3ZHBA

R-imine reductase from streptomyces kanamyceticus in complex with nadp.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
289
structure length
288
Chain Sequence
EHTPVTVIGLGLMGQALAGAFLGAGHPTTVWNRTAAKEPLVARGAKSAGSVAEAVAASPLVVVCVSDYDAVHALLDPLDGTALQGRTLVNLTSGTSAQARERAAWADGRGADYLDGAILAGPAAIGTADAVVLLSGPRSAFDPHASALGGLGAGTTYLGADHGLASLYDAAGLVMMWSILNGFLQGAALLGTAGVDATTFAPFITQGIGTVADWLPGYARQIDDGAYPADDAAIDTHLATMEHLIHESEFLGVNAELPRFIKALADRAVADGHGGSGYPALIEQFRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Activity of Nadph-Dependent Reductase Q1Eqe0 from Streptomyces Kanamyceticus, which Catalyses the R-Selective Reduction of an Imine Substrate.
pubmed doi rcsb
source organism Streptomyces kanamyceticus
molecule tags Oxidoreductase
molecule keywords R-IMINE REDUCTASE
total genus 101
structure length 288
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.-:
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zhbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zhbA01
2WSBA 1KERA 3LF2A 4CMCA 1LU9A 3IKTA 4MP6A 4EDFA 3HADA 3OJOA 4CMGA 4GVXA 3WQQA 1XWFA 4M8SA 1T25A 3HN2A 2ZKLA 5DBGA 1SB8A 1E3EA 1IHYA 3ANMA 4ZU3A 1VPDA 4XR9A 2AMFA 5T57A 4B79A 1JVSA 4BMVA 3WGTA 3QVOA 4IIUA 2DVMA 3DBVO 1OBFO 4PG4A 1GDHA 2C5AA 4WEOA 3BMQB 1SC6A 3FBGA 1O5IA 4FFRA 4B4UA 1QKIA 1PL6A 1UR5A 1MX3A 3ROMA 3C7CB 3H9GA 4GMGA 5KVSA 4YJGB 2H63A 3DOCA 3HB5X 1MUUA 2C07A 1Y1PA 4GX1A 4AL4A 5JC1A 3HDYA 1IOLA 3OQBA 3VKVA 1DFGA 2B36A 5JSFA 1W6UA 3EMKA 1NYTA 2P4QA 4ITUA 1SPXA 2YHIB 4FR5A 5BNFA 1CIVA 2W8ZA 3ENKA 1YJ8A 2HO5A 2OBNA 3OJEA 3BTUA 3DBRB 3IAHA 1EQ2A 2PZKA 4DIFA 5JCJA 2I65A 3R1IA 2B83A 3PYXA 3DMTC 1PU2A 3SXPA 4AJKA 3GPIA 3OH8A 1EE2A 1RKXA 4NFHA 2NU9A 1GFSA 4RPKA 1XHLA 3RC2A 1ISIA 1Z6ZA 3ZWOA 1E1MA 4IDFA 5GZ3A 4BNWA 4R9SA 3FI9A 3HDHA 2VHWA 4TKLA 1FK8A 4DA9A 4WASA 4XB2A 4UVGA 3U9LA 2O3QA 1TA4A 4R1TA 4HNGA 3FR8A 5A9SA 2EXXA 3KXDA 1YL7A 3MJVA 3UN1A 2B0JA 2IODA 5G0TA 3DO5A 3GHYA 2HDHA 3RKRA 2J5KA 3FNHA 3BZUA 5FWNA 3JQGB 4LISA 3I9KA 4WCFC 2A35A 1FDWA 3FWZA 1BGVA 4LSWA 3INRA 1ENPA 4IJKA 2OZPA 3RBVA 3WBFA 3PHHA 4I8XA 2R6JA 3PFFA 5DCWA 4OKIA 1DC4A 3R3SA 2JAHA 3E6AA 3PLNA 4CLEA 4WCDA 1MGOA 3HNPA 1PQPA 4FDAA 2X0NA 2BLLA 3HZZA 2A92A 2PLAA 5JBIA 3DOJA 1DFIA 1ZO8A 2I66A 2IRWA 3AFMA 4OGWA 3TL3A 3TFOA 2VYNA 3ROQA 4A10A 4L9RA 5CDUA 1MLDA 2P9EA 2ZYAA 2UUPA 2GZ2A 2H6EA 3U62A 1E3WA 3ZWYA 1E7RA 3AJRA 3ON5A 3WGOA 2GN8A 2J6IA 3Q9NA 4M49A 5ER9A 4OH1A 2G0TA 2VOJA 4DPMA 5JAZA 3E18A 3VPGA 3KYCA 1LC3A 3FPCA 4EUFA 4ZJUA 4LCJA 2DBZA 1I3NA 5DN9A 4D3SA 4O5OA 3E9QA 3ABIA 4M89A 2W2LA 4PG8A 4NQZA 4YRDA 1KOLA 3JQAB 1JU9A 3H8VA 3OJLA 4J7UA 4QSMA 2Q2VA 4PCVA 4LCEA 4NZ9A 5TT1A 1PJ2A 3GK3A 4DC1A 4D3FA 4FPXA 9LDTA 2ZATA 1RM0A 1BHSA 3GUCA 2YHIA 4ZQFA 2NADA 4XYLA 1CYDA 5JFOA 3WYEA 1WZIA 4CQMD 2P4HX 3NX4A 1AGNA 1DO8A 3E9MA 5C7IO 5IDXA 1KY4A 2DFVA 2JCXA 2R2GA 1T2DA 3V8BA 1DIHA 5JYDA 3MJ4A 3BHMA 4XDZA 3IS3A 3L6EA 2PD6A 2B37A 3N7UA 4YAGA 2DBRA 5KJFA 3GPDG 3L4BC 4WUVA 1PEDA 3NYWA 4KQWA 3NV9A 3W1VA 1I2BA 4MKXA 1PL7A 1VRWA 4BS9A 3ZU3A 2EF1A 4ALLA 3DZJA 1KETA 4JBIA 1QG6A 4WLVA 2UUOA 2Y68A 1HRDA 4E21A 4KDFA 1ISMA 4MVJA 4RF2A 1K3TA 4EGFA 3IMFA 5COAA 3KSUA 4BIIA 1PS8A 2R00A 4PLHA 1S7CA 3FR7A 1UDBA 1IPEA 5F5NA 4U6SA 2FWMX 3NJ4A 4QEDA 3DXFA 5C7LO 3GLQA 1ZK0A 1GCUA 5TX7A 2DUWA 4KWIA 1JWBB 1I2ZA 5B12A 5TSDA 2HK9A 4RZIA 3W4IA 4BQRA 3EW7A 2NUAA 3HFGA 4GH5A 1OAAA 2FZWA 3ULKA 4IJVA 1H94A 4K26A 3RUEA 1E1KA 3IC5A 3PQFA 3QIVA 3FSRA 5IAAA 3GNQA 4CMIA 1N7GA 2GDZA 5JY1A 5HA5A 5ENDA 3JQ6A 1X7GA 3VPHA 3IOYA 3M1LA 1CQIA 2GR9A 1ZUD1 1GV1A 1PGQA 3JQCA 1YQGA 4QQRA 3UHAA 2X8LA 2RAFA 1B16A 3D4NA 2TMGA 3JD3A 2HJSA 2IZ1A 3PJDA 3H6KA 2H1SA 2Y0CA 2HK8A 3Q6IA 3L4BA 3L07A 3FNEA 1QR6A 4KTTE 2CY0A 4IDCA 2EKQA 1UUFA 3IUSA 4LVUA 4DGSA 1LLCA 2AE1A 5FYDA 1O89A 4JNKA 4DQUA 1I24A 4ZQEA 5U9CA 1WAMA 4YT5A 4NFSA 4KDEA 2OXIA 3WLEA 3ZV6A 3F4LA 1ONNA 3GVCA 3EUWA 5KIAA 1O9BA 2VUSA 1T2FA 1H6BA 3EDMA 4MVJG 1ZK3A 4II2A 3DOOA 1Y9AA 3PJEA 5L4LA 1PJ4A 2EKLA 2YW9A 4U0KA 4GWKA 2GERA 4OQYA 1R4MB 2B5VA 3GVHA 3Q1LA 1L7EA 1KYQA 4DTIA 1YBAA 4BNLA 2ZJ1A 4O59O 1GY8A 3IP1A 3KEQA 2GO1A 4TZKA 2VZ0A 3WICA 3RUFA 1DXYA 3JQ8A 3MJCA 1DHRA 3A9WA 5DBIA 5JDCC 1JWAB 1A4IA 1EBUA 1MFZA 2D5CA 1Y6JA 5A05A 4IMRA 2X5OA 1GR0A 4WLUA 4BNXA 5LDHA 1NFFA 2LDBA 3BMNA 4HNHA 2BH9A 1Q7CA 2B4TO 3SC4A 3QVTA 3DFUA 4NG5A 3VDRA 1SAYA 4EEXA 2WTBA 5MGBA 4JQCA 3BMCA 1ZK2A 3TZHA 4LGVA 4LW8A 3GUYA 1UAGA 4UULA 3OJFA 3C7AA 4PG6A 3CTVA 3CINA 1GUYA 1ONPA 3PVZA 4XGNA 3ZW8A 2Z5LA 4UEOA 3ZHBA 3GNTA 4W7HA 3PGXA 1XLTA 4CLOB 4IM7A 3TNLA 2W4QA 3K73O 3L4SO 4J91A 1U4OA 4Y67A 5G2OA 3PJFA 1N5DA 4R4JA 2ZQYA 4AFNA 4W99A 4PZEA 1GEEA 1U4SA 1XR3A 4YBZA 4TRRA 1NBOA 3PYMA 4TSKA 3DQPA 1IHXA 1CDOA 1LSUA 4IDBA 4YQYA 4WGGA 5DT9A 4QECA 4XRGA 4D3DA 1IUKA 3FRJA 3GDOA 4QO7A 4NR0A 1HSOA 2P5YA 1ZSYA 2CF6A 3MWDB 4EZBA 1TXGA 2OMEA 2Q2QA 3WXBA 4N5NA 1ZKMA 1HDCA 3ZV4A 4H15A 1A7KA 4KOAA 3F6YA 4CM8A 1VM6A 4HUJA 5A9TA 5DULA 5TJ9A 3U49A 3O8QA 4MVJH 1R12A 4ALKA 3LU1A 5CDSA 5TIIA 1JVBA 1VJ0A 4G65A 1GQ2A 5U1PA 2O3UA 1GD1O 3U0BA 4Y8VA 2AEMA 4BO2A 4JROA 5A9SB 1IZ0A 4I5GA 5KVVA 1MG0A 4PRLA 1I2CA 3ZU5A 