3RQSA

Crystal structure of human l-3- hydroxyacyl-coa dehydrogenase (ec1.1.1.35) from mitochondria at the resolution 2.0 a, northeast structural genomics consortium target hr487, mitochondrial protein partnership
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
292
structure length
292
Chain Sequence
KKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
publication title Northeast Structural Genomics Consortium Target HR487
rcsb
source organism Homo sapiens
total genus 115
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3rqsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rqsA01
3LC7O 3OIDA 3QW2A 5DCUA 1EVZA 1HE2A 4BO7A 4Z3KA 1UXKA 1NAIA 3IJRA 1PS8A 5ITVA 3ADOA 4LMRA 4KUGA 5ICSA 3NV9A 2I76A 3FCOA 2BELA 4Q3NA 4EW6A 1XGKA 1DLIA 4HV4A 4EJ0A 1NQTA 4UUPA 1T2FA 3ANNA 4J2HA 1U4OA 3W8DA 5COAA 1PS9A 2VWHA 2EP5A 2JJYA 3OMLA 2B4TO 1ZEMA 1ULSA 4JK3A 5F21A 5G2OA 5IDXA 5JCJA 3WXBA 4II3A 1CIVA 4PLYA 1N1GA 3TSCA 3GDGA 1ZUD1 3ZWYA 4IDDA 4WLFA 3S2EA 4NR0A 5KJCA 3ZHBA 1ZNQO 1Q7GA 1XLTA 2HDHA 4IIUA 1U7TA 2HU2A 5ER9A 4UVEA 4FC7A 4CL3A 5IDQA 2PH5A 1ZXLA 2OGUA 2VNSA 4Z0TA 4AFNA 5C7OO 3QWFA 4XYBA 1C3VA 1YGYA 4JQCA 1UZMA 3DMTA 4ZU3A 1UH5A 1LC3A 4KP7A 3EYWA 3ZWNA 4LSMA 5L4LA 4YT8A 3KV3O 3DR3A 2UUPA 4YTEA 1DAOA 1ZJZA 2EG9A 4BB5A 4PN3A 1C1XB 1H94A 3GVIA 5CDUA 3ROKA 5H83A 2B5VA 2AW5A 5JE8A 4XYLA 3PWKA 3ENNA 2WMDA 3WGYA 1E7SA 2GD1O 2IZ0A 4ND1A 4HFMA 4M87A 2A92A 4Y6RA 4YQYA 1LU9A 2CDAA 4XRRA 1JDJA 2QX7A 4WNCA 5TGDA 2WD7A 5JO9A 1A4UA 2DBVO 3WR5A 4IGEA 3WSVA 3MZ0A 2UUOA 3I9MA 4E5NA 2X4GA 1PJQA 4E2XA 1GQ2A 2WTBA 4XD2A 4FR5A 3P2YA 2Z5LA 1Q1NA 3ZWCA 3KZVA 1WMAA 1BXKA 2EXXA 3PWSA 2Y05A 3AI1A 3PHGA 3PIDA 1EE2A 4IMPA 1P1RA 1P1KA 5TIIA 2AMFA 3RSHA 2X23A 3WB9A 2JD0A 3BTOA 1HRDA 1I30A 1ENOA 3HJAA 1VRWA 1I5RA 4BV8A 4R3WA 3OJLA 2D2IA 1PJLA 3GT0A 3DOJA 4BO3A 5KOIA 1KOLA 3WMXA 4I5DA 1U1IA 2LDXA 2Y1CA 3GC6A 1OOEA 3HB5X 1MC4A 2OMEA 3QVSA 4GQAA 4YCAA 3I1JA 2Y1DA 1HETA 2O3RA 1B0AA 3KSDO 4MP8A 1V35A 3VZQA 3X2FA 1MFPA 3ZWXA 5ER6A 4XQ9A 4TZTA 1DDOA 4XGKA 4YRBA 1K6IA 4ND4A 4UEKA 3WS7A 3MJEA 4DYDA 2ZQYA 1QXSA 3QY9A 3GMSA 3R1IA 4O6VA 1DRUA 2PFGA 3IP3A 2YQ4A 1PQWA 5KVCA 2JKVA 4JP3A 2X0RA 3B70A 4IDGA 3FSRA 1C14A 4YXFA 1RYDA 2B4RO 3IIEA 5JAMA 1E3JA 1SNYA 3B20A 2PTGA 3G79A 4OIMA 2EV9A 1UDAA 4R9SA 2Q46A 2YV2A 4WLOA 4DQXA 4O59O 2CVZA 4CV0A 1YONA 1SOVA 1NFQA 4E6PA 4IJWA 2CSUA 3BMQB 2TMGA 3ZU2A 1AN9A 2VZ8A 4DGSA 2B35A 4CR7A 3HNPA 3VVBA 5DT9A 5TT1A 2EGHA 3G3EA 2X5KO 4L0QA 3PFFA 5ENDA 1M67A 4NI5A 1VKOA 3NDRA 3RVDA 1GUZA 4RGBA 4BGEA 1I2BA 1P33A 1I36A 4OM8A 1BDMA 1HWYA 1UUFA 1ZZEA 5ILGA 3UCEA 1IHYA 4WPGA 2QG4A 4GBJA 4A03A 4K28A 2YUTA 1BTOA 3FNGA 1ONOA 2XXBA 3LSYA 3A06A 1R4MA 3M2TA 3S2FA 2GPTA 3A1NA 3IMFA 2VQ3A 4HNGA 1N9GA 1PZGA 1UR5A 3WTCA 1DRVA 5BNFA 5IFLA 1DIBA 1U4SA 3ANMA 3RJ5A 1N7HA 2GZ3A 3PI7A 4B4OA 1VKNA 4YEDA 1D4FA 3LT1A 5IZ4A 2Y1OA 3TZKA 3VH3A 1QYVA 4E12A 1MXFA 3GVCA 1Z7BA 3SXPA 1NFFA 1C0IA 3PQFA 2C2XA 4IM7A 1DC5A 3OJFA 2YFHA 2J3KA 3KBOA 1HYGA 3NT5A 1J0XO 4TRJA 3AUTA 3DBRA 3WNQA 3AM5A 1E3LA 3PQEA 3VAZA 4RPKA 3G49A 4BV9A 1VI2A 2YYYA 6ADHA 2J8ZA 3WGHA 4DUPA 4AJKA 3AM4A 3C8MA 4YAEA 4CMGA 2VHZA 4U0JA 5DULA 3DB2A 1X7HA 3HN7A 3DC2A 4R01A 2IXAA 1VL6A 4IDEA 3VZRA 1HZJA 4NJOA 2BFAA 4CQMD 2G0TA 3KYDA 1EEHA 5FI5A 1UJMA 4EGFA 4J0FA 1E1NA 4H16A 4FB5A 2P91A 2OZPA 1C1DB 3F1LA 1ONPA 3DO5A 4B8ZA 4CM8A 4IZHA 2JHFA 1B2LA 3JQBC 2W2KB 4MKZA 1O95A 4W6ZA 3ROQA 3U5TA 5JBIA 5COBA 3GLQA 2C20A 3OEWA 3ZNNA 2EIHA 2GSDA 1K89A 2GF2A 4JJFA 2QHXA 1B8PA 3W8EA 4JNKA 1GQYA 3GZ4A 3M1LA 2V6GA 4Q3DA 3IJPA 5A9SB 1E3SA 1JKIA 5MGBA 4O1MA 4DIBA 2P5YA 4BKRA 4I08A 3WJ7A 4ZD6A 4XR9A 1JQBA 1AXGA 4BMSA 3FRJA 5F5NA 1R4NB 1CQJA 3DOOA 3GF4A 1PR9A 4HUJA 1HDXA 1B8VA 1BW9B 2NQTA 1HKUA 1EZ4A 2DBZA 5KJEA 4Z0PA 1EFLA 5HM8A 4URFA 3EY4A 2YQ5A 3WSWA 1YB5A 1YBVA 1P0CA 1CRWG 1E6UA 1I3NA 4GKBA 4IJKA 3ZNOA 2Q2QA 1GL3A 3FTPA 3TJRA 5ITWA 4Q3AA 1A4IA 5CDGA 4BO4A 1ZSYA 4YJFB 3KVOA 4ALIA 4B3IA 3PPIA 3WNVA 1IE3A 1S6YA 3NDJA 1KY5A 2GR9A 1HDYA 2H6EA 4KQWA 4CPDA 1PU2A 3LT2A 4JBHA 4TKLA 1MB4A 1SAYA 2X9NA 4Q3EA 4J43A 1GAEO 4FJ2A 4R4JA 4A27A 4CLEA 2GRAA 1ZXBA 3FNEA 1NPTO 1MP0A 1GDHA 3FBTA 3WICA 4RPLA 1SEVA 2IEDA 2VTEA 3VPFA 2FOIA 4BOYA 3GGPA 3W4KA 3WFJA 4NBWA 4BQPA 4YBZA 2BGKA 3V2HA 3CPSA 1T4DA 3OHSX 5L53A 4R1TA 3EDMA 4EBFA 2TMDA 4QECA 3QWHA 2X9GA 3PQDA 4E2WA 3ANLA 4Y6SA 1P1FA 4QXMA 4PLTA 3STHA 4CL8A 1CYDA 1W6UA 4E30A 3RUEA 4EDFA 1KEVA 1O6ZA 1LSUA 4NU5A 1GV1A 4Z9FA 1VPDA 4QTZA 1HSOA 1WW8A 2CNBA 1LLCA 2ZJ0A 5I7VA 3LK7A 2C7VA 3L4BA 2FY8A 5ENVA 1DSSG 5A1TA 5FF9A 4IMRA 4YAIA 4BMVA 2FSVA 1B8UA 1LNQA 1WDKA 3D4OA 4FIZA 4F6CA 1EQUA 1GD1O 3RCBA 3JYNA 4PLWA 4O0LA 1PGOA 1YJQA 1DBVO 1R0KA 5DCYA 5B12A 3QIVA 4GMFA 3INRA 2O4CA 3PEFA 4FBGA 5CDSA 1K6JA 1DHTA 2CMDA 3PJEA 4UUOA 4X54A 1ISHA 3JYLA 1JVBA 1B7GO 1MG0A 3M1AA 4PVDA 4UEOA 5JO0A 4OL9A 2IYOA 4YQZA 3KXDA 4OXYA 4XWYA 1D1TA 1Z45A 3E5RA 1PGJA 1WZEA 4J7CA 4C7JA 4D42A 3Q2IA 1ID1A 3NKLA 3CZRA 2XPCA 3AK4A 4CV3A 1YOVA 1VC2A 4B3HA 2P68A 3CINA 3LT0A 5H82A 1Q0HA 4A7PA 1XQ6A 1BRMA 1W8DA 4HFNA 2AG8A 5T64A 4R1NA 3RU9A 1T2AA 