2ZRMA

Msreca datp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
319
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 93
structure length 319
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrmA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrmA01
1KO4A 2J7PD 4OI0A 1RW4A 1SXJA 2VIIA 4G5QA 2ZI3A 2EWVA 2GEUA 2HDNB 5JZVA 3I61A 4RCZA 1JECA 3K8YA 2VH5R 3IQWA 2ZSEA 2RMKA 2ZUCA 4B3FX 4NYJQ 3W5IA 4DSNA 4I1OA 4Y0AA 2DFTA 1PJRA 1Z07A 3QPWA 4IDHA 4KBFA 3CIOA 3UMRA 2XX3A 2IX3A 4BRUA 3VR3A 4N1AA 4AG5A 1TU3A 1OJLA 4EQ6B 1RRGA 1XTIA 4M9QA 4TQ9A 1X86B 3B9PA 3QNUA 2KWIA 3CUEF 2GTPA 2Q9BA 4IOJA 1FL9A 1MT0A 4DLWA 1XTJA 1W4AA 2EFCB 4HAZA 1KI1A 1G7SA 3SJBA 2GK6A 4TL7A 3ZVLA 1FPMA 2GEVA 2AWNA 2GXAA 5BXQC 3PUXA 2FV8A 1UDXA 3LQRA 1E94E 4YONB 2ATVA 1X3SA 3CF6R 2IHBA 1E4YA 1JBKA 1VCNA 2YJTD 2Z43A 2ORWA 2RHDA 3Q8XB 4WAUA 2JLXA 4CEHB 1XPRA 1KJYA 1Q1EA 2R8RA 3VR5A 2QP9X 1KHTA 5LPNA 4V0NA 1HT1E 1NBME 1TEXA 1XD9A 4PAQA 2BOVA 1MV5A 2J5XA 3IQXA 5FL7A 2J59A 3IO3A 2V7QA 4OHWA 5JJKA 5EZ6B 2QAGB 3NBXX 1NG1A 3SN6A 4MYHA 5J4HA 1P9NA 4Z54A 2G1KA 4JLJA 1IQPA 1TUEA 3FKQA 3Q85A 2DHRA 1Z06A 4B43A 2GAAA 3WMFA 1Q21A 1RVDA 1YJ5A 3LW7A 1KMHA 2QZ4A 2ZRJA 4ESHA 4ZI3A 1GL6A 2B7BA 5FL3A 3LAWA 2BKEA 1CKEA 1U8AA 3PEUA 5EUQB 2GDJA 5HKKA 1KO1A 3Q7PA 5B64A 2ODBA 1T6NA 2VP5A 3EASA 1DE0A 4V02A 3U4QA 1A82A 3I72A 1M34E 2G9NA 3A1UA 3A4NA 5FOXA 3UANA 2YOHA 1F6BA 2HUPA 5C18A 2OCAA 1DAGA 4PHTA 1NY5A 3VU9B 1XXHE 2WWFA 4JYCA 1W36D 2MSCB 1JQJC 3GPLA 4A9AA 1ZD8A 2JLYA 3RNLA 4TWZA 4GPTA 2GF0A 4IJMA 3FTQA 2AK3A 2HLDA 2BDTA 1KY2A 4XD7D 1SKQA 1WQ1R 2XSZA 1PZNA 3HDTA 2FSIA 3NXSA 1L2TA 2FMXA 4TLCA 5HE8A 4B73A 4GMXA 2J46A 4A0RA 3IUYA 4JLDA 4B44A 3ZD7A 2IXFA 2ZANA 3KQLA 3P4YA 1MABB 3QE0A 1XMVA 3WRYC 1GDDA 3PEWA 4F4JA 1X8JA 3AVOA 4IOMA 4A2QA 1Z0IA 3U2QA 5B58C 3RSOA 5JCPA 3NHAA 3THYA 1OFIA 2F43B 3EW9A 4F38A 1N6IA 2WJYA 1L7VC 2CDNA 2GXUA 4IOKA 1E2KA 2L0XA 4JSYA 3BOSA 5UKDA 4YMUA 2PX3A 4E5UA 4NP6A 4EFLA 3VNUA 4MYCA 3IBYA 3BB4A 3LBHA 3WMEA 4AC9A 1W7AA 5JMTA 4IHQA 1G3UA 5L3SA 3PUYA 2JLRA 5B30A 3SYNA 1E0KA 1U9IA 1ZINA 3T1TA 3GLGE 3BJIC 3TMKA 4DLXA 2F3TA 1JI0A 1R6BX 1TAGA 3R9IA 5JBQA 4OQMA 3CPHA 2KJQA 1UKEA 1KNXA 1NMZA 4GOXA 2IUUA 2ONJA 5P21A 5GJWC 3R8CA 3TQFA 4P4SB 3GLIB 5TARA 1II9A 1M7HA 4OQNA 4BRWA 4DEXA 1XPUA 3QPVA 2A30A 2RGDA 5D3MB 4MUBA 4AIIA 1QHIA 4UKDA 3R20A 5J4KA 4IDNA 4UJ3A 1TNDA 5CM9C 2A78A 2R6DA 3KXLA 4R7ZA 5ELXA 3FGNA 3NKVA 3ZH9B 2A5YB 4OHVA 5EP2A 2Z4SA 4EJSA 2DWPA 4C2UA 3QKRA 1GL7A 1OT3A 2EVWX 4RVCA 2R6AA 4PPQA 2AX4A 2W83A 3MWYW 4Q7KA 2EQBA 3A4MA 3NHBA 4UNPA 4EPVA 1GRNA 2ZSBA 2P3SA 1W49A 3FE2A 4FMCB 1S1MA 1E4VA 2BBOA 2OAQ1 3W9YA 2IK8A 3BH0A 4U7DA 2Z83A 5FOTA 3SI7A 3P4XA 1RYFA 2FPMA 2FGJA 2F1JA 3B85A 5L3QB 4MRPA 2B6HA 2PBRA 3HYRA 1P4SA 5H1YA 1LW7A 2H5EA 4NCHA 5AK0A 1TF5A 2DWQA 4HB0A 4CF7A 2JGNA 1AA9A 3CPJB 1YZTA 3GLHE 3QXHA 3SS8A 4B3GA 1SKYE 2V54A 4DC9A 2I1VB 3I5YA 2QSZA 2QPAA 2W00A 2ZS8A 3F3YA 1X1RA 5F2EA 3CRW1 2CCGA 4DCTA 1JJVA 2GWHA 5KSYA 3SJCA 1A2KC 3PR1A 4FIDA 3LH5A 1KK0A 4O25A 1S3SA 4EPWA 3QKSB 2C9YA 1T3HA 2CJWA 3TR5A 2QE7D 1UBFA 3SNHA 5JFGA 1QHSA 2VHQA 3PCRB 1FZQA 4KFTA 3KQHA 1COWD 4JIMA 3TVDA 3LA6A 4B35A 2WJIA 4AYXA 1XFAA 4HLUC 4JT2A 1JAHA 1KO7A 1P2VA 4N0EA 4ZCMA 2DB3A 1KI9A 1JEDA 3KKPA 1WF3A 2HEIA 2J0QA 2VEDA 2HJGA 4US0R 4PAOA 2PT7A 3KKNA 4URVR 3TRFA 2PZEA 2IYSA 3PITA 4N0DA 5JECA 4AK9A 3I5XA 1HA3A 5EXXA 2YC2C 4YMSA 1ZM3A 4RKFA 4D26A 4Q03A 2ZI7A 1IOZA 2AHOA 3GFOA 2D2EA 3SBDA 3OFND 2FF7A 4G01B 1UBEA 1VTKA 2AR7A 2WOJA 3UWOA 2V1XA 1N2CE 3CPEA 1HV8A 2IWRA 1CIPA 2YYZA 3KDSE 2D2FA 3GJ6A 3EWAA 1M7GA 3B1WA 3THWA 2FNAA 2HF8A 1NBMA 1YE8A 3RSLA 4D4KA 4A6XA 2QP3A 2OE2A 1G20E 1I4LD 1ZU4A 2GZAA 2ZJ2A 3HYTA 3SE0A 1KI3A 2O8CA 2OLJA 4KXFB 1RIFA 4MUAA 4XJXA 3EPJA 1YZUA 2H18A 2ZTSA 4Q4HA 4TYNA 3KFXA 4A1FA 1MRNA 2IYVA 5IRCD 3H0KA 1UKZA 4A8JB 1G6OA 2ZS9A 1DPFA 3H1TA 3RWOA 2PLRA 1VMAA 3CRVA 1Z22A 2XXAB 5FBWB 1D2NA 4Z1MA 1QHXA 3VMFA 1MKYA 3QSYA 3ADCA 3BB3A 1Z0KA 3HU1A 3Q7QA 4GP6A 1CS4C 4GOJA 1SVWA 2JIZD 3PJRA 4TTPA 4LYHA 2HV8A 4YXWD 1W5TA 3X1XA 2V4ZA 3UKDA 1PUIA 1OPXA 1WRBA 3KUDA 3KZ1E 2MSDB 2I4IA 4Q4JB 2UVQA 3K0CA 1NVVQ 1AGPA 1ZVQA 2J0UB 2GAOA 3GLIE 5HTKA 4HB2A 3RYTC 3AEZA 4TLEA 5EE0A 3RANA 1F3OA 2W2XA 2BEKA 5CIQA 3O8CA 3FB4A 3B1VA 4C4PA 1N5KA 4GL2A 5KSPA 3EIEA 1A4RA 1BH2A 1NY6A 3ZYCA 5KOYA 1P6XA 2FFBA 5JLJA 4M8NE 1E98A 1HQCA 4NZYA 3A1SA 4R2HA 4RFSB 1TTTA 2D74A 4DB4A 1I2DA 5CJPA 1EX7A 2RGEA 2HF9A 1FQKA 3E2IA 3KB1A 4ZI2A 1F48A 4TMTA 2WJVA 3GJ8A 2ZRIA 3H86A 3H2YA 4ARZB 1EFHA 1GRRA 2J41A 1M2OB 4KYIB 2OT3B 1ZD9A 4FCTA 5AJZA 1EFCA 3A4LA 3BGWA 2ZIAA 3LV8A 1UFQA 1II0A 2PJZA 4B47A 4TTQA 2O0HA 3GJ7A 4KO8A 1XTSA 2AD5A 5F98A 4L4UA 5CDFE 1E2HA 2X2EA 3U44B 1RFLA 1YR8A 1XCMA 4QJ5A 4OJQA 1VECA 4DIDA 3TVTA 5J4YA 2ZU0C 1XTKA 4PZLA 1GKUB 3X2SA 1CR0A 2OM2A 2H7VA 1SVOA 3UMSA 1OFHA 4QOSA 2KE5A 5DSZA 3CLVA 1E2MA 3K09C 2VBCA 2CNWD 2REOA 4RD2A 4QHSA 3UPUA 3A1TA 4TTRA 4I1SA 5JHGB 4C2TA 3NTUA 3OE7D 3TK1A 1YZNA 1S0UA 3EAQA 3I32A 2C8VA 4TMWA 3O8DA 4WZ6A 1L4YA 1C1YA 1G19A 1OFUX 4L16A 