3AFNA 3N58A 1NX6A 3EK2A 4W7IA 1B8PA 3I9NA 3PXXA 4B7CA 4K6FA 2WYVA 2XXJA 3PHJA 3UVEA 1AHHA 2WEKA 4UVHA 1A9YA 4CM9A 3KSZO 4CR8A 4HADA 3W4JA 4C7JA 2FR0A 1X13A 1T2CA 3C1TA 4CMAA 4WCFA 2DLDA 3CMCO 3DC2A 4UVIA 2PD4A 4R1NA 2JCVA 1P0FA 4KUHA 1XG5A 3PP8A 5IJZA 4J4HA 3JSAA 3ZU2A 4ZRMA 4BNNA 5L4NA 1TEHA 1SO8A 4RZHA 1R6DA 3RC9A 4WNIA 1ZIDA 1NASA 3MOGA 4OO3A 3N74A 5L95A 4LMPA 4AJOA 3TWOA 3RBXA 3AUAA 5T64A 3AM3A 1NVTA 3W8FA 4MDHA 1FMCA 2Q1WA 2X1HA 4XD2A 5G4KB 1E3SA 1LRJA 1Z7EA 1PR9A 1YE3A 3RROA 1DOHA 4TWRA 3NGXA 1Q0QA 2HKIA 4YQZA 1Z82A 5DNAA 1OC2A 2BF7A 4XGKA 5GMOA 3ASUA 3M6IA 3WFIA 4BV9A 4IGEA 3KEOA 4JCOA 5HTOA 3OP4A 1QXSA 4FIZA 1JN0A 3ASVA 2PKQO 4YJGA 1D1SA 1YO6A 4L4XA 4NFYA 5DZSA 5FEUA 1WZEA 2Q1UA 5KJCA 4IUYA 4BMSA 4YA6A 4BNVA 4BNUA 3MTGA 2Z95A 3C24A 3FN4A 2ILTA 2AXQA 3I23A 4L75A 1M76A 2PKRA 4E13A 1KEUA 5KJEA 2VYND 5H83A 1V3VA 4IQGA 1B0AA 4NK5A 3VVCA 1KIFA 4YACA 4Z0TA 3GEGA 4U6QA 1JW9B 1GYQA 1WP4A 5CFZA 1MG5A 1LTHR 2WE7A 4X54A 2BRUA 4CPDA 5EL0A 2Y0EA 2O50A 4AVYA 1RM4A 1DPGA 5IDWA 4B7XA 1DEHA 2VWPA 1LLUA 3G17A 4XJTA 4RL6A 1ZK4A 4MINA 4M54A 2CDCA 4Z0PA 4BNKA 1UAYA 3ICCA 4PLCA 3U4HA 2HSDA 2UYYA 3KO8A 4CL8A 4CM4A 2I76A 1N1GA 2C59A 4LK3A 2D1YA 3U3XA 2GRAA 1G0OA 2RHCA 3ZI0A 1HDZA 1DHTA 3CKYA 1YB4A 3H5AA 1U28A 2I9PA 5AXCA 4B3JA 5H82A 3E8XA 3I52A 1E7SA 1SOVA 4UUMA 3EZYA 3C85A 2EIHA 3NGLA 2IYOA 5TJHA 5AXAA 4A73A 1H6AA 4D41A 5HS6A 1LRKA 3GY0A 3WS7A 2I5PO 4R01A 1JAXA 3GF4A 1LUAA 3O9ZA 3RWBA 1AE1A 3FPLA 3HUDA 2XPCA 1DJNA 2HLPA 3IUPA 5BSFA 3V1YA 3RU9A 5JY6A 1K6IA 1LDBA 1BXGB 4XYMA 3X2EA 4ROSA 3E48A 1TT5B 2OUIA 4MVJD 1NM5A 2ZTLA 3RBZA 2QQ5A 2O23A 1NP3A 4U0JA 3HB4X 4YB8A 1Q7BA 4GGOA 4J3FA 1QLHA 2EV9A 3PJGA 3GC6A 4HFJA 5ICSA 2YV1A 1XU9A 4XA8A 2J5RA 3DZIA 3GAFA 2Q1SA 1ADGA 2X7HA 3K5PA 2P2SA 3JTMA 2G5CA 2OBYA 5EESA 1C1XB 3F1LA 3ZV5A 2F1KA 2J5QA 1WDMA 3KUXA 3WQSB 1NVMB 1GL3A 1U7HA 4NMHA 4P4LA 4DBZA 2HMSA 2CVOA 4B8WA 2IEDA 4TRNA 4E12A 1AUPA 4P4GA 1N9GB 3D5TA 3H7AA 1E0DA 1ZXLA 4FS3A 1MA0A 1YWGO 2FSVA 3GZ4A 1P31A 2JFGA 3V2UA 4Q3NA 4TROA 4B4VA 5F21A 4CUKA 1MV8A 5A4DA 1BG6A 2O3SA 4WNCA 3AY3A 5I9NA 1NVGA 3AK4A 4IJWA 3EVNA 4ZRNA 4O1MA 3KRTA 5LC1A 1F0YA 1T2EA 3GRKA 3ZV3A 5HS4A 1C3VA 5JC8A 4WOJA 1A27A 4ALJA 4MO2A 4YRBA 1S6YA 2H5LA 4IZHA 5TT0A 4ALNA 3UCEA 1M75A 2HCTA 4ND3A 4W4TA 4XJSA 2EJWA 3D4OA 1EUCA 4GWGA 1O6ZA 3OQ6A 5CP8A 4IGFA 3DMTA 2EEZA 4DWVA 1ZJYA 1V35A 4Z0HO 1ZSNA 1WPQA 2EW2A 2ZQZA 1WWKA 4AJHA 1CJCA 1YQDA 4FCCA 2YJZA 4I1IA 5JDCA 3GA0A 2RH4A 5B1YA 3P2YA 1BW9A 3K96A 3TRIA 4BO9A 3WR5A 4E5YA 3RQSA 1U3TA 2X5JO 1SB9A 3H2SA 4J1SA 4OIMA 1H6CA 1KVUA 1OC4A 1ZK1A 4XEHA 4D79A 4CQLA 4XYGA 5BNIA 1IPFA 1R0SA 4FC6A 1I8TA 2DBVO 4UUOA 1GYRA 1LBEA 2WYUA 2IE0A 2AG5A 3RKUA 3QHAA 3R3JA 5ITWA 3PFWO 1N9GA 2NQ8A 1ZXBA 4GPD1 3VAZA 2DM6A 2Y67A 4BKPA 5EQFA 4CQMB 4D0RA 3X2FA 4F45A 5IFLA 2FPGA 4YT8A 4JGBA 5G4KA 1SMKA 4FFPA 3S55A 5A04A 1H2BA 2EGHA 3P2OA 4BUCA 5CPBA 3GMDA 2YV2A 1QYWA 3VZRA 4BL5A 3ETEA 1DC6A 4FJ2A 4TMFA 3PWSA 3NTQA 2RIRA 3D64A 4CODB 1C0IA 1UXJA 2VNSA 1BMDA 4YT4A 4MIYA 3L6DA 4CM3A 4E30A 4DIBA 1XYGA 3OMLA 3DTTA 4Y6RA 2NU8A 3T7CA 5ER6A 2A94A 3EZLA 3I83A 1EBFA 1PZHA 3D1LA 4IY1A 3JQ7A 1PWXA 2W2KB 4RDIA 1SEPA 3PZBA 1WDLA 5C3MA 4XR4A 3UW3A 2FR8A 4HY3A 1F12A 7ADHA 1R4MA 4RCVA 1OI7A 1EVYA 5DP1A 1JLLA 4JXKA 2WD7B 3RD5A 5T67A 4Y6PA 1EZ4A 1QYCA 4Q3EA 3E5RA 3ZHYA 4DLBA 1DRWA 2DAPA 2J8ZA 3DHEA 4HXYA 3JQ9C 3ST7A 4DYVA 4ALMA 3OEWA 3JQAD 4YJFA 4IMPA 4XQEA 3WGIA 2QW8A 3ZWWA 6LDHA 3OETA 5CDGA 2VUTA 1U2DA 1OZAA 3PYLA 2FR1A 2ZTUA 4F46A 4E5KA 5KTKA 1R66A 5IDYA 2ZB4A 2ZB3A 4BO0A 4EUEA 2B5WA 4FC7A 5BSHA 3E1KA 3DTYA 2GASA 2OO5A 3UUWA 4L4SA 1E92A 1YS4A 3ORFA 4IQ8A 4ONEA 5L53A 4JLWA 1U3UA 1PWZA 5U4QA 1KEWA 1PGJA 4Y6SA 5L45A 2PY6A 3KB6A 4BNIA 5ILOA 4XRRA 2ZB7A 2I6TA 3QE3A 1E7MA 3VZQA 4BHTA 5JW6A 3GZNA 3K6JA 4F6LA 1JQBA 5F3RA 1I3KA 1CEQA 5BNTA 3HE3A 4II3A 4Q39A 3JYPA 1BVUA 5DOZA 4E6PA 4BNGA 2PWZA 3OIFA 2IXBA 1JA9A 3B1JA 2JD2A 2GZ1A 2VUUA 3H65A 1NR1A 3KSDO 1AXGA 4J9UE 4D42A 1BWSA 1R4NB 5K0ZA 4CMBA 4PG7A 4GBJA 2X22A 2YY7A 4FOOA 5LCXA 4YRAA 3LYLA 4MVJI 1DFHA 1HSZA 1VJTA 2VOEA 5A3VA 3JYLA 3MWEB 1E6UA 3JYOA 1N8KA 3A1NA 3NUGA 2Y05A 3ADPA 2VTDA 4EBFA 2JHFA 3C1AA 3ANNA 3F5QA 2PK3A 3G3EA 3ZW9A 3LT4A 4WJZA 1W8DA 2NVWA 3KYBA 2YQ4A 2TMDA 3LK7A 4FQ8A 1FDVA 5B4UA 5KJ1A 2BFMA 1W0CA 4E2ZA 4OSPA 4I5FA 4ID9A 4XYBA 4PN3A 1JKJA 1A72A 2NLOA 2BGMA 4OL9A 3CSDA 3VTFA 1QMGA 4BKQA 4OXKA 2NNLD 3AU9A 1NQOA 3DR3A 4UREA 4FGSA 3GVIA 4NDNE 2JD0A 5GZ6A 2PGJA 4BNJA 1GZ3A 3AUTA 4U8GA 5A5FA 2PZMA 4GSLA 1FF9A 1B26A 1NR7A 2LDXA 1ZFNA 2OGUA 3JQAA 4IS3A 1YL5A 5IZCA 3G1TA 5L9AA 5T6BA 3E9NA 1H2HA 3BHIA 3S2FA 4YDRA 4W82A 4FFMA 3RUAA 1GTMA 1SNYA 1U3WA 3UGKA 2EWMA 2D59A 4YYZA 4D43A 1DC5A 4NBWA 3M2TA 1P1HA 2GUGA 2VYVA 3D5QA 5JO9A 1T24A 2IZZA 4XCVA 1I3LA 3CTMA 1UH5A 3QWBA 3U4IA 3TSCA 2YDXA 1I10A 1F8FA 2WDZA 2BHLA 4KUGA 1HE3A 2B4QA 1UXGA 2QX7A 2XAAA 2Z1MA 3UCFA 4CR7A 3RU7A 2X9GA 1W4ZA 3GOHA 4PLVA 2DTDA 2GD1O 2PZLA 3CXRA 5K6AA 4GSKA 4NU6A 2NWQA 1OOEA 1P0CA 4UEJA 5IXSA 3JYNA 3DZGA 4WLNA 3S2GA 3VTZA 2DC1A 1ISGA 3RCBA 2RH8A 1R0KA 1VC2A 3PRJA 4FD3A 4E0BA 1ISFA 4B8ZA 2QRLA 1VSUA 4GI2A 5JNLA 1ML3A 2CDBA 