3RQSA

Crystal structure of human l-3- hydroxyacyl-coa dehydrogenase (ec1.1.1.35) from mitochondria at the resolution 2.0 a, northeast structural genomics consortium target hr487, mitochondrial protein partnership
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
292
structure length
292
Chain Sequence
KKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR487
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
total genus 115
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3rqsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rqsA01
1P1JA 5JAZA 2GPTA 2CMDA 4LVUA 4N7RA 4IXWA 1E1LA 2DUWA 5JAMA 1B14A 3E5MA 1QMGA 3GAZA 3PYMA 3TZQA 4I08A 4XYGA 4DLBA 4BVAA 3ETDA 4NU5A 3E03A 2CF6A 3DZGA 1HDYA 4J1TA 5IXYA 1MGOA 4EI2A 1JA9A 4XYMA 3BMNA 1O9BA 1GZ4A 3OF2A 1N5DA 4XQ9A 1U9JA 1DHRA 5K0ZA 4MDHA 3BMCB 5FWNA 1ZSNA 3LT2A 4GWKA 2C54A 1E1KA 2QQ5A 4ALKA 1L7EA 1GPJA 3KVOA 4IIVA 2Q1SA 3C7AA 1XDWA 2NLOA 5JDIC 1WZIA 3I6QA 4AJKA 1GUYA 1KEUA 2RHCA 4QECA 5I9NA 3ZV5A 1TT5B 1X14A 1Y8QB 3VZRA 2O4CA 1ZVMA 2JD1A 3AUTA 3KHUA 3UGKA 1GCUA 1PL6A 2H1SA 4CJXA 1PZHA 3IIEA 3PQEA 1CF2O 1HF3A 1I5RA 3GHYA 1RYDA 1KVUA 2HK9A 1A4UA 2WM3A 4IS2A 5DT9A 3MJTA 3OIDA 5EQDA 1SMKA 4YJFB 4TRNA 4HFNA 4RVUA 3E9MA 4N18A 4OOEA 2EGGA 2I99A 4JQCA 3NV9A 3KLPX 3AI1A 1LRJA 4PLPA 4CR8A 2Q3EA 3ZN2A 4KUHA 5JYEA 3I6IA 3E1KA 2BF7A 5BNFA 2RIRA 4YCAA 3GOHA 4FGWA 4ZQHA 3I9KA 1UXIA 1R4MA 3U49A 1ULSA 1EVJA 3E8XA 1HDZA 1DIRA 1PS9A 1TI7A 1U4OA 3IJRA 4HY3A 1ZNQO 4L8VA 5DP2A 1U8FO 3JQ6A 1SZJG 3INRA 2Q1UA 2VHWA 4JBIA 3IDSA 1VC2A 4G2NA 4YBZA 3EVNA 2F00A 2OP0A 1ML3A 4J49A 4CL3A 1Y5RA 2VZ8A 5TRTA 3K5PA 4TRRA 2GZ3A 4BGVA 1LI4A 5IG2A 3ONDA 4M8SA 4Q3BA 2PD6A 2IEDA 2VT2A 1E6WA 1GYPA 1Y8RA 2JFHA 3PHGA 2PFGA 3QWFA 4PLGA 1LUAA 4WCDA 2JD0A 2PD4A 4CL8A 4TRJA 4N5LA 2VOJA 1C0PA 1I3MA 1V0JA 2NQTA 2YV3A 4PG6A 3ULKA 4EZBA 2VWHA 4IDBA 4E6PA 3BYZA 5H82A 4B4VA 1GY8A 5IDXA 5A4DA 2Y68A 1QORA 1N8KA 3KSUA 3O9ZA 4UEKA 3JD0A 1N9GA 2GF2A 4FS3A 3ADPA 3F4LA 1C3VA 3SVTA 4CLRA 4KDFA 1DC6A 4F45A 4QT0A 2ZK7A 4OXKA 4EUHA 2DBQA 1YDWA 3WFIA 1DSSG 3K92A 4YJHB 5A5FA 1I3KA 3GDOA 1PQUA 5TSDA 4NK5A 4XB1A 4GSKA 5DP1A 4R3NA 4IUYA 5CDUA 2EERA 1E7RA 3JYPA 5DOZA 1K2WA 2WDZA 4YXFA 1WMBA 1T2EA 3VVCA 4B3JA 1YJ8A 4ND5A 4ND4A 2QG4A 3OJFA 2CDCA 3GHHA 4OM8A 4J90A 5F3RA 1OAAA 1WDMA 1NX6A 4EEXA 2PNFA 4MP8A 3NEPX 1CQIA 4RORA 4CMKA 4YAEA 4ZA2A 3RSHA 1ADFA 1QXSA 3WSWA 4S1VA 3CZMA 5A04A 5KIAA 4LK3A 2DPHA 1O8CA 4CMAA 3UXYA 1TA4A 1BXGA 1TT5A 3W1VA 4P4LA 3EW7A 4DUPA 4J7XA 1XYGA 4I5GA 3JYOA 4CPDA 4CLHA 3PTZA 5FFFA 3O8QB 4ND3A 4MIYA 4O5OA 1NASA 1VL0A 3A06A 5F1PA 5C7IO 1ISIA 2Y0CA 5CDYA 1Y5MA 3NDJA 3DMYA 3K8ZA 3BAZA 2X4GA 4HWKA 5JAQA 4YRDA 2CUKA 3ST7A 1EBUA 2GUGA 5KJCA 2WMDA 2NWQA 1LA2A 1JKFA 3GDFA 4DWVA 4FFOA 4XIYA 5CPFA 3UOGA 3CEAA 3STHA 5KVVA 5KVSA 4TRMA 4AJEA 5GZ6A 1MG5A 3TZKA 3S1LA 3H9UA 4WCFB 2PZMA 1Y9AA 3I9OA 4KUGA 4DREA 1MV8A 4U0KA 2LDXA 4YTEA 4HNGA 4MVJH 3GVXA 1PJCA 2FSSA 3GN2A 3UCFA 2EG9A 2Q2QA 2X0NA 4RLSA 1UDCA 3U09A 1WW8A 2R6JA 3PEFA 1J6UA 5JS6A 1HDRA 4GH5A 3TWOA 3DBLB 4Z0PA 2NU8A 1Q0LA 4YJHA 5H81A 2G76A 3N74A 3INTA 5IFLA 3K30A 3ZWPA 4XEHA 2P9EA 5ER6A 2D5CA 4IDCA 2I6TA 2HK7A 1ORRA 3LLVA 3VZPA 2DC1A 1LDMA 1H6BA 3VZQA 4WCFC 1JKIA 4JLWA 4D3FA 2HJRA 2QZZA 1Q0HA 3HSKA 3RBVA 3PFFA 4L9RA 4YPOA 2J5RA 1V9LA 4DPMA 1DEHA 3R6DA 4YT4A 2QYSA 3AY3A 1LLCA 4JBGA 1DRWA 1PS8A 3UICA 4ROSA 1LDYA 4KZPA 4Y98A 5C37A 2YZ7A 1JAYA 1TEHA 1XCBA 3KEOA 1EMDA 4DVJA 3MJVA 4J1SA 1E3LA 1NQOA 1YKFA 2V6BA 3JYLA 3WGQA 4TKMA 4XR9A 5T5QA 4BNVA 1VM6A 3A4VA 2D2IA 4RVFA 5HRUA 4E4YA 2PA3A 5I9LA 3RWBA 1ZK2A 2X9NA 5ICSA 1HDCA 1DLIA 4H15A 1IZ0A 2C07A 2CFCA 3TF5A 4H3VA 2IYPA 1MC5A 5KJ6A 3HN2A 5BR7A 4BO2A 2ZIZA 3DZHA 3WGZA 3GUYA 2V7PA 3E9NA 5LC1A 4I9NA 4UVEA 5COQA 2DTXA 4YQYA 5JY1A 5EL0A 1UDBA 4RZIA 4RZHA 4E5NA 5L45A 3HE3A 4NIMA 5HS6A 5TQVA 3H3JA 3CMMA 1H6DA 2GGSA 3HG7A 1H94A 3N7UA 3D1LA 3JQBA 3NGLA 4GKVA 1X0XA 4R5MA 5EN4A 4CM8B 3K2EA 5HTOA 1IUKA 2Y0DA 4YT8A 1R0SA 4Q9NA 5CPBA 2Y05A 2ZB4A 3SBOA 1ZW1A 3MTJA 3MEQA 1LSUA 3AI2A 3O03A 3OSUA 1QYVA 3H6KA 3GY0A 2FR0A 4DRYA 1A9YA 3F46A 5L53A 4L4XA 1ZK3A 2WSBA 3NUGA 2X22A 4OIMA 4PN3A 3QA9A 1KC1A 4ZVVA 2JCYA 1H0KA 4J91A 1FF9A 3CH6A 4FFPA 3U3XA 3IMFA 4ID9A 1GYRA 1VI2A 1B3RA 3MJCA 4II3A 3KBOA 2FPIA 3VKVA 4PIVA 4BO8A 1HDGO 1RM3A 2O3UA 1T1RA 4PVDA 3F1KA 3AOEA 3FBTA 3R0IA 4NJMA 1RYEA 5K6AA 1OBFO 3JQ8A 1ONNA 4FDAA 1G1AA 1U2GA 5THQA 1O89A 8LDHA 4ALNA 1VJTA 3C85A 5CEEA 1LDBA 5GMOA 5CAEA 1YOVA 3IJPA 2IYOA 3RC7A 2GERA 1B8UA 1Y81A 1ISGA 1PQWA 1ZFNA 4F46A 4CLOA 4OSPA 1YE3A 5G2OA 3QJ5A 4EYEA 5C7OO 2WJPA 4LRSB 5B4TA 5AXCA 1N7GA 1P77A 2AE2A 1QV7A 3H4VA 1E3SA 4HX5A 4CV0A 4BNLA 5IDQA 4UUOA 3K9QO 3S2FA 3UH1A 1G0NA 5A3JA 2B83A 2YJZA 2BLLA 3NX4A 4WLEA 3ZCXA 3AU9A 3HB4X 4CM9D 4W9NA 1BXGB 4CV1A 1IYZA 1WDKA 1VL6A 3B1JA 4ZQFA 1IZ9A 4UVHA 3TQHA 2VCYA 3DBRB 1RM0A 1FXSA 4IQ0A 2C29D 1YBAA 2BI7A 4L0QA 1EQ2A 5ENVA 5G0WA 3VTFA 1KBZA 3ICCA 3H2ZA 3DFZA 2DKNA 4FW8A 3V1TC 1N1EA 1PL8A 3AI3A 4BO7A 2YW9A 4FN4A 3KYBA 2FSVA 4YR9A 4AJOA 3JD4A 4J6FA 3WB9A 2HO5A 2FMUA 1M67A 4YJFA 3DXFA 4TKLA 