2ZRMA

Msreca datp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
319
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 93
structure length 319
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrmA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrmA01
3GLFE 3KZ1E 3AP1A 2Q3MA 5GJWC 5LD2C 1GL6A 1G8HA 3DHWC 2JLYA 3VR2A 3LLUA 3UG6A 4B73A 4MGYR 4I81A 1HT1E 1E98A 5TMPA 2CVHA 1WRBA 4QHTA 4LBVA 3SR0A 4LJ4A 2I4IA 2AX4A 5FL7D 1Y63A 4OI1A 4W5HA 3SJCA 1LW7A 1FW6A 2FPKA 1L2TA 1OKKD 1SVWA 2ZUBA 1FQKA 4NHOA 5C4MA 2A5FA 1DO0A 1FNMA 4GP7A 3VX3A 4WW0A 3ZZUA 3IO3A 2QT0A 5JZVA 3H86A 2REOA 4A8JA 3B2EA 1RW4A 4G5QA 4JYBA 3T5GA 3MD0A 4PZZA 1X8KA 1XP8A 3RS0A 1JECA 1WDTA 3AEZA 4QOSA 1F2UA 2W0SA 4U5XA 4ILEA 3RRMA 5SZJA 4GL2A 1PV4A 4QBGB 5DISB 2D74A 1XXHA 5JEEA 1QBKC 3TUJC 4JBYA 1E2HA 4UJ5A 2KI5A 4PPQA 2C96A 5DN6A 4C0KA 1TF2A 3DM5A 5CYPA 4F4CA 1SVLA 4CEJB 2EQBA 2YYZA 1YR7A 2XTNA 4Q66C 3IGFA 4ITRC 4ARZB 4XTRA 4ZDIA 1YZLA 5JHGB 4P4UA 4LPSA 4AD8A 2OXCA 4ZV4A 4V0ME 4DLTA 3IDQA 1TQ2A 1W47A 3GJ4A 2C03A 4TT3D 4PC1A 2ZEJA 3FMFA 1FZQA 2W0MA 5AUPB 4MKIA 1SULA 5CM9C 5KSYA 3AKYA 2QGNA 1NL3A 3TQFA 2QAGC 3AVOA 4DT1B 2WSMA 2AXNA 2GF9A 2DBYA 3FFAA 1XXHB 4N0EA 1ZP6A 4TYWA 1KHTA 4WZAE 5KNDA 5EP1A 4JLDA 1XTSA 3DZDA 2PJRA 2ZSDA 1H8HD 1VTKA 4BLOA 3WMGA 4LSGA 2Z6VA 3SYNA 4KHZA 4IHQA 721PA 3DM9B 5FBLB 5K8TA 3GLGB 2NO6A 4ABYA 4QJ3A 2FF7A 2JLUA 4JMPA 3TVDA 3PV0A 4AKGA 1R5NA 1ZVQA 2QG6A 5E95A 4BGDA 1E1RD 1OH5A 1Z22A 2JLVA 3TW8B 3ASYA 1I2MA 4TL9A 1E32A 2OBMA 4OKSA 1ZM9A 4DT1A 4ACBA 4KFSA 4PO1A 4M21A 3RDPA 1W49A 3CUEF 2ZRGA 1OH6A 5KHOC 3FKSA 1J70A 1LTQA 5FPSA 2VHTA 3B7GA 3KXKA 4JVLA 5HZKA 1FTSA 3JZMA 2WKQA 1YZUA 1Z63A 1Q44A 1UKZA 2D2EA 4TSFA 1LFDB 2WZQA 3WP1B 3SEAA 4DIDA 3LD9A 5B58C 5DH9A 4AKIA 4LI0A 1KI2A 4DWJA 1UDXA 1N6PA 2CLSA 1GUAA 2CEAA 5IHPA 2F6RA 3B9PA 4OBEA 5EE5B 1RFLA 1HEIA 1FP7A 1KK3A 1NLZA 3UMFA 3W5JA 5FFMA 1W4RA 