3TZHA 4CMIB 3QV1A 3T4XA 1K6XA 1T25A 4F46A 3GGOA 2CDBA 4NHEA 1UP4A 3NGLA 2WYWA 1JWAB 1M2WA 3C1OA 3F9IA 4WK6A 4BKOA 1ZK3A 3CZMA 2OBYA 4KDFA 1H0KA 1O9BA 3H5RA 3VPGA 4CQLB 1N7GA 1LI4A 3GRKA 4D7AA 2AEJA 4OJNA 4Z3DA 2AEFA 3HUDA 4RVGA 5G4KB 2EJWA 1P3DA 2OO5A 1DB3A 4FFRA 1UP6A 2O7SA 3KEOA 3K73O 1IULA 1YJ8A 1K2WA 1ORRA 2VYVA 4WUVA 4RO0A 1KYQA 5A02A 4NU6A 4TSKA 4M86A 4RF2A 1NQOA 4PLGA 4ZN6A 2E82A 2ZK7A 1DAPA 3ZZNA 5K6AC 3U09A 3ICPA 4DIOA 1X0VA 5T8KC 5BQFA 4RDHA 2P4HX 1N92A 1H9AA 4NIMA 2NVWA 1WMBA 3K30A 1N1EA 2QZZA 5A3JA 4BUCA 3FD8A 3NTOA 3OEYA 5B4UA 3W6ZA 1Y5MA 4GX5A 3BMOA 1ISJA 5C5IA 3VZPA 1NVGA 1EVYA 3HZZA 2VHYA 3ZHXA 4BNFA 4CM6A 4IPTA 3DL2A 3OM9A 3RROA 5CG1A 2O3UA 4FFOA 5EN4A 4P8RA 3RWBA 5A4DA 3FBGA 4H7PA 2NVUB 4DTIA 4ZHSA 1DRWA 3O26A 1ZKMA 1GPJA 3H9EO 3IUSA 2CF5A 3VDRA 2C5EA 3QWIA 4PGFA 2G1UA 1PGQA 1RPNA 3WYCA 4W82A 2WWRA 2NTVA 3I9NA 5DDIP 2V65A 4DPMA 3GGGA 2OOSA 3JQAD 1F17A 1E3WB 2FR1A 3UH1A 2JD1A 2QRLA 3JQEA 3KB6A 3QWAA 2Y1FA 3QE3A 5TQVA 3E8XA 1E7RA 1PJTA 3U4CA 2FPPA 1DFGA 1VSUA 4IUYA 4RCVA 5JMPA 4DQUA 1KVRA 1MX3A 4W9NA 1X7DA 4R3NA 3HB4X 1EK6A 2PZMA 1P77A 5TSDA 3BZUA 4DLLA 3ZNQA 1SEPA 4GH5A 5IF3A 3WYBA 4BGIA 5KVSA 3PLRA 1F8GA 4CLRB 1T2DA 4D3FA 1LRJA 4BNTA 3A9WA 3JV7A 1VE9A 3DHNA 5C7LO 1T26A 4KQXA 4L73A 4Z0HO 4CLDA 1JLLA 5L40A 4R69A 2Q1WA 2PWZA 2RCYA 2ZCVA 3C1AA 3C85A 3GFBA 3MJSA 3U0BA 1P1JA 3GN1A 5BNIA 1J49A 3O38A 2VOJA 4PLCA 1UXJA 4B7UA 1QYDA 3GOHA 5TJ9A 2O2YA 1QLJA 1M6WA 1PR3A 4D45A 4LGVA 3FNHA 4KWHA 2CVOA 2NU6A 3AFNA 3Q0EA 2Q45A 1XIVA 3L4SO 4AJOA 3Q3CA 1YB1A 3WJAA 1A9YA 3HDYA 3CMMA 4TQGA 4ZRMA 3WGQA 3GPIA 1F8FA 3RUDA 4BIIA 3EVTA 2ILTA 2XAAA 4DC1A 2QRKA 5AVOA 3U4HA 3DZJA 2JAHA 1PZHA 3NUGA 3CMCO 4E2ZA 2NU8A 2NTJA 4R51A 3I9LA 1PGNA 3JQ9A 4MP3A 3V1TC 3KM0A 3UICA 3E9MA 4J91A 3WOHA 2O3SA 2PD3A 4HFRA 1E92A 5J23A 5DBFA 5BSFA 2VHWA 3IDSA 1AHHA 3NX4A 4LVUA 4NH4A 4QUKA 1R66A 1RM5A 3JQGA 3KYCA 4GMGA 4E33A 4GX2A 4ZA2A 3LQFA 1T1RA 5IZCA 4OHUA 2BKAA 5B4TA 1X1TA 3TZQA 1LX6A 3GRPA 3TQHA 1RKXA 1IL0A 3DQPA 1K5HA 2Y1GA 3AOEA 1ZK0A 4AVYA 2ZTLA 3KRTA 4F6LA 4IDFA 4J90A 1NNUA 3FI9A 4D43A 2EW8A 5ADHA 5L7YA 2ZYGA 2Q2WA 3V1UA 4A0SA 4XA8A 1E5LA 4D0RA 2P4QA 4JGBA 2HK9A 2P9CA 4LN1A 1FK8A 4FFPA 4WLUA 1KVUA 4EZBA 1L1FA 3L6OO 2VYNA 1HE3A 2QIOA 3DAPA 4F3YA 1UAGA 3P2OA 2Q4EA 3FN4A 3FPCA 4TRNA 2A35A 5DOVA 1WPQA 4JXKA 3A28A 4WCFA 2GN9A 2X22A 1P74A 2HMUA 3DMTC 2RH8A 3HSKA 3SX2A 2GCGA 3H65A 2VWPA 3BTSA 1U3WA 3HDJA 4U7WA 3F5SA 4LRTB 2SCUA 4CJXA 1PL8A 2O3QA 1HT0A 1NP3A 4ALNA 2OFPA 1YL5A 3DAGA 4G81A 4XGIA 3RAJA 4B7CA 4BQRA 3I83A 4HFJA 5BSGA 8ADHA 2V7PA 5CG2A 3UW3A 3MJ4A 3RKUA 1T1SA 3DONA 1ZH8A 4HP8A 4G2NA 5DBIA 2HUNA 1Y81A 3L07A 3SJ7A 5L4NA 2OP0A 4NFHA 2JCXA 1I2CA 3WBFA 3ZWVA 1DHRA 5ICMA 1ZSNA 2PNFA 3ZWOA 5G0SA 1QRRA 4WEQA 1D8AA 2HK7A 3CEAA 3JQAB 4CUZA 4CMEA 1M6HA 2FZEA 3JTMA 5CP8A 5EMHA 3HADA 2J3JA 1GFSA 2QZ9A 1OFGA 1GCOA 2V6MA 2E37A 4JJIA 4W7IA 3JQ7B 5G4LA 3COSA 3D7LA 2YW9A 2ZTUA 3ZNPA 2NV6A 4Z6KA 1GU7A 3FWNA 1YQXA 2AE1A 4XEHA 3UOGA 3IC5A 2UAGA 3DEYX 4UAGA 5HTOA 2C7GA 4BGUA 1T24A 4IDAA 4LRSB 1VL8A 5JAQA 1JAYA 2ZIZA 3K8ZA 4TWRA 4CODB 1ISGA 2VT3A 3DTYA 4F45A 4A5OA 3E48A 1C0PA 5IG2A 1GCUA 1A7AA 2YHIA 3GDFA 4GGPA 1CERA 1HYEA 2QW8A 2R6JA 2XF8A 5KJ6A 3T4EA 1HDZA 2VWQA 1C0KA 2W2KA 1LEHA 2X6TA 2BLLA 3BMCA 3UHAA 1BGVA 4XZ3A 1KVQA 4FS3A 1Q0LA 1R6DA 3VTFA 5JCJD 4MDHA 4QSMA 1WNTA 1C0LA 3A4VA 2HAEA 5EERA 2IZ1A 2WSBA 5A3VA 3O8QB 1TT7A 4NBRA 3KO8A 3NAQA 2EP7A 3PP8A 4XJTA 5EESA 1JN0A 3TWOA 4EUFA 1YKFA 1H2HA 4RJTA 1R4NA 5GY7A 3V1YA 2Y1EA 1ZW1A 5L51A 1BW9A 1LLUA 1P1HA 1TT5B 2I67A 1DFHA 3AI2A 4GKVA 2VN8A 3RD5A 3U49A 2C59A 4QO8A 1TLTA 4GX1A 1HXHA 4MINA 1YQDA 2D8AA 3HHPA 3SBOA 1BXGB 3GVXA 5JW6A 3F6YA 2EEZA 3RBZA 2RIRA 1GQQA 2X0JA 3AY7A 1E7MA 3VKVA 4EJ6A 2DTXA 1M75A 1LBEA 2EWMA 3KHUA 4YJDA 2WJPA 1IZ9A 1HTBA 3FNFA 3MWDB 2ZTVA 4MKXA 1VM6A 1FDVA 5A9RA 2DBQA 2JD2A 4YJGA 2DPGA 2JCVA 3GNQA 1EFKA 1U2DA 1X14A 4ZQGA 2ZB4A 5TNXA 1ENZA 2VT2A 3SJUA 3IP1A 1XYGA 2Y0DA 1UZNA 3TZCA 3C7DB 1DXYA 1RM0A 1Y8RB 1BHSA 2Y99A 3BAZA 3E1KA 2JFGA 4XB1A 4BNLA 4NFSA 3WGTA 1UDBA 3H4VA 3ZGYA 4ZICA 2Q99A 1V3VA 3KLMX 3ULKA 3C1TA 2NU9A 4I8XA 2B69A 4K6FA 3G0OA 3LU1A 4JBGA 4RPJA 4MVJM 2A94A 4ZVVA 4DA9A 4HNHA 1U3VA 5JPIA 5EPOA 5CDYA 1H6CA 2AEMA 4BO6A 5HS4A 3CIFA 3WX0A 3ENKA 1TB4A 5A06A 1R37A 2NM0A 4Z9YA 4FN4A 3GVHA 4AJLA 1SC6A 3F4LA 1FDTA 3CH6A 4PLHA 2D3TA 3I9KA 2ZJ1A 2VCYA 3LDHA 1UXGA 4IY1A 2NQ8A 4MVJI 3PFWO 5DZSA 1PS0A 2UYYA 4NG5A 4TMFA 2GYYA 3RC1A 1Y9EA 4OO3A 3AUAA 3H9UA 3UCXA 2P9GA 1EK5A 2GZ2A 4XCVA 3F47A 5HBRA 2UVDA 1PJCA 4IXWA 2Y0CA 2JAPA 3ZWMA 3OA0A 2Z95A 4R5HA 1GYPA 1E7YA 1GZ3A 1QSGA 4GI2A 3VH4A 1NHWA 1KETA 2Q4BA 2R00A 2C07A 2Y66A 4INAA 1I3LA 3AW9A 3IUPA 4ONEA 4YT5A 1HYHA 1Y8QB 3M2PA 4L75A 4GLOA 1O0SA 3H3JA 3QJ5A 4DPKA 1LSJA 1HE4A 1WP4A 4K6CA 1QORA 4PLZA 4A10A 1FXSA 1PEDA 1P31A 4IQGA 4ALJA 2C54A 9LDBA 2XXJA 3E18A 1GEEA 4U5QA 3TNLA 4DLAA 3ONEA 1H2BA 4L74A 4XKJA 2DFVA 3I23A 4RVFA 1Z7EA 3NTQA 3LF1A 1QYCA 2BI8A 1XELA 2VUUA 4BNHA 1IPFA 3GG2A 5TT0A 3RC2A 4DRYA 4N5LA 4GPD1 1AE1A 1VJ0A 1JVSA 4GL4A 2GZ1A 4E2YA 2Y0EA 2DPHA 4JX8A 