5JE8A

The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with nad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MKKIGFIGLGNMGLPMSKNLVKSGYTVYGVDLNKEAEASFEKEGGIIGLSISKLAETCDVVFTSLPSPRAVEAVYFGAEGLFENGHSNVVFIDTSTVSPQLNKQLEEAAKEKKVDFLAAPVSGGVIGAENRTLTFMVGGSKDVYEKTESIMGVLGANIFHVSEQIDSGTTVKLINNLLIGFYTAGVSEALTLAKKNNMDLDKMFDILNVSYGQSRIYERNYKSFIAPENYEPGFTVNLLKKDLGFAVDLAKESELHLPVSEMLLNVYDEASQAGYGENDMAALYKKVSEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
publication title Structural and biochemical characterization of the Bacillus cereus 3-hydroxyisobutyrate dehydrogenase
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5je8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5je8A01
2Y1DA 4D0RA 3IJPA 3FR7A 2GF2A 1VC2A 1KYQA 3K2BA 4R68A 4CV0A 1VE9A 3VZRA 5I9NA 4B8ZA 1F06A 3U4IA 1H2BA 1SBYA 3P19A 3PQFA 2OP1A 3X2FA 4X54A 2GN6A 1JN0A 4PVDA 3UCEA 2YDXA 2V6BA 4YQYA 1SMKA 2JCVA 1QYDA 2GCGA 2BFAA 3ZWXA 1H0KA 3TL3A 2X4GA 1ZBQA 4BO9A 4CV2A 4A27A 2EJWA 2O3SA 2H9IA 3K8ZA 1Y81A 4ZRMA 3AJRA 4C7JA 1ZK0A 4R5HA 2UV8A 4JBHA 4R16A 1ID1A 4QO8A 3E9QA 2EEZA 2UYYA 2RHCA 5DZSA 4NK5A 3ABIA 2A94A 2VOJA 3AM3A 4RF5A 1H6DA 4OSOA 3MJEA 3QW2A 4RL6A 2Q2VA 3BYZA 1UXKA 4YCAA 3C7CB 3GUCA 4D41A 4BGUA 3KLPX 5BSEA 1D7OA 4WLFA 3D1LA 5KJFA 3VPHA 3M2PA 1EZ4A 1ZH8A 5TRTA 1YQGA 4RPKA 4ZA2A 3UVEA 2OUIA 4GKBA 4GQAA 1I32A 3CZMA 3WQRA 2NTJA 1ARZA 4A7PA 4OXKA 1WP4A 1G0NA 4AJJA 2GSDA 1AHIA 3E03A 1TXGA 4RF4A 4ZICA 4GMFA 2EXXA 4XZ3A 2WD7A 1ZXLA 4E5MA 1B14A 1HETA 3QY9A 4E4YA 2YY7A 3ZHBA 1DO8A 1X7GA 2WJPA 3ZWVA 4E5PA 1NHGA 4Z0HO 1M66A 3D3WB 1NHWA 3RVDA 4M86A 3B1JA 2V6MA 3WQSB 4FOSA 3DZIA 4MJLA 1I3LA 5K6AA 1LDMA 4XYMA 1J49A 5IDYA 3U4CA 1HYGA 1GYQA 1L1FA 2PK3A 4WEQA 3UICA 3ADOA 2Z1MA 3C85A 4CUJA 1I3KA 3RWBA 3D3EA 4GBJA 1XEAA 3PFWO 3QLJA 1Y7TA 5HA5A 4BKRA 1GQ2A 2WWRA 3OQ1A 3Q1LA 2D1YA 3GR6A 4J4TA 2AQHA 4JNKA 4BKOA 1B3BA 1E7MA 1R4MB 4WE3A 4NH4A 4TMFA 1EFKA 4BNMA 3EUWA 4LCEA 3F46A 2FPIA 3GAZA 1EBUA 1S7CA 4HX5A 2NNLD 2NACA 1E3SA 3TZ6A 2ET6A 4XQEA 1DJNA 1PR9A 3H2ZA 3JD0A 3QWAA 4RZIA 2B4QA 3RC2A 3AOGA 4FC6A 4BKPA 4CL8A 2NLOA 2E48A 1X1EA 1PGQA 2Y1EA 4WCDA 4W9NC 5FF9A 2OXIA 4GLOA 1KC1A 1ZUD1 3BMQA 4DXHA 3I6IA 7MDHA 2W2KB 2WYVA 2P9CA 3AM5A 4F6CA 4O1MA 5B1YA 2HSDA 5FI5A 1ADGA 1PZEA 2IDZA 2ZB3A 4MDHA 1EK5A 1XSEA 3JTMA 2G1UA 3L77A 1Y9EA 4Z0PA 1DBVO 4CM5A 3PZRA 3JQEA 3AWDA 3OJOA 3PJEA 4FN4A 3FTNA 4OXYA 4Z9YA 2NTVA 3IP3A 3QVWA 1PQWA 1LDYA 2VHWA 1LA2A 3NJ8A 1JDJA 2CF6A 3Q2IA 1K89A 4Y8VA 2BKAA 2EIHA 2A9FA 2GNAA 4AJPA 1PJBA 3GHHA 3MJSA 4E33A 5JAZA 2AXQA 2GR9A 2AE2A 4IDAA 1DFGA 1Z6ZA 3UW3A 3H4VA 1Z75A 4FDAA 3E1KA 2YQ4A 4LISA 3ZI0A 2ZK7A 3AI1A 1LLDA 1PJ2A 4FFRA 3FNHA 4BO8A 2F1KA 4R01A 1DIRA 1Q1NA 1DLJA 2VHVA 2WD7B 3DFUA 1HDGO 3H6KA 2VHZA 4NBUA 1OOEA 4XJSA 1PJCA 3HN7A 1MXHA 1P1IA 2TMGA 1YB5A 3H3FA 4A5OA 3RFXA 4EDFA 3QV1A 2R00C 4EUHA 5JDCA 1P1RA 4MVJE 3ZZNA 3PHGA 3KM0A 4WECA 2PD4A 4CM4A 3PYLA 3V2GA 1B0AA 3ANMA 2IYPA 3NT2A 4GAEA 5EIOA 1ONNA 1PQUA 4P4GA 1GEEA 4UEOA 2BGLA 4PG8A 1JQBA 2Z1NA 5DOVA 5HM8A 3JQAA 1JVSA 4J1NA 1SCUA 4MVJP 2IZZA 3LC2O 4D42A 2PKQP 1EE2A 3QQPA 4B3JA 1E3EA 5EESA 3ETEA 3C24A 4XCVA 2RHRA 4CLOA 5L4LA 1DAPA 4BGVA 1NQ5A 1G6KA 3BTOA 3C1AA 4XA8A 3OETA 4J43A 4F46A 2UVDA 1J4AA 4PLWA 2VWHA 1DFIA 3VPXA 2HMVA 1H9BA 4BUCA 5IDXA 2EKLA 3AY7A 4U6SA 1HKUA 3EC7A 3AFNA 1ZMTA 1NWCA 3D7LA 3VH3A 1YDWA 9LDTA 1V9LA 3OIFA 4JCOA 2CDBA 5EERA 4CMEC 4FPXA 1KEWA 4YT2A 1HLDA 3OSUA 1PQPA 2V7PA 3ROQA 1MC4A 4P38A 4OOFA 4PGFA 1I24A 1NWHA 4L74A 2FP4A 1K0UA 2Y93A 2X7HA 5K0ZA 2CSUA 2ZTVA 1FK8A 4WK6A 4XX0A 5JFOA 2JL1A 3QVSA 1YJ8A 1GQYA 2JFGA 4U0KA 5EL0A 4MKXA 2WE7A 3ZWCA 2DKNA 1JKJA 4MKRA 1B15A 1C3VA 2R2GA 2VNAA 3L4BA 3C3XA 3WX0A 1E0DA 3PGXA 1VKNA 5U4QA 1UP4A 1NR7A 3K6JA 5TF4A 3QJ5A 2WTBA 3JD3A 3IAHA 4JK3A 2DLDA 4BMNA 2HRZA 3F47A 4B7CA 1BVUA 4RVSA 2NWQA 1HZJA 4YQZA 3W8FA 1SAYA 3ZDFA 4BNFA 1PZHA 2B0JA 3G3EA 1RM4A 3S1LA 3TSCA 4BNXA 1O8CA 1MXFA 3LDHA 1MV8A 5I7VA 3IQDB 2ZTUA 4JBGA 3WQQA 4WPGA 4D79A 2Z5LA 4MVJM 5EQDA 1SEVA 4XYGA 4A73A 4DLLA 1T25A 5CEEA 1DSSG 3R3JA 2AEFA 3GEDA 4O6VA 1IZ9A 1JA9A 1IB6A 3EVNA 4IDDA 4NMHA 4MINA 5KJ6A 3NTQA 1YO6A 4YYZA 4CM8A 3E8XA 2BH9A 2J8ZA 1QRRA 3SJ7A 3TFQA 3BXXA 1Z73A 4GX0A 4G5HA 4Z9XA 1N1EA 3IC5A 2B4RO 5AOVA 3JQCA 3ANLA 5L51A 3MTJA 2DM6A 1W6UA 3UGKA 3GN1A 3V2UA 3PPIA 5A1TA 3HDHA 2EJVA 1Q7BA 3ONFA 5COBA 4CR6A 1Y8RB 3SC4A 4FFOA 3RC9A 3PTZA 1IHXA 2Q1WA 3W1VA 3B1KA 3CINA 1BW9A 4IY1A 3VOSA 4KUGA 2YFHA 3OM9A 3WGIA 3LYLA 2DTEA 5AXCA 3ANNA 4BGEA 1ZMOA 1UP6A 1TT5A 4MOWA 3EGOA 2NU6A 4IBOA 1AN9A 4XQGA 3K73O 3JQ8B 4D3SA 1JW9B 1PGNA 2FHSA 4U7WA 4RVGA 1ONPA 1JAXA 1J5PA 1ULSA 1RWBA 2GYYA 2OL4A 3JQDA 5KVVA 2HK8A 4KMSA 3RKUA 2ZQYA 3JQGA 1BDBA 5BNIA 3DONA 1KVSA 3FN4A 1RJWA 2J3JA 2VUTA 1P0CA 3M1AA 2QX7A 1DIBA 1L7EA 5G2OA 2Q46A 4DLAA 4PLTA 5A04A 2VZ8A 1ZJYA 2F00A 4DIOA 4ALIA 4AJ2A 1FDWA 4EEXA 4BS9A 3WLEA 1CETA 3I3OA 1NR1A 3JQAD 1N7HA 3ETDA 5L7TA 1WLYA 4FIZA 4U0JA 4BNKA 4XGKA 1V35A 4EBFA 1VI2A 4YA6A 3KB6A 2ZYDA 4EUEA 4BNYA 4O5OA 3CMCO 3NTOA 5JAQA 4R1UA 3MEQA 3ROMA 3GRKA 3T7EA 5CEFA 4RDHA 1Y6JA 4BNJA 2AEJA 2FMUA 2W8ZA 