3K9HA 1NSFA 5FUWA 4BLRA 1S0UA 2QROA 3LV8A 5B64A 5EP2A 2H8KA 3RS2A 4HAXA 3G5UA 3QKRB 4AG6A 1Z0KA 3QEJA 1P9RA 1D2MA 1M7BA 2BCGY 1MOZA 4EJSC 4HI0E 2VHQA 4P31A 3IHLA 2ZROA 3U4QA 2GKSA 1T0JB 2QZ4A 3KX2A 4A8JB 2MMCA 3K0CC 3HJNA 1U0HC 2GK7A 2WOOA 5KDDA 1OXTA 3EA0A 2ZE6A 4P4SA 2CMKA 4Y0VA 3A1TA 1MV5A 1KDTA 1QHXA 1G7CA 4N1AA 2Z5FA 3TLXA 5J4VA 3ADDA 3FMPB 4LJYA 5HR5A 4KCGA 2BHRA 3UKDA 3B13B 1EGAA 4YQFA 1W36D 1DARA 1W5SA 4LDJA 1IXZA 1RC8A 1YRAA 3GJ6A 1N0WA 2WVJA 1BO6A 3PG5A 2WAXA 3MMPA 3BJIC 4O0MA 3OZXA 5KO2A 1NJGA 2OZEA 2PL3A 2OAP1 1F48A 3WXMA 2VSXA 4KXFB 3SOPA 2R6CA 2UZIR 3K0AB 2G1KA 1E1QA 2ECKA 5BYKA 4JLMA 1ZD8A 4KVAA 1NLFA 3G82C 2NPFA 4DVGA 3UPUA 1RRCA 1G20E 4FXPA 3BH7A 2I3BA 1OHHD 2JAQA 3QXXA 1SKYB 1MR3F 2ZI7A 4BFXA 4BZPA 5HZHA 1E79D 1ZNWA 4R2IA 5JMTA 1U94A 1XCPA 2XJ4A 2ZAMA 3KDSE 3VMFA 1IJFA 4G5OA 1AA9A 4H1VA 1MABB 5HCNA 5DHAA 4DCNA 2BMEA 5GADl 2QL6A 2G0NA 4V02A 1XEXA 1ZD9A 2VLIA 5GVRA 2A3RA 1D9ZA 3V4RA 1E2QA 3MLEA 4BZXA 2AL7A 2QY9A 4BRUA 1KMHA 2FSHA 3VFDA 2H1LA 2YHSA 3BGWA 4TMWA 1P72A 2GK6A 5CJPA 3OFNA 4C7OA 3CBQA 1XTQA 3OEHD 4IOLA 1LNZA 3FHTA 1U8ZA 3LFUA 5G53C 4B6FA 4Q7LA 3LA6A 3LAWA 2V6JA 4Q02A 3CH4B 1G3MA 2PLRA 1KI7A 1OIWA 4Q1DA 2P67A 4RFVA 1KO1A 1Q21A 2O8FA 2WWFA 3FVQA 2GBLC 2RHMA 4ZIRB 3ADCA 1DEKA 4TMXA 1GG2A 4LHZA 2O8DB 2FNAA 2FFQA 4Q1CA 2ZSBA 4FWIB 2DY1A 2ZRCA 2R6FA 2ZYUX 3K0FA 3T1TA 2O8FB 2TMKA 3DKPA 5LBIA 1GIAA 1SHZA 1GRQA 1VCIA 4EPTA 4BRWA 1X8LA 3OEHA 2E1RA 1YKSA 3O8DA 1KSFX 2FU5C 1G5TA 4LHWA 1D2EA 1HURA 1JAIA 3MJHA 4PC6A 4CEHA 1FNNA 3LW8A 2WKPA 2NGRA 1KK0A 3B78A 4MRSA 1E9DA 3EA5A 1UBCA 5FUYA 4KBFA 2C99A 4NTZA 3SI7A 1NKTA 3W3AA 2Z4RA 1E2EA 1P9NA 1E2IA 1IQPA 4L4UA 2B92A 4EJSB 2IYYA 4DLWA 3QVVA 1G41A 1AA3A 1KJYA 4V0NA 1ZUHA 3AUYA 1TQDA 3U3KA 3QNUA 4OHYA 4TN1A 4GOXA 2AKYA 4PHFA 4QBFA 2P6NA 1ZUIA 2GRJA 3N5CA 2Y8EA 2ZJBA 3UWKA 4DJTA 1N6OA 1LS1A 2DWOA 5TXGA 1PLKA 3P4YA 1K6MA 1UADA 2CL7X 