5JE8A

The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with nad
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MKKIGFIGLGNMGLPMSKNLVKSGYTVYGVDLNKEAEASFEKEGGIIGLSISKLAETCDVVFTSLPSPRAVEAVYFGAEGLFENGHSNVVFIDTSTVSPQLNKQLEEAAKEKKVDFLAAPVSGGVIGAENRTLTFMVGGSKDVYEKTESIMGVLGANIFHVSEQIDSGTTVKLINNLLIGFYTAGVSEALTLAKKNNMDLDKMFDILNVSYGQSRIYERNYKSFIAPENYEPGFTVNLLKKDLGFAVDLAKESELHLPVSEMLLNVYDEASQAGYGENDMAALYKKVSEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of the Bacillus cereus 3-hydroxyisobutyrate dehydrogenase
pubmed doi rcsb
source organism Bacillus cereus atcc 14579
molecule tags Oxidoreductase
molecule keywords 3-hydroxyisobutyrate dehydrogenase
total genus 112
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.31: 3-hydroxyisobutyrate dehydrogenase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5je8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5je8A01
2PGLA 3NX4A 1H6DA 1HE5A 3ZU4A 4CR7A 3EGOA 2WD7A 1SPXA 2B69A 1ISGA 4HFJA 1G0OA 4RPKA 2WE7A 1I32A 5COQA 3RUCA 2QZZA 4MIOA 2ZCUA 1MUUA 3P2OA 4YJHB 2NV6A 2W4QA 2BGLA 1LRJA 1GV1A 1UP4A 3UF0A 1BXGA 1XIVA 3H2SA 2YQ4A 1PZHA 4GI2A 4YXFA 1LLCA 3PGXA 4BNNA 2GERA 3F4BA 4MVJG 5TS3A 2BFOA 1LDEA 5DN9A 1LLQA 3BMNA 3OQ6A 1C1DB 4O6VA 1LJ8A 4GVXA 1ENYA 1IPFA 3AU9A 3KV3O 4WOJA 2VWHA 2DKNA 4BV9A 1U5AA 5FFFA 3KUXA 1XGKA 2WSBA 1NTOA 2GGSA 4J3FA 3VZQA 1CF2O 1O95A 3E9MA 2XXBA 1E7QA 5ES3A 4D0RA 1NVMB 2J5KA 2PA3A 3UCFA 5JYEA 1G0NA 2ZJ1A 5JE8A 3IJRA 3FBGA 3PLRA 3BTOA 2ZKLA 2J6IA 3TDKA 4FFRA 3SC4A 3WGTA 4D0SA 4O59O 1UR5A 3IP3A 4PLPA 2FOIA 4CM3A 2RH8A 4AJLA 3AY3A 1EVJA 2IEBA 3OBBA 1EE9A 1OMOA 4HV4A 2NWQA 3I3OA 4Y9DA 4KTVE 3VAZA 4Z0PA 3UAGA 2GZ1A 4CPDA 2D59A 4HNHA 1FDUA 1X0XA 3K6JA 4W6ZA 4R9RA 5F5LA 4Z3DA 4A03A 4HWKA 4ALLA 1DSSG 3ZWMA 3A06A 4NPCA 3PHIA 4ZRMA 3DC2A 3ETDA 2TMDA 3WWYA 4XQ9A 4W4TA 5GY7A 2NU6A 2H6EA 1GR0A 3ST7A 3JQ9C 4JP3A 3GEDA 3KYDA 4IINA 1HSZA 4XQEA 4CQMD 3ICPA 2J5QA 1U3WA 1J5PA 4BNLA 4UEOA 1CQJA 2FR1A 4FB5A 3TSCA 5L7YA 5IN5A 5I7EA 1DB3A 4D45A 1YJ8A 2X1HA 3C7CB 3GC6A 2FRDA 1I30A 3CTVA 1MP0A 3F5QA 4MKXA 1UXJA 2B4TO 1LLDA 3RFVA 3SLGA 3U4HA 3B1FA 3AM3A 3HQ4O 5A3VA 1E1NA 2DAPA 4MVJI 2NU8A 1HE2A 1X1EA 3PGJA 2CF6A 3BHJA 4BMVA 3WOHA 3K96A 1P1JA 4WJZA 2X9GA 3WFIA 2GN8A 3RKRA 3IUPA 3KSZO 3ZHZA 1WVGA 1PGNA 1XHLA 3COSA 4PLVA 1WDLA 5U4QA 2X7HA 2JCVA 1RPNA 2IYPA 2O3RA 4J49A 3JQCA 3EVTA 3X2EA 2D5AA 3T4EA 2X86A 1GD1O 3W6UA 4DMLA 3ANNA 1WPQA 2FZEA 4YJGA 4XIYA 2UAGA 4RLHA 4DQUA 2CD9A 1TT7A 4ALMA 5AXBA 5EJ2A 1QYCA 2GZ3A 3BHIA 3DL2A 3H5AA 1E7YA 2I6TA 1MG5A 4R1NA 3U62A 3MEQA 2V65A 1UDAA 4YCAA 2O7SA 2OP0A 1LQTA 1NQ5A 5HBRA 3VH1A 4KWIA 1KIFA 4BO8A 1N1EA 2C5AA 2DU8A 1N7HA 3PYXA 3V5NA 2ZCVA 1C0KA 2HMWA 1O0SA 1HEUA 1N9GA 2IEDA 4JQCA 5CAEA 4NQZA 4KUGA 2Q49A 2NTVA 1QLJA 3LT4A 3WIEA 1BVUA 3JSAA 1NQOA 3JD0A 1QKIA 2E82A 3KO8A 2PD4A 5EN4A 2J3IA 1YBAA 3FN4A 3RJ5A 1DRUA 2ZJ0A 3ONDA 2EJWA 1A4IA 1Z7EA 2ZYGA 4FR5A 3GMSA 4BNZA 1DFHA 2P9CA 1HETA 3E9NA 1NWCA 4BNKA 4BB5A 4CLRA 4ND1A 1XG5A 1HDZA 3QSGA 4IJVA 4J4HA 5KJFA 4RPGA 5ILOA 2PKQO 4NZ9A 3EMKA 5DNAA 2B35A 3K9QO 2CNBA 3KYCA 4RVHA 3GHYA 3U09A 5DOVA 4DMMA 2DBZA 4URFA 2VQ3A 5JO9A 3INRA 4YR9A 5AOVA 4E32A 1E6UA 1U4OA 3TNLA 4IJKA 2DLDA 4M49A 1JW9B 2R2GA 3VH4A 4ZGWA 4KQWA 4RF5A 3UXYA 1B15A 1F8GA 4P4NA 4Z3KA 1MB4A 1Q0HA 5AYVA 3ROMA 3VZSA 1GYQA 3ZW9A 4OQZA 1LUAA 3PYLA 2AQ8A 2QX7A 3FHLA 4EYEA 3M2TA 1NQAO 2B37A 3QJ5A 1W4ZA 4GGPA 4CLOB 5U9CA 4YACA 1EVZA 1C0LA 1EZ4A 2WE8A 2VUTA 3TZHA 4GWGA 2C5EA 4TZTA 1Q7GA 1CRWG 2F00A 4OYRA 1LDYA 2JL1A 3TL2A 5JXWA 5G0TA 1I24A 3PHLA 4UEKA 1LU9A 5CDSA 4DL9A 1BGVA 1E3SA 3BZUA 1UZMA 1AGNA 5TLSA 1YB1A 4IDEA 4JJIA 4MP8A 4YYZA 3LC7O 2CVQA 4B8WA 1WMBA 4XX0A 2JD0A 4IJUA 3ZV6A 3AUTA 5FWNA 3U0BA 5F21A 3C1AA 4WLNA 1ZK0A 2E6UX 4R5HA 1FJHA 1UXIA 3KOUA 1DJQA 4J1QA 4E6PA 3LDHA 1JVSA 3LLVA 4PLFA 2HU2A 3MJVA 4ZRNA 4HFNA 3GUYA 1BW9A 4FPXA 1OOEA 3HUDA 4D46A 1GPDG 5JAZA 4FSHA 3GPIA 3ORFA 3GY0A 5LDGA 2BD0A 1Q2XA 2FPPA 4WEQA 4ONEA 4TMFA 1J6UA 1ZZEA 5G4KB 4DVJA 3LT0A 2O4CA 4PG5A 4ROSA 1ZXBA 3GVHA 1HYGA 1P1HA 2BGKA 2E4AA 4AICA 1T1RA 2ZB7A 3RUEA 3E9QA 4CM8B 3RAJA 3L6EA 4AJ1A 1DRWA 2Y1DA 1PEDA 4OQYA 3C85A 3GFBA 3KLPX 3BHMA 4TWRA 1KYQA 3AUSA 3RUAA 3PZBA 1IPEA 1GQYA 2W2KA 4QFCA 2UUPA 3AUUA 1DHRA 4OKIA 3H4VA 3VVBA 4J0FA 5COBA 4PG6A 1MV8A 3WQSB 4J16A 4BGIA 1IYZA 4EDFA 3O4RA 4MKZA 4BNVA 3D64A 5IG2A 4AFNA 5K0ZA 1H5QA 3OF2A 4OSOA 4CUZA 1RM0A 1DXYA 4OO3A 2PWZA 4KTTE 3HFGA 1C1XA 1X7HA 3VH3A 1D4FA 3KB6A 4IIVA 5CHEA 1O5IA 3KVOA 4BKPA 4FJ0A 2YFQA 4N5NA 3RC1A 1Y7TA 4NJOA 5A4DA 3IIEA 3JQAA 3H65A 1LDGA 4ZHSA 2X5KO 2O3JA 1ENZA 1XWFA 2VRBA 3ZNNA 4CL3A 2C07A 2I67A 1GCUA 3IOYA 3K2EA 1WP4A 5A9SB 4PZCA 4HNGA 1PJSA 3EYWA 1ZK2A 1LEHA 3CZRA 4RZHA 2PK3A 3Q9UA 2B5VA 4BOYA 4IY1A 1E1LA 4WNCA 1PJ2A 1MLDA 1PS0A 3U49A 3WDSA 5JY1A 2VHXA 4NK5A 3HHPA 3RC7A 3LK7A 1Y8QA 4U6QA 1P9LA 5JAMA 1R4NB 3GGPA 1E6EA 1OC2A 1M2WA 1EUDA 1R4MA 4LISA 3AI1A 3RU7A 2R6JA 1JKJA 2GRAA 1E7WA 3DB2A 1SNYA 2HO5A 1CETA 1NVGA 4BO2A 5K9ZA 1FDVA 1Z6ZA 1WAMA 4ND4A 4Q3BA 3LF1A 1E1MA 3WWZA 3NT4A 4LRSB 4DC1A 2VYNA 2ZTVA 3V2GA 4KP7A 1U2DA 4HY3A 2I66A 2EG9A 1TXGA 