4AVYA 2PKQP 3C3XA 3DEYX 4GQAA 1KVRA 3K31A 4HXYA 4ZU3A 4E5KA 4J0FA 1YGYA 3OICA 4DYVA 3AW9A 1WWKA 4BNXA 1LDEA 4BB6A 2EJWA 2VYND 1PJ3A 4LGVA 2J3KA 1YJQA 2BGKA 2CVZA 3NKLA 5COAA 3ZWXA 3HNPA 4DPKA 4BL5A 2FZEA 1ONOA 3Q9UA 3DZFA 3DQPA 4TZKA 3IP1A 5TT1A 2DFDA 3WJAA 2H6EA 1YB1A 2C20A 4EJ0A 2DTDA 3BTOA 4Z9YA 1O94A 3TZHA 1BGVA 4G81A 3ZZNA 4EITA 3VH3A 3AOEC 2AQKA 2RHRA 1K5HA 4JJGA 3MJEA 3GF4A 5EMHA 5LDGA 3OA2A 1NM5A 3D64A 4XR4A 4MVJG 3EZYA 3TPCA 3VPFA 3SLKA 3GGGA 1P44A 4D3DA 1HZZA 1P74A 1A5ZA 2YV2A 5JDCC 3MJ4A 1W8DA 4IGFA 4XJSA 3GG2A 4GGPA 3KOUA 4MPDA 3ZDFA 2OP1A 3ITDA 1Y9EA 1W73A 4N5NA 3C24A 1NP3A 2AE1A 1V3UA 3QQPA 3WQRA 4AJ2A 3ZU2A 4CQLA 4AICA 1KERA 1GZ3A 2PKQO 1G0OA 2Q4BA 3DONA 5B4UA 3PJEA 2EGHA 3WTCA 3HDJA 2NVWA 3TNLA 3AM5A 2B5WA 2I5PO 2YY7A 1FDSA 3GRPA 4XQEA 3EGOA 4DQVA 2HU2A 4A27A 1PGJA 4E5YA 5BSEA 3JQEA 5JAIA 3PIDA 2W2LD 1KEPA 2D1YA 4PFJA 4R41A 3RIHA 2R00C 1YRLA 4BS9A 1SBYA 3HZZA 4PG8A 5KCZA 2A92A 3FCOA 3HJAA 1Y6JA 3CINA 3P2OA 2NTNA 3KYCA 1ARZA 1V8BA 4K9DA 4E2WA 5JLAA 6ADHA 1C0LA 1HE4A 2I66A 1LC3A 4BO4A 5I7FA 5JCJD 4R54A 1WMAA 1ZO8A 3F47A 3H7AA 1R4NA 4ALJA 2EW2A 3PGJA 3RKRA 2GN8A 4PLVA 3GH3A 2ZATA 3BMNB 4M87A 3RJ5A 4FQ8A 1HLPA 2J5KA 3FSRA 2EP7A 1UH5A 2B35A 1ZH8A 2A9FA 1LDNA 1X1TA 4O0LA 1JN0A 3NDIA 3OJOA 4CLDA 3JQAA 2DQ4A 2BKAA 4D46A 3DAPA 4B8ZA 3JQCA 1CIVA 4DC1A 1U1IA 2Q2VA 4E0BA 2JCVA 1ZJZA 5DDIP 2PZLA 4GX2A 4TMFA 3ZW8A 4WECA 3ZU4A 3RJ9A 1H2HA 1NWHA 4BB5A 3M2PA 4A0SA 1V35A 1CJCA 4H16A 4O59O 1R66A 1YQXA 2EKPA 3GEMA 2O3JA 5JC8A 1PJSA 1DJNA 4A03A 1KEWA 4CV2A 5EQFA 2HKIA 2ZTLA 2HMVA 4KTVE 4WK6A 3RUIA 2DFVA 2X5JO 3ZNNA 3GMSA 4DYDA 1M6WA 1PSDA 2WWRA 1LC0A 3D0OA 4RJTA 1I2ZA 2HJSA 2PZKA 2NNLD 4KWIA 3F3SA 1GD1O 3JYQA 1GQQA 4CV3A 4IJKA 2BGMA 2Q99A 1UP7A 1KOLA 1UP6A 3HADA 1XQ6A 3FRJA 1ADCA 2P5YA 3OIGA 3UKOA 3C8MA 3F1LA 5DCWA 5FF9A 2IE0A 4J1NA 4WOKA 1HDOA 1HSZA 2WD7B 4MIOA 4Q3AA 2OXIA 2O48X 1HE3A 2PWZA 2BH9A 4DQXA 5L3ZA 2Q4EA 2VN8A 2CSUA 2FOIA 4BGUA 1ENPA 3Q3CA 1RM5A 2FRDA 1P1IA 3QY9A 3NTQA 3PZBA 2GCGA 4IZIA 4IQGA 5I7EA 4PG4A 3AY7A 1I33A 2D5AA 2BFAA 4KQWA 4WNIA 2GR9A 2NACA 3S8MA 2ZTMA 3JD2A 3OMLA 1UP4A 3NJ8A 4E31A 2VRBA 3DZKA 1HETA 3RUDA 1FDVA 2TMGA 2X0JA 3X2FA 2XXBA 4MKXA 5JDCA 4IDDA 1VLLA 4RVDA 3QIVA 3Q1LA 4JN6B 1IULA 1P45A 4I5EA 4FC6A 5L40A 1JWAB 4U7WA 5THKA 3P2YA 4C4OA 4YRBA 2ZCVA 3IS3A 4HFJA 4HP8A 4BO0A 3WOHA 3WIEA 1K6IA 1QKIA 3F5SA 4ILKA 1ADBA 4GI2A 4J2OA 3KYCB 1XSEA 1I2CA 3D3WB 3VPGA 1DRVA 1O95A 4RLHA 2WEKA 2ZB3A 1C1XA 4UULA 1ZZEA 2O3QA 4BUCA 4TSKA 1XGKA 3NTOA 4K26A 4E5PA 1R4NB 1DXYA 1EVYA 2VNSA 3FF4A 4DLLA 2W90A 4HBGA 3W4IA 5DF1A 4MO2A 4GX0A 3V8BA 2PH5A 5HA5A 5G0SA 3MJSA 1T2AA 1W6UA 3ZU5A 4UVGA 4U5QA 3K96A 2VZ9A 3L0DA 3QW2A 4XJTA 3ZWVA 3D4OA 1P0CA 2V65A 4ITUA 3BA1A 4N5MA 1KVTA 4JX8A 3S2GA 2TMDA 1B16A 1I10A 4AG3A 1JDJA 4MJLA 3OFSA 2V6MA 3P19A 3ABIA 3FNEA 3CUKA 1ZSYA 3OQBA 3DOJA 4GGOA 3WWYA 2DU8A 3FD8A 1QYXA 3JCZA 1PWXA 3WQQA 4YJDA 3QE3A 1WLYA 2PK3A 2HRBA 5A3VA 1N7HA 3D5QA 4AJIA 2NADA 5ER9A 7ADHA 1ISMA 1AGNA 3NT4A 3H8VA 3QVXA 4W99A 3H9QA 3RROA 3NGXA 4RF2A 3SC6A 4GLLA 4CR7A 4INAA 4XB2A 2AXQA 4CM8A 4L73A 1ULUA 2Q2WA 3DAFA 3DC2A 2QIOA 3FNFA 1LSSA 3ZV3A 2C7VA 1C1XB 1SCUA 5BNTA 2E48A 3OEYA 1LJ8A 4A2CA 4Q3EA 2J3HA 2VHZA 1QG6A 1KVQA 1HWYA 2P9GA 3LC7O 1B7GO 4BMNA 4FOOA 3WYCA 2I3GA 1R0LA 1R0KA 1KETA 2J3JA 4FJ1A 1P9LA 1HRDA 3DBVO 3CZRA 3WLEA 1GYQA 2NSDA 1BG6A 1S7CA 3RBZA 4CLRB 4IBOA 5GY7A 1A9ZA 4BV8A 1WXDA 3PRJA 4BNKA 4IINA 4WGGA 3GLQA 5B12A 3FNGA 1L7DA 2IRWA 2VTEA 2PTGA 4QO8A 3UN1A 4B3HA 1BVUA 4F3YA 3GVIA 1VRWA 1BDBA 3I5MA 4FFMA 5TJHA 2CD9A 2Q1TA 3UFXA 5TS3A 3RUEA 5GZ1A 5TIIA 2DPGA 4B79A 3FBGA 1VL8A 5T67A 3BMQA 4BGEA 1GAEO 3F9IA 4NZ9A 3PZRA 5F21A 3FR7A 4BHTA 3QLJA 5A1TA 2WTBA 3TN7A 2AA3A 1OC4A 3RBXA 3JQAB 2UUOA 4RVHA 1LRLA 4RGBA 4UREA 2GRAA 4UAGA 4YT5A 1ZXBA 4HKTA 1X0VA 4I1IA 1C0KA 1T26A 5CDSA 1KY5A 5A5EA 5CEFA 3WDSA 4JGBA 5L4NA 1MB4A 3F6YA 3OECA 3HN7A 4K6CA 1P1FA 4W9NC 2HMWA 1F0YA 2BD0A 1SB8A 2NV6A 3H2SA 4CM9A 5EJ2A 1SC6A 2WE8A 3VKUA 1EDOA 3HWRA 3ZGYA 2QW8A 2WE7A 4IJUA 2P2SA 5BSGA 2W2KB 1PJBA 1E6EA 4AJHA 2JFFA 1CETA 2A94A 2Y1CA 2RCYA 2EWMA 1VKOA 1ZEJA 5C7LO 5MDHA 1GZ6A 1NPTO 3JQ7B 3ZWYA 4HNHA 4OXNA 3Q2KA 3WJ7A 1IOLA 3D3WA 4R68A 1MA0A 4RF3A 4FJ2A 4TWRA 4Z9XA 1K89A 5I8ZA 4OYRA 5A06A 1E92A 1J4AA 4Y6PA 1U5CA 2O2YA 1PJ2A 3ASUA 5A9SA 4IDEA 4Q3DA 4WE3A 4CQLB 3NRCA 1EFKA 1C14A 4R16A 1KY4A 4CMBA 3DOOA 1X7GA 2B5VA 2G17A 3RU7A 4CLOB 4BNYA 4CM1A 3W8EA 1DIAA 4KMSA 4KDEA 2C0CA 2O2SA 4OMUA 4XGKA 4DA9A 2OGUA 2SCUA 1PWZA 1B3BA 2BHLA 4FOSA 3ROPA 3FPCA 1NVTA 2I3AA 2FPPA 2O3SA 4NPCA 2FHSA 3WGTA 3TL3A 4M1QA 1TXGA 1YQDA 4JJFA 4R1NA 1LXCA 1T2DA 4YRAA 1P1HA 3DR3A 1M76A 3QHAA 4RQUA 4E2YA 2FZWA 2HLPA 3GT0A 4PG7A 4F6CA 1DDOA 1OOEA 3HFGA 3PHJA 3I9NA 4J9VA 4OO3A 4F6LA 3DTTA 3QWBA 4GPD1 4RPGA 5T8KC 2O3TA 1UXHA 4OHUA 3MCVA 2OL4A 3QVTA 4QO7A 3I23A 4IY1A 1SEVA 3WWZA 3AU8A 4UEOA 4NFHA 1U3VA 4NNJA 4DMLA 3PJGA 3DHEA 4MVJI 1X13A 3L77A 4JK3A 5DBIA 5FYDA 3GRKA 3V2GA 2YHIB 1RKXA 3GZNA 1LQUA 2CVOA 4PGFA 1CDOA 3DZJA 4R5HA 2VUTA 1EE2A 3DDNA 1Q2XA 2W98A 1LDGA 1ADGA 4OQZA 3GQVA 2AQHA 