYA 3HDQA 3ZWOA 2RIRA 1KEWA 3OJLA 2JJYA 1P9LA 4W82A 5JDIA 3DR3A 3KUXA 1KEUA 2C7VA 3TN7A 1MB4A 1I2ZA 2VZ0A 4BO9A 1P3DA 4XA8A 5JFOA 4XEHA 1P74A 2HMVA 4MIOA 3PEFA 1EVYA 1NQ5A 3ZU2A 4BQRA 1IZ0A 4E13A 1BXGB 2HSDA 2GCGA 3HHPA 3WGQA 3GOHA 2IZZA 3BTSA 3ONEA 5L4LA 1LLDA 1LRKA 2R00C 1C1DA 1E92A 3GG9A 1UJMA 5TGDA 3TNLA 4D79A 3W6UA 2H6EA 3E8XA 2QYTA 3E1KA 1DJQA 3PDUA 1HDYA 3NDRA 2E4AA 3EZLA 4ZU3A 3C7CB 4AJPA 1VJTA 4NK5A 5DDIP 2HLPA 2Y0DA 4NNJA 3JSAA 3JD2A 5KCZA 2Q99A 3GGOA 4IJKA 1UR5A 2UUPA 5FFFA 1BTOA 3GVPA 4PLCA 3PGXA 1F06A 4MVJH 2PD4A 4XR9A 1A4IA 1MX3A 2FWMX 1XG5A 3CKYA 2VHWA 3FPCA 3PHJA 2PD3A 4TRJA 4D0RA 4QECA 1GQ2A 4PG5A 4BKPA 1PU2A 1A72A 1RPNA 3SXPA 1EFLA 4Q3DA 1K0UA 4GKBA 2X0RA 4W4TA 5CG2A 5J23A 3KZVA 1UXIA 2XXJA 3NGXA 4BNUA 3L4SO 4CL3A 4UVDA 1U7HA 1AUPA 3TZCA 1BXGA 3PIDA 1ZO8A 3LQFA 5JPIA 3DWFA 2AEFA 4TKMA 3GMDA 1ZNQO 4RV9A 4IIVA 2CVZA 4ALMA
chains in the Genus database with same CATH superfamily
4QDKA 1CR0A 2HGZA 4DT1B 1X7XB 4BMCA 3LL7A 1F51E 3KWLA 4LPSA 2WHPA 3DFZA 4MW2A 5IT4A 2WG0A 5BR4A 2IYTA 3PD0A 2JVJA 1FP4A 2FSSA 2D1RA 1MIOB 3EVAA 5EE5B 3RSGA 2ECFA 4E21A 5D84A 5EZ6B 2JDID 2JFQA 2O1EA 2QTVA 1YHYA 4OMDA 5LQNA 4JDUA 4I19A 4RY2A 4C4PA 2GEVA 3AYZB 2I8LA 4GPZA 5HRUA 5DBGA 4OLAA 2OORC 3K4QA 2G1AA 4DTIA 4OD0A 3I34X 2ZTLA 3MCZA 2EZUA 1KY5A 2LKDA 4S0ZA 4TLLB 2APJA 2UVDA 4TWRA 2HQSA 5F4ZA 4D96A 1H69A 4K88A 2YJZA 3KKNA 3H2ZA 4NF2A 3CGGA 2RBGA 3SEAA 1FFWA 2O23A 2PMDA 1BEZA 1KY2A 2AYYA 4L5AA 2ZM6B 1C50A 2J67A 3Q0IA 1MH1A 2WM3A 4XSGA 3VPGA 1ZD3A 2E4YA 3BRCA 3KPUA 5SY4A 5KU1A 1PR0A 5CBKA 3SM9A 4QO7A 5A02A 4QWWA 4R1LA 3BGVA 2KJQA 3CRZA 4HX2A 4EJSA 3MAJA 2XMPA 2AH5A 2VK1A 3IBGA 1CNFA 2X8AA 4V2IA 3KVYA 4FYHA 4JD5A 3W2FA 3WKAA 3BKXA 4L15A 1J2EA 1SD2A 4B4WA 5JO0A 3B8HA 4NCKA 5K0BA 3ZJYA 3EZ7A 2QL5A 1B73A 1NLUA 3FTDA 4M6WB 1KQNA 4EFKA 5LPNA 3I8XA 3OZRA 1RI3A 5FQOA 2OD9A 4PX9A 4R54A 1QHGA 2PEYA 2JFOA 2YOHA 4MI9A 4ZXPA 2E21A 2RAFA 1I3OA 5FFMA 4EJMA 4QUAA 5F2KA 1R74A 4KXXA 4CM5A 1XZPA 1JWAB 5L3SA 3WP1B 1BH6A 5TMPA 4G4JA 2WC1A 5T6BA 4S1OA 2UKDA 1C0IA 3G82C 4JCOA 4X71A 3UAGA 2AUTA 2PR7A 4J03A 4LECA 3NGMA 2FB9A 3P27A 3BRQA 4RVFA 1O8CA 3O47A 3OCUA 2J3HA 4W5HA 5HCIA 4AK9A 1W5BA 5J2TF 4UQLA 2CLKB 1QIMA 1WO8A 4D6PA 1NMXA 1S1CA 4DJJA 3PJDA 1ZM3A 2WIFA 4TLEA 3T9DA 5IZCC 2ZJZA 3PEYA 5EHGA 4Z4IA 3NATA 3RNOA 2NXEA 3GUUA 1YZHA 4K3VA 2KLBA 5CVUA 5EKXA 1I5OA 1V9LA 1VHJA 2JPDA 2Z1DA 3QE0A 3NVAA 1JHRA 5I51A 4F5DA 3PYXA 1Z8NA 4DB4A 1W4CA 3G2PA 3F49S 1DAGA 4PFQA 4AZVA 3D3KA 4FYXA 5D7BA 