1Q0HA 4NFYA 2WYUA 4DREA 1BMDA 1I2BA 3GLQA 3E9MA 4TKLA 1BXGB 4IS3A 1RKXA 2H5LA 4CM9A 1YONA 2EW2A 2B37A 4R51A 1B7GO 3DHNA 4L9RA 3BMOA 1ZKMA 5T6BA 4CM8B 3JSAA 4K6CA 4KTVE 4E21A 3UCFA 3PLNA 1B8UA 1EDOA 2C2YA 1E7RA 4NJMA 5F1PA 3TL2A 5TGDA 3QWBA 4I9UA 4A0SA 1GD1O 4EJ6A 3JQFC 1G0OA 4PG4A 3AW9A 3GG9A 1UR5A 4JP3A 1M6HA 1GPJA 4EJ0A 5F3RA 3E6AA 4INAA 5DF1A 5DULA 2DBRA 1IUKA 1BW9B 3ROPA 2BFPA 2FZEA 4CLRB 1ISMA 4UULA 3H3JA 1QP8A 3GY0A 3W4IA 3RBVA 2O2SA 5CDYA 1BGVA 4PLPA 4BKQA 3GHYA 4FQ8A 2HU2A 1H5QA 4QFCA 3HFSA 1TEHA 4DGSA 4RJTA 1E3LA 1N7GA 2X9VA 5B4TA 2H6EA 3LT2A 4DBVO 4BQRA 1GPDG 2QRJA 3JQ9A 4YRDA 2AE1A 2WM3A 1DRUA 4TSKA 5T64A 2HUNA 3JQGB 2EG9A 5TLSA 3W6UA 3DTTA 1Z82A 5T67A 1ISFA 1PJSA 1QLJA 3OH8A 4BNZA 1DPGA 3GMSA 5C7LO 3CSDA 3LC7O 1H6CA 1YWGO 5JC8A 3RUAA 4I5EA 4DYDA 1A7AA 3HQ4O 2FR1A 3ZV6A 1CRWG 2GO1A 3WGZA 4GWKA 3IUSA 3VVCA 1NFFA 2A4KA 3KYBA 2YV1A 4ZVVA 4IZIA 3U62A 3SVTA 1SB9A 1CQJA 3B1FA 3I9NA 2FRDA 1G1AA 2H1SA 2YJZA 3ETGA 4NJOA 3DZJA 5TS3A 4DMLA 1X0VA 1CIVA 2B69A 3OP4A 3DR3A 1QYCA 4Z3KA 5B4UA 4B4WA 1WW8A 4LMRA 1UUFA 2GZ2A 5L45A 2W90A 4IJVA 5BT9A 3ZU2A 2DPGA 5JBIA 1BTOA 1XG5A 5DNAA 3ZHXA 1R16A 3HDYA 4R5MA 2AMFA 4TVOA 2PR2A 1ZK3A 2C2XA 4TQGA 4MO2A 2I99A 4FFPA 4UUOA 4FOOA 4J7XA 3QA9A 1WVGA 1P3DA 1LUAA 4DC0A 3W6ZA 4DPKA 3BHJA 1Q0LA 4URFA 1WAMA 4DVJA 4ALNA 4RPHA 3KSZO 4Z6KA 4E5YA 3TOXA 1DFHA 1I10A 4CM1A 3KETA 3KSUA 1O6ZA 3BMOB 1F8FA 5ITVA 4D7AA 1H94A 3MTGA 3UFXA 1HDZA 1E6WA 2C82A 4CLEA 4BO2A 1QYXA 2XPCA 3MWEB 4BNVA 4YJFA 4E13A 2CZCA 4RV9A 3MZ0A 4IJKA 1NVGA 4XR4A 1ENPA 3KZVA 1X7HA 2OORA 3DBVO 3GZ4A 3S2FA 4AJIA 2EERA 1CYDA 4YT5A 2Y0EA 3ZW8A 4YEDA 3W4JA 5DBFA 1WNTA 3PLRA 3JQ6A 1I0ZA 2QYSA 3KOUA 4YBZA 4N5NA 2BFMA 1E5LA 1LBEA 3U49A 5L7WA 3D4PA 1MFZA 3GH3A 4U5QA 3ZV4A 1LC3A 4IGEA 4UEKA 2B35A 4AJ1A 4KTTE 5TQVA 2VRCA 4FD3A 1PGOA 1QMGA 4GX5A 1OBFO 3F6YA 4OXNA 3WSWA 1ISIA 4KZPA 4IQGA 2O7QA 3V1UA 1KS9A 1A4UA 3MWDB 1DHRA 2X0NA 3CXRA 3VC7A 1GQQA 3LLSA 1EUDA 4IDBA 2Y1CA 4CJXA 1NAIA 1T24A 3QSGA 2J3IA 1V3UA 3NJ4A 2W98A 4IQ0A 1LC0A 4KDEA 3TJRA 4L76A 1AGNA 2O4UX 3GZNA 5G0WA 2VWGA 1I01A 4Z3DA 4YJHA 8ADHA 5JNLA 2VUUA 4JLWA 3WSVA 4CM9D 4LSMA 3VDQA 5ADHA 3A14A 1E3WB 3KXDA 3LU1A 1XHLA 4IQ8A 3NT5A 1VJ0A 4E2XA 2A92A 3Q2KA 4ND1A 4NQZA 4OH1A 6ADHA 4DIBA 1P1FA 2RIRA 4A2CA 1CF2O 1FDTA 1LSJA 3SEFA 3H8VA 4L75A 2IE0A 3C7AA 2FR8A 2JCYA 4QFDA 1CEQA 3KHUA 2X9GA 1J0XO 1KY4A 5F21A 1NPDA 4IMPA 4GSLA 4GL4A 4GX2A 1ULUA 4ZQHA 1N5DA 4FSHA 4J90A 4W7IA 3PRJA 4XIYA 2D3TA 4DLBA 1GR0A 3IMFA 3L9WA 2WEKA 1XWFA 1Z7BA 4W7HA 2WMDA 3WFJA 4BIIA 1BHSA 4HNHA 5JO0A 2CVOA 4XJTA 2FY8A 3S2EA 5JAIA 4WLEA 3JYNA 2GUGA 3AI2A 4E6PA 1PL6A 2FZWA 3EZYA 4RVUA 3VKUA 4M1QA 1EMDA 5H83A 3AY6A 5L7YA 3GVXA 2DUWA 4PLVA 2JJYA 1OC4A 4ZQEA 2YZ7A 4ONEA 3KEQA 5CG2A 1B8PA 4J16A 3C7DB 1SEPA 1LTHR 3IUPA 4UVGA 3H5NA 3TRIA 4XDZA 1X13A 4D44A 2VQ3A 3F5QA 3QWIA 4LK3A 1NFQA 3ZWOA 1YKFA 3RASA 2Q3EA 5KKCA 3K2EA 4BMSA 1H6BA 1R4NA 4OAQA 3GVIA 3S8MA 4E3ZA 1ZSNA 4ITUA 2BF7A 4J9UE 1SOWA 3E5MA 4EW6A 5I8ZA 4PLHA 1PJ4A 3G1TA 2ZJ0A 1N1GA 2XXBA 1ENYA 1WXDA 5KOIA 3HDJA 4WUVA 2G5CA 2P5YA 5JCJA 4QTZA 1P1HA 1LRLA 2P9EA 3TOZA 3KTDA 3GZNB 5JSFA 4Y6PA 4YJHB 3SX2A 3ZWMA 2ZATA 2PD6A 3RQSA 3VVBA 1I3MA 4WLNA 5FEUA 1XR3A 1I5RA 1DC4A 1RM0A 3AU9A 4KQWA 2DUUA 3ZWWA 2WD8A 5JW6A 3EVTA 1EVJA 3RUDA 2FPPA 1XU9A 4BQPA 1C14A 3I6QA 4BNIA 4YAGA 1HL3A 5ENDA 3NX4A 2C20A 4JJFA 4YRBA 3Q3CA 2I9PA 3ON5A 1ISHA 3GEMA 4BV8A 2HKIA 5G4LA 4KWIA 1QKIA 3FPCA 5CDTA 3TWOA 1DIGA 3E48A 2OGUA 3ZU4A 4R1NA 3HDQA 4DIFA 3DO5A 1PTJA 4NG5A 3OMLA 3RFVA 4RCVA 3TQHA 1DOHA 4A26A 4RGBA 2R6JA 5IF3A 3FSRA 2ZYGA 1P1KA 2AA3A 2VRCD 1YB4A 3R0IA 5BQFA 5I7SA 3MJ4A 5BNTA 3HN2A 5IZCA 1N9GB 5JDCC 4GLLA 2DFVA 3NT4A 4J2OA 3MJTA 3IKVA 4AICA 3QIVA 1Q2XA 4EI2A 4M8SA 4HFRA 1U28A 5BSGA 3RFTA 5LC1A 3ZU5A 1U4OA 1ORRA 1E6UA 1HYEA 2FSSA 4ZD6A 2YW9A 1PR3A 3WBBA 3JYPA 3QP9A 4S1VA 1N2SA 4W99A 2H63A 3ZNPA 5JS6A 4ZHSA 4Q39A 4PG5A 1X7DA 3WB9A 5IG2A 3RU7A 4OKIA 5ICSA 3I5MA 1YS4A 2BMAA 3DMTA 3PEFA 2HAEA 3WIDA 1XCBA 5FFFA 1CDOA 3H9UA 1E3IA 1UZLA 4J4BA 3DBRA 3RD5A 5I7EA 2W4QA 1HDCA 2YFQA 3RAJA 1CERA 4BNWA 5BR7A 1GZ6A 1R4NB 3HNPA 1ADCA 2JKVA 1ZVMA 3KV3O 4C4OA 2FWMX 5A05A 1A9YA 2CY0A 2EWMA 3U4DA 4PCVA 4Y67A 2Q49A 3BTVA 4O0LA 4ZGWA 1CWUA 4RPGA 4CM6A 1TLTA 4XDYA 3O8QA 1KVTA 4AVYA 3G1UA 4KUEA 4KQXA 2VT2A 4IINA 1FXSA 1PZFA 1LNQA 4Q3EA 4GKVA 1DXYA 3HE3A 3M1LA 3SJUA 4CM7A 3OECA 3PHIA 1D1TA 4J0FA 1DDOA 1KVQA 4QT0A 1GUYA 2VCYA 4L4SA 1U7HA 2Y1FA 3T7CA 3PDUA 2P4QA 3PIIA 4ALMA 4QUKA 3WGOA 1UXIA 1NP3A 1Z45A 3L4BC 1H93A 1RYEA 3P5SA 3ZNNA 3QWHA 1P45A 4HKTA 4LCJA 1JTVA 1NQAO 3JCZA 1NX6A 1E7QA 1VL6A 5DCYA 3O26A 1EVYA 4BO7A 3HUDA 2NM0A 1O0SA 4J6FA 3HZZA 2UAGA 3RIHA 5C3MA 3CTMA 5LDHA 3GK3A 4HBGA 1E1LA 3RC7A 3IOYA 3I4FA 1JWAB 3IL2A 2BFOA 1XYGA 3G0OA 2OBYA 4R1SA 4NFHA 1C0IA 4BGIA 1W4ZA 1BRMA 5A5EA 4BB5A 1MX3A 2J3HA 4UREA 2E4AA 2IODA 2PKRA 3WWYA 4BO3A 3SLGA 3ZV3A 3DMYA 2X6TA 6LDHA 1UH5A 2FSVA 1D4FA 2X0JA 3KSDO 4LGVA 5KVQA 4AJ4A 5T5QA 5TNXA 4BL5A 5JCJD 2ZTLA 5A9RA 4WNIA 4ND5A 5G4KA 4FR5A 1IPFA 5B12A 5U1PA 4CMBA 4Y6RA 1YVEI 2BHLA 2PZJA 3FWZA 3FNGA 1K2WA 4AJKA 