2IHYA 4QM7A 3RANA 1E2JA 5JLJA 1G9XA 1E9RA 2A5JA 4CEIB 3REGA 2BBTA 4JJKA 4IJMA 4XSHA 4BLTA 4MRRA 4B2LA 1NVUQ 3BAFA 1L4UA 1W4BA 1AQUA 2J0VA 3Q5EA 1OFIA 5AR1A 4C0AC 3HU2A 4B76A 2OFOA 3IEVA 2ZRAA 4Y0AA 1X3SA 3P26A 1CF4A 2P0EA 4HAZA 3GLGA 5JS7A 2NO9A 4GMXA 3THYB 1KSJA 2VYFA 2PBRA 2YWEA 3AF3A 1Z6AA 1EFRD 2NZJA 5FTLA 3GLIB 1DVRA 1OXUA 4FCVA 5KPJA 3F5FA 5FTNA 4X8MA 3PENA 1VCMA 5F2EA 5SZKB 2ZYVX 4CEIA 2W6JD 4FMBB 1SXJE 3A1SA 2EWVA 2XGJA 4MYUA 2IS6A 2OFWA 5BN5A 1C1YA 5L8VA 3U4QB 1CJTC 2LWIA 3GLFB 5FOTA 2L0XA 3Q5DA 1GOTA 2YNMA 3AV0B 2CK3D 3NC1C 4WVFA 1DAGA 2ASEA 2F3TA 3BORA 1TF7A 2CNWD 1T8TA 1CR2A 3C7KA 2ZU6A 3CWQA 3T5DA 4EPRA 2V7QD 4LUCA 4HB2A 5GJBA 4XD7D 4Q01A 1KDOA 4JKYA 3SYKA 3ND9A 2WICA 1NVVQ 3PUWA 4YMSA 2BC9A 2OESA 3AQ4A 1QHHB 4PZLA 3K9LA 1E96A 2SHKA 3P1JA 2QTVB 4II7A 4QGFA 1OE0A 1HY3A 1AKYA 1NN1A 3K70C 1P2TA 1Z47A 2AHOA 3PEYA 2Q0HA 3LQQA 1XBTA 4PTLA 1AGRA 4LRWA 3VTKA 1TMKA 3OIWA 3N70A 3AUXA 3U7EB 1DAKA 4DB2A 2DB3A 1ELOA 5FPHA 3EPHA 5C18A 3A8TA 3CF6R 4M0LA 2JJ2A 3IQWA 1HH4A 4OK5A 1R8SA 5DI9A 5F3WB 4A36A 1LY1A 3RAPR 4KITB 1MO5A 1G291 4MDEA 4IDPA 1CKEA 1K8RA 1Z8FA 2XB2A 4IFEA 4YMVA 4U7DA 4G0NA 1E2GA 2W6ID 2R6DA 2ZUCA 2GTPA 2ONJA 1P60A 3HYTA 1KDRA 2WIAA 1YVDA 4LWZA 4WZBE 3SZRA 2IYSA 2Q9CA 1N5IA 1LS6A 1W2HA 3DZ8A 2Q6TA 2ZR9A 2BMJA 4XSGA 1KOFA 1WQ1R 1P2VA 3DMDA 3L82B 4YLGA 3SJAA 2VP2A 2OE2A 2KE5A 3EIQA 1NVVR 1O87A 3M0EA 5KSZA 2ATVA 3DVLA 2ZPTX 4URWR 5JEDA 4TMVA 4L8GA 1S4QA 3X1YA 3IHWA 1DS6A 4UXHA 4PPNA 4QBHA 1UBEA 1MO4A 1MRNA 5H68A 3NVAA 2ZR0A 3KFXA 2HLDA 2ZJAA 1II0A 2G6BA 2QQ0A 2OAQ1 4IKEA 1JB1A 1GRRA 3EARA 4P32A 1KI8A 3PUZA 2ODNA 2C98A 2D2FA 3ZQJA 5ELXA 3MJRA 1XPUA 4B71A 1GFIA 5LB2A 4OQXA 5UKDA 1OV4A 2FOLA 2J87A 2IA5A 4I1VA 3TQCA 4RFSB 3C5HA 4OQMA 4DCUA 2VA8A 2IYVA 4M1YA 4DBLC 5FR1A 2Z83A 3ZGXA 2H5EA 5JRZA 1Z2AA 1KY3A 3HR8A 1ZM2A 2D06A 2WMOB 3RHFA 2QNRA 1GM5A 4TLEA 3K8YA 2BMDA 4QKQA 1WXQA 4ZCIA 