4IZHA 2CVZA 2X8LA 4J43A 4RQTA 3ROKA 1PQWA 4A0SA 4WK6A 3RIHA 1HRDA 1HDCA 3DXFA 1LSSA 2IZ1A 1X14A 3RSHA 1V0JA 4DPLA 3UFXA 4YBZA 2YQ5A 3IMFA 3ONEA 4CMAA 5BNFA 2AMFA 2HRZA 2OZPA 3G79A 2Q99A 4W9NC 1H6CA 4KDEA 4YJDA 3N7UA 4B4VA 3PZRA 3WGQA 1LTHR 8ADHA 3GGOA 2WYUA 3L9WA 1HDXA 1I10A 3ZNOA 4FFLA 3FNFA 4NNJA 3AFMA 2GCGA 3RWBA 4NU5A 5A06A 3TZKA 1C1DA 3GVCA 1S7CA 5A9RA 5EPOA 1RM3A 3SEFA 3WJ7A 3WTCA 3GUCA 1B8PA 2DM6A 3U5TA 3WX0A 1WZIA 4B7UA 3HZZA 4HADA 4F6LA 4BNXA 2YV1A 3PFFA 1G6KA 4ZQBA 3ZHXA 1O94A 1B0AA 2FHSA 4TRRA 4PG8A 4FBGA 3MWEB 3RASA 3QP9A 3WQRA 1UJMA 3C1TA 2JAPA 3OETA 4R9SA 1KC1A 5IDXA 4DBVO 4XCVA 1YXMA 3FTNA 2YY7A 1I36A 2IZZA 4G81A 1CERA 1D7OA 3GHHA 4PZEA 2JCXA 3JQBA 3CPSA 2X23A 5CFZA 2D0IA 2D2IA 1ONPA 3D5QA 3JQ9A 3R3SA 5TRTA 1GQQA 4ZN6A 4XB1A 3NTQA 3KTDA 4CR8A 4FFPA 3WSWA 3OEYA 3F47A 1DC6A 1I01A 4J7UA 4UUPA 3G49A 4IGFA 3OJOA 2G76A 1NBOA 5TSDA 1JQBA 1JDJA 4QX6A 4CM8A 2AHRA 4R1TA 4OM8A 4PN3A 1V8BA 2IRWA 1BXGB 3V2HA 3GG9A 3BTSA 3GNTA 2DQ4A 5ITVA 2PR2A 5G4LA 3STHA 5KTKA 3RROA 1GL3A 2UV8A 3SXPA 1VL0A 4I1IA 5G2OA 3PWSA 3ZWXA 5KJ6A 2G1UA 4MIYA 4L4SA 3V2UA 1OC4A 3ULKA 2H63A 2RBEA 1UXKA 2DBVO 2Y0DA 2Y0CA 3ZWYA 2D5CA 5KVCA 1E6WA 3BMCA 4XYGA 4E5YA 1K0UA 1T2EA 1DRVA 4Y67A 3HSKA 1UUFA 4OXNA 4OIMA 4YVFA 4MIEA 3SLKA 4A26A 4D79A 4ZJUA 4MO2A 1GADO 3HN2A 3GZNB 1LBEA 3WGGA 4QSMA 2DUWA 3PJGA 4GMFA 3ZWWA 1XU7A 1Q0LA 3PHHA 3ZU2A 1W8DA 3VC7A 4PLCA 5KKAA 3JQAB 4ZICA 4UVEA 3JD3A 1NPDA 5B4VA 2WTBA 2W98A 3CKYA 1U3UA 3HWRA 2GO1A 1PR9A 1QRRA 4FOSA 1KEWA 2WD8A 2QZ9A 5FYDA 5DP1A 1B14A 1LA2A 1ARZA 3QVWA 4Y6SA 4CUKA 1M76A 3U4CA 2C54A 3ETGA 5G4KA 4BKRA 1NX6A 3QE3A 4HKTA 1H2HA 2GN4A 2I9PA 1DC3A 3UCXA 1F06A 1EQUA 3GLQA 2ZTMA 3AY7A 4INAA 2NVWA 4AL4A 1VJ0A 3D3WB 3WG9A 1O8CA 1RYDA 4B8ZA 1SO8A 3JQGB 1VL8A 4W9NA 1NR1A 3LF2A 4JNKA 2A35A 5DCWA 3H5RA 1R12A 4DYDA 2Q45A 3L0DA 3GRPA 4N7RA 1N8KA 5HS4A 1VKNA 1XEAA 3MJ4A 1IHXA 3ON5A 2Z5LA 1UZLA 1ZJYA 2OGUA 3C8MA 4R54A 3EW7A 1LRLA 3UKOA 4WLFA 2QG4A 1B3BA 2NTNA 4LVUA 4WGGA 3QY9A 3BA1A 1QV7A 2B83A 4FIZA 4XZ3A 1V6AA 2VZ9A 1H9AA 4YT4A 2Q2QA 1EE2A 1NAIA 3H9GA 2PD3A 3MJCA 5T5QA 2FSVA 1Z45A 2WMDA 4YB8A 1E1KA 3CZMA 1P3DA 4IDCA 3DZGA 3RBVA 4DQXA 1ISMA 5ER9A 1VL6A 5ITWA 1K6JA 3P19A 1HSOA 1SOVA 2CDBA 4RGBA 4IDGA 3V1TC 4FFOA 2NU9A 3EZYA 5JW6A 1I5RA 1M67A 2ZTUA 1KEVA 2BMAA 1NHWA 5L4LA 3G0OA 2OHXA 2VT2A 4U6SA 4NHEA 3JYLA 3DFUA 3MJEA 1P31A 4CQLB 3CH6A 2DFVA 3G1TA 2FY8A 4WUVA 3I83A 4E2XA 1HKUA 3SC6A 3EUWA 4PVCA 1UDCA 3K8ZA 5AXDA 3WGOA 4FJ2A 4CMIB 1O6ZA 4FC6A 4PCVA 3RFXA 4AJEA 4AJOA 2A92A 3HNPA 2HRBA 2BHLA 3ASVA 3BMCB 4B3IA 5CDYA 3I6QA 4ZQGA 4RJTA 3GPDG 1E7MA 3WYCA 3QWFA 4BNFA 2RH4A 3GN1A 4I9NA 1KERA 1NWHA 1R0SA 2P68A 2Q50A 3WICA 4DYVA 3PEFA 3WBFA 4WLVA 1JKFA 2OBYA 3EVNA 3FNHA 2OO5A 2WYWA 4FS3A 3PIDA 5TF4A 4E13A 3UGKA 4L8VA 3KZVA 4NFYA 1QYWA 4OOEA 4HBGA 4JROA 4KUHA 3DTYA 1Y8RB 4I5DA 1D8AA 4H3VA 3W8EA 1EBUA 4FGWA 2QRLA 4B4UA 1HE3A 4BIIA 2YW9A 4J4TA 3JQ8B 1Y81A 1XDWA 3AOGA 3DR3A 2CF5A 3DZFA 4I08A 1CEQA 2JJYA 2NACA 3I9OA 2BI8A 3GDOA 5AQ1A 5H83A 1R15A 3JYOA 3PQFA 2FSSA 3VDRA 5DZSA 3T7CA 3NDJA 1L7EA 4XYMA 2YFHA 4FDAA 3ZGYA 4R01A 4ALNA 5HS6A 5JC8A 5U1PA 3ITKA 4AJ2A 4GX0A 3NUGA 5IXYA 3RKUA 1CIVA 1PGJA 2HK7A 3IS3A 4AJJA 1R0LA 3KYDB 3ZN2A 2NNLD 1HF3A 1WNTA 2RIRA 2EGHA 4CMGA 3LC2O 1JTVA 3SJUA 3V1YA 1HZJA 2ZYDA 1OAAA 4IBOA 1XA0A 1F8FA 1H6BA 5IF3A 4LVCA 4BO0A 2X5JO 2I99A 4GBJA 2IZ0A 3RUDA 3ENNA 1NXQA 1GYRA 2PV7A 2Y1GA 2OP1A 3VOSA 4RORA 2VRCA 1E3WA 3MCVA 1JA9A 3GZ4A 3TPCA 1CQIA 4W99A 2I3AA 3RD5A 1YO6A 3DEYX 2BKAA 1BDMA 1RM4A 4IS3A 4BKOA 3I9JA 5JAQA 1GU7A 3PWKA 1WW8A 1UXHA 1ZFNA 1HZZA 2ZQZA 3WS7A 1MC4A 2OFPA 4MVJH 2GN9A 1GV0A 3KSUA 1Y5RA 4H16A 4GX1A 4NDNE 4EI2A 1T4BA 4DXHA 5TQVA 1GEEA 3SVTA 4A7PA 4CQLA 1T26A 5I7FA 1I3KA 5A04A 4TKLA 2HMUA 5C3MA 4J4BA 2GPTA 5DCUA 5G0SA 3MWDB 1QSGA 2OUIA 2X9VA 3I9KA 4MOWA 1O89A 3Q2IA 3ZNPA 4EITA 4UUMA 2EERA 3VKVA 5DF1A 3UW3A 1D1SA 1W0CA 3WQQA 5ENDA 3OIDA 4UVGA 4O0LA 1MG0A 1K5HA 5F1OA 2C7GA 1XYGA 1R4MB 4PFJA 1EEHA 4XA8A 3WXBA 4UVDA 2AEJA 4WKGA 3RJ9A 1A71A 3WGZA 4DWVA 5JDCC 2VHVA 1K3TA 1PL6A 2PZLA 4GPD1 1LI4A 4Q3NA 3GGGA 4YEDA 2EKPA 5FF9A 2W2LA 3I1JA 2QQ5A 5DULA 3DOOA 3ZV4A 1HLPA 4QXMA 1JN0A 4CLOA 1R37A 1ML3A 3DMTA 3LSYA 3RCBA 1OBFO 1U8FO 2D8AA 1X0VA 1T4DA 3B70A 3VVCA 4WEOA 4AJHA 4S1VA 4AJ4A 1B8UA 2AEMA 2IXAA 3HDYA 4WCFA 1IZ9A 4Z9YA 5IZCA 1YKFA 1HYHA 1KETA 4NFHA 2FWMX 4OSPA 1YGYA 5ER6A 3O9ZA 5I9MA 2H1SA 4EZBA 3F46A 1YQXA 4BQRA 5C7IO 4L76A 1PJQA 3GZNA 3MTGA 3AJRA 1MGOA 3GMDA 2EP5A 5BR7A 3GT0A 4K6FA 3CUKA 2JAHA 2VYVA 5MDHA 4JBIA 2QRKA 2JFFA 4F46A 3QVTA 4FQ8A 2BI7A 5KIAA 5L7TA 2C59A 2BFAA 1LSUA 2Z1MA 4M86A 4XQCA 1P77A 4Q9NA 3H7AA 3QWIA 2AA3A 4DLLA 3OJEA 9LDTA 4CMEC 3KYBA 2CDCA 3QW2A 4LN1A 3ZU3A 3DZBA 4NK4A 2WD7B 2NQTA 4J9UE 3E5RA 4O1MA 1GZ3A 3DHEA 4OAQA 1E3WB 4YRAA 1N1GA 2AG8A 2FR8A 4CODB 4E5PA 3PRJA 3PVZA 1EFLA 2PZKA 3LYLA 5T57A 3ENKA 2VWQA 1GQ2A 4BO7A 3HB5X 3DAPA 5B1YA 1E7RA 5JAIA 1E92A 3B20A 3PYMA 1C0PA 1PJCA 3TFOA 4DIFA 4IS2A 4PLZA 3VPFA 1NQTA 1SMKA 1U3TA 3A1NA 3IAHA 2O48X 3QV1A 4PIVA 4ZQHA 4C7JA 1U9JA 1U2GA 1ZMTA 4XR9A 3G1UA 2OMEA 3U4DA 2EJVA 4RPLA 3S2FA 1FXSA 1IY8A 2ZIZA 