2Y05A 3DBRB 3JYLA 2P68A 4FJ0A 5CEJA 3TZHA 1YE3A 4ZQFA 1HDOA 3V2HA 1PX0A 5HWSA 4IIVA 1O89A 1VSVA 4P22A 3PVZA 1R0SA 4DQVA 3BMQB 1T4DA 1Z7EA 4LVUA 2JD1A 2X0RA 5TSDA 2EGHA 1GCUA 1LDEA 3DZGA 2Q2WA 5KJEA 3HWRA 4PLCA 4XRGA 4C7KA 5AVOA 4TZKA 3FPLA 3WS7A 1SPXA 2AG5A 2J5RA 3WTCA 2GRAA 3D4OA 3Q0EA 5EPOA 1C0PA 2CF5A 4PVCA 2PGJA 1AE1A 3E9NA 1B16A 4YT8A 3HHPA 1KERA 3BA1A 3RC1A 4NNJA 3KYCA 1HSOA 3GEGA 4BNGA 3GFGA 3VZSA 2E37A 3GRPA 4QEDA 3PWKA 5JE8A 1IPEA 1R6DA 3I23A 3K92A 2O2YA 2O4CA 5F5LA 4AL4A 1ZEJA 4W6ZA 4K1LA 5JMWA 1TT7A 2ZB7A 1F12A 4TZTA 4RF3A 3EAGA 3A9WA 3LZ6A 4L0QA 5JDIA 3DZFA 4N18A 1ENOA 1DC5A 3M6IA 2ILTA 1RPNA 2ZB4A 1ZO8A 1MP0A 3PDJA 1CQIA 4G81A 1P77A 3EDMA 4JN6B 3PJGA 2GN9A 3WTBA 2ZKLA 2GDZA 3AUTA 4CM4B 2D8AA 3FNFA 3K30A 3WGTA 2PGDA 1UJMA 1OC2A 3R3SA 4PZCA 1V0JA 3PFFA 4QX6A 2X86A 1NYTA 4K26A 3U09A 4I08A 2YYYA 2PZMA 3INTA 3CUKA 3V5NA 1LDNA 3GDFA 3JQAB 1KEUA 4O63O 2BD0A 5G4KB 5KCZA 2Q1TA 4AJOA 3CE6A 4CLOB 1KIFA 1LX6A 1JKIA 2Y1GA 2Y67A 3CH6A 3MOIA 3N58A 4XEHA 3C1OA 4YWJA 4N5LA 5TC4A 1GL3A 1A72A 3DAFA 3JD1A 1GADO 3WMWA 2Y0CA 1I3NA 4EGFA 5I7FA 5FYDA 4YAJA 1ENZA 4Q9NA 4B3IA 4KUHA 5KJCA 3DWFA 3EHEA 3WGYA 3RJ5A 3ICCA 4NR0A 3NDJA 4R41A 4XD2A 1B3RA 1GU7A 2OO5A 1D8AA 4QECA 5I9MA 4ND2A 4JGBA 1F8GA 3RBZA 1A9ZA 2Y1OA 4NDNE 3LT1A 3AUUA 3JQ9C 2VZ9A 1W8DA 5EJ2A 1FF9A 1VJTA 3GF4A 3NYWA 3OBBA 5JMPA 5KIAA 5ES3A 3HB4X 5GY7A 1WMAA 1GTMA 1AXGA 2JFFA 3WNQA 1HTBA 3KYCB 4CMCA 3GAFA 3PP8A 4FFLA 3WYCA 2GERA 5MDHA 3ZN2A 3AK4A 1DB3A 2OBNA 1PJQA 5JAMA 1U4SA 2PH5A 3BHMA 4JBIA 3GGGA 8LDHA 3WBFA 5IXYA 5L4NA 1ZSYA 3GMDA 3SC6A 2CUKA 1HXHA 1V3VA 4J1TA 3JQBA 2PNFA 5ICMA 4WLVA 1PS0A 5CPBA 3IDSA 2CNBA 4GVXA 1V6AA 4TVBA 4MVJG 2YV3A 5KTKA 1GUFA 2IXAA 4H16A 4D43A 3H9QA 4PLGA 4K6FA 2TMDA 2VYVD 3PWZA 1VJ1A 2I67A 4DBZA 1HE5A 4LMPA 1M67A 4K9DA 3ZU3A 5IDWA 1T2CA 4IUYA 1M6WA 3FCOA 5L9AA 4PG7A 2Z95A 2C5EA 1XIVA 3LSYA 2O3TA 3WYEA 5TX7A 1M2WA 1U3TA 4LW8A 3LT4A 3FBGA 3WR5A 2X5KO 3QHAA 1HDYA 4II2A 1EUZA 1SB8A 2QYTA 3Q11A 3A1NA 5CHEA 1R66A 3GGPA 4E2ZA 1O95A 4G65A 4CL3A 2SCUA 4DPMA 4LSWA 1XU7A 1ZEMA 2VT3A 3RUHA 2GLXA 1HE2A 4XQ9A 4FFNA 3U5TA 4AJNA 4J9VA 3FTPA 2HO5A 4UUPA 4GGOA 2W2LA 4Q3AA 4MKZA 4MPDA 2HMUA 1V3TA 1TT5B 4E2WA 1I33A 4DTIA 2YHIA 1TB4A 3V1TC 3NEPX 3OIDA 2UDPA 1LEHA 3I1JA 2WYWA 1PL7A 3AUSA 2JAPA 5LCXA 5A06A 1LRKA 1Y5MA 4S3MA 2YDYA 4J49A 5CP8A 3FNEA 3DBLA 4DA9A 2GZ3A 1PGJA 2B5WA 2HK9A 4M49A 1NAHA 1Q0QA 2NQTA 1Y9AA 4OKNA 1H9AA 1F14A 1VM6A 1QLHA 5DBGA 1XELA 4CQMA 5BSHA 2NTNA 3W4KA 3K31A 1WDMA 1ADFA 1IZ0A 4FFMA 2VUSA 4XGNA 2PV7A 3BIOA 4K28A 4MVJF 3UH1A 4E2YA 1T4BA 3CPSA 2AG8A 4KDFA 1ISGA 2HLPA 4NIMA 2QW8A 4BO6A 2YUTA 3OJEA 3OJFA 2RH8A 2EGGA 4H15A 4DYVA 2PZKA 4OIMA 2ZJ1A 1NPTO 1YL7A 2XOXA 3MJVA 3EK2A 4RLHA 3UN1A 2RBEA 1NQTA 4OOEA 4Y6SA 4W4TA 4CM3A 3E5RA 2P5UA 4JJIA 4N54A 3TN7A 1SC6A 1BVRA 5L4SA 1ZK2A 4E31A 4BVAA 4MP6A 5JYEA 3NTRA 4BNLA 1ZCJA 1E77A 2G0TA 2DTXA 2GD1O 3WWZA 4NFSA 2FOIA 2QZ9A 4ZJUA 1H6AA 2IEBA 2VNSA 1UZNA 4IJWA 3ZW9A 5DT9A 3AI3A 4NHEA 4YAIA 5IZ4A 1XQ6A 4EZBA 1PGPA 2I5PO 3DOJA 4HFMA 2GN4A 3ONDA 1T1SA 2C07A 3AFMA 3TZCA 3FHLA 1LDBA 3O38A 4DWVA 1U5CA 4NJMB 5I9LA 2QQ5A 1WDLA 3HJAA 1WDKA 4B8WA 2X5OA 1EK6A 3PGJA 4CR7A 1RM3A 4FJ1A 2G17A 1U2GA 3ICPA 5H81A 2NU8A 1WZIA 3Q9UA 2AQ8A 2ZB8A 3DZBA 3DAGA 4L8VA 2D4AA 4WASA 4CODB 1JWBB 3OICA 4E32A 4WCFA 1T1RA 4DC1A 2VHYA 5AXBA 4F3YA 2BRUA 1ZZEA 4GPD1 3ZWYA 3FWNA 3PXXA 4NBWA 2VYNA 1OMOA 3PI7A 2B5VA 2I66A 2IXBA 3TFOA 2YHIB 1NVMB 3JQFA 2PZLA 5IFLA 3WOHA 1KBZA 3OA0A 7ADHA 4U8GA 3DOCA 4ZQBA 5KNLA 1NBOA 4YRAA 4CMHA 4Q3NA 1IHYA 2VHXA 5F5NA 2CMDA 3ZWBA 4JIGA 1QORA 1LSOA 4ILKA 4HUJA 4F6LA 3KBOA 5MGBA 4J3FA 4EYEA 1IL0A 3ULKA 1PEDA 4CUKA 2D59A 1R0KA 2PGLA 4HXYA 4DQXA 4BKUA 4IXTA 2BI7A 3PYMA 5DN9A 3BHIA 5CAEA 1SO8A 3I83A 4CMAA 4ALLA 1X15A 1ZSVA 1KVRA 1GV0A 1XA0A 4J1QA 5DBIA 4HWKA 3LK7A 4IDFA 5GMOA 4WOJA 3RJ9A 5KKAA 1R12A 2I3GA 1JU9A 1YBVA 1HYHA 4GI2A 4OJNA 5DP2A 5HS4A 2Q4EA 2O23A 3MCVA 4U6QA 2OMEA 1PU2A 2HMSA 2C59A 1A27A 3PJDA 2DT5A 4IZHA 3VPFA 1YXMA 2VZ0A 2A35A 1IE3A 1GFSA 1ZNQO 2Q45A 5B4VA 4IMRA 4P4NA 3IJRA 2Y0DA 2W2LD 1DRVA 3GG2A 4RPLA 2X8LA 3JYOA 4YXFA 3IP1A 4HNGA 1D3AA 4AJHA 4HFJA 5ITWA 4YJDA 1P9LA 3GFBA 4RZHA 2PH3A 3UXYA 4JXKA 4LN1A 4R4JA 2D2IA 5K6AC 3JD2A 4EUFA 5TIIA 1EDZA 4BHTA 2DFDA 4B4OA 4YJFB 5THQA 3GN2A 3FR8A 2EHDA 4ALJA 3GPIA 4J91A 3D3WA 4H7PA 1FDVA 1K6IA 3T4EA 4CQMD 3JD4A 3WGQA 3NUGA 4NI5A 4CV3A 2AW5A 4FCCA 4R1TA 1AHHA 1GY8A 3U9LA 5T8KA 2PY6A 4XRRA 2D5CA 3UF0A 3DMTC 2X1HA 4XQCA 4IM7A 1MLDA 1U3VA 2GZ1A 1EE9A 2VTDA 1YRLA 2C29D 1ADBA 3UUWA 3WJAA 1E1NA 2DPHA 1BDMA 2RAFA 4P8RA 5L53A 2OFPA 2OHXA 4RQTA 4GMGA 3ADPA 2HRBA 3F4BA 2I6TA 1GUZA 1KEPA 1T2DA 1UDCA 3KRTA 5TT1A 2EP5A 3W8DA 3WJ7A 4DRYA 1E6EA 3ROKA 4PRKA 1E5QA 4GH5A 1U2DA 4IDGA 3RUEA 1AXEA 1T26A 1GDHA 4IPTA 1I36A 1YH3A 1YQDA 4OMUA 4AJLA 5HS6A 5JY1A 4LRTB 4Y9DA 4JROA 2PA3A 3RSHA 5C7IO 1UXGA 2BLLA 5G0SA 5A9SA 1IULA 2NU9A 4OL9A 3AOEA 3JYQA 3S2GA 1JLLA 2CD9A 1C1XA 3QVXA 1NFRA 3OHSX 1MC5A 3BTUA 2W2KA 4WNCA 3SBOA 4W82A 1IOLA 3GVCA 3P7MA 2WDZA 3H2SA 1NVTA 1VPDA 2RH4A 2JCXA 3PHLA 4IDCA 4J7UA 1DJQA 3I4CA 1PJ3A 