1XGKA 3WGHA 1PX0A 5IN4A 3EGOA 1F14A 3W6ZA 4FGWA 3IL2A 3V2HA 4JJGA 2G17A 1SBYA 4C7KA 1GPJA 4PLFA 2FY8A 3ZNNA 4YAIA 4I5EA 4RJTA 2UV8A 3DBHA 3ZHZA 4IDAA 4PLZA 2CVZA 1ORRA 1DRVA 1E1LA 2E49A 2J3KA 2W2KA 4GX0A 3QVSA 4R9RA 4D0SA 1ONOA 3AUUA 1LJ8A 2GN6A 3AOGA 3PLRA 4DPLA 4JBHA 1PS0A 1PJSA 1NFRA 1I01A 1R16A 3C3XA 2VQ3A 3OECA 4MIEA 1HF3A 1KY5A 1IULA 1RYDA 1C1XA 5EPOA 1SOWA 3GEDA 4PLGA 1GZ6A 1F8GA 3PTZA 3WIEA 3UFXA 2PR2A 4GQAA 1NHWA 2VWGA 4JIGA 5EMHA 3UF0A 3WYBA 4F3YA 1ZJZA 2PV7A 3DAGA 3LF1A 4AICA 1Z75A 3GGOA 5COQA 2HMWA 3GFGA 2IDZA 1A7AA 2Y0DA 5I8ZA 2O4CA 2J3IA 3DONA 2Q4BA 1VL6A 3WX0A 4DMMA 4ILKA 2DT5A 5G4LA 2C7VA 5I9LA 4J1NA 4IINA 1ZH8A 1KBZA 4WECA 1J49A 1KVTA 3BA1A 5ITVA 1OMOA 2EHDA 4PIVA 2GPTA 3H4VA 1NAIA 3AI2A 1NQ5A 4AJLA 1XQ6A 2X0IA 1IY8A 5H81A 3AOEC 3DB2A 1UP6A 3ONDA 4FBGA 3TPCA 4BMNA 5L7WA 1J0XO 5THKA 1Q7GA 4BGVA 2VZ8A 2C29D 2VNAA 3OSUA 4J49A 4XDYA 4Y9DA 4YTEA 3TOZA 4NBRA 2VT2A 5KVQA 3G49A 1PR3A 1WMBA 4IXWA 4FJ0A 4MIOA 4HBGA 5JO0A 3T4EA 2V6GA 4YAKA 1PJ3A 2EERA 4FOSA 1YQXA 2AQHA 3GVPA 5TRTA 1C0PA 2X0RA 2AW5A 1T26A 3DAPA 1MB4A 3E5MA 1U7TA 5JPIA 1KEVA 3OA0A 1MP0A 1H6DA 4BGEA 3QQPA 4DL9A 1TB4A 3PI7A 3LT1A 3K2BA 4TRJA 2NV6A 4NJMA 4CM8B 1HYHA 4GKVA 5TNXA 2OOSA 3CMMA 4RPGA 5CDYA 4CLDA 4LRTB 1KC1A 5JDIA 1UDCA 4XB1A 2GCGA 4XKJA 2VHXA 3WOHA 4RPJA 4K28A 4MVJE 3SBOA 1G6KA 4CV0A 3F3SA 2AA3A 4BV8A 4BB5A 1DIRA 4PVCA 5A5EA 2NTNA 1MC4A 1I36A 4BB6A 1NFQA 1VKOA 4RO0A 4DVJA 2WD7A 3ETGA 4Q9NA 3MJEA 3R6DA 4BNFA 3RSHA 3RFXA 4ZA2A 5TGDA 3I6QA 1XKQA 3QVXA 1HLDA 2IEBA 3JQFA 4ALIA 1M6HA 2B4RO 4Q3BA 4R16A 4U5QA 3VH4A 4CJXA 4OM8A 5AXBA 1QORA 3JQ7B 1DC3A 1MFPA 3IJRA 2X6TA 1TI7A 4RVSA 1LQTA 2FN7A 3ZWAA 5BSGA 2W90A 4A0SA 2VHYA 2W2LD 4QFDA 2JHGA 1WDKA 1K89A 4J7CA 1Q1NA 2GSDA 1FDSA 4B7UA 1C0LA 1JKIA 4N18A 3BTOA 3P7MA 4NNJA 1RWBA 1SZJG 2DBQA 1EVJA 4W6ZA 5JAMA 4B3IA 4WLFA 1GPDG 3WTBA 3RJ9A 3PEFA 1LQUA 4XX0A 5EINA 4CMEC 4MVJM 4RVFA 4CQMA 4YAEA 3UAGA 4EEZA 1VLLA 1YGYA 3ROKA 4HFRA 3V1TC 4AJ4A 4GL4A 1DJQA 3ZU4A 2NVUA 4URFA 1P1KA 4E33A 1LDNA 4EJ0A 4ND1A 2E48A 4CM7A 4CM9D 4WCFB 4KTVE 1QV6A 4CUJA 1EVIA 1LI4A 3DHNA 2QRKA 4HFNA 4YR9A 2H9IA 1RM5A 1ZSVA 1NPDA 2OORA 1EQUA 2PNFA 3FNFA 3WQRA 3WNQA 1PTJA 3KYCB 4ESOA 2QHXA 1PJTA 1E5QA 4CLXA 5TQVA 3IP3A 4CV3A 3PK0A 1HWYA 5IXYA 5DCYA 2CMDA 3A4VA 5L40A 5JCXA 2BGKA 1UXKA 3ANLA 3PGJA 1ID1A 3WFJA 4FFOA 5A02A 3TZQA 3TQHA 4A5OA 4K6CA 4EITA 5IZCC 1CRWG 3RASA 3CH6A 1H9BA 2EG9A 5F1KA 3NAQA 3P19A 1LDGA 4DQXA 4PVDA 4IZIA 5AQ1A 4WK6A 3ZGYA 4BO8A 2BMAA 3G0OA 3ZZNA 4KP7A 4L73A 4GAEA 4NBUA 1EDOA 3D7LA 1UZLA 3FCOA 3JQBA 3KOUA 1LC0A 2Y1FA 1JAYA 2OL4A 2GF2A 3DZKA 3L9WA 4AJ2A 1N1EA 4E2XA 2CUKA 3QVWA 1LDYA 3WIDA 1YH3A 1NAHA 1PJCA 2UAGA 3LLSA 3I9MA 4B4OA 3RI3A 1VL8A 3ITKA 1B8VA 1DLJA 6ADHA 4OOEA 2ZTMA 5IN5A 4E3ZA 3U5TA 4MKRA 5TLSA 4N7RA 3WMXA 5AOVA 4E32A 3FWNA 1ADCA 1HYEA 3Q2IA 4QTZA 5G0UA 4YVFA 1BSVA 3GG9A 1QYVA 4BO5A 4YT2A 2YFQA 4A2CA 1XDWA 2CDAA 1E3JA 4P4NA 4Z6KA 1ZCJA 3RAJA 3I9JA 4EYEA 1XA0A 3ROPA 2C5EA 1TT5A 1RPNA 1P44A 2VCYA 4HX5A 1U9JA 1D8AA 2E6UX 2BGLA 2HK7A 4QT0A 2D0IA 1GU7A 2X86A 1K6XA 3ZNQA 2EJVA 2G76A 3K92A 5CHEA 5T5QA 5DP2A 4WLEA 2DKNA 5HBRA 1NPYA 2VWHA 2Y99A 4RVUA 4EJ6A 1ZMOA 2I67A 4M1QA 4HKTA 4Y98A 4J7XA 3SEFA 5AVOA 1K6JA 1T4DA 1J6UA 3WYCA 3ZNOA 4AJEA 2VHZA 4R68A 4ZN6A 1BDBA 4IDDA 5G0WA 2JKVA 1GCOA 1D4FA 5HM8A 4E4YA 1P1JA 4L4RA 4J4TA 5EJ2A 3VPSA 8ADHA 3INGA 3LC7O 3WGZA 2X0JA 1H0KA 4RLSA 4GX5A 4O6VA 4DUPA 3PPIA 1E6EA 2QYTA 4ZD6A 1C1DA 3NKLA 3RFVA 3F9IA 1YONA 4J4BA 2FPIA 1YB5A 3WSVA 3HSKA 1T2AA 5BT9A 3HWRA 3Q9UA 4BQPA 4DLAA 3MJSA 3TZ6A 1IB6A 4UUNA 1MXHA 1Z74A 2AHRA 3L0DA 4YEDA 3KV3O 5L7TA 1NQAO 1YOVB 1CQJA 1NQTA 2CNBA 4Z3DA 4CLRB 3C1OA 1CERA 3RFTA 2Q4EA 4AG3A 2AEJA 3AUSA 2AQ8A 3QY9A 1X1EA 4XQCA 2XOXA 1ZBQA 4KWHA 1K5HA 3V2GA 2X5KO 4IBOA 1QYDA 4JJFA 3FD8A 3JQFC 1WNTA 3LZ6A 2Q49A 2Y1DA 2QRJA 4L0QA 3O26A 5JE8A 3NDIA 2FPPA 3JQ9A 5EN4A 3MCVA 1LNQA 3WLFA 4EW6A 3WMWA 1JTVA 5I7EA 1P1IA 1E6WA 3JD4A 3WGGA 4QUKA 3NTRA 5DOVA 1I30A 3LSYA 1Z45A 1R0LA 3COSA 3IQDB 2P91A 3PHGA 4RVHA 3UXYA 4YJHA 1X0XA 5F1PA 1ULUA 3KLPX 1DBVO 7MDHA 1H5QA 4NU5A 1PS9A 5IG2A 1X7DA 3EYWA 3GRPA 4D46A 3BMNB 3I9OA 2PH3A 4MOWA 4I9HA 3DWFA 3GG2A 1YDEA 2D4AA 3GR6A 3PZRA 1PSDA 4MVJP 3CPSA 4YXFA 3D3EA 1G1AA 3QWHA 4K1LA 1LX6A 5A06A 3SVTA 3F47A 5I7FA 1LA2A 1EFLA 1U5AA 4OKNA 4JBGA 4NBTA 3T7EA 3CZMA 4ND5A 1HL3A 4M87A 5IF3A 3HDJA 4PG5A 5FI3A 3L9XA 2FHSA 5CG2A 1YKFA 2BD0A 3E82A 2IXAA 3DBHB 4OQZA 3BYZA 1QRRA 1NXQA 1Y8RB 3SJ7A 2QZ9A 2C0CA 3PWKA 4XQ9A 1YXMA 4O63O 4AJPA 1XEAA 2IYPA 3S2IA 3KHUA 1Y5MA 3BAZA 1QP8A 5LDGA 3K30A 4HP8A 4R69A 4QFCA 1XCBA 2WJPA 3JCZA 2VZ9A 4HWKA 4NBVA 3PQDA 3ONFA 2YFHA 1U3VA 1U8XX 2PGDA 3B1FA 1R4NA 4BOYA 4LSMA 3ZWNA 4RGBA 1Q0HA 2D8AA 1LDEA 4GMFA 5GZ1A 3M1AA 1PJQA 3NEPX 4RORA 3RUDA 3A28A 4NJMB 2POQX 5ENVA 2W98A 1ARZA 1BXKA 5L4SA 2DPHA 2VHVA 1HLPA 2YV3A 3OHSX 1BRMA 1E7WA 2GGSA 1B15A 3EY4A 1ZW1A 2Y1GA 3STHA 4F6CA 3KZVA 5TC4A 3PHLA 2BFPA 4PGFA 3VKUA 4BGUA 1KVQA 5ILGA 3G79A 2Y66A 5FF9A 3GAZA 4AJIA 3H5RA 3UICA 4XYEA 4B3HA 1HDXA 1HETA 2YHUA 2AQIA 3W8DA 3H9EO 5TS3A 4E5MA 4TVBA 3G1UA 1HKUA 2OP0A 4WOKA 1M2WA 2GZ3A 3GVXA 4J1TA 4PLYA 