3ZNPA 3HB5X 4AJ1A 3U0BA 3I83A 3VH2A 3OJ0A 1X7DA 2EJVA 3TOZA 5BNIA 5F5NA 4XX0A 4YJGA 1OMOA 2O50A 1NFFA 5HM8A 3PIIA 1YB5A 1E77A 2A35A 3WGHA 4YJGB 3OP4A 2IODA 2NVBA 3A28A 4U0JA 1K3TA 4DIBA 1YONA 4FFNA 2ET6A 3NT2A 2WYWA 3EC7A 1T24A 5KJFA 3AK4A 2NUAA 2OUIA 1E5QA 1BRMA 4TZTA 4WCFA 3B1FA 2B69A 4Z3KA 1E3WA 3NTRA 1JVBA 4II2A 3WGYA 4AJNA 4DGSA 4BNFA 3JQ9A 2VUUA 4E5MA 4XRRA 1ISJA 1ENOA 3MZ0A 3FI9A 3C7CB 4Y67A 4XRGA 3GPDG 3H65A 3D5TA 5CG2A 3W4KA 1UXGA 2DT5A 3RFVA 3Q9NA 1P1RA 1Z45A 2BFPA 4NDNE 2VOEA 4IMRA 3ADOA 1T1SA 5G4KA 4B4WA 1HYHA 5JMWA 3LT4A 2GD1O 5A03A 4NBVA 1R4MB 4K6FA 4KUEA 1UJMA 4MVJP 4KTTE 4LCEA 5AOVA 3RVDA 5ICMA 1DRUA 4MKZA 3QVSA 2R2GA 1IPFA 4UVIA 1I0ZA 2H5LA 4TVBA 4CM4B 4BOYA 4D45A 3L6DA 2NU7A 4NJOA 3SC4A 5K6AC 5TLSA 5TT0A 4J4BA 1MG0A 1P1KA 3ROKA 1NBOA 4OH1A 5HS4A 5L4SA 1Q7GA 4MP3A 4BNJA 5FEUA 3R3SA 2DUUA 1DOHA 2JCXA 4P4GA 1O0SA 4IJVA 2QYTA 5IZCC 2YHIA 4XGNA 2PY6A 1B26A 1XIVA 3NDRA 3OJLA 4Y6SA 2B36A 1T4DA 5I8WA 3IL2A 4XGIA 1J5PA 2UVDA 1NVGA 2VWQA 3PDJA 5JO0A 3C7DB 3FTNA 2FPGA 2YYYA 5KVQA 2B4RO 2CNBA 2VWGA 2ZCUA 3LZ6A 3PPIA 4W7IA 3RUFA 4CLEA 5JSFA 1QYDA 2QX7A 4R3WA 2O23A 3EZLA 4XYLA 2JHFA 4BNMA 4DC0A 3B70A 4IM7A 1R15A 2Y67A 1EQUA 3LF1A 4AFNA 3G49A 4XDYA 1I8TA 2C5EA 5G0UA 4RO0A 4JBHA 2ZYGA 3W4JA 2PGLA 5DBFA 4DMMA 4CMCA 2DTEA 2OHXA 4ND1A 5FI5A 3VDQA 3QV1A 4YAGA 1AHHA 4MINA 2RH8A 3UHAA 1U4SA 3KRTA 4D79A 3ANLA 1PGPA 2NVUB 4U6SA 3PI7A 4NI5A 4WLUA 1HYGA 3H9JA 4MIEA 3E5RA 4QXMA 2P4QA 3VH1A 4DBVO 4GX5A 1JU9A 1U7HA 2AW5A 3W8FA 2VUSA 1CWUA 5ES3A 1PS0A 1Z82A 4RQTA 4YWJA 1QP8A 5DNAA 2GSDA 2IDZA 2J5QA 4BNWA 3EAGA 3QP9A 1NFQA 4W4TA 4J9UE 3HHPA 4E21A 3U62A 3WGOA 3W6ZA 1NFRA 1M6HA 3JQFA 4D7AA 1X15A 1AXEA 2J3IA 3O38A 3PXXA 3KO8A 4PLZA 4B3IA 5DCUA 3DL2A 4LISA 4AL4A 1BHSA 1A71A 4RL6A 3KXDA 5JBIA 4IQ8A 5T57A 4CMEC 4NBWA 2YDXA 4WLFA 2BMAA 3I1JA 4R1SA 2I9PA 4OQYA 1A7AA 1PZEA 3JQGB 1IPEA 1L1FA 1I3LA 2O7SA 5DCYA 4NFYA 4QUKA 3PP8A 3WLFA 3QRWA 4CM7A 3VZSA 5GZ3A 3L6OO 2G5CA 4RV9A 4CR6A 3AUSA 4E13A 5L95A 3T7CA 1VKNA 2DAPA 3I4FA 1E0DA 5F1KA 5U4QA 1MFZA 5L7TA 2D3TA 1D8AA 2GN9A 1DC5A 1Z75A 4NHEA 2HSDA 1C0IA 4NG5A 3BTUA 1EUCA 3K73O 3PK0A 4YQZA 4NK4A 1F17A 3G1UA 3ZI0A 1GCOA 2BI8A 1E5LA 3L9WA 5COBA 5A05A 1NPYA 1ZEMA 3PHHA 4D43A 3L9XA 3L07A 3Q6IA 3BTSA 4PRLA 4D44A 3PJFA 3W6UA 3U4CA 1U28A 4CMGA 4CM3A 1DO8A 2W2LA 1I36A 4KP7A 2ILTA 4XYEA 5I9MA 1K0UA 3ASVA 1DIHA 1SAYA 3V1YA 4YACA 3ZV4A 1ZCJA 4URFA 2GO1A 1ZUD1 1HTBA 3CKYA 1YO6A 3DWFA 2Z5LA 1NQ5A 3BHJA 4W7HA 3OETA 5U9CA 3DOCA 1PJ4A 3JQDA 4ND2A 3QWIA 4MVJE 3JYNA 4J4HA 3FWZA 3KZVA 3PHIA 4Q3NA 3PLRA 1VJ0A 3C1OA 3IKVA 4B7XA 2X58A 5DN9A 5G0TA 2C82A 4FJ0A 3LC1O 3P7MA 1HL3A 4R9RA 2CDAA 3WYBA 2WYVA 3KLMX 1ENYA 5JE8A 4BO1A 1QR6A 4I8XA 3EUWA 2EEZA 1PJQA 4FCCA 4Q39A 2AEMA 3A9WA 3JSAA 5IJZA 1W4ZA 2B4QA 3PGXA 4BO3A 4ZRNA 4ALMA 1T2CA 1DBVO 3CE6A 2C5AA 3H3FA 2AMFA 3ZWOA 1LBEA 3ANNA 3M1AA 1NR1A 4Z0TA 2X5OA 3GUCA 4M49A 3MOIA 5BSHA 1BW9A 3GFGA 4I9HA 4ALLA 4E30A 2VYVD 3SLGA 4KQXA 3RC2A 4CQMA 1MX3A 1R37A 4XDZA 1GUFA 3KSZO 4GL4A 2OBYA 4IDGA 3UCXA 5L7WA 3E6AA 5TGDA 3WGIA 5CHEA 1RWBA 2X86A 3GEDA 4IPTA 1PZFA 2VHXA 3JQGA 4R1TA 2HAEA 4S3MA 4P4NA 1QRRA 2G82A 5F1OA 1GL3A 3T4EA 2VWPA 1O6ZA 1R16A 1QLJA 2FWMX 5ILOA 3E18A 1GR0A 1LSOA 4QTZA 5JPIA 2ZQZA 3LF2A 1PGOA 1CYDA 1F8GA 1DAPA 4UUMA 4YYZA 3HUDA 3LK7A 3AUUA 4RDHA 3GGPA 5DULA 5JY6A 4LSMA 4GSLA 3KETA 2FR8A 4UVDA 1W0CA 4CMJA 2JL1A 3T4XA 4CUKA 1KYQA 4EGFA 2E37A 1V6AA 3BMOB 2FY8A 2P5UA 5DZSA 1Z73A 5LDHA 2X23A 3GEGA 3OH8A 4JROA 5L4LA 4AJLA 2XAAA 5JFOA 1NNUA 3ZH2A 2OOSA 3LC2O 3ZWCA 5CP8A 4Z9FA 2W4QA 3HDQA 3DTYA 4BNGA 5C3MA 3CMCO 3WBFA 2C59A 4NBRA 4RDIA 4I5FA 1E7MA 1MP0A 1Y8RB 2EKLA 3KYDB 5JC1A 3GGOA 3ETGA 2PV7A 1KVSA 4XCVA 5KJ1A 3TZCA 1A27A 1Y8QA 4NFSA 4CM6A 2HMUA 3V1UA 1I32A 1Q7BA 3IC5A 3PQFA 3KM0A 4WEOA 5T6BA 3GFBA 3AOGA 2GZ1A 2Z95A 3HDHA 3LYLA 5TC4A 4B8WA 4RPJA 4E32A 1BXZA 1DC4A 1E1MA 4CMHA 3WR5A 2PR2A 3LU1A 3AFMA 4RF4A 4ZHSA 1A72A 3B6ZA 3U4IA 1Z7BA 3GVCA 4FD3A 2NU6A 2PLAA 1P31A 2E49A 3WTBA 1EUDA 1LX6A 1WAMA 3PQDA 2WD8A 3TOXA 1HLDA 3JTMA 4BNIA 1RJWA 3H9EO 5HBRA 1IHXA 4DL9A 2UAGA 5CEJA 4E12A 3ZWWA 3VPSA 1XU9A 2Q50A 4KOAA 2DBZA 1ZBQA 1JTVA 3U5TA 4FC7A 1Z74A 1H6CA 1YL5A 2I67A 3AWDA 3EHEA 4QSMA 4EEZA 1UXJA 1MXHA 2IXAA 2ZTVA 4WASA 4M86A 2RAFA 4N54A 1HYEA 1H93A 1XWFA 2W2KA 1XR3A 1JWBB 1KIFA 4UUPA 4WOJA 1IHYA 5AQ1A 1X1EA 5BT9A 1HXHA 4NQZA 4GBJA 1LLUA 3O4RA 3F5QA 3UVEA 3QWAA 3M1LA 2EHDA 3RD5A 3I52A 3VC7A 1PEDA 3K2BA 3OJEA 4LMRA 5A9SB 4EUFA 1YQGA 1EUZA 2E4AA 1E3WB 1YH3A 1HE5A 2IEBA 3C1TA 3JD3A 5TJ9A 1KEVA 3H5RA 3GNTA 1U5AA 1KC3A 2P4HX 5G0VA 2HMTA 1H5QA 2D59A 1LRKA 2H63A 4XYBA 4M54A 3L4BA 4ZQEA 2X9VA 3BMCA 2EW8A 4WLNA 2R00A 1A4IA 3LQFA 1D3AA 1YL7A 3ICPA 1QSGA 2YFHA 4JIGA 4OXYA 2O4UX 4YAJA 5A9RA 1DPGA 3RI3A 2JKVA 1ENZA 1IB6A 1N1GA 4QQRA 3TJRA 5JMPA 1N9GB 3DB2A 2DLDA 1XLTA 1PTJA 2UYYA 3G1TA 3UCEA 1N2SA 1PR3A 4RPLA 5ENDA 4GLOA 1LLQA 3G0OA 3CXRA 3VOSA 1IL0A 5IAAA 3WICA 8ADHA 1D7OA 3ZWAA 1ONPA 4RCVA 5JO9A 4O63O 2NM0A 2G0TA 1YBMA 1YOVB 4PG5A 2AHRA 4OKIA 4RPHA 1NQAO 3JQFC 4Y8VA 2W8ZA 3V2UA 4WNCA 3BIOA 3OQ6A 4KWHA 