1XGKA 4NBRA 1NQOA 1UXJA 3BMCA 2EKQA 2GGSA 2X5JO 2VTEA 3ST7A 1BG6A 1DC3A 3NRCA 1YL6A 4Z9FA 5THKA 5AXDA 4IDEA 3ZV5A 1DHTA 3ASUA 2VYND 1R0LA 3WDSA 2V6FA 3ONEA 3R6DA 5ILOA 1U1IA 3DL2A 1GYPA 5ER9A 4WJZA 1QYWA 4YAKA 3KUXA 4CMJA 5A02A 2NV6A 4RLSA 1GEGA 2HJSA 3WG9A 3JV7A 4Y98A 4P4LA 3U4HA 3TDKA 1P31A 1EBFA 3UKOA 2J3KA 4M89A 4PIVA 9LDBA 3GUYA 4WOKA 1O5IA 3BMNA 4YVFA 2QG4A 2J5QA 4AJEA 3I52A 5CPFA 3ZNOA 1GCOA 3HFGA 4DPLA 5LDGA 3VH1A 1DEHA 4GVLA 1HE4A 4XB1A 3GDGA 3WMXA 3NAQA 3ZNQA 4CLXA 1O9BA 2BGKA 4D3DA 3ASVA 3PWSA 3L6OO 1VSUA 2DAPA 4EEZA 1C0LA 2AHRA 5EQFA 4BOYA 1EQUA 1QYVA 2HJRA 1EVZA 2ZYAA 2P91A 2Q99A 2DBVO 1PJLA 4B7UA 3NGLA 4B3HA 5C37A 4MVJI 4HADA 5A9SB 3CEAA 5BNFA 5A4DA 3CZRA 3RBXA 1C1XB 4TRRA 1KETA 2IYOA 3O03A 3ZCXA 4A10A 3VPSA 5IDQA 3ITDA 3O4RA 3B20A 4CUZA 3CMMA 3JQ7A 1ZIDA 2NVUA 2PKQO 1E7SA 3IIEA 1Q7CA 1QR6A 2WE8A 3F4LA 5FWNA 2ZCVA 2EV9A 3BMCB 2ZIZA 4DQUA 2ZQZA 3OF2A 2YQ5A 3P2YA 4UEJA 2DQ4A 1X0XA 5JDIC 1MB4A 3ZHZA 5CG1A 3VZPA 1IYZA 3Q6IA 3H5RA 4HP8A 3GNSA 3INRA 5IJZA 5KVCA 4FW8A 4TRNA 3PQDA 4FS3A 3V8BA 1DLIA 1YQXA 4JJGA 4IIUA 4I5FA 3DEYX 3RCBA 2GPTA 1F0YA 4IS2A 1S6YA 2UUOA 2DBZA 1RYDA 4R3WA 1LQTA 5J23A 3PQEA 4NK4A 1QV7A 1YBMA 2X22A 4BV9A 1Y1PA 4PZEA 1MG0A 4FB5A 3E82A 3DAPA 3GVHA 3BMNB 4YB8A 3RUFA 1HDXA 4LVCA 1QXSA 1P33A 1PIWA 1PWXA 5A9TA 3ENNA 5AYVA 1PL8A 2JFHA 3DBHA 3H5AA 3VH2A 5HRUA 3F3SA 1DRWA 1E3JA 1T2EA 1U8FO 2X0IA 2VYVA 3L0DA 3ZWAA 5GZ3A 2O3RA 3STHA 3G17A 3C1TA 1NNUA 1F17A 4FGWA 5CFZA 5JCXA 2EW8A 4J4HA 1OZAA 3LF2A 4OGWA 1UAYA 3VDRA 1ZK1A 1AUPA 2NSDA 4GGPA 2HCTA 3HSKA 1Y8RA 3O8QB 4PLYA 3SLKA 3AUAA 3RROA 3ZWPA 5IXSA 4IJUA 2D5AA 5TJHA 3NDIA 4W9NA 1HWYA 3A4VA 1LJ8A 5COAA 1HSZA 2XXJA 3UCXA 4I5GA 3JQ8A 3EYWA 1HZZA 1TVEA 4I9HA 3DB2A 4ND3A 3JQ7B 3RUIA 4B7XA 2NVUB 1YJQA 2NU7A 3CKYA 2C54A 4WLUA 1PZGA 3VPGA 3VTZA 3INGA 1P44A 3D4NA 3QWFA 3S2IA 2O3JA 4CQLA 5TJ9A 4B4UA 3BZUA 3LC1O 3A28A 2PLAA 3GC6A 3KO8A 5L40A 3WYBA 3JQBC 5TT0A 4O59O 1HRDA 2JD2A 3G79A 3ZH2A 4M55A 1K5HA 2YHUA 3K9QO 4M54A 1C1DA 3GNQA 1LXCA 1K3TA 1NASA 2DTDA 5AXAA 1KOLA 1A5ZA 1EVIA 4ZRNA 4YTEA 5CDGA 2HMTA 4YJGA 2JHGA 2DU8A 2O3QA 4J7CA 3IKTA 3VAZA 3Q9NA 1Z74A 3UAGA 3VHRA 3HB5X 1BXZA 1SZJG 5ENVA 1OI7A 1PS8A 1R15A 3DTYA 1GAEO 1LQUA 2QRLA 2IEDA 5C5IA 2DC1A 3UHAA 1WMBA 3TF5A 1I2CA 3LLVA 2R00A 3H65A 3FD8A 2CDAA 3COSA 4YT4A 3QE3A 1NXQA 2OOSA 4KP7A 4JQCA 4QO7A 5EN4A 2O7SA 3WICA 4PZDA 1KY5A 4CLHA 4E5NA 4E30A 1BXKA 1UAGA 5A3JA 1BXGA 1VL0A 1VL8A 5JXWA 1RM5A 1ZK4A 2VWQA 3I9LA 2QRKA 5ER6A 2VRBA 4Q3BA 3PHJA 5JC1A 3AM4A 2AQKA 3DBHB 5AQ1A 1UDBA 4WGGA 4RVDA 4CMIA 1M76A 1MFPA 4XKJA 1PJTA 4FGSA 4L4XA 3KVOA 2EF1A 4MP8A 4TRJA 4FJ2A 1U7TA 4XYBA 4PLFA 5A3VA 4QXMA 3X2EA 4PLZA 3HADA 3DZHA 4WEOA 3D64A 1ISJA 4BNHA 3F1LA 1EQ2A 2POQX 1TA4A 3C8MA 3T4XA 4N7RA 5IAAA 3GGOA 2C0CA 4F45A 2DBQA 5C7OO 4UVIA 1MUUA 4D46A 4MVJA 3ZGYA 2PWZA 3OQ6A 5DCWA 2XF8A 3BAZA 2GASA 3PHHA 3R1IA 1GYRA 4JP2A 2FR0A 4CLRA 1YBAA 2IZ1A 1T2FA 4UUNA 2IRWA 2HDHA 5HTOA 2QHXA 5CDUA 3U0BA 3PYXA 1QG6A 2QZZA 1KVUA 1ONOA 1YL5A 4NU5A 3GOHA 3TPCA 4CMEA 4MP3A 5H82A 1N92A 1IY8A 2C5AA 1LDGA 1PS9A 3L07A 4FC7A 3ZHYA 4NBVA 1VKOA 1E7YA 1EEHA 2OP0A 5IN4A 5DP1A 2BGMA 4CMKA 3I9JA 1K6XA 4ND4A 3VTFA 1LSSA 1HLPA 1FJHA 4I1IA 1MG5A 3H9JA 3QVTA 3PZBA 1U5AA 4CQLB 4Q3CA 1DIHA 4FBGA 2Q1UA 4NU6A 4CPDA 4ZQGA 4R69A 2NUAA 4AFNA 5JLAA 2E49A 3ZWNA 1KC3A 2C7VA 3FI9A 4IGFA 5KWEA 1C1DB 2EKPA 2J6IA 1GV1A 3HG7A 3QVOA 3H7AA 2XAAA 4I9NA 3EW7A 2O50A 4YJGB 1OAAA 5EINA 4ALKA 5G0VA 3DFZA 2LDXA 5L95A 1Y5RA 2JAHA 4TROA 1VLLA 4TRMA 1EUCA 4TWRA 2B83A 2I76A 1FDSA 3L6EA 4OM8A 3H9GA 4GSKA 1UDAA 3AY3A 1D1SA 2G82A 3I9OA 3LQFA 2Y99A 4J2HA 5HBRA 2X9NA 1DIAA 5FI3A 2P4HX 4Q3DA 3B6ZA 1HE3A 1Q7GA 1XDWA 1YOVA 1ZFNA 1VRWA 2RCYA 3GQVA 4UVEA 3GA0A 5COQA 4HY3A 4ZN6A 3RKRA 4R3NA 4ROSA 4M87A 2PTGA 1HT0A 2E6UX 4RPJA 4N5MA 4UUMA 4BO1A 2NVBA 3K96A 3D5TA 4RDIA 4WCFC 4CMIB 4PN3A 1UXHA 4HFNA 3WGHA 3OFSA 2VWPA 4NBTA 4UAGA 4CV1A 1C0KA 3NDRA 1U9JA 4BB6A 2PD3A 4XR9A 3TZKA 2HMWA 3N74A 4R9SA 2AEMA 4BNUA 3L9XA 1P74A 1MA0A 3VH4A 4NPCA 1JKFA 2ZTMA 2LDBA 5G0TA 3DC2A 3GNTA 4YAEA 3DQPA 5KJ1A 1U3UA 1XLTA 4XB2A 1L7DA 3E18A 1UP7A 1JAYA 1E7WA 2WSBA 3GPDG 3QRWA 1FDUA 3DOOA 2G76A 3P2OA 2Y68A 3L4SO 1SNYA 2DVMA 1R37A 3OEWA 3LT0A 3ORFA 3OJ0A 4DMMA 1K6JA 3BTSA 1T2AA 3SXPA 4HV4A 1BSVA 3GVPA 1X14A 3DXFA 4MIOA 2O48X 4J0EA 3EZLA 4DL9A 2HQ1A 3GDOA 5G0UA 4PG6A 5GZ6A 2CVQA 1QSGA 1PWZA 1LSUA 3V1YA 3RI3A 3A06A 1HF3A 3FRJA 3CTVA 5DCUA 4G2NA 2CDCA 1ZJZA 3LF1A 4OO3A 4CMGA 4UVDA 4Z0TA 1MGOA 2AQIA 3DHYA 2C7GA 1WPQA 4RORA 1E3WA 3WGGA 3WNVA 4YACA 2NVWA 4PRLA 4TKMA 2Q4BA 5F1OA 4ID9A 2B36A 2PFGA 3O9ZA 1DAOA 3DHEA 4R54A 3PJFA 3W8EA 3CIFA 4XYLA 1LLCA 2J5KA 3KLMX 4AG3A 1P0FA 3LVFO 3L6DA 4MVJD 1Y8QA 3AU8A 1JVBA 1A7KA 1LI4A 3N7UA 2FN7A 1LLQA 3KYDA 4II3A 1YOVB 4B79A 4KWHA 2O3UA 1H2HA 2GN8A 4BO0A 3OJLA 3F9IA 1HEUA 2YV2A 4B4VA 2VOEA 4YPOA 4XGIA 4EJMA 2QIOA 2Q1SA 1YDEA 1YGYA 2P9GA 4GWGA 4YR9A 1N8KA 1OFGA 4E12A 1XQ1A 1GZ3A 3NKLA 4KOAA 2Q50A 5T8KC 3MJCA 4WLOA 2B4TO 2CFCA 2I65A 4J1SA 3NGXA 1ML3A 5L3ZA 1KEVA 4OSPA 3RUCA 3F5SA 3UOGA 3VKVA 5A03A 4BO4A 4OHUA 1WWKA 4RVFA 3I9KA 