2FSSA 3ZWCA 4IQ0A 1LEHA 4J43A 1N92A 3AI3A 4R3NA 4XIYA 3KYDB 1Y9EA 4XIJA 1PJBA 1YVEI 2DQ4A 1IZ9A 5I7SA 1VL0A 2PH5A 2B69A 3I3OA 4YJFB 3WWZA 2BKAA 5FFFA 3KETA 1EK5A 2AG8A 3ZCXA 4EJMA 4BKRA 1A9ZA 5JAIA 4FN4A 1QV7A 5JYEA 4ZICA 2GN9A 1YJQA 4BNHA 2ZJ0A 3JD1A 3O03A 3B20A 2EGGA 1I33A 3FF4A 3W4KA 2GN4A 5TF4A 1YL6A 5JCJD 4RQTA 3B6ZA 4YWJA 4CM5A 3Q3CA 2O3TA 1G0NA 2UVDA 1BTOA 3QLJA 1Q0LA 3BMOA 3K2EA 5DBFA 4XWYA 2BELA 4DQVA 1KVRA 3SLKA 1IYZA 2FP4A 3ZWBA 3ZDFA 4NJOA 2O3RA 3GDFA 3ITDA 2OFPA 4UVDA 2ZIZA 3DZHA 4H7PA 3PDJA 1EK6A 1DDOA 4C4OA 1UDAA 3LDHA 5DF1A 5B37A 3SLGA 1K0UA 4GGPA 4DBVO 2YUTA 2CZCA 3WSWA 4R41A 4U7WA 4DYDA 2NTVA 4ZVVA 3FTPA 2FZEA 1Q2XA 2BFAA 4OMUA 4WPGA 3EHEA 3EVTA 3M2PA 2JD1A 3QRWA 1Y7TA 2JFFA 2B35A 2D3TA 1EE9A 2V6MA 4RF5A 4E2YA 5CG1A 3WNVA 4IIVA 1BDMA 4TQGA 4M86A 4UVEA 3Q11A 2E37A 1GUFA 3JV7A 3TOXA 2CSUA 3O8QB 3WB9A 1VSVA 4XQGA 1LXCA 1MC5A 3KLMX 3Q0EA 1AXEA 4WE3A 1GV0A 4N5LA 3FBTA 2O48X 1VE9A 3NT2A 2D2IA 1UZMA 2HMTA 3C7DB 2HMUA 5T8KA 3V5NA 4YPOA 3L6OO 3MEQA 4TZTA 2VTEA 4RPLA 3F1KA 4YAJA 1M66A 1N2SA 4XGIA 1U1IA 4MP3A 4EUHA 1CETA 5ADHA 1X14A 1J4AA 4PZCA 1BW9B 3V1UA 3W6UA 2J3JA 5CEFA 2EKPA 3DHYA 3BHJA 3JD0A 2WWRA 1D3AA 3KYDA 3R0IA 3CEAA 5KKCA 3NDRA 4I08A 2JJYA 1YDWA 5JMPA 2V6FA 3OF2A 4BNMA 2WD8A 4LMRA 1HDYA 1LRLA 4FFNA 2X23A 1V6AA 4D44A 4IXTA 4Q3AA 1ZMTA 5ES3A 2V7PA 2HRBA 1E7YA 2VYVD 1PIWA 3QV1A 4QX6A 4BVAA 1GUZA 3AM4A 3DBLA 3DMYA 5CEEA 1EFKA 1X0VA 4DPKA 3F46A 3I5MA 4J90A 1YB1A 5JDIC 4E5PA 4G5HA 4E31A 2HJRA 4I5DA 3TN7A 4PLTA 4OJNA 1P9LA 1C0KA 4H16A 1B3BA 1PZGA 4HFMA 5C5IA 1W73A 4BO1A 4BNYA 4DXHA 4FFLA 2PD3A 5THQA 1Y81A 1HDOA 3S1LA 3U4DA 4UUPA 2NVUB 5A3JA 1PL8A 2Q1TA 1PGNA 3B70A 3C8MA 3OIDA 1AN9A 5J23A 1BVRA 1QSGA 3AOEA 4HV4A 4NH4A 2JCYA 4CL3A 3I4CA 3KBOA 4MPDA 4DRYA 1WXDA 5KJ6A 1CF2O 3ENNA 4EI2A 3K31A 3I6IA 2C82A 2VT3A 3INTA 3TDKA 4AJNA 2O4UX 1HTBA 4OAQA 4NIMA 2O3JA 1E5LA 4W9NC 2ZTVA 3JQ8B 4BKUA 1BXGA 2ET6A 4P8RA 3OQ1A 2DTEA 1LLQA 2O7QA 3NT4A 2Y1OA 1PJLA 3GN2A 1LSJA 4R5HA 3QJ5A 1ZEJA 1WLYA 4WKGA 3OICA 3AWDA 3GT0A 1F17A 4BO4A 2BFOA 1L1FA 5I7VA 1WW8A 3PHIA 4IPTA 3GN1A 2Y1EA 3BMOB 2C2YA 1LSSA 2YDYA 3BTVA 3OEYA 4TRMA 1L7DA 1VJ1A 1H93A 2CF5A 4GX2A 2XXBA 4LN1A 5KKAA 3RJ5A 1NTOA 4Z9FA 1V0JA 2O2YA 4MJLA 3VH1A 4E5NA 2NU7A 4J0FA 2NM0A 1Y8QA 3ETDA 1B8UA 4BGIA 1ENZA 1E3IA 4BNZA 2VRCA 3E03A 4N5MA 3JQEA 4J2OA 3PIDA 1UJMA 1M6WA 5CPFA 4YJHB 5KCZA 3WTCA 1IL0A 3GGGA 4A03A 4PLPA 3LLVA 3OM9A 3WJAA 3ZH2A 2HMVA 3VDQA 3NTOA 2ZCUA 2YQ5A 1N7HA 3CZRA 4DREA 3PWZA 3CIFA 3GZNB 3ZHXA 2P9GA 4I9UA 2Q46A 2QIOA 2A9FA 1PGOA 1LSOA 2RHRA 3HFSA 3CUKA 3OIGA 4A26A 5IDQA 3EAGA 2Z1NA 4FJ1A 3T4XA 4W9NA 1P3DA 2GLXA 4CR6A 4FB5A 4J2HA 3U09A 1PZFA 3TZKA 2IZ0A 2DU8A 2QG4A 5IZ4A 4Z9YA 1GQQA 1U8FO 4CUZA 4YCAA 3VPFA 5I8WA 2NSDA 4KZPA 3AU8A 3RVDA 1UP4A 2X4GA 2X9NA 1VKNA 1YOVA 2CFCA 2WMDA 3ICPA 4O0LA 5FI5A 1UP7A 2Q2WA 3DAFA 3B1KA 1FDUA 2ZYGA 4RVDA 1FJHA 3MTJA 4G2NA 5K6AC 2RCYA 1KC3A 3BMCB 1A5ZA 1DAPA 3JQBC 1YRLA 3DBRA 1RM3A 3GH3A 3FNGA 2E82A 1DSSG 4JJIA 5DDIP 4J16A 1UZNA 1Z73A 3UCXA 1FXSA 1NWHA 4R51A 1MXFA 1V3TA 4RVGA 5CAEA 2ZCVA 5A9RA 3H3FA 1I32A 4ND2A 2VRBA 3NRCA 4L76A 1A4UA 4AJJA 4J9VA 1ENOA 1XSEA 3I9LA 4J6FA 2CD9A 5G0SA 3SJUA 2HQ1A 3D3WB 1GADO 4UEKA 4LRSB 4D7AA 4CMEA 4CMJA 4DIOA 4G81A 4JX8A 1T4BA 3KM0A 3VVBA 1D1TA 2HU2A 1IE3A 1J5PA 1P74A 3P5SA 1XU7A 5BSEA 3FHLA 3QSGA 4J0EA 1ZNQO 2P68A 4OHUA 3ZWXA 2OP1A 3ZWMA 3A06A 4CV1A 2GYYA 1I0ZA 4CM4B 1ZEMA 4GVLA 1R37A 3LC2O 2YZ7A 2C54A 2YYYA 3GNSA 1GZ4A 1KVSA 5AXDA 4BO6A 5MDHA 3TFQA 3WWYA 1T1SA 2GNAA 2VRCD 1CWUA 3BIOA 3UKOA 3H5NA 4Z9XA 1EUZA 1PQWA 1GEGA 5BQFA 5JS6A 2FOIA 4JP2A 4CMHA 4H3VA 1EEHA 1GQYA 5A1TA 1XELA 1E3LA 5KWEA 4A27A 3D4PA 5KVCA 3VC7A 4KMSA 4P22A 4NPCA 1TLTA 3HQ4O 3U4CA 5C7OO 2JL1A 3VPXA 3H9JA 1B3RA 1ZZEA 1O94A 2A4KA 3LT0A 2NVBA 3HDQA 2R00C 4K9DA 3BTSA 1WMAA 3QWIA 1NPTO 5F1OA 3OBBA 3EC7A 4OXYA 3WGQA 5L51A 2G1UA 1HZZA 2V6BA 2WYWA 3JD2A 3JQDA 4L8VA 3LVFO 2XF8A 4GKBA 5DCUA 1HZJA 3PQEA 1P77A 3I1JA 3SX2A 4CLRA 1PZEA 3DZFA 3RIHA 4J1QA 5HRUA 2HUNA 4AJ1A 3Q2KA 1NNUA 4MVJF 4OYRA 4XZ3A 5CEJA 3HJAA 4KQXA 4B4WA 3H3JA 5EQDA 1K2WA 5I9MA 3ONEA 3GDGA 3GMSA 3HG7A 1R15A 5JMWA 3HHPA 3RUHA 1Y8QB 4S1VA 4N54A 4I9NA 1HE4A 3L77A 2ZYDA 5KOIA 1DIAA 4BNTA 3WDSA 2ZK7A 3OJ0A 5K9ZA 5JAQA 3GEMA 3GQVA 4DC0A 2FRDA 1RYEA 1O0SA 4GLLA 3WJ7A 2DTXA 2HRZA 4OSOA 2Q45A 3ZWVA 2ZB8A 3W8EA 4KUEA 2DPGA 4CMKA 1HEUA 2NU6A 4M55A 3PDUA 1X15A 1JDJA 2EP7A 2PFGA 3MJTA 4FSHA 1QLJA 1Y8RA 4S3MA 2C7GA 1LDMA 1KEPA 4Q3CA 3UOGA 8LDHA 1X7HA 4GLOA 3VHRA 4MKZA 2O7SA 1D7OA 4ZGWA 2PZJA 2Y1CA 1JKFA 4DLLA 3DZBA 3FTNA 1DAOA 3DL2A 4RDHA 3TL2A 5B4TA 1U2GA 1V8BA 3F4BA 2E4AA 5C37A 3H2ZA 3F5SA 1LLDA 1UXIA 2QYSA 4JP3A 3MOIA 3KTDA 4DMLA 1ISHA 4RF4A 1FDTA 4JK3A 3OA2A 1ADBA 1T1RA 2DUUA 4RQUA 3IKVA 2V65A 1O95A 5EERA 4NHEA 4ZQGA 1F06A 3RC1A 1B14A 2FMUA 1U5CA 1I3MA 1ZVMA 3AY7A 4ZHSA 1H9AA 2EP5A 3LQFA 1VI2A 1BXZA 1DLIA 2UDPA 1HE2A 2O2SA 3BMQA 3TJRA 1RJWA 1E77A 1HYGA 4JN6B 4OXNA 3RUCA 1A71A 4ZQBA 1XIVA 4CV2A 4BKOA 4IDEA 3WGYA 5COBA 5CDTA 1DIBA 2Y93A 4PFJA 2WM3A 5L3ZA 1HDRA 2AQKA 1NHGA 1X1TA 3UH1A 2NTJA 3DBLB 1P1FA 2C20A 4R1SA 4RF3A 1PGPA 2RBEA 1B2LA 3QP9A 3QWAA 