4RD2A 1W1WA 3GEHA 3GJ7A 3BBPA 3NDPA 4HUQA 2ZJYA 5FPKA 4MH0R 3U5ZB 1OYWA 2BCJQ 3KQUA 2O8BA 2HJGA 4OK3A 4PPGA 3NTUA 4DUGD 3QOFA 3KJEA 2V54A 1T3HA 1G64A 3EZ2A 3X1ZA 4DIEA 4C7OB 2ODBA 4Q1EA 3UWOA 3T15A 5E7IA 4JBXA 2DHRA 1XD9A 2EWWA 2ERYA 5AUQA 4C0LA 2GJAA 1N3BA 3SQXA 1R10A 2D7DA 3AVYA 5L3VA 1CR1A 1N2CE 2R62A 5JI2E 1OFHA 4BEBA 2PX3A 2GEVA 3K70B 4NCKA 3A37A 4EPXA 4PHGA 2DR3A 1NMZA 1U0LA 3WP0A 3B1XA 1N6KA 3A4LA 3LO5A 3W6PA 3I3SR 3CLVA 1SXJD 1JJVA 2ORVA 1A4RA 3SBDA 1KNQA 3V4FA 3QBTA 4HB3A 4Q7MB 1W44A 1AM4D 3VHXA 1F2TA 1NBME 3RWOA 5K8LA 5FTKA 3WRXC 3RRYA 4LC0A 4CDGA 3GJXC 2RAPA 3FYHA 2XNSA 4RZXA 1FUUA 1TF5A 1H8HA 4NCNA 3A1WA 1XB2A 3HR7A 4NMMA 2YC2C 2ZTSA 4V03A 4Z1MA 5KYKA 3SNHA 1IN6A 5L3QA 1EFCA 3ZZTA 3BXZA 4Z8YA 2J5XA 4DSUA 1RE0A 1KI3A 1Z6GA 2RB4A 1A1VA 2XAUA 5BQ5A 2GETA 3BRWD 5LB4A 3ECCA 3U3JA 2X8AA 5FOWA 3L0SA 1QVAA 5AWFC 4DDVA 2E87A 1Z0AA 4HZUB 4EQ6A 1XXHE 2O8CA 2GJSA 4AYWA 2AD5A 3LRPA 3A1VA 1T5IA 3CR8A 2O52A 2XOKD 5KDLA 2RMKA 1BIFA 4GSYA 2QSZA 2J0UA 4R71A 2XJ9A 4A92A 2WSSA 2REBA 1YHNA 4RJLA 3GLHE 2ZM5A 1E2FA 1YRBA 2ORIA 4Q9HA 1G7RA 1ZNXA 5KU1A 1Z6YA 1E3MA 4F7WA 3DKVA 3CZQA 3W9YA 4EFMA 1P73A 1TEVA 3IPYA 1NN5A 2RGCA 1N0UA 1Z83A 1RJ9A 2IS2A 1KMQA 1W0KD 3B6EA 1D5CA 4LHVA 1KMHB 2NO0A 5C46F 1KY2A 3CX6A 5G3ZA 3RVBA 3THXB 2RGGA 4B2IA 5KDOA 5CDFA 4HSEA 2FH5B 2IYWA 3MFYA 1CIPA 1PLLA 1T91A 1Z6XA 5H1YA 1IM2A 1JEEA 4XWKA 2JATA 3AGPA 4PHTA 3TR5A 2BKUA 1AJEA 2FX3A 3L8YA 1OYYA 1GWNA 2JJ2D 1TAGA 2JEOA 2DFNA 3WBJA 4I4LA 4LYJA 3T34A 2ZRHA 1IJEA 1G7TA 1IBRA 2DWPA 2EFDB 4I99A 4JL8A 4UNRA 1XTRA 2MSEB 1E0SA 3GLFA 3OE7D 3AP2A 2VF8A 5D3MA 3CR7A 3Q85A 4IVRA 1AQYA 4BLQA 2RGNC 4CF7A 2A5DA 4C2UA 1ZC4A 3MCAA 1E2KA 2H92A 3GLIA 4JLJA 2DFKB 2BWJA 5EP4A 3ZDQA 2DWQA 3K1JA 1R2QA 1VG8A 2R6AA 3ZD6A 5JWOA 2OV2A 5BN4A 5KPDA 2KB0A 1GZSA 4HDQB 2NZ8A 3ZVNA 1PUIA 3SS8A 3LBNA 1E2LA 1JR6A 1OB2A 5J47A 1W0KA 4Z8XA 1NN0A 4XOIA 3ZVRA 1ZRHA 