5DDIP 1WZEA 1I8TA 5B37A 1UZMA 1EFLA 1E1KA 4CR8A 3DBLB 1HDRA 3FF4A 4A03A 4XYEA 3I9MA 5EMHA 4E0BA 1E1MA 1GZ4A 3G49A 3TNLA 2NQ8A 2D0IA 4NZ9A 1TI7A 1A71A 4LRSB 3TZQA 2CVZA 1NTOA 4CQMB 1U3WA 5JYDA 1P1JA 1XKQA 2V6GA 3KEOA 2IZ0A 3VZQA 4D0SA 4YDRA 4BNNA 5DOZA 5U9CA 1B8VA 3DDNA 4E5KA 2Q2QA 4I5DA 3AOEC 1B2LA 4CLDA 1NM5A 2BELA 3D5QA 4L4RA 4EITA 1I2ZA 5KVSA 4RF2A 3OA2A 1PSDA 3DZKA 2X58A 4GX1A 4UVHA 1O94A 4DUPA 4MIEA 1V8BA 2NADA 3ITKA 3GT0A 4RO0A 3U3XA 4JX8A 5BSFA 4RQUA 2VN8A 5JO9A 3WXBA 1J6UA 1LU9A 4XWYA 1LLUA 2JD0A 4ZU3A 4ESOA 5CDSA 3B70A 4OQYA 1CJCA 3WFIA 1DC6A 5F1KA 1SOVA 2HK7A 2E82A 1ZXBA 3OEYA 1NPYA 1FMCA 2OZPA 5IZCC 3PIDA 4L73A 2X23A 5IN5A 1W73A 2P2SA 1QV6A 1Y8QB 4D3FA 4OQZA 4RVHA 4WKGA 3S55A 1I30A 4MVJH 1U8XX 1B26A 3K5PA 3KYDB 4MIYA 5I8WA 1BWSA 3EY4A 1LRJA 3EMKA 1W0CA 1YB1A 3NV9A 2JHFA 4I8XA 5GZ1A 3FBTA 5K9ZA 3OQBA 4H3VA 4WCFB 1N9GA 2BI8A 5T57A 4XIJA 3MOGA 1M75A 3WLFA 2Y66A 5JPIA 3H9EO 5ILGA 2I3AA 3RU9A 4IXWA 4R9RA 3IS3A 4OYRA 1E92A 1A4IA 2EP7A 5JY6A 1ZW1A 5A5FA 3D0OA 4QSMA 2ZCUA 4PFJA 3OIGA 2FPGA 2V65A 4BNTA 3ENKA 3F1KA 3PK0A 4QQRA 4BMVA 3M2TA 3WIEA 1R4MA 4BO5A 1X1TA 2UUPA 4D45A
chains in the Genus database with same CATH superfamily
5CFNA 4WDQA 3IJPA 1NZDA 1TJNA 4PZYA 4Z86A 1E1RD 3ACBA 5C35A 3QVJA 3NUQA 5BYJA 5BRNA 4D1YA 1E4VA 3RS3A 3X2FA 1AMOA 3R6LA 4X54A 1H8ED 4Y7DA 5C81A 4IUDS 4PVDA 5BSKA 4OB7A 4POAA 3ZQ4A 1GSAA 5ALRA 2FZLA 2HWKA 3P9SA 1QYDA 5IM5A 1SKYE 1KI6A 3CNQS 4O29A 5GOZA 3TL3A 5K45A 2A88A 4TSFA 2X4GA 3USES 1T4CA 4BO9A 5MFZA 4EMSA 2O3SA 3OZAA 4B80A 1F3LA 4N39A 3SBEA 4C7JA 1V11A 4QDZA 1HFKA 3TD6A 3KWMA 3H2GA 1XF9A 3U7FB 3ABRB 1T9KA 4TS1A 1SG6A 1GTVA 1YQ9A 3R0ZA 1IXZA 1KYVA 1W4AA 16PKA 3DE3X 4QO8A 4CCYA 3ZJUA 4OHFA 2WPNA 3BICA 2AOUB 4NK5A 2A94A 4G24A 3ZD9A 3AM3A 2L0XA 4V1CA 1H6DA 3D8SA 4FR0A 3MJEA 1SIUA 1JEEA 5CBPA 1GCAA 3EYAA 3WIUA 2HU7A 2ASVA 4ZRDA 4YCAA 3GUCA 3T5MA 1YZHA 3ONNA 1VXOA 4BGUA 5LUAA 3KV1A 4S12A 4UXHA 4H31A 4OIFA 3MGAA 3HEAA 1NVFA 1MPXA 4ZODA 5HJ2A 3VPHA 3HMQA 1KY2A 3HXTA 5TRTA 3WRVA 3FYTA 4X64B 5D3ZA 4CT4B 2I4IA 2YOFA 4IR7A 4KN6A 1YFKA 2ACVA 2NTJA 4WN9B 1ARZA 3FLMA 3SZRA 2CDNA 1TPZA 4MYHA 3EC2A 2YC2C 2XUQA 4RF4A 5CGQB 1BKDR 2JASA 4GMFA 4XZ3A 1PDWA 5IBCA 3CRNA 5DGXA 4E5MA 3UJ8A 4ENTA 5B6IA 4JKYA 2IKSA 4P5EA 3PHBE 4M1MA 1GSOA 2H2AA 2C5GA 3CH5A 4G26A 5GONA 1NHGA 3LA6A 4QAQA 3D3WB 1K27A 1NHWA 3RVDA 3HK2A 5IC5A 3B1JA 2HA5A 3QPVA 3WQSB 1IBLB 1M2JA 3DZIA 4HPWA 4ND7A 4RA6B 4W1SA 3TTVA 1UF9A 4HAXA 4XSVA 1JFFA 5BSWA 1HYGA 2IV2X 2O7NA 1SQSA 4C7MA 3N8NA 1G8FA 2W2PA 3JATB 4W9RA 3BQNB 4QU9A 3UMBA 1I3KA 3ZYZA 521PA 4CUJA 3PFWO 2UVPA 1IOVA 1DX4A 1GQ2A 3OQ1A 4LDZA 4C87A 5AUOB 5FEMA 3QV2A 1FRVA 1QQAA 5FDFA 3FYUA 2FFHA 1CY6A 3HB9A 4BKOA 4F2DA 1N32B 2BGJA 3R5HA 2WKPA 1XXLA 5GJWC 1T8UA 4X93A 3V2IA 1C50A 2FPSA 4KIWA 4PBTA 5DM1A 3EEOA 2BGIA 5KQRA 5M5BA 1QVAA 3U0VA 5KB3A 3UJNA 1WMSA 3EUWA 4LCEA 2ZAOA 4M9QA 3F46A 3KVNA 2PUCA 4JJAA 2X8BA 1TTQB 1LLFA 4A23A 2DJIA 1BVHA 1T8RA 1E3SA 2NACA 2VK1A 2IC5A 1HH4A 1NVBA 1Z0SA 1OSNA 1DJNA 1OQAA 1PR9A 4BFWA 3E61A 2B8TA 2EZ9A 3IQIX 4Z2AA 3K4HA 1G21B 1E3TA 4JODA 3RC2A 2OCIA 2BKVA 2JBAB 2G8LA 3EDCA 4LNAA 4MMYB 4CNBA 4Z3OA 4WCDA 1VJCA 1X1EA 2Y1EA 5FF9A 4W9NC 1E1YA 3UQZA 4FE3A 3P94A 4YCDA 5T3UA 4GLOA 1YA4A 1JLLB 1KAOA 1Q11A 1RAAA 1GAJA 4KQHA 4CL2A 4LWZA 1KI2A 7MDHA 4HWGA 3N0RA 3AM5A 4E1VA 5GTDA 4F6CA 2EZTA 1X7ZB 4V02A 3JR7A 1IZYA 4DDHA 4YS6A 1J8YF 1KJNA 2Q3JA 3GH1A 3CZQA 4NL4H 2ZB3A 2IPAB 1DMSA 2I0FA 1F5NA 4WSOA 1G55A 1N5RA 1H85A 3KC2A 2KBEA 3LPLA 4LY0A 4O2AA 5EWJA 1EB9A 5IBRA 3I6ZA 3PQCA 3RK4A 1E3MA 3PZRA 3PJEA 4P82A 3I2HA 3ZI4A 2QL5A 3CX4A 2H1IA 2H4YA 2AF4C 2Q5QA 3II6X 3LKVA 4I1RA 4U39A 1OFTA 5E6SB 4Z9YA 3KEFA 1E4EB 1MQAA 2I71A 4UU7A 3T15A 3T3GA 4DTCA 1REQA 3WV4A 4K8RB 1K89A 4Y8VA 2BKAA 3V80A 4AJPA 2I8LA 1PJBA 3GHHA 1ZOIA 3MJSA 4QELA 2AXQA 2ZG6A 5JAZA 2QI9F 4CI9A 4RIIA 4AZ0B 2JARA 3NHAA 1EZ1A 1YVPA 1DFGA 1Z6ZA 4R2HA 1ZINA 3FY4A 3QSYA 3UG7A 1G1MA 2HWXA 3G8CA 4L4ZA 4U7HA 1EWVA 4IWNA 1IN7A 3K1AA 1PJ2A 4BQFA 1SXJC 2F1KA 4RGVA 2WHYA 1Q1NA 3VHRA 4P35A 5C1OA 3CNHA 3L1JA 2LKCA 2A30A 3LQ1A 2MYTA 1XRNA 3MQ4A 4FVTA 4NBUA 5DYGA 2DYKA 1D8TA 1FSZA 2JIPA 1IATA 1MV5A 1UEIA 1TMYA 3H19A 3VC2A 2TMGA 4I2VA 4BYMA 3W9BA 2E4ZA 3A4LA 3IIMA 1KYIA 1LZKA 4H1HA 4NECA 2YICA 4L4YA 3H2JA 3EAFA 1XJWA 1EGAA 2R00C 3CZAA 4D6XA 3A1VA 1E5XA 1XMVA 2PDAA 4MVJE 2H59A 3G5MA 1YJCA 2XAUA 3ED5A 3KM0A 5TQ2A 4PO9A 2B94A 1B0AA 2W6OA 5EIOA 4QGGA 2IX9A 4P4GA 3IYLW 1PDVA 2PBRA 3F3YA 3I62A 5I8PA 1U11A 5DTJA 1JQBA 2AUNA 1ZG3A 2C9CA 2QKYA 2Z1NA 3L7KA 4JY7A 4MMXB 4TSFD 5CNJA 5DOVA 4FYPA 4JJ4A 3HJRA 3DCIA 5LQSA 3SOPA 3GEIA 4J1NA 4LZLA 4N3CA 1SCUA 3KR0A 1AC5A 5E0OA 4WFQA 3N6RA 3VU0A 3ZJ5A 1IK6A 2Q5EA 3RVMA 4MVJP 2IZZA 1MRSA 3PUJA 1JIJA 4DNQA 4G36A 4B3JA 1E3EA 3QELB 4FFDA 3IHWA 4LS3A 3C24A 3DLCA 2SBTA 4B8YA 2RHRA 1NULA 4OXIA 4BGVA 2VAMA 1NQ5A 1NI4B 4MVCA 4DKJA 1HOXA 1OREA 3OETA 2CLFB 4Q7JB 5CLQA 3EQ6A 2PWPA 4RZUA 4TKVB 4F46A 4E7PA 2UXCB 1QRAA 2B1RA 2F43B 2OV8A 2VLBA 2BBOA 4PLWA 1ZGHA 4GW3A 3RIMA 3WIBA 4BX3A 4NF2A 4J7AA 2PT5A 4QYMA 4X63A 2O0JA 4OJMX 5ELXA 3AR6A 1J1IA 2ETVA 