4MP8A 1WVGA 1XQ1A 1HDGO 4ND4A 3IDSA 3NT5A 3KVOA 1HE5A 2I3AA 2BI7A 1M67A 3VH3A 1EDZA 4P38A 4RV9A 4CLOA 5EIOA 3IJPA 5B4VA 2Q3EA 1V9LA 2AEFA 3JQGA 3WG9A 1P1RA 5KNLA 1V3UA 2J3HA 4D45A 3VZSA 4CLHA 1OFGA 3GGPA 2OHXA 3O4RA 5GY7A 1O8CA 2P5UA 1TVEA 3VOSA 5ICMA 3TF5A 3JYQA 3ADOA 3VZPA 2PTGA 1UXHA 1YBVA 4WEQA 1DB3A 4QO8A 3HN7A 4Z3KA 4RLHA 4E2WA 5A03A 4FW8A 1ENYA 4NI5A 3D3WA 3NJ8A 3WBBA 5L7YA 2VWQA 4BO7A 1Z7BA 1KS9A 2EW8A 4RPHA 2PGLA 5G0VA 1GAEO 2D5AA 3K8ZA 1YBMA 5BR7A 1EMDA 1EUDA 3LT2A 4IDGA 3RC7A 1DIGA 4TVOA 4NK4A 2C2XA 5JLAA 1E7QA 1EVZA 1PQUA 4A7PA 2X58A 3ZNPA 3IIEA 4BO3A 2PKQP 3MZ0A 4PZDA 2PA3A 3K9QO 2VN8A 3DEYX 4R3WA 4L74A 1GYPA 2P9CA 3O38A 2JFHA 3PIIA 4PRKA 5JXWA 1Y5RA 3I4FA 3AY6A 3GFBA 2JAPA 5F5LA 5AYVA 4LVCA 2WE8A 1AHIA 3CE6A 5HWSA 1P33A 4YJDA 3DFZA 4IJUA 1ULSA 3S2EA 4PLWA 4CQLB 4QXMA 3QW2A 3D0OA 4UAGA 4R5MA 4CM1A 1E3WB 4TKMA 1QYXA 2AE2A 1HXHA 3H9QA 4CM6A 3VH2A 1SEVA 3DDNA 2QZZA 2I99A 3LC1O 3BXXA 3S8MA 2BI8A 1DRUA 1NWCA 4CMIB 1ISJA 3OFSA 4R1UA 1ADFA 3NDJA 3ZN2A 3QWFA 4ZQHA 1B7GO 4WLOA 3AI1A 5T8KC 2I3GA 2NQTA 3AW9A 4INAA 2X9VA 2Q99A 4OOFA 4IS2A 3QA9A 1P45A 9LDBA 1C14A 2F00A 3TZCA 3A14A 3RUIA 1SCUA 1E1NA 3AM5A 2Q50A 3SC6A 4Q3DA 2NACA 3H9UA 1TT7A 2G82A 4R54A 3GHHA 2HAEA 1C1DB 3ZWPA 2SCUA 2CVQA 1I5RA 1HT0A 2DFDA
chains in the Genus database with same CATH superfamily
1MW9X 4IDHA 3DEZA 5LBTA 3C6YA 2XLBA 3V4PB 3DL0A 3LF2A 5CBPB 4MW9A 2PUCA 1TF5A 2N1MA 2BSXA 2EC5A 2ZJYA 2QMZA 3LG2A 3W0LB 2WZQA 5ALUA 5JAHA 2Q0HA 5HGXA 3WQQA 1XWFA 1T25A 3HN2A 5A05A 2CDNA 1IHYA 3ANMA 4BNJA 1VPDA 1YKSA 3MXOA 4EL5A 1JVSA 2RGCA 1UIMA 3DKVA 4K6OA 5HF5A 1Z0KA 1EGAA 4IIUA 3DBVO 2PZBA 4ZXFA 5EQTA 4RFSB 2B2NA 1T3LA 2PH1A 3B5EA 3PNBA 4KIFA 4L57A 5FUYA 4AKTA 2VTBB 4WEOA 1SC6A 1O5IA 3G2OA 2WWYA 2DPYA 1U7UA 1LK0A 1PL6A 2ZYWX 1QF6A 1RAEA 3C7CB 1SZDA 2FDRA 2ZBEA 3H9GA 4FZ3A 2ACWA 4B47A 1SVLA 2FW7A 2WJJA 2P9BA 4OFWA 4TUYF 1N2CE 3GLUA 3PE4A 4HDNA 2CNNA 5GV7A 2C07A 3HBFA 3UUEA 3S81A 4ZEWA 5JC1A 4P3NA 5DISB 4ZREA 2C9DA 5IU6A 3V8VA 3B3GA 5C4GB 4P2BA 3VKVA 1DFGA 2B36A 4I8IA 5JSFA 2DXIA 2XI4A 2GK3A 3W3AD 4BQNA 2YH2A 4ZV4A 2R6ZA 3DOUA 3HLTA 5DN6A 3RC8A 5BNFA 4XJXA 1YUBA 3CH4B 1CIVA 3TNYA 4EO4A 4ZOQI 1JQKA 1QO0A 3BE5A 3H7IA 1DXQA 3DBRB 1XCMA 1ZI6A 3CO5A 4HLUC 4NDZA 3GUUA 1DV2A 4KE9A 4O2AA 5CVUA 3WZMA 3KKLA 5JRZA 2I65A 3R1IA 1PU2A 3BXPA 4WTOA 1LPSA 4LJ6A 1P2BA 1QWSA 5JNTA 4G0UA 4DQVA 4RPKA 4JJ8A 1ISIA 2RD2A 2ZU6A 2VP6A 3AR4A 3TSWA 1QP0A 4EGQA 1J0AA 1AU9A 2CLKB 4MYRA 2RONA 3S40A 3N76A 1FK8A 3A1DA 4CGZA 5CLIA 4DA9A 4UBJA 1POWA 2H9AA 2CV1A 5KYUB 2A0FA 3G0IA 3LYAA 3U9LA 4Q4CA 1RI4A 3NHAA 4TLCA 5F7OA 1JR3E 1XRNA 1IN6A 3FR8A 4HNGA 4ES6A 2EYQA 1XNJA 1L8XA 1SHZA 1X7ZB 3PU6A 4H7KA 2N3ZA 3UN1A 3GHYA 2HDHA 2DBYA 1KL7A 2Z98A 5D87A 2QS9A 3DQQA 1E2LA 2J5KA 2YWJA 4G09A 4XTRA 3FNHA 4LISA 5E6UA 5EIHA 1K9SA 1WCXA 1P7PA 3I9KA 5C1DA 2IDJA 3PA8A 4WCFC 5AVJA 1E8DA 1U0EA 3AHFA 1E1DA 5ENZA 5TJ9A 4J7AA 2PLFA 3E22A 3ECAA 3B1VA 3INRA 4IJKA 2OZPA 3RBVA 3PHHA 2W4IA 1JJVA 3IV6A 3EVEA 4V02A 4LZPA 3CLHA 4PRZA 4M0KA 4N0QA 5FFMA 3R3SA 3PLNA 1U2GC 1NBEA 4R81A 1R5JA 4CLEA 1DBPA 3UUGA 4L0MA 2IS1A 1PQPA 3G8CA 3HZZA 1LY1A 5FR2A 3V8RA 1AV6A 2I66A 5K2MA 3KKMA 1XVVA 4A10A 1GSAA 1GSIA 1MLDA 2H2HA 3M5WA 3N0RA 3U62A 1E3WA 2V9CA 4L6AA 4YUWA 2VQEB 1P4RA 3EDQA 3FDFA 1MB3A 2J6IA 4IKPA 3SQOA 2VDWA 4DPMA 3DV0B 4OB6A 1FVFA 1TCVA 1FLDA 2CK3D 1EQAA 2FSPA 1A8QA 2CJXA 1LC3A 2JJ1A 2ZJ3A 2QMEA 1SCBA 2GBIA 2ZT8A 4Q47A 4BVLA 1L4UA 4OF4A 3FVVA 5ICFA 1QHGA 3TEJA 1JYFA 1N2GA 2OXFA 3VU3A 4G25A 1Q7RA 3D4IA 3ABIA 3E9QA 2W2LA 3FZYA 1K08A 2RJ3A 3HKBA 1VG9B 4NQZA 5LUBA 3CB4A 1KOLA 1J5EB 2DE0X 4M3NA 2WK1A 1CUHA 1T6ZA 1GZ5A 3OJLA 4B3BA 2Z83A 3KP1A 4LCEA 4NZ9A 2ZUTA 4Z4GA 4KXUA 1PV2A 2YWHA 4OUDA 3CTPA 3PQ8A 4LZJA 4OB7A 4DC1A 5JR3A 4DV4B 2O8EB 1DGQA 1FMJA 1GILA 3EE6A 4N5DA 1SCDA 3CVJA 3N3AC 2OV3A 3BGIA 2BH2A 2LIPA 3H05A 1GOTA 5JFOA 1Z62A 3WYEA 5FWXB 3AGQA 5EA2A 1K5GA 3B6KA 4HLCA 2P4HX 5F9HA 1XQXA 4YMLA 2ZJFA 3M6LA 4KQ1A 1CJSA 1DO8A 4E5VA 5KWJA 4G5OA 2I55A 3PGLA 3BFJA 4K9RA 1TJ3A 3URMA 4DNXA 4C3OB 3OE4A 1IBSA 1PZXA 1UCFA 1TF7A 2CJWA 4DB2A 1GNRA 3EIFA 1K98A 5DWDA 4FEYA 3ND8A 3S7TA 1H8EA 1U9IA 4GMKA 5JYDA 3QKRB 3T6KA 5FOSA 3U13A 1XVIA 3IS3A 3D7SA 3BFKA 3GGSA 3L6EA 2PD6A 3IO3A 2B37A 4YAGA 5KJFA 3HUTA 3GPDG 3L4BC 1OX5A 4KOEC 3GUVA 2C8KA 2QGNA 1ZWKA 1OLSB 3DC7A 3M6XA 3ME5A 2AWNA 2V58A 2YW2A 4JLVA 3T1QA 1I3OA 3Q7QA 3W1VA 3SQWA 2WVJA 4F9FA 2EF1A 4OJTA 5DXJA 4ALLA 2PXAA 2B82A 5ELMA 3A0RB 1Q95A 4BX9A 3T0FA 4DWWA 1D0SA 5EHGA 3DVSX 1ULZA 2I4TA 4J6EA 1RQLA 1RYHA 2NX2A 4KQEA 5C8YF 1JEJA 2C3MA 4EGFA 1C8KA 3SGLA 5COAA 3HL4A 1AT1A 1IEXA 2ZYIA 2B8WA 2HRRA 2R00A 4DV3B 2XY4A 2R1TB 1CNEA 1UDBA 4XASA 3T15A 1D6NA 2WJZB 4DLVA 1X19A 1MO3A 5JSKA 3DAYA 4QEDA 1ID8A 3AUJB 5CNMA 1TZMA 2IU0A 4D6PA 1O9GA 2CXXA 2RHMA 5AM5A 1UBRS 2O2GA 3BSSA 5ALFA 5BWMA 4FR2A 4PYQA 4HNQA 2HK9A 4R1PA 3W4IA 4BQRA 4V0SA 1I0IA 3QVJA 4YI3A 2GKGA 3HFGA 1OAAA 2FZWA 1FPQA 1N6NA 1H94A 1VSBA 3G2MA 3IC5A 2OMKA 3A9CA 3IYLW 4OHYA 3FM9A 2A4MA 3FYUC 2O2ZA 3GNQA 3TS1A 2C7OA 1E62A 1R88A 2W2NA 5HCUA 3RK0A 2O8NA 1Z4NA 5HA5A 1SBCA 3JQ6A 4AX4A 4UFPA 5FBVB 1TA0A 1YRBA 2GR9A 