4J2HA 2I76A 3INGA 4WPGA 2HDHA 2DBRA 4BNZA 1PGQA 4UUNA 1DFIA 2EIHA 4LW8A 2P68A 1ZMTA 3IQDB 5CDGA 3I4CA 4PCVA 3CIFA 1E7WA 1CERA 5JCJA 5U1PA 2VHVA 3WSVA 4L76A 4OL9A 1F06A 2PD3A 1GDHA 3VPXA 2UUPA 1N92A 1DIBA 2G1UA 2Q45A 3S2IA 1FDWA 3PFWO 5A02A 4E2XA 1R12A 2ZTUA 5F5LA 1EVZA 1E7SA 4NU6A 1UAGA 3WNVA 5BQFA 5EERA 1BDMA 1AXGA 1AE1A 4WKGA 5KJEA 3RUAA 4CMEA 4U6QA 1IE3A 1G6KA 3TZ6A 3OBBA 1GV0A 3AM3A 4M55A 3O8QA 2JFGA 5A9TA 1ZSVA 1DHTA 4ONEA 1B8VA 2AEFA 3TSCA 4D0SA 4BKOA 5JXWA 4MVJD 3R1IA 2LDBA 1YB4A 4RF5A 1EZ4A 4OGWA 4GAEA 3NAQA 4BO9A 4NBTA 3U4HA 4BO5A 5IZ4A 4XKJA 3EDMA 2XOXA 3SEFA 5KKAA 3MOGA 2Y93A 4EW6A 4XD2A 2OMEA 3DAGA 2HMSA 2UDPA 3WQSB 4L75A 4IMPA 4ZQGA 2XPCA 1V3TA 3K6JA 1LU9A 3BHMA 4K1LA 4EBFA 2ZB8A 3GDGA 4DBZA 5KOIA 1XA0A 4ZICA 4JJIA 3DBHB 4PZDA 3D7LA 4DIOA 1VPDA 1KS9A 5EPOA 2BELA 4J4TA 1TB4A 1VE9A 2WYUA 4P8RA 9LDBA 3EMKA 2GYYA 3JQ7A 3KYDA 2JAPA 1E1NA 3BMQB 5KKCA 4JP2A 1XEAA 2YFQA 3DZIA 3TFOA 1HDXA 4CLXA 1GQYA 1SO8A 3GVPA 3PWSA 4BKUA 3CTVA 3IP3A 2HK8A 3H5AA 1PU2A 4PLFA 4MVJM 1GPDG 4QFDA 1WZEA 3F4BA 1ZJYA 4CUJA 1I3NA 2ZYDA 2AG8A 3PYLA 3H5NA 1TLTA 3OHSX 3E48A 2VT3A 3H9GA 5KWEA 5T8KA 2UV8A 3ENKA 1B2LA 3L4BC 1P33A 1HSOA 3ZV6A 4IJWA 3R3JA 4PLHA 3ZHBA 1EE9A 2O3RA 1X7HA 1SPXA 3KUXA 1GTMA 5DBGA 3RAJA 1SOVA 2VNAA 3WX0A 1SB9A 3RASA 4DLAA 2NTVA 2EV9A 3WBBA 3JV7A 4J3FA 2B37A 4BNNA 1JAXA 1ZK1A 1GEEA 3QSGA 2ZB7A 3GK3A 1RPNA 2GDZA 5IXSA 3ZHZA 3D4NA 1BTOA 4XA8A 4ZJUA 3QVOA 1HEUA 3GC6A 1H9BA 3UF0A 5C5IA 1U2DA 2Z1NA 2J6IA 1MC4A 1NXQA 4GWGA 3ROMA 1JVSA 3S2EA 4DPLA 2RBEA 3U9LA 3O26A 1MUUA 1JLLA 1QYCA 2NVUA 1K6XA 5TNXA 3G3EA 5B1YA 5CFZA 4FPXA 2Y1EA 4Z0HO 5KTKA 1LQTA 2ZJ0A 1NHGA 4PLWA 3PLNA 4CQMD 4TVOA 2VYVA 1B15A 1J49A 1QYWA 3FPLA 2OBNA 3UAGA 4HFMA 4I5DA 4YDRA 1LNQA 3IUSA 3ZNQA 3D4PA 4B7UA 3JQ9C 1TT7A 4ZN6A 4QFCA 4BKQA 1BWSA 1FDUA 1UR5A 5IN5A 2QRLA 2FP4A 2F1KA 5AYVA 1I24A 1JQBA 4AJ4A 5B37A 1E7YA 3E82A 4ZD6A 1MLDA 4DTIA 2NU9A 3GMDA 1EDZA 4YT2A 4P38A 1GQ2A 2GASA 1F14A 2VTDA 4R01A 1NAHA 2ZQYA 1K6JA 4NMHA 4PZCA 3GPIA 2X9GA 3FTPA 4D42A 4XWYA 1UZNA 1ISFA 4Q3CA 4BIIA 1T4BA 2V6GA 5KNLA 2Q46A 1WP4A 3IOYA 1GFSA 2RH4A 3ON5A 5AXAA 3WS7A 1A7KA 3KSDO 3LVFO 1ISHA 4CMIB 2EKQA 1BSVA 3V5NA 4MVJA 2NQ8A 4R9SA 4CMIA 4CODB 1NTOA 3KV3O 4OKNA 1PIWA 1NYTA 4HUJA 5LCXA 1E3IA 3TFQA 1GUZA 1C1DB 1O5IA 3FWNA 5BSFA 3KB6A 2GZ2A 5EESA 1YL6A 2EP5A 3LDHA 3PJDA 4MVJF 1C1DA 1UZMA 1WDLA 1PJTA 1U3UA 1Z6ZA 4ZRMA 5ADHA 4WEQA 1BXKA 1U8XX 3HFSA 3RC9A 3IKTA 3Q11A 5AXBA 2PZJA 4C7JA 1EK5A 1DIGA 5JDIA 2X7HA 3G79A 3OA0A 1AUPA 4RVGA 4A5OA 4XIJA 3SJ7A 3RQSA 3ZHXA 1EK6A 3TDKA 1YVEI 4JCOA 2OORA 1D4FA 3NJ4A 2IZ1A 4Y6RA 1ID1A 3IAHA 3VTZA 2AQIA 1E3EA 1UXKA 3EK2A 1M75A 2YQ4A 2PGDA 4HV4A 4E33A 4J1QA 1LTHR 3I9JA 2VHYA 4GX1A 4JP3A 3RC1A 1DC3A 3DO5A 3E9QA 4HADA 2D4AA 4BKRA 4IDFA 3VAZA 3WNQA 4G65A 1QV6A 4CM5A 4R1UA 3FHLA 3M6IA 5MGBA 1Y7TA 4J7UA 1UUFA 2HRZA 1JW9B 1T2FA 3Q2IA 4FFRA 1BVRA 4B4OA 3TL2A 4BO6A 1OI7A 2QRKA 1EFLA 5ILGA 5ITWA 4BNTA 4NH4A 1Q1NA 1YXMA 1Q0QA 5H83A 3GAFA 5AXDA 3U4DA 1DB3A 2YHUA 1WVGA 4MKRA 2Q1WA 3RFTA 2C2YA 1NAIA 4FIZA 3L6EA 4J16A 1OZAA 3DBLA 4R69A 3ROQA 2E82A 2X8LA 4I9UA 1FDTA 1T25A 2JD2A 3DBRA 3OEWA 1FJHA 3GZ4A 2OFPA 3WG9A 4D3SA 4BKPA 3UW3A 4QEDA 2Y66A 1WPQA 2CY0A 2DM6A 1I30A 2C7GA 1BMDA 4YVFA 3HDYA 4AJPA 4B7CA 1GV1A 3EVTA 4BMVA 3T7EA 4MOWA 3WFJA 3BZUA 4FBGA 3AFNA 3ZWNA 5CG1A 3RKUA 3BTVA 1EVIA 3LT0A 3MWEB 3WXBA 2EXXA 3G17A 2GLXA 3PWZA 1U3WA 3VHRA 2B0JA 5I7VA 4ESOA 3VVBA 4BQPA 4CUZA 3JQAD 2X6TA 4LMPA 5DOVA 1SOWA 3ZHYA 3D3EA 2NTJA 3MTGA 5JW6A 6LDHA 4BV9A 1VSUA 2D8AA 2I65A 4MP6A 2D0IA 2Y1DA 2YV1A 4C7KA 3PWKA 4BNHA 4CM4A 1HZJA 2JJYA 2AEJA 3V2HA 4R51A 4DIFA 4E3ZA 4BGIA 3ETEA 3COSA 3PYXA 2P91A 3I9LA 4YB8A 4IGEA 1LLDA 4PRKA 1ZK0A 2Y99A 4DQUA 1DFGA 1YBVA 3DBHA 2PKRA 5HWSA 4FFLA 4NR0A 3ONFA 4EJMA 3I9MA 2P9CA 2JHGA 1PZGA 1RM4A 1AHIA 2PH3A 3GR6A 1E6UA 3CSDA 1D1SA 2FR1A 2OZPA 3AY6A 4YAIA 3HQ4O 1ZXLA 5EINA 5IF3A 5JYDA 5J23A 2BRUA 3EYWA 3ITKA 3WYEA 2VZ0A 1ZKMA 4IZHA 4LRTB 4R4JA 1PGNA 1ZIDA 2Y1OA 4Y9DA 2GN4A 3GA0A 1JKJA 4A7PA 1ZK4A 2X0RA 4NJMB 5TF4A 4EJ6A 2YDYA 4M89A 3N58A 1PR9A 3IUPA 4YAKA 2VRCA 4Z6KA 4W82A 4YA6A 3FNHA 4WLOA 3NT5A 1UZLA 4A73A 3ZU3A 4J7CA 4D41A 1F12A 1H2BA 4PLYA 2QHXA 3GNSA 3VH4A 3CPSA 3LLSA 3GG9A 2XF8A 4GMGA 1GU7A 1H6AA 5L9AA 5G4KB 3ZWBA 1B8PA 3P5SA 4PLCA 2C2XA 2VQ3A 4IS3A 4WJZA 4X54A 4YEDA 3VDRA 1UAYA 3RU9A 4BNUA 1IY8A 5TX7A 5L7YA 4ZGWA 1MXFA 2ZJ1A 2E6UX 3A1NA 1OFGA 3AJRA 3DHNA 4PLTA 1Y1PA 2X0IA 3MWDB 1CRWG 4RVSA 1M2WA 1GEGA 2Q49A 1HE2A 3RUCA 1VSVA 4BMSA 1NQTA 3LSYA 3ANMA 4PVCA 4L74A 4GVLA 4A10A 2AQ8A 3WGGA 3I3OA 2ZKLA 1GADO 4LVCA 2V6FA 2ZYAA 3QWHA 3RCBA 2Y0EA 1YS4A 3B20A 1V3VA 1R6DA 1NHWA 2VRCD 4A26A 1S6YA 3JQ8B 1NVMB 3CTMA 4IXTA 3GVHA 2WD7A 1B0AA 3FR8A 1SNYA 2HUNA 3GNQA 2AG5A 4GMFA 5IZCA 1LEHA 3W8DA 1P0FA 5ITVA 3JD1A 3ZNOA 2DVMA 2HQ1A 1VJ1A 1PJLA 1DLJA 4QX6A 2FN7A 3ZWMA 2Z1MA 3M2TA 4K28A 2EF1A 3VPHA 4XZ3A 3L4SO 3GZNB 2CF5A 4L4RA 5AVOA 3ONEA 1Z7EA 4P22A 5JNLA 2IXBA 4LSWA 4NBUA 1HKUA 2JAHA 3PVZA 1WNTA 3S55A 1MFPA 2QRJA 4JXKA 4EUEA 4WLVA 1J0XO 3A14A 1NWCA 1H9AA 3OM9A 3DZBA 1NR7A 1AN9A 4IIUA 