3NDBB 2ZITA 1WA5A 2C2HA 3WBKA 4MKFA 1TMKA 3U7HB 4M2LA 2NO0A 4UNSA 4ZO4A 4LOAA 3GP8A 1TF7A 2VQSA 3U3RA 2O0JA 4H1UA 3RRZA 1U0JA 2W6JD 4EQ6A 4DB2A 3ZIAD 4BGDA 1NP6A 5LD2B 5SZJA 3GLFB 4B6FA 5JS7A 5L8VA 1IN6A 1XEWY 5CJ2A 3Q3JB 3W5JA 2X19A 3KKQA 4NYIR 3EG5A 4AURA 1OW3B 3DMNA 1O87A 4X8MA 3ICQB 4NBSA 3ICEA 2GRJA 4US2R 1G7TA 2OEPA 4JVNA 3PUZA 1R5BA 2XGJA 1ZBDA 3DOFA 3I3SR 1E9FA 1KI6B 2DR3A 4JYBA 4CEHA 5FOSA 4DDUA 2WJGA 3FKSA 4LJ7A 1UADA 3FHTA 1DADA 4GFDA 2IS6A 1XB2A 5DI3B 4M53A 3C5CA 5G53C 3GLHA 4Q66C 2WAXA 1SXJD 1K8RA 4BFYA 1XBTA 3A8TA 4TLBA 1DELA 2QAGA 1MRSA 1O3YA 4U00A 3RAPR 1GUAA 4A36A 4WZBE 1Y3AA 1OF1A 4HLQB 1TQ6A 2ANBA 3OEHA 4JVLA 3R9WA 4IOLA 2A3RA 4ABYA 2O52A 3DEFA 3EZ2A 4Q02A 4C0HA 3IDQA 3BH7A 4QXAA 4EAQA 4YDHB 4C0LA 2ZXUA 3LFUA 2IYZA 2XTZA 3L0OA 1KSFX 2NOAA 4QGHA 1XU4A 4DDWA 3PG5A 1VG8A 3VU9A 2YV5A 1NMXA 2E87A 2B92A 2ZI5A 4LBVA 3ZGXA 5EXSA 3CW2A 2H17A 4L9WA 4BZXA 2PH1A 3ZVMA 2XZLA 1UM8A 2ZR9A 3PFIA 4HUTA 3T1VA 4WXPA 1E32A 4OHZA 3EPKA 1ESNA 4NE2A 3V4RA 1OXUA 1VG9B 1Z08A 2VHJA 1N3BA 1AS2A 4LJ9A 4RZ3A 5EJEA 3EZ6A 4B48A 4DLTA 5FI0B 4PXAA 2VHTA 3KXKA 4G1UC 5FL7D 4BFVA 1X1SA 4RSGA 4MYUA 3QKTA 4HB3A 2OBNA 3RDPA 5FFMA 2V7QD 4W5JA 2MMCA 1MABA 1CBUA 3QUSA 1G18A 2HT1A 2WTUA 1XX6A 1E79A 5DI9A 2BWJA 4FWIB 2VHCA 2GA8A 3AF1A 5FPSA 3KJHA 4XTRA 3F5FA 2F43A 3KTAB 2GZHA 1R7RA 4U02A 3CKLA 4WXRA 4DZZA 2BCJQ 3CWQA 1CJKC 2VTKA 5HKKD 3VX4A 4L9SA 1RZ3A 3VAAA 2JASA 3BERA 2BVNA 4TN1A 5E95A 3KQNA 1OIVA 4FCWA 1R0XA 3MLEA 1GOTA 5E7IA 3QXSA 4F93B 4DWJA 4K46A 1BYIA 5EXPA 1DARA 1QHGA 2SHKA 5LBIA 4TL6A 1AS3A 2GVDC 3KX2A 1MO3A 1TUIA 4LCBA 1KK3A 3C5HA 1CR2A 1NVXQ 1QDEA 5EQTA 3QJYA 2FFHA 4G3XA 2HLDD 4D2IA 1Z6GA 4LBWA 4KLZA 1DAEA 2XSZD 3LBIA 2X77A 5DLQC 4M1WA 4P4SA 3GLIA 2WHXA 4NPHA 4O2RA 2AN9A 3M1IA 1SXJC 5BQ5A 5D3MA 3O8RA 1JPNA 1OIWA 2VLIA 1Q1BA 1MO4A 3DPUA 4XIGS 5HZHA 4Z8XA 2ASEA 2QMOA 1G5PA 2FZLA 2FOLA 3E1SA 3CRMA 2QAJA 5LDDC 1Q1ZA 2B7CA 3DKVA 4PR0A 2NGRA 4NYJR 4CYMA 4FD2A 2GBLA 5C1BA 3QIAA 3AVUA 4K8OA 2IEZA 3EIHA 5GADl 4D80A 1Q22A 3EZ9A 1AQUA 1H8ED 4IEIA 3TBKA 2HT6A 1W46A 1KSJA 1US8B 4F7WA 2MMGA 4PTLA 3J81k 2FE4A 2IYUA 4CW7A 2OSBA 4Q5IA 4AKEA 1FX0B 5KDDA 3N5CA 5FUWA 1G16A 3T06B 4IXMA 2QT1A 3PUWA 1RE0A 1NIPA 3AB3A 4D4LA 2P6NA 4RKEA 2IC5A 2VHUA 3AF2A 4TSFA 3B13B 621PA 2VL7A 5H68A 5CLLA 1FFHA 5L3QA 4B3XA 1U2RA 1N6NA 5FUYA 3N70A 3CO5A 1EGAA 4MGZR 3UATA 3VHXA 1D9ZA 3MD0A 4WOPA 3PEVA 3LRPA 1XD2B 4QG7A 5CYOA 3AGQA 4PPFA 2W2VA 4LJAA 2F1RA 2NMVA 3FOZA 3QEOA 2RB4A 5KNDA 1QZXA 3QKSA 4HDQB 4A92A 4BE7B 5FPKA 1KIMA 4YMWA 4LHWA 1WMSA 4JL6A 3SYLA 4LUCA 3KJIA 4PPGA 1FW6A 3QVUA 3CH5A 5E3HA 3QEJA 4Q19A 3K0AB 4PHGA 2ERXA 3E70C 2C9CA 4KFRA 4HSEA 4BWYA 3DHWC 1S96A 4MRSA 4AG6A 4DXAA 1VCMA 1OB5A 1KO5A 1NKTA 5C46F 5DNYB 1FTSA 2VRWA 4TMKA 2FSFA 4QL3A 1MO5A 3WRXC 4QJ3A 3NC1C 2PL3A 4DLVA 3PEYA 4LJ8A 4V0KA 1K5GA 2OESA 4OK5A 3MWKA 5L3RA 4AYWA 4LHVA 4BPBA 1VPLA 2CBZA 1R2QA 3BS4A 1F5NA 3I73A 4MYTA 1XEWX 2IF2A 2WJJA 3DOEA 3ZQJA 4CRWB 4YDSA 2FEOA 3VKWA 3NC0C 3LXRA 3GJ4A 4QFMA 4RJLA 1TL7C 1JR3E 4DHEA 1A7JA 2QMHA 4C9BA 5CK5A 4A82A 1YZQA 3LX8A 4JBXA 2AKAB 2IS1A 2ZSAA 3EA0A 1BYUA 4AI6A 4JVMA 4Q1FA 1E99A 2CE2X 2PEYA 1IY1A 3K70D 3SHWA 5JI2E 2AXPA 1XNJA 2QM8A 1VKJA 1G291 4BUJA 4QGFA 4A2PA 1ZNWA 2XTMA 4S35A 5TDHA 2PEZA 2W6IA 4XWKA 2A5DA 2OCBA 1ZJ6A 1ZC4A 3LDAA 4WW0A 2PCLA 4A8JA 5J40A 2XTNA 2NTYC 5JHHB 5KNBA 2XXAA 4TQAA 2OZEA 4KJZA 2BMFA 4DCVA 2RAPA 5FPYA 3TR0A 4A15A 5CITA 5JRZA 1SVIA 2XZPA 1CJUC 3HR7A 3QF7A 4HAWA 4KSCA 2V3CC 3DM5A 1U9IC 3CX6A 4I1UA 3QXXA 1ZNXA 3LLUA 5F3WB 4Q4JA 4MA4A 1IONA 1YR7A 5FI1B 1NNEA 4HAXA 1E2NA 3MCAA 1N6KA 2GHIA 4BLQA 4TLAA 4A2WA 4Q7LA 1XTQA 3X1YA 3AVVA 1G7CA 4LK2A 1Z6XA 2JDIA 4LRWA 1GL9B 4DDTA 3U6KA 4G5GA 2J9RA 2ZYVX 3AQ4A 4GMDA 3R7WA 1IY0A 2IXEA 3SU8A 1IBRA 2Q6TA 4BZQA 5EP4A 1W4BA 2CK3A 1IAQA 3D7MA 3H4MA 1NBMD 4Q18A 3PIRA 4IVPA 1JB1A 4HDCA 3T5DA 1NIJA 3ND9A 4RFSA 1MH1A 2ZJOA 2BMJA 3ZZ0A 5HZKA 5FTMA 3RS2A 5GJBA 1W47A 1RJ9B 2BM1A 2BV3A 4EJSC 3KJGA 2ZE8A 1E0SA 1E9SA 4KFSA 1ZAKA 4LYFA 3THXB 2FFAA 1NRJB 3MSXA 4B74A 5FUXA 4ARZA 3VNVA 3LVQE 5FPTA 4BLOA 4Q9IA 2IYWA 1N6OA 2OO7A 3T34A 2NO6A 4Z1MD 5A4JA 1KYIA 3REFA 2IL1A 4B76A 1EG7A 1OYWA 1H8EA 2RCNA 3CX7A 4QHYA 4E07A 4PPNA 721PA 2BMDA 4DVGA 1XWIA 3U44A 2XB2A 4URUR 5F9FA 1S1CA 3LNCA 2UZ3A 1T0HB 2FZ4A 2GESA 4OBEA 2HYDA 1P5ZB 2ZRDA 4OL0A 3L8YA 2WWHA 1D6JA 3MRSA 1OIXA 4MITA 3C7KA 1E2FA 4RD0A 5D3QA 5GVSA 1YU9A 3UMFA 1XJCA 4URXR 1FNNA 5DO9A 4DBLC 5FH9A 1DTSA 1PLKA 4D0NA 1IXSB 1NVWQ 1SVLA 5FOWA 2EFDB 4P3YA 1LS6A 1CULC 5SZHB 2F55A 4TQUS 3BORA 4LI0A 5DGXA 1ZU5A 1R8QA 1XMIA 1ZNYA 1OXSC 2WIAA 2W0MA 3GEEA 5G40A 4OK6A 3BWDD 1TQDA 1ELOA 1AZTA 4JJZA 4M22A 3W3AA 1GSIA 2ODEA 1W0JA 4Q1CA 2QP4A 2GJAA 4D25A 4C30A 3AV0B 5JEDA 2V1UA 3CNNA 3V00A 2ZRBA 4EIWA 4MQBA 4OI1A 4ZCIA 1OHHA 2ODNA 3B78A 1ZD1A 4R2IA 3C8UA 4DJTA 4K81B 3FHCB 1EFUA 2ZUBA 4WVFA 1ESMA 3K0EA 2VO1A 2ZI6A 1OLOA 1ZMXA 2FG5A 2FGKA 3ADDA 4B71A 2IBMA 4EUNA 1G8PA 2ZEJA 3BRWD 2ZE5A 1W36C 3QBTA 1PV4A 5DI3A 4JLMA 4F4IA 4XOIA 4BQSA 3U60B 4R9UC 5K8TA 1T4GA 1ZM9A 1OSNA 