1GV1A 2I8AA 4KQFA 4PW0A 5CIYA 2EQ5A 3CPJB 1ZH4A 5DHFA 1YDFA 3AVXA 3D4NA 2TMGA 3RRMA 1CUZA 3N9IA 4GE0A 1ORIA 1Q57A 1RQNA 1T1IA 4NX2A 3KVVA 2XRYA 3PJDA 2GEKA 5K99A 2JHPA 4BVBA 2H1SA 2Y0CA 1U0JA 3C74A 2I1VB 2P6OA 3L4BA 2R7AA 1UFKA 3VYRB 5DYWA 3BK2A 1EFPB 2C42A 5CK4A 4BN0A 2RKOA 1LLCA 3AI7A 2VPWA 2VSNA 3GDWA 3YASA 2B8EA 2GARA 3C8UA 4JNKA 5FJIA 3ZXYA 1WAMA 3DUFA 4Q9KA 3KALA 1EFTA 2NO7A 2IIVA 4ARAA 3K2QA 2R47A 5HTKA 4E1BA 1I4DD 1QP4A 2PX5A 3THWA 3NM6B 2QRMA 2IITA 4RVOA 4IEEA 2KLBA 4IVQA 1T2FA 4YUZA 3L7LA 3I42A 3LY9A 3EDMA 4TKUB 1EP1B 4C22A 5L4LA 5BQ5A 2DCUA 5JYCA 2DYKA 5DHQA 1Z0SA 3RSGA 3Q41A 3R0XA 3ORQA 5DHPA 2GN2A 5REQB 1QNFA 4EPRA 4PX9A 4U0KA 3NHPA 4GWKA 3ZTWA 1ZVVA 2Y9ZA 5JCPA 3KD2A 3PXCX 1XZQA 2B5VA 1J9EA 1B6TA 3MINA 4ZMBA 2NMVA 1Q84A 2GVNA 2PRKA 1V1MA 4MB2A 4BNLA 1KJWA 2RARA 1GY8A 3I64A 3IP1A 4PTLA 4Q1DA 2GO1A 5KAMA 4TZKA 3JPWA 4DAEA 1UT6A 1FEZA 2ODPA 3VYUB 3JQ8A 1DHRA 1E9FA 2NW6A 4XVUA 1MPTA 3A9WA 4IG9A 5DBIA 4K8RB 3BL5A 5HJ5A 1SKUA 2FMIA 4KQIA 1EBUA 3LHKA 4HBZA 1XQYA 2IWHA 3OLYA 5LDHA 2Z6VA 3HR7A 2C84A 2DHQA 4HNHA 1QJ4A 1Q7CA 2C31A 2PS9A 5E6SA 4CEIA 3KAKA 3LXMA 3QVTA 4XLZA 2ILVA 4TZ0A 4NG5A 5ALKA 2I87A 3QLUC 4HVTA 4QHYA 3UHPA 4EEXA 1IC6A 3WK7A 2FEKA 1HG0A 3LJKA 5KJCA 4LW8A 2IV3A 3GUYA 1XTZA 5LQAA 4PG6A 3C7AA 3RVOA 3CINA 1ONPA 3ECSA 4UEOA 2Q0QA 2ZUSA 2FQ1A 3WGVA 3SBXA 3GNTA 1IZZA 1I1HA 1VJ5A 2B1RA 2DHEA 4AY4A 3KETA 2QU8A 5AHKA 4D82A 1T0PA 3WHPA 4GYJA 5EQJB 4AAYA 4IM7A 2QJFA 2OM6A 2Z09A 1ODFA 4CLOB 5MF6A 1TKAA 1L5FA 3BWVA 3ENQA 3LWDA 1MH9A 4IG4A 4L6CA 4G9EA 5G2OA 3PJFA 4AFNA 4LOJA 1TRHA 1GEEA 4QG7A 2P77A 4EO7A 2XD4A 3E70C 3Q7TA 3G2NA 4LYHA 3PYMA 5FWDA 2WU8A 4LF4B 3VV2A 4DBLE 4RJLA 4Z4IA 1PUIA 3CC8A 4BFWA 1WMEA 2VPTA 3VI3B 3VRHA 2ZW9A 4I4TB 1JMVA 4F9TA 4HAZA 3FRJA 3UHFA 4NR0A 1BN7A 1VHTA 1DC7A 3OJCA 2HMYB 1QMPA 2CF6A 4K1XA 1ILWA 2ZJOA 1TXGA 2ATIA 2P3SA 2Q2QA 4AURA 4BWYA 3WLPA 1MX1A 1Z06A 2WIAA 3TEMA 3OVMA 1NYRA 4H15A 3F6YA 2QN7A 1O6GA 2A0UA 2HSEA 2NVOA 2Q6LA 1TKRA 2IY8A 2V97A 3FJ1A 3LBFA 4IIJB 2IL1A 3F6BX 2H18A 1JVBA 2CCGA 2BGIA 2RGWA 4WXHA 4CT0A 1SQ0A 4GR5A 1OZHA 3CNOA 1KY3A 1IAQA 2A84A 2AI3A 2QMUA 1Z5NA 2AEMA 2H00A 1COWA 3HL0A 3FWKA 4LZZA 5C8XA 4JUIA 1YHYA 2TS1A 2ZJ4A 5KVVA 1QZUA 2AFVA 2VAWA 2WRZA 2BY4A 1Z13A 2FEWB 2FLVA 1GGJA 2Q1XA 1CD5A 2Q29A 2JANA 3B89A 3HFJA 4HLUA 5A3SA 3AFNA 5K0TA 1NX6A 2G80A 1T15A 3U7EB 3OU7A 3EK2A 3D8UA 1B8PA 1Z5VA 3HCDA 4W7IA 4XOIA 1NIPA 5BOVA 5U4XA 4K6FA 4D81A 2A1UA 2H85A 4HEA1 5I7AA 4H6XA 3UVEA 1W581 1A9YA 1JS1X 3CG4A 3EWNA 4H1HA 4C7JA 5DW0A 4GZMA 1CXZA 3W2TA 3D6MA 4L5BA 1TAQA 2FCRA 5FPKA 2CXTA 4KB5A 3DULA 3AIIA 1DKPA 4CMAA 2B2CA 3MTEA 2HHJA 2B8NA 1OTYA 1UQRA 1A8SA 1ZLXA 5JNSA 4FYYA 4TMWA 1XAGA 1JPJA 1O2DA 4XVRA 3PP8A 4CF7A 5IJZA 5KWIA 1W0JD 4ZRMA 1BO6A 2QRZA 1SUEA 3D6JA 4BNNA 4UNRA 1OREA 5EIEA 1UBUS 4RNDB 3OCJA 2OV2A 1ZIDA 3TTUA 2Y9PB 4MW0A 4HT3B 1VGQA 3N74A 1FTNA 3KJZA 3UT5B 4YP0A 1FXWF 5D3MA 3OWOA 3WB0A 2F3RA 3KSRA 3B3FA 5T64A 2NZUG 5H9WA 4F3RA 1KY2A 4MDHA 5K3BA 3FAZA 1UMBA 1ZD1A 1LRJA 3P8ZA 3ZLUA 1YE3A 3KQTA 5BV8A 1P6UA 1E59A 2OV6A 3PD7A 5ALJA 2JZOA 3NGXA 2FU5C 3BSYA 3D4LA 2XYQA 3CWQA 3L7IA 4KQMA 1Z82A 3T0IA 4B31A 1KMMA 4C78A 3UTCA 5GMOA 1KWGA 3HN6A 3B36A 3M6IA 3OO0A 4NU0A 2XSZA 4IGEA 4LJ5A 1QGYA 3LA8A 5DI3B 3ZD8A 4FIZA 1EEXB 3C7KA 4C05A 1JN0A 1H69A 2GN0A 2PKQO 4YJGA 3UV3A 3X2SA 3T7JA 1JMYA 3LV8A 5DZSA 4RC9A 3QOWA 1G16A 1XVUA 1C9MA 3JAKA 4IUYA 4P92A 5E9AA 3TCXB 4BNVA 4BMSA 1LS1A 1TK3A 1RJEA 2EGUA 2Z95A 3C24A 3FN4A 1NJ1A 2A9QA 2MYUA 4U1RA 1BD4A 3ANSA 1W94A 3VA7A 1V3VA 3JALA 1DO2A 4NK5A 4OFXA 5IVDA 4OKSA 5A2QA 4Z0TA 1FYDA 1J39A 4LWQA 4KLRA 4UHBA 5KDDA 2OG2A 1CTQA 1GYQA 2W22A 2MSDB 3WC4A 3MD0A 5C1OA 3I73A 3UQYS 3A6FA 1E4EA 4HB2A 2I6UA 4B6SA 5CFZA 1E69A 2EBUA 1R74A 2EZUA 2ZRBA 3HCNA 2XBMA 1B6GA 2J48A 4LSGA 2BRUA 4CPDA 3VU9B 4AS1A 4KE8A 1IJBA 3HNOA 5SY9A 3GL9A 4G26A 2BDTA 3B38A 2PUVA 3R4CA 3DE5X 4YCJA 2Q3CA 2XT6A 3ILYA 1EWQA 2OUKA 1DEHA 1GVHA 1SVMA 3T34A 3G17A 3G0BA 3UWKA 1BS9A 1WHTB 1ADJA 3TCKA 4I19A 4MINA 2XCUA 2CDCA 2Q28A 2B99A 4GGMX 2PANA 4PYOA 3KO8A 2R1VA 5EMLA 1QS0A 4F2GA 4JR0A 4MR7A 2PO7A 1XTRA 5KOHB 3PKZA 2F3PA 2GBPA 5K8JB 3L49A 2C59A 1QIIA 1Z12A 2JGFA 2ONJA 2D1YA 1RLJA 1DDIA 5IVIA 3U3XA 3NKVA 5E4FA 1A50B 5CHYA 2GA8A 5IPFA 2VDRB 3U1VA 4I1PA 4UU8A 4CNQA 1XWWA 2P9JA 4JX9A 1E2BA 1BAPA 1NW3A 4X00A 1MORA 5FTWA 4BLWA 3S1SA 4KI7A 3EEYA 2QSUA 1EA5A 3E8XA 4YCSA 4PEVA 3WKDA 3C85A 1U1DA 4DV5B 4WXYB 5FD8A 4GR4A 3T9BA 2IYOA 5TJHA 3SVZA 4A73A 1V11A 3HXQA 2DFKB 2JLUA 4N49A 4D41A 4KH0A 4JQOA 3R9XB 1LRKA 3JZFA 4Q1CA 3LRTA 3GF4A 1Z33A 1LUAA 1Z35A 3IB3A 4HI0E 4YGXB 3H17A 2HREA 4CKYA 1QZXA 3LCCA 1T4CA 3HJFA 3WL3A 1GAXA 4WBXC 3FKJA 1CSEE 3LDFA 1KZ4A 3KJGA 3MLAA 5ITZB 2Q1YA 3PNLA 5JWRA 4F4CA 3C39A 5J1SB 4NNOA 3WY9A 1BXGB 3H99A 1H2WA 1RADA 1D6MA 4JBNA 5DFAA 4Q05A 2EATA 1TT5B 3DDSA 3BUSA 1FTWA 2OUIA 4Y1EA 3VX4A 1NP3A 1ZICA 2OESA 4J3FA 5A0VA 1QLHA 2OE2A 3K8OE 1V7PC 3PJGA 2EV9A 4ZK2A 5JNRA 4HFJA 5ICSA 4W5TA 5EZ6B 3G9UA 3FZNA 4XA8A 5ITSA 2J5RA 2Q07A 3QX3A 2EWVA 2HOQA 3HGMA 2JEZA 1K66A 4MS1B 4TSFD 3K94A 3RRFA 4QAJA 3GT3A 4Q93A 4YAUA 3SNKA 1ZISA 1NRXA 5E6RB 3ZV5A 4LQDA 