3V7WA 4BUCA 3ZHCA 4N01A 4R8RA 5IDXA 2DR2A 3C3PA 4U6SA 4HQRA 3EC7A 3AFNA 9LDTA 5ALGA 4FPXA 2ZRBA 2ZRKA 3A1UA 4F21A 3QOYA 4MYDA 2Q5HA 4OMCA 4HTAA 4GYJA 4OGGA 4HYTA 1MC4A 2QTFA 1ZN7A 3EXHA 3LPAA 3QOXA 1NWHA 4MR7A 2ZRFA 1QHFA 2X7HA 4MQEB 2CSUA 2UZ1B 2K87A 1Q1QA 4A15A 4TYYA 1RRVA 3GLTA 4YRLA 4BUZA 5J47A 5JFOA 4GICA 4DN6A 2WU4A 4PX9A 3GLUA 3ZWCA 4QNRA 4RELA 4F7DA 1B15A 2FKNA 2RB5A 3EXFA 2OENG 3DEAA 2N46A 1DKPA 3IELA 4Y0NA 2FFRA 1WM1A 3NHWA 1G42A 3SYKA 5AKIA 1UT8A 3L92A 1DTSA 4ZI3A 1NW6A 3K6JA 3A1WA 2QOEA 5TF4A 1H4VB 3ORHA 4QG3A 2F1IA 4MRMB 3IV6A 2HRZA 2I3ZA 4FWTA 3UJDA 4AU1A 4PAQA 5A7HA 1NMYA 1G8PA 2Y6UA 2X6RA 4AY5A 1B4DA 3OZTA 1Q1BA 2Z2XA 3L8EA 1SAYA 1CNMA 3W8FA 3ZDFA 1PZHA 1JDVA 3G3EA 5H16A 3S1LA 1UOEA 4KDRA 1XQVA 5JCOC 3U37A 3BH7A 1Z9BA 2QLLA 1MO4A 1VDZA 3IQDB 3VOTA 4XAQA 3L5OA 2RAVA 4JBGA 4WPGA 1T0UA 1C7RA 5EQDA 4ZJYA 1V7PC 3A3OA 4XYGA 4AF8A 2ODEA 4XDHA 1DSSG 2N3ZA 3L4JA 2HBYA 3O83A 3SHVA 4ZGBA 2C4WA 1ZVKA 1VYTA 1IZ9A 2ZPTX 3EVNA 4IDDA 1KXZA 2P9FA 1H4SA 2VJNA 4JVNA 4WZBB 1DG3A 1TO2E 3R09A 2GEDA 4YYZA 2K2WA 1AF7A 3C98A 4P4TA 3ER6A 4RETA 1HYBA 3AL2A 1QRRA 1SCIA 4HYYA 3BXXA 5EUQB 4GX0A 4H1UA 3WL4A 2ZAYA 4LHEA 3RKSA 4M0UA 2AR0A 2BFDB 3VSAA 2CBGA 5A7FA 2F9MA 5B6JA 4XPIA 5H9WA 2GJKA 4MHOA 4MV5A 1UJ6A 1T2UA 2JZCA 4C05A 5A1TA 1NUHA 2ZZKA 1H22A 7MHTA 1XRMA 3BGDA 2WNSA 3OX1A 4PX5A 5COBA 4CR6A 4RU1A 4MLZA 1NNEA 1RFGE 5M7EA 4GEKA 3PTZA 2HDWA 3S8EA 1WPXA 2A5GA 2KW5A 4KE8A 3W1VA 1T29A 1CY7A 1C9YA 1XKLA 2IIBA 1Q1GA 3B1KA 2ZI3A 3R0JA 1M6VB 1YNOA 3NOVA 5EZYA 3KQNA 4LK2A 5E3JA 3JQRA 1X1QA 4M88A 3LYLA 4HQNA 1XLTC 3ANNA 1GKUB 1OVGA 1ZMOA 3E7WA 3N59A 4ZPXA 3T5CA 1TFUA 1JIIA 2NU6A 4G8DA 5BSMA 2I6SA 1UODA 3JQ8B 1QHIA 1EA5A 1LF5A 2FHSA 4ARUA 2HEIA 1PO7A 2WG0A 4QTXA 4N76A 3VNBA 2Q41A 2JIMA 2GYYA 2XUJA 1M3SA 3GJTA 1HTTA 3RKUA 2NU7B 5JS1A 3S81A 1Y4SA 4LOIA 1T3HA 5BQ3A 4FZRA 2FP4B 1J1UA 3DONA 4UTVA 3AP2A 4U2BA 4R9VA 1D2HA 1NSTA 1J8MF 1Y3IA 1YCFA 3W77A 1RJWA 2R8EA 3RGGA 4N5IX 2VUTA 4OTZA 4G86A 3VNRA 1A4XA 2QX7A 2WLTA 3ZUPA 5AW0A 3GEPA 4MGHA 1IXRC 1JKJB 1NBAA 1YS9A 4S24A 4DLAA 5I3ZA 3QXJA 3I5YA 1JEDA 2JLQA 3RK0A 1KA9H 1ZJYA 2F00A 4ALIA 5EA2A 2D1SA 1GT6A 1QQ7A 3WB0A 4BS9A 3KJQA 2VSFA 1CETA 1W48A 4TM7A 2JLZA 2GN2A 2LNDA 3U3OA 2SNIE 4KR9A 4OHCA 3SS8A 4A8JC 1J0AA 3ROTA 4BNKA 4U0JA 1PUJA 4JYMA 4ZARA 3W9SA 3HDTA 2WZDA 1Z39A 3KB6A 5KHOC 1D2EA 2ZUUA 4BLPA 3MWLA 4PGGA 4EUEA 9GPBA 3VR6A 3T5AA 4DRZA 1IU9A 1FP4A 5CX1A 1SA0A 2ZYWX 1A2BA 3CS3A 3HB7A 3PJRA 1L4EA 3RSGA 2FMUA 2H0AA 3A7EA 5F2KA 5CCBA 2AJ8A 2I33A 2TMYA 2W8ZA 1ESCA 2X3YA 2ZAMA 3HVIA 2VK8A 2YY6A 4I4TA 4GI7A 3WLIA 2VQEB 4OQXA 2E1RA 1NUAA 4EKNB 2XCUA 5KYYA 1THZA 3KNZA 2H5LA 3RRJA 2CCGA 2ORWA 3W9YA 5EJFA 4CM9A 5SICE 4OB8A 4I6GA 4OK5A 5TE9A 3RIGA 4MRAA 3V7YA 1ZKMA 1ZNXA 3G85A 5T6BA 3ZQUA 1E9DA 4LJLA 1PFKA 4K6CA 4KTVE 2IH2A 1OFVA 4D8YA 3L7NA 3LBIA 3RHSA 1WVIA 1B8UA 1EDOA 2C2YA 5F1PA 4Z54A 3KP1A 3EN0A 1V3QE 1GT91 2G28A 4I9UA 4N0MA 1W2GA 2DSTA 3OLQA 4PG4A 4QODA 5EZQA 2C9MA 5KMGA 3WIOA 2MDTA 4DIDA 3FTDA 1M6HA 3WYGA 1KEZA 3DV0B 2XQKA 3IKMB 5F3RA 2OV2A 4INAA 3ZBTA 4KRFA 3ZGOA 1WPGA 1KYWA 4Z4CA 3ZXXA 1BW9B 3ROPA 2X5XA 1YD7A 2BFPA 4ZT7A 4TWAA 1R6XA 1FS5A 2FYTA 1RHRA 2PLRA 1QP8A 3GY0A 1AKWA 3H3JA 3VR5A 4XCXA 4D8WA 3RREA 3RNOA 2KPOA 4PLPA 1UWLA 5CDYA 3KSRA 5HJ7A 3GHYA 3ONWA 4AY4A 5IEJA 1Z36A 4KR0A 3I42A 3X1KA 1YDMA 4P2BA 3PITA 1Z0IA 2ARKA 3LUAA 4DGSA 2X9VA 4DBVO 4IIXA 1JB9A 4YRDA 4OG2A 5K3OA 2AE1A 2LZ0A 2VJAA 4UDOA 1QH1A 1H5UA 3B3QA 4DLSA 5TLSA 1XD2A 4J0JA 4JJKA 5DPMA 4EA9A 1Z82A 1QX3A 1ISFA 3FUCA 1PJSA 3DT9A 3HWWA 3PFBA 5T67A 4B7AA 5JZ9A 2QTHA 5FTJA 1A8IA 5T64A 3ZGZA 2JAUA 1YWGO 4FFSA 5JC8A 2Z9CA 3OI7A 3OT1B 4YRFA 1CDEA 1A7AA 2XWBF 5JHGB 1I4DD 1YFZA 3WGZA 3UY4A 4W8GA 4QYIB 5HQ3A 1XKTA 2A4KA 3LD9A 5DBOA 1GPYA 4ZVVA 3U62A 3V6LA 4R2WA 5A6SA 4M53A 3B9RA 2WDPA 3W3ZB 1EG2A 2ZE8A 3OLYA 5TS3A 3LXXA 2FUG6 3FUUA 1X0VA 3I1YA 4DMLA 4F6RB 1J97A 3TKAA 3CRRA 1QYCA 5EJEA 1ILWA 5L45A 2GZ2A 6GPBA 1J00A 2W90A 4TS4A 5EJ4A 2HJGA 3ZU2A 1XG5A 4PNPA 3PXAA 1ZN8A 4UDYX 3KFXA 3LUDA 5EPUA 4A16A 4TVOA 1MZPA 4LE2A 4EB8A 4D2IA 2VA9A 4PQEA 4W5WA 3E0XA 1UT5A 3REQA 5DASA 5FP0A 4MO2A 2PX2A 4UUOA 4J7XA 3PSAA 1VI6A 1TL7C 5ADVA 4A4DA 3G8BA 4DPKA 1M34A 4ASUA 1S7GA 1WAMA 2QUJA 2WYOA 4IEFB 4FD2A 4ALNA 4DVJA 2IIQA 4ZCQA 4Z6KA 2Y9YA 1QTRA 5M04A 1EX9A 2AOVA 3O8BA 1DFHA 1QOZA 5LXTA 4X1KB 3KSUA 5F51A 4G0WA 1ZIOA 4OLFA 3TTWA 2V54A 4BP9A 5BMVB 1H3FA 2ZIAA 4EMUA 3HR7A 4RW0A 3IAUA 1IDN1 5DTQA 2ZJFA 1H0RA 3UFXA 3P71T 1GPBA 3PDIA 3PNVA 3Q7PA 2ZYIA 3AF5A 3X43A 1QHNA 3DXYA 1WF6A 3LW8A 2XUFA 4BO2A 2CFIA 3PGA1 3RVSA 2OBBA 3NBXX 2FMTA 4IJKA 2XITA 4QUHA 3KZVA 2OORA 3GZ4A 3WQBA 1H0HA 3ETNA 4C1NA 1SUAA 1EKXA 1TM3E 1Z2EA 3PU6A 4EI9A 4MPPA 4YBZA 2JHPA 2H65A 1LBEA 3D4PA 4UFPA 1MFZA 3ZV4A 4N82A 4R2IA 3ZZ1A 3BF8A 3HYTA 2EFEB 3ETCA 1X9IA 2K4MA 3KPJA 4RHTA 1W19A 3JW8A 1OBVA 4PHTA 3WSWA 1G4HA 2B1IA 2PU7A 4EG8A 1M73E 3MWDB 4E2FA 3VR6D 1T8SA 3M81A 3VC7A 1UJNA 4ROTA 5BV8A 3QPCA 2XKJE 5K0SA 5DWQA 2QV7A 1KMHB 2P90A 4GLFA 5K1ZA 1EDEA 621PA 1TC2A 3DS8A 5CT9A 4GNRA 3OWHA 1V3UA 2E5LB 4XIIA 3FNBA 4IQ0A 4KDEA 1OXTA 