3WSVA 3DOCA 4ALIA 3T4XA 1UP7A 4YQZA 2GDZA 1B26A 3NJ8A 4QQRA 4MINA 2HQ1A 2HLPA 3AUAA 5I7VA 5JYDA 5IN4A 2O2YA 3FNGA 3VPXA 3AOEA 3H5NA 4FFMA 5H82A 2EKQA 2BRUA 3HDHA 3W6ZA 3LT1A 5EQDA 5ILGA 4EBFA 2IYOA 1DDOA 2PY6A 1TLTA 4I8XA 1DHTA 3GA0A 3H9QA 4IDDA 3KEQA 1PGOA 1I0ZA 1GPJA 5T8KA 2QRJA 3BTUA 1U1IA 4NBUA 3V8BA 4NFSA 3H3JA 4E5NA 1YQDA 2X0RA 1LDBA 3NJ4A 4E3ZA 1CWUA 1MFPA 4KMSA 2GNAA 4GKVA 4D41A 3QWHA 4CM4B 1K6XA 3JD2A 2RAFA 5IDYA 1RWBA 2C2XA 1E0DA 3CSDA 4GVLA 5KJ1A 2WM3A 1LDNA 1CDOA 1QXSA 2GASA 5EERA 4EJMA 4M54A 1X7DA 1AUPA 1BDBA 1A4UA 3WLEA 4PGFA 1T2AA 2PH5A 3PP8A 5T6BA 1N7GA 4FD3A 3PPIA 2NQ8A 4NMHA 3WGIA 2WDZA 1NASA 3KBOA 3ZWAA 2VOEA 1PS8A 4KZPA 5K6AA 3RI3A 3SJ7A 2GSDA 2Y1EA 2R00C 1A72A 4D3SA 3MOGA 4LW8A 1GDHA 1JKIA 4TRJA 3DZHA 1DIBA 1VKOA 4H7PA 1EUZA 3RFTA 7MDHA 5MGBA 4U7WA 1HT0A 5LC1A 3OH8A 5T64A 5A03A 1DLJA 5COAA 2ZK7A 1ISIA 5F1KA 1ZMOA 4E2YA 4MKRA 4WASA 3BYZA 5LCXA 4WLOA 3ICCA 4HX5A 3TQHA 3D5TA 2VRCD 2YHUA 1QG6A 1BHSA 4L4XA 4QO7A 5A9TA 3PDJA 4W7IA 5KWEA 3OQ1A 3BMQA 1E3IA 1EFKA 4N54A 3LLSA 4AG3A 2P9EA 3GK3A 4MVJM 2PKQP 1H94A 2VT3A 3W4JA 3KHUA 5FI5A 3N74A 3WJAA 1FDWA 1XQ1A 5CEJA 4K9DA 3PK0A 2UVDA 1GZ4A 3UUWA 3AK4A 3R0IA 2NVUA 1KVRA 2BFPA 4JLWA 3ZV3A 1P1FA 4YJFA 4L0QA 3QLJA 1T24A 2C29D 5KKCA 2VHWA 1ADFA 1DAOA 3EC7A 2Y99A 3O8QA 3UHAA 3PJFA 3C3XA 3C7DB 2B36A 3OEWA 2HJRA 1IB6A 3K2BA 3CIFA 3WMXA 1HE4A 1KEPA 3VZRA 3GEGA 4BO6A 1CYDA 1C3VA 1E3LA 1NNUA 1A27A 5JLAA 2E49A 4RQUA 4NBRA 2PZMA 4A10A 2Q1UA 1O9BA 2CUKA 2J3KA 4HFMA 2CFCA 5TJHA 2ILTA 2VZ8A 6ADHA 5JMPA 1F12A 4FW8A 4CQMB 1ZH8A 3I9NA 4LRTB 3CXRA 2DBQA 1YL7A 2C82A 3PFWO 3OIGA 1H2BA 1ZIDA 4EW6A 3D4OA 2FMUA 1LRKA 5JBIA 1R6DA 4TKMA 3ZCXA 3I52A 1EBFA 4P4GA 1Z7BA 4JXKA 2TMGA 3GRKA 3PJEA 4P38A 4CLEA 1WMAA 5B12A 3QVXA 2LDXA 1VE9A 2C0CA 4XRRA 4XYEA 1E77A 4UULA 4J6FA 4Y6PA 2YHIA 5F3RA 2H5LA 3WGHA 1GEGA 1HL3A 2A9FA 4MP3A 2AQKA 4J2OA 2X9NA 1DO8A 4KDFA 4II2A 3DOJA 2R00A 3GNQA 3JTMA 3NAQA 5H81A 5A05A 4BVAA 5THQA 1QMGA 1Q7CA 3CEAA 4XQGA 4YAGA 1ZSYA 4U5QA 3S2EA 1FF9A 1R4NA 1HDGO 2VZ0A 3ZNQA 4PG4A 2CSUA 3SBOA 4IJWA 2QIOA 2XAAA 4RF2A 4XD2A 2AEFA 3PQDA 2YDYA 1HWYA 3RC9A 2EWMA 4XDYA 2P91A 1LLUA 1ONOA 3ADOA 3JQAD 3OMLA 4BNWA 4NIMA 4DC0A 5I8WA 1YONA 3E48A 4IDBA 4M55A 5TJ9A 1ULSA 2LDBA 4D3DA 1VRWA 3DFZA 3RBXA 3DBRB 2YJZA 4YWJA 5L45A 2Q1WA 1K6IA 2YDXA 3HB4X 1QYDA 4BNJA 4B4WA 5L4NA 2SCUA 3OIFA 2BLLA 4XGNA 3KM0A 2DTEA 3WIDA 1N9GB 5DDIP 1Y1PA 1VC2A 3MOIA 4FFNA 5BSGA 1N92A 1ZSNA 2DBRA 1VPDA 2XXJA 4ND3A 1M66A 3JQFA 3S1LA 1M6HA 1J4AA 1DAPA 4CUJA 4WECA 5L3ZA 4DTIA 3UVEA 2QHXA 4NH4A 1LC3A 4J0EA 3H2ZA 3F4LA 3OP4A 1XLTA 3PI7A 2Q3EA 2IE0A 5EMHA 4A73A 3IL2A 1YH3A 3AY6A 4ND2A 3AW9A 4JN6B 2EP7A 2I76A 4LK3A 4LCJA 4RPJA 2ZQYA 4R4JA 3W8DA 4DQVA 1ADCA 5IDWA 3JQ8A 4LGVA 3H9JA 3TRIA 3ZWCA 1NP3A 1PGQA 5F5NA 4RV9A 3NEPX 4G5HA 5G0UA 4BGUA 4AJPA 5ADHA 5LDHA 2HMTA 1RJWA 3M1AA 4LSMA 3BTVA 3B6ZA 9LDBA 1TI7A 5CEEA 4AVYA 3K73O 1P33A 3KETA 4CM6A 3AM4A 2AQHA 3LQFA 4IDFA 4XDZA 4UUOA 1ISHA 1TT5A 4J1NA 1U4SA 4QECA 4AJIA 3TN7A 1YL6A 3DBLB 1XKQA 3EHEA 2P5UA 5I7SA 2B0JA 1EVYA 2Y68A 1HTBA 3NDRA 4CMEA 3G17A 3E5MA 1IE3A 2Y05A 5CDTA 1QP8A 4XWYA 3MJSA 1ZK1A 3DBLA 3Q0EA 1XSEA 3OFSA 1MA0A 3GFGA 4J2HA 1LQUA 3ROPA 1TB4A 3TJRA 5JPIA 1P1RA 2Y1FA 3B1KA 4R68A 3GR6A 2GF2A 1RKXA 1C14A 1LC0A 2EXXA 5JMWA 1BWSA 1NPYA 3EDMA 2EV9A 4Y8VA 4CL8A 1I3LA 1NAHA 4QO8A 2C20A 5C37A 3JQGA 3NTOA 4Z9FA 1PL7A 3QWAA 1DPGA 4CM1A 2UUOA 3CTMA 3P2YA 4O63O 1PQUA 4RDIA 3E1KA 2Y67A 4II3A 5HRUA 1AXGA 1JWBB 4JX8A 5EINA 1HXHA 1MC5A 3D7LA 4BS9A 3L6DA 4NJMA 2BFMA 2DPGA 4IM7A 3ZWNA 3FWNA 2OXIA 1GUFA 1AHHA 1YB5A 4DUPA 4CV1A 1DBVO 1N2SA 1SEPA 4UVHA 4J7XA 5JSFA 3JQ6A 3AU8A 3D4NA 4ND5A 2FZWA 5C5IA 4F45A 4RDHA 2DTDA 1PX0A 1ZSVA 1DIGA 5A02A 3Q9NA 1SB9A 3I6IA 5C7OO 4YT5A 3C7AA 4EUHA 3UCEA 1PTJA 3ZWBA 1DEHA 1VM6A 2J5RA 2D3TA 3JQEA 4OOFA 7ADHA 2PZJA 4WLEA 2XOXA 4BO1A 1J49A 2PGDA 1ADBA 3G3EA 4MVJE 5CEFA 1GZ6A 2VUUA 5JDIA 3TF5A 3QRWA 3O26A 1YRLA 1EUCA 1KVSA 4J9VA 1HDRA 3B1JA 3Q1LA 2O3SA 2O3QA 2JCYA 1KS9A 4YDRA 3GDFA 4JJGA 4YAIA 2AE2A 2HK9A 1C0IA 5EQFA 4PZDA 5AXAA 4Z9XA 1AN9A 3HJAA 5A5FA 5TNXA 3WNVA 4CLHA 1U7TA 4CMIA 5JFOA 5A9SA 4XGKA 3AI3A 3DQPA 4PVDA 3ETEA 3FF4A 4OHUA 1U5CA 3U3XA 2GLXA 1LX6A 3OJ0A 3QWBA 3V1UA 3IKTA 5T67A 3WYBA 4UEJA 3NGLA 3NKLA 5JC1A 2Q4EA 3NTRA 2EW8A 1DIHA 1I33A 3AWDA 3GNSA 3X2FA 2JD1A 2AE1A 5BT9A 1E5QA 2Y1OA 4Z0TA 3FRJA 2UDPA 2ZB8A 2CY0A 2O50A 4FCCA 4L4RA 1HDYA 2V6GA 4ITUA 4XEHA 4IXTA 3GOHA 3WYEA 3GVIA 4M87A 1LXCA 4RVGA 2X58A 2ZB4A 1S6YA 6LDHA 3IDSA 3NRCA 4IGEA 5BSFA 1PGPA 2W2KB 3DTTA 3C1OA 3H9UA 3BIOA 4E21A 4BL5A 1ZO8A 1ZVMA 2I3GA 5CPFA 4RVDA 1B16A 2AXQA 4BMSA 2YV2A 5L7WA 4B7XA 3VZPA 4GQAA 4MVJA 1YL5A 4IPTA 4TRMA 2Q4BA 1RYEA 1T2FA 4R1SA 4GX5A 3S2IA 4UUNA 3O8QB 3LZ6A 1ZW1A 3OQBA 4R16A 3E82A 5L40A 4S3MA 2B4RO 3FCOA 3UICA 1NFQA 1V3UA 3P5SA 2ZB3A 1GUYA 4D42A 2PLAA 2Q1SA 4E12A 3L4BA 4R69A 5GZ6A 1XELA 4GH5A 4RVSA 1LNQA 2FR0A 4K26A 3U9LA 2Q46A 5B4TA 1X15A 4MP6A 1V35A 3WR5A 5FEUA 1I2CA 4TRNA 4M89A 4P8RA 2X4GA 4QEDA 4ZU3A 2PNFA 3NYWA 4AJNA 1TT5B 1W73A 3JD1A 5AXCA 4JGBA 1EK5A 3MTJA 4BO3A 4B3JA 2JD2A 2JFGA 4GGOA 1E7SA 4D3FA 2NADA 