1H65A 5DYIA 1QHHA 1S9DA 2CE2X 4CYMA 3THWA 1E0KA 2IXGA 2JA1A 1NI3A 4LC1A 4MKGA 5H70A 1JR3E 5AJXA 1E69A 5BWMA 4US1R 3NKVA 4G01B 2J1LA 4GOJA 2G83A 1H8EA 1W4AA 2C04A 2GZAA 5HE8A 3OEEA 3ZJYA 1XCGB 1KDPA 3BS4A 3B1WA 3KXIA 2FE4A 2VP5A 3Q7QA 3VKHA 2QP4A 3I8XA 5FOVA 1WE2A 2JLSA 1S9HA 2UZ3A 1Q1QA 3ASZA 2QPTA 1GVNB 2F1HA 4BFWA 1HTWA 1ZIPA 4BASA 3WY9A 1GRNA 4US0R 3C16C 2IYLD 1P2UA 2KBFA 4Q4HB 5B2ZA 3W8RA 3GLGE 4LHYA 1OFUX 1KIMA 4PANA 3AM1A 2VRWA 1XEWY 1NIPA 1P75A 3ZVLA 2ZUDA 4IXNA 4RD6A 1AZSC 3KKOA 2GF0A 1K5GA 2K5UA 3QF4A 4HAVA 3O47A 2C9YA 5A5GA 2UKDA 2ZETA 1KSGA 4C3ZA 2G77B 1M74A 4JVMA 2PZGA 3KTAA 3KFVA 4C9BA 1QHYA 1QHNA 3REFA 2FSGA 3TBKA 1C9KA 1P7CA 1YZNA 4E5UA 1QHGA 4MYHA 4IDOA 3FFBA 2ZIAA 3CKLA 1N6LA 4V0MA 1TU3A 5F98A 4DLXA 3MG9A 3TW4A 4RCZA 3AVWA 4TL7A 4QGGA 4NH0A 2GEUA 2WWWA 5FBQB 2GVZC 4F91B 4MKFA 3HP1A 1TPZA 3U61B 4M9XA 4H1UA 3QKUA 4JJZA 2QRZA 2GEDA 2V6IA 3KJIA 1ZBDA 3W34A 4TZ0A 3VNVA 1JR3A 1ZU4A 2CHQA 4GBMA 221PA 2IXFA 3KQNA 4GZLA 4GDFA 3RRZA 1S8FA 2FEMA 4QC2A 3GFTA 4MDFA 2E9SA 4D0GA 1G6OA 4F4IA 2HDNB 4ZDJA 4ARZA 1XD8A 2W00A 3CRW1 3CZPA 3VR6A 1AN0A 2QGZA 5G41A 4Z1MD 2JASA 2D3WA 2CK3A 3QSYA 4DB4A 3AP3A 2A5YB 3AB3A 1G5PA 4C4PA 3QG1A 5JS8A 5B57C 4B33A 1E1RA 1T8UA 3JZAA 3NBFA 1XD2A 3NDBB 3T06B 2JJ8A 3VR3A 1VMAA 1U90A 4GT1A 4WIAA 3M1IA 4XWAA 3DOEA 2ZI4A 1BOFA 3U3RA 3IPXA 1E79A 2PT7A 2QT1A 4O2RA 2RCNA 4CT4B 3DDCA 3QUSA 5A0FA 3TJZA 2VHCA 4HLQB 4KBGA 5EUMA 3CO5A 4RY2A 1E99A 3K53A 2O8CB 3AH8A 3FOZA 1SZPA 4BFTA 1US8A 3NBZC 2P3SA 1DADA 2RGEA 3PUYA 1KKLA 1KGDA 1CJMA 2EFEB 2IF0A 4M1SA 2X2FA 4M9ZA 1OIXA 4PO9A 4B2PA 2IUSA 1N6NA 2EYUA 4EAQA 5HE9A 5HPYB 4TYNA 3ICQB 1XWIA 3CF0A 1ZD1A 3KUDA 3OHMA 3WMEA 1S96A 4B75A 1S1CA 3PEUA 3B85A 5J4YA 2ZRFA 4TQUS 2NG1A 1A7JA 2ZS8A 3C14C 4JSYA 4OYHA 4I1SA 2MMGA 1P61B 1M7GA 4M1WA 3W8NA 5J4HA 2XXAA 5EXXA 3WBKA 1Z5ZA 1FL9A 1KNXA 1VYTA 3EIEA 4TLCA 2HYDA 2B8TA 5EZ5A 3PEVA 2YWFA 