2C4TA 2HH9A 3TJRA 4AW9A 2OSBA 2O4UX 1UOQA 1K92A 5G0WA 4EJ2A 1I01A 4Z3DA 2IF2A 2GEUA 4YJHA 5A4FS 5DXAA 5LUBA 2GPYA 2OSVA 2V1XA 1RI2A 1VBFA 2VUUA 1H1DA 5CIQA 3WSVA 4FSXA 4CM9D 3MRVA 3SR0A 4IWXA 1WQ1R 1UIMA 1VLQA 2AEEA 4JBNA 2C8JA 1E3WB 2ONKA 3H75A 3KXDA 4QPJC 1XHLA 4BP3A 3CLSC 4ZREA 4TLDA 4LV8B 5E3IA 4ZO9A 3CT6A 2ZI6A 3Q2KA 4M0KA 1SXHA 1N0IA 4A2QA 2RIRA 3N5KA 2OHOA 1FDTA 1LSJA 4UHEA 4C6SA 3C7AA 2FR8A 1CX9B 2ZJZA 4C2TA 1T3GA 4ZQCB 1JZTA 2IL1A 8GPBA 1NPDA 1X8KA 4IMPA 3KQUA 1E20A 2B34A 2C58A 2WNHA 3OCVA 1DV2A 2AZDA 1WA5A 2PFKA 2VDWA 3I37X 2DWQA 4I19A 3S7TA 3SU8A 2ODAA 3VR5D 4BVLA 3HVRA 3G2LA 1T8PA 3EXIA 2D3TA 2FX3A 1RRGA 3L9WA 5IKXA 1A98A 1Z7BA 5CK4A 1YZKA 3LCJA 4TV9B 3WFJA 5B2EA 1NVVQ 4OJKA 4BBZA 2Z5GA 2X42A 2V9ZA 4DAEA 2H1LA 1SCAA 1K4MA 2PWYA 3DH0A 5AJZA 2VBCA 2CVOA 4WZAA 2FY8A 4XJTA 3V4SA 4YV7A 1VLZA 3IILA 2D5LA 3NBMA 1Y0BA 3NTVA 4MWOA 5KWSA 4UBNA 3AI2A 5EHZA 1TU4A 2VSNA 1R9NA 1Z07A 1AO3A 2C5LA 3EZYA 3F5MA 4XASA 2J3DA 1R50A 1N2XA 2YZ2A 4HWTA 5H83A 3RUEA 3W6PA 1WBJB 3AY6A 4NNPA 5L7YA 2PUBA 4PLVA 1QHSA 2JJYA 4HEA6 1V6CA 4ZQEA 4BJ6A 1I4WA 1UMKA 3O9MA 4RABA 5K0JA 4D9KA 2PRJA 5J2TB 2ZIWB 1GN9A 2P30A 4P6VF 5EMNA 5TY0A 1SVMA 1RC0A 1D2AA 3FAKA 4YMGA 4XDZA 1ZGBA 3GEEA 3MXTA 1ACLA 2CYBA 3OLVA 1YB6A 2VQ3A 2XRMA 5D3MB 5FOVA 2CEKA 3QWIA 2NXCA 3RRXA 3HCCA 1N0WA 3ZWOA 1FU8A 2EDCA 2Q3EA 2GXAA 4BMSA 1XYVA 1R4NA 4JVSB 1I4OA 1RADA 2C2WA 3KVYA 1B74A 2ADOA 3G5LA 4GMKA 1OR8A 1X80A 1SVLA 4J9UE 3KD2A 2YYSA 1SOWA 1X1SA 3E5MA 1IQPA 1E5VA 4PO8A 1YK1A 2B9EA 2VP5A 1A9PA 2QQGA 4PLHA 4UD6A 5I8ZA 1V43A 3UB2A 5C8DA 2R11A 2G1PA 3A04A 5KOIA 3B8EA 4ZAFA 3HDJA 1KJYA 1OYVA 3SS7X 3KSBC 2G5CA 2P5YA 4NAHA 2D7CA 2HYDA 2W37A 4RTKA 1H2XA 1SWWA 2IK8A 2RAUA 4X85A 3KXIA 4ASUD 2ZETA 8OHMA 2LKDA 4IF4A 3KKMA 2Z4TA 2PD6A 3RQSA 1IBRA 3L8FA 4RNDB 4LOLA 2PRKA 2IEYA 3GRAA 2O0MA 1SFRA 1N9KA 3BL5A 4HC4A 3AU9A 5DSZA 5BMOA 2IW1A 3C6BA 4KQWA 2W93A 2J67A 3QEMB 4G37A 4HZUA 3EVTA 4IRMA 1EVJA 3RUDA 3UH0A 3W8NA 3HVUA 4LRXA 1K3FA 3IBFA 1JU3A 5T4HA 3WKCA 2ZRPA 1HL3A 2IHJA 2RGNC 1BS9A 4JJFA 5ENDA 4LZAA 4IXNA 4YRBA 5SYAA 1XUOA 3TLEA 3ON5A 2EKDA 3PL1A 1ISHA 5K0BA 4C6RA 4E94A 1K1EA 3AEZA 3R8XA 1POWA 4M1TA 4QREA 2ZB2A 4KWIA 4J0IA 2Z6VA 4RIHA 3D6AA 4HEHA 1DIGA 4R8VA 4G0XA 1KRWA 5ALJA 1ICEA 3HDQA 3OZVA 2YINC 1JJBA 1PTJA 2AJLI 2CWWA 2N75A 3SOZA 3GLIA 1XVAA 2ZJBA 1DOHA 2JLSA 3ERCA 3UXEA 2JH8A 5AKJA 5HZGA 3Q4GA 2HDNB 1P1KA 2ZBVA 4N5DA 5KAMA 4B9AA 3R0IA 5KWVA 2WVHA 5I7SA 4HLUA 4B2PA 1BS2A 2IH4A 2HHHB 3FUTA 3GQBA 4EA8A 1O08A 1LPNA 4IKEA 5AK6A 2Q3BA 3DHVA 4DV1B 1OT5A 2PBZA 2VJMB 1RCUA 2JGFA 1YZ3A 4HFRA 5ALUA 2BGUA 3RFTA 4EL5A 4WADA 4L5AA 5BSGA 1VKZA 1O0BA 3VPBA 2O8CA 5BYKA 5AM4A 2IEZA 3WO1A 1QKKA 2GJSA 2IDJA 3T35A 2XD4A 1V7ZA 4YHHB 3U4QB 3ZZUA 1DT5A 1UFKA 4ZD6A 4RTMA 3QYFA 2DY0A 3KJXA 4PBRA 3FMIA 2H63A 2M6SA 3KKLA 2WWVD 4PG5A 4ARZA 4AYTA 1X7DA 3WB9A 4BAZA 2E55A 1YU9A 5ICSA 4F2HA 3I8SA 2J5BA 3I5MA 1ORHA 3G13A 3K0AA 1W30A 4ZYTA 3LCMA 4MRVA 1XMIA 2CFSA 2WSLA 4PRZA 2XGMA 3WIDA 1HX7A 4P33A 2CNNA 3DKVA 4J76A 3V4OA 1AO0A 2XB2A 4AQDA 3NWPA 2DF8A 3P5BA 5I5EA 4RXMA 3DBRA 4MV8A 1WZUA 4OFZA 1HDCA 2H1OA 1GUAA 3HNPA 3LTNC 1CVIA 3VTKA 3LWZA 4HN2A 4I66A 2JKVA 1ZVMA 5FL3A 4WINA 5C5EA 1DTWB 2FWMX 5A05A 5BN4B 4CF4A 1TE2A 1EDDA 3CV3A 3OZXA 2W43A 2XIJA 4ZAXA 3X1WA 4OP3A 3IUMA 5FJJA 4ZGWA 1ZBDA 5EHNA 3D8BA 2CJYA 1SQ0A 1CWUA 1KAHA 1NXVA 4ENRA 1Y33E 5EJGA 3V8VA 1SUPA 3O8QA 4WWHA 4ODIA 3TTSA 3USCS 5AWFC 2NXEA 721PA 4AVYA 3IAS6 3ZDAA 3ILXA 4Q3EA 4KQMA 3HE3A 3QE0A 5DYYA 4CKWB 1BO6A 2FW9A 4PNHA 3N8DA 1ADJA 1JT9A 4FDLA 4QT0A 3TSYA 5THXA 1ZAYA 4L4SA 1U7HA 3PGLA 3H1TA 1NV9A 2FPPB 4RIGA 5ES4B 3U7RA 2BKUA 2WF5A 3WGOA 4RX1A 4C0QC 1YRWA 3ET4A 1Z45A 1KDZA 1VGQA 1IRIA 1N5KA 1W5BA 2VT6A 3P5SA 4KGDA 5FO1A 3ZNNA 3JASA 3W90A 3TSWA 1JTVA 3JCZA 3DHWC 2KYRA 1DXHA 1E7QA 4UAUA 2ZXFA 2NTEA 1OASA 2V3VA 3DYIA 4NEHB 5FPTA 5KQSA 4J6FA 1EWYA 5E0KB 2UAGA 2V03A 3RIHA 3PUHA 3CTMA 1T4MA 4CCWA 3V1MA 1Z7WA 2DERA 2OHIA 3IOYA 3ZOKA 1MR3F 4GBGA 4QOFA 1JWAB 1V8OA 2B99A 3C3WA 3GLFA 3KLNA 3G0OA 3NAGA 4R1SA 3STVA 3W2IA 1GSHA 2HV9A 1W4ZA 1BRMA 2F3QA 1N3IA 4AKEA 5B30A 2R1TB 2J9YB 2PYZA 4HYEA 1MX3A 2AFHA 3JWEA 4UREA 4EY3A 2QBYA 2E4AA 1GG5A 4XLLA 2IODA 4BO3A 1G8GA 2PWBA 4ESHA 1JMKC 1U9IC 1SBNE 2I34A 5LQDA 3GRZA 3UATA 4A8HA 1ZC3A 2NUPA 4ZI2A 4D8TA 5HYVA 4MV1A 2ZCJA 1P80A 5FTWA 4I14A 2NSHA 1K2VN 4ND5A 1E1DA 3CLRC 2XCTB 1EFPA 1JIUA 1S01A 2IOYA 3FUXA 1FRQA 1R2QA 3GRVA 3KG2A 5TPWA 2AC2A 2C9BA 4EARA 1LBQA 3P4YA 3T3IA 5U1PA 4A1OA 4CMBA 3FDZA 2AUTA 2BHLA 4ZMBA 2NAPA 1W1UA 2QQFA 3BFJA 5F7JA 3WL3A 3ANXA 4IQ4A 3AEUB 4KCGA 3T1VA 4B3CA 1NBWB 2QTBA 4L72A 4YJ3B 2P68A 3RLIA 4KQ6A 1X1DA 3NU1A 4J0GA 5IS2A 2J30A 4BMXA 1OTHA 1YE3A 1NBME 2YASA 2JIDA 2XTZA 3DULA 3T7RA 1TUBA 3ZZ0A 1KSJA 5CYGA 3L05A 2YMMA 1ESMA 3D6HA 4F12A 1WHTB 4RZ2A 4YRNA 5JECA 4W1PA 5KCMA 1E99A 4FCWA 3BMQB 1AU9A 2W2XA 4BZPA 1Z7EA 4MKIA 4MI6A 4ZV9A 1GO2A 3R6TA 2EGHA 3BJEA 3HPQA 4BQSA 1U31A 1PSWA 4TL6A 5FUXA 3RTCA 1TVMA 3JPWA 1OH6A 1D2RA 1X2BA 1MA3A 1V1MB 4C7KA 5AVOA 1DBRA 3BM5A 1QZUA 2WAXA 2DUMA 1E2BA 1SPXA 1HT3A 2Q9AA 4FILA 4EHHA 1W85B 4KJZA 