2WJPA 2J3HA 3U4IA 4I9HA 4BNIA 2E37A 1KY5A 1U8XX 4NBWA 4BNMA 3PTZA 4BHTA 1BTOA 3KYCB 3RBZA 3CINA 2O4UX 5BNIA 1QORA 3WGYA 5CP8A 4E5MA 3HE3A 3QIVA 2ZATA 1B7GO 1OI7A 1UXGA 1A7AA 1DFIA 2I65A 1VLLA 4PLTA 3K92A 2VCYA 4UAGA 1OFGA 1P45A 3WFJA 3K5PA 2IODA 4GKBA 3LVFO 3C24A 3L07A 1PJBA 3IUSA 5KVSA 4LCEA 4R1UA 1LDMA 5IXSA 2X6TA 1YS4A 4BO9A 3FNEA 2BH9A 3I5MA 4KWHA 4NBVA 4FC7A 3W4KA 1J0XO 2JKVA 4DIOA 4E2ZA 4RVUA 3D3EA 3DZJA 3Q11A 4XGIA 3L77A 5L4SA 3RUIA 1KEUA 4K1LA 4RLSA 3JYQA 1IOLA 3HFSA 2V6FA 2VOJA 1PJ3A 4ILKA 1PQPA 1P74A 4PLYA 1DFGA 1BVRA 3TZ6A 1GFSA 2W8ZA 4BKUA 5B4UA 2HMSA 4ALKA 3GAFA 4CLXA 3K31A 1DLIA 4G2NA 1TA4A 1C1XB 2EF1A 3AFNA 3PIIA 2EIHA 4YQYA 4BGVA 1AE1A 3ZZNA 2FPIA 3RQSA 2HCTA 4E30A 2B5WA 3TL3A 1YDEA 1IULA 1ZJZA 1DIAA 2B4QA 2ET6A 3UOGA 4YJHA 1D3AA 1JVBA 1FDSA 4U0KA 5G0VA 5I9LA 8LDHA 3ANMA 1YOVB 3D1LA 2CVOA 1E5LA 3DWFA 4C4OA 1FDTA 4NI5A 4HUJA 3W4IA 1A5ZA 2YV3A 2VWPA 4TVBA 4E33A 5TIIA 3GVXA 3K30A 1MX3A 4L75A 4IQGA 1UH5A 5HWSA 1SC6A 3O03A 3R1IA 3UN1A 4XYLA 2P9GA 5TC4A 2NUAA 2O23A 4RCVA 4Z6KA 5DBIA 1HDOA 3F1KA 1PJTA 3W1VA 1P1IA 4IQ8A 2DUUA 4HFRA 2JHGA 4RZIA 3OA2A 1EDOA 3INGA 1PZEA 5EIOA 1ENPA 2Z95A 1A9ZA 4PLHA 1Z74A 2HKIA 3L4BC 3NV9A 3DZIA 1V3TA 3LT2A 1YOVA 1ULUA 1VJ1A 3FBTA 4YJGB 4Z0HO 2G0TA 4OXYA 3O38A 4IXWA 3GN2A 1IL0A 2V7PA 2VUSA 2WYVA 3JQFC 4WNIA 2VTEA 3MZ0A 4IQ0A 4TZKA 3ZU5A 4W82A 3D0OA 4J91A 1ENOA 4FJ1A 1RM5A 4CM9A 3A28A 5BNTA 5EESA 5FI3A 5KJCA 2IDZA 3JQ7A 1CJCA 3ONFA 3NT5A 5K6AC 4XJSA 4R5MA 2O3TA 1F14A 3IP1A 2ZTLA 5JS6A 1I2BA 4QT0A 1PJ4A 3BMOA 4G65A 4NG5A 4I5GA 4NBTA 4BNTA 2QYSA 1ID1A 1L1FA 1WXDA 2EKLA 2X22A 3OJFA 4CV2A 3GF4A 2W2LD 5TX7A 1ZXLA 4BKQA 1A7KA 1QV6A 3R3JA 3ZWPA 4NR0A 5HA5A 1LSJA 1DOHA 3A4VA 3VTZA 1Y9AA 4B4OA 2IXBA 1WZEA 4P4LA 3ZWOA 1YWGO 4Y98A 4NJMB 1PIWA 2GYYA 4KQXA 5J23A 5JCXA 3F5SA 4J7CA 2XPCA 3WNQA 1ONNA 2PH3A 4HP8A 4B7CA 1I3MA 4GLOA 4XJTA 1E3EA 1B3RA 1ZBQA 1IUKA 3PWZA 2Y1CA 4DLBA 5L9AA 3R6DA 4ESOA 1VSVA 1ZUD1 3H3FA 2HAEA 1WDMA 2DT5A 3CE6A 1NM5A 2NM0A 3DHYA 4JIGA 4DIBA 1ZNQO 2OOSA 4Q3AA 2VYVD 2AW5A 3ABIA 5KVQA 2W90A 1T1SA 4J1TA 2POQX 2PFGA 3HN7A 4PRKA 1Y8QB 3ASUA 2HDHA 5F1PA 4DGSA 1K89A 4MVJD 4RF3A 4EUFA 4PG7A 2CDAA 1GAEO 4GX2A 4YA6A 3A9WA 3VDQA 5ICSA 4D7AA 1DC4A 3Q3CA 1YBVA 4TSKA 4PLGA 3IKVA 2G82A 3PJDA 4FN4A 4RF4A 3RU9A 3D4PA 3D3WA 2VWGA 4Y6RA 4JCOA 1ISFA 1GTMA 4I5EA 1PR3A 3E8XA 3QVSA 4BNUA 5IAAA 3OA0A 4CM4A 2VNAA 4FOOA 4YRDA 3TOZA 2NLOA 1YJQA 1PJLA 2X0IA 3DZKA 3BMNB 4LSWA 4N18A 5JCJD 4XKJA 3ZHYA 2DVMA 2Z1NA 1TEHA 3LU1A 1ORRA 3JV7A 4R3NA 1ZK3A 4N5MA 3VHRA 4BNHA 4DRYA 2BF7A 1B2LA 2WWRA 3AI2A 3NGXA 3DBVO 5CPBA 2VYND 2X0NA 4YTEA 1JLLA 2NVBA 3FI9A 4CR6A 3OECA 2NVUB 1X1TA 2ZYAA 3ZI0A 1W6UA 4JP2A 2BGMA 2QYTA 1B8VA 3L9XA 4PLWA 5L95A 5DOZA 4K28A 1HLDA 1SB8A 3GH3A 2VHYA 3EY4A 1H6AA 5CDGA 4RPHA 4P22A 1KBZA 4L9RA 2GZ2A 1AXEA 2Q1TA 4PRLA 4MDHA 4DLAA 4WE3A 4WCFC 3DBHB 1H93A 3HDJA 3ZW8A 3KRTA 4MPDA 3FR7A 4EJ6A 2YHIB 4CV3A 3ZDFA 3E6AA 4WCFB 3EK2A 3BMOB 1ZEJA 1EVIA 1PZFA 4BO4A 3FR8A 4GL4A 3DBHA 1P0FA 4OKNA 4UVIA 4GWKA 3DAFA 5KNLA 1PS9A 3OM9A 4QUKA 1T2DA 1TVEA 3DBRA 4N5LA 4XIJA 2A4KA 4F6CA 4TVOA 3JQ7B 3PXXA 3GQVA 1YE3A 4RO0A 1G1AA 2YUTA 4RVFA 1AHIA 4Q3CA 4CM5A 1OZAA 1U7HA 3NT2A 3HDQA 1YVEI 1ZCJA 3DDNA 1Y5MA 3SX2A 2GUGA 3QVOA 4YAJA 2P2SA 1VI2A 5DBFA 4BQPA 4QFDA 1NVTA 2FP4A 2G5CA 4IDAA 4GMGA 2AQIA 3I9MA 1BXZA 3JYNA 4CM7A 5IJZA 3INTA 5ICMA 4CMBA 3P7MA 1QR6A 3PQEA 1MFZA 4E4YA 4TQGA 5CDUA 4MVJP 3E18A 3FPLA 4JK3A 5I9NA 4E31A 2EW2A 4OL9A 1V3VA 4B3HA 3OHSX 3DAGA 2AG5A 4CMCA 4EGFA 5JNLA 2DPHA 1UP6A 5AVOA 3EAGA 4YJFB 3PDUA 1I8TA 1N5DA 3FTPA 1GUZA 5KJEA 3MJTA 4XR4A 1Q1NA 5TGDA 4M1QA 4WLUA 1XU9A 3WTBA 1H0KA 5IDQA 2GR9A 3KSDO 3VTFA 1ISJA 3F1LA 4Q39A 3IC5A 1SEVA 1WDKA 2CMDA 4YPOA 3M1LA 4D44A 4A27A 4C7KA 5BSEA 5L51A 2O2SA 1QLHA 2JFHA 4JBGA 5DCYA 1ZKMA 1ZK4A 3Q6IA 1Q7BA 1PZGA 4K6CA 4OMUA 2H9IA 1M75A 5GMOA 1X7GA 4WPGA 5BSHA 2P4HX 4BV8A 4ZA2A 3ZWVA 1P0CA 3EZLA 2FPGA 3DO5A 4CLRB 4HXYA 1PWXA 2GN6A 1E3JA 3RUFA 3VH2A 2VTDA 1WWKA 3RVDA 5KVVA 4L73A 1Y8RA 5DP2A 5T8KC 1DJNA 2UYYA 1KC3A 4WCDA 4YAEA 1F0YA 4LMRA 4CM9D 1IHYA 4DA9A 5C7LO 4IMPA 2P5YA 4U8GA 1XCBA 4WOKA 5CG2A 1JWAB 1Y9EA 2V6BA 1NHGA 2QW8A 4LMPA 5DBGA 5A3JA 3PLNA 2A94A 4Q3DA 4OJNA 3TFQA 3T7EA 4YAKA 3TOXA 4CMJA 1BSVA 3ZH2A 1SAYA 3F9IA 4QTZA 3ROQA 3PHGA 4E0BA 4BB6A 2PTGA 4YT2A 4H15A 1KOLA 1MXFA 2EHDA 3GDGA 4FGSA 3VKUA 3CMCO 2P4QA 1QYXA 5G0WA 4W7HA 4OXKA 2YYYA 5HTOA 3QHAA 3GG2A 3FWZA 1KVUA 2EGGA 5TT1A 3JYPA 3JQBC 1NR7A 1P1KA 4DPMA 5GZ1A 1V9LA 3ANLA 1EK6A 1K2WA 5IZ4A 2CZCA 3I4CA 5BQFA 1GYPA 2FN7A 5HM8A 3FD8A 2BELA 3DMYA 2Q2WA 2J8ZA 4GAEA 3W8FA 5JY6A 1LSOA 3ADPA 3JCZA 3UH1A 2GD1O 3ZV5A 2Y66A 2C2YA 1FMCA 4BMNA 4CQMA 2G17A 3N58A 1DIRA 1IZ0A 5GZ3A 5JO0A 2C7VA 4EEZA 2RHRA 1JAXA 5KOIA 1NFRA 3H8VA 2PGJA 5DT9A 4YT8A 2X0JA 3OJLA 1Z73A 2HSDA 1SBYA 1Z75A 3GAZA 1I3NA 4B79A 4XB2A 3S2GA 5A1TA 1R66A 2XF8A 5CG1A 4A5OA 1EDZA 1R16A 2E48A 5B37A 1YQGA 3KEOA 1GCOA 2I5PO 3ZHBA 1H9BA 2VNSA 3M6IA 1PSDA 1UAGA 3L4SO 3F3SA 3NDIA 1FK8A 2OBNA 1P44A 1Y6JA 4NU6A 1A9YA 4BNGA 4D43A 4EEXA 1Q0QA 3AM5A 2Y93A 4DREA 3DHNA 4YRBA 1KVTA 3JQDA 1UDBA 5JCJA 1NYTA 2PD6A 4R41A 