2HMUA 2LP4Y 4WFKA 3HK2A 5J1TB 3JAMA 3V8VA 1H0HA 1IN1A 3C16C 1NVFA 4AFNA 4TSKA 5DWVA 3OPVA 2AG1A 4IQGA 4GRAA 5AXBA 2I4LA 2VDRB 3LSTA 3I8OA 5E1OA 3B60A 2DP4E 3WAKA 2VJAA 1P5ZB 4JYCA 2JIZD 2FAXA 2XBUA 3O8NA 2W4QA 2QORA 4FQ5A 4FILA 5B1SA 3ZWMA 5CDUA 5HQTA 1XZEA 1Q44A 2GBCA 3PFNA 3FDJA 1AMNA 1ZOIA 4C89A 5KC9A 1RJEA 1CYDA 1UJCA 2AR0A 1AGXA 3B1XA 3DYIA 3C7DB 3COYA 3IPRA 3U4GA 1XJ0A 2W42A 2HWWA 4NBSA 4DOMA 3P0JA 1UM8A 5KTPA 3O8RA 2GBPA 1D1PA 1AX9A 1DRVA 1THZA 1Z5PA 2VJMA 4G01B 2QPOA 4KXLA 4PYMA 4Q34A 2Z2XA 3RSLA 4B34A 4UUQA 4BLSA 4DLBA 2VDOB 4MS3A 4Y2SA 3ML1A 1ZISA 3UMYA 4DZZA 4DMGA 1L7OA 3ADPA 4FKZA 5PGMA 1Z88A 2R5NA 3G2QA 4LE1A 3DL2A 2QSYA 3L04A 4D3DA 3K32A 2FWPA 3UPDA 2J5KA 3UMMA 3LQQA 2R68A 4JI5B 1QP7A 1AM4D 3VR6D 1R64A 3WK5A 1OB5A 2BFDB 1PGNA 1GG9A 3KV3O 1G21E 2D5IA 3WGKA 9LDBA 3AVUA 1MG0A 4G4SP 3GFVA 2WD7A 1WXXA 3UM9A 3RKRA 3F6EX 3B52X 1EG2A 4LDJA 4JODA 3H5IA 2E18A 2PGLA 1TVMA 1L7EA 4HNGA 5ALZA 1YTLA 1FTYA 4C87A 2QAIA 4HNQA 1ACLA 5CT6A 3I9JA 5LOVF 5LD2B 1WTAA 1T5IA 5AJXA 5G0TA 5DZSA 3GLHA 4OXRA 2MYPA 1DELA 1NMYA 2OHVA 3FOWA 5EERA 4X1KB 3K1AA 1TCUA 3GNSA 4HDNA 4EA8A 4I9NA 2RGWA 2XLBA 3AP2A 3O8OB 1HTBA 2GFIA 1CE8B 3TRIA 2V9CA 5F1OA 4M8SA 4MVCA 2I7XA 5CCEA 3TLAA 4PPGA 4Z0TA 3DCNA 4Z4GA 2Z6QA 2XGSA 5J47A 1XP5A 3D6UA 3OD5A 4FKBA 4HVAA 2CLIB 5I48A 3N2NA 3ZK9A 1F9AA 2HA7A 2VRNA 4HSGA 1QO0A 4UE3S 4WWHA 2W9XA 2Z57A 1N9GB 2GETA 2YJ4A 2ZETA 2JJ8A 5KVQA 4G1UC 3SK0A 4ED9A 4HQ6A 3VA7A 1L5LA 2YQ5A 5AUPB 1ZCJA 2V0NA 1R18A 2W6OA 1N5OX 4FK8A 4UHDA 3LTNC 2AN9A 3NBUA 2BBOA 2BLNA 2DUNA 3AUSA 1IZ7A 4WOCA 3CZAA 3HO1A 2EJTA 1EK6A 1WZIA 1ZXBA 4YNBA 3JARB 1L0BA 2DPMA 3LUHA 4I1RA 4L9AA 2MT9A 5E7JA 3AETA 4WL0A 3DG9A 5DNAA 2XB6A 1LLQA 3GRZA 3GXOA 4ZV4A 3L4JA 1LVGA 3F9RA 1T4BA 4JUBA 2W2LA 1X94A 3IT2A 1UBMS 2BGMA 1XVLA 4L76A 1B6SA 1A96A 1XZDA 2OZEA 3KPVA 4IFEA 1MDFA 2MYNA 3X2EA 3V5NA 1YVPA 1CT9A 2YWXA 3LX8A 4S05A 4ABTA 4YBRA 1G8YA 3BBPA 1XVVA 3JPWA 1JZSA 2EP8A 3LBNA 1ZK4A 4NPCA 3HJTA 4W7IA 1GPH1 5EIEA 4RNDB 4XOIA 5KX5B 1UFRA 1OPXA 3JQGA 3FFTA 3KVRA 4P58A 1CUSA 4MXDA 4BNKA 4DR4B 1BXRB 3N75A 4L22A 3F5MA 4EABA 1D2GA 4NG4A 5BV8A 1KSGA 4C5AA 4QG3A 2BEWB 2IT1A 5LB2A 5C81A 1SHKA 1KQ3A 3DB2A 1F8YA 4WBXC 4X54A 1A8IA 1WMEA 4Y7CA 2LZ0A 3QVTA 1MOSA 3BGSA 5K45A 2JGRA 2B3TA 3WRWA 1BA2A 2QF7A 4HDRA 1I32A 2BCGY 1QLHA 1Z6QA 2YIDA 3VYSB 1VMDA 2YVQA 3HBJA 5ITSA 2W0MA 1OTYA 5IT9A 3FGPA 1XRJA 4WN9A 1NF8A 1EFPA 3DH0A 4Q0MA 4KPEC 1X3LA 3B7GA 3RTEA 2AXQA 2EW8A 1P80A 2WZDA 2WU1A 4QUGA 3LQYA 1UFOA 1ECFA 