3T5PA 1NVMB 4P4LA 2WV9A 3TX6A 1Z0IA 2RH9B 5GINE 4B9EA 3CVXA 5HOQA 1LD3A 2XQIA 1DUIA 2IHZA 4FS3A 4LTNA 2JAXA 5DW3A 1MA0A 2HBRA 1YWGO 2YVLA 3GZ4A 4TS1A 3VR3A 4YDQA 1OWPA 1ZA1A 3P9NA 2DUMA 4X41A 2JFGA 2QL7A 1T3SA 4RQBA 3PFCA 1MV8A 4NJEA 5A4DA 2ACVA 1VCNA 1BOOA 1ZOLA 1YZLA 1Z6AA 3KQOA 4WNCA 1X80B 3AY3A 3TW6A 4E11A 1IOVA 5LN1A 4UOZA 4KIGA 4FINA 4IVRA 3MYYA 3JQQA 1F0YA 2Q5CA 1T2EA 1SY7A 3ZV3A 4V1CA 1XDGA 4C87A 1G3IA 3UMJA 3O93A 3QLEA 4D4HA 4MITA 4HUJA 1S6YA 2H5LA 2OCXA 2BGUA 1Q5PA 4JQYA 2KQUA 3OTGA 5TT0A 4ALNA 3DT9A 4W4TA 2BT4A 3CUTA 1U3CA 3LUBA 1N34B 1EUCA 2SKEA 2PUHA 3DMTA 3EXFA 1ZJYA 5E2BA 2OGSA 4FOTA 4C6SA 4DR3B 1H1DA 1IONA 3DEJA 2FYTA 3HY3A 4DCPA 1T29A 1OTXA 3STWA 2E6KA 1RXVA 2XJ9A 4FCCA 1S8OA 2F8SA 4YUVA 3GA0A 2RH4A 1V7CA 3GRUA 4DKJA 3FIUA 2GPBA 3TRIA 1LV8A 1PI3A 4JJEA 3RQSA 1U3TA 1KOFA 1FP1D 2OM2A 3H2SA 4RK0A 4YCCA 5CH3A 1FS6A 3HTXA 4G37A 2Q7OE 5JASA 1NZJA 4S1PA 1OC4A 4KIJA 1Z9BA 1SHLA 2KHZA 2HXGA 4LJKA 4ND7A 5BNIA 1DINA 4YS6A 2GD0A 1X1QA 2PRIA 1Q0PA 2DBVO 2H1IA 2JCBA 2YN2A 1TYAE 2XMBA 2DQYA 2IE0A 2BFWA 3RYIA 4H77A 1XZLA 2JNWA 3S27A 3QHAA 5ITWA 4ZT2A 4TPKA 1N9GA 3KTAA 1C3JA 4GPD1 3R7DA 3J81k 3PT5A 5EQFA 1KE1A 4D0RA 2F90A 3X2FA 2YIDA 4MROA 4RE6A 2ZAMA 2VDKB 2P30A 2Z5GA 4YT8A 4OV6B 3UB2A 1BHJA 3CX4A 3QVVA 3W6PA 1KJ8A 5G4KA 1CUAA 4K88A 4MULA 2RK4A 5A04A 1R0YA 5FH9A 3GMDA 3I12A 2YV2A 2W6JD 2GM3A 2QG6A 1QYWA 4MCAA 3AL0C 1X8XA 4YIHA 3F7MA 1KMHB 4XB6B 4BEWA 5J4LA 1QRDA 2ZTHA 5K0GA 3EPHA 4QXAA 1LK7A 2Z3VA 3LM8A 4FJ2A 5IYZF 4IUCS 2D0PB 4NY1A 3WLKX 1SURA 4LXQA 3AKDA 2VNSA 4IEIA 5EJMA 1Z16A 4YT4A 2PVPA 1L7XA 4CM3A 1K68A 4K5QA 2CNOA 4Y30A 5CNIA 1U2QA 2WF7A 4EGCB 3PGA1 4PBTA 1A0OA 2AZMA 3HYNA 4L7QA 1M0TA 3AIOA 4BWFB 4JYAB 2QX6A 1BZYA 4FX2A 1U1EA 3OZVA 1Q1EA 4RDIA 5I8PA 1TMOA 1J9ZA 2PMFA 1SEPA 4H3KB 1WDLA 1T9GS 3E7WA 3H3XA 3JR3A 4Y2SA 4L3OA 2QTLA 1F12A 1BD3A 3F3KA 2H1HA 2YRWA 4RCVA 3RYCB 1SJ9A 4KFRA 3R8FA 5DT2A 3BQMB 4YCMA 1V39A 2IE8A 3COWA 4BLOA 5BR4A 1AKTA 1EZ4A 1KR5A 3E5RA 5DHRA 4YQEA 2O8CB 1CY1A 4DLBA 2SHKA 4UQLA 2J8ZA 3JQ9C 2Z6UA 4O4LB 3WLLA 1YR3A 3MC1A 2J7PD 4NABA 1ZRNA 1KE2A 3JRNA 4PZ9A 4JI1B 4YK7A 1F6DA 3B52X 5BYJA 4LV8B 2QW8A 3OETA 2A0XA 4X93A 2VUTA 1CR0A 5HJEA 1EFAA 2FR1A 4U6NA 4YNBA 1U8YA 1X9GA 4EA8A 1JHXA 3TUZC 2OBMA 2SNIE 4C6TA 3QTLA 1U6JA 2ZI7A 3U56A 1E3MA 1EFPA 3VC2A 4Q9DA 5AI5A 4HAUA 1MHPA 4X6XA 1Y6FA 5AM3A 1UMDA 2OO5A 3O8DA 4FXOA 4RMIA 2AOWA 2QX8A 2XNDA 2XYRA 2ZYVX 1YS4A 3AV0B 3ORFA 4L4SA 4TQAA 3UNXA 5NLLA 2H3HA 4KZKA 4NICA 3K05A 3NIFB 3GLFA 2AYZA 3CSUA 3G5MA 2RGAA 1GZUA 4HPWA 5D3ZA 3VZQA 4BNIA 1EDEA 4GBGA 5HXAA 5ILOA 3TJZA 2QNRA 2ZB7A 2I6TA 4B34A 1OVGA 4OYLA 4RD3A 4TL9A 2QP9X 1MABB 1OHHD 1N4AA 1J9GA 4JZKA 2R60A 4BHTA 5JW6A 5JWOA 3K6JA 3BM5A 4J0KA 3QH4A 4QWMA 3HM2A 5J4KA 3PDCA 4EA6A 1CEQA 5JSZB 2F3TA 4X5OA 1XZCA 3JYPA 4YP1A 1BVUA 1OYYA 3I2JA 3N75A 3I6BA 3W5AA 4KNYA 5JJKA 4E6PA 3U48A 3HU5A 3OPQA 3WLSA 1JA9A 3AEZA 3B1JA 2GZ1A 4D42A 5D6OA 3KSDO 1AXGA 3L4EA 1Y7IA 2P2ZA 1R4NB 2I62A 4QOIA 5IDVA 5CB4A 3WMGA 1K7SN 3IULA 4D8YA 1G5PA 2X22A 3O1JC 1V1RB 5IAGA 1Z6TA 2HDOA 2FKAA 1DQSA 4KE7A 4LE1A 5LCXA 4DLKA 4YRAA 1JLRA 4BN5A 1DFHA 3CF2A 1G5IA 4BJ1A 1MDBA 2P9YA 2VOEA 4YXWA 4DMCA 4KE6A 4MQ5A 5ICCA 2AFRA 1VL5A 3LWNA 5TE9A 2RHDA 4KR0A 2W6JA 3MWEB 3FMOB 1N8KA 2ZZKA 5AKHA 3ZVNA 1MR3F 1RJ9A 4C0KA 3ICOA 5DHSA 3QQ5A 3BJEA 3EXG2 3W8RA 2G25A 4DDUA 3U4QB 1BDJA 3JZIA 5JD6A 4EL0A 4I1VA 1W8DA 4LDNA 4V38A 3HKCB 2XE7A 3KYBA 1WMDA 4ZCMA 4RTNA 2ZULA 2R48A 1IH8A 4DLWA 2YQ4A 3GOQA 3VJMA 4HDKA 3LK7A 2IIPA 2PZ8A 1KH1A 1MJGA 2QE7D 2VHJA 3K1TA 4M9RA 1RQXA 3CXUA 2E55A 4GYKA 4CKWA 2H8GA 1H4VB 3CUUA 1W0CA 4E2ZA 1KBOA 5KCZA 3KU4A 1O9HA 1L7OA 4I5FA 5IANA 4LV6A 1WETA 1JKJA 4P84A 3PWTA 3ZPXA 1NW6A 2NLOA 4ZO4A 4M9CA 1Z3IX 2BGMA 2D1TA 1JFLA 1E1QA 2JIRA 2HIGA 2FK8A 2PBZA 3EIOA 3SEZA 4BC1A 4MJXA 1CKEA 4ZKDA 1QMGA 3QUTA 1V41E 2GCEA 2XXAA 4S1OA 4UREA 4OHZA 4LY0A 3V6LA 1BGXT 1KPHA 2J9XB 2JD0A 1NDHA 2ZR9A 3O4JA 3Q4GA 2BTQB 2O19A 4LBWA 3TGLA 4MRMB 1JSCA 2JVKA 1VKRA 2PUFA 5A5FA 4N6GA 1WSWA 1BS2A 1CUFA 4A9AA 1LVGA 4M7PA 4QOSA 4XDGA 1FF9A 5BPFA 4P9NA 5H9VA 4E7OA 3RFCA 1PT6A 1G18A 3JQAA 1LVHA 2OV8A 4B3TB 3A1FA 4KYVA 1B0ZA 1YL5A 4MQ4A 1RD4A 5DBHX 5IZCA 3RYHB 3AG6A 5L9AA 5MDHA 2WW8A 1C9DB 4ZDIA 1V47A 1AZSC 1E2KA 1HV8A 3E9NA 1H2HA 4H7FA 1E4VA 4JL6A 4UDNA 2YYAA 3RK1A 1U98A 3S2FA 4PNHA 4FFMA 4IIFA 1VG0B 1GPAA 2B7BA 4D43A 4JXZA 3HXTA 4IGIA 4FDVA 1WBBA 4ZANA 5JO9A 2WAMA 3WK4A 1T24A 4WNAB 1Q22A 2YZKA 3SN6A 3AHJA 5EIAA 1P7WA 4MQLA 4D80A 4XCVA 1SOAA 3KZMA 3LOUA 4EQ6B 3EF1A 4FYPA 1OH5A 1JSZA 1N1MA 1NBIA 1XTKA 3WLQA 1JFTA 4JL5A 5BORA 1E2MA 3MCAA 1DQZA 1GAWA 3TQCA 2AUMA 1OHHA 3EPRA 1TGYA 3ADDA 1XRLA 1KU6A 2PZLA 3CXRA 2PRZA 4UHFA 2I29A 2VF8A 3PDHA 1QIHA 4RJ2A 3U26A 5IXSA 5LKAA 2EZ9A 4NARA 3Q15C 4MKFA 2WKQA 4HZIA 2BC9A 4RY8A 5B2FA 8OHMA 4FD3A 2O2DA 3M4JA 2Z8XA 1G6Q1 2QRLA 3IMGA 4GI2A 4TVSA 3BVPA 3TAXA 1M7GA 3IP8A 1W5TA 3B9RA 3WGHA 1PX0A 2HSGA 3BE8A 3NZEA 5BMOA 5LFAA 2YHSA 4G0MA 1F14A 1O58A 1ZI9A 1WY5A 4JKIA 1NC3A 3V2HA 3PTAA 4IV0A 4DS3A 4JJGA 3TB4A 2CFRA 3ACCA 3CLUC 4UAVA 3FVRA 3BQ9A 4C7KA 4MV3A 5BUCA 1JFRA 3NH6A 3C3BA 3CCFA 3ZNNA 4YAIA 2J59A 