3OIFA 3SXPA 3WMWA 4H7PA 3DMTC 1EBFA 2X5KO 4WUVA 1F8FA 1UDAA 1XELA 3RUHA 4LN1A 4U8GA 4AJJA 3ZW9A 4D0RA 3ENNA 4BQRA 5CDTA 4B4UA 2IZ0A 4L4SA 5JCXA 4JNKA 3KTDA 5IN4A 2XXJA 1DFHA 1OC2A 3OQ1A 5EIOA 3TRIA 1XHLA 4TROA 5IDWA 4RPKA 3AM4A 3DHYA 5KVCA 1EEHA 3BXXA 2A4KA 2CVQA 4LCJA 4OJNA 1M66A 4W6ZA 1YWGO 4ZQBA 1PX0A 3NYWA 4XQCA 3KEQA 1XU7A 2DBVO 5B4VA 4ALIA 2VYNA 5IDYA 5T64A 4IDAA 2HCTA 3WIDA 1DJQA 4TQGA 3EY4A 1P3DA 3ORFA 3WMXA 9LDTA 4GKBA 1CEQA 2CZCA 4O1MA 5I7SA 2QZ9A 2POQX 4J43A 4FSHA 4FB5A 2Y1FA 2YUTA 2B4TO 1U3TA 3AUAA 3B1KA 4PZEA 1E7QA 1ZMOA 2OO5A 1XKQA 2BGLA 4O6VA 3X2EA 1D1TA 2GNAA 4EDFA 3BHIA 4Z3DA 3GN1A 4XQGA 2CDBA 3SJUA 3RFXA 2YQ5A 2GN6A 5G4LA 5L51A 3PDUA 4CQMB 2H9IA 4HFRA 5FI3A 1FMCA 1TVEA 1XQ1A 1HT0A 1BW9B 4FGSA 3BMOA 3FN4A 2O7QA 3Q0EA 1PQPA 3SX2A 3C1AA 2X1HA 1QLHA 2IZZA 4DXHA 4OOFA 1DAOA 3DMTA 4OSOA 1XG5A 4J0EA 4UEJA 4G5HA 2PGJA 2Y1GA 4FR5A 1I2BA 1I01A 1Q7CA 1YDEA 4OAQA 3PHLA 2J8ZA 3DFUA 7MDHA 1E3JA 1U7TA 2BFMA 1LSJA 1PL7A 1FK8A 1SEPA 3QVWA 1NPDA 5K9ZA 4GVXA 3JQBC 2BFOA 4E2ZA 3LT1A 1CQJA 3UUWA
chains in the Genus database with same CATH superfamily
1F3OA 2HYDA 3PS9A 2GPTA 3EQ9A 3UUFA 2P9QA 2G4LA 2DUWA 3LWZA 3UBTA 3TZQA 3E5MA 4BFXA 3IBTA 3C3DA 1NLUA 3ESYA 2HHAA 4BVAA 4R71A 4P3OA 2NGRA 3ETDA 4P33A 2CF6A 3DZGA 4D74A 4J1TA 2O2CA 4JT2A 5IXYA 1UPTA 1VB5A 2DX7A 1GZ4A 1EESA 1CZLA 4LC9A 1YS7A 4QWWA 4XQ9A 5HOQA 3SC2B 1UMBA 1XEWX 4Y2HA 2ZULA 4DJTA 3MC1A 2CHFA 1ULZA 3FROA 3ZWDA 4QLAA 5CLGA 4RGVA 4EG4A 1ZSNA 2QWXA 4LY6A 2ZG6A 1FFHA 2DF8A 3NTUA 4ZHQF 1EHCA 3OTIA 4DR4B 3MCAA 1K8QA 2XNDD 4FD2A 3LE8A 4YV0A 2C95A 1XK7A 3LYHA 1LJUA 2EGUA 1SH7A 1XDWA 5I7HA 3QITA 5G1OA 3T8YA 1T9DA 3H5LA 3PI6A 2AFIA 1EFHA 4QJ5A 4MWTA 4BEJA 3V8QA 4RPCA 5D5HA 5J1SB 4LJ8A 4B3GA 3RUPA 1MDFA 3E35A 1RWNA 1CE8A 1Q1EA 1OXBB 1D7AA 4YN3A 2QSJA 1OWNA 2O4CA 5JSQA 1ZVMA 1V43A 3E2IA 1M2NA 3SIWA 1PL6A 2BEUB 1HTWA 4CJXA 3RARA 1PZHA 2DUNA 1DBWA 5TB5A 3AP3A 2I4NA 3VDNB 2CMHA 1HF3A 1OXVA 4KYIB 5CT5A 5J58A 3HMKA 1BO6A 1KDYA 3H2KA 2ZUSA 2WA1A 3WV5A 2PS0A 4CF4A 1E2JA 2WPNA 1KVUA 2HK9A 4QELA 4M6WA 2TMKA 1Z0KA 2XWJI 4B3MB 1NI4B 3RNLA 1AA9A 5EQDA 4MS4B 3TTXA 3CRW1 3B6MA 2CLEB 3E9MA 2QD4A 1G1MA 1WY5A 1YDHA 2QL7A 4AKGA 2EGGA 2Y1XA 2JIQA 2I99A 4JQCA 4KIUA 5AVWA 1IIBA 1C80A 2XDQA 4N3BA 1MABA 1RYMA 3CFYA 3KLPX 4ZYVA 5FL7A 2V5UA 2AFHE 4CR8A 1R6XA 1C30B 4Y2TA 5J2TA 4V0MA 3I6IA 1Z12A 2BF7A 3ZE6A 2OZEA 4EW2A 2RIRA 4GO1A 1OXSC 1RP1A 3WIBA 5IW8A 3ROFA 1NVBA 3MG9A 3O83A 1FFEA 1IXYA 1R4MA 3D5EA 3W2EA 5FBZA 1JBKA 1ULSA 4JQSA 1GG5A 4PHCA 2NAPA 3RVLA 3VJLA 1U4OA 2KHZA 4JFAA 4P36A 5J1TB 4MWDA 4DMHA 5EE0A 1SZJG 2NZUG 3INRA 3IXMA 5E1DA 2QJRA 3Q9LA 3BDAA 4G2NA 3NEAA 2A1UA 3ZX4A 3EVNA 1G7RA 3T7DA 4URZR 1ML3A 2PX2A 4ASUD 1M10A 1Y5RA 3K94A 3OOHA 4AKTA 2VZ8A 5TRTA 4JZKA 1T8SA 4KH0A 4EHKA 4BWYA 2FE1A 2XA9A 1E60A 1DTWB 4ENSA 1EVLA 4P5EA 4JLAA 4QQKA 3T1HB 2XQIA 5FWXB 1JR4A 3NLLA 1JHMA 4KXNA 1KYZA 5BWBA 2RE8A 1GYPA 3VYRB 2E4ZA 3QWFA 1PLLA 4PLGA 3KXKA 1LUAA 3V9PA 4W5QA 2MJLA 4TT3D 4N39A 1FTQA 1ZVKA 2PX6A 2IOYA 2VOJA 2YV3A 1DKUA 1NYRA 3EPRA 3F74A 3DYBA 2PL3A 3Q0IA 3U13A 2CJFA 3W1WA 2FVYA 4B4VA 4EL0A 3AV3A 1X19A 1WUKS 5DNVA 1V39A 4UEKA 3QGMA 3X1XA 5IF9A 1YZ3A 1KNXA 2BIFA 3A05A 4D5EA 2PYDA 2H54A 4MA5A 3DJYA 1C3VA 1VSBA 2HDNB 3G59A 3O8OB 5EJFA 5IC4A 1T4CA 4KU4A 3MLEA 1Q1AA 4MYUA 1XMJA 2DBQA 3K92A 1JU4A 3AI7A 4N0EA 1VPWA 3RVSA 3GDOA 4Y1EA 5TSDA 1MVLA 2VPQA 5DP1A 3KYIB 1PT7A 5FUWA 1TC2A 2BJVA 2VQDA 2ZIFA 3PR2B 4DM4A 4E5DA 2EERA 5CDUA 3WYAA 4DOMA 4QA9A 1K2WA 2C2HA 3OSZA 3S2UA 1GSOA 1T2EA 3QPVA 1V16A 2CDNA 3L8DA 4V0ME 3WK7A 2QLFA 4IDQA 4XEUA 1AS3A 1QH1A 1R9NA 1GQOA 3V3KA 4S2UA 2R2AA 4ND5A 3KOXA 1W2WB 2CDCA 3DE6X 2F43A 1OAAA 1KEEB 2HWYA 4KQHA 4OD0A 2HCJB 4MP8A 3M81A 1OJ7A 5AOCA 4PBSA 1Y6QA 2X6QA 3SBEA 4S1VA 1N5RA 1DCMA 2X4DA 4IIXA 4LK3A 2ONJA 2YX1A 1O8CA 1SKQA 4BE4A 3B2NA 3D4BA 1N9KA 5TEVA 3C1UA 2GFQA 4F3RA 2ZRMA 4UXHA 4J7XA 1GNQA 4UFPA 1RBMA 1MX1A 1XYGA 2NPIA 2OD2A 2ZGVA 3NHLA 3JYOA 4I5GA 4RXTA 3K70D 4JXJA 2N42A 1KFCB 3CVVA 2F1IA 3O91A 4H7IA 3FJYA 2VT7A 4ND3A 4O5OA 3TLMA 1VCIA 2OEPA 2BMEA 1ISIA 3S4YA 1HT1E 2C9DA 2PGXA 3TI9A 3UANA 1NJFA 4HRVA 3P9YA 5JAPA 3K8ZA 3TB6A 3BAZA 4RC9A 2ATIA 2CL0X 2H59A 3OZDA 4A6DA 2EKZA 4I2VA 2GUGA 3AO0B 3B3JA 4GYJA 4XIGS 3TUZC 3WB2A 1G291 1L5SA 1ZHHA 2N46A 3IT2A 3QVMA 1HT3A 2QAGB 4R8VA 4XIYA 2C4NA 3DPSA 3SIPA 1AA6A 1OFUX 1N6RA 5AR1A 3H11A 5AKGA 2RGUA 1G20B 1K27A 4FVTA 5KVSA 1N34B 2HBRA 1VRCA 2PCLA 5GZ6A 5IBRA 4ZWNA 3WADA 3NR2A 4U6NA 3DP7A 3WLRA 1Y3CE 4KGXA 2WJJA 4MUFA 1E2PA 4U3JA 3VC3A 1Y9AA 5CX1B 3I9OA 3QYFA 3BT7A 3W9BA 4NSNA 1SXJA 3K0FA 8ATCA 2QTLA 4JR0A 1R6BX 4AU1A 2PYZA 4GKJB 2HO4A 4MVJH 3ZE1B 1TKBA 2QRUA 3GVXA 3X2SA 3GN2A 4B4DA 2GD0A 3EIUA 1UANA 2Q2QA 2JANA 2XYPA 2AD1A 4BJ1A 2Z5VA 4RLSA 2A57A 4TYMA 4WA7A 3H2YA 4RKFA 4Z4HA 1J6UA 1MH9A 4QOJA 4DR2B 2V8BA 1UQRA 4GH5A 3TWOA 4ZO9A 5FNVF 5DFAA 2NU8A 4ADSG 4KE6A 1VHWA 3LV8A 4X85A 4YJHA 3IKLA 3INTA 3L8FA 5IFLA 5J4KA 3ZDDA 3K0HA 1FVFA 2WWXA 3ZXSA 1W9HA 1GGMA 4AMZA 1ORRA 1P2SA 1M34E 2IIPA 1SUIA 3AYZB 3RTAA 1H6BA 4WCFC 2B20A 3VHQA 1EXDA 4DG8A 5J63A 3I61A 