2V03A 5FORA 1ANKA 2JI6A 3LD9A 4FGSA 4FS3A 4DV7B 3AOEC 2GM3A 5AXDA 2P27A 1VLVA 2Q9AA 4F3KA 2PIDA 1J09A 3ITDA 3BMNA 1SA0A 1V6AA 2RJOA 3A1UA 1WV1A 3C6YA 3D8BA 4JLKA 3S7TA 5JS8A 2W8ZA 1NJGA 5HTOA 1WLYA 5E6SA 3S1LA 3A6DA 4GPIB 5I7WA 1T5OA 4MV1A 4QHSA 4JT8A 3ZDFA 2VA8A 5CIWA 3EX7C 5EKTA 3RUIA 4DBLC 5TEWA 2WSSD 1GGMA 4Q1EA 1QH0A 4V38A 4V2UA 4QUHA 1JG6A 3OA0A 3C0KA 4E1VA 3SZGA 3K9CA 3AHEA 4MCJA 1IRXA 1A4RA 3RUCA 2I6XA 1EZ4A 2BDTA 3B6IA 3UWOA 4B46A 1I51A 1OC2A 3VISA 1IM8A 3KKPA 1Z5ZA 3S2UA 3QOWA 4C1NA 5GTDA 3A0UA 1W2HA 2QJTA 5KEIA 3QPCA 4UTOA 1CDZA 1S7CA 3E5RA 4DV0B 3CCBA 5JXIA 5F1KA 4OPMA 5KWVA 3S1SA 2O2DA 2ZRQA 1HT0A 1THGA 4UFNA 2CLMB 5DV9A 3IKJA 1Y9DA 4TL9A 1M2NA 1X9HA 4FOPA 1I33A 4L0QA 5ALXA 5REQB 2O8CB 4WDRA 1RU3A 2SCUA 3D6JA 4LNHA 4CI0B 1B14A 3FDFA 3IPYA 3EOAI 4XXHA 4D9JA 2W2TA 4W9RA 1XSEA 3R0JA 1QFSA 2OGUA 4L4ZA 1JJ7A 5FHRA 2YZKA 5THQA 1JFSA 2GLTA 3G1WA 3I30X 3GR6A 1B2LA 2I4MA 2IQ5A 3KD2A 2NSYA 5KDOA 1E5TA 4DWOA 1E5QA 5HKKA 2VXCA 3C6MA 3T1OA 2CJXA 2JJ1D 4DR7B 2JHAA 4PZYA 5BMVF 3ENKA 4HUQB 1FVXA 1C9KA 2ID4A 2RGUA 2A1TR 3DHYA 4L4UA 5A5VA 2J1LA 3JY6A 4ZANA 4LF5B 3EYAA 3HUDA 2DTEA 3K8YA 4QTUB 3RTAA 1OMOA 4LC0A 2VRBA 4CFYA 1CZHA 2XQIA 4M1KA 4CIBA 3IE1A 1PKEA 1QCCA 4BMNA 2JD1A 4IYRA 1KZGB 1NVXQ 1BHQ1 3O4GA 1SWVA 4YO7A 4WCFB 1L4MA 1DFIA 4YN3A 1NYTA 1NZFA 2PJZA 4WN3A 5F2NA 1MP0A 4CM4B 3MC1A 5JVDB 5H59A 1M6EX 4N41A 1U65A 2GF0A 1QF7A 2YCLA 5U4XA 1PEYA 2WIJA 5DLDA 3B2NA 4KUEA 2XJ4A 3MMSA 2KHZA 4BO5A 1XJ5A 1JBKA 3FCCA 3L8MA 3QLUC 4F21A 4Y1FA 4FB4A 1T1RA 3AESA 1KMMA 3LUDA 3RJ9A 3OF2A 4AJEA 4CTNA 1FA9A 2NV0A 2YHUA 4OP2A 4YIHA 4HDMB 3FPBA 2OO5A 1QYVA 4C3OB 5EHNA 4F2DA 5FOTA 1NSTA 1W4AA 3E5NA 1C3OA 1O0SA 5CVCA 2G70A 3OCYA 2NUAA 2GERA 2DBYA 1Z5WA 2AVNA 1OTXA 1I7QB 3FLAA 3P2JA 4G6ZA 2D0OB 3INYA 3JVVA 2H1OA 2QWXA 1D1TA 1PZEA 1H0SA 1T6XA 2ERXA 2ZJ3A 2PZ8A 3IMCA 3O1IC 4K9NA 5DEOA 5FPTA 5JS6A 3I0MA 1Q3HA 2XWJI 2IX3A 5HF9A 2Q21A 3AEQA 4EF5A 3FSGD 1ZK1A 2RC6A 2DF8A 2ZR7A 1VCIA 3HGTA 1PWXA 1QIIA 5E3JA 5IKMA 1UJ2A 2HNBA 4GYKA 5IDYA 4B4OA 4TTPA 3MRSA 5E9JA 1O77A 3NX4A 3I5XA 4DJAA 3Q8KA 2P9GA 3A2MA 1QCYA 1SBIA 1YSCA 2WF5A 3H11B 4FN5A 4RC9A 2PL1A 4LNUA 2KE5A 3ROGA 3KOWA 1AO3A 2BFFB 4Y98A 2OFOA 1JIKA 4JA0A 2YRWA 1GU7A 5K09A 5IK2A 3ZDAA 1E1DA 2DB3A 4DDTA 3A3KA 4HN2A 4LGVA 4TN5A 4DE5A 5H8WA 2ZR0A 3D4BA 4C20A 1X7ZB 1AHHA 2B7BA 2QW8A 3KZXA 1E2DA 3RC1A 2ODNA 3RYFB 3QEJA 4TT8A 2RKWA 4BC1A 2H9YA 4H0FA 2WY2D 4OLBA 2WFMA 3U4AA 3T15A 3AVTA 1TVKB 4OK3A 3STXA 3WZMA 3CUVA 3UXYA 3KKKA 1FVFA 