3DDNA 1BG6A 4J3FA 4UVGA 4CQLA 2YHUA 3L77A 3N74A 2PGLA 4E21A 1CJCA 4OSOA 4BKUA 3IS3A 4YJHA 1LDMA 3JQFA 2QYTA 2HMWA 2HJSA 4L9RA 4J4TA 4LK3A 3KYBA 4OXNA 4WJZA 5JMWA 1H5QA 4XYGA 3JD3A 4XDYA 1IYZA 1PQUA 3D3WA 2HMVA 3ZHZA 4I5FA 1T2EA 3VPSA 4U6QA 3D1LA 4OOEA 3DZKA 3TOZA 3DBLA 1T2CA 1I3MA 1F06A 1KEWA 1WVGA 3H3FA 4UVHA 2JHGA 4HBGA 3VOSA 2VUSA 3CTMA 1DJNA 1DJQA 3K2EA 3O03A 4XQCA 4CM9A 4E5PA 2E4AA 1OC4A 5JY6A 4PG6A 3OQ6A 1XU9A 1JWBB 1N8KA 3NT4A 1NTOA 5A04A 5TX7A 1G0OA 3WGZA 4P4NA 2NLOA 4M49A 2WD7B 1KS9A 4GSKA 3W4JA 4MVJA 1EUCA 3X2EA 1MFZA 3QSGA 3L4BC 3M6IA 4RDIA 3WWYA 5A9TA 4Q9NA 2I6TA 4PIVA 3AWDA 4AJ4A 1ZK1A 4WLVA 2B36A 1SB9A 2EF1A 4R68A 2HCTA 1ULUA 4AJNA 3I3OA 3QVTA 4AJHA 3GZNA 3AJRA 5T57A 1XWFA 5KVQA 4C4OA 1DO8A 1E3WA 4IS3A 3U9LA 5TLSA 2X1HA 5I7FA 1OAAA 2C29D 1X15A 2DC1A 3IAHA 4NDNE 4OH1A 5I7EA 1U8XX 5BSHA 4P4GA 3ORFA 1VJ1A 3OJEA 1E77A 1YS4A 2Q3EA 5COQA 3GH3A 4BNIA 4GX0A 4WGGA 1G6KA 3FWZA 3KSUA 3CUKA 2W2LA 3L6EA 5AQ1A 1WDLA 2RBEA 2NVBA 3C3XA 3DHEA 4FD3A 4ND5A 3UN1A 1NWCA 4K1LA 2X86A 4CM3A 2B5WA 2EW2A 4XYMA 5KWEA 1MXHA 3TRIA 4JROA 3DHYA 3QHAA 4MVJE 1ZBQA 3R0IA 4BO9A 1FDUA 4L76A 4E4YA 3DZFA 2BHLA 3JD0A 2VNAA 4BS9A 5L7TA 1A71A 3S2GA 4R54A 3AUSA 5F1PA 4M89A 3ADPA 4PZEA 2HRZA 4BB6A 1EUDA 4IINA 1QYWA 4G65A 3RU7A 1NQ5A 3H9JA 4TVBA 3IL2A 4YAJA 4TRMA 3HE3A 3SC6A 4NNJA 3EZYA 1ML3A 3JQ6A 3ZW9A 4WECA 3N58A 3F3SA 3GMDA 4J9UE 4QT0A 4RVUA 1PL6A 5U4QA 1W0CA 2A9FA 1ONNA 2HO5A 4H3VA 3KOUA 3ETGA 4JLWA 3D3EA 4CLXA 4OSPA 3B1JA 3FHLA 2Y68A 2WE8A 2WYVA 1U8FO 4R41A 1LSSA 3H5NA 4FPXA 4RVSA 3VPXA 3INTA 1E5QA 2OHXA 4BGVA 1U5AA 4O5OA 3V2GA 1VLLA 5JDIA 1QP8A 4JBIA 2Q1UA 4CQMB 4GWKA 5U9CA 3LVFO 1N9GB 1P45A 2DFDA 2Q2VA 2PZKA 4NZ9A 1R0SA 3R6DA 5JXWA 2I5PO 3O9ZA 4OYRA 3PRJA 3INGA 4IIVA 2WYUA 2Q50A 4B4UA 4UVDA 1Y5RA 3MOIA 4FOSA 3K96A 3D0OA 2VTDA 4CMAA 3GDOA 1I0ZA 1XG5A 4FDAA 4HXYA 3OA2A 4CUJA 4E5MA 2ZYAA 4GSLA 1NVMB 3AM3A 3JD2A 5ES3A 3HDHA 4IJVA 4YDRA 3DBRB 4I5GA 4BNVA 3V8BA 4DWVA 3NDIA 2J5RA 3GHYA 2DAPA 2I99A 3MJCA 2EERA 1KC1A 5EIOA 3BA1A 2DU8A 3ITKA 4BO1A 5TC4A 2G76A 2JFHA 3TL2A 5I7SA 3TDKA 1TVEA 3DMYA 3JCZA 3PTZA 3KEQA 3OETA 3N7UA 3NT2A 1LTHR 1SO8A 2WEKA 2H1SA 4M1QA 1LLDA 4S3MA 2JCYA 4CR8A 3D5QA 4D41A 1LQTA 1E1LA 3MWEB 3KYDB 4FC6A 1N5DA 1UDCA 3GHHA 3JQ8B 4W4TA 2J3HA 4LSWA 1YDEA 4W9NC 2YFQA 1NR1A 5IJZA 3LF2A 3DTTA 1NFRA 1LRLA 1KY4A 3PHLA 3DBHB 5L95A 1HSZA 2PV7A 2FPGA 3RUIA 4O63O 4FSHA 2AQKA 3ZI0A 4IS2A 1O89A 1Y1PA 3ABIA 5L45A 3ROPA 3I52A 5T6BA 1HDGO 1O8CA 1DIHA 3F46A 3PHHA 2EJVA 5F5LA 1FDWA 2VZ9A 2X9VA 4JP2A 2VYVD 5KTKA 1LXCA 5JC1A 2PK3A 2CF6A 4YAGA 2HKIA 3U4IA 4NJMB 5CEEA 4ESOA 4MVJH 5I9NA 5JY1A 2FN7A 4BNZA 1LQUA 3PZBA 1C1XA 2HMTA 2HK8A 3I6IA 4UUMA 3S1LA 4QO7A 3ZWWA 3G1UA 1UZLA 3UUWA 1YB4A 4I1IA 4PG4A 3ZV6A 3Q6IA 4RF4A 4PG8A 3RBXA 4R5MA 3OSUA 1AXEA 3GEGA 5I9MA 3ZU5A 5L4SA 3ICCA 1ZJYA 2GDZA 3O4RA 2OXIA 1NR7A 2DVMA 2VHVA 2D5CA 4M55A 3JQ9C 1Z74A 4CM7A 1M66A 1GR0A 4ITUA 4DMLA 2YJZA 3AY3A 1NPDA 4CLOB 2V6BA 4ALKA 2C5AA 1DC4A 2X5OA 3OECA 5IZCC 5JAZA 5G0UA 4KWIA 3ZWAA 5BR7A 2VRBA 4I9UA 3ZV3A 5F1KA 1E6WA 4UULA 4W7HA 4DC0A 2YDXA 1BSVA 4NFYA 1YDWA 4K26A 3PJGA 4DIFA 1VL0A 1MGOA 1NX6A 3AOEC 3KTDA 4JJGA 3U3XA 1YE3A 4PLVA 4BO5A 3K2BA 4CMKA 3ETEA 4II2A 5F3RA 1MV8A 2W98A 4B7XA 1JKFA 5IDWA 3PYMA 5G0VA 1E0DA 4BO8A 1DIAA 3VH1A 2DUUA 2A4KA 4EI2A 1ADGA 1SPXA 1BVUA 4XIYA 4EUEA 2W8ZA 3K6JA 1YWGO 4UUNA 2FHSA 3L0DA 3Q9NA 3B6ZA 1DLJA 1CF2O 4D3DA 1ZCJA 4P38A 4PLPA 5JDCA 5G0TA 1YBMA 3LYLA 2AHRA 2WM3A 4WCFC 5C3MA 3IOYA 5DNAA 5CPBA 3MOGA 4NBTA 2CZCA 4YRDA 5KIAA 1W4ZA 2H5LA 3KLPX 2BRUA 1IHXA 3H9GA 1NYTA 2UDPA 4YB8A 3QWBA 3OFSA 5JLAA 3IKTA 3TZ6A 3JYOA 4CM1A 1IZ0A 4WNIA 3WQSB 2UV8A 4EEZA 5L9AA 3WDSA 1RJWA 3PIIA 1AHIA 4EUHA 3KETA 4CR6A 5K0ZA 5DCWA 2JL1A 1Y6JA 4ALMA 1WXDA 3LZ6A 4J2OA 3GG9A 3VZSA 3BMQA 4U8GA 4CMEC 3IKVA 3TL3A 1YVEI 3L9XA 3FPLA 1P1IA 2BH9A 2ZYDA 4R16A 2PKQO 1PGPA 4Q3BA 2R2GA 2E48A 3LT4A 4LISA 3QLJA 3T7CA 9LDTA 2E6UX 2WD8A 2WE7A 1QR6A 3I9OA 1PWZA 3GVPA 1XA0A 2CD9A 1IUKA 2IE0A 1AGNA 3E82A 4YVFA 3HDQA 3ZN2A 3HN2A 3ZV4A 3PGJA 3MJTA 4ALLA 4E0BA 1V6AA 2VHXA 2XOXA 1D3AA 2J3IA 2ZB7A 4BNNA 1NAHA 4J1TA 1HL3A 4ZGWA 3F1KA 1U5CA 2D59A 3C7AA 4RF3A 4ND2A 1QV6A 2IODA 4J1NA 5IDYA 1QV7A 1S7CA 2ZTMA 5AXAA 1DC3A 2I66A 3PK0A 1Y8QA 1YO6A 3RI3A 1JKJA 5TJHA 4MVJF 3RUFA 3R3SA 4AJ2A 2EKQA 4NBUA 3RJ9A 2IXBA 4J0EA 1IOLA 1R16A 3PJDA 4WLEA 3EMKA 1QYXA 2DBRA 1MG5A 4DQVA 1DC6A 4OKNA 1ZMTA 3LC2O 2VYND 3H2ZA 1LJ8A 1X13A 3JSAA 2BFPA 4DVJA 4FOOA 1EVIA 1ZMOA 2O3JA 1CQIA 2FR0A 3MJVA 1I2ZA 4DBZA 3BMOB 1Q7CA 4UEJA 3ITDA 3S8MA 4DXHA 5B1YA 1A27A 5DOZA 2ZCUA 2VZ0A 4GWGA 1ZIDA 4BO0A 4QFCA 1HE5A 3PHJA 1GADO 4R1UA 1NASA 3AU9A 7MDHA 3NJ8A 2O3TA 4QFDA 3W1VA 1C1DA 3GEDA 4MJLA 2GERA 4PLFA 1U7HA 1EDZA 2FPIA 3RUHA 2W90A 4RVDA 3H2SA 3K31A 3ZH2A 2NSDA 1LDGA 5DBGA 1N2SA 3S55A 3RIHA 3QRWA 2J5QA 2X8LA 4LCJA 1PSDA 1R12A 1L7EA 3HFSA 4DREA 1KEPA 1JAXA 2BFOA 4Q3CA 3WFIA 4L4XA 4AJPA 2IRWA 3RKRA 5A9SA 1E1MA 3D4PA 2EKLA 1LUAA 4GVLA 1W73A 1LRKA 4PG7A 3DBVO 4HY3A 4Q39A 5JYDA 1MC5A 1U2GA 2OORA 1PJ3A 4IXTA 4RL6A 4I9HA 1LDEA 3JQCA 3ST7A 1V9LA 2ZB8A 3D5TA 2AA3A 