3HSKA 3JXEA 3RSSA 1PKEA 3PFFA 3G8AA 4UBNA 3FH0A 2ZPTX 4YT4A 3HWX1 3AY3A 1IK4A 1ZJJA 4FHEA 4QPZA 3LX5A 1OT3A 1NZFA 3C8DA 3PC6A 4ERXA 3GLRA 1BH6A 1DQPA 1ZIYA 5C37A 2C7OA 1XRPA 1W0JA 4MI9A 3NPMA 4Y7DA 4DV4B 3KEOA 1U1DA 1OB2A 4WTOA 3MJVA 3N76A 1ZESA 4ZO4A 1Q11A 3EVEA 2XGGA 4N76A 3FGPA 1E9DA 1YIAA 2ZTHA 3RNOA 1VG1A 1Q6YA 5T5QA 3WKBA 3MWGA 3OQIA 1KYWA 2DP4E 2GH1A 3S28A 1IBKB 3TW0A 4BVHA 3WGVA 3H97A 3ZDQA 4H15A 4KKXB 3PGVA 4D02A 1IHPA 1E5TA 1TLLA 1YZLA 5IJAA 1Z4IA 4M9SA 1ZJWA 1JDUA 1EGMB 4AN1A 2IOQA 4DXAA 2IBSA 1G3MA 5KJ6A 3FKJA 5DM1A 1C7ZA 3HS3A 2H07A 3LDGA 5BR7A 4QOFA 3RTCA 1RMYA 3IMCA 1CS0B 3OFNA 1FUIA 4F93B 1FLAA 1XB2A 2JIMA 4WZBE 2IS2A 1CUCA 3OZVA 2H2IA 4UZEA 1KFKB 3KOOA 2YIJA 1P2FA 4P31A 4PNEA 1KGSA 3DOEA 1OGYA 2ZUWA 2F55A 5JY1A 2N75A 4Q9LA 4ZHQA 1YI8A 4WVLA 1NBHA 4QDOA 4FYMA 2G8NA 1H6DA 1S1CA 2QLJA 3D1LA 3JQBA 3JWPA 4NOKA 4QNMA 5HTOA 2ZI7A 3UBMA 2FDCA 3UNXA 4L8YA 3HSSA 1R0SA 4HB3A 3E2MA 3GAAA 1D5WA 2ZB4A 1GTG1 1ZW1A 3F6SA 3A9CA 3MTJA 5DTRA 2MCFA 1F0PA 3MEQA 4P7KA 2M6KA 5BN5A 3AI2A 5K5EA 3HYNA 3A9SA 1QB8A 3H3XA 3H6KA 3EJWA 2BFBA 4OP2A 4V0KA 1CY7A 3F46A 3CW9A 3P2EA 1L7OA 4TV8F 5ECWA 3MD0A 1ZK3A 3NUGA 5EUQB 4OIMA 3QA9A 2BDTA 1M34A 2W6ZA 4B32A 5F7ZA 2LWIA 4FFPA 4ID9A 2XY4A 4S0ZA 3HBLA 4J0HA 1MC8A 1VI2A 1ELOA 2KLBA 3K5IA 2IVZA 2XUAA 1IG0A 3D31A 3VKVA 3UAXA 2R1VB 4WGFA 4NC9A 4XIFA 3U26A 4OXQA 4PVDA 3F1KA 1BHJA 1V11A 5LYJA 3OZGA 3SIRA 3FBTA 3X1JA 4B71A 1K8XB 4NJMA 1RYEA 3KK0A 4GR4A 2QNBA 1OBFO 1RE1A 3CX7A 1G8FA 3LKVA 1ONNA 5HHTA 3AJEA 3DXZA 5ECYA 1HLGA 4ALNA 4C2UA 3WL7A 3O82A 1SG6A 1WUHS 4IEIA 2NZXA 3IJPA 4RY0A 2CXNA 4BVBA 1L8OA 1Y81A 1QFZA 2WTXA 5JI2E 3EA0A 1BQEA 5C4IA 4CLOA 1YE3A 3TPFA 4HPJB 3VU9B 5C7OO 1X1CA 4QYMA 4LRSB 2FUCA 4KBGA 2O2DA 4OF4A 1PT9A 3E5NA 3WLKX 2J9FA 1CFZA 2WTNA 4JASB 5FPSA 1YE5A 1UCFA 2IHZA 4Y2RA 2OFWA 3TCXB 3H2GA 4D4LA 1JEQB 3S2FA 3OQMA 1SRQA 4LQDA 3STUA 1KP3A 4BFZA 1G0NA 4IIJA 2XT9A 4AIRA 4JJ6A 2NW6A 3IPRA 4P32A 3CG4A 2H5JA 4WESB 2Z6QA 3DVLA 2BLLA 3PQ5A 3HB4X 3JQPA 4W9NA 1H85A 3C45A 4Y30A 3K9FC 2Q5OA 3QMVA 3JWEA 3T52A 1IZ9A 2P8SA 1MRZA 2CXXA 1PYGA 1YJBA 4UVHA 4C14A 4B3FX 2C29D 1DINA 2BI7A 3VTFA 5G0WA 5CXUA 3U7QB 2D1SA 1TIPA 3BRCA 3KOZA 3H2ZA 2IF2A 3DFZA 3O8NA 1NOIA 1MAAA 3LQ1A 4GUDA 2DRIA 1U04A 4V1CB 2B0CA 3I3SR 4YRTA 2Q4RA 2H8KA 2J67A 3AI3A 3T4UA 3LH5A 4QT4A 2XOEA 4UDXX 3LNCA 4TTRA 2HR1A 3CZPA 2FSVA 4K9RA 2MU1A 3L49A 2AIRA 4QRIA 5EC8A 3WB9A 2HO5A 1HV8A 1M67A 2FMUA 2NTYC 3WB1A 2HIHA 4TKLA 3P26A 3KHTA 4IFIA 4ZCIA 3K9CA 3ZTYA 4AO6A 2D0DA 3ZGXA 4JBNA 3HLKA 2QU8A 3VSAA 1FFCA 1RJFA 3WLMA 4E5KA 2WKQA 4J0FA 3CEMA 4DYVA 3FNBA 3A9TA 4QOEA 4WH0A 4NZNA 2JCGA 2IDKA 2OHHA 2R7MA 1YJQA 2BGKA 3NKLA 1QHHB 3WGUA 4TKUB 1H2WA 1ONOA 2FZEA 2PUGA 2FW1A 3CRVA 1XK6A 3WV4A 1HI9A 3IP1A 1FW6A 3QMWA 5KQLA 4K2HA 1JKXA 3U44A 2DFDA 1PFUA 3V00A 3HC7A 2DTDA 2JGRA 2UKDA 3BTOA 1O94A 2I54A 3DD5A 3N2GB 4PZUA 5B2EA 1VJCA 3T9DA 5LU9A 1QIKA 5AUNB 1KK1A 1R50A 1CJUC 2IXGA 4AWBA 4DQLA 5LDGA 5FPQA 2WHRA 4XR4A 4EB6A 5LP6A 1K5GA 2JDID 1DEOA 3SLKA 4YK7A 1P44A 2PSEA 1DWUA 1GZSA 2Z0MA 2YV2A 3WWPA 1NF9A 3MJ4A 3P2MA 1W8DA 1T8RA 3M6UA 4GLJA 2POCA 4IGFA 4O4HB 4XJSA 3B7WA 1SJ9A 3ROXA 4D96A 4PNPA 3M5WA 3LQKA 4MPDA 2ODQA 3ITDA 3ZDFA 5JV5A 4Z9AA 4N01A 1J9GA 3C24A 3N1UA 4PTZA 1H9CA 1ZD1A 2W48A 1IC6A 3WQRA 1N5OX 2Q7XA 2F8MA 4YXWA 3L8YA 4MQMA 4AICA 4U5XA 3ANYB 1ISPA 1W85B 1G0OA 2CK3D 2Q4BA 5B4UA 2QQ0A 4CN9A 5ICEA 1FLDA 2NVWA 3AM5A 4BQOA 4EA6A 1JPUA 2B5WA 2J0VA 2JAWA 2YY7A 3GXOA 2VT6A 4GE3A 3SFZA 1PFVA 4DXDA 2QTHA 5I5EA 1BU8A 4J0DA 4WWHA 3FDXA 4YRIA 1SBNE 2CLLB 5CGZA 1Z15A 2I33A 3I1FA 4G23A 4RVCA 4DCNA 2R00C 1YRLA 2PIDA 1SBYA 1ZY2A 2AB0A 3HZZA 2GRUA 4PG8A 1JMYA 5KCZA 1QQAA 3K3PA 3P2OA 2DUJA 1M6NA 1YS1X 4K88A 1V8BA 3W9SA 3ZY2A 3E0QA 4E2WA 6ADHA 5CA1F 2KWIA 1T5SA 1CUEA 4G1EB 3WGNA 2QPTA 4LX8A 3NW9A 4BBZA 1JEDA 1R5BA 3ODPA 3H7AA 1R4NA 1TGYA 4DZRA 5K7SA 4JA2A 1OPRA 4HTFA 2ODWA 3T3IA 3RJ5A 3LXUX 2VTBB 1GOTA 4B3XA 3V46A 2YXNA 4IH1A 1QH1B 3FSRA 1FC0A 3O92A 3OPVA 1FUUA 2BJHA 3PEEA 3PKJA 3UV3A 4DY6A 1X1TA 3IOEA 4F9GA 4CLDA 5SYMA 3O8RA 3FLBA 4TN5A 3JQAA 3U4MA 4D46A 3TR0A 1I4TD 1VRVA 2G1AA 2DFPA 1EP9A 2IYTA 2ZBDA 3CZ9A 1NW8A 2PZLA 4XTRA 3FGOA 1OI3A 4YJ3B 4V2IA 4CF5A 1RWVA 2ILVA 4XM2A 5LLTA 3U7FB 3ZW8A 3U3OA 1T6YA 5TQ0B 1U6IA 1V35A 1V48A 2O3JA 4HNVA 1PJSA 5KX5B 3PU6A 4A03A 3L4EA 4BAGA 3LUPA 1GA1A 3R3HA 3PE6A 3UC5A 2QBYB 3VKGA 4JLJA 1HQYE 3RUIA 1VPEA 2DFVA 2X5JO 3L40A 4D80A 3K6SA 2DPXA 3ZNNA 2ZJFA 2HBYA 3D0OA 2RONA 4RM3A 3TZEA 4MR8A 2Q41A 5F51A 1A9XA 4PZAA 5E6SA 1MVNA 4GMKA 3JYQA 4IILA 2GSWA 3CX4A 1PYDA 4PXSA 4F8YA 2BH2A 4RULA 1S3GA 1XQ6A 2E2WA 4HAUA 1FYVA 5LMUB 3RB8A 1XCLA 2P5YA 3EIHA 2AJCA 3UK7A 4NEQA 1DAKA 2IE0A 1DJPA 1E4VA 2OO3A 1X3LA 4L8LA 3QNUA 1QH8A 2H2AA 1HDOA 5BOSA 5HYVA 1O97D 3NIFB 2C5LA 1M83A 1P5FA 2BH9A 4L0CA 3MELA 4QEZA 2P27A 2Q4EA 2JJ2A 4BYMA 2IS6A 2HBZA 1LX7A 1ENPA 2GYVA 1L4HA 3LW8A 3M34A 3Q7EA 4QYTA 2ZUTA 2FRDA 2PZAA 3QY9A 1TCUA 1P7YA 1FX1A 3DE1X 5I7EA 1OTHA 2QG6A 1GNLA 1CZNA 3KJQA 4KQJA 3FUUA 5ARBA 1EDEA 4IGKA 1GFWA 1J7JA 1I33A 3H8WA 4FEEA 2GR9A 1DEAA 1TTPB 3JD2A 