2C5LA 2GCPA 4IKEA 2C96A 4AWXA 3AKDA 2JCSA 5AR1A 3U5ZB 1QG2A 3WNCA 4ZIRB 1VHTA 4F92B 1ODFA 1G8YA 4LC1A 1X6VA 2P6UA 2X1VA 4QBGB 3B1YA 5TY0A 2IHYA 2YOGA 4I4LA 4RZXA 1OXTA 1ZC3A 5J47A 3AVWA 3VR1A 4MDFA 4PC1A 1F2UB 5J4LA 2D62A 2OHFA 4QNRA 3EC2A 5JRJA 1JXMA 5M04A 1Z0AA 2RGNA 5GVRA 3LWNA 2OBMA 2VYFA 4JBYA 2WJHA 2JJ2A 3IIJA 3Q5EA 3LVRE 3OESA 1VIYA 4Q7MB 3QXCA 5BYJA 4Q48A 3UXMA 1GG2A 1W48A 1BS1A 3RS0A 1GVNB 1Q12A 1FP7A 3RC3A 1T3SA 3TAUA 2BMEA 2QL6A 5E7JA 3V9PA 1E2LA 3CZQA 5KSOA 1NVVR 3K0CC 4DKXA 2XAUA 1OV4A 1R5NA 4ZDIA 4BZPA 4OI4A 3WBJA 1EFTA 5SZIA 4JLBA 1UEIA 3FKSD 1N6RA 1S9HA 2ECKA 3TGPA 1ZM7A 1U99A 5BN3A 3EPLA 4B3BA 1KDRA 2JLWA 3AM1A 5FR1A 3OIWA 5FBVB 3WNDA 1MR3F 1LF0A 1E69A 1NN3A 3PXGA 5EP1A 4PO1A 1SZPA 1VG1A 2NPFA 4B2IA 2BHRA 1IN8A 4PO8A 4AD8A 1M1YE 4BFWA 2OBLA 1JR3A 4HZUB 3G82C 4NONA 5KUTA 1WBDA 4BASA 3B60A 4U5XA 3DKPA 3OEHD 3RLFA 5DYIA 4P4UA 1AN0A 3TH5A 1YRAA 3FMIA 2WBLC 3KTAA 2O0KA 1VCIA 3VKHA 2ZRPA 3LBNA 1YZKA 3U7FB 1E0AA 3QPUA 1GWNA 5HCNA 4JMPA 1KDOA 2FDCA 1ZIOA 1G8HA 3P32A 1KZGB 1WE2A 3TAHA 2IT1A 2PLFA 3VTKA 4QBHA 1U0HC 1ZM2A 2JJ1A 4Q4LA 4XVQA 3CF2A 5KTYA 2E1RA 2GCOB 1XRJA 2UKDA 2XJ4A 1K6MA 2O8FA 1VYVA 2YZ2A 3AVPA 3D31A 1XTRA 3BFKA 5J4VA 3QY0A 5KO2A 3N2EA 1NKSA 4LHYA 3WMGA 2QTVB 4S2EA 2GJ8A 3O47A 2ANCA 2KBFA 4DLYA 5DN6A 3X1ZA 1P73A 1VDZA 1UKVY 2IYYA 4NCIA 2ZRMA 4WIAA 1JQLB 2IW3A 2IYLD 1LFDB 3UIEA 1TEVA 2CL0X 1HEIA 4EFNA 4NL4H 1G1MA 4YC7A 4LSGA 5AUQA 1E79D 1ZRHA 4RD1A 1Z6YA 2WZQA 1EK0A 4GBMA 4MGKR 3QI2A 2WVJA 5TV2A 3DVLA 3TLXA 4Q9HA 5K8IA 1T9HA 2HCJB 3DL0A 4P0TA 2FU5C 2R65A 4G5RA 3EX7C 3EZ7A 5TXGA 1US8A 4Y0VA 1N5LA 4HLUA 1RYHA 1RPZA 1XMSA 2NPIA 2ZREA 2J7KA 3IIMA 1FX0A 2JLVA 1KI8A 1KKMA 1VIAA 3WY9A 2MSEB 2YWGA 2NIPA 2XOKA 1KSGA 1G4UR 5F9HA 4M0LA 3NWJA 1E2IA 3WYAA 1G6HA 4UNNA 4B2PA 3AUYA 4PX9A 3JVVA 3W6PA 1OYYA 2NQ2C 2YKGA 4Q01A 3CR8A 2IS4A 5DE3A 4EFMA 3BXZA 3NDPA 4TYPA 3AP2A 1G9XA 4PQFA 3BD9A 3QKUA 1ETUA 1SQ5A 2BKUA 2OUKA 2WKRA 2ZSFA 3OAAA 1EFRA 4CEJA 4AKGA 1R0ZA 1XD2A 3HPRA 3VQTA 3CZPA 2VSOA 1GNPA 4LPKA 2ZRLA 4MDEA 2ZRGA 3IKJA 4UNRA 3TNFA 3BFXA 4MH0R 3U3OA 4L15A 4XSHA 2ZE7A 2QRNA 4V0ME 4LJ6A 2RKOA 2O8EB 1KK1A 4F91B 2X8AA 2EYUA 2I1QA 1C4OA 4RCYA 4ACAA 3K0AA 5EXTA 2XNDD 1XP8A 3KKMA 2IS2A 2XZOA 4A0GA 5AUNB 1A5TA 1EWRA 2PMDA 3I8XA 4TZ6A 2B8WA 2QBYB 3TUIC 1GIAA 1ANKA 2H8KA 1UF9A 2CHVA 4BLPA 1IN4A 1RRPA 2QROA 2A5GA 1E9RA 2IYQA 3AH8A 3CM0A 4H9GA 2YWFA 3IBGA 4TSFD 3UG7A 1E9DA 1W5SA 2Q9AA 2QSYA 3EC1A 1CTQA 3KUCA 4URWR 3TJZA 4BLRA 3QOFA 3I92A 1YRBA 4QBIA 2EU8A 3W8RA 2OILA 3FFAA 3LY5A 2DFLA 2FFQA 3O8BA 5IDVA 2REBA 4C0KA 3DDCA 2A5JA 4PHHA 5JS8A 2YWEA 4KSBA 5FR2A 1I4TD 1QF9A 4P33A 5CLQA 3FVQA 3DZDA 4FMBB 2VSXA 3S1AB 4NCJA 3UG6A 2F9MA 1LS1A 1GNRA 4D81A 3SQWA 4POAA 1DS6A 4TYQA 3N2IA 1VYUA 2WWXA 4O2LA 5IF9A 2PZGA 2PMKA 3WHLA 2GVZC 4BFTA 3T61A 5C4MA 3SQXA 3AVYA 2GILA 3SHFA 2O8DB 3Q5DA 5DYGA 3VR2A 1P72A 3GJ0A 3MMPA 4KCGA 1T5LA 2AWOA 3TSWA 2WWGA 5B57C 1W1WA 5JWHA 4DIEA 3NBYC 3QXJA 2QRZA 3H84A 4UNQA 2D3WA 5DIFA 1IJFA 4EPXA 8OHMA 1CJVC 1QVRA 5JSZB 4X8LA 1P61B 2GNOA 4C0BA 5C2JB 1S9DA 3RRMA 1RC8A 3EWSA 2ZYUX 3K0SA 2VF8A 5E4FA 1W4RA 4PZYA 2BBWA 4XTCS 1DVRA 1WB9A 1YZGA 1OH7A 2NO7A 2ONKA 1FP6A 5KDOA 2IYRA 3IHWA 2WPDA 4JL5A 4Q4AB 1KI7A 3TSOA 1UJ2A 5IT5A 1P2SA 2QA5A 4M1OA 3RS3A 3U6BA 1KTVA 4NYMQ 4WA7A 2RH5A 3CH4B 4HATA 4TT3A 3SFZA 4MKGA 4O0MA 3SZRA 3AF0A 1XJQA 1CJTC 3BB1A 1RJ9A 2O5VA 1R0WA 2R2AA 1GTVA 2H57A 5FTJA 2C04A 5TB5A 4BLSA 1NL3A 3ZVNA 1SVMA 2W6ID 1QVAA 3DM9B 2GETA 1NN5A 3QBVA 3THXA 4GDFA 3KKOA 1G3IA 3U61B 2QG6A 1K5DA 4JLPA 1N0VC 2YC4C 5EP3A 1JR6A 3MWJA 1WCV1 3EARA 3AVQA 2OCPA 1E9CA 4NYIQ 1DOAA 2BEJA 3W3ZB 1YR9A 1PLJA 4ASUA 4L8GA 1G21E 1N6LA 2W2TA 2PT5A 2CL7X 5KHOC 4MRRA 2C98A 1ZYUA 4IXNA 1BO6A 1E1RA 3GJXC 2ZRKA 2CL6X 3SC3A 2A2ZA 1EX6A 5K8UA 2OFWA 2ZE6A 2BBTA 4G5OA 5BYKA 1WXQA 4TZ0A 1EESA 1Y63A 2JDID 2ZJZA 1W36B 2OLKA 5FTKA 2G6BA 3RVBA 1Z3IX 2EYQA 1P9RA 2ZJBA 5JI3E 1M6NA 3BFVA 2ZJAA 3KJEA 2CK3D 3B5JA 1CP2A 4PSVA 2FH5B 3K0FB 2OFXA 2O8FB 2FN4A 1CU1A 4B75A 3B9QA 5EE9A 1G3MA 1T8UA 3EA5A 1HE1C 4OQLA 3WYGA 2RHMA 1Z0FA 2JLUA 1JNYA 4FXPA 4KLNA 1DG3A 1FNMA 4C0SA 1TQ2A 2WAYA 1N0UA 2WIBA 2G88A 2D7DA 3FFBA 2ZJYA 2GEDA 2VP9A 5KYKA 4JJKA 5AJXA 1L4UA 3ZZTA 3REGA 3GLFE 4QC2A 5AJWA 5BN4A 2VSFA 1OB2A 4Z51A 1TF2A 2XNDA 4TL9A 4W5WA 3GQBA 3I8SA 4DCNA 4PANA 1NJGA 2P6RA 3W6NA 1KI4A 3OEEA 2FJUA 1E2QA 4TMVA 1E1QA 1KK2A 4GOKA 3THOA 4BEJA 4M1KA 1XXHB 4II7A 1TQ4A 2C95A 2CEAA 4LV8B 4TMXA 5HPYB 2R6GA 2WWIA 5AUOB 4CVNA 3FMFA 4GNKA 5FUVA 2VA8A 1QHHB 4J0QA 1D2MA 2B8TA 3L0SA 1J90A 4LGMA 2QU8A 4P31A 1DO2A 3B1XA 5G41A 4C0QC 3OIYA 1I4DD 4RZUA 3HU3A 3QG1A 4L5BA 4Q1EA 4HUQB 4LDJA 1J99A 3E5HA 3K9GA 3VFDA 2F3RA 4ZIRA 5AUPB 2CMKA 3F0TA 3V4FA 1OKKA 3UK6A 2YHSA 1YHNA 2ORVA 3MJHA 1E2PA 4KU4A 4B3CA 3IHLA 3TSZA 1F2UA 2WSSD 3U3KA 1B23P 2EFHB 4KFUA 3NG1A 2ZVQX 5DHFA 1JAIA 1KOFA 4V0MA 4AYTA 2P5SA 1JPJA 2QTFA 2ZM5A 1R5OA 4FINA 1MOZA 1AK2A 4FW9A 3EZFA 1W0JD 4DRZA 1UKYA 3B82A 1IJEA 3DO6A 2JEOA 1RRFA 1NI3A 4OHYA 2ZI4A 2I3BA 3AP3A 1IXZA 4RZ2A 5DISB 1CRPA 4NHOA 4M4SA 