4CM4B 4I9NA 1ISIA 1KERA 1BMDA 1J4AA 2X5JO 3HG7A 1XEAA 5DF1A 5BT9A 3DZGA 4A26A 3LLSA 1RYEA 4ZJUA 3BMNB 3WLEA 4PRLA 1UXIA 1VSVA 2AXQA 4YJFA 3WGIA 4XIJA 3L9WA 1KC3A 1IB6A 1P0FA 3W8FA 5EQFA 5FWNA 4YRAA 2O50A 4XRGA 4B4VA 1O5IA 2C2YA 5I8WA 3I4FA 1GPDG 4CMHA 4IGFA 3H9QA 3TPCA 4AL4A 1WWKA 1ZVMA 2JFFA 4RPGA 3ZCXA 5JFOA 4YWJA 2I3GA 3H7AA 3ZV5A 1UAYA 1U9JA 5KJFA 5FYDA 3BTVA 3ASUA 2NWQA 4E3ZA 4GLLA 1D1SA 4N7RA 2NUAA 4DBVO 5I8ZA 2R00C 1XCBA 4RZIA 3L6DA 3U62A 4J9VA 1YL7A 5JCXA 4J1SA 1A9ZA 3ONDA 4KTVE 1FDSA 2HQ1A 1FMCA 2FR8A 5K9ZA 1G0NA 1PTJA 3PVZA 1TEHA 2D5AA 3GY0A 4Y67A 1JTVA 4PRKA 4E13A 3VKUA 1K0UA 1ISFA 1H6AA 1XDWA 1ZK4A 1U3TA 3JD1A 4RLSA 1TXGA 4E5KA 1DIRA 4WOKA 2V6FA 3WTBA 4ZQHA 3JQGB 3KYCB 4KDEA 5B4VA 4D44A 5JC8A 1GZ4A 3ZU3A 2H9IA 5GZ6A 2AQIA 4L4RA 1EQ2A 3AY6A 3DZBA 1OBFO 4RQUA 4EJMA 1I32A 2QQ5A 1Z73A 3V5NA 2IEBA 1OI7A 3KUXA 5H81A 4XR4A 1FJHA 1Q7BA 2DLDA 5CEFA 3NRCA 4ND3A 4E31A 1GEGA 3JQFC 1EBUA 4M54A 4J4BA 1JA9A 4OKIA 3QVWA 3B1KA 1DOHA 1TI7A 4RQTA 2AQ8A 4CV2A 2PLAA 3UCFA 3SVTA 5C37A 2VWGA 3OJOA 1RWBA 1MUUA 1F0YA 3P19A 4WCFB 5KCZA 3DFUA 5CEJA 1BVRA 1ADCA 1WLYA 2ZATA 2G82A 4J4HA 4CQMA 2QRJA 3Q2KA 4BMNA 5IN4A 4CMIA 3DXFA 2I65A 2H63A 4NPCA 5I9LA 4NMHA 1R15A 1HZZA 1E7QA 3NEPX 3PYXA 5AXCA 4BNKA 5A03A 3JD4A 4N18A 2P5UA 2PGJA 3NJ4A 4MVJP 5GZ3A 2O23A 1KVTA 4YYZA 5LDHA 2YZ7A 3GA0A 3AU8A 3OH8A 1F12A 2DUWA 3FTNA 3WGGA 3GFGA 4AJJA 3EZLA 3SEFA 5G4KA 3ROMA 4AJEA 2GN8A 1ARZA 3W6UA 2IYPA 3BTUA 1ZO8A 2ZKLA 3OICA 4J7UA 4ROSA 1SCUA 4IBOA 4IZIA 3H8VA 3I4CA 1SMKA 1Y9AA 1PZEA 5DP1A 3UFXA 1M76A 2Y67A 4L8VA 4M8SA 2I3AA 5F1OA 3WLFA 3UGKA 3VC7A 4G5HA 1DFIA 5KNLA 2DTEA 3TFQA 1EE9A 3I5MA 3PHIA 2CFCA 1EUZA 5GZ1A 1IPEA 1LC0A 1E3IA 2PD4A 2Q1TA 3P5SA 5CHEA 3WYEA 5T67A 1A72A 2DQ4A 2CDCA 4B4WA 4DYVA 4CMJA 2C0CA 3E9NA 1GUYA 3JQ8A 2YHIB 4AJ1A 1OMOA 2VRCA 4NK4A 1D7OA 2Q1SA 1X7GA 1V3TA 3LLVA 3F4BA 4JIGA 3BMCB 1BXZA 2BGMA 3DBHA 4ZRNA 1I10A 3DOCA 5LDGA 2J5KA 3PXXA 1HEUA 4WLNA 3A14A 3BXXA 3AOGA 4GGOA 3NTRA 2X7HA 3PZRA 4RV9A 1HDRA 3BYZA 3GPDG 2NVUA 5EJ2A 5L7WA 1JW9B 2PGDA 4R9RA 3VPHA 5BNTA 5JYEA 4D0SA 2DKNA 4Y98A 1PJ2A 2VOEA 3F5QA 1SBYA 2CY0A 1CEQA 3ON5A 3R3JA 1EMDA 4RORA 1MA0A 3S2IA 1ISMA 4NJMA 4HX5A 2AQHA 3WQQA 4YT4A 4XDZA 4PZCA 1I8TA 5DP2A 4BHTA 4BNMA 2BMAA 2YV3A 4Y8VA 2GO1A 2I9PA 1DIGA 4JCOA 1I33A 1YXMA 4BNYA 5T5QA 5IN5A 3AI3A 4BL5A 5IAAA 4B8WA 3Q11A 2GN6A 5KKCA 2VRCD 4CM9D 2DTDA 3WIDA 4LW8A 4BNJA 1LDYA 1ZFNA 1UP7A 2YDYA 3JQBA 4NK5A 2QYSA 4WE3A 1OZAA 5DN9A 1EDOA 4MO2A 2W4QA 4YJGB 2AE2A 4RVHA 3TN7A 1G1AA 1RM3A 2O48X 1HDCA 1Y7TA 4YAKA 3SLKA 3QQPA 4CLRA 4RPHA 5HWSA 1LDBA 3RC9A 4JN6B 2GASA 3OQBA 4LCEA 1H93A 4MVJD 3VVCA 5JDIC 5LCXA 4CLOA 3RUAA 2PH3A 5JAIA 2X0NA 6LDHA 4EITA 3RBVA 2EGGA 3ZU4A 4BNXA 4AG3A 3NYWA 5CPFA 5CAEA 3MEQA 3UVEA 5MDHA 1MLDA 1SZJG 4H15A 4HWKA 4P22A 2EHDA 1GZ6A 2FSSA 4U0KA 1T4BA 4IDCA 5EINA 2B0JA 1J5PA 3CXRA 5BSEA 1JU9A 4KOAA 4BKQA 2P2SA 2FP4A 4Z9XA 2PD6A 3DAFA 4NBVA 3OJ0A 4UREA 4D46A 2GGSA 2X0IA 5JNLA 3JYPA 4MP6A 1PJSA 4KMSA 1WDMA 3EVNA 4KUEA 1ENPA 1LLQA 4PCVA 1U28A 4PG5A 5LC1A 5KVVA 1B3BA 4ILKA 2EKPA 2RHRA 3PDJA 4CUKA 4MIYA 2RAFA 3FF4A 3E5MA 5JSFA 3GK3A 2W2LD 4XQGA 2WDZA 1K3TA 2ZQZA 4WOJA 4WASA 2CUKA 1L7DA 2PY6A 4EYEA 5THKA 5EL0A 1Q2XA 3WG9A 4FQ8A 3PWZA 5A5EA 1KEUA 2BF7A 1Q0QA 1R4MB 3RFTA 3EHEA 4UVIA 5FEUA 4WEOA 3FR7A 1VJTA 3OIGA 3U4DA 1PJ4A 4OXKA 5GMOA 4GAEA 1U3UA 4FGSA 2B37A 1AUPA 3EGOA 4TROA 5AXBA 1NM5A 1GY8A 4E32A 3B1FA 1DPGA 4BKPA 4YA6A 2D0IA 3EAGA 1E6EA 3GUYA 1LDNA 3WQRA 3RC7A 2PA3A 4K9DA 1E1KA 3H5AA 2F00A 3G1TA 1QMGA 3D4NA 4P4LA 3GEMA 5KJ1A 1ZEJA 3VTZA 2C82A 4J49A 4C7KA 1IY8A 4IQ8A 5CDTA 3EW7A 4OMUA 4S1VA 3ZW8A 5CFZA 3RFVA 5IXYA 3K92A 1A5ZA 1YQGA 5C7IO 4DL9A 5HS6A 3RASA 1PIWA 3CKYA 1YH3A 2G5CA 4DLBA 5G0WA 5AXDA 4FGWA 4U6SA 3JYQA 2Y93A 2RHCA 3ASVA 5IXSA 4IQ0A 2IDZA 3PYLA 4D3SA 3D64A 3OQ1A 4YPOA 4I5EA 2OUIA 1KBZA 5A05A 3GAZA 3RQSA 2F1KA 2GUGA 1BWSA 2GNAA 4XGNA 4YJHB 4LVCA 2Z1MA 5FI3A 5L3ZA 4CV1A 4MIOA 1A7KA 4CM8B 1F14A 3VDQA 4FW8A 3WGOA 1Z75A 1GYRA 4RLHA 1SOWA 1NHGA 2PKQP 3E03A 3PJFA 1O94A 3D3WB 2ET6A 2HJRA 4OQYA 2PKRA 2HSDA 1UXHA 3JQAA 2NTNA 1HDOA 5KKAA 4OQZA 3DBLB 1B3RA 3DWFA 3LC1O 4RF5A 3UKOA 1NPYA 4BNUA 1ENYA 3JQ7A 3GUCA 3UF0A 1XSEA 4N5NA 3ZWPA 4AICA 4FFLA 5U1PA 3GAFA 1I01A 4TKMA 3EC7A 2O7QA 2NNLD 1I24A 1E7WA 1H9BA 5EQDA 2J6IA 1XHLA 2AG5A 3ETDA 3EUWA 2FWMX 3GNTA 4ZQFA 3NGXA 1B14A 3GQVA 2CVQA 3PLNA 3C7CB 3GN2A 1DEHA 1KIFA 1QG6A 1H6BA 1SB8A 2IZZA 1YL6A 3ONFA 4DMMA 5A5FA 1PX0A 2B4QA 2G17A 2DT5A 3DFZA 4DPLA 5TS3A 4E5YA 4BVAA 2YV1A 1LA2A 3CE6A 1PL7A 1KVSA 1HLDA 3ZHYA 1NBOA 4OOFA 4XX0A 2ZB3A 3BHMA 3EK2A 4FFNA 2GN4A 4MVJG 4B3JA 5JDCC 2FRDA 1EBFA 4OGWA 1QKIA 4ID9A 3WMWA 1GTMA 2P9EA 1XQ1A 3GZNB 4W99A 5B37A 2RH4A 1YRLA 3TOXA 1BDBA 5K6AA 3GNSA 4TRRA 3O8QA 3HQ4O 5T8KA 4MKRA 3QA9A 3IQDB 1Z6ZA 1QLHA 4YR9A 2DM6A 2BGLA 3E6AA 4WCDA 4IJUA 4MOWA 3RUCA 3KSZO 3G17A 1R0LA 2NACA 3K5PA 1GUFA 3GR6A 1TT5A 2VUTA 4CM4A 3MTGA 4OAQA 3W4IA 2NU7A 3VHRA 4KTTE 1ADBA 5AOVA 1BXGA 1ADFA 1EVJA 4BO2A 2E49A 4CM5A 4TZKA 2PZJA 2PZLA 3QVOA 5TF4A 4EEXA 3BMNA 3TF5A 4MIEA 3WIEA 2YY7A 1B26A 2BD0A 