2NSDA 3BMQB 1EQ2A 3WLFA 1PL8A 4F3YA 3JD4A 2DFDA 4IMRA 2VN8A 2YZ7A 1JU9A 5L53A 1R0KA 3WMWA 1VJTA 1YDWA 4ALJA 3BXXA 4BUCA 3ITDA 3TWOA 4EJ0A 3RC2A 2EEZA 2NTJA 1L7DA 2O3UA 2HK8A 2O7QA 2D4AA 4CMHA 3FPCA 1JAYA 5A5EA 2F1KA 4J1SA 1SZJG 1BG6A 4MVJF 3M2PA 4IZIA 3QA9A 1F17A 3E03A 1KVQA 3WBBA 4OGWA 1GY8A 2NU7A 3F6YA 4R51A 1NPTO 1QYVA 2J3JA 4J90A 1XR3A 1VSUA 2RCYA 4X54A 4ZQFA 5EL0A 4ZVVA 4UREA 3RUHA 5IFLA 3GEMA 4M8SA 2V6MA 4GLLA 1HYEA 3KLMX 2VHZA 5JDIC 1YB4A 1T2CA 5THKA 1BRMA 4R3WA 3L6OO 3S55A 2JHFA 3QQPA 4CV0A 3WB9A 2Y0EA 5IZCC 1BMDA 1NFFA 2PKRA 1ZEMA 4GSLA 3I23A 3I4FA 3S8MA 3IQDB 3VPGA 1UZNA 2RHCA 1U28A 3HG7A 2HMVA 2HUNA 5I8ZA 5KCZA 4DBZA 1SCUA 4U0JA 1EMDA 3TZQA 3CMMA 3IJPA 4ID9A 4AJKA 4CMKA 4CJXA 4ZD6A 4A2CA 4IUYA 1U3VA 4TROA 3HADA 1DC5A 4JJFA 1WLYA 4BNYA 1UAYA 4MJLA 2OL4A 4ZQEA 1PWZA 4OH1A 1ADGA 1T25A 3GVPA 5TT0A 4RL6A 4E5KA 5ENVA 2OORA 3OICA 4I9UA 3VPSA 4XRGA 5JDCA 3TZCA 4BO5A 1D1TA 1PU2A 1YBMA 2HJSA 3KXDA 1BXKA 2WEKA 4JBHA 4GSKA 3FSRA 1KY4A 3H9EO 4I5FA 4BGEA 1Z82A 4KUEA 1MXHA 3A14A 4O5OA 4XYBA 3DMTC 4IIUA 3I9LA 1X13A 2DTXA 1SOWA 3H6KA 3BAZA 3DONA 4EUEA 4DPKA 1XQ6A 1M6WA 2DC1A 4E2WA 1I2ZA 4KOAA 3PHJA 3OSUA 4L74A 3LC1O 3AOEC 3VPHA 2Q2VA 4CLDA 4Q3EA 3Q2KA 1BW9B 2X5OA 2D1YA
chains in the Genus database with same CATH superfamily
4KVGA 1CULC 1OILA 2PGLA 3NX4A 1L7NA 3SNKA 4CR7A 2WD7A 1Q17A 5LLDA 2B69A 4UCXA 4HFJA 1G0OA 2UZAA 3IOEA 5LWHA 2VSFA 3PPWA 2WE7A 2ZPUA 2A58A 2GTHA 2ZZNA 1OFVA 3OIVA 2QZZA 4PHCA 3DT8A 4DM7A 4LF9B 2G1KA 4IV5A 4P0PB 1MUUA 3H19A 1CLUA 2GF9A 2IH4A 4ZMBA 1GV1A 2YN2A 4Z5XA 3RAFC 3AUJB 3VJLA 1XIVA 1L8QA 3H2SA 2YQ4A 2BTQB 3CZAA 4DDWA 1MAAA 1OR8A 2A86A 2YWRA 3CH7A 3M33A 1OD6A 2N75A 3KVRA 1ZCFA 4XGRA 1J0DA 2K2QB 1SKBA 3PWTA 5LP6F 3ZZ0A 2R84A 3I2GA 3EZNA 4I50F 3QVUA 1VCIA 4I55B 2YXDA 4TTJA 4ENQA 1LDEA 1FDRA 2E4UA 3R0ZA 1LLQA 4FMDB 5DN9A 4MEBA 5A5VA 2RAUA 2PXAA 4B6JA 4ZI7B 3KV3O 2HQBA 5EIBD 2JH9A 3IXMA 2DKNA 3MXTA 4R0NA 5ESWA 3V1MA 4D9CA 2OCYC 1RAEA 5DLDA 5FFFA 2WSBA 3RVJA 3F49S 2PWPA 2QTCA 1PYDA 1I2AA 1O95A 5FJIA 4D92A 1B6GA 2P3OA 2J5KA 3BGIA 5HCIA 3UCFA 3WIOA 5JYEA 3V4RA 3PHBE 1ZCBA 5JE8A 1C3OA 1VSTA 3IJRA 1UC4B 3COWA 2FFHA 1XZPA 1H8HD 3HO6A 5D7BA 3PLRA 4M53A 1BIFA 4FFWA 2ABWA 2BHNA 4BLQA 3O83A 3TIGA 5HZGA 2WTEA 4OH7A 4XDHA 6REQA 3K9HA 1UR5A 4O59O 2FOIA 2P0EA 2PBFA 4ZK2A 1AUXA 2OFWA 3K4HA 1EVJA 2FPKA 2IEBA 4HNQA 1I7DA 3OBBA 1OMOA 2LV8A 2NWQA 1RYBA 1YDGA 3V1LA 1OZFA 3IQGX 4KTVE 1T5DX 3UAYA 4A8JB 3RJZA 3GZJA 2P8SA 5KOYA 2PN1A 3FDIA 2NP6A 1X0XA 3ZCPA 1VECA 2NSHA 4Z3DA 2YINC 5F5LA 3FOAA 9GPBA 4NCBA 3U7IA 5BORA 1V37A 2IITA 4LK2A 2BWJA 2J5XA 3A06A 2JGEA 3JS5A 4DCOA 1NVVQ 2F8TA 2I8CA 3O7WA 3WYAA 2BBWA 3WWYA 3D2BA 5F35A 4A82A 4EPRA 5ALGA 5E9QA 4WZBA 3RO7A 4F3NA 4W4TA 5GY7A 5FULA 2H6EA 2OHIA 1GR0A 1ZUWA 4J0GA 3CEHA 5C8DA 4GBED 4M8KA 2XKJE 1XYYA 4X1IA 3TI7A 1CZNA 2ZULA 3BXFA 1FLVA 4CQMD 2FSPA 4Y2XA 4A9AA 2ISSD 1M2HA 2FJUA 3B1YA 2PL9A 3KK0A 1YR3A 4RX1A 4BNLA 3OEHD 1GG8A 4JLNA 2WKWA 2ZSEA 4JMPA 4NMWA 4B74A 3HU5A 4EB0A 3TSCA 3U1VA 2HEIA 1JEYA 1UKAA 2HF9A 3BF8A 5L7YA 4YDHB 2Q21A 4KRXA 4NZYA 5IN5A 5I7EA 3GC6A 4G24A 1Q91A 1TECE 5LQRA 1MP0A 3F5QA 1UXJA 1KSHA 1LLDA 1ZIPA 2DUNA 1VBNA 3AR5A 1MORA 3ILSA 4J6EA 1U2SA 3B1FA 1SQGA 2R11A 3MYRA 3H0CA 1FA9A 3KQTA 5M7EA 5T4HA 1HE2A 1ZJ4A 2FVYA 4OLAA 3H13A 2F3PA 3D4LA 3PGJA 2ZT5A 3K96A 1P1JA 1Z33A 4NESA 2DBYA 5KX5F 3VTAA 3L41A 1A3CA 3WFIA 2GN8A 4FXOA 3HMKA 4JGIA 4YBRA 1RWPA 3PXDA 3Q8WA 3SDSA 4PLVA 1JLHA 4QOFA 1VHTA 2AC7A 3CR3C 4W9MC 3CT4A 1ELOA 3IALA 4U3JA 2EIXA 2FWNA 3JQCA 3AI7A 4B3DA 4MWEA 4QL3A 1Q16A 5FNVB 2XMBA 3X2EA 4Y1FA 3D6MA 5GJBA 2A9QA 2XKBA 2R86A 3LOPA 2B2CA 4ABYA 4DMLA 3ZLUA 1UBCA 2R66A 2GD2A 4XUGB 2UAGA 3DAYA 2CLLB 4Q12A 4RLHA 4JYAB 2Z56A 2YASA 4P3PA 3G85A 2CXSA 5HILA 3HCEA 2GZ3A 3BHIA 3DL2A 3PGVA 4R2JA 1ILEA 1TVKB 4BFVA 3Q98A 3OZCA 1A5BB 3DLIA 4YP9A 3MEQA 4G25A 2V65A 3KQVA 4TMVA 2OP0A 3GJ6A 1LQTA 2RHTA 1NQ5A 4LYGA 3VH1A 1KIFA 3OUUA 4RAOA 3RE1A 3W3AD 3W78A 5DCLA 2C5AA 1BN6A 3GU3A 5EP3A 5IAEA 1C0KA 2B7LA 2XA9A 3WNCA 3ZCRA 2BYTA 2XSZD 1HEUA 1KYXA 2IEDA 2MYPA 2QUIA 4JQCA 3ABRB 4DN6A 5CAEA 4KUGA 2WQ7A 1QPBA 3GUUA 1FX0B 1HH4A 1QLJA 3LT4A 1W6RA 3KB8A 1M5TA 1BVUA 2ZBEA 3JAMA 3GLIB 1NQOA 3JD0A 1FDIA 5A4MS 1U2ZA 1CR0A 4HMQA 5EN4A 1GZVA 1XDUA 3QHQA 3THSA 1BX3A 3R6LA 4QBFA 2ZYGA 4UASA 2BC9A 3GMSA 1IJBA 1DFHA 2NZ2A 3MFQA 3TOCA 2P9CA 4DHEA 1HETA 1EVEA 2FP4B 3DE7X 1QHXA 3E9NA 4JLUA 3TSZA 3ZHOA 1SPBS 1XFDA 2BW0A 4RC9A 1UMBA 3AKDA 1BOOA 4HDRA 5HW0A 1HDZA 4RABA 3QSGA 2WPDD 2M6RA 4TKVB 4GOXA 3GJQA 1Z0FA 3DXYA 4ZOBA 5ILOA 4FQ7A 4JC0A 5DNAA 4HQLA 3TAXA 4KQ2A 4MKFA 2F48A 4QICA 4YCCA 5CCXA 4A0FA 3K9QO 2CNBA 2H1WA 3PUHA 3UM9A 2MMCA 4OLBA 1IWPB 1NJGA 2ERCA 4B5LA 4LECA 4UMEA 3U09A 5IM4A 1YULA 1SURA 3KVVA 3ROXA 1BROA 1QAMA 3INRA 2FHPA 1G8AA 4JSRA 3LHKA 3CNQS 1GU0A 1QANA 5AOVA 2OMKA 2JH8A 2WUWE 4NJEA 5IVKA 3ZLJA 3PXUA 2CSXA 1RC0A 3FF1A 1DS6A 2Q5IA 4RJKA 5HDQA 3VH4A 2R2GA 2VDWA 4OB6A 4ZHQA 4LF6B 1AMNA 3UXYA 1F8GA 3IUNA 5AYVA 1GG5A 1F2TB 3ZW9A 1GYQA 1RAFA 3KFVA 4X9XA 5K3SA 5EZQA 1R18A 4OQZA 3AVTA 1LUAA 4M1ZA 5EKUA 1QIKA 3PYLA 4DCSA 5KPJA 3B52X 2AQ8A 3UV6A 2PWBA 