2NP7A 3IO5A 4MGIR 5AKIA 3O9VA 3A3PA 3P1JA 2ARKA 1CETA 4KU4A 4CMKA 2OOSA 4WHMA 4ZYTA 4KE9A 4YCMA 1YL6A 4K9PA 4PBSA 3ANXA 3ZE9A 3SM3A 4ZOBA 1CZUA 2ZKIA 3OOEA 4YXFA 1GOTA 2QQFA 3UJPA 2Z3ZA 3E9YA 3GP3A 3IO3A 3HI4A 1IN6A 5HR5A 1W93A 4UOQA 1FSFA 3KQLA 4TZ6A 2C7GA 4X5OA 3PR2B 4ACAA 2WU8A 5L7TA 4IFBA 3PFCA 3RS9A 1W36C 2XYVA 5KHLB 3EPKA 2AFIE 3Q8MA 1WMSA 1L5YA 2GKSA 4Q7KA 4B6EA 1L4EA 1MAHA 3UMSA 4XUEA 4UD2A 2PT5A 3RS7A 3A3YA 1P0QA 4LVNA 4Z86A 4D2IA 1JEAA 3FIUA 5B64A 1RC1A 3G9ZA 3Q9UA 3G6KA 1XQYA 4YY3B 1P60A 2FVXA 2YXLA 5C0OE 1VKZA 1BDBA 2AGVA 3BOSA 5CNJA 1ZY2A 2GD1O 4UM7A 4Y18A 3A1NA 5TR9A 5I7HA 1KKLA 1WNTA 2AWOA 1YTUA 1XTZA 4X93A 2Q1WA 3FZYA 5EL0A 3CUWA 1QHHA 3IP7A 2YMLA 3GJ4A 3OLZA 4UVHA 4CIXA 1RTTA 4YCSA 1XCPA 2VT3A 4B09A 2BFAA 4M0FA 2PGDA 1RHMA 2RGNA 2VJYA 3CRW1 4K28A 4PU0A 1GTL1 1YL7A 2POQX 3RVBA 3SDBA 1FUKA 2E4VA 2QRLA 2Z2YA 3RLFA 2IEIA 4D5GA 2P1DA 4PYNA 1GL9B 4R2WA 5LU9A 1R0ZA 1VA4A 3ADKA 3IQFA 1SVUA 2VPIA 3LHDA 3T7RA 5A4AA 2NSJA 2G9NA 3A9CA 3CXUA 4R8KA 3UXHA 3H9QA 4TMZA 5I8WA 5FTMA 2L42A 1G8FA 4NECA 5C34B 2RHLA 2QPLA 1G5IA 1E9DA 13PKA 3TLZA 2WUDA 4I6EA 1CQJB 1G8PA 2Q5EA 5MN5A 3UOAB 4DLZA 3GB9A 5A04A 1TEZA 5B3AA 4HGZA 1P9WA 1Z0AA 2AKYA 2VT2A 5CA1A 5LLDA 3KXKA 1R9NA 2C4TA 1GRCA 3PWKA 2PLWA 3N2GA 2RFLA 1PSDA 4F2PA 4C88A 1Z36A 4BFCA 1XK6A 4ZVUA 1KYIA 4HVTA 1E6LA 1H6BA 2QHXA 2GEJA 4INPA 2A7QA 2A9KA 3I45A 3WYEA 2O4CA 3IIEA 1WPRA 1L5QA 3L8DA 3M2PA 1N8KA 2HFKA 3L7CA 2R6DA 4LY3A 2VYQA 2FZ4A 2XVYA 3RSZA 3JVIA 4J75A 2YJGA 2VWHA 1BVHA 2J3MA 1GT91 3IA7A 5KJEA 4TTIA 1Z38A 2V6JA 3NNDA 1NATA 3RK4A 3CG4A 3DEHA 3COSA 4MUMA 2HRBA 3THWA 3OSUA 4TKLA 3COPA 5FV7A 1QS0A 2VJPA 1Z6GA 2A5GA 3OTGA 5F7XA 1YE5A 2HLNA 3KQSA 5A7GA 5L6MB 1ORDA 4I55F 2NTJA 3L01A 3R76A 5AD1A 3H17A 1JHPA 1YIDA 1UOEA 2C5SA 3QBVA 5L3RA 2DU8A 1KVRA 1R7RA 3WB9A 2I4NA 3V8EA 3WA6A 1V5IA 4KFUA 5C3MA 4N6OA 4ND3A 3HXPA 1LZKA 2BJWA 2OFWA 4WAUA 2GM4A 3MQ4A 1PTJA 4DSOA 5JSQA 3WMFA 2JEYA 4HJRA 4Y6OA 3ZH2A 2R2AA 1JKFA 1R5BA 2BM0A 2DHRA 1WU8A 2JGLA 2LCQA 1EFDN 2P4SA 2XT6A 4II2A 2ZIAA 3MGAA 4O4HB 2P4QA 2WIKA 3MPUA 5HWSA 1ZESA 2C04A 1XZMA 2IY8A 2O48X 3QTLA 2IZ7A 4U2DA 3NS7A 3BN3A 3HABA 2NZ8A 5DXFA 1M2FA 6YASA 1GRQA 2CUTA 3ESZA 4MDHA 3DDNA 4X95A 2CYBA 2P90A 3LWZA 5ALHA 3FMVA 3UCEA 1BNCA 1FPQA 5EZ5A 4PSCA 2IELA 2ZYIA 2ICAA 5BQXA 4C5BA 1XU7A 1FFAA 2HXYA 4J1SA 4PO3X 1A9XA 4ZT5A 3WHIA 4F6LA 1UWCA 3W1VA 4B3TB 3OECA 1PT6A 1UL1X 4OHVA 2PFKA 1DXOA 4F93B 3R4CA 3RC7A 4BU1A 1KKUA 4MZDA 1E3QA 2P3LA 2HA2A 4G5XA 1K06A 4NFSA 