1P44A 2OL4A 1PWXA 1XU7A 4PZDA 4L4SA 3JQDA 3Q1LA 1X1EA 5JS6A 1GV0A 1PZFA 2POQX 4B79A 5AYVA 1I3KA 4YT2A 1PJBA 4QQRA 5HRUA 1PQPA 4BNGA 3SLGA 4QX6A 1NXQA 3OP4A 4XYEA 3K9QO 5HA5A 4A73A 4AJIA 3H6KA 1WZIA 2B83A 3OBBA 2Z1NA 3UAGA 3BIOA 3I6QA 4J1QA 2O2SA 1Y8RA 2OP1A 3DZIA 7ADHA 4XJSA 4CMBA 3PDUA 2OBNA 4Y9DA 3FR8A 3VH2A 3HFGA 2O4UX 2PR2A 3I9JA 3OF2A 5TRTA 1YBAA 1X0XA 4FCCA 3WBBA 4ZQEA 3T7EA 3QVXA 4FFMA 4J6FA 3E9QA 1CWUA 1ZSVA 4TVOA 2HMSA 3CTVA 2HRBA 2LDBA 5FFFA 3CSDA 3ZWBA 2D1YA 3HWRA 1NWHA 1Z82A 4CLHA 1H6DA 2BFMA 1V8BA 4MPDA 1YOVB 3AFMA 4QEDA 1P9LA 4J16A 3V2UA 1TA4A 2D4AA 2NADA 1LSOA 4KUHA 2FZWA 4WKGA 4PFJA 4BNWA 3UXYA 4GVXA 4IDBA 3TFOA 4XB2A 2FMUA 4CMCA 4RZHA 1CDOA 3MTJA 1WAMA 8LDHA 4NQZA 4J7XA 4YACA 1OC2A 4PVCA 1ZK2A 2X58A 1J6UA 4A2CA 4ZQBA 2BI7A 5ILOA 1XKQA 3BHIA 4FJ1A 1GYQA 3OIFA 4HKTA 1RM4A 3SC4A 5THQA 3PGXA 2Q49A 3P7MA 1E3EA 4N54A 1B16A 3AUUA 3WWZA 1NVTA 3C24A 3QP9A 1V0JA 1B15A 4N5MA 3ZDFA 1V3UA 3DZHA 1HF3A 3RFXA 2GLXA 2HLPA 4XQEA 1XR3A 4KZPA 1NQAO 4D79A 4HADA 3BHJA 4FJ0A 1CETA 1FF9A 3Q9UA 4LMPA 4R1SA 4Y6PA 1HLPA 3MCVA
chains in the Genus database with same CATH superfamily
2V7BA 3K1YA 4B31A 3EWAA 1DDGA 2CZGA 2XJ9A 3OIDA 2VUHB 3QW2A 5JQGA 1QGUB 5DCUA 1VHQA 3H4IA 1HE2A 3CZ9A 4N12A 4Z3KA 1UXKA 2IUYA 2OQ2A 5M34A 1WQ1R 5ITVA 2CBZA 3CUWA 4QTUB 3UXMA 3CE9A 4FEYA 3ZCVA 2ZYWX 4Q3NA 2RG1A 3L7YA 2GHRA 4J7AA 1L3CA 2RGBA 3OZEA 1KOFA 5FWDA 1H3FA 4J2HA 4TXMA 1M6EX 3RIGA 1TF2A 4FYMA 1QIMA 1R9GA 4AY3A 1UJ5A 1ZEMA 1ULSA 1NBMA 4JK3A 3DUFB 5A0TA 1XTPA 1TK3A 1Z4QA 5I9TA 3WC4A 1J39A 1E6CA 4Q3LA 1M3SA 3CZQA 3Q87B 2CNDA 4EO9A 4F9TA 3AR9A 2YHSA 5AMXA 1NW4A 3GDGA 2J07A 4CEHB 1EVEA 5KSYA 3EXHB 3SF0A 3WLPA 2JLCA 2WOOA 3ZHBA 2H1RA 3RSLA 1QE3A 3BUSA 4UPDA 1KNQA 3L1KA 1L7OA 1XLTA 4EB3A 1P4GA 3KVRA 5ER9A 1NW3A 1QHXA 2IXEA 3I1IA 4DXAA 1AKVA 3GA5A 3QWFA 4XYBA 1YGYA 1U2TA 1YVRA 2L0XA 4IX9A 4JQCA 4GYJA 4KK4A 3ZWNA 3TRJA 3ROXA 5EZYB 4G9EA 2XMRA 1R88A 1BA3A 3DR3A 4HQKA 1E2HA 3BWXA 2ZYVX 1E3QA 2X3YA 3W5JA 2OILA 1TQDA 3DWIA 3ROKA 4CL0A 4A82A 1RI3A 4XYLA 5DN6A 3QHQA 4ZYVA 2X2FA 2P0YA 2QQFA 3ZVLA 3B6KA 4BN5A 4MYCA 1E7SA 2R2AA 4TTTS 4BVKA 2IZ0A 4FYPA 4NE2A 3EIQA 4Y6RA 3QPWA 1H3EA 2G08A 2X7XA 4TXNA 4UUAA 3T1OA 4WNCA 5TGDA 4ZO6A 5HILA 3WR5A 1SVMA 2FG7C 2NAPA 4KG7A 3IUBA 2CD7A 1U1FA 2J09A 2QXUA 4E5NA 1P0MA 3L7AA 4B6PA 3EIUA 4OUDA 3KKQA 1MB2A 4WY2A 5JZBA 4ZCPA 4LHXA 4TUYA 3SVZA 2A9PA 2GCOB 4ENQA 2XYGA 2W2XA 3ZV7A 4Q37A 3MNFA 5DASA 4PW0A 1LS6A 2Z5LA 4HAVA 4L27A 1Q1NA 3KZVA 2QR5A 3VR3A 1NQWA 5K45A 5BN1A 3JRWA 1W34A 2ZJ5A 3PWSA 3DKKA 1EIZA 3ILSA 3OOJA 3PIDA 3GRAA 2XCSB 5E9JA 3N2ZB 1U2PA 3HR4A 5TIIA 1YZHA 221PA 2XA2A 4QAJA 1PLKA 1E1RD 2Q6KA 3MAJA 1NI3A 1HRDA 1MX9A 1ENOA 3HJAA 4A9AA 2GLUA 3PR1A 4TS4A 1JG1A 1K7SN 4BV8A 2FXVA 4R3WA 2R65A 4OYHA 4HBZA 1F8YA 1UWVA 3U48A 1FX0B 3C70A 4Z7JA 4B3CA 2ZUUA 2NT3A 4G4JA 3LHFA 2AC7A 2AC2A 1W0JD 2Z5VA 3GC6A 1VCNA 1MC4A 2SKEA 4OBEA 2OMEA 4G5YA 4YCAA 1K8ZB 3P9RA 4XSHA 1HETA 5EWLA 1SVSA 3QLTA 3KSDO 3C3KA 1HT2E 1QJ4A 5F98A 4QOHA 5DIZA 3M5CA 1FP1D 1DCMA 4XQ9A 6AT1A 1O7JA 4GMDA 2HYDA 1IG3A 1K6IA 5TR9A 3UPTA 4KRYA 1JIJA 4YV0A 2PBZA 1O87A 1N8NA 3ESDA 1UBSB 1IY2A 1ECFA 2OPHA 5JQGB 3RVSA 2QVZX 3EOZA 1JUDA 1MO4A 1OI3A 4C0HA 2ZIAA 3HM2A 4BE9A 4HNAB 1FZQA 5C53B 3B70A 4IDGA 2R4TA 1QK3A 2BMFA 4EHIA 3EF3A 1WUHS 2B4RO 4KIJA 3VR1A 3B20A 1CUZA 2Y9ZA 1TC1A 2JIQA 4KACA 2PTGA 3CWCA 4BNDA 3G79A 4WTOA 5C2JB 1J2RA 3NUZA 4R9SA 2CLMB 2VAVA 5B7PA 2YV2A 1A98A 2P77A 4BPRA 4DQXA 1TMGE 2CVZA 2Y77A 1YONA 3G0GA 4Z49A 1D5CA 5AP9A 3H2BA 3BMQB 5B64A 2B25A 4X8OA 3GLIB 2TMGA 1T0HB 5HYVA 1QVZA 3PD1A 5E2IA 3WRXA 1U63A 2EGHA 3UMBA 3G3EA 2F64A 1ZU4A 2X5KO 3E7WA 3T5MA 2DETA 3PFFA 2OB1A 3PKJA 1SQFA 1WCXA 1M67A 2R7MA 1GUZA 1WSWA 4RGBA 4KHPB 1I2BA 1P33A 3ZV6A 4DWOA 3ILYA 1IHYA 4WPGA 2JATA 5BQ3A 2ZU6A 1TTQB 6CHYA 4URVR 3FUVA 1ODFA 2Q0SA 4JV5B 4MGHA 1I4TD 3M3HA 3HJBA 4DADA 3S2FA 2IHKA 3CPHA 1N9GA 3TG2A 3ZLJA 2A67A 3KXIA 3G82C 4MQLA 1UR5A 2HNBA 4NBNA 4NEQA 5IFLA 1TZMA 4JKOA 4BMZA 4GNKA 3LWZA 1BE0A 3EQZA 1P1BA 2GZ3A 1F2TB 4IILA 2QRHA 2YJNA 1JEEA 4YEDA 4GC9A 1A82A 1D4FA 4M9XA 1G5FA 2JGKA 2XQFA 3A1VA 3N2YA 4OJTA 1KF0A 1QYVA 3A2LA 3HPRA 3SI7A 1MXFA 2GVDC 4V0KA 1LWNA 3GVCA 5DHFA 1DG9A 1RRKA 3SXPA 4BP3A 4RTKA 1L4MA 4TQAA 4GFDA 2GETA 1O54A 1XMXA 1TGYA 4IM7A 1JQ3A 2CXSA 1HYBA 4UM9B 1A8UA 3VC2A 3OJFA 1X92A 2J3KA 2YFHA 1ZH0A 3GPBA 1GITA 4JOBA 5AHKA 3AUXA 3HNOA 5ALYA 3QI7A 4TRJA 4IIEA 3OIUA 3SNKA 4P35A 4BVHA 1YAHA 2ZJAA 1H2ZA 1E3LA 4HH1A 4WXHA 1OU4A 2V8BA 2A5DA 1ZGCA 3LTNC 2FMIA 2C7RA 6ADHA 2J8ZA 4OL0A 2B92A 5CU7A 3ET4A 3RTDA 1CQIB 4FOLA 2WSIA 4Q01A 3UYKA 1ABFA 2OBFA 2PTHA 4B17A 4BLVA 4BMCA 1JHZA 2QSZA 2BLNA 3E84A 2W6OA 3IJ5A 2WQ7A 3QKWA 4TT3A 1ZOSA 2I2CA 3PA6A 3S40A 5L6MB 1NW5A 1YJCA 1UMCA 1TZKA 1Z4PX 3CRMA 3AB3A 3Q12A 4GLJA 4B84A 1U31A 4DEVA 1YC2A 2BFAA 2G0TA 5EOVA 4KXNA 3KWJA 3F7OA 3OEEA 3T15A 1E32A 1DE0A 3A9VA 4LF8B 2HFKA 4UHHA 2BBOA 3C41J 3D6TB 4LYFA 4ZU6X 4DV0B 4H27A 1FDIA 3F1LA 3ZUGA 1V25A 1V47A 3HDVA 4CM8A 1PK7A 1YR6A 4M9ZA 4P54A 3BQNB 2W2KB 2LCIA 1RAFA 2ZRKA 1KZGB 3U5TA 1JX6A 5CA0F 3FHOA 3P9NA 3KFVA 