1DWUA 1SXJC 2QX7A 3HJNA 4PZPA 1OPXA 2B37A 7YASA 4OGGA 3RREA 2O0MA 3CH4B 2O2IA 1QGDA 2B98A 4QYXA 4RHCA 4ZOLB 1C0LA 2Q28A 2VSQA 4QARA 5MF6A 2C5EA 1Q7GA 4OYHA 2F00A 4EKYA 5LKRA 2UZ4A 4AQYB 2FDCA 4EHFA 3QU9A 2H1OA 3QPBA 4IH4A 2JL1A 4CIWA 5JXWA 1I24A 3KOMA 4UEKA 4QXAA 4A6DA 3GUHA 1QYIA 1WV0A 1AB5A 4UBIA 3AUYA 3LKBA 5CDSA 1BGVA 2ZT7A 4G1EB 4MQUA 4Z1OA 5M3BA 4FT4A 1AGNA 4MV4A 5TLSA 4MUMA 4FZJA 1XRMA 4MP8A 3WP0A 3D5EA 4MWCA 2BLNA 3RSGA 2A84A 3FVQA 2IYSA 4XX0A 4XWTA 4JHXA 1L8LA 1V5IA 2EC5A 2AVDA 3STUA 3AUTA 1A9PA 2WJHA 5F21A 4WLNA 1G21B 2E6UX 3TW8A 2AXPA 1F8UA 2MSKA 3KOUA 2IEZA 1P0PA 2H52A 1JVSA 4K87A 1IZZA 3G0DA 4PLFA 1E6LA 3FROA 1HGXA 2VP3A 4RNCA 1CQPA 3O2JA 1KFKB 1Y37A 3BWMA 3QVKA 1SBZA 4JB8A 4TMWA 5AVJA 4F3TA 4R1OA 1V16A 1BX0A 4IDHA 5EG5A 1OOEA 1VMDA 4WY2A 1LH0A 4HPJB 4YY3B 2Y76A 3ID6C 5C0OE 1NBHA 1T34A 3B2EA 3L18A 1BYIA 4KJXA 2WW8A 4X93A 1ZIYA 3FMFA 5AJYA 4P9NA 4ZVLA 2R60A 4MQEA 4F1KA 2BD0A 1Q2XA 4EL0A 3GJ0A 4B9AA 4ER3A 4FSDA 5G4KB 3RHTA 4ROSA 3NKVA 2QLJA 4NFLA 4TKUA 3GVHA 1ZIOA 2E4AA 1XAJA 3AXTA 2R6DA 1SVLA 1L8OA 2JJMA 2VA8A 2Z8YA 4YUZA 3KXLA 4F8YA 3AUXA 4NE7A 2PIDA 4AJ1A 1DRWA 2Y1DA 3TTYA 4I4LA 4P5DA 2X41A 2YKGA 2A9KA 4I6JA 1SUEA 5DK6A 5AM4A 4JJZA 2DULA 3WMEA 4C14A 4WHMA 2FMFA 4JP1A 1D0IA 5FJJA 1GNRA 3TNFA 3WLLA 2Q5LA 1KYQA 3F6EX 3RUAA 1ZH2A 2UZIR 4EG4A 5DIZA 2IPOA 1PR0A 3PZBA 4UBKA 1IPEA 3K8QA 2D0OB 1NNI1 3IULA 4EHIA 4DZRA 2HCRA 4GD3Q 5KNDD 3AUUA 3R9KA 1SHKA 4OKIA 3H4VA 1I51A 4MAMA 3ZJTA 5LP1A 5EGSA 1X77A 4EDFA 1ODIA 5IG2A 4OBBA 1ZAKA 2GTIA 2PSSA 3ABQB 2QZPA 2R1TA 3EMVA 5GM2A 5K0ZA 1H5QA 2FPIB 2GAIA 4CUZA 1ZM4A 1ZM7A 3JRNA 3ZQKA 1XCMA 4OO3A 2WMNB 4AN1A 3EEOA 2CJYA 3HFGA 4KTTE 3KDAA 3OZTA 3PSAA 1NSTA 2IXFA 1N7JA 2P67A 3AIMA 3OQJA 4FX2A 3TLYA 5J2UA 1O5IA 1UPAA 3A2MA 3VXKA 2PCLA 2QE7A 1WU7A 3JQAA 5FUXA 3H65A 1XWFA 2GYVA 1OBVA 4JI0B 2OKCA 5K0BA 2IF2A 3BDVA 3PNYA 5AK4A 1UPXA 4MTLA 3K2EA 5F76A 1IBKB 3OMXA 1WP4A 4PZCA 1EHIA 4HDAA 3EYWA 3RIEA 5A1JA 3IOCA 3CZRA 1UWLA 2X14A 3D0RA 3OWHA 3DGEC 4GGMX 2KJQA 1Z37A 2WKSA 4IIJF 4M0EA 3H87A 5IM5A 1WUJS 5ILQA 4OD0A 1N34B 1EXDA 3H2JA 1E1LA 2OECA 3AF6A 5F7XA 4J94A 3U49A 3WDSA 1VG1A 1TQ8A 1X7ZB 2VJDA 2JGNA 3EIWA 4NU0A 4HJRA 1W4BA 2A5DA 4RXUA 4TKVA 2PUAA 3RC7A 2WG0A 2C5FA 1ZWKA 4ARZA 3A58B 3I2JA 4U6QA 5LYJA 3GGPA 4QTTB 1E6EA 4FYMA 3SSMA 3RIYA 1NUSA 2VRNA 2XWBF 4XFDA 3RU7A 2CL7X 5KYNA 5AJTA 1YKSA 4FUQA 5JJIA 4GIBA 4BO2A 4DLRA 2P2NA 1FDVA 2BHRA 3PDIA 4Q3BA 1EKXA 4F93B 3WWZA 3ESXA 3NT4A 3ZCQA 5LDDC 3FSEA 2ZDHA 2I6FA 3DXZA 3FVRA 3KR0A 4HY3A 3OX2A 4MR8A 4ACAA 2X8LA 3MWDA 4S0ZA 4KGZA 4J43A 4RQTA 3ROKA 1PZXA 3ORSA 1D6NA 3ZK9A 3LCUA 2ZYUX 1HDCA 2C5BA 5H5JA 5REQB 2C58A 3NZEA 3W04A 4D5GA 3CUSA 4DPLA 1E3MA 5IKOA 3TKLA 4YBZA 2YVLA 4IIDA 4UQPA 3IMFA 1GFZA 2IYWA 1KDRA 3I39X 1W9MA 1NF2A 3BXGA 1TMKA 1I3OA 5BN4B 5JJCA 1TTHA 4OYYA 4W9NC 2F7SA 2Q99A 4PONA 1SC9A 4LBVA 3FOWA 5DW0A 1Z39A 5I7UA 2AW3A 2PDAA 3OMWA 2JA1A 3F7NA 2J3MA 2ZYHA 1KA9H 4FFLA 4NNJA 3HM9A 2AN5A 4BXOB 3RHSA 5A06A 5GGXA 1LWNA 3UJ7A 3EQ2A 3Q0TA 1RM3A 2YWEA 4MW0A 3WJ7A 3R3ZA 4X8LA 5IEJA 5IMBA 1B8PA 2DM6A 4QDJA 4YIHA 4LE2A 5FBZA 2YMQA 5DBHX 4B7UA 3M83A 5DNVA 3DMFA 4JU8A 4FMPA 3VBCA 2GA9A 2YV1A 4QPCA 3UMGA 1V8ZA 1G5FA 1O6GA 1P80A 2DECA 4LYJA 4Y6QA 3QI7A 4QWWA 3K9FC 2CNNA 1P0IA 2PLWA 4PG8A 3DE6X 1B93A 1EX6A 4FBGA 4NKRA 1Z2PX 3RASA 5DYWA 1UJMA 3C1TA 2YICA 4PYLA 2DH6A 3IDQA 4B2YA 4MR9B 3LLUA 2O19A 1UINA 2X40A 2IZZA 2H29A 3MLAA 1G8SA 4U9UA 1CERA 3ZBPA 2UXDB 3C74A 3KWJA 1XPJA 3LZDA 5HF5A 1KZHA 1EESA 2JCXA 2P6MA 3JQQA 3JQBA 1W2GA 3ZDXB 3P0RA 1J21A 1KTIA 5B64A 1MVOA 1ONPA 2AI2A 3VJKA 3R3SA 2QU8A 5JWOA 1TYZA 3DVRX 3PC8C 2BMJA 2FLWA 4K6KA 2FWPA 4UNNA 5DO9A 2VP9A 1BDHA 3NTQA 2GVDC 3CC8A 1YJXA 3VUFA 2GCEA 3F47A 1WE2A 5FUBA 4UUPA 1DXQA 3PDCA 3H84A 3MWFA 1F2VA 4DLVA 1PNVA 5TSDA 4J0KA 1NQWA 1E9DA 5JSQA 3PENA 4QX6A 2AHRA 4Y2TA 4R1TA 4YRTA 5EWJA 2AFHB 1V8BA 2V7UA 5AMXA 4PN3A 3SIRA 2Z3WA 3BTSA 2GVNA 2QZJA 2ZS7A 3PT9A 4BFYA 2ZT6A 3O94A 2PYIA 5G4LA 2VBIA 1R0BA 3BK7A 3L7OA 4GI3A 5KTKA 4AYWA 4DFDA 3JALA 4DW8A 4RJIA 1AMUA 2B82A 4TL9A 1TM7E 4BB0A 2WBLC 3PE3A 3O2NA 3ZWXA 2H8KA 2JC3A 4OGKA 5B58T 4AMVA 2WNSA 5KJ6A 3H99A 1J5XA 4UATA 3V2UA 2C4HA 5BY2A 4ZVOA 2HMYB 1OC4A 2B1RA 2QTWB 2XUFA 4GKJB 2JKYA 1UXKA 3H75A 2Y0DA 4K9RA 4CDMA 2VPQA 4LZNA 4ZO8A 2BMFA 3FM9A 4LNUA 5DYNA 5FORA 1E6WA 3TIIA 4UM9B 3OY7A 3TR0A 4E5YA 4RV5A 1QIGA 4Y67A 4LOJA 2XZLA 1UUFA 1XNGA 5HOEA 4X41A 4D79A 4A26A 5EUCA 1LBEA 3VNSA 2XRFA 3QKSB 4G4SP 4I4CA 1SOAA 4ZVQA 4EKNB 3Q1KA 3PJGA 1I1OA 4PN7A 2O8FA 1GN8A 4CT4B 2PV0A 5KYGA 1M2EA 3PHHA 3TLCA 3ZU2A 3GBSA 2P2ZA 4PLCA 3EGDA 3JQAB 2XODA 4ZICA 4W5NA 3MWEA 4W6QA 2ZU6A 2I4IA 1NPDA 5M5BA 2QQFA 1DBPA 4X0EA 4KBYA 1OBHA 4OQLA 1IB0A 1HY3A 1OLUA 1M0WA 2G1AA 2ILVA 5IC6A 1EEXB 3DMRA 1VDZA 3CKYA 1CCWA 3IOMA 4RYDA 4C6TA 4GMDA 2GO1A 3ZUPA 4DMCA 1SIWA 5FI1B 1Q1AA 1CFJA 4TT3D 2QVXX 3E35A 4F3CA 2X8WA 4P3KA 3QVWA 1S1CA 1U3GA 2CVPA 4XTRA 4WZAA 4ZYLA 2X0DA 1ZGCA 1NX6A 3O1HB 1CV2A 3QE3A 2J6HA 5CXSA 3EFEA 1MD9A 2GN4A 2NYUA 3HKBA 1NVAA 3K0HA 4HVAA 4QAJA 2GZSA 3MF4A 1SK9A 1I3CA 5F77A 1XLTC 3LOQA 1MHTA 4INAA 4AL4A 1VJ0A 3VJMA 4PX2A 4C4XA 