1J8QA 4J0EA 1GITA 4E15A 3RV4A 3RUEA 4O2BB 3AKZA 3JATA 2R8YA 2VI5A 2Q50A 3HO6A 4HI0E 1B8OA 4E09A 2WPDA 5DTIA 1JS1X 1WMFA 3LK7A 4M60A 3AHFA 4OUDB 2NG1A 1P8AA 3GLGE 2AR9A 3DM9B 3VO2A 3CKLA 1TC1A 2JAWA 2XWPA 5GVSA 3OTQA 5LNK6 3RRMA 1TEVA 2VT6A 3K5HA 1E98A 4WA7A 1CHDA 2JJ2D 1YDEA 2X86A 2XYRA 1JVSA 4GO1A 3R9WA 4LOKA 1XMPA 1U81A 4RA9B 2FMTA 1J2RA 3L02A 1JKXA 1L7AA 2VA9A 4ND6A 3MD0A 1DTSA 4Y2TA 3V7UA 4RHXA 1LDBA 1EJBA 2WU4A 4B8WA 3VR2D 3LK6A 1HDIA 1E58A 1CEQA 1O6ZA 4MPRA 2W37A 1MNAA 4RV5A 4RVNA 1PFVA 4D44A 3HC7A 1ZIDA 3AFGA 1HRKA 4UAUA 5EXXA 3FWYA 2ZVPX 3WTBA 3BXOA 4M0MA 5BSFA 2VH2A 3TVTA 3GZNB 3Q9SA 5LA6B 5KB3A 5J2TA 1G38A 3DAOA 2FFAA 2D3TA 1L5VA 3GEBA 2P11A 4QGGA 3C7AA 1FRVA 2FOLA 3MA0A 1A71A 1Q0QA 1RW4A 3Q3HA 3CUSA 4U2FA 5HSGA 1QQAA 5AHWA 4P7JA 1T34A 3MSXA 3FPHA 3C2QA 3K9NA 3UAYA 2OP1A 3R0VA 1YB7A 3EY4A 4A3SA 1ZG3A 2HIAA 3KOUA 4IWNA 5GM2A 2YIVX 4NSNA 4FEGA 4EI2A 3A4YA 1A9ZA 4HXEB 5F7OA 1C1YA 2GPSA 5L7YA 3RWOA 1LRLA 2AK2A 2ATIA 1KVSA 2XQVA 3MWDB 2AFHA 3OOWA 3HKCB 1RXIA 2G4LA 2WYHA 3R0IA 1RQXA 1XHLA 3TIVA 4C78A 4DMKA 1P5FA 2W70A 5FOQA 3U16A 3WRXA 2I2BA 2I4OA 2JKVA 3H65A 3KEQA 4OLJA 1A98A 1P3Y1 1CY7A 5DT2A 1LH0A 1W19A 4XFDA 1XQ1A 3Q3GE 1U8AA 5FLYA 3A36A 4JROA 4OP1A 4ARZA 1FQWA 4POOA 2J0EA 4RK4A 5L3QB 3PVZA 1GAQA 1MOZA 3OETA 1LW6E 3OEHA 2VJLA 3WK7A 3RADC 1V9SA 2AN1A 2EGGA 2O57A 2G0AA 3DBRB 3EUAA 4N0MA 4RGVA 1YHZA 2IPAB 4WXMA 3VC3A 1X6VA 3VU1A 2F17A 4OM7A 6LDHA 4KQJA 4ZT2A 4K40A 5JZMA 3QSGA 4HEA1 2H52A 3OAAA 2VH1A 4RPHA 2V7TA 4LK2A 3UJ6A 3QIVA 1GZ6A 2GAJA 1O9HA 3G5LA 1D6MA 3BFJA 1IOZA 4D3SA 1E96A 1II8A 3R9KA 2H4YA 2I3ZA 1W75A 2DRIA 1IC6A 2KWIA 4J94A 4CF3A 1D0VA 1H42A 5F23A 2X0DA 2O2GA 4E32A 4TTJA 3DCJA 1NP6A 4DQVA 4MGYR 3AB7A 4KNVA 4DA0A 1S0UA 1UDAA 4NZOA 5CD1A 3ORQA 1I3LA 1XWIA 1AV7A 4RHUA 3A9WA 4OF4A 3RARA 1H6AA 4QGSA 3TOXA 4LQLA 3Q7IA 2A35A 3TAXA 1P7CA 3NBMA 3FROA 1QU3A 3U9LA 3DDZX 5AW0A 4ATNA 1EESA 1YB4A 3DFFA 2EFHB 5LOVA 4ENVA 3OUUA 4KXNA 4NEGA 3LLMA 3EQ2A 3EGOA 4BNZA 3R6GA 3QV1A 1NI4A 2R60A 3HSYA 1LPSA 4AZ3A 2BW0A 3PICA 4AMBA 3QEMA 1ZLXA 2MWMA 1NDUA 4LJYA 4O4LF 3ZE8A 1V26A 4V1CI 3HLKA 1OBFO 3I62A 4XZ3A 4YMSA 1XC7A 4TKVB 6REQA 4FHFA 2VQ3A 1OBVA 3STYA 5C8ZA 4JSYA 1U28A 1I3MA 3F6CA 4YT5A 4QGBA 3L77A 2VK8A 4P5PA 2QPAA 5U4QA 1J8DA 4UAGA 4RLFA 1KI6A 5FBZA 2CF5A 1BX0A 2WDZA 3L0PA 1CZNA 1OPRA 1USGA 4G1MB 1USKA 4UZSA 5JU6A 3ZCRA 2IVFA 3O03A 2GCOA 5JOQA 1P44A 3WI7A 1RKBA 1V5FA 1WW3A 3UV3A 2XCQA 2W6NA 3W5UA 3MCTA 1PUJA 3BE8A 3ELUA 4FGLA 4IDHA 4US2R 4PXSA 1UBHS 