4RVCA 4WOPA 4W9MC 2V1UA 1CTQA 4CZ2A 1J90A 1II8B 3GPLA 1YU9A 3RC8A 2UVQA 3TAHA 4ASUA 1R0YA 4UXIA 1HUQA 1N5JA 3TNFA 1UBFA 3X1DA 4NU0A 1IHUA 1XEWX 3QE0A 4JLVA 4YMWA 2XNDD 1NRJB 4ERNA 5J4KA 3A1UA 2C5LA 4A2WA 4A0GA 2C8VA 4TLDA 4BQSA 2RGXA 4KI0A 2VL7A 3IIKA 2ODEA 2QTHA 3QVUA 1OPXA 2XEXA 3L0IB 4D0NA 2PMKA 1XDBA 1DTSA 2AXPA 2PEYA 1FP6A 2OG2A 4HAUA 3Q9LA 5CJ2A 4BLPA 3K0FB 5FL3A 4EFLA 3NBYC 2V3CC 1KI6A 1DOAA 4NONA 2VEDA 1AGPA 2N1BA 2W2TA 1RZ3A 5DIFA 4ZIRA 3B82A 4U02A 2YWGA 1UFQA 2CDNA 4JVNA 2ZRKA 1DO2A 3MWJA 2IK8A 2JLZA 4BUJA 4JT2A 3RS7A 4NYJR 1PZNA 5ANRB 1LF0A 3R20A 1IN4A 3QG5A 3PITA 4LBYA 1J7KA 1NIJA 1P62B 3OF5A 1ZC3A 4OL0A 5K8UA 2FDCA 1G17A 3AF0A 2ZRPA 4D4LA 2JJ1D 2HT1A 3T1QA 1Z6TA 4RKEA 4DDUA 3K0EA 3CRMA 1HE1C 3GJ8A 2MSDB 3N2IA 1R6BX 3B8HA 3WNBA 2JGNA 4UNSA 1WB9A 1DAHA 1IAQA 1EXMA 1VHTA 1XMSA 1HA3A 3BFXA 5L3RA 1IXRC 2WMNB 3NC0C 4PZYA 1XRJA 2EFCB 2O0KA 4QM6A 4BECA 2NQ2C 1EG7A 2G9NA 5BYJA 1E94E 2O8EA 3U6BA 5FUVA 4OHWA 5EP3A 3SQWA 4B32A 4Q1AA 4HB4A 3CNOA 3A4NA 3ZD7A 1SQ5A 4G3XA 4RD3A 4D26A 2JJ1A 4H9GA 1SXJA 3WYFA 4EUNA 2QPOA 2AWOA 4JIMA 4K8OA 3C41J 1E1QD 4OQNA 4DSTA 3SHWA 1OSNA 2C9OA 3ZZ0A 2ZRLA 4BWYA 5AJYA 3ZS8A 3QENA 3X2SA 2F9MA 5GVSA 1KO4A 4MGKR 4A82A 1P6XA 4G5RA 3KL4A 4Q7KA 3KQKA 1SKQA 5HKKA 4LHXA 4KYIB 1N0VC 3K0CA 4NE2A 4FMCB 1UEJA 3AKDA 3LQRA 4N0DA 3KKQA 3PXGA 5KSOA 1IY2A 4B3CA 2QI9C 4BE7B 5KNBA 1WBBA 4WAUA 1GTVA 3TKLA 1JBKA 4PAOA 3BERA 2OSBA 2YOHA 3WNCA 2IL1A 2Q9BA 4DRZA 3BB4A 1E9EA 2HUPA 2IYTA 4M9SA 1YZQA 2HEIA 5EXSA 2QP3A 4OQLA 3UATA 621PA 4XTCS 1XMVA 4C2TA 4D4JA 1YZKA 1CULC 5AJVB 2ANCA 4JLOA 1T0HB 4NYJQ 1BS1A 4UQOA 2P6RA 1U9IA 3A58B 2ZI9A 1VIYA 4Q19A 3BIFA 5TARA 1EFUA 4HUTA 3TMKA 4URXR 1XX6A 2O0HA 4Q4AB 3C5CA 1WCV1 5KUTA 4M1KA 3TK1A 2PH1A 1ZJ6A 5E7MA 2ZR7A 1Z0IA 1TQ4A 1CR0A 3DO6A 4LV8B 3SC3A 2OLKA 3U3OA 3EIHA 2FPLA 2O8EB 3LX8A 4B35A 3L8ZA 2FGJA 5FBRB 2H57A 4RZ2A 5F9FA 3G0HA 3JVVA 5CIQA 