3MRXA 2ZYVX 5LOVB 1LY1A 3HBMA 2QX6A 4E31A 3VISA 3N8DA 1HETA 1WXIA 4Y6GB 1RRKA 2TMGA 4IXDA 2HA0A 2NSHA 2XRYA 5CK5A 1ZI9A 4JENA 2HC9A 4M1EA 1HQCA 2X9QA 2ZRFA 3C6YA 4OVKA 1ZJ6A 1TO1E 1R9MA 1COWD 2EQBA 3FTDA 2AZDA 4JN6B 2YMPA 1Q95A 1P45A 4HH1A 3UTCA 2FW9A 1EWRA 1JWAB 2QN3A 3LUCA 1MQ8B 4YRBA 5C5CA 3SR4A 2J3DA 4HFJA 3IS3A 3BCUA 4OPMA 3ZEIA 3SOZA 4NCNA 4BCDA 4HP8A 4N0MA 5JQGF 1X1RA 1XTBA 3WIEA 4J2OA 1JQKA 2FG5A 4JEMA 4PFQA 3ZQ4A 1NBME 2NO0A 1I2CA 1Z6TA 4N0PA 2I6FA 2ZSKA 3BD7A 2HLNA 3OT4A 5F2OA 4FX2A 4ZT5A 1XTSA 2PCJA 3SOPA 3S1AA 4BRUA 1C1XA 2N1BA 1JG7A 2AWNA 3U0VA 1R3UA 1FQOA 1RHQA 3G5LA 5GP1A 2O3QA 4BUCA 2CMGA 3HKBA 1J21A 1JHQA 1SU4A 4WCVA 5LXTA 1E2LA 2W90A 4HBGA 1DV2A 2JW5A 4KQ2A 2IZ5A 4MO2A 4EMTA 2ZM5A 2VJOA 4FR0A 4Q93A 1IDOA 4L4YA 5HA5A 4BZWA 1Y3FE 1F2VA 1T2AA 2W2MA 3BDVA 4AD8A 4UVGA 2WTEA 4M21A 4RACA 1ZD5A 1PZXA 1U5BA 2XGMA 1IUPA 3BA1A 1K66A 1JIQA 3N6XA 4N5MA 3W2GA 1PP4A 3NWEA 3F71A 4LPKA 3DLPX 1UZUA 1Z83A 1AUOA 3HGMA 3QUCA 4GT1A 2V6MA 1QU2A 2VSQA 3GFVA 4OHRA 3FZYA 1PSZA 3NBFA 3CUKA 4KODA 1NE2A 3OQBA 1QZTA 4GGOA 3LOUA 4JYPA 3JCZA 1MMFB 1EIZA 1QR2A 2NO6A 4KO8A 4OHWA 3VKWA 2A5GA 5GIPE 4W1SA 3QE3A 5E4TA 1YZKA 3C5VA 4P4TA 3QX7A 3KJEA 3PNMA 2IH5A 1UMCB 4AJIA 1KAOA 2NADA 2ZSAA 2PZFA 7ADHA 4YCLA 1Y1SA 3H8VA 2VEOA 3H9QA 3PICA 2WT8A 1ZNXA 3SC6A 3ILXA 4CR7A 4XB2A 2FN9A 2AXQA 2L0XA 2ZT5A 1ULUA 3DAFA 4N8DA 3WA6A 4M7OA 5AFSA 5TQ2A 4BU0A 1Y8CA 4FYYA 1HG0A 2E48A 1LJ8A 3LECA 4Q3EA 2VHZA 1VYTA 2IYRA 1J2UA 2YRWA 4NZMA 5DSZA 3OQIB 1QVVA 1YCGA 1PKXA 3LC7O 4FYKA 3H8JA 4BMNA 4I5IA 1KK3A 2GXAA 2QQFA 1OASA 5LJLA 2D2EA 3OE7D 5C0OE 2ZI5A 4Q48A 4BVFA 3DLTA 3DBVO 1SOAA 1VKJA 2Q2NA 3CZRA 4KHZA 3PUKA 3K4HA 3WLEA 3ZK9A 4G0VA 1BG6A 4URYR 1KFEB 1NXWA 5GONB 3AVPA 4IBOA 2W93A 3N75A 6GPBA 5GY7A 1ETHA 3OY2A 3QJYA 2XOKA 4Q3KA 2GMWA 3S29A 4IINA 4WGGA 4BNKA 3FTFA 3HCCA 4H0CA 1KKMA 2PTGA 4IH4A 4B3HA 5T3YA 3JZMA 5CLFA 1BVUA 4BTEA 5JEEA 3EQ7A 4Y2PA 2BVNA 4FFMA 3FI0A 1BMTA 1OFUA 1SULA 1XRQA 2Q1TA 3HCWA 5HFAA 3MLBA 4B85A 5GZ1A 3NOXA 2DPGA 1A9OA 1PT8A 5BSUA 5T67A 1NG9A 2V6JA 1RXCA 4DA0A 3BMQA 4EELA 1F3LA 1GAEO 1FQJA 1Z5OA 3PZRA 1RBQA 3RRZA 4A6EA 3KL4A 4LY3A 2J33A 2RFLA 3JQAB 5ULLA 3ISJA 4IOJA 2A0KA 2V7VA 2QORA 3R24A 1BOOA 3MTDA 1ZXBA 3R0VA 2PUHA 3K6KA 1E79D 2W8BA 3KELA 5T7BA 1HA3A 1KY5A 1CUWA 5H9WA 3WDSA 5BWMA 1IY1A 1RNLA 3IP8A 5LIPA 3HN7A 3FOZA 1SB8A 1U99A 1XKTA 1VG0B 2C4WA 3CEHA 2OCDA 3EZ6A 3H2SA 2QMYA 3KAJA 3GGCA 2W0SA 5ECGC 4LV5B 5EJ2A 3VKUA 3ZQUA 1Z4QA 1B4DA 1KYYA 1FMTA 3EDRA 1ND5A 2XX3A 4NTZA 1W35A 2C4KA 3BGIA 4G01B 3REQB 4M8NE 4FYIA 2QQGA 2YVLA 3O8DA 4JS0A 2LP4Y 3TLBA 5PNTA 3TAXA 1OAOC 2I3DA 2IHVA 3CISA 5JYBA 5EIHA 1H3FA 2NXNA 2RCYA 1ZEJA 5MDHA 4DUGA 5BVGA 4HVLA 3JQ7B 1W88A 3NH9A 2OC4A 4US0R 2H16A 1IOLA 3A1VA 1MA0A 1JKMA 4NEGA 3RFFA 2Q29A 2E4YA 3JZDA 4FJ2A 2B2CA 3TQRA 4CF3A 2V3VA 1K89A 3F49S 4Z9XA 5MF6A 4OYRA 3TBFA 1J4AA 4LOHA 4FOTA 1JA1A 1U5CA 4HGOA 1YQ9A 3CCBA 4GYWA 2QVLA 3UXEA 4CMBA 1EFKA 1MW8X 1KY4A 1CUIA 3MQFA 2B5VA 4IR7A 1QVAA 1BRTA 2PGNA 3Q5EA 3M6VA 1PR6A 4CM1A 3NFRA 2XWSA 3W8EA 1DIAA 2J32A 4K0RA 4KMSA 2GTIA 4C3ZA 4CG3A 2C0CA 2JLSA 4UTRA 2I4OA 3FKQA 2OGUA 3FYHA 1NRWA 1ORVA 2Z5GA 2BHLA 1B3BA 5D01A 2WVJA 4IIJB 1HZZC 4Q37A 5FHRA 1KAEA 3RWMB 4KXQA 3FPCA 4RTPA 1R27A 4S24A 1ZM7A 1NVTA 2M6SA 5JD3A 8OHMA 2QLLA 4QEKA 4RTMA 2O0LA 1C9EA 4KQFA 2FPPA 1W36B 4EYQA 1YTUA 2BISA 3WDKA 3KZMA 5LB4A 3QLTA 1O95D 2DYKA 3WGTA 4JJFA 5KC9A 1EFCA 1LXCA 2HU7A 1T2DA 1J1UA 4L5BA 3JRNA 5AK0A 3A6LA 2UZ1B 2BI4A 3COZA 1P39A 1G17A 1EM8B 3D7SA 1ZISA 2QV7A 3DR3A 4AY4A 4E2YA 2O1SA 4UTNA 2I55A 4GC9A 4F2GA 5BV7A 3PHJA 1F2DA 4J9VA 1A9QA 3I9NA 4EYSA 3DTTA 1EK0A 4CI9A 4A3SA 3HP7A 3QOXA 1EZ1A 1QH8B 1KKUA 3HDVA 4MQFA 2QM3A 5T8KC 2O3TA 3BL6A 4EB6B 1UXHA 2LW7A 4KE9A 4MS1A 1CBUA 2NU7B 1K8RA 2FTKE 4QO7A 1QVRA 1MQ9A 2FJPA 1E9SA 2I8AA 3GQBA 2O20A 4ISCA 4TXHA 3SCZA 1V8OA 4UEOA 4EF6A 1WB6A 3WLIA 4DMLA 1VDMA 3BSYA 3KEGA 3CR8A 4ZCMA 4BDTA 3TR5A 1VHDA 1X13A 4HYTA 1VMEA 1PWYE 4RKYA 3S5JA 4PGGA 4PQRA 2FUEA 3Q85A 2XMGA 5K3SA 2CVOA 5AI8A 4OB8A 3TLAA 1I13A 5KQPA 3FNRA 1RQNA 4H18A 1MT3A 3DDNA 4XLLA 3UB3A 1H1LA 2F8LA 2WC1A 3WL4A 1QYRA 3JARA 4AJ1A 1BIFA 3QQ5A 4AI6A 4R0NA 4RNDB 2EEPA 4CEHB 1GNPA 3F7TA 3RG8A 1AGXA 1X7DA 2C2BA 2NTEA 3EPKA 1AF7A 2C5FA 4I7EA 5FH9A 2O50A 2XYVA 1FSSA 1WB9A 3BHNA 1NRJB 3DFIA 4YJGB 3EX7C 4MKHA 3QBEA 2G7MC 4HDQB 2NVBA 3FRHA 5EP2A 1M2EA 3AEXA 1F8UA 1I4EB 3E7WA 3C5HA 621PA 3AHHA 2YNMC 5JAHA 1YONA 3BJMA 4NBLA 1G38A 1JTEA 3NT2A 4JLPA 4TYYA 2Y77A 1ZP6A 5F1YA 1IATA 1JT9A 2P30A 2XOKD 2NUAA 3GUHA 1E5QA 4DDMA 4N5DA 2WNIA 4TZTA 4FCWA 2JIPA 4WCFA 1NA5A 2HJGA 4GPTA 5DTQA 2ZIUB 3IBFA 3NTRA 2B1GA 4X3PA 2NP6A 3ET4A 2QVZX 2XIJA 1ZD8A 4TYQA 4JOQA 3G5AA 2BR5A 3C3MA 3JQ9A 3NORA 2RHTA 4GLBA 1D6MA 4MUKA 1ENOA 4TMKA 3F6RA 2W6NA 1KH2A 1KU6A 2VUHB 4RETA 2QN6A 3MZ0A 4Y67A 3ED5A 1KPHA 1UC4B 3FX2A 4M7RA 5LP6C 2G5PA 5CG2A 3E53A 2Q8PA 3H8SA 1AQLA 4FMBB 3RQIA 3GCGA 4S05A 1CR0A 1Z45A 2KBFA 4X65B 3UA3A 2VOEA 3GJYA 5AJXA 4FDMA 3ADOA 1SVSA 2PVPA 4YIKA 2Y76A 3EBOA 4O2AB 3TUJC 5C81A 4NBVA 2XZPA 1DTSA 4ZEWA 4A0RA 1UAAA 4UNQA 1ZXXA 