1G8SA 4AMUA 1OJLA 2OOKA 3NHUA 5FTNA 2JCGA 2YWBA 1YB6A 3HDYA 1REQB 1YCHA 1TYCA 4CNQA 4PYLA 3WIEA 2XVAA 3U7GA 5M04A 1GA1A 1YCFA 4BIMA 2IBTA 1SM4A 4CFSA 4ESOA 3EZFA 2HPZA 3ERCA 2RCNA 1GVHA 2EVWX 3KOXA 4FJ1A 3G8CA 4G5SA 4FOLA 3ZK7A 4BNJA 5EXEA 2AG8A 2ZUEA 1CQIB 3AJEA 5H70A 5CA0B 3FYSA 2XIQA 3IBTA 5CHYA 5AVUA 2NO1A 1N2CA 2OVFA 3LA6A 2PUWA 3OCCA 3BCRA 3GJTA 2W58A 4UPDA 4LFAB 4ND4A 1RM0A 2V7PA 4TYYA 2QRVA 3LXRA 3H9UA 4PAOA 1X2BA 3OM9A 4KL8S 4PGAA 1K4KA 1EDZA 1R16A 4Y2XA 2EIHA 1RKXA 2HSZA 1Z4NA 2C95A 3CLKA 5FA5A 3RFUA 3RU7A 3VBEA 3MOGA 1LU9A 1H9CA 1EDOA 1IHOA 3NORA 5HOEA 3I2IA 4YMGA 1FUIA 3T54A 5HX7A 2EFDB 1YZTA 3EC2A 3KG2A 4Y0VA 4UCFA 4DAOA 4DLKA 4ZDJA 2X9GA 4AN0A 1EFCA 2XB2A 2O2EA 4Q00A 1MO6A 5AW1A 2GLUA 1A1VA 4PRLA 1WSWA 4KFCA 1XU4A 2X5JO 3WSVA 4UHFA 3KDAA 3MS4A 4U7DA 4KJZA 2BDEA 2ZRGA 3ZTWA 1YL5A 5C52B 4JI8B 1G21B 4XJTA 4DNPA 3GLHE 2C4MA 2FRVA 2GILA 1W36D 4MQMA 1D3AA 4KGZA 1CY8A 2VRCD 4R7GA 3TL3A 2H9AA 3R7LA 1C5KA 1TI7A 3FAKA 5ES3A 3PWTA 3EPHA 1JHAA 5F64A 1JB9A 1JXMA 1GL6A 4KWHA 3V4PB 3IV6A 1WU7A 3QJ5A 1EFUA 3QKTA 1Y4ZA 3C98A 3C5HA 1JQLB 4OGLA 3P9KA 5EZQA 4ARUA 3SIWA 2DETA 3X1ZA 3ZOKA 4KMSA 1PR2A 3N1UA 4ALKA 4BZQA 5HRAA 4OSEA 3WL8A 3NYWA 3CX6A 4HHEA 4ECEA 2ETXA 3FXAA 1NSYA 3K96A 1DBVO 3NOOA 4NPHA 3GEMA 2DUUA 1FL9A 3I2JA 1NFFA 3AM4A 5AUQA 4F4HA 5SYMA 3Q7PA 3ROXA 4DSZA 1R8QA 3CJRA 2EBUA 4ME6A 5H1YA 4MUGA 1QQ5A 3OP1A 3K0SA 2COKA 4HF7A 4EF6A 1S6YA 2WW8A 3L7MA 2GH1A 2Q27A 4RTMA 4KFSA 3TNFA 3AIKA 3GH3A 4LDPA 1F8FA 1RXYA 2NZWA 2Y4OA 2O3JA 4PYRA 1DC8A 3HHEA 3SS7X 3QVJA 1HI9A 2BN4A 4B2IA 3RV3A 4BWYA 1N6HA 2DSTA 3N8GA 4D9NA 5BMVA 2Z3VA 1GZ5A 2XXBA 4R2KA 1NYLA 1I80A 3KKLA 3REQA 2DQKA 4A73A 4D02A 5ETJA 5HA5A 1PGQA 2F55A 1FZTA 5D86A 1U8XX 3P9QA 4XGIA 4ZT3A 3F97A 1JIXA 1ZICA 1FYFA 2OD2A 4C0SA 4DLYA 5K0ZA 3R8CA 5J5AA 1RLUA 1I2BA 2JH8A 1M8KA 3GP8A 1SOVA 3HYLA 1QPZA 3VYRB 2PEZA 2B20A 3EXHA 4LJ6A 1XMOB 1S1MA 4ETWA 2QZ4A 2LPMA 2WHRA 1SCDA 3ZCQA 4LF4B 8MHTA 4QQFA 1O1YA 4I4TA 5EI5A 3QXHA 4OI2A 2P65A 2ZTUA 3OZ7A 5HW0A 2B1GA 3UENA 2BGIA 2OCBA 2NT4A 1TJNA 2VDQB 4CUJA 1PEKE 1N0WA 3IIIA 4PF1A 2ZTVA 4AMVA 4AS2A 1LSUA 2V4MA 4CKCB 5FUMA 3VPBA 3U19A 1GGNA 2ZPTX 3NDBB 2OO7A 3BGWA 1UBEA 4ND8B 3ZX5A 1C8KA 1BX3A 2P5YA 5FWXA 1SBYA 3EFHA 2ZULA 2XTAA 4XLLA 1T2DA 2IHJA 2O7SA 3KNZA 3H7IA 4W8GA 2BE7A 3F74A 3TK1A 1NBOA 1SY7A 1Q2UA 3E03A 4ZD6A 3JYOA 2WP8J 1TDJA 4RF5A 5IRCD 4LHYA 3I3SR 3DLTA 2PQ0A 4OI1A 3AY0A 4FQ7A 1M6NA 1KFBB 3WLEA 4M21A 3O94A 4XTCS 3GAZA 1IG0A 4MITA 4D92A 1DTWB 4LZAA 3HA2A 