2ZYWX 5TDHA 4ZKEA 2XZLA 3KKPA 1T3SA 3W3ZB 3EAQA 4XJXA 5KNCA 2CHVA 4DHEA 2VHUA 2OO7A 5LDDC 1QG4A 1YR6A 1RJ9B 2HXSA 1KSHA 2J0QA 2QN6A 2X1VA 3LVQE 5FTJA 4AIIA 5AUNB 2MSCB 3LX5A 3SJZA 1BYIA 1W36C 4Q7JB 3NG1A 4IDQA 1I4TD 1ZW6A 3P32A 1U99A 4A2PA 1XNJA 2IBMA 1TNDA 4MRNA 2CL0X 1BKDR 1VHLA 1JQJC 4E22A 3K09A 1KI6B 3GEEA 4D4KA 3B1YA 4IEIA 4A2QA 1M1YE 4YXWA 3MRSA 2B6HA 5JECA 1UBGA 3NH6A 1LV7A 1XMIA 1GDDA 4Q9JA 4KFTA 3MAAC 4RD1A 4DZZA 1GNQA 3DOFA 1IN5A 4B74A 2P2LA 2WSSD 4R7ZA 1X8JA 4PSKA 4PQRA 3CPJB 3R8FA 1RYFA 2IW3A 3K9GA 1U8AA 3SDZA 5EE0A 2FV8A 2HXYA 1G16A 1FX0A 3CX8A 1II8A 3EG5A 2O0JA 2ERXA 1L8QA 4B3XA 3K0SA 2QBYA 2O5VA 4B48A 3B60A 3VU9B 5CK5A 4US2R 5IRCD 1CXZA 4LZZA 1ZCAA 3FHOA 3D31A 3P27A 5EE9A 5FH9A 3EWAA 4F4JA 2HCBA 3ZVMA 1U0JA 1HE8B 2ZRBA 2VF7A 4OI4A 4BFVA 4ESHA 5DE3A 4QG7A 1YZGA 1KO5A 4PC7A 4XVQA 3RLFA 1OH8A 3SU8A 3WYAA 2IUTA 1UJ2A 4OHVA 4HLUC 2F43A 4A9AA 2G88A 4GPTA 4MUBA 2J59A 1O3YA 2W6IA 2O8BB 1YQTA 3M4YA 1TQ6A 1II9A 4LK2A 4C0JA 1DAMA 2WJHA 4FIDA 4AYXA 2WM9B 3E70C 2FPMA 4QHSA 3EZ7A 1UEIA 3U2QA 4BEJA 3AVQA 2BEKA 1MT0A 3KKMA 1T9HA 2FSFA 3NBXX 3BOSA 3AVVA 4HATA 2FZ4A 4LCBA 3AGQA 1WA5A 2J45A 1COWA 2VIIA 4PHHA 2OUKA 2OXRA 1Z06A 1EFHA 2ZANA 3W90A 3H0KA 4MA4A 3V9PA 1EK0A 4J0QA 2PX0A 4P33A 5BXQC 2Q3HA 3A6PC 3H1TA 3R8CA 1H8ED 4Z54A 1HT2E 2VQSA 1QG2A 2ZRNA 3RS5A 2ANBA 4NZYA 1F2TB 4K81B 1ZMXA 1CR4A 1V43A 5SZHB 3TUZC 5JBQA 4L16A 2V7QA 1U2RA 2OCBA 4KVGA 1N5LA 4RZ3A 1G19A 1E0JA 1ZINA 4UJ3A 3BE4A 4B6EA 2C77A 1EX6A 1V5WA 3DMNA 4IW3B 2LKCA 4HDOB 1ESMA 5TB5A 3EW9A 1G8FA 1GAJA 1G4AE 3L43A 1W5TA 1YZTA 3H2YA 1JPJA 2IUUA 4KJZA 4DLUA 4WZ6A 3BB1A 3RC3A 2P65A 2FJUA 4ASUD 5DGXA 1U98A 2J0SA 1UF9A 3Q7PA 1OW3B 3QF7A 1Z28A 4JL5A 4Q9KA 5C4GB 4PSAA 4EKDA 2YV5A 3EXAA 2ZI5A 4MITA 1I2DA 4Q1BA 4Q9IA 4UNQA 4F38A 4IFBA 1N6RA 2G3YA 1XTKA 1E9CA 5FPTA 1KI9A 4IDHA 1P9WA 1OKKA 2ZI6A 2RGAA 3IEUA 1N6IA 4Q4JB 1JXMA 4BFSA 3KB1A 4JVSB 