1OHHD 4D0LB 3CNOA 3C15C 4D0GA 1DAMA 1P2UA 4QGGA 5J5CA 3GJ3A 2E9SA 3VX3A 3C14C 3AF3A 1EWQA 1L8QA 1I2MA 3GLGB 3CWZA 4QJ4A 1KDPA 1CJMA 1AM4D 4X8HA 1TPZA 4I99A 1KDTA 2ZR0A 1LV7A 3MWLA 3FYHA 4PC6A 2C9OA 1OH6A 3Q9LA 1G64A 3B7GA 2CLCX 2ZI9A 4NTZA 1G8FA 3CX8A 4KV9A 4ZDJA 2N1BA 3SFVA 2Q3FA 3M6AA 2F1HA 2AFIE 1II8B 4Q47A 1GKIA 1XEFA 3WXMA 2IYTA 1HYQA 4PO9A 2A9KA 3AP1A 4HZUA 2WSMA 3F8TA 4KYUA 4Q1DA 1ZM4A 3GFTA 3WP0A 4Q1AA 2IF0A 4PSAA 1CR4A 4M9SA 1HY3A 2FSHA 5EUMA 1J8MF 5AJYA 1KZ7B 4FWTA 4YMTA 1AJEA 2XB4A 1ZCAA 3ONWA 4Q00A 4LJYA 4JLNA 2JJ8A 2JJ2D 4A0FA 3SJAA 4ACBA 2ZRFA 1R10A 2H16A 3A1VA 4W7SA 2J3EA 4GZMA 4KVGA 5FTLA 3D6TB 2GCOA 1E3MA 1Z29A 2JATA 4FMDF 1DAIA 4LJ5A 3B2EA 4E03A 4JZKA 2QPOA 3BC1A 4P32A 1N6HA 4HI0E 4CZ2A 2BM0A 4PZZA 3BBPA 1P60A 3K9LA 1T5IA 3C4JA 3OZXA 3PQCA 1Z5ZA 4JL8A 4NKRA 4LHXA 4M1MA 3RHFA 2ZAOA 2RGXA 3U3MA 2RGBA 1JXOA 3GLHB 3MAAC 4C7OB 1IM2A 1F2TB 3DZ8A 1Z0JA 4MRVA 1SKYB 1S2MA 2VPPA 3B6EA 2J0UA 5GJCA 4UQOA 4B32A 5B2ZA 2WV9A 4Q9JA 1GFIA 2QY9A 2Q3MA 4NCKA 1JR3D 3CRRA 3LX5A 2Z6VA 3TKLA 4I1VA 1Z6AA 2VF7A 2WOOA 3SBEA 1Z28A 3FHOA 2ZYTX 2ZRCA 4ERNA 5LD2C 1F60A 1H8HA 1A2BA 2VP4A 4QNMA 3R9XA 1YKSA 4CGZA 4IEEA 1YQTA 2ZJ8A 3PV0A 3L0IB 4BFZA 5KNCA 2JJ1D 4P4TA 1OXVA 1KAOA 2JLSA 3A36A 2CHQA 2IA5A 4XSGA 4H1VA 2ZETA 2VP0A 2DYKA 2V6JA 2FX3A 2W58A 2ZRNA 1OE0A 1R8SA 4HAUA 5G3ZA 4JVSB 1U81A 5IK2D 3GCGA 3GEHA 4N3NA 5H70A 4CEIB 4LYAA 3WYFA 1Z0DA 2QM7A 3CR7A 4TMZA 2ZSDA 4EPYA 1XCGB 3ZQ6A 2KBEA 4URZR 1NG9A 4KODA 5DN6D 1XEXB 1VHLA 2A5FA 3QF4B 3L0PA 4C3ZA 1P3JA 3VHLB 2P5TB 4M1YA 4LWZA 4ZCLA 2JLZA 4PQRA 2N42A 4HB4A 4DSTA 1AKEA 1W0KA 4XVUA 4M1TA 1G4AE 2DFKB 1G7RA 3X1DA 4LX0A 1AA3A 4FI3C 4V0LA 4GZLA 1E2EA 2O8EA 1Q3TA 4D82A 2XITA 2F1IA 3ECCA 3FPAA 4JSTA 4IVRA 2RGNC 121PA 4DT1B 3Q72A 3L2OB 3IILA 4PFSA 1PVOA 1QBKC 3K9HA 3VR4A 5KU1A 3K70C 3UWKA 2NZ8A 4EKDA 2QBYA 3EIQA 4HLDA 1Z8FA 2WSSA 3BH6A 4DCSA 4OK3A 2XOKD 3T1OA 4D4JA 5BN5A 3G5UA 3NBZC 2XNSA 3NIBA 3GLFA 1G5RA 4LZZA 3B1ZA 2FA9A 1KKLA 1J8YF 1E9AA 2EFEB 3TQCA 4Q9LA 3GFPA 5CK4A 2LCFA 1HE8B 2CE7A 2EW1A 2GJSA 5AWFC 3M4YA 2H92A 1NSFA 3CBQA 1GITA 3ZLJA 1ZNZA 2OV2A 2H1LA 1C9KA 2FPKA 3FMPB 4ITRC 2O8BB 1E96A 1B0UA 2AL7A 3LO5A 4DUGA 3OAAD 1EFRD 4C0AC 1U8ZA 1ZUIA 221PA 1KI6A 1NLFA 3AVTA 3QVVA 4XH9B 1Z83A 1GNQA 3ND8A 3BIFA 3VKGA 2QPTA 4UXIA 3S1AA 3NEYA 3ZD6A 2WWWA 3W6OA 1D9XA 3C41J 2X2FA 4JS0A 3W90A 1A1VA 3NBFA 2GXSA 1N5JA 4ZDWA 2J7PA 4BEBA 4OI2A 4LJ4A 1ZUNB 2J87A 2QTHA 3U7GA 3HWSA 3BK7A 2O8DA 2ZVPX 2IWHA 3ETLA 4HAYA 4AKHA 2D7CA 2AKYA 4ZDKA 3U7EB 1KJWA 1KMQA 1VYTA 4RD4A 3TW4A 1P7CA 1NVUQ 5CB6A 1FMLA 5JCZA 3VR6A 2EWWA 2IXGA 5BW8A 4FN5A 4MRNA 5JSZA 1Q1QA 1G5TA 3OHMA 2G83A 1GAJA 1DAFA 4LV6A 4CDGA 1Q20A 4NU0A 2A7QA 2ZYWX 3IEUA 3GEIA 2QGNA 2PCJA 3TIFA 4CT4B 2QT0A 3AVXA 1X8LA 1AQYA 3L43A 1IY2A 2CXXA 4Q4AA 4YLGA 3ZJYA 1AS0A 4DEYA 1FUUA 1U0LA 1X8KA 4NDZA 1XPOA 1GZSA 3ZZUA 1FTNA 1D2EA 1ZP6A 2CCKA 4E22A 3ADBA 4HDOB 2G77B 2IYXA 3R8FA 5FOUA 3ZS8A 3ASZA 1SXJB 2QEQA 1KI2A 1DG1G 1XJ0A 5EE1A 1SVSA 3NH9A 2P65A 2YNMA 4UJ5A 5A5GA 1SHKA 3I4LA 1HUQA 2PJRA 1DBSA 2NO1A 3ASYA 4BFSA 4DLUA 4PC3A 1DEKA 2FSGA 3A37A 1FUKA 2ZS7A 1XZPA 3HU2A 2HJVA 1G3QA 2ZRAA 2C03A 4URYR 4CEJB 1NSTA 3T1QA 3KQKA 4WBSA 3WP1B 2REXB 3HP1A 421PA 3QG5A 4TYWA 1G17A 1ZUHA 2GXQA 2DFNA 1E2JA 5EE5B 5G3YA 1BOFA 5KPJA 2ZAMA 5HCIA 1WBBA 4BFUA 1AKYA 5H8WA 4ILEA 4AY2A 3IPYA 1IXRC 1W2GA 4IDOA 4LBZA 4Q21A 1XF9A 2WPDD 3I1FA 3RABA 3WHKA 3MJRA 2CLDX 4LBYA 2Q9CA 2QENA 3RS5A 3QENA 5IK2A 4XWAA 5SZKB 3RRYA 4CT5A 1VCOA 4TL8A 2JAQA 2Q3HA 3K0FA 4A4DA 4O3MA 4QHTA 1NN0A 4JLAA 4FMCF 1S8FA 4XD7A 4TT3D 4M21A 4XWOA 3C16C 1BKDR 3ZDQA 4HLCA 2G1JA 3SOPA 4OQXA 1KNQA 2BC9A 3LXXA 4Z8YA 4LHZA 3OIVA 2LWIA 2DWOA 4BLTA 5KSZA 1VG0B 1Z2AA 1KJZA 1NLZA 4MGIR 3U3JA 1V43A 4FCVA 1NF3A 4M9XA 1KMHB 4G0NA 1SHZA 2CVHA 1P2TA 2OG2A 4PC7A 1LNZA 4ZKEA 4ASUD 3CONA 1CRQA 1XDBA 1UDWA 1KO8A 4IDPA 2DCUA 2VP2A 3U4QB 1T0JB 1E1RD 1PUJA 3HR8A 3NH6A 1XXHA 2HYIC 3MGCA 5CIWA 2VP6A 4JLOA 3WNBA 4JLVA 2ZU6A 5IHPA 3FDIA 1QHHA 2J45A 2NO9A 1W44A 5HR5A 3R7WB 2IEYA 1U90A 3K1JA 3RS4A 4HEJA 4HUQA 4MGYR 2QMEA 1AGRA 1N6PA 1LY1A 2ZJ5A 3A6PC 1GRQA 1NJFA 3BAFA 4X8OA 1UAAA 2FPLA 1HQYE 1ONBA 1OH8A 3I62A 2JA1A 1JALA 4JT4A 3NVAA 1CLUA 2QAGC 2P2LA 1OFTA 3IEVA 2YOFA 1YZLA 2K5UA 4LPSA 1LVGA 1TADA 3ADKA 4A6PA 4IRUB 1M74A 3D3QA 4M1SA 1CEEA 4YQFA 1P75A 4LC0A 3THYB 2P0EA 3IGFA 2LKDA 3SDZA 4GP7A 5L3VA 2PZFA 3MUFA 3TUZC 1N0WA 3EXAA 2AFHE 2GF9A 5LB4A 2C77A 3K53A 1DO0A 1QRAA 4RD3A 1UPTA 3OEED 3IO5A 5AJVB 3SYKA 1E1QD 5FOVA 5C4GB 4EPRA 3RC8A 4BECA 4KAXA 1GP2A 1G3RA 4Q1BA 3AGPA 1GM5A 3GLGA 3HJNA 2R6CA 2QI9C 2EFGA 2QQEA 5EE3A 2RGCA 4M9ZA 1JJ7A 2HCBA 5L3SB 3LD9A 1CR1A 2ZQ5A 1QHNA 1KSHA 3SEAA 4OQFA 3P26A 3SJZA 2ODWA 5DHAA 5FPHA 1QHYA 4NYMR 4GI7A 4US1R 1S3GA 3MFYA 1OH5A 1II8A 2LKCA 1SXJE 2FEMA 1KAGA 2ZR7A 4RD6A 3ZVRA 4ZV4A 3X1WA 1UBCA 4E09A 1OKKD 2BJVA 2UZIR 3OIUA 4GT1A 1SGWA 3PENA 5BWMA 4OJKA 3P1JA 3W8NA 2G0NA 5EZ5A 3KXIA 4ESVA 3AKYA 2Z0MA 2QN6A 2WMOB 3T35A 2DY1A 2G0TA 1SULA 2RGGA 2ZUDA 5TMPA 4OYHA 1E9BA 2OXRA 1LF5A 4MKHA 5JEEA 1GKYA 