3A6JA 3KC2A 3IEVA 3WZLA 1UXHA 1YULA 2OAEA 1FDTA 3M4YA 1T3TA 3O7WA 3QVMA 1NBMD 4KQXA 4WPGA 3KLMX 4KN5A 4BZZA 3RC8A 1VJ1A 4ISCA 2V4ZA 4BE7B 4ZCMA 1DUVG 2J6HA 2IW3A 2OC9A 2B98A 2C82A 2QDKA 1F0YA 1J0BA 2WDPA 5EFZA 3LYHA 5CTJA 3U39A 4XM2A 2YZGA 3ZUGA 2PZKA 4KFRA 1A2QA 1W0KD 1GU1A 4JUDX 4OMUA 1S2GA 3DM5A 8AT1A 1NY5A 1QVRA 2FPPA 2FW6A 3V8NA 3D3EA 4H7FA 2JVIA 5JMPA 4ZHQB 1ILEA 1ZAYA 3ZN2A 2KW5A 1A9OA 1NTRA 1T9BA 1XWFA 2GJ8A 2ZLBA 2ZSAA 3QFFA 3CWCA 2ZIXB 4UBMA 2VJKA 2D7CA 1P1HA 2LCIA 2Z2ZA 5TVKA 1G6KA 4XX0B 2UZAA 2IXEA 1XPOA 1DLJA 2VYVA 1QONA 4Z1OA 4YEDA 5G4LA 1LSOA 1ENPA 3AIOA 3LY7A 4DHEA 5IZ4A 2XD4A 4I1IA 4BNFA 2HRZA 1Z13A 1R3UA 3Q3JB 3E3LA 3U1BA 1FLVA 2OT3B 1DT5A 3TUIC 1DWQA 4TTVA 4OB8A 3QLVC 4I6JA 4UHKA 5I9LA 4K9QA 2XZDA 2H17A 1Z06A 2QN7A 2BF4A 3EVFA 3ABQB 4DLTA 2B9VA 2VF7A 2PGIA 3A06A 4A8TA 2ACVA 2C99A 2VDJA 2VDPB 3SCZA 1E1YA 4EMUA 2V5VA 1KNXA 5CLFA 5IAOA 1N3BA 5DNEA 2Y3IA 4AJNA 3PD7A 1ZMXA 1SKYE 2BJVA 2IHUA 3QVSA 4YJHB 1HT2E 3ZHXA 4EB6B 5CEEA 1KU6A 3CXRA 2RHOA 2CNOA 4NBKA 3SQMA 4CKEB 4NYJR 3BG5A 1IL0A 2Y9ZA 1P9NA 3D6FA 4KV7A 3P45A 4P3OA 5P21A 3RFTA 4F92B 5JD4A 1EJ0A 2IDMA 3OPMA 4O3MA 3R5SA 4I4IA 1HC7A 2PWAA 3DCYA 3OU7A 2IFTA 4OHMA 1AURA 1RXCA 4YDSA 3DAHA 4X84A 3MYYA 2CDAA 4DSUA 1FRFS 1W9HA 2R6ZA 1Y98A 1ZH2A 2Q6LA 3VNUA 5JI3E 1PQ4A 1ZD8A 3OF5A 3P94A 1VL0A 4KW7A 1M1NA 3ZVRA 2YWRA 3GQVA 4JP5A 3ZZUA 1A5BB 1FNSA 4Y2HA 2CE7A 3MXOA 4Q6BA 5K99A 3AUJB 1T6BY 1S5PA 2CXSA 3WS7A 1LC0A 3FTFA 1AE1A 1V1JA 3I9NA 1CS0A 2W22A 1W6UA 5K3BA 1D5WA 1U7DA 4H77A 2EOAA 4U9IS 4G89A 4ENUA 2DHDA 3E27A 1JJBA 4XDGA 1JEYB 5AWFC 3VNRA 1A9QA 4QVGA 4EX6A 4ZZ3A 3P9RA 1YE3A 1AN9A 1FU7A 3ONWA 2DVMA 4RJKA 1KGSA 5BOSB 3JVDA 5HE8A 7GPBA 4X1IA 2H4JA 5CNIA 3WLTA 4BP8A 1FSGA 2WWHA 3QM1A 4D56A 5KSZA 3DE1X 3LA8A 3M83A 1KQOA 2HRQA 4NV3A 4EY7A 1WBBA 2C9MA 1YCDA 4WDQA 5H16A 2N0SA 1OFTA 2C2GA 2YNMA 4FONA 1QAQA 4KZPA 1RBYA 4HFJA 4YUYA 3KUDA 3DA8A 1HQCA 4ZWNA 3DVAB 3TKYA 2C77A 2JBAB 1U4SA 2WFLA 5A05A 5TF4A 3EMDA 3VV2A 3F5SA 1EFRD 1FJ2A 2PA3A 1EE9A 4CUKA 2W6JD 4YP5A 4BKMA 5AM5A 1Z7YA 4JLOA 3QWBA 3E8MA 4K6GA 1GGEA 1NQOA 2FN4A 4MW6A 5G0UA 2BDUA 3NV7A 5AHRA 3UO8B 5IU6A 1IBRA 3PGJA 1YOVA 1TMOA 4QODA 3RYIB 4MYRA 1E0DA 4F6CA 2XE4A 3QUQA 4CCYB 2ID7A 1OUMA 4UHHA 4Z3OA 2VHYA 2OQRA 5CB6A 2GJ4A 1TVCA 2NTEA 4I55A 4CMEC 4EHDA 2VDVE 4RZUA 3PEVA 3ZS9A 1CZLA 1UDBA 3C3EA 3GFRA 1GAWA 3H9CA 4RF2A 1Z2PX 4UEOA 4BO6A 5FA6A 3RBVA 1ABBA 5CDGA 5DIFA 4YAOA 2CMFA 3W9YA 4OL0A 2DKOA 4H08A 3TZHA 1V16A 2EQ5A 4CMIA 3MTJA 4QYIB 1CQPA 