2M6RA 3FZQA 4I1UA 4AX4A 4OF4A 4EPTA 2C20A 2ZBVA 3OEWA 2EIHA 1WX1A 2GSDA 1ORVA 4IGKA 2Y0PA 4L8FA 4LQLA 1IHDA 1PJAA 2G4LA 5KOHA 2GF2A 3BK2A 2OGZA 4TVKA 4DLNA 1ACMA 3RVJA 4XB6B 1MT0A 1B8PA 4AZ0A 3GJ8A 3GZ4A 4JNKA 1DBIA 1QS0B 1VE1A 5LYYA 3BGIA 4KSBA 4Z9AA 5A9SB 1JKIA 2W2MA 2YJ6A 3IHKA 3KWMA 4O1MA 4ZODA 3P71T 1V45E 3JW8A 2PHZA 2PJZA 3ILHA 4I08A 4UJ5A 3WJ7A 1WD7A 4Q7JB 4M1SA 2A1TR 5LYJB 3DVQX 4NXNB 4RKRA 1OVGA 2G72A 5AHXA 1C1YA 1XVLA 2WJWA 3BE4A 4KYVA 5EQTA 5IJXA 2CE2X 4KR2A 1RWQA 1CQJA 1OTHA 3LUGA 4RHTA 4TLCA 2NYRA 2VPYA 1HDXA 2P9QA 1RWMA 4HUJA 4P4UA 4XWOA 2P2DA 3GD7A 1RIFA 1Q95A 2WB2A 1EZ4A 1BKSB 2DBZA 2JCGA 1EFLA 3DVLA 4B9AA 3I61A 2XUIA 2ZYIA 3EY4A 5IM5A 5C31A 1TU0A 2A0FA 3ZDZB 4DT1B 4E08A 4JLAA 4PYKA 3UBMA 4EA8A 4DB2A 1E6UA 1D2MA 1KI6B 2DWQA 4RTOA 3TK1A 3FTPA 5GAJA 4UE3S 3TJRA 3ZNOA 1Q57A 1E0SA 2VF8A 1PAUA 1AGRA 5CDGA 5DT2A 2CE7A 2WY2D 4B76A 4H1VA 1OI2A 4B3IA 1CUCA 2GBGA 3PPIA 4KHZA 3KS9A 2WPDA 3NDJA 1W1WA 5FFNA 3TLJA 1ZI6A 2FFRA 1JHDA 4HAXA 4AKHA 4H60A 2HT6A 2A7QA 1FVHA 4MHOA 4IG9A 1O9HA 1Z4IA 4M9CA 2GSWA 3LT2A 4NAHA 1SQ0A 2FSHA 2Q8PA 4IICA 4TKLA 4Y2TA 1JJAA 2X6RA 3O4JA 1C30A 3AUYA 3EGCA 2RGYA 3QX8A 4R8KA 1NZJA 2QTFA 4IHQA 1Z34A 3TGPA 2R7AA 1ZXBA 3BGDA 3CRNA 2ZW9A 3PB3A 4Q9KA 1FYXA 4MR9A 4RPLA 5C80A 4IVNA 2VTEA 4M7PA 3ZJ5A 5JARA 3ELYA 3SBXA 3UKJA 3GGPA 4J03A 1FU7A 1IEVA 2LIVA 2NU9B 5L3VA 1II9A 3GUZA 1TKRA 4XIFA 1OB5A 5FH9A 4V03A 3K9FC 2BGKA 5L53A 3O5AA 1PG0A 3DLBA 1XCJA 4C4PA 3G5UA 1JPNA 1KDTA 1NM5C 4L8GA 1TO6A 3QWHA 4FI3F 2VAPA 4YUWA 1P1FA 4R1QA 3U5ZB 4E30A 4KLCA 3CT6A 3RUEA 4U7JA 4O2LA 4PCUA 1N2IA 2NVOA 4M88A 1GV1A 3EMDA 3O6VA 4Z9FA 4ISCA 1VPDA 3HLKA 5TARA 4OI1A 1D2GA 1RQNA 1X1SA 2ZYUX 3WGIA 3WE7A 2Q5FA 3F0TA 2VK2A 4JUFA 1LLCA 3T0FA 2BI4A 2ZJ0A 4CKWB 2C7VA 3L4BA 5I7VA 5FF9A 3ZDAA 1ZHOA 4KPEC 3C97A 3RLFA 3CF0A 2WZCA 4MQEB 4TTSA 3D4OA 4MLDA 4PSAA 2OBXA 3TD9A 3WK9A 5JJKA 3HYRA 4M0DA 4F6CA 2PR7A 1GD1O 1DKLA 1NVKA 4PLWA 1KYWA 2OAQ1 3L7JA 2KWIA 1YJQA 2WMNB 3MK31 4BLTA 4QTYA 3L7NA 2O4CA 3PEFA 4W5JA 5CH5A 4KXUA 1SU7A 2UXBB 1Y37A 3L84A 3O94A 2CWDA 2CMDA 4RETA 3PJEA 4MGIR 5DNYB 1N0IA 4BZWA 3RAEC 2P2LA 1ISHA 3GV0A 5KTRA 1B7GO 3M1AA 2CJWA 4PVDA 3H86A 3MQ4A 4UEOA 1P2UA 4LXIA 3SS9X 4OL9A 2O8NA 3C3CA 1WDWB 2IPXA 2W70A 5B5SA 3GAAA 2R3SA 1ZIPA 7REQA 1UMDB 4OXYA 1BN7A 4XFDA 2D00A 4XWYA 4X3CA 4C30A 3WRYC 3NMUF 1PGJA 1KGDA 2QVBA 5A6SA 3Q2IA 2FZKA 4NE7A 3WLHA 4BTEA 1C7ZA 2C8LA 3TGWA 1O94C 3N28A 1MQ8B 1ZUHA 3AK4A 4C78A 4CV3A 3HU5A 1OJLA 1P17A 2JF0A 3M1YA 5FBRB 3S27A 2LD4A 2QTRA 3HJTA 5H82A 5HF5A 2G7ZA 4UU1A 1F60A 2IBMA 3J81k 3GLHA 4Y30A 1T2AA 4MKGA 1U4NA 4P53A 1QWOA 2WKSA 3QV1A 4M98A 1H2EA 4XOIA 3L1JA 5EJ7A 4UU7A 4EG8A 1K6XA 1T25A 3JYHA 1Q7EA 3GGOA 5E95A 4NHEA 3X1YA 4DIUA 3DOHA 4NJEA 4P3OA 3L0SA 4E94A 1JWAB 1GSOA 1MAAA 3CZMA 4RCYA 3T94A 3WNCA 2BHNA 4RS4A 1H0KA 1G7CA 1HG1A 1O9BA 3BDVA 1G5IA 2H1CA 4JP5A 3WB1A 3NKVA 1QF7A 4FMDB 1OFIA 1DO0A 1LI4A 1SIWA 4MW2A 2QRNA 4D9GA 1GXSA 5C8DA 5CYGA 2A9QA 3HUDA 4ODIA 5E3IA 1K3UB 1CJTC 2EFCB 2WFAA 1GAQA 4IIJF 1HLGA 1RS0A 2GPAA 2VDVE 3OCXA 3P20A 5CJJA 1G9XA 3D4LA 3H2GA 4BDSA 1UP6A 4KQ9A 1SCUB 4KKVA 2WUWE 2X8JB 3K73O 2X40A 1YJ8A 2ZS7A 3BH7A 3IO3A 1ORRA 1W35A 2L17A 2IDJA 5HF6A 3E23A 3AH8A 2VCEA 4HDOB 3FVQA 4TSKA 1E2JA 1NQOA 5JZMA 4BLSA 2FPSA 4ZN6A 2JZCA 2ZJOA 4KO3S 3ZZNA 3PL5A 3FE2A 3L4EA 1AV6A 1I2MA 1LI5A 4TMYA 3TI7A 5B58C 4LWZA 4IO1A 4UCFA 1X7YA 2JIZD 5DYNA 2Z2XA 2XYVA 5JD5A 4M46A 4Q12A 2FUEA 1WMBA 3MINA 3C8UA 1DKPA 3HV0A 4DRXA 4GZLA 4BUCA 3FD8A 4FYIA 2CEAA 2HQBA 4V0NA 5KHAA 3KU4A 2IV7A 1OBHA 1HTTA 4JP1A 1NVGA 2C5HA 4RX1A 5AK3A 2Q41A 3ADKA 3ZHXA 2E4UA 4F4DA 1HPLA 2V9PA 3SHOA 3TVDA 3DTVD 1SKYB 4BNFA 1KZ6A 4FMBB 5A7GA 2G0NA 5EN4A 4FFOA 4D6YA 2A57A 1E8MA 3G8CA 4PAMA 4M22A 4P8RA 4B47A 5A4DA 2UYHA 3NHBA 5PGMA 3PEEA 4H7PA 2NVUB 5BW5A 3QOFA 1GZUA 1SQGA 4YLEA 3P4UA 1KFEB 3GD5A 4MR7B 3DL0A 3O4FA 1NMEA 5GJCA 4MDFA 3SSMA 2QY9A 4EFMA 3DMFA 3O84A 2QTMA 1OXTA 1UQUA 3Q8XB 1T5SA 1MJHA 1RPNA 1PBNA 2WWRA 2NTVA 2VFAA 2XCRB 3VUFA 2WFMA 2IV2X 3D2CA 4IH4A 3RREA 3QUTA 3GGGA 2OOSA 1A96A 3L93A 3ROZA 1VCOA 3BXOA 3JQAD 3DD5A 3SY8A 2UZ3A 1NOJA 1TF7A 2FR1A 4KR9A 3UH1A 3JZDA 2QRLA 3JQEA 5DPMA 1GZSA 5D7BA 2EFYA 2R8PA 2VJYA 3OEHA 4KV9A 3AT1A 5IAJA 4H0FA 1Z12A 1GILA 3A2MA 1KIMA 4K9RA 1E7RA 5LLDA 2AFIE 4PQGA 1DFGA 1VSUA 1CNFA 1P9WA 1TYCA 2XJ4A 1KVRA 2ZKIA 1P4JA 3HB4X 1T29A 3WLIA 1EK6A 1RJEA 1SC4A 2FDCA 4BMYA 4AF8A 2ZRDA 4DLLA 2TSYB 1IJKA 2KX7A 2QVXX 3W9SA 1XDGA 2HHLA 3GFFA 4YCJA 5BW8A 3IIJA 1LRJA 1EB9A 1DO2A 3JV7A 3KOWA 1VE9A 1GNQA 4MB6A 3PNBA 5AI9A 3B60A 1AO0A 3S1SA 2ANCA 4L73A 1VIYA 1ZA1A 4IH9A 1R3DA 3IYLW 3A8TA 3FW1A 3C3EA 5L40A 2MINB 3C1AA 2ZQ5A 1HNNA 5E7JA 4BCCA 1JQJC 3MJSA 4EY8A 2YJ4A 1P2VA 4G26A 2ZP1A 3E8MA 3GN1A 3TQFA 2WM9B 1M2FA 1N2CA 1J49A 1N1MA 1V4NA 3C39A 3GRCA 3VQTA 2E18A 2QL7A 4ZEWA 2ORIA 4BTVA 4ILEA 3T9BA 2O2YA 1NC1A 3HI4A 2VP3A 3SC2B 3UV3A 3WL3A 3CVUA 3ZJTA 5FA6A 1BE1A 2PDAA 3INNA 2R8RA 3DULA 2OYCA 5J2UF 3ABRB 2NU6A 3Q0EA 1WPRA 5C4IA 1XIVA 1YDFA 3BWCA 3Q3CA 1A77A 1A9YA 1FDRA 3HDYA 4R6WA 4ZRMA 3TIXB 4ZCLA 3WGQA 4WHMA 4BATA 3GPIA 4JYZA 