1RRCA 2BCGY 2G3YA 4IFEA 4UXJA 1BMFD 2GJ9A 1EXMA 1M8PA 2QE7A 1WP9A 2WM9B 4V03A 4KITB 3P20A 1AZSC 4JKIA 4A0HA 2DBYA 1ZIPA 1COWA 4EJSB 1IN5A 3KL4A 3QKRB 2OCYC 2CHGA 4Q9KA 2ZRHA 4PQYA 5A0FA 2J0SA 3HPQA 4NMMA 3NEJA 1G41A 1XCPA 1LB1B 3PUVA 4DSUA 2WMNB 3GMTA 1P62B 6Q21A 2Q0HA 2YWHA 3AUXA 2CVFA 1XZQA 2Z5FA 4KI0A 3T5GA 3L8ZA 5E7MA 3EPHA 1W2HA 2J1LA 1DAHA 3BE4A 5TVKA 4C7OA 4PHFA 1F2TA 1N5IA 3P27A 5CYPA 1Q0UA 3AF4A 5CB8A 3OFNA 4GSYA 1Q3HA 4W5HA 1IHUA 3CB4A 4JKYA 4QKQA 4ON9A 1E2DA 1Q57A 1Q44A 1P9WA 1AIPA 3FWYA 3OF5A 3TE6A 4EPTA 4R98A 1GILA 3K09A 2D4HA 1FQJA 2ZROA 1Z47A 2ERYA 2W0SA 4B33A 3RS7A 4DDVA 4KHZA 1ZCBA 3GJ5A 3RRNA 1T91A 2CJWB 1KGDA 2CLSA 4QGAA 2GBLC 1NMYA 4IFBA 3K70B 4C0JA 2HXYA 1LTQA 1PLLA 2GCNA 2GKSA 3D8BA 4UXHA 1CF4A 3LLMA 1JEEA 2R6FA 4EDHA 5KDLA 2IUTA 4LV5B 1U98A 2KB0A 3CNLA 2KSQA 4D6PA 1J7KA 4CEIA 4RFVA 3W34A 1FOEB 5JWRA 1TU4A 1IN7A 3QQ5A 1T8TA 2IUSA 4DCUA 4AKIA 2KI5A 2N46A 2JIZA 4YXWA 1XEXA 3K9NA 4JBWA 4QRHA 3LQQA 3AKCA 3QF4A 1U8YA 2YINC 1HH4A 3L82B 2HXSA 2F6RA 1Z63A 5KPDA 4XVRA 1D8TA 2R44A 5LB2A 4ZPXA 2GJKA 2V6IA 1H65A 4MKIA 1S4QA 2C78A 2WKQA 4QBFA 5FBRB 1NLYA 1UBGA 2AXNA 2BBSA 2J0VA 1G8GA 3JZAA 2QORA 4IDQA 1SVKA 1MO6A 2Z4RA 5FTNA 3THWB 5ANRB 4OKSA 5FBLB 4KVAA 1N25A 3IIKA 4DT1A 3SR0A 2BJWA 1E6CA 1H8HD 3T15A 2F9LA 5HE9A 4PC2A 1T3LA 4CIDA 2O8CB 4YMVA 3TUJC 4B6EA 4DLRA 2DPXA 3KQUA 4Q4HB 2F7SA 3JVUA 3JZMA 5DH9A 4DSOA 1HT2E 4W9MC 2ORIA 5JJIA 4QM7A 4R71A 1DAKA 3M0EA 1NN1A 4PAMA 821PA 1Z6TA 2D06A 2B21A 1OXXK 2TMKA 4ZKDA 3B8HA 1CXZA 2AD1A 5K8LA 4TLDA 4JLKA 3ZS9A 3A1WA 2NZJA 4NCNA 4KBGA 4BFXA 3TW8B 4HZIA 3MG9A 1E9EA 3FMOB 3PVSA 4DLZA 5CM8B 3AKEA 2O8BA 1J70A 2XEXA 4B2LA 2ZPTX 3CRQA 3IPXA 4D4MA 2XJ9A 2PX0A 1E2GA 1ZW6A 1UEJA 1W0KD 2P67A 2OFOA 2R9VA 1XMJA 1WDTA 2C99A 2QMUA 4TYYA 4LYJA 2JLQA 2WWYA 2CNWA 1RKBA 2QQ0A 4FMDB 3OE7A 1QG4A 5JWOA 5FBQB 1V5WA 4I81A 4F4CA 1Z2CA 4IW3B 3CF0A 2QUZA 4G5SA 1W4CA 4B3DA 5JJLA 4LY6A 4Q7JB 1E0JA 1R0YA 4B34A 1XD8A 2V9PA 1BIFA 4HYYA 4HAVA 4OHXA 1U94A 2YVUA 2V8OA 5GJVC 2W6JA 3ZIAA 2Y8EA 4QM6A 1HURA 4WZAE 4A8JC 3G0HA 2FWRA 4IVQA 3T12A 1BMFA 3GD7A 1KY3A 2WICA 1D5CA 2ATXA 2R62A 2GK7A 2QGZA 5CDFA 1YVDA 2WKPA 4GRAA 4RY2A 1J2JA 2V55B 2CCJA 2OXCA 2OAP1 1M7BA 2RGAA 1YR6A 1FMJA 2BIFA 2Q21A 4DUGD 4NH0A 3RWMB 3A58B 3DMDA 1TX4B 1R4AA 2GZDA 1HTWA 4V0OA 2AK2A 4PSKA 2QNRA 4DLSA 3KB2A 3KFVA 3LW8A 521PA 2NG1A
chains in the Genus database with same CATH superfamily
4D9IA 3HLKA 1AUVA 2PUGA 2J7PD 5CAEA 3EXHA 3F7OA 5DGIA 4GPD1 1RAHA 1KZ4A 1YC2A 2R85A 3RYIB 3AU8A 1O0CA 1NI4A 3I61A 1HE3A 1O6FA 4O29A 3UUWA 3TQTA 1AV7A 3H7IA 5ALHA 3CF4G 2A94A 3IC5A 3NBQA 3PXXA 3RUDA 1G59A 4JGIA 3OPQA 3IULA 1MOPA 3W5IA 4BGEA 1XR3A 4DSNA 1C1DB 1GUDA 2DFTA 1Z07A 2H0AA 4IDHA 4RDXA 1DPGA 2EIHA 2QJRA 3CIOA 3IESA 2XX3A 4DPKA 2IX3A 1AZLA 3VR3A 3VR6D 4QAQA 4FGKA 3OTIA 1AGNA 1RRGA 1XTIA 2BHNA 3LUBA 3Q40A 5J5AA 2GNPA 4ZYVA 5K0GA 2Z1DA 3CUEF 3JYOA 2GTPA 4YS6A 1KF0A 4CIVA 2HU2A 1IWOA 5JXHA 2JK0A 4DDMA 3M8KA 1KAHA 4IJQA 1G7SA 4PGGA 4Y2GA 1QYRA 2D3TA 2H1HA 3AW9A 4NEGA 5AVJA 3ZBUA 2GEVA 2SKEA 2AWNA 2GXAA 1R0BA 3BTSA 1QQTA 2QDKA 5BXQC 1MU0A 4ZJYA 2NWQA 2HMUA 4PCLA 3E1KA 3WLRA 2ATVA 1X3SA 2I6QA 1QYVA 2IHBA 2Q8PA 2R7LA 4EX6A 3KZCA 1VCNA 1FDOA 2P9GA 4JCOA 2A0FA 2K2WA 2H2HA 5HMMA 4D42A 1A4XA 2RC5A 3NEPX 1JI3A 3FRJA 4HEA1 3PXUA 2PRIA 5C31A 2VSNA 1RM3A 4N48A 3HCDA 3OE5A 1SUFA 2XUHA 3JASB 3EY4A 4PG4A 3JQAA 3IQXA 1VI6A 1ESCA 1T34A 4OBBA 4R0MA 5H7XA 1QF7A 1MJGM 2V7QA 2OGUA 1NUQA 3FBTA 3NFYA 5B1IA 1PTJC 1R6XA 4DR1B 2QAGB 1AKUA 1NG1A 2B5WA 3SN6A 3FF1A 3UXYA 4CV2A 1YRWA 3IMFA 1P9NA 1HEUA 1RYNA 4P6VF 2MJLA 1JHYA 1X1TA 4HEA6 1DDOA 3ULKA 1QC5B 3QUQA 4KLCA 4B43A 2WU0A 1NMEA 2GHQA 1Q21A 1X2BA 1RVDA 4EKEA 1T4CB 4ESHA 3ER6A 1GL6A 1RR6A 2B7BA 4FFSA 3A1FA 1JHPA 4Q9AA 1U8AA 2UV8A 2XQVA 5CCEA 2AUNA 5HKKA 1KO1A 4UC0A 2XMGA 5JPCA 2ODBA 4UOQA 5CTAA 3CTPA 3NV9A 4K5QA 4V02A 1O9HA 3U4DA 4N5HX 1PFVA 3WAJA 3I9V1 3DF7A 1FP2A 4QAJA 3UANA 1PBNA 1QRTA 2OCAA 1DAGA 2XF2A 3C3AA 4E3WA 1XTTA 4H1HA 3RVPA 3GLVA 1XXHE 2PGOA 5K3FB 2WIFA 5CFMA 3HHPA 2IKQA 1CDOA 4RK1A 4RMHA 5BSTA 4F4FA 2GPYA 2JLYA 4GPTA 4LK3A 5KCMA 2GF0A 3P8ZA 3I9V6 1WVGA 3FTQA 4DM4A 2AK3A 4CNBA 2XUPA 2HLDA 4ISCA 4XD7D 3FUXA 2EW2A 5EXDA 2MYNA 3KZXA 1JFSA 1T3TA 2XOEA 5HE8A 2ZGVA 3JQ6A 5A6SA 2E49A 4IGFA 1BE1A 1P91A 5ALVA 4B44A 4RE5A 2IXFA 2IZOA 4GPIB 3ZD7A 4KREA 3LUCA 1HNZB 1PR1A 2OG1A 1MABB 4UE6A 2DE0X 2AF4C 3O26A 4GX5A 4TUYA 4XGNA 3DE0X 1JJIA 1SXHA 5JCJA 3W4JA 5HS4A 1TJ4A 4F4JA 1ZN8A 2HBRA 1B76A 2PHZA 2WG0A 4IBOA 1GPDG 4IOMA 2M1ZA 2XDWA 1J8DA 4LXGA 1ORTA 3QLUC 4PIVA 3OUTA 3NHAA 3B3FA 3W5SA 2B3DA 2O2XA 3EW9A 4HZGA 1N6IA 4CM4A 2YJ6A 1NBWB 4RW0A 3J7TA 2D1RA 2E4VA 4G5XA 4U7PB 1E2KA 1R6AA 1PBTA 2VPYA 1X87A 2I67A 3KKEA 3BOSA 4B45A 4YMUA 1L7DA 2PD4A 1G5IA 1YJQA 5JNLA 1AKTA 4MIYA 3PRYA 4ZQFA 5ILOA 2VDKB 3BB4A 4CM8B 4P53A 1XAIA 3SS7X 5JMTA 3INYA 1I1NA 3FVWA 2H3HA 5L3SA 1BFDA 4DB4A 1LBQA 2O0MA 3AY3A 1FVHA 2PAAA 4JQZA 5BOSB 3SHVA 3PNYA 3TMKA 2WDPA 3ZU6A 1AG9A 1Y8RB 2NUTA 1GPLA 4YRJA 5LQUA 1R9JA 4BNDB 2GFHA 5COQA 4XDZA 