3SFVA 5CG2A 4CG0A 1U1GA 4ZEVA 4XD7A 3IR7A 4ZT3A 4G5SA 3QX3A 3CONA 1J99A 3CN7A 4ZU1X 1P5RA 2XMRA 3A6JA 4PVCA 1F2TA 2E1PA 3Q3HA 1B16A 2AZTA 4NYJR 3V4LA 4YT8A 1DIOB 1KERA 1OW3B 3PNYA 3KYCA 3QXXA 3K0FA 3GEGA 4GM0A 4NNJA 3VHLB 3GRPA 4QEDA 1M2EA 1ZH6A 2TRSB 1N2JA 3U44B 1B6GA 4X65B 2G1AA 2Q0XA 3PPWA 3O8OA 1NW4A 5FT9A 3CY6A 3RO7A 4IXMA 4QTUB 1TT7A 1Y9JA 3FJ1A 1XZHA 3KQWA 1F12A 4JHLA 4COOA 2FLWA 4RADA 5KYVA 4YLYA 4DE5A 2OUKA 2VKQA 3U48A 4DG5A 4ERXA 1W4CA 1Z2PX 1TZJA 4L0QA 5LBIA 1L9XA 1Z33A 4RVOA 3GLVA 4JH0A 1B8OA 3ZZTA 3DZFA 2V58A 4R81A 5DNEA 1CSEE 4O8CA 1H1LA 5F9HA 3RHFA 2EJBA 1E2NA 3RTAA 3RIXA 3SM9A 4F92B 4RH1A 4B3SB 1KU0A 1ZO8A 5AI0A 2VH2A 1Y9DA 3PDJA 1CQIA 2H5JA 4TWIA 1HQDA 4G81A 4MCAA 3ZR4B 4QPNA 4JN6B 4EKGA 4F5DA 2GN9A 3WTBA 5F76A 3AUTA 4CM4B 4URXR 1BCSA 2UXBB 5HE8A 4BVKA 1EX6A 1OC2A 3UJPA 3OSZA 3R3SA 4JLVA 3S2ZA 3U7QB 2F55A 2O7RA 2MT9A 1XMQB 1F8XA 4I08A 2YYYA 1W4RA 2PZMA 2XNCA 1NVXQ 4ZO4A 3QY0A 1BJKA 1KZ4A 4Y2HA 1ZR4A 5JH7B 2PRIA 3N53A 4HDAA 5EY5B 4YAWA 4REQB 2IYYA 2BD0A 5G4KB 5C8VA 4DR2B 1ECPA 4H77A 2IELA 1CUHA 2GCEA 2Q1TA 3THRA 4AJOA 1Z6QA 4CLOB 3UPUA 5C1BA 3NVKI 4OF4A 2Y67A 5C1DA 3CH6A 3HR8A 2XHEA 5EGNA 4X1IA 4C7OB 1T5HX 1VG1A 2XGSA 3ZHRA 1KZGB 5TC4A 1JAHA 3MIZA 1ZX1A 4WL0A 2O2HA 5D7NA 3WMWA 4KH1A 2Q6IA 2WAMA 1I3NA 4I1VA 4YASA 4DS3A 4ZCMA 2WR8A 2JVKA 4JOQA 5HIIA 2WTUA 2Z0MA 3K70C 4KUHA 5KJCA 3EHEA 2ZBDA 4JFAA 4ZCPA 1PR0A 4UM9D 5JQGB 2NO1A 1B0ZA 1KHHA 4R41A 2AOTA 2XVZA 4XD2A 4UHKA 4E5DA 4RMHA 1W94A 5ALVA 5DHUA 1DJMA 5B1IA 3USZA 1BWPA 1Q91A 4YRGA 3EAQA 1CZOA 4ND2A 4GHWA 1RBZA 1UEJA 5I5GA 2Y1OA 2GEBA 3RSQA 2GAOA 1SUEA 1XCGB 2O1XA 2ZYTX 3D6FA 5EJ2A 4OHYA 3E5HA 2GUWA 1IY9A 4BE7B 4UMDA 2J33A 5ES3A 1UMCA 3HB4X 1WMAA 3JQQA 2JRLA 3VRHA 2DXIA 4K9RA 1GTMA 3ML1A 3IT1A 1J22A 4ZWNA 1H0SA 5CBKA 2QYHA 3P9CA 2Z04A 4CMCA 2W6NA 4P5DA 1DQSA 3WLKX 2J48A 4NULA 3D7MA 1FNNA 3AK4A 2PQ0A 5JAMA 2BEUB 1R6AA 1U1DA 4XW2A 2YJNA 1OGIA 3GGGA 4XLZA 4Y9TA 3UXHA 4EMTA 8LDHA 5BN5B 3WBFA 1T9ZA 5IXYA 4JI2B 1I2MA 2NUBA 2DEUA 1E6LA 2C9YA 5DM60 3LFHA 2XB4A 1W88B 1RAFA 2O2JA 2VSYA 3K5HA 4YYEA 3JQBA 3WO0A 2PNFA 1SVNA 3AF4A 2A3RA 1N6LA 3NOXA 1ECCA 3SIWA 3ANTA 3VFDA 4E4RA 2R7LA 1F8YA 1DZ3A 2O9JA 3F6EX 3GD5A 2CNBA 4M99A 5KTKA 1GUFA 4YQEA 3W5AA 4Q02A 3WNZA 1PQ4A 1DBPA 1SC1A 3PWZA 1F6WA 1VJ1A 2A3NA 2Z3WA 1N77A 1TTTA 1Z0AA 2I67A 5KYXA 1P0QA 3GCZA 1TTPB 1X7XB 4LMPA 2B5OA 5IDWA 1T2CA 4IUYA 1M6WA 4K2HA 5L9AA 4PG7A 1L5MA 2JLRA 1D9XA 4AAYA 5DNCA 3LSYA 1KYZA 3AFOA 4TLLB 1IHOA 2O3TA 4CKBA 3WYEA 3ZWQA 4B3DA 1GGJA 3IDAA 3U3JA 4BWYA 3RYHA 3LT4A 1CP3A 3FBGA 2CMKA 3QHAA 4TMZA 1I7SB 4OI4A 1HDYA 3CVWA 2ZRJA 1EUZA 3JVDA 3A1NA 4QIHA 3QFRA 4XD7D 5BYBA 3OO1A 4E2ZA 3PQ6A 3IVGA 5BWNA 2SCUA 3Q7QA 4LSWA 1QRSA 4GKJB 3H2IA 5BUQA 1FTSA 2GLXA 4H1WA 2ZBGA 4LJ9A 1HY3A 1HG0A 1NJFA 3U5TA 4FHEA 3IODA 4DSUA 2QPLA 3QKRB 1MT3A 1D2CA 1PR2A 2IHKA 4HX2A 4UUPA 4AURA 3MJDA 5HKBA 3EMVA 3HL4A 5HILA 5DV9A 1TT5B 4LNUB 1VMAA 2BGTA 4IILA 3VNUA 3V1LA 5BV7A 1NVWQ 1UL1X 3NEPX 3QTLA 4DSZA 3UT0A 4X00A 2I4LA 5AVSA 1CU1A 4XWGA 1PRYA 3S3TA 1LGYA 1N3YA 2BFBB 1LEHA 2L42A 2Q4DA 2X1MA 3I1JA 1Q3HA 2Z83A 5KNBA 2PJZA 3EIUA 2JAPA 3M0EA 5IAGA 1LRKA 1ZMRA 5A06A 2SKDA 3DBLA 3NP7A 4MNTA 1INLA 2C7PA 4FZJA 1PGJA 2HK9A 3HYRA 5A2GA 2YIDA 1Y9AA 4H7IA 2B8NA 3BWMA 1H9AA 3RC8A 4HN4B 1F14A 4L8GA 2MINA 3L2OB 1Y6ZA 3EGWA 4B6JA 4F91B 3ABZA 3V7FA 1OLXB 4NCBA 1W2HA 1WDMA 2WUEA 3K31A 1ADFA 1QGAA 2A84A 1RPTA 2FEWB 4FFMA 5KI6A 3TM4A 2PV7A 3BIOA 4K28A 3VAYA 4E2YA 5JNTA 1VCMA 3EQ8A 2AG8A 1XXHE 9ATCA 3O93A 4KDFA 4NMWA 4P54A 1ZI8A 2HLPA 2ZSUA 4FXPA 4NIMA 5H3LA 4EY7A 2WUDA 1NDUA 4LXIA 2FHPA 1L5HB 2EGGA 3FFAA 2PZKA 4ZOQI 5EKSA 4WN3A 1OBHA 2XH8A 5ALLA 1BCRA 1NPTO 4ZZ2A 5IUKC 3G2JA 3RYIA 1YE8A 4RLHA 5C4IA 4OOEA 5I7WA 2EL7A 1FNMA 2PYDA 3L8HA 4LGYA 4CM3A 4BXOB 1YB7A 2D0OB 1U3FA 3RTBA 1ZD2P 1G9SA 4JJIA 2LPMA 2VP2A 3TN7A 3ACCA 2HGSA 1ZDMA 1Y4ZA 4KN5A 1OA1A 2NXJA 3RS2A 3NTRA 4D4KA 4HDNB 4BNLA 4LXGA 2CJFA 1NQWA 1KZ6A 5FULA 3TEMA 2H9AA 2WSSA 2DTXA 2GD1O 2ZWIA 3IB6A 5JV5A 5KOJB 1CLUA 4ZJUA 3T5BA 3M9LA 1H6AA 2IEBA 3ILHA 4NAUA 2EJCA 1Z62A 2NT4A 1ZNYA 2C2HA 2PVPA 2PL3A 3OPMA 4IJWA 3AI3A 3FGZA 4NHEA 3LX4A 3SY8A 5A3RA 1JSCA 4DHWA 5IZ4A 3HWSA 1ESEA 1Q6YA 4NBSA 4S1OA 1KJ8A 4LRQA 3L7AA 3PNSA 4ER0A 5KKNB 3AVWA 4KREA 5E7JA 4JEUA 4LZOA 2BEVB 2X2PA 5CT6A 3AFMA 3FHLA 1MO2A 4YCMA 4LQ4A 1WBDA 3EISA 1U5CA 4TN5A 3CA8A 1U99A 1WDLA 2AXNA 3NLLA 1DJPA 1MT0A 3KUCA 5D87A 1WDKA 4K81B 2X5OA 2OTCA 3TLMA 4B8WA 4QGAA 4DB2A 2G17A 2NU8A 1WZIA 3OQJA 4WD3A 1J7KA 1S8AA 2JFUA 2FRXA 2ZB8A 2PCJA 4N1AA 1W7AA 2C3UA 3HHEA 1Z63A 3OICA 2PGNA 2R8PA 2A7QA 5AK5A 3WIVA 3U9SA 4DC1A 5B6PA 5AXBA 2F8TA 1Y42X 5PGMA 1US8A 4LYDA 4TQ9A 1R9GA 4QEKA 3C8DA 3IXMA 2VYNA 3PI7A 1Y5IA 2JK0A 2Q0HA 1EE1A 4OFWA 3UUGA 3S4YA 2YHIB 1NVMB 2Q8PA 4RAQA 4E1AA 2HCBA 5ALEA 3IUQA 5IFLA 1Y6FA 1EVLA 1N8TA 7ADHA 1RMYA 1USWA 2BHSA 3DOCA 3I73A 1OD6A 2UXDB 1NBOA 1X1BA 5FYQA 2C99A 1XCJA 4Q3NA 2CMDA 1FNDA 4JIGA 3OUTA 3EA0A 4JJ6A 3HL0A 5BMVF 3DFKA 3KJGA 3KBOA 1QIIA 3U4MA 1JHMA 2ZBPA 4A6DA 3LDAA 4MICA 5GM1A 1L8OA 3BH6A 4LQDA 2CHGA 1J42A 4M1ZA 4RD1A 4DQXA 4D8XA 4N49A