3IULA 1RLIA 5A7GA 1JT2A 4KNYA 2Q5QA 1IBRA 5J59A 1ODKA 3RVDA 1DRUA 1W5SA 4MKZA 3QVSA 5ICMA 5IT5A 4PBRA 3UJ8A 5DH9A 4CN8A 1IPFA 1KMHA 1I0ZA 2H5LA 1B0UA 1KSFX 4M7PA 4C5CA 4CM4B 3PUXA 4BOYA 2ZE6A 4DW8A 4DRXA 5C8ZA 3L6DA 4TZ6A 3M6AA 1FE8A 2AR7A 3SC4A 5TT0A 4HTFB 1B74A 5BV8A 1YC2A 4ZRDA 2XNCA 1N5IA 3MPOA 1ZN7A 2C8JA 2L19A 1Q7GA 2XZLA 5KNDA 2ONKA 2VH5R 4RMGA 2DY0A 1SVLA 4BNJA 3OQPA 2PSDA 2DUUA 4HNRA 3V4LA 2PUEA 1N8NA 2ZBUA 4IJVA 2XRFA 2YVQA 2QYTA 3JR7A 5AM4A 3RAGA 4ETIA 1KEEA 2WFZA 4XGNA 2P0EA 2PY6A 3PCRB 4CKWB 4AM8A 2VDRB 2JGLA 5KREA 2QN7A 4Y6SA 5CGQB 1GUBA 2PANA 1R5OA 4XGIA 1J5PA 1YNOA 5PGMA 5T4EA 4F3CA 5KNDD 2VWQA 4HNQA 3PRYA 4Q0MA 4RABA 4EVSA 5CLHA 5AHRA 4URUR 1R00A 5JO0A 4KYUA 1ZD9A 5KYWA 4ACBA 4OX9Y 2VJYA 2ZCUA 2VWGA 2W83A 1NU6A 1T10A 2QI9C 3PPIA 4W7IA 4WT7A 3BIXA 2WVAA 1OFTA 5DVZA 5EVCA 4CLEA 4ETNA 4G1FA 3K0SA 2BFEB 5EJ5A 1QYDA 3MS2A 3ZGOA 4LRUA 4R3WA 2OQVA 3ELYA 5EMLA 5AESA 3QFSA 3EZLA 3HY4A 4XYLA 5BSVA 2GM9A 4DC0A 3LF1A 1R15A 2Y67A 1EQUA 4LVOA 1CS4C 1VLVA 4AFNA 1M73E 5L3RA 3VPBA 4QXRA 1KRXA 3ZX5A 1V4NA 2EJTA 5G0UA 4YH1A 4Q7KA 4KIGA 3WLNA 1O5OA 4EUNA 1QS0B 3GJ0A 4B44A 3QV1A 5BUSA 1T6BY 4B2LA 4Q16A 1BX3A 1WUTA 3QKRB 4JV5B 1RWXA 2IZ7A 1SD1A 1G98A 3KRTA 1NGSA 5HQ3B 3ANLA 2NVUB 1ZOOA 2ECQA 3UHOA 1U8AA 3V7NA 3AVXA 4G41A 1ZNWA 5JTUA 2PPLA 5C1BA 4C4AA 1AKTA 1K8ZB 1T0UA 2HHCA 3VH1A 4DV0B 1VQ1A 1YJXA 4GX5A 1H8HA 2RJ3A 3RS9A 4BFCA 4DY4A 2VDNB 5E3IA 4ZGGA 1GKIA 4A8JA 1RMQA 1PS0A 2QTAA 3KJGA 1YKSA 3I34X 4I8DA 4YRJA 4W5OA 1JIVA 2ARKA 1OBCA 3DWIA 4RQTA 4TUYB 5D7BA 2GSDA 2IDZA 1JF8A 2J5QA 4AY3A 3RSZA 4BNWA 1Z26A 4JLSA 4WV3A 3HWSA 1CUHA 3L1HA 1A4RA 4E21A 3GJSA 1XZQA 2FSUA 3W6ZA 2O7VA 3HB1A 4XUGB 1MEEA 3SYLA 4K9SA 1U6JA 4Z2YA 1WEKA 1CKEA 3RRXA 1X15A 2FQQA 3O38A 3KO8A 1QCZA 1CLEA 4AL4A 3HBFA 4ZZ1A 5EJ4A 2D7JA 4U1RA 4W5TA 4OH7A 4RL6A 5A3SA 4F1JA 1SXIA 3HVUA 4ZMSA 1XRRA 2BMAA 2WIBA 3H86A 3LQYA 5DNEA 2W6MA 3M82A 4RFSB 4BVJA 4F7WA 5LNK6 2YWJA 4OQYA 1I1OA 3FZNA 4PYMA 4R2IA 4YREA 5KQRA 4RKWA 2O7SA 3FOFC 1JDVA 1YUBA 3FWYA 3ZE9A 5JH7B 4UE2A 4D3ZA 4KPFC 4LBWA 1AKWA 4N03A 3Q12A 3EF0A 4K0KB 3L8GA 1J1ZA 3AUSA 1FJXA 1AUXA 1G63A 5L95A 1WPGA 2EZ4A 3T7CA 3UOWA 1VKNA 1N77A 2JLRA 3L7AA 5F1KA 1IXKA 3EZGA 4YP0A 1MFZA 1AOXA 5EXEA 4DRZA 3V7WA 2Z6AA 4R8RA 2UYGA 2BYTA 5L7TA 4F9EA 4J75A 3TAUA 1U5BB 4X00A 4A92A 3FM9A 1Z75A 2I1LA 3KKLA 4DR6B 5EMNA 2GEBA 4NG5A 1TO6A 4EB0A 2NO1A 3KPJA 3ZU6A 2HLDD 2HA4A 1W34A 1H0HA 3CLUD 4YQZA 5D51S 1ZVJA 3LUFA 4NK4A 1ZWKA 2XMPA 1Q0ZA 4W1PA 1GCOA 2BI8A 5H7XA 3RC3A 3C8HA 4S35A 1NUPA 1YZVA 3CLTD 3ZHQA 4YUYA 5BMVB 2O8VA 3CNBA 3EEQA 3L9XA 4U2EA 5G1PA 3V4OA 4D43A 3Q6IA 1G60A 2X2OA 3HCFA 4Q12A 4PRLA 5KSWB 2K7FA 5SZJA 5ICCA 3K0KA 3ECAA 4RZQA 1V5FA 3N70A 4X66B 1U28A 1I36A 4XYEA 5K4AA 4FEYA 3FMVA 2R8ZA 1DIHA 3EA5A 3V1YA 4YACA 3GGJA 3DYVA 4URFA 4W5NA 1GZUA 1KR5A 1MAVA 2IYNA 1ZUD1 3ZDAA 1HTBA 4F4IA 2I6XA 5AVSA 1N36B 1YO6A 3DWFA 1R64A 3BHJA 3DOCA 2P6OA 3JQDA 4C22A 5FWAA 5FEMA 1UK7A 5EVJA 3QWIA 3E23A 5E95A 3FRIA 2HIAA 2CD7A 3RIMA 4X1IB 3MF4A 4X90A 3UIEA 2JAXA 2P1RA 3WKDA 5DWQA 3M33A 3IKVA 2Q9CA 4LUCA 4M1ZA 3AQIA 5HIKA 2X58A 1A5SB 4ER5A 2ZYRA 5LD2C 2V0NA 3FB1A 4JAVC 4FJ0A 1LPNA 2QNIA 3P7MA 1HL3A 5IJ0B 4EGCB 4KIJA 1S5PA 1L0BA 2IEZA 4MMXB 4R9RA 1JZQA 1T4CB 1Y9JA 2CXQA 2WYVA 3KLMX 5ED4A 3NANA 4BO1A 1H1TA 3DEZA 4LKRA 3EUWA 2EEZA 4KFRA 4X8HA 2PBLA 2Q8QA 4ME6A 2Q9AA 2ISQA 1JE0A 2AEMA 1YK1A 3JSAA 3GRUA 4KN8A 3QELA 4BO3A 1E6MA 3STYA 4TKVA 2E55A 4L6AA 3L3BA 5EMKA 2IFTA 4LMBA 3H3FA 3LY9A 1RI1A 1QHFA 1SVIA 3DWGA 3AF3A 2FDRA 1K5PA 1XNHA 4S04A 3FNIA 9MHTA 4I99A 2FRXA 1ZQ9A 2CEAA 3HKCB 5ELMA 3N8IA 4Z0TA 4EG3A 2BEJA 5BSHA 2PS3A 4I9HA 4WKCA 4YYEA 1JBQA 3FPSA 3HPQA 3RC2A 1R37A 4GL4A 3KSZO 1TKCA 3I6YA 3WGIA 3PDIB 3HI6A 5KDDA 4RAQA 4BCCA 3GEDA 3O7MA 4IPTA 2VHXA 3ZXIA 1ZCFA 3JQGA 5KOJB 3H6GA 4IHKA 2XI4A 3AFIA 4KXYA 5F1OA 3T4EA 3VUEA 2VWPA 1L5WA 2V03A 3L1KA 2QTRA 4KN9S 2ZIXB 4Q05A 1EFRD 4C88A 3ENQA 3T3NA 3V42A 4EARA 1CY2A 1F6DA 3X1WA 3JARB 4DRXB 1XJCA 3E18A 3IAAA 1XBTA 5I48A 1ZS9A 4GXTA 1U02A 3DV0A 4MR7B 1PGOA 5DRTA 3AMVA 3CLKA 3E58A 3SBXA 4UUMA 4CNBA 2B25A 4TS3A 2G80A 4LZWA 3KETA 4GSLA 3WMEA 4Z2AA 1QGOA 2JL1A 1LBHA 2O5EA 4AURA 4MA4A 1SA0B 4QTYA 4LXHA 1YVRA 2XH8A 1UM8A 4KLZA 2NXJA 2X23A 3LM8A 3LWNA 3LWDA 4WDQA 4JROA 1A5AB 4N7BA 4PF1A 3GRYA 4CG2A 5IU6A 4IHJF 4PQGA 1J23A 3VVMA 1IHOA 1JDPA 1VPLA 5C8YA 5JFOA 2OOSA 1ZH4A 2WMOB 2F67A 2Z2KA 5CP8A 1BWRA 1C0EA 2W4QA 4G0YA 4O4IF 4U2BA 4JB0A 2DWPA 3AETA 4JR2A 2VLBA 2VPIA 2ONZA 5AKEA 1XZGA 3LTEA 2Z8YM 4ITVA 3UHPA 2A3RA 4DDTA 4RDIA 4BATA 1JLMA 3DEJA 1KZ1A 4WHMA 3SN6A 1SQ5A 4FYHA 5BN3A 2OLEA 2FRDC 4OHYA 4YV2A 5JQWA 3IELA 3SKYA 3GGOA 4NYJQ 4DT1B 3GT4A 1KVSA 3DL7A 3QEJA 3TZCA 1A27A 4CM6A 5MN4A 5DIZA 1IMJA 3N86A 4GP7A 2HMUA 4MR9B 4YDHB 5E1BA 3V1UA 3O3NB 3PQFA 4KFTA 1L1EA 4B6EA 2JFXA 3KM0A 3PQCA 4F92B 4RTSA 5DHUA 3AVWA 5E9JA 1BXZA 1DC4A 1E1MA 2PR2A 5EWMB 2P4EA 5JWHA 2WVHA 3EDCA 1N1MA 3LU1A 1N2XA 4G4SO 5HJ2A 1M2HA 3C6QA 2VAWA 2CSXA 3EE6A 1WR8A 1SQ6A 1TIBA 3T34A 2YFKA 1P31A 3ELDA 4GD3Q 2PJUA 3OJXA 3WLSA 2FRVA 4D4KA 1HLDA 1E6KA 3JTMA 3QLVC 4U2DA