1EIZA 5BNWA 4EY7A 3CPHA 1UKEA 1NMZA 4GOXA 4JJ7A 4AF7A 2I6FA 4I9HA 1K86A 5DXJA 1DP4A 2R1VB 1C50A 5GJWC 4MI6A 5TE9A 1JHXA 3ZWCA 4L02A 4NJMA 4CFZA 2ZFUA 4YASA 5ILQA 3WSWA 1W30A 2X23A 3QPVA 4PYOA 1UWLA 2A30A 1LLQA 3IQGX 5TSDA 3Q8MA 1RQNA 2Q1TA 1O94A 3JD3A 4LNUB 1QHIA 2WZDA 4UKDA 4XPIB 4YPVA 5AVVA 2K7ZA 1V9CA 5J4KA 4IDNA 2NU9A 3GD5A 1Y8ZA 5CM9C 1MENA 2O1XA 1KL7A 2H1FA 3G9XA 2VXYA 3FUWA 3N3BC 4H27A 4R7ZA 4YUAA 1RWBA 5BUCA 1DGQA 3FGNA 4FZ5A 3KUXA 5GAJA 3WWPA 3ZH9B 4JI7B 1Z3CA 1BCRA 2A5YB 2QI9F 5EP2A 4EJSA 4ITUA 4C2UA 1ARZA 1GL7A 1OT3A 4KK4A 2VK4A 5EIFA 3VU0A 2HK7A 3E53A 5TGTA 1WCIA 2P3SA 1W49A 3OX2A 3FE2A 5B4UA 2Z2IA 4FNGA 3ECAA 4K9MA 2XWBF 3H9UA 4JOCA 3BH0A 2ERCA 4P82A 4PLCA 1X8XA 4U7DA 1JDTA 5KQMA 2XMRA 1XQ9A 1MX1A 3G89A 3TRKA 4YP7A 2ZKLA 1ZPDA 2AB0A 2EJUA 5EMKA 1SVUA 2WIGA 2XA9A 4TVKA 1GLGA 1P4SA 3TEFA 1LW7A 1J0CA 1VLZA 3OI7A 4YRSA 3CPJB 1AA9A 3DAHA 4JY7A 1K2WA 1MEEA 2N1MA 2XRMA 5ALSA 4UCWA 4DM3A 3ELYA 4F85A 3R3JA 3VHXB 4JC0A 5EIHA 5C7YA 4JGGA 2FE1A 4X41A 2Y1FA 4RIEA 3ICCA 5IN5A 4AS3A 1ML3A 2I1VB 2QSZA 3I5YA 2HJWA 2V7GA 2HDHA 4JEIA 4GMHA 5F12A 4TTIA 3RG2A 5HZGA 4DCTA 5F33A 3KQQA 4B3MB 4M1EA 4O25A 1KK0A 3DGFC 4XR9A 3PFKA 4K6OA 3T9CA 5AW0A 5LBTA 5IUKC 3IEKA 1HLPA 3I6QA 5M2QA 1UBFA 2G76A 4EB6B 3SNHA 1QHSA 1OBVA 1AO3A 5BT9A 1NATA 4KFTA 3FLEA 1NDHA 4RJTA 3Q2IA 3TVDA 3DC2A 4N03A 3DBLB 2GH1A 1HDYA 2XZDA 2EP7A 2VTBB 1CRWG 1U7TA 3PHJA 3GH1A 4KX5A 1O4VA 3EXIA 1DJMA 2H31A 4JT2A 2BJHA 4N0EA 2P69A 1KI9A 5EYPA 3A32A 4ODIA 1FNSA 2HEIA 4TYMA 2J0QA 1NVTA 3FWHA 4R69A 1IDN1 1W8IA 3LPAA 4M60A 4XOUA 5LDGA 1FFDA 4URVR 1EFDN 2GFIA 4QREA 2PZEA 3TRFA 4GZ5A 2K7FA 2PUBA 4N0DA 4AK9A 3QY9A 4ALJA 5SV2A 3FZQA 4OJNA 1YZ3A 1RAIA 4HN4B 1JEJA 5E1OA 1LK7A 3C3XA 3IP6A 4BMZA 3ZDZB 3P9PA 3OFND 4G01B 4K6FA 1AH2A 1UBEA 3UWOA 1VIVA 2V1XA 2IEAA 1KEVA 4M9RA 3A6HA 1X7HA 1HV8A 2QTBA 1YONA 3B5IA 3ZWPA 4V1CA 3KDSE 1PJ2A 3OZVA 4M0PA 3E81A 1F06A 1UPBA 1R4ZA 3JQ8B 4C4TA 2GN8A 2QS9A 4J1TA 3B1WA 1EK6A 1CV2A 1NBMA 1U0OC 1I6KA 1VL6A 3AM4A 4H7EA 4A6XA 4P83A 2QP3A 3AG5A 3IYLW 5T4FA 4EUFA 3EVTA 3GLIA 1YL6A 2O8CA 1TEHA 1DKPA 3IVMA 3PE6A 4EEZA 1YZUA 3EPJA 1OUMA 4TYNA 3QNWA 4WZBB 4WZZA 4A1FA 3H18A 1RQRA 1VSVA 2IQIA 2IYVA 3ZE8A 1BA2A 3K92A 3HA7A 2G25A 1G6OA 4LRYA 3H1TA 3ZK9A 2YX1A 1VMAA 1WUJS 1GTJ1 1LBTA 1D2NA 2WJ3A 2FQ1A 1J24A 3FHLA 2W2NA 3JQ7A 3QSYA 4EK9A 1TC1A 3ADCA 1PDWA 2H9YA 4B7UA 2G6TA 4IFIA 4EG6A 1FNCA 2VPXA 3MRVA 3P9IA 4HGRA 1HLDA 4LSWA 4YXWD 5LYJF 1KU6A 3OIDA 1W5TA 3QFRA 4RPJA 1MFPA 3L77A 3UOGA 3CEMA 3OZEA 1J56A 3PFCA 4Y98A 2PKXA 2AZXA 1JKIA 1RYDA 2QLTA 3OKCA 1O1YA 1QZTA 2JFGA 3K0CA 1AGPA 3QW2A 1JEQA 2WYWA 4IIJB 2PSSA 3HCEA 5FEMA 5HTKA 10MHA 1WXWA 4BO6A 1F3OA 3PQ3A 2W2XA 4NFYA 2JCYA 3NTQA 5CIQA 3O8CA 3NP7A 5LQJA 2BRUC 4I5DA 3FB4A 1FVFA 2J3QA 4H08A 4E94A 3COZA 5C8XA 3KQOA 4WI1A 4C4PA 1RC0A 4H35A 5IBRA 3KHSA 2CMGA 3EIEA 1N2GA 4AICA 1A4RA 1BH2A 2R2GA 1CVRA 2WFAA 3C6KA 3TLGA 4K05A 3AL3A 1S7CA 4EITA 5JLJA 3H2HA 1PJTA 2YUTA 4CKBB 4NZYA 4QG3A 1TTTA 1YI0A 1CEYA 2VDOB 2B9EA 1L7OA 4TKMA 3UJ6A 2HF9A 3CLRD 1Y1TA 3DCYA 1NMQA 5DASA 3RTDA 4AG3A 3LPCA 4WKPA 2F9FA 3QLTA 1PZMA 1EFHA 1K6EA 2G63A 1RWOA 1PTKA 2WUWE 1J09A 1M2OB 1UM9A 3B6KA 4LXUA 1XNHA 2F00A 2P2CA 2AJTA 5AJZA 3SQMA 4C7VA 1XAJA 2P9JA 3L8DA 5A6VA 2UZ4A 1B42A 2PGXA 3Q6NA 1QQ5A 2IY7A 2ODQA 3G5MA 5EFOA 1TTPB 4KO8A 1XTSA 2RAFA 3FMVA 1R4NB 5F98A 3HB1A 1E2HA 1UXKA 5JH7B 4B6GA 2Y05A 4ZAGA 3ORSA 1QRRA 2A4KA 4OJQA 5U4XA 3V3TA 1C3XA 3MTDA 5J4YA 2BFBA 2ZU0C 4FE4A 4X66B 1GKUB 3G2QA 4MRAA 4Y9DA 2QMYA 3BRWA 4BKRA 1SVOA 4Y9RA 4A16A 1OFHA 4X93A 1QPZA 2YZ7A 3IE2A 1BC5A 1RLTA 2KE5A 5DSZA 3SEQA 1IH8A 1SJ9A 3UC5A 3K09C 2VBCA 2REOA 3A1TA 2CFRA 3EG9B 1SUAA 3LQ1A 1DZIA 3OE7D 4NZOA 1S0UA 2FZ5A 4AJ1A 4R2KA 3ZCSA 4CU5A 1ZCJA 1A9XB 1CY4A 3K35A 1VHJA 1U7XA 5GP1A 1EWTA 4L16A 1Q84A 3GXBA 3QSGA 4MKFA 4MHSA 4WASA 4K7JA 3AF6A 1TMKA 1GCUA 1NQWA 1NW3A 4FHDA 4M2LA 2C59A 1G8MA 3W4KA 3U7HB 4LQDA 2H4YA 1PR3A 3U7IA 3WJAA 3HVKA 3U3RA 4DB2A 4H1UA 3FPJA 4GHWA 3GGDA 5IJZA 1OWMA 4XIIA 2E89A 2ARKA 3NT5A 3PJDA 2AF3C 4R31A 4Z9YA 1UFRA 1IN6A 1ZUD1 3RFUA 1CF9A 4XYMA 4AUNA 1JDJA 5FWXA 3IRUA 4S1OA 2FHPA 1P2GA 4GXNA 5KTRA 4NBSA 3ICEA 1UAYA 1TRHA 2GRJA 3ORRA 2C7VA 4F04A 3NC4A 2W6CX 2L69A 3S8YA 2Z2ZA 4GGOA 2PMEA 1IWPB 4JVNA 4ZV7A 2O2ZA 3IP9A 3PUZA 3G0OA 2L19A 2IPXA 4I3FA 3VYTB 1Z18A 1JA0A 3C6XA 3TOZA 1ZBDA 3VOAA 3DOFA 3LWDA 2RH8A 3TD6A 4JHXA 3K9WA 4MV8A 3ZWKA 2BD0A 4NCAA 3TBFA 3HEMA 4KUHA 4EJ2A 1FDUA 4JYBA 1P77A 5A03A 2PUVA 1CUJA 3UBMA 4AECA 2WJGA 1NJ1A 3FHTA 3JYQA 4IH1A 4U2GA 2MSKA 3OMXA 1VKHA 3GROA 3KOUA 4OFWA 2ORYA 4GFDA 3N3AC 4Q37A 4R1LA 2Q2VA 2HBYA 1SNYA 3GLHA 4HWKA 4Q66C 1DXOA 4KE8A 5DM70 2O1WA 1XBTA 2I4MA 1ZQ9A 1DELA 2XDQA 4TLBA 1V7QA 4GEGA 4UQPA 2W4IA 1NSYA 3UMJA 4FB5A 2IYFA 2JD2A 1P74A 3DEIA 4U00A 1NXTA 4OHPA 5E9WA 4D3SA 4WZBE 3PHIA 1M6VB 1MC5A 3OEHA 3G9QA 8LDHA 4TRRA 3FNHA 7MDHA 3O1HB 3KIPA 1CQZA 3R9WA 2NVOA 3SYTA 4L6AA 4OBEA 3VTAA 4PF1A 4P08A 4UCFA 3R7NA 4Q02A 4C0HA 3EFBA 2A9RA 4E6PA 4ZOLA 1ZOIA 2JAWA 1T5DX 5FO0A 2VJDA 4QXAA 4D98A 3FYUA 4P8RA 5KVSA 