1HOXA 4V0OA 3UWSA 1O8CA 4UTNA 5KNDA 1SO8A 2OC9A 3G8DA 3FPFA 1R88A 1HTTA 4JNKA 3HCOA 1ZCAA 4WBNA 5DCWA 1SELA 1XTVA 2F43B 4P6VF 2RKOA 1OPRA 5EQTA 4EAQA 2Q45A 4EW2A 2FSVC 4KSBA 4AS3A 4C88A 3GRPA 1P29A 2PEZA 2HTEA 2ONJA 1XMOB 3BHNA 3QX3A 4RESA 3TLXA 5EZ6B 4W5WA 5HOQA 3MJ4A 1IHXA 4MUGA 1L9XA 4L8FA 3IELA 1W49A 2A3RA 4JYBA 4OXIA 1R4ZA 2E4YA 3EW7A 5SZKB 2RHBA 4RMGA 4WLFA 1MO4A 2QG4A 3T7KA 4YCLA 1LI7A 1XDSA 3FSGA 4MH0R 1WLSA 2ZVDA 3QY9A 1KJZA 4LVUA 4UAVA 4GPEA 5EEHA 2PUVA 2CNOA 1WHTA 3QE9Y 2VZ9A 2PRSA 4HAIA 3O9VA 1Y1SA 3R7LA 4WKCA 3G6WA 4YT4A 1EE2A 4HQNA 2A0KA 1M6NA 2PD3A 5LP6B 3MJCA 3TIVA 3ZDZB 2WMDA 2Z5GA 1MEJA 4KR6A 1O9GA 1Z0DA 3IQWA 4I55F 3KR2A 4MWBA 5FB3A 3OM1A 3FDZA 3KJXA 4G4GA 1I9CA 2OLJA 1ISMA 4ZOLA 1QX4A 2HOQA 3CHYA 2I1WA 4MQFB 4C0SA 3BWBA 1HUQA 1HSOA 1MR3F 4KE8A 4HAYA 2CDBA 4RGBA 5CVEA 3RVKA 4AY6A 4IDGA 3ZUGA 4CN9A 1TCUA 2VYFA 1TCCA 3I05A 4BQNA 1BXRB 2AF4C 2D2VA 4N49A 2DPYA 5JNTA 1Z6YA 2QPTA 1K5DA 2WHRA 4GYKA 4YIKA 1GDDA 1SBHA 3AVVA 5L4LA 2QRVB 2Q6OA 2RGXA 2OHXA 4Z4CA 1KFJB 2VT2A 3VC3A 4OX9B 3JRWA 5KYXB 4NHEA 1EFCA 3PG5A 1Y8ZA 2XUKA 2DLCX 4G5YA 3W5DA 1MZPA 2GRUA 5DTEA 3Q2OA 1UOQA 5CCEA 2DFVA 2W58A 2FY8A 4G01B 3ETLA 4E2XA 5KHOC 5FFNA 4F2GA 2AJLI 2HXYA 1P2SA 1ZN7A 2FZVA 3EUWA 3K0KA 2ZAGA 3K8ZA 4RMNA 5IVDA 3WGOA 4AJOA 2H7VA 4FC6A 4PCVA 1BKDR 3RFXA 5E4TA 3WIUA 4CMIB 1XPUA 1RZRA 3ASVA 3IBSA 4FEEA 3D1VA 5KYUB 2P9YA 2PJUA 3QQ5A 3R6GA 4J3JA 1M2OA 1QNFA 1FFDA 1Y5NA 1T0PA 1R0SA 1II8B 2IVFA 2P68A 4MGIR 4WI1A 4D3ZA 1IIRA 3WICA 1JTEA 4L07A 5F2OA 3WBFA 1UKBA 1JKFA 1XI2A 2ZZKA 4WBNF 4JLPA 4ZKEA 3FNHA 4MHSA 3DKPA 2Z9CA 4ZVSA 5EXTA 5CA0A 4IIGA 5FOUA 4L2IB 3W1EA 5HG0A 3MUOA 1IJEA 3CS3A 2PX5A 3KKMA 4L22A 4G26A 4D4MA 4M1EA 1JJBA 3MRTA 4DSUA 5HSGA 4DA4A 3B1XA 4LJ4A 5ALPA 1D8AA 1RXUA 3UT5B 3UV3A 3W8EA 2QRLA 3MHTA 1GL9B 3HI6A 2OZLA 4AIRA 2GPBA 3WLTA 1FMLA 1XDWA 1C8KA 3DR3A 4I1UA 2CF5A 2GWRA 4I08A 2XOEA 3GDHA 2EG5A 3SE7A 3E23A 2HDNB 3PR1A 3MIIA 3LXMA 3LQ4A 4FIDA 3ZG6A 5KMGB 1HLFA 5DZSA 3VDRA 2RGGA 1L7EA 4XYMA 5DLQC 2YFHA 1AF7A 4EI9A 3E81A 2QKYA 4LRWA 4CF5A 1NT2A 3TEMA 2DHRA 2FFBA 5TGTA 1DQSA 1DV2A 1U3DA 1LK5A 3CRRA 3PNOA 2AUMA 5JC8A 3DO8A 1A8UA 3IQEA 3NM4A 3W34A 1PGJA 1IMOA 4AJJA 1R0LA 3IEIA 4X1IB 3V3KA 3RS0A 3M5PA 1HF3A 3CONA 3RYIA 1XZIA 1YFLA 5J1SB 3I5UA 1C7RA 3FTCA 3HVUA 4CMGA 4G5GA 2A30A 3SJUA 1GAJA 2GPWA 1HZJA 2ZYDA 4PEVA 5DBEX 4IBOA 3DVAB 1ECPA 1H6BA 4MMXB 1VIVA 3WNZA 4RV4A 3W5SA 2I99A 4GBJA 3RUDA 2O8CA 3OU7A 1NXQA 1R0YA 2PUHA 2ZCJA 1U1CA 2N46A 3VNRA 2NVOA 2QENA 4QD3A 5HIKA 2R68A 3ABZA 4RORA 3QVJA 2HQOA 3NP7A 1GQOA 4TMKA 1GFIA 2D8MA 2ODAA 3AR9A 1U63A 1GNLA 2QTTA 3E9RA 4S24A 1O8BA 1QHYA 2V3WA 5AT1A 1EZ1A 3TGPA 4X5OA 1QCCA 2BUCA 2A9JA 4A23A 3TRDA 4DA0A 1ZFNA 3EODA 3A9SA 3KSAC 4BCBA 3WS7A 5JNVA 1DKLA 4ZFNA 2RGUA 3A9CA 5CLFA 2J67A 2VT7A 4YYEA 4B47A 1GV0A 3KSUA 3OZSA 1ZGHA 5IP5A 3RKSA 4A1FA 4BN4A 4H16A 5GV7A 2IWRA 3G5TA 3SSAA 1G20E 5A04A 5I7FA 1D04A 1UEXC 2Z3ZA 2OFXA 3HKDA 2QSJA 4N41A 1VBKA 1K66A 4J4BA 2GPTA 5DCUA 1M72A 5DN6D 3L0CA 2PNJA 3UUGA 3BGDA 2AOXA 2UYCA 4BASA 3IPLA 5DXJA 4EB3A 4RZ3A 3PGLA 4JBLA 5BSKA 5DI3B 3ZGOA 3ZNPA 1IATA 4EOGA 4EITA 3NHMA 4JB0A 2EERA 4AZ3B 1BNCA 3LTEA 3SM9A 1XJWA 4ETIA 1W9HA 1UEJA 2X1MA 3PDIB 4TM8A 1D1SA 3C3JA 4FNAA 3WQQA 5ALIA 5ENDA 3T0GA 2J87A 3L8EA 1AUVA 1U8UA 2F3RA 4PBTA 4QPNA 3PF8A 4ZVTA 1IY1A 2GZMA 5F1OA 2C7GA 5IUNC 1ZINA 1R4MB 1XYGA 1EEHA 1NF3A 4N3GA 1EFRA 1K8QA 5AQEA 4ZT3A 4YAUA 3UKJA 4WKGA 3P94A 3RJ9A 4ARZB 1A71A 1A95A 4Q4AB 1L5QA 1B0ZA 1PL6A 3CX8A 4GPD1 4Q3NA 1UOOA 4B6SA 1TF7A 2GK3A 5FOTA 4TT3A 4X1YA 3ZE1B 4K9NA 3VR6H 2A5GA 2W2LA 3SXUB 5DULA 3B48A 2JFOA 1V9SA 1ZOOA 3LQYA 2E4WA 3KPVA 3I5AA 3DOOA 5SYAA 3ZV4A 4V2UA 4BC1A 3EOBI 5KTTA 1DUIA 1ZOLA 2C9DA 1XKXA 4HNAA 1R37A 1ML3A 3ZVMA 1NUPA 5AKIA 4ZAVA 1L7RA 1U8FO 4FFSA 4BKMA 5A71A 2HDOA 1GCAA 4AJHA 4BV2A 3RSLA 4S1VA 5FOWA 3HDYA 5REQA 4WCFA 1IZ9A 4TV8F 1XMPA 5JXIA 4UPEA 5F9FA 4NFHA 1BFDA 3GCDA 4OSPA 2LWIA 1M0EA 2P5SA 3TGWA 3O9ZA 4KPGA 1G41A 2H1SA 4CCYA 1R2QA 3HBLA 1VIMA 3R23A 4BU0A 4M4SA 4Z8YA 5E7QA 1S2IA 4EP1A 5C7IO 2R0QC 1Q12A 3GWGA 2YJNA 3GZNA 3ZGXA 4C78A 1G5QA 1YASA 4K6FA 2IIPA 1SUDA 2JAHA 2JGJA 3ZYCA 3RYHA 4BDTA 5BYJA 4XUDA 1RE0A 4AB1A 4LQLA 4BMYA 5MN5A 1Z88A 2V3VA 2BR4A 5BV1A 3H4IA 1DX9A 1QBGA 2RONA 3OJEA 1SCKA 2W70A 2EP8A 2QDXA 1B2RA 2ZYRA 1ZI6A 3OOJA 4NSNA 2VDJA 2WD7B 4NK4A 1JX6A 2QB5A 3C1UA 1L7BA 4O1MA 2VHJA 1E3WB 3T5GA 4RXMA 4RY8A 4AO7A 3LUAA 1XFAA 5FV7A 4YP5A 3B3GA 4EA7A 3AVPA 3GLTA 4CODB 3M9WA 3R9XA 2HV8A 5T57A 1BMQA 1CZRA 2NT4A 2WUFA 2VWQA 3BXOA 4KXVA 2IX9A 3DAPA 1MX5A 4AS1A 3B20A 7MHTA 2V58A 1KI6A 2GXUA 4WA8A 4FKMA 3WAJA 2FMTA 2IOFA 2AJ8A 4PLZA 3KAKA 1DARA 3A25A 3FG9A 3OJCA 3UO8B 4C7MA 5EHZA 2EFJA 1P0MA 1YZHA 1ZJ6A 1XRJA 2GCNA 2ZAYA 3BEOA 3MD0A 3QV1A 4ZQHA 1J2JA 4MSUA 4Q21A 4C1NA 2ZRFA 3OLVA 4PR0A 4RENA 4FUTA 3U4DA 2WP8J 3BIJA 4NBKA 2F1HA 1FXSA 2B9EA 1IY8A 1MX9A 1NXSA 3EIQA 1XZBA 3DOCA 2NUTA 4E14A 1H1TA 1NV8A 1S7GA 2GEKA 4QQRA 4MINA 3O8OA 3AUAA 5I7WA 1WCIA 2IS6A 4KYUA 2F8MA 1RZRD 1OAKA 3FNGA 3FWHA 1KI8A 1U8YA 4TV9A 2QN2A 2ZSIA 4G6ZA 1FXWA 1N2CB 1QF7A 3VMFA 1MH1A 3W6ZA 2KHZA 3IDOA 4X8MA 4AXBA 