2IGTA 4I5EA 4LYYA 1IATA 1UJ5A 2ZANA 3DBHA 3FMGA 2EFHB 2QRPA 3HY4A 3KQQA 3NBXX 1ORRA 3HS3A 4IDAA 4QUJA 4YRTA 3F98A 4BB9A 2E49A 4GX0A 1V8PA 1TMGE 4R9RA 4O33A 4D0SA 1SUDA 2CMHA 3AOGA 2GN6A 3MINB 3PLRA 4DPLA 2BZGA 4JBHA 1PS0A 4RX1A 1PJSA 3T9EA 1PTJC 4AN1A 3NYRA 4OMDA 1N5RA 1IULA 3P1JA 2QTZA 1DX4A 5EPOA 3TE7A 5L8VA 2MSLA 2VXOA 1GZ6A 1W0KA 3NBZC 1F8GA 2Q4OA 2BM1A 3PTZA 4UUAA 4AZWA 4AT1A 3IJEB 1CY4A 5AM1A 5BN4B 3IGFA 3KVYA 3UT6A 4KKVA 3WYBA 3I5YA 3HPQA 3UF0A 2QBYA 2O1SA 3X1JA 2HHLA 1KI7A 4FT2A 4G86A 4Y9UA 2FSIA 2MR5A 5EJ9A 4BYMA 3GGOA 2HMWA 2QTRA 5I8ZA 2IIQA 1AQ6A 3GCXA 4HJXA 2XCLA 4DMMA 2XR1A 3A04A 3LX8A 4ILKA 4KQ2A 5FXMA 3WBKA 3RCBA 3TIFA 3V8EA 3H0KA 3DJYA 5G4LA 4DCCA 2ETXA 4WZAA 4J1NA 2CLEB 1M5RA 4BYGA 1B00A 4AG6A 3S7ZA 2OCAA 1J49A 3FUVA 1T13A 4OJKA 1CQXA 4DABA 2EHDA 2YWDA 2B9VA 1J22A 4JY7A 3KDAA 2QE6A 5LDDC 5H59A 4EEKA 3UGTA 3EISA 4QL3A 2A30A 3GMTA 2ZSIA 1YDGA 3DB2A 1JZTA 2XUQA 5CFRA 1KPIA 2X77A 1UP6A 2XDYA 1PO7A 3H1TA 1Q7GA 4CI9A 4BGVA 4NSNA 4XDYA 3U19A 3FOAA 4QYIB 3K0HA 3WIVA 2F8MA 3G49A 5KVQA 4HATA 1YTLA 1U7ZA 1YULA 1W49A 2IX9A 5ERYA 5KTOA 5L3QA 5TRTA 4BFXA 2X0RA 4AIIA 5DGHA 1MB4A 1W85A 3KU1A 2P27A 3I0NA 3CLTC 1ZGHA 4O2RA 3E5MA 1U7TA 4O2BF 4WK4B 2GCOA 3ZHVA 3VKHA 3OA0A 4TXLA 1T2UA 3P9RA 3QQPA 2Z4RA 4MMZB 4LJ7A 4F84A 3LUDA 2JH9A 4BP9A 1U1CA 2AVDA 1N2CB 1S8FA 4K05A 4C7XA 3H13A 2JJ2D 3ITNA 3GPCA 1XHFA 3GGDA 1HYHA 1V16B 2CYAA 3EZ7A 3T99A 4FDTA 4Y7DA 4B84A 5I5GA 3O1HB 1X7WA 2Y4OA 1W76A 1JIXA 3D7NA 3DCJA 3NAGA 3RIMA 5BNZA 4XB1A 2CB0A 1M2FA 1KH2A 2AN3A 4JC4A 4CV0A 4LOIA 4BV8A 2CUNA 3QTTA 4BB5A 4ZZ1A 5GGXA 1UC8A 1I36A 4MPRA 2IOHA 2JIZA 1C30A 1JDBC 2QDKA 3QBJA 2WD7A 4DB4A 2JCSA 3NS7A 1TZ2A 3ETGA 2HWUA 3MJEA 5JAPA 1VIVA 2Z9DA 2MSKA 3EG9A 1JPVA 1JB9A 1PT8A 3FNIA 3HC7A 1WVIA 3K53A 4RKFA 5TGDA 4G5XA 4QJ3A 4GECA 1XKQA 1HLDA 4ALIA 3TL6A 4R16A 1BQ3A 2HO4A 4I50A 1J8VA 4OXRA 3VH4A 1P2FA 4R2JA 1FJGB 4KVFA 5HFNA 3LW7A 1MFPA 2JGRA 1TI7A 5CVEA 2FDXA 4F4DA 2MHCA 2W90A 4A0SA 4JYPA 3UJNA 3NTUA 4QFDA 1ZUWA 4Q7QA 1T8TA 1UPUA 3R74A 2R4UA 3DZDA 2PUBA 1IJEA 3BTOA 1DV1A 1RWBA 3I9FA 5D6NA 4RKWA 5JAMA 3RIGA 3I1YA 1FRNA 3N2EA 3WYDA 1JG4A 4M1SA 1XP8A 1KAGA 2A0YA 4ZI2A 5CA1B 4ITRC 1FFCA 4RVFA 4CQMA 1T8UA 4YAEA 1NBMA 2XQGA 3A4YA 1UBHS 1YGYA 4D1YA 5EGNA 2JDID 3MWLA 1V1RA 1VDMA 4GL4A 4WWHA 4URFA 3ZU4A 4F4HA 1LH0A 1FZTA 2VT7A 4BATA 3I0ZA 4KTVE 2WMYA 2IHVA 4LI3X 4P58A 4RSRA 5F3WB 4JENA 4AMUA 5EWJA 3AC0A 4HFNA 2OZLA 5AK3A 2JFBA 2H9IA 2ZGVA 1ODCA 1RM5A 1WCWA 4FP9A 2PNFA 3FNFA 1RLTA 4HAWA 1T9KA 1KEEB 1PTJA 3AERA 4ESOA 3A1CA 1A2QA 2C1ZA 3IAS1 4R83A 3PK0A 2XECA 3JWGA 5IXYA 1EIZA 2CMDA 5DCYA 2E7ZA 2C1EA 3KPWA 1FYWA 1EAYA 1YCHA 1ID1A 3WFJA 3RGGA 4IOMA 4K9PA 1JJIA 1GAQA 2IOFA 3FY4A 2RDMA 3LUFA 3TQHA 3TZQA 4DLPA 4EKNB 1QQ6A 4K6CA 2BMDA 4A6PA 1Z28A 4CCYB 1H4QA 4NCAA 2A2ZA 5MHTA 3LBYA 4IQFA 3MERA 4PGGA 1LDGA 2XUFA 3H83A 3C87A 2H65A 4TV8A 2P9HA 4PONA 1SU4A 4MW7A 3STYA 1GIAA 3NYIA 5KUTA 3L0BA 3ADKA 3CUVA 4K87A 3UIEA 3G0OA 3QFRA 3ZZNA 4B9AA 2G06A 2Z56A 2PSSA 4IL5A 1XN4A 4AF6A 4NC9A 1WBDA 4WSOA 3L6BA 4Y2YA 2GF2A 3DZKA 2A0WA 3MWYW 2BUCA 1G5TA 2G4CA 3G85A 2CUKA 1PJCA 1YQTA 2UAGA 3LLSA 4B4OA 5CA0A 3RSZA 1BJKA 1SM4A 3HVHA 3ITKA 3MVEA 5K0SA 3QEAZ 4LF9B 1DLJA 3DHVA 1X39A 5INTA 3R7SA 6CHYA 4EB0A 2EHJA 4PZZA 3TG2A 6ADHA 4P4SA 3B9QA 3U5TA 2R6R1 1CUUA 5L6LB 1RAHA 3JAKB 3UWDA 1MZPA 1NN3A 2QR3A 4UHEA 5DWQA 2ID4A 3C6QA 4JVLA 4QTZA 3DTVA 3GROA 4FT4A 1M8GA 2WHRA 3ABZA 4OI1A 1VGRA 4A2CA 2WYIA 3L2OB 5C32A 1BHQ1 1WU8A 3KAJA 4DIDA 1MA3A 2GOYA 2F1JA 4P93A 1C7FA 1NKVA 2HNKA 2JI6A 4I3FA 3VFDA 4JYZA 2AC7A 2PKYX 3EVZA 3M6FA 4F3CA 2GZMA 2NV0A 3SYKA 1EH5A 5KQMA 2B9EA 2QP3A 2WPDD 1CUXA 4PU0A 5G41A 2BCGY 5BURA 1P44A 5AM2A 2ZIEA 2IYNA 2ATEA 3JVEA 3OOHA 4WZAB 5K3CA 5KCMA 5CAEB 5AIBA 5IAOA 1UDWA 3HHEA 2WILA 1U9ZA 1JJBA 2HK7A 1P5HA 3IPLA 3NBFA 4QT0A 3VZBA 4A2PA 4ZDJA 4LFBB 5DN6D 3RJMA 4L7VA 5FNZA 4GG1A 3ZGXA 4DXDA 4F92B 3SVLA 3R23A 5CHEA 1M2NA 5T5QA 3TLXA 4E2FA 1ATIA 2FFAA 1WB5A 5HBRA 1NOKA 2Y99A 4CEJB 4RVUA 4KMOA 5E4TA 5K09A 2O1XA 1ZMOA 1UBSB 2G88A 4HKTA 4UBLA 1R10A 4J7XA 3B82A 1TMYA 3HB1A 1W4CA 4BQQA 4AJEA 3ZNOA 3WYCA 4LPSA 2QRUA 4OX9Y 2GWRA 2VHZA 1GXSA 4RA9A 4RIHA 1I6MA 4MQMA 1SUCA 4LZNA 4UHCA 1T9CA 3W9BA 5HM8A 4EFLA 4L4RA 4ENQA 1C8LA 5EJ2A 1KYZA 1LF0A 1QH8B 2O05A 3INGA 3T38A 5B6IA 4WMLA 5MN4A 4CQNA 1ZLYA 3QFCA 4WKCA 1WXIA 2ZVDA 4C29A 2O8DB 4RULA 3SS8A 4GX5A 4O6VA 2VF2A 3EPKA 1U2RA 2UZ1A 1GCGA 3GJXC 1C1DA 1FVOA 3HBMA 1ZIPA 3LECA 3NKLA 3F9IA 2C99A 4MLPA 1VBFA 2G08A 4PC3A 4AKGA 3N8IA 1H1TA 2FPIA 3QEMB 1JG1A 5TQ2A 1RRKA 1T2AA 3BH0A 1DQNA 1G4UR 1OA0A 3Q3IA 4LDRA 3NPMA 5BT9A 5KNDA 5IHPA 1FW6A 4FLEA 1T5IA 4PSUA 3EWIA 2JKZA 2VF5X 1BWPA 4O4IB 5T3YA 4YEDA 4Y0NA 4L9AA 3FJYA 3RVBA 1NQAO 3WK8A 3U3KA 5BRJA 1E2NA 1NIJA 3RFTA 4YMWA 2XODA 4LZLA 2AEJA 3FKSD 2AQ8A 1MN6A 3SU8A 5LP1A 4H1WA 1ORDA 1ZBQA 2VXYA 2XOXA 3KTOA 2GXQA 4CBVA 4ED9A 1NG9A 1EE1A 2X5KO 2QAGB 3IE1A 5ESXA 1WNTA 2QN9A 2Q49A 4ENVA 4XE5A 1F4PA 2QRJA 4H7JA 4FGLA 1QVZA 4L0QA 3O26A 5JE8A 3NDIA 4OHKA 4ETMA 3LUKA 2UYOA 3MCVA 4KXXA 1K3FA 2WJYA 2UYGA 1BEUB 5T4EA 1UFVA 2PZAA 4YDSA 5B53A 4IHKA 1CY2A 3HM9A 3MT8A 4D96A 3LSYA 3A8TA