3NR2A 2HR1A 1DBIA 3IP3A 1A76A 3IULA 4X3PA 1C0EA 2PS3A 3ESAA 4CTKA 2PZFA 2V96A 3B7WA 3DSRA 3JQRA 3MWGA 4DJDC 3K6JA 2AFIB 3IB6A 1A5TA 4C0WA 1TKBA 2FP3A 1JVNA 2AEMA 3A1TA 1TM1E 3JW8A 4GX2A 2ZE8A 4MW9A 3I53A 3KJXA 2FRDC 2OZLB 2V9ZA 3HCFA 3ETNA 4YWJA 4U7FA 1MC8A 4XCQA 5FL3A 5AI8A 1YQ9A 3SVTA 4ZOCA 5TT0A 3DUWA 3C5CA 2I2AA 1RM5A 3E22B 3IE2A 4E33A 2WMOB 4JR0A 3S2FA 5JG7A 5CLHA 3VR5H 2RH8A 3ZE1B 1A8HA 3Q40A 1AQUA 3TCKA 1WIWA 2CXRA 3AR2A 4WT7A 3NAZA 3ID6C 2NUTB 4I2VA 1UZMA 4L6IA 4AY4A 1TM2A 1WPXA 3AUKA 4I36A 1DO0A 4MVJI 3JZAA 1EIWA 1VJ0A 2XHEA 3RS8A 4XLZA 3MT7A 2BBWA 4I8XA 3WRVA 4L0MA 2RONA 2RH5A 1R9JA 5IFKA 2VTDA 2X76A 1U0LA 3RSSA 2NU7B 2ZJAA 3TQSA 5A6VA 4YONB 4P4TA 4UUAA 5A4MS 1JKJB 3KT8A 3LP5A 5DNUA 4W99A 1QX3A 4BWVA 2O59A 1I9GA 1U0SY 5CDFA 1ZGAA 3DE3X 5JYBA 5MHTA 3DKKA 1OY1A 1FP6A 1VKNA 4KR3A 2NO7A 1Z9BA 4JXXA 1VHDA 5CPFA 4CIDA 2GAFA 1ZNYA 7ABPA 2GHRA 3PEUA 2DBVO 4C7MA 2ZBRA 2JNWA 4TWJA 1YVUA 1XVUA 4MTCA 4NOMA 5GJWC 3WHLA 1ZNZA 4HC4A 1I0LA 1N5KA 4RETA 4CU2A 5CVVA 1DKNA 4R1UA 1SVMA 3LF1A 3RVLA 5MFPA 2O8FB 1K3UB 4M9RA 3V48A 1YOBA 2OUIA 1RRGA 3EAQA 4JLJA 3NJRA 4IDFA 1NNUA 5BW4A 5B1IA 1U2GC 3L8ZA 3V6LA 2P9YA 1Y3BE 4OK6A 5INTA 1RAHA 1H66A 1RQNA 4PIVA 3NCTA 3TTYA 3W6ZA 1QVAA 2IDKA 1E2GA 4MHSA 1NSFA 1AC5A 3WYNA 3AI2A 5MN6A 3OICA 3I37X 5CXSA 2PX5A 5JXHA 3RI3A 4LGYA 2XY4A 3GYGA 4CVNA 3H18A 1JRLA 4QQNA 5SZJA 3FWNA 1NM5A 3R7FA 3SAJA 1R00A 2FP4B 2GM5A 1IVSA 1H4QA 4KLRA 2FUG6 2IGBA 1UPUA 5E9QA 2ZSFA 4PHTA 5JSUA 5KTKA 2X1LA 2XAAA 5KNDD 1ID1A 3K0AB 1SBQA 4JT2A 4ZRNA 4DXHA 3H5NA 2JG3A 2NVUA 4RH0A 1E77A 2X8LA 4CJXA 4XSHA 3TQTA 2X1MA 2OAP1 2RJ3A 5IN5A 4B6PA 3WJ7A 3VKGA 3I5MA 4NOLA 3E5MA 2JLBA 3FB1A 2QLJA 5KNCH 2B0JA 4F3TA 4NCIA 2D2FA 5JCJD 2PXCA 3NTRA 3OMLA 1KWGA 1GTVA 1LBIA 2DBZA 4QXPA 4FWIB 3NWBA 3TJRA 1QH1A 3RK1A 3CY6A 4KJXA 4KIFA 4AKEA 4CT0A 1WCIB 1UIMA 4J4HA 3BMCB 4EG7A 3B12A 2XB4A 5ALEA 4IBOA 2ZXUA 2PPVA 3GBVA 3MPOA 2FWAA 1ICIA 1IXZA 3B1WA 4L6CA 1JLMA 1G3UA 3I6ZA 3OCXA 2CV1A 1E69A 1NONA 1T9GS 3MW8A 3BSYA 2QRJA 3DT9A 3SR3A 4QPPA 1EVIA 2B21A 3C6KA 5ALRA 3VYWA 1UH5A 2HLDA 5J2UF 3VU9B 2XX3A 4MARA 1QYCA 2R79A 2ZSIA 2ZFUA 4Q47A 5BP7A 5BYAA 5JWRA 3QHPA 3VXKA 4EB0A 3KYCA 1AGNA 1KXJA 3GI1A 2OG2A 1OH8A 3F5DA 3I4FA 1IB0A 4CR8A 4I46A 5DN9A 1ESNA 3E9EA 3NDPA 1CB7A 4PZCA 1B26A 3UH0A 1PWZA 5AUNB 1EU1A 3BZBA 1SC6A 3DDHA 4L2IA 3VVBA 5A4IS 4LJSA 5LWHA 3NTOA 4AXXA 4F1WA 1HNXB 1PR9A 4CODB 2TYSB 2CVQA 3VHQA 3HCBA 2QEQA 1M10A 4XQGA 3RJZA 4WNIA 3NCHA 5CM9C 4Y6LA 2C88A 2GT1A 4U2BA 2E4ZA