4JFRA 4EBFA 4AP6A 4MI6A 2PY6A 3QW4B 4B32A 5CCBA 4I8XA 6AT1A 2FU5C 3IDZA 3H9QA 3KVYA 4D6XA 3KEQA 4IIHA 1PGOA 2RH9B 3TCNA 3L0SA 4RDXA 3Q8KA 4IHAA 3I73A 3I5XA 3PQ8A 3BTUA 3ZJ5A 1XP8A 1I1QB 4F0JA 5A5GA 1OWOA 1QU3A 5INTA 3H3JA 4E5NA 1YQDA 3HCWA 3NJ4A 3NC1C 5AK5A 1U31A 1Q0SA 2CV0A 2H7YA 3CJTA 3QWHA 1EK1A 2A3NA 3GEIA 3B3QA 4EF5A 4UTRA 3JD2A 4ENUA 4TT8A 3Q8LA 4IQFA 4F1WA 2QXUA 1NVWQ 3CSDA 2Y8EA 2HLHA 2WM3A 1QVRA 1QXSA 1MKYA 3SPXA 3WLEA 4MCAA 1A4UA 1K7FB 2PH5A 3PFHA 4TOIA 4PAMA 4FD3A 2E1RA 3UFXB 1U0LA 1BYUA 1GT6A 3C4VA 2LZ0A 2WDZA 2QN6A 3ZWAA 4O25A 4C20A 3KQPA 3FJYA 1DNPA 3DFFA 3RI3A 2JNWA 1M5RA 2WF6A 1QZXA 2FETA 2RCNA 5B6IA 4G2TA 4JYPA 2VJCA 4MIKA 1AGYA 3WLSA 5GJCA 3DTNA 1J97A 1GQFA 5BYKA 2OZVA 3FHJA 3A4MA 1Z6XA 3V8MA 4G0VA 1RJEA 1VKOA 3AL0C 1XTKA 4YECA 2YWDA 4RD2A 3UJ6A 7MDHA 2IYZA 2EX4A 5ALMA 3E3NA 4A8TA 4NH0A 1Z8NA 3M4ZA 3UUFA 4KEAA 1DLJA 3W9UA 4FXPA 4KFTA 2O57A 2ZK7A 3N6XA 1WO8A 3IAXA 4BVHA 3O3OB 3DAHA 1CY8A 2KI5A 1ADJA 4LYHA 4WLOA 4HX5A 5LCXA 2G3YA 4Y6LA 2NO0A 3F5DA 4LDZA 4IKEA 1BHSA 2CJFA 2GF0A 2HADA 2Q2NA 3R09A 1Y6RA 3G5LA 4M9RA 5IKEA 3ZCVA 1XTUA 4LC0A 1P9NA 4DOMA 2ZBGA 1PQYA 3OQ1A 5KWEA 2O54A 1EFKA 1MBZA 3UB2A 3OZRA 5JJLA 1FS6A 3X2SA 4QTYA 1BFKA 1V5WA 1ZC3A 1S3GA 3HY4A 3PKZA 5LLSA 3PR2B 2OV3A 1G20B 5CB4A 2FWBA 2EQBA 1RSZA 1J99A 2AWOA 2DQZA 2GLUA 2RJ3A 4IG4A 4OHOA 3IHLA 3BKXA 2VL7A 1GZ4A 1C2YA 1NVDA 4N3BA 3KTAA 3L7LA 2RHDA 1F5NA 5H80A 4G86A 3UY4A 1YZUA 2GD6A 4LRXA 2NVUA 1KVRA 4QJBA 4KXQA 3OF5A 4YJFA 1OFUA 2R79A 4URUR 1LB1B 3RG2A 2J0VA 5H8WA 3UHAA 3NCHA 4Q34A 3SN6A 2YJ4A 3O73A 3C7DB 4OTZA 2C84A 4ZO4A 4KXYA 1K7CA 1YK0A 2GPYA 3K2BA 4J0JA 5AI5A 3TD2A 3EWSA 3WMXA 1HE4A 4L9SA 4YV7A 3OTIA 1KEPA 2PXCA 2QJRA 1BHQ1 3GEGA 4HTAA 1CYDA 4X61A 2B4YA 5FR2A 4TN5A 2O5EA 1W75A 1L5WA 4RQUA 5G1PA 1NC3A 4GS5A 1T0IA 4MGHA 2Q1UA 1PV2A 4TS9A 2ZUFA 1ZP6A 3W6PA 2ORWA 2OBLA 1SIOA 1FQJA 3LM8A 4ESEA 1FY2A 1KMMA 2FEPA 2VZ8A 6ADHA 4G89A 3HB1A 4CQMB 3TQIA 3VOAA 2HD4A 1Z13A 2DBQA 1YL7A 3Q0IA 1NW5A 3RIMA 4ER0A 1L5GB 1IOVA 2WKQA 4I19A 4BMPB 4BMZA 3CPHA 4NAVA 3D4OA 1GSIA 1DBQA 1Z4NA 3MT8A 4Z0NA 3R7SA 3ZCXA 4ED9A 3I52A 5JBIA 2WILA 4P4GA 4E07A 3BFVA 1W29A 4M22A 1NYLA 5I9BA 1P9OA 4F96A 3PJEA 1GO2A 4HAVA 5KEIA 4G0ZA 4V2IA 3IBYA 1DCKA 2I55A 4FCTA 3I01M 4TTSA 4DJJA 1IRXA 1YC2A 3QVXA 2Y4OA 4XYEA 4DRXB 4J6FA 4Y6PA 1XALA 5F3RA 1HQCA 2YN4A 1G7RA 4MV7A 1DAKA 3UW1A 1WHSB 1LTQA 2BOVA 4KFSA 2DSNA 1Q1GA 2BMDA 4KDFA 1DO8A 2PRIA 4FWTA 3A0UA 4GMKA 4C4YA 1QFJA 1T2UA 2BFDB 3JTMA 3DEKA 5A05A 3VR4D 4NOLA 2X15A 4M0CA 2R47A 1Y48E 2WVJA 3LKVA 3ISTA 3N8NA 5THQA 1C3EA 1TVKA 2C2ZA 1IXRC 3CEAA 1O1YA 4XQGA 4CN8A 5JXHA 2ODTX 2I34A 2QYHA 3S2EA 1FF9A 2VZ0A 3ZNQA 2ZWIA 1MC8A 4QQKA 1GKKA 3B13B 4AY2A 4PCLA 1XVVA 4P08A 1U7OA 1XVLA 3H1AA 3MCTA 1E4VA 3RC9A 1D1PA 4KI7A 4C4TA 4AQ7A 1ONOA 3ADOA 5JAOA 5FNVA 3LNTA 5EWLA 3B2NA 2BFBA 3HO8A 1K7YA 4O4IA 2V7XA 4IOLA 1KDPA 4YMHA 3QEBZ 2J0SA 2R1UA 4O4LB 3RF6A 4M55A 3N86A 5TJ9A 1ULSA 4D3DA 1SG6A 2F6RA 1COWA 3DFZA 3LOUA 1TKRA 4A2QA 4UE6A 1Z6GA 2NZVG 3H16A 3HB4X 4O4JA 3J80A 3QVVA 1LPBB 2DR0A 2GHQA 1CEYA 4WESB 2Q3LA 4WZ6A 1L5VA 3KM0A 3AETA 2PGNA 2P3LA 2QD2A 2ZR9A 3D81A 1F9AA 1Y1PA 3L1KA 3MOIA 4QEKA 4HDOB 1G3IA 1MAVA 2JJ8A 3FCEA 2ACKA 3EVEA 5K3EA 4HXGA 4D9EA 4PHGA 4DCTA 2DBRA 4URXR 4G4JA 2F67A 2DR2A 1KNXA 4OA5A 3V1NA 4B75A 5JV5A 1V1MA 2C8KA 1DAFA 5JCZA 1CEXA 4X7MA 1J4AA 1CUDA 4WECA 4RBNA 4W1RA 5ECYA 4DTIA 1YT5A 3UVEA 4C0XA 4FOPA 1NBAA 1OT5A 4DDTA 1NMZA 3QLUC 2AOUB 4RTJA 2CMFA 2G08A 3GRYA 3OP4A 1WXQA 1XLTA 3PI7A 2RH5A 3AY6A 1NXTA 3KL2A 4ND2A 2IQIA 1FTWA 3D6JA 4GG1A 2EP7A 5J2TF 1W0KD 2A7QA 2I76A 3UH0A 3ZVNA 4LV8B 2ZQYA 4Y1GA 3W8DA 1Q7EA 4LGVA 1WY7A 3G2HA 2QQ0A 1D9ZA 1Y4UA 1VLJA 1PGQA 2KLHA 1ZA2A 2I7DA 4G5HA 5G0UA 4BGUA 5D85A 1QDUA 2X6RA 3U4AA 3DL0A 4DMFA 5AH0A 3M1AA 2GVZC 4OGLA 1MZVA 4LSMA 1ZL0A 9LDBA 1IRIA 3TI9A 4C4SA 5FWYA 1TI7A 1TKAA 5CEEA 3C6XA 3OAAD 3L7DA 4G07A 5KHLB 3KETA 5HXAA 4CM6A 3PC3A 3AM4A 2AQHA 1FFAA 4L6IA 2IHKA 4XDZA 2QVLA 1B8OA 3KKOA 4Y7DA 2X1LA 3HSSA 4W1PA 3PFKA 2GK4A 1U4SA 2V3CC 2VYQA 4IEIA 3TN7A 2HT1A 4PO3X 4U7FA 2WP0A 1BN7A 4G0QA 4INPA 5ECDA 2P5UA 1XV5A 2Q6VA 4HYTA 3SFTA 2ZRJA 1EFVB 2ZQ5A 3NDRA 3G17A 1FMJA 1QP8A 3K5HA 1NOIA 1N3IA 1EFPA 3T35A 3Q0EA 4PS1A 3OFSA 1MA0A 2PH1A 4J2HA 1NV9A 1L7MA 4BLTA 5CHYA 1R4AA 2R65A 3ROPA 2V6IA 4NEQA 4ZO6A 4BTEA 4HNVA 3TJRA 1FJGB 1DO2A 5JPIA 3B1KA 2O6HA 4OQXA 2QTNA 3EGCA 3GR6A 2GF2A 4L5JA 1RKXA 2D1SA 3AFGA 4R68A 4G8JA 2EXXA 5WRFA 4P53A 3THXB 1Y82A 3MG9A 1M2VB 3AWIA 1NPYA 3EDMA 3JRXA 4V39A 4Y8VA 5D3KA 3WWOA 4CL8A 4DUZB 3DVLA 1I3LA 4HDQB 1CUJA 4I4TF 1KFCB 3WV5A 5C37A 1XQ9A 3JQGA 4IRUB 4ESVA 3V8RA 1MOZA 1RQNA 3QWAA 4W7SA 1SVKA 4CM1A 1CUSA 4CW7A 1PQUA 4DLWA 3E1KA 5CLGA 1XZQA 5FTKA 2O8EA 3STWA 3L0IB 5FOQA 1ND5A 1UBFA 3L4EA 3BQMB 4KL8S 1VE1A 1HXHA 5EINA 3SJCA 5A0TA 1JLKA 5TS2A 4OATA 2ZT8A 4JQYA 1BQEA 3D7LA 3VO2A 3UT0A 2WICA 1ZJWA 3H2GA 5H16A 3RANA 1VXOA 4D25A 3VO1A 1JEOA 2XCRB 2QLMA 4IM7A 3ZWNA 3FWNA 4QFMA 5EP2A 2OXIA 5FUQA 3RR2A 1WZUA 3AFHA 3NW9A 2FF7A 1JLRA 5A2GA 3K0BA 1ZGAA 3V33A 1SEPA 4DV2B 2WSLA 3V4FA 4PYJA 1GGMA 5L3SB 3D4NA 3E3LA 2FW6A 4F45A 3NP9A 4CEIB 3C0KA