4QUJA 1PJAA 1KP2A 4JAVC 2YWXA 3C98A 5IYZF 4DA7A 3TFQA 1TVKB 3RIMA 3O4IA 5BSVA 2ZXUA 1IMJA 3UG7A 4COKA 1KSFX 4CUZA 2XCRB 1M2WA 4WESB 1QVVA 3K0HA 3PG5A 1X9HA 1VG8A 4GQAA 2YV5A 3VU9A 1NMXA 3BD7A 4Z1OA 2ZCJA 2B92A 4FOTA 1GPH1 2XMQA 2H17A 4BZXA 3ZVMA 1MVOA 5F1OA 4N8DA 3K2IA 3AHIA 1HKUA 3T1VA 1ZAYA 4WXPA 4R68A 3OF2A 1A8UA 3NYIA 1E32A 1NAIA 3I9MA 1FTGA 1ESNA 4NE2A 4OHZA 2H6EA 6PFKA 4JENA 4OBWA 3LYUA 1BRTA 2EW8A 3VGJA 2WB4A 3VR5D 3RRXA 5EJEA 5G0SA 3FDZA 3QYJA 5FL7D 3QU5A 1PT9A 2G7ZA 3QKTA 4HB3A 5FFMA 1N2CA 3L84A 4W5JA 4H15A 3NYRA 4O4LF 2JRBA 1ZKMA 1CBUA 3VDXA 5JSQA 4QKQA 1VMIA 5A71A 4NC9A 1C5KA 1Q77A 3E5RA 4FMPA 2M6SA 5T8KC 4FWIB 2GA8A 1OX6A 3B1FA 3MCVA 5DHTA 1L1EA 4ZYWA 2F43A 3WO0A 1RDFA 3SX2A 4QYXA 2GZHA 5EOVA 1JLSA 2XIJA 3CKLA 4WXRA 2DQ4A 3K2EA 2PVCA 1D6MA 1HDCA 3HL0A 3PQDA 3CWQA 1LDEA 2VDWA 1CJKC 5JDCC 1ZIDA 3KL2A 4L9SA 1V1JA 4G0MA 5CVEA 3BERA 4UHBA 1X7YA 2KS6A 1C14A 1P44A 3HNRA 2FKAA 2COEA 2GAJA 4WDQA 1OBHA 3NT2A 1GOTA 1VPVA 4KIJA 5E7IA 1XG5A 4LVOA 1CUDA 1TA9A 2M1XA 2X5KO 3DE5X 4K46A 4ND2A 3PNPA 3U4CA 1RRVA 3IVGA 1QHGA 3C3CA 5LBIA 1S6YA 3KX2A 4QNNA 1UMCA 2AUMA 2O1SA 2ZULA 2YN0A 1CR2A 2VDVE 3D8RA 1PFGA 4GVPA 4ZOQI 3EZLA 4P3OA 5I7EA 4G3XA 1Z6GA 2H4JA 4W82A 5SYMA 2P3LA 2XSZD 4P4SA 5GM2A 1E66A 2WP8J 1GT91 4M7OA 5DNEA 1V4VA 3DOOA 3EVGA 3NIDB 3O8RA 1J4AA 4KNWA 2X15A 4W1PA 4XIGS 2YV2A 3BCSA 3IT2A 4NOJA 2PGNA 1TZMA 1MW8X 3E1SA 3I3OA 2FOLA 3V2GA 4YRNA 2QAJA 5BVGA 1QU2A 2WDZA 2B7CA 5HJ5A 2XMBA 3DKVA 4CCAA 1IM5A 6LDHA 2C88A 2IEZA 3C74A 4WOJA 5BQPA 3P96A 5D3ZA 4D80A 3JX9A 4ZT2A 3EZ9A 1SU7A 4DIMA 3S2GA 4DF3A 1WPXA 4KYVA 1QTQA 2PT6A 4RUKA 1FS4A 1W46A 4CIWA 1YA4A 4XE5A 2V4UA 5PGMA 2GM9A 3P9ZA 2FE4A 1Q1AA 2OSBA 1QIMA 3G2MA 5D2CA 5FUWA 1DRKA 4PV7A 3A4TA 4CQNA 5KVVA 5CXSA 4YRCA 3SOZA 1RE0A 5EQJB 3AB3A 2D6FA 1F8FA 2IC5A 1YMQA 3IOCA 4JN6B 3AF2A 1ZH8A 4G8CA 5B7NA 4B5KA 2XF8A 1WPGA 5CLLA 4P4NA 5L3QA 1BVRA 2J3JA 1A5ZA 2QIOA 4IVNA 1N6NA 1K6XA 5DF1A 4TLMB 2C61A 3UCXA 1XQVA 4UZSA 3GNTA 1EGAA 4ID3A 1WB6A 3UATA 3NASA 1F8YA 1D9ZA 1QB7A 5C1DA 1V1MB 2CN1A 3MJDA 1KRXA 4P7JA 3O3NB 2VBIA 1PJ3A 3L05A 3BQNB 5EPUA 2NMVA 1COZA 2R1ZA 3FOZA 1SN7A 3QEOA 1GV0A 2I6XA 2E6KA 3FN4A 1FYDA 1GPAA 1QZXA 5FPKA 4BE7B 1KIMA 4B17A 4DAEA 4H1TA 3T4UA 3AZQA 3PC8A 1W75A 1O77A 4YCJA 4DBLE 4EDFA 3SYLA 1I30A 1KH3A 1YZYA 3I2JA 3RGGA 4DEVA 2WKSA 3CH5A 1CYDA 5CP8A 4Y2VA 5HNKA 3L4KA 5FFNA 4Q19A 1FX1A 4XFDA 2ERXA 1OZHA 1RCTE 3OUZA 3UGQA 2ZBPA 4UVDA 3EUWA 4CMIA 5HIKA 1EP9A 3G2HA 4KFRA 4CR8A 4HSEA 5ERYA 5AVZA 1RWWA 2NTNA 3HMQA 4NQRA 1E7SA 5TLSA 2QDXA 3KB8A 4M0DA 1QLWA 4AG6A 3LBYA 2POQX 1OI2A 2IIQA 4ZVUA 3WGLA 1VCMA 1T2DA 4WT7A 1KAEA 1KO5A 3D54D 3IR6A 4YCBA 3TRDA 4BJ3A 1FTSA 4TMKA 1GPNA 2FSVA 2DXIA 1MO5A 3M3PA 1L7PA 1E3WA 3HKCB 1K98A 2Y0EA 3I28A 3IT3A 1MH9A 1TUGA 1QNLA 3QTBA 4LJ8A 4PFJA 4KIWA 2V6GA 2B78A 2FFJA 3QWBA 2I1LA 3UJAA 1DWPA 4AYWA 3GEGA 5EJ7A 1Z0ZA 2EIXA 2BSXA 3N58A 1T5OA 5DNVA 3W5CA 2JARA 1BHJA 1EFKA 2IF2A 3DOEA 4MYTA 3ZQJA 5IM4F 1LI7A 4IS2A 3DLAA 3RWBA 1QZUA 1L8LA 3TKYA 4X9XA 3ANSA 4OXRA 3TPFA 3HS3A 5FAXA 4OGFA 4RJLA 4F1JA 1T6BY 1A7JA 4C9BA 3P4UA 4ZCQA 3ZY5A 2WJAA 1YZQA 5NLLA 4A82A 4U7GA 4AY3A 4KPYA 3GMIA 1WUTA 5LP6F 1O03A 1DUIA 3R5JA 2ZUVA 4QDZA 5JI2E 2OCLA 3VR6H 1HR0B 3H5AA 4BBZA 2QM8A 4J0IA 2VZ8A 2YWCA 3OZAA 1NYRA 1VRWA 1ZNWA 3L6CA 4IKPA 4EKIA 2BGUA 2HIHA 1X13A 3Q98A 1J5PA 4C0WA 4O4HF 5CBPA 3PPIA 3DFKA 2I65A 3LDAA 4WW0A 2PCLA 3KR2A 3FJYA 1UXHA 4X61A 3P5BA 4A8JA 1GU1A 1VPEA 5GWXA 5JASA 5JHHB 5LNK1 1E3EA 2BMFA 4DCVA 4FE7A 1BFUA 1BEEA 1Y34E 5FPYA 4B3IA 4Q05A 5EZQA 3IVXA 3UQZA 2C9BA 1TTQB 4URFA 5AD1A 4KR6A 5J2TA 1ZK4A 1EGQA 1SVIA 1R8JA 2XZPA 1CJUC 3HR7A 4HAWA 2OPBA 4KSCA 3AEYA 5IT4A 2V3CC 3HK2A 1MTZA 1RWPA 1U9IC 3CX6A 4I1UA 3BHJA 4CIYA 3OQMA 2YWDA 4MIOA 3OD1A 4C4OA 4LMBA 4MA4A 4Q4JA 1XKTA 1MOSA 1NNEA 2ZBFA 3V4SA 1E2NA 1Z2EA 1XZGA 3FNGA 4CG2A 1XTPA 1Q0RA 1XTQA 2F48A 3NORA 3HRIA 1H42A 1T3ZA 1GL9B 2PV7A 4RKWA 4BQFA 3U6KA 3HCWA 3R7WA 1YS6A 3TO5A 3WFIA 2GK4A 1WEHA 3MJTA 2QU7A 1L1FA 3CLKA 1CUGA 3MRTA 1UMBB 2CK3A 3VUFA 1IUPA 1H6AA 2Y0DA 4I9FA 2ZUTA 2AJ8A 1QIFA 1R5JA 4KPFC 3SVTA 3KJNA 2UZ1B 1I3KA 2C92A 3T5DA 3FR7A 4D3FA 4YJ2B 3UAZA 4YBZA 5TPWA 3KYCB 2X4DA 3AU9A 4QBKA 1PR9A 1W47A 1SWVA 3HY6A 3BZBA 3TFWA 2FEWB 4WL0A 4KFSA 1E9SA 1T0IA 1ZAKA 3C3JA 4LYFA 2OCKA 2HSEA 3OZIA 4B74A 5AESA 2OXTA 1SBQA 2QRHA 4C7BA 4UU0A 5FPTA 3FX2A 3JCZA 3LT2A 3RASA 5F7JA 4TM7A 2QLBA 2IYWA 1N6OA 1NF2A 1QDUA 2FWPA 2JCGA 2VDLB 2QOEA 2WT9A 3O6VA 4Z1MD 1CC1S 3REFA 3E6AA 1H66A 2NU8A 3R8XA 3LXUX 2ZUEA 1TKBA 1EG7A 5HYVA 1ZH6A 1OYWA 4UD2A 3FY4A 3QWIA 3ZGVA 3JQFC 4QHYA 4E07A 4PPNA 5E4TA 2BMDA 4RHCA 2W6OA 2YJNA 3WGJA 721PA 1A8IA 3NHMA 4QYTA 4URUR 3U44A 2XB2A 1MZPA 2QLJA 1M2KA 5BSMA 2OKGA 1RQ2A 1X7XB 1Z36A 2FZ4A 2GESA 2Q50A 2UUPA 3HA2A 3LNCA 4UM9D 3DOUA 3SCZA 5B12A 3RV4A 2EERA 5L51A 1E18A 1PZFA 2DAPA 3P9YA 2WRZA 3PXBA 2Y0CA 1D6JA 1HDRA 3HA3A 1NF8A 2OHHA 1EQ2A 3IR7A 1L4EA 4YP0A 5DKFA 4CEIA 3UY4A 1SPXA 5GONB 1KJ9A 5GVSA 4ZALA 2BKVA 6ADHA 4JLUA 4RYLA 1FNNA 2VPZA 2HA6A 4DBLC 2IU3A 4IR7A 1EE1A 1G6Q1 1IXSB 