1AA6A 1JEJA 1ZRMA 2REQA 3E9YA 3PT9A 2QS9A 4WWHA 1S2DA 1MW9X 3EVTA 4RABA 4BIIA 4MV8A 2ATIA 1OZHA 4X84A 1PZHA 1G59A 1IPHA 4O4LA 1QIEA 1SVUA 2I9KA 3CPJB 4LOKA 1POWA 2V98A 3JQ9A 3T12A 5J5VA 3ISJA 5K0CA 3V1TC 2PS0A 3BF7A 1IBSA 4O33A 4QLBA 2O3SA 2XRZA 1G17A 4PZUA 5FTKA 1E92A 1EHCA 1OLOA 5DBFA 1AHHA 5EZSA 5JV5A 1H66A 1EX6A 1R66A 1APBA 4E33A 4GX2A 1PTKA 2VH1A 4JB2A 2BKAA 1G291 5JYCA 3TZQA 3OU6A 4C03A 1TTHA 4YJ3F 5DWDA 1FYWA 5JASA 4C7OB 3KLOA 4OHBA 1Y63A 2D5IA 7MHTA 1CUSA 1JG4A 1X9HA 4WOCA 1A9PA 5ECGC 2Q29A 1JHMA 3FZYA 1MR3F 2B3DA 2ZTLA 3HACA 3V3TA 5CTJA 5SYAA 2HA7A 4DR3B 3MWJA 3V32A 5ADHA 5L7YA 1SD2A 5IH3A 2ZYGA 4A0SA 3E1GA 1GGKA 4XA8A 1E5LA 3V1UA 1P6UA 2P4QA 2AOTA 4D0RA 2HK9A 4ER3A 2IY8A 3H2KA 1P73A 2YIMA 1TIBA 1KVUA 2PL9A 1Z0JA 4EHFA 3PUYA 4V2UA 4AW9A 3DAPA 2ZI3A 2XT9A 1QFMA 1VCMA 1Q3HA 1XLTC 2IGBA 2OKCA 2HHJA 3OZGA 3ZLUA 3NVKI 4BEVA 2I4RA 1JLSA 3R4VA 1M8GA 1XD9A 1DAEA 5ADUS 4OCZA 2OXFA 3SIPA 2X22A 2HMUA 3MILA 3HSKA 2IHVA 5ALPA 1DAGA 2QLLA 4UBOA 3H65A 4RZXA 5E8RA 3OWXA 3BTSA 4U7WA 1PK9A 3F5SA 4BU1A 5U4XA 3VMMA 1PL8A 2VJDA 1HT0A 3DXXA 2OFPA 4ALNA 4DXDA 1YL5A 3DAGA 4XGIA 4BQRA 2RKBA 5DTRA 5E7QA 3KVVA 3S2UA 1MAVA 1P81A 3VR2A 3MJ4A 1TYBE 4OATA 4RVNA 5IU6A 3DONA 2WTUA 1LFDB 4U39A 4KXLA 3GJSA 5DBIA 5DMHA 1XX6A 3ZJVA 3SJ7A 3UOAB 2BFCA 4HPXB 5DX1A 1NE2A 2JCXA 3FNRA 3QEAZ 5IP5A 2RHWA 1JFTA 2J1LA 4QOIA 3R77A 4PONA 5J2TF 1HFEL 1CP3A 2PNFA 3AHCA 3JWIA 5G0SA 1QRRA 4QL3A 2VDPB 4RA6A 4DCNA 2BSQA 3V4VB 5B7GA 1G66A 1NNLA 4IIGA 2FZEA 3JTMA 4X7BA 5CP8A 5ILQA 3KL4A 5BR8B 1CJUC 2J3JA 2QZ9A 3G2IA 1J07A 4C21A 2F3RA 2F4NA 2GWHA 4QRIA 1DXHA 3IJEB 4BXOA 1JFFA 3QX7A 3K0KA 1FTWA 1U0FA 2JH8A 4O4HF 1ZMXA 1HDIA 3E8SA 2QN3A 1GU7A 2AE1A 3LCJA 5K0NA 2NPFA 4EG3A 3FPKA 4DC9A 4R05A 2Y1LA 2VDLB 4Y6QA 1RWKA 5HGJA 5JVDF 5HTOA 2JLZA 4BGUA 2ARKA 1SZCA 3VR6D 4EKYA 1LZLA 5IRCD 1SCDA 2FSIA 1CLEA 1JPJA 1BGXT 4L9WA 3KLBA 3MPOA 4WZBA 4RHEA 4DIKA 4RTJA 4KI7A 4XVHA 3DTYA 3CLKA 3MRXA 2QUKA 2MSKA 4HN2A 4K03A 3UB2A 2FPMA 2FEWB 1CERA 2VH5R 2Z9DA 2QW8A 4X7MA 5TS2A 3O31A 2JH3A 5KYKA 2YR0A 3L7KA 3R7AA 2ONKA 2VNHA 1C0KA 3CNQS 2Q62A 5IVIA 4ITVA 2X6TA 3BEDA 3WADA 2IGTA 2VNIA 1TCAA 2BLLA 2VTKA 4Q4JA 2PGOA 4OP1A 3D4BA 3BMCA 4FK8A 4MX8A 3EGWA 1WCWA 1DUSA 2FP3A 2B61A 3OIWA 4C43A 2ROQA 1Q0LA 3LM8A 3VNRA 1DL5A 3ZE0B 2FDXA 3OBIA 2YMQA 2ACVA 1RKVA 1WNTA 3QBVA 3QE0A 5DFAA 3A4VA 2HAEA 3CKLA 4RD3A 2IZ1A 1O57A 5EERA 4Y2UA 3ZCQA 3OUZA 4G0OA 2RI1A 2QN1A 3FAKA 4XJTA 3LO5A 4F4FA 1RRCA 4FE3A 4QGFA 1HQCA 1BH6A 4EUFA 4DHEA 1WR8A 1QZUA 3A9CA 3V1YA 2O8BA 1LLUA 5JCPA 3O92A 1XEXB 4OQEA 2VXYA 4Z4EA 1Y4DE 2N0SA 3SBOA 4JI4B 1BXGB 4DCOA 2QLBA 5ERYA 4S05A 2EEZA 5CYPA 3AY7A 1DV2A 3VR4A 2QKYA 1Q2UA 2IHJA 3B5JA 4WNAB 2PN1A 1G1MA 2AJDA 3KZNA 4EJ6A 1R8JA 3ZY4A 4BCBA 3EA0A 2F3SA 4E5SA 3CWZA 1LBEA 1GO2A 2JJ8A 3WRXC 3KHUA 3Q2OA 4GZ5A 5AW7A 1S2GA 1S4QA 2CK3A 5TQ0B 1KHTA 1ZAKA 3BE6A 3MWDB 1HTBA 2GHTA 4MKXA 5ECDA 3W9BA 1VM6A 4RFSB 1WUTA 2JBAA 4HDRA 2Z6VA 5BUSA 1VFNA 3FSGD 3LZCA 4G1FA 4YJGA 4BQFA 2VQEB 1II8B 1Z88A 2JCVA 3BCSA 4KWCA 5EI5A 2BBTA 2VHTA 1FYDA 4ZIRA 1X14A 2JK0A 3SJUA 1M0TA 3IP1A 1UZNA 2BOVA 1Z4JA 1RM0A 3TZCA 4BTLA 1M72A 2JFGA 2D62A 4J0QA 3MC1A 1E5VA 2GPWA 1NUPA 3IEPA 2VC2B 3OTHA 3FYCA 1V3VA 4Z7OB 3KLMX 2IBTA 3NANA 4I8XA 2B69A 3EBOA 3TW8B 1UOEA 4MVJM 4ZVVA 3Q7EA 4HNHA 5JPIA 4DV4B 1Z5PA 3HLYA 2H18A 5EPOA 4EQZA 5CDYA 1I3CA 1GTSA 2OSBA 2I3DA 3GOQA 3UAVA 1KEKA 3B6MA 4BP8A 4NXMB 1R37A 4Y2RA 3BD6A 4FN4A 3GVHA 2WV7A 4KR0A 2PZ8A 5J1TB 4EHHA 3SOPA 5BWOA 4M0MA 2VQFB 2P4UA 2VP4A 3IBFA 5C0OE 1X94A 4RS3A 3O8BA 4BWGA 2EU8A 2ODNA 3W0LB 1YBFA 1XDDA 2EQBA 2XDYA 3AZOA 3KD2A 3AHJA 1UXGA 4IY1A 3FDZA 5LMNB 4RMJA 4BPBA 5JSUA 3SHQA 1PS0A 1ZM9A 4TMFA 4S24A 3RC1A 2NZYA 4OO3A 1CULC 2JAOA 2FX5A 3EF0A 3FZEA 1CD5A 3OKCA 4KN9S 2IX3A 4XIGS 4L85A 1G2IA 5SICE 5C1DA 4XCVA 3FOBA 4EJSB 2IH5A 3NB0A 2W6JA 2UVDA 3MD0A 2YIDA 1EGMB 1YHYA 1H1TA 2D7CA 4N6NA 3N6VA 4A0QA 2JAPA 4CN8A 1NQUA 4JT9A 2AOUA 3IBCA 2Z95A 4R5HA 3NKFA 4DTCA 1E7YA 1H2YA 1PN3A 1GZ3A 4GI2A 2OQIA 4IOJA 5FUXA 5LZ5A 2H1VA 2WICA 2Y0BA 1CY1A 3ONWA 4Z4GA 4G0MA 4RD1A 3UWMA 1RRGA 5BVHA 3L5KA 1IN1A 1A69A 4NOLA 2PMCA 3PEVA 2C07A 4INAA 2QT1A 2GNOA 3HNRA 2IYTA 2ZJBA 4GLOA 2PUHA 1S02A 2CFIA 3H3JA 3E2PA 1WLSA 3L8DA 5IWAB 1LSJA 1G6OA 1UEJA 3LUCA 4K6CA 4LHYA 4PLZA 4ZAGA 3FFBA 4ZCRA 5BQ5A 1B73A 3T8YA 2HHHB 3JVEA 4CEIB 2C54A 4TL6A 3I01M 1JFVA 1GEEA 2FK7A 4RKQA 1BAPA 4PGGA 4YRTA 5EUQB 3B1YA 3RVBA 1W9HA 1O96A 1SFRA 4TQ9A 3NBUA 3D2AA 4HS4A 4XKJA 5DNEA 4KH0A 1CEEA 1H69A 2Q8QA 2WHRA 3I23A 4E7PA 4E5DA 3RTGA 5KQGA 2G4CA 3HJGA 3TEFA 1IPFA 1KO7A 4BNHA 2BTOA 3GG2A 1AK2A 4DV6B 5D1HA 2AZTA 4ERNA 4OJYA 4P4SA 2C98A 5LXTF 4KXWA 4GL4A 2MYPA 2D06A 2ECFA 4R8SA 2Y0EA 1BG6A 4PHGA 4OGLA 4UVGA 4CQLA 5DU2A 2A59A 3L77A 2G04A 5GONF 5FYQA 4GOLD 4E21A 3CUVA 3RU3A 3WLAA 3KVNA 3G9ZA 3HMKA 1CJBA 3KEFA 1DBRA 4UEQA 4KITB 1CNEA 2WHXA 3REQB 1ABBA 1E0JA 3LRTA 3J7AC 2HJSA 4L9RA 5CHYA 5EMJA 1KZYC 2Z1DA 3N6XA 4LK3A 4MEBA 2FWAA 4GD3Q 4KO4S 3K4HA 2YVAA 1V8DA 5E4JA 5EP3A 1IYZA 4ZU1X 5BT8A 1PQUA 2I8CA 2JGLA 1G98A 1USWA 3UJPA 1XL0A 3VPSA 1ESEA 5EZ5A 1C3OA 1XEWX 