1PR5A 1NVWQ 2J9FA 3IVCA 2EFDB 1RXSA 2G9QA 2P4EA 3LT4A 4LDRA 1GA4A 2I80A 4P3YA 2Q5HA 2A4MA 4OJYA 1YVRA 5FCDA 1AHNA 3ZUPA 1G8AA 4ALKA 4BVGA 1XYVA 2WT4A 1EXWA 3DDWA 2DG2A 5MGBA 1JJAA 1ZU5A 3LL4A 4C2BA 1HC7A 5D5HA 3LIPA 3GEEA 2BF4A 5G40A 5AI6A 4MS3B 4BN4A 1TQDA 4KOEC 2WEKA 1ZSVA 1GSIA 2G09A 2HK9A 3PL1A 2MSLA 3PA8A 4OGWA 4MGHA 1AV6A 3HKBA 5EJ2A 1P7WA 3AV0B 3IDSA 4N82A 3SEZA 5HJEA 1ZIYA 1P4RA 1YS7A 3V00A 1GD1O 1L7EA 2ZRBA 3LYAA 4EIWA 3LOUA 1SQ0A 1N3YA 2QG4A 3F9CA 5EUCA 4DLLA 3FOFC 3IAEA 2FF5A 1GQOA 2FXVA 3B78A 3OURA 3QUAA 1ZD1A 4R2IA 1YRHA 1NZDA 4E4RA 4EF6A 3ZW7A 3FHCB 3CURA 3HB5X 1JIXA 4WVFA 3TI9A 3K0EA 2VO1A 2ZI6A 5F7OA 1OLOA 3IAFA 2UUOA 3E84A 3QBEA 4PYMA 1Z88A 3ADDA 3IELA 2VHVA 2WG2A 2W2OA 3R2JA 1G8PA 2ZEJA 1FYVA 2EF1A 1C41A 3DUWA 1A72A 1MAAA 3QBTA 5J1TB 4XQCA 4JLMA 3SFTA 5FWYB 2VN8A 1KVSA 3KVNA 1JLMA 1RAAA 2YIVX 5DM2A 1U3GA 1OSNA 1SVNA 1K8QA 1ZM9A 2C96A 3BQ9A 3UJBA 3BG5A 4UUPA 2BDEA 5AR1A 3U5ZB 3WNCA 1V35A 3A31A 5E2IA 2EXXA 4PLPA 1VHTA 4BRSA 1EUCB 1G8YA 2B20A 4WJLA 4LC1A 4YCLA 4BU0A 1KBZA 2IHYA 3GB9A 4I4LA 1QFJA 1ZC3A 2FW8A 4QQRA 3AVWA 1EAMA 1SELA 4D3XA 1NXXA 2FR8C 1T35A 2Q3DA 2R6R1 3BGOS 3QOWA 3T6KA 3WQQA 5KB3A 5LKAA 2QZJA 2IH4A 2C5EA 1T2AA 3T5BA 3SZ3A 3KKLA 4LDZA 1JXMA 5DBIA 5T4EA 2JW5A 2QTNA 2P9EA 3FPCA 4EENA 4H0FA 4F2WA 3PD1A 1LC0A 1GTMA 2JJ2A 1H2YA 3LC2O 4GPBA 4NHEA 1M66A 2XB9A 3KUKA 2FMIA 3OESA 3RBXA 3MERA 3PUJA 4IINA 2X6TA 3SZGA 4X1KB 3WK7A 1SO8A 2FMHA 3PDUA 3MWFA 1BS1A 3HN2A 3RS0A 1Z75A 2F1OA 1F2DA 2G8LA 3I05A 5TEVA 4RLQA 1T3SA 2EQAA 2BMEA 4GE3A 3R7BA 4OHRA 1MXFA 3SC2A 1MEJA 4KW7A 4IJWA 3PXDA 2VKTA 3G0BA 3I0ZA 4ZDIA 1F0KA 4JUBA 4OI4A 3QMVA 5EEHA 1EFTA 3S81A 5AIBA 1PIWA 1X38A 1XHFA 2OBYA 2QVCA 5SZIA 1XT6A 3F1KA 3FKSD 2O3RA 3W8EA 1YKFA 4OUDB 1N6RA 1S9HA 2CNLA 5AOVA 2P3OA 3EEBA 3VZPA 4BMNA 1LD3A 1J2EA 2JLWA 4KQJA 5AH0A 2C97A 2XHEA 3OIWA 4KWEA 2EC5A 4JP1A 2KPOA 4P7FA 5DLEA 3WLSA 4M0KA 5FBVB 1NN3A 2EZUA 3JVIA 4R1SA 3ANYB 4WINA 1ZD5A 5E6SB 2E4WA 1TJPB 1RYZA 4GH5A 4ANFA 3KJQA 1M1YE 4G4JA 4BFWA 4CM9D 2OBLA 1JR3A 4HZUB 4I5FA 5KUTA 3H05A 3GFBA 4U5XA 4YCSA 3RLFA 4P4UA 4E88A 2WBLC 3KTAA 1VCIA 3VKHA 1YBMA 1ZOSA 2O3QA 5TIIA 3JZFA 1WMEA 1M6EX 3F5QA 2VAPA 4Z86A 3U7FB 4MAMA 4M7WA 5CT4A 3IT0A 1KYXA 4E2YA 5GV7A 3KUUA 4QO8A 1ID1A 2WTAA 4CIXA 5HKOA 1WD5A 2FDCA 1BQ4A 4M87A 1EBUA 2YV4A 3OCXA 4FR5A 1JYEA 1G8HA 1ZCFA 3OA2A 3P32A 3IMGA 1KZYC 2IT1A 2PLFA 3PFWO 4YJHA 1QZ3A 1QH8B 3VTKA 1ZH4A 5T6BA 3S2IA 4YRTA 1I1HA 2C0PA 2G9UA 3NGMA 2WP0A 3D0KA 2P7IA 2YZ2A 2X58A 1RWQA 2GEKA 2JIBA 4YAOA 4OJMX 4N47A 2VT2A 5D6OA 1SCBA 3H3JA 5KO2A 4A1OA 1ZWKA 3WMGA 2IP1A 2QTVB 3L06A 2TECE 4S2EA 1TCAA 2ANCA 3SOOA 1Z4NA 3AV3A 5DN6A 4RIGA 5FJJA 2XXBA 4ZU6X 1JFFB 4IDBA 2IW3A 1ZN2A 3MS2A 2IYLD 1MFZA 1LFDB 2X5OA 4LHSA 3K1YA 1G1MA 1KVQA 2PA3A 5CH5A 5AUQA 1M1UA 1ZRHA 2DQYA 2Q4BA 4QE3A 4MXDA 1Z6YA 9LDBA 4EY4A 1EK0A 3DAYA 3QI2A 2JIDA 1QXSA 1UQUA 4EHDA 4DJJA 2HJSA 3PFBA 1L5GB 3M1AA 2E4UA 2O2HA 1PSWA 1PWYE 2QRVB 2PYDA 3F7NA 1GZUA 2FU5C 1BX0A 1V6CA 2FZGA 2IITA 2R65A 3P0IA 2A9PA 4G5RA 4PG5A 1WF6A 1R37A 2OBFA 1US8A 3NALA 4H3SA 2DFVA 4EO7A 3TLJA 3O8QA 4E4YA 5JADA 3ZZTA 3R75A 3BULA 2FRDC 5DTIA 4F6RB 3ZJUA 4WGGA 1FX0A 1H1LB 5CNJA 2GGSA 4O2AB 5ADHA 2V03A 3BD8A 4BO2A 3WY9A 1MB4A 3ZTWA 2D4AA 4FFDA 5KJFA 5BR8B 1KSGA 1QCZA 2P40A 2VAWA 1G4UR 3FDFA 5F9HA 4NK5A 2XMZA 5GIOE 1G6HA 2P79A 5JPIA 1ZFNA 1GFWA 4ZT4A 3V8EA 4CKWB 3GRKA 3JVVA 3WGQA 3LJKA 1OGYA 3QITA 1N57A 4RMNA 4ENPA 2NQ2C 3ZWVA 1YFZA 3MNFA 3OKFA 4Q01A 3CR8A 3S29A 5JU6A 2IBTA 1LZLA 3LT1A 3BXZA 1Y3BE 4TYPA 4I9UA 3GW8A 3BD9A 1ETUA 2WKRA 2OUKA 1E62A 2ZSFA 2W37A 1EFRA 1THMA 4MTCA 2O3UA 3RJMA 4IXWA 3RK0A 1QFXA 5HIAA 3WI7A 5JJBA 1JU4A 1RVV1 5EJIA 4HX5A 1V3TA 1Z38A 1ULUA 2O14A 1OLUA 3ZE2B 3KETA 1Z7BA 4I1PA 1X80B 1SA0B 2N47A 2CXPA 3L7YA 3EEIA 4L15A 4FFMA 1O95A 4UASA 3EWIA 1R8YA 4V0ME 4DQDA 4ZGBA 1ZI9A 4ZAVA 2O8EB 1I2AA 1KK1A 3EFEA 1JEOA 2EYUA 4WN9B 4F91B 2I1QA 3LC0A 1D4ZA 3OT4A 4HJRA 4R2XA 4E03A 4FUQA 3N2ZB 3K0AA 1XCOA 3DDHA 4JFRA 3PIIA 4L6CA 4WCVA 1XP8A 5EXTA 3DEKA 3KKMA 1V9SA 3R6LA 2IS2A 2XZOA 1IQ0A 4TVBA 5AUNB 2DKFA 1A5TA 1YQGA 3ZHYA 3I8XA 2AKEA 1ZMBA 5AJTA 4P0QB 4Q9NA 2Q99A 3TUIC 1ZQ1A 1RJEA 3U16A 1CY6A 1ANKA 2DKOA 1TD9A 2H8KA 2ZDQA 3DV0A 1VHDA 2OV4A 3KSDO 4XLTA 4BLPA 2CHVA 2AN3A 2W6MA 4LYDA 1IN4A 1AHHA 1RRPA 3V1UA 2A5GA 5K8JB 1Z4QA 3CM0A 2W2LA 3MJ4A 3QYFA 2YWFA 3IBGA 4H9GA 1CZNA 2HF2A 1F3LA 2IW1A 2C7GA 2EARA 3GLRA 3MINB 4JOBA 3H13A 2GYUA 2CLFB 3OJ0A 3I6MA 2QSYA 5EHQA 4ZCPA 4MR7B 4ZVTA 3TJZA 3ZWQA 1YRBA 2ZIZA 1NFQA 3ETCA 4V0QA 2X0NA 1IQUA 4PTZA 4F3KA 1SUDA 3F4LA 5C1IA 2VT6A 4OOEA 3IKVA 5IDVA 4AMBA 4I5EA 2AXQA 4UTZA 1G63A 4ZTUB 4KSBA 1QF9A 2AFVA 1Z4OA 4DAOA 2VJMA 3NLLA 5EJ8A 5CDUA 1MIOB 4U2KA 4DC0A 5ALJA 4LOJA 4IWYA 1BD3A 2F9MA 1GGKA 2FFRA 3OC0A 3U37A 5FBZA 5IF9A 5EIBC 4O2LA 1VYUA 3T5AA 2PZGA 4C4RA 1I14A 1B26A 4X1YB 1C7JA 1N1EA 3T61A 3EAGA 4RVDA 4Z7JA 1WSWA 2O8DB 2XA2A 3Q5DA 3WJ1A 3IAM6 4ND4A 2FOIA 5DYGA 1P72A 4PU0A 2HCRA 3TZBA 3O4RA 3FYTA 3GEBA 1T5LA 3DQQA 4KCGA 4DXDA 1FSFA 1TD1A 5B57C 5JYBA 4RE6A 3CLRC 1CY2A