4LIPD 3WL7A 3W05A 1WZUA 4DAOA 4GI3A 1ZCBA 3ZD8A 3BHNA 1XTRA 2ATCA 2GNPA 1KEWA 1QP0A 4M9QA 2WTNA 3P2JA 3UAWA 2JHGA 2ZE7A 3CTMA 1O2DA 2ATEA 3GBSA 1Z4OA 3K2EA 5D51S 5ES4B 2OHGA 1G5RA 1BD3A 4G8DA 3QEJA 4LTNA 4PCLA 1UBGA 2A1UA 2QV7A 3AY0A 3K6KA 3NCHA 4IIJB 1GIAA 3MT8A 1M8KA 3M6UA 1N8KA 3TQIA 1DEOA 4WA7A 3NT4A 2MYNA 4ZI2A 1XKXA 2Q0QA 4MW0A 2C03A 2I54A 3G0HA 1TPZA 3DZ8A 1U02A 5C18A 4HQFA 4Q82A 3B2NA 2O1SA 5FKJA 3X2EA 3L4BC 1XFDA 3M49A 3FVVA 4UTXA 2I6TA 2JW5A 1UBHS 4OHOA 3LKBA 1F7UA 3RYIA 4NF2A 2CUTA 4F8JA 4MK4A 4EYGA 1OYVA 2BR5A 3K0BA 4WX2B 5B57C 5BN4B 5HQJA 5G3YA 2VPIA 4BEJA 5AI8A 3U7IA 1ULUA 2SECE 4AJHA 2PWYA 2WG2A 3AJRA 4NZZA 3FIJA 3IEXA 1XWFA 1WP9A 4FDMA 1E3WA 2RH5A 4Q9JA 2GCEA 2O1EA 3QF7A 2BFEA 4A0FA 3E9CA 2A0UA 5AM5A 3FNIA 3X1JA 1GJRA 1EK1A 4YBRA 2CHVA 3Q15C 2QJOA 1I6MA 4II7A 4NDNE 2QOEA 5H3CA 1OASA 2XDAA 3B85A 4I3GA 4G67A 3ORFA 3BDIA 3OJEA 3W6OA 4EG0A 5BSHA 2O9JA 1U0BB 2OHJA 5COQA 4JVMA 1MA3A 3GH3A 4WJLA 4BNIA 5AKEA 1USUA 2FGKA 1XZFA 2W2LA 4MQBA 4QLOA 2R1ZA 2B30A 1N2HA 1PWYE 1S8NA 4R2MA 3F90A 3ZTTA 3MWFA 1WHSA 1OT5A 1YMQA 1J42A 1ZN7A 2PZEA 3DMGA 1ND6A 3DHEA 4FD3A 4ND5A 3PQ7A 4W1SA 1NWCA 3I34X 4NOKA 5C1IA 3UWPA 2H52A 3A9UA 2B7LA 3H5LA 4QUHA 1FFEA 1BN6A 1QAOA 3DHYA 1R10A 4MVJE 2ON6A 4D82A 3R0IA 4PFKA 1XQXA 2CMHA 3CLHA 5TEVA 3JD0A 3BA6A 1FP6A 1A71A 1RLUA 3K5IA 3RYFB 3WAKA 2G83A 1LJLA 1MGPA 1FFWA 4EG6A 2O1XA 3GJ6A 5GVSA 2AKYA 3FJYA 1XJQA 1KGSA 3O83A 2ZJ2A 1J06A 1COWA 2GAIA 4HSGA 4IYJA 4MVYA 4HWSA 3FETA 3R6TA 5EXDA 3ORYA 2FMTA 5LZ4A 2VYQA 1K9SA 1Z0AA 4ZOEA 1NQ5A 5AFSA 3IL2A 1CS4C 3K2IA 2AFHE 3R6GA 1T0IA 1LBIA 2QN9A 4YAJA 1YU6A 4NNJA 5JCOA 2OG2A 3EZYA 3H3XA 3SC6A 4ZYLA 1WPXA 4L3OA 4X61A 3VPBA 4C1BA 4MO9A 1Z16A 4GOJA 3O93A 3OZAA 3CF6R 1V4VA 4LY3A 1KAQA 2H65A 3GROA 3N58A 4PS0A 1KMCA 4RVUA 1SJ9A 1W0CA 2I6GA 4DKJA 1IEQA 3RW9A 3BK1A 3OMWA 2J3LA 4H3VA 4JLWA 1W5BA 4KXFB 3CNLA 5HF9A 5DM60 5I7HA 4UFPA 5EMLA 3RVKA 2WE8A 4OHMA 1U8FO 4R41A 2EYQA 3BZWA 4DS3A 1UMBA 3D7MA 3RS7A 2O8FB 3OC6A 4AZSA 3INTA 3SX4A 4BGVA 4RGQA 4GWLA 1WCIB 3K16A 5ALDA 2W2TA 5CDFA 3AJDA 3CA8A 3V2GA 3G89A 1QP8A 1UZAA 2NP7A 2Q1UA 4L57A 4RLFA 3C74A 3LVFO 2H4JA 2A86A 2DFDA 2FN4A 4NZ9A 4AXBA 2RB4A 1R0SA 5J2UB 3D6VA 2P9YA 2WBLC 2C88A 1YRHA 2WP8J 4IYRA 4OYRA 3ZKAA 1XO1A 3F7MA 3A0RB 4KR3A 3INGA 3GCWA 1X1AA 3WDKA 5BYAA 4G5RA 4JI0B 3OZTA 3MN1A 1S89A 2FZLA 3EXEA 3L7LA 4KKXB 1U9YA 4UVDA 1ODLA 4HWGA 1RJFA 2MSEB 2VTDA 3QOYA 1E2EA 1I0ZA 2ZRAA 3E0XA 1SVOA 4CMAA 1VJGA 5H9WA 4HXYA 2OV8A 2SHKA 4GSLA 1VLMA 4NVRA 1NVMB 2PKYX 3THWA 1FW8A 3Q5EA 1NMSA 2ZWMA 1PR5A 3HDHA 1AO3A 2RB5A 5KX5A 2QTCA 3DBRB 2IS1A 1AH2A 4Z4FA 3QYPA 4DWVA 3CBGA 3UK2A 4DLRA 3AJ8A 4BN4A 1K86A 3GHYA 4MW4A 4M0EA 4TTPA 2EQ5A 3ND5A 3FKSD 1OXKB 4WDRA 1V1RA 1M6NA 1T36A 3L41A 3UFXB 2ZUWA 2FPUA 2QLNA 4G5OA 1JLHA 4JLNA 2AUNA 1O6FA 5I7SA 3T0GA 2XDQB 3O95A 1XEWY 1BFKA 1JR3D 3D3NA 3PTZA 4F4JA 2GPBA 3N7UA 4YJ3B 5KQRA 2QROA 4LJ4A 5BV2P 1XMJA 2AG1A 2HTEA 1LQTA 3LLCA 1E1LA 1Z3IX 2QXYA 3G9XA 3KYDB 4FC6A 4Z86A 3KX2A 1PUXA 1M10A 3VTAA 1OY1A 1WV1A 3R0VA 3FMPB 4CIDA 4DZTA 2X3UA 4RNCA 3GLHE 5A5DA 1KSJA 1REQB 4YFYA 3WMEA 2HJ9A 3WHLA 3TI9A 3GJTA 2EKBA 4RZ2A 4XSVA 4M0LA 3Q72A 1BX0A 4IJQA 5IJZA 3E5NA 1N7JA 3DTTA 4LC1A 1NFRA 1E6KA 2AZ4A 1BHQ1 1EGAA 4P36A 5AR1A 4FDTA 3C6ZA 3KKNA 1HSZA 4WSOA 5CIQA 4YREA 4F3NA 3I12A 3GL9A 3NXKA 4Q1DA 1TFUA 4O63O 4EW3A 2WVGA 1C5KA 4ED9A 3IBGA 1SZDA 5AJWA 1B4DA 2EL9A 3EOAI 4NABA 2PL1A 4K9OA 4X1YA 1Y1PA 1BOOA 3WLRA 3R5XA 4LX8A 3I52A 5T6BA 4B44A 2AFRA 2QEQA 5SY9A 1SCAA 3MSCA 4KSYA 2PEZA 3AHGA 3F46A 3PHHA 3GP3A 4TV9F 5DHAA 5EMNA 1G4UR 2OB2A 2X9VA 3KDSE 3NI2A 3SQXA 3JR7A 1CLUA 4UM8B 3AQIA 4U7GA 3C3BA 4BE7B 1ZVKA 2OCIA 1B42A 2HKIA 3AP3A 3U4IA 2J4CA 2P3SA 1OILA 4NJMB 4RAQA 4UE6A 1K0FA 5I9NA 3K8QA 2BGUA 4BNZA 1GA1A 1BC5A 1OQAA 3N3BC 4LHWA 1XB2A 1LQUA 3LL7A 5J2TB 4UUMA 1GU0A 2FXIA 4QO7A 3BAFA 1AF7A 5FUVA 4UNSA 2JAXA 4CCYB 1CVRA 1S2LA 1TZCA 1FBTA 1ZPDA 3IDZA 3OWOA 3VUEA 2F2TA 5EUCA 1IDN1 4FYKA 3UMYA 2W6QA 4N0PA 1YFZA 4CF4A 2Q3MA 3A25A 3GEGA 5FPQA 3QF4A 2I55A 4B6JA 1PVVA 4NENB 3TPFA 1GNPA 2DVMA 2J9RA 2D5CA 3L0YA 3LA6A 1MX1A 4O4HB 4M55A 4MI3A 2PS1A 3JQ9C 4FOTA 4PQEA 3SGLA 2GAJA 3KR9A 4OYYA 1X1CA 3EIEA 3HYCA 2P9FA 2ZBEA 3SXUA 5IK2D 5JVDB 3FFTA 2CW5A 4DMLA 1KDOA 1I2DA 2V1XA 3SIWA 4CLOB 4IZ6A 2OCLA 3PNOA 3U3RA 2C3UA 3MUEA 3A6ZA 2C5FA 1K2VN 2P2GA 5M3BA 1WB6A 3ZWAA 1PKXA 4UZEA 5G0UA 5BR7A 1A8IA 1E6WA 2R84A 4OVKA 4CHGA 4BJHB 1PZXA 3W3AH 2H4WA 4PLVA 2J4FA 2EWWA 1F4VA 2IXDA 3K2BA 4QJ5A 4BO5A 5KNDA 3M6WA 4II2A 1PV4A 1N6LA 2XLBA 3ESQA 1B1CA 1JSLA 2W98A 3KXLA 4C7BA 5H7XA 1L4KA 4X94A 5IDWA 2PRYA 5DX8A 5JH7A 2C9YA 3VOAA 2V7WA 1BVUA 1SC9A 4WKBA 2W8ZA 2H7VA 2VJNA 3DDCA 5HKOA 3BXGA 2C58A 3UH0A 2RHOA 4JLDA 4YUXA 2E9SA 2FHSA 2O2EA 3L0DA 4RV5A 1DLJA 4HQOA 4D3DA 2PUBA 1T6NA 2ONCA 5JDCA 3VC1A 1CE8B 1YBMA 1DKQA 2A5LA 1TKBA 3LYLA 5BN3B 5K6RA 2F62A 1BKDR 4RGVA 5DNAA 2ZUFA 4QXQA 2HRCA 2LCFA 4AS3A 4YRDA 1J1UA 2IE8A 2OV6A 1OKKA 2EX0A 3TW6A 5FA5A 3PX2A 3H9GA 1GCIA 1NYTA 1JJBA 3T9AA 3WYNA 1EFRD 2KBEA 5MN6A 4HAIA 5FL7D 4R0VA 4N8DA 1CR6A 3QWBA 4HNTA 4IV0A 5IX8A 1ODKA <