4FCWA 4L15A 2IS4A 2ZJ5A 2IEZA 3PJRA 3MWLA 3LBIA 4B3DA 4HAWA 2V1XA 3ETLA 1KJWA 2KWIA 3OE7A 1SKYE 3K9NA 2BM1A 4JYCA 5DN6D 4BPBA 2ZRMA 3AF2A 2ZYTX 3KKNA 4DUGA 1G18A 2VH5R 2B7BA 4EPYA 4AC9A 1IONA 4Q4HA 1Z0DA 1M6NA 3B1VA 1P5ZB 4RKFA 1RRPA 3FGNA 4OHZA 3VKGA 3IIMA 4GZMA 2ZITA 3VX4A 5GJVC 4A6XA 1YE8A 2CCGA 1CJVC 1CJUC 1AS3A 1DAIA 3PIRA 2BM0A 2QA5A 4FCTA 4FN5A 4MUAA 3X1XA 3QBVA 3K70D 2QMEA 2QBYB 1CJKC 4YC7A 2PT5A 3V00A 4TL8A 5EXPA 2KSQA 2ZREA 1E9SA 1Q12A 2AK2A 2F7SA 1P2SA 3QKSA 5EE1A 4OJKA 4DXAA 5EZ6B 5IK2D 4IDNA 4W5JA 4PPFA 2VP0A 2D7CA 2RGBA 3GCGA 4XH9B 4DLVA 1RVDA 2OBLA 3S1AA 4HYYA 3CWZA 2J3EA 5CB8A 2ONKA 1GP2A 2GBLA 2WJYA 3OIVA 5CITA 2BEJA 4D80A 1TU4A 1XCMA 2FSIA 2XOKA 3BWDD 1Q57A 3JVUA 4DEYA 3W5IA 4C0SA 4W5WA 1ZU5A 3D6TB 2HCJB 1KAGA 3LXRA 3C4JA 4O25A 4JT4A 4XWOA 2PMDA 4BLSA 2JLWA 1N5KA 4HUQB 4Q5IA 4TMKA 3VQTA 1VKJA 2N46A 5FPYA 2GAOA 4NDZA 2EVWX 2PCJA 3GFOA 2GJ9A 2CNWA 1NBMA 1OT3A 4WBSA 2IYZA 2ZRDA 4IVPA 1JEDA 4DC9A 2JIZA 3I4LA 2W58A 2WWYA 4IEEA 1IN8A 1P4SA 2WPDD 3BFKA 3RYTC 1UM8A 3LW7A 3GEIA 4MQBA 4ZI3A 3IKJA 4BFUA 2F1JA 5IF9A 5CYOA 1OB5A 2GJKA 2ZS7A 1XZQA 1VIAA 2A30A 2WWIA 5JFGA 1AS0A 1GITA 2Z43A 1NVWQ 4IXMA 1OHHA 3VR5A 5E4FA 3QKSB 1FUKA 1G3UA 5CLLA 5JJIA 4LYHA 1CBUA 4TLAA 3TIFA 3WHLA 4OQFA 4D0LB 1Z3IX 5DO9A 4Q48A 4CGZA 4EJSA 2EYQA 3CRVA 2ZE5A 2WTUA 2R65A 4HLCA 3UMRA 5A4JA 2ZRIA 5D3QA 1Q20A 3LVRE 4D4MA 2GCOB 3QPVA 5AK0A 2NIPA 2CLCX 2IF2A 2DFTA 4PC2A 4TYQA 821PA 2D4HA 1HV8A 3F3YA 4ZCLA 3L2OB 4HZIA 3TE6A 2I1QA 3O8RA 1VYVA 1XZPA 4RZUA 1OXSC 1M34E 1XFAA 2CXXA 2QAJA 3OIUA 1EWQA 1ZIOA 3X1WA 2ZE7A 3GJ3A 2AD1A 4G5SA 5G3YA 2V4ZA 3NEJA 4KV9A 4ESVA 2GILA 4NYIR 2PCLA 3MWKA 4C30A 4Q4JA 3KQHA 2CLDX 4MKHA 5TY0A 1Z2CA 3I92A 1G6HA 3VR1A 3PVSA 2J7KA 4LBWA 4ZO4A 3BC1A 2IWRA 4Q4LA 3PFIA 4PO8A 3TSWA 4R2HA 4A15A 2CCJA 2F43B 1T3LA 2ATXA 2P5SA 5FI0B 1G7SA 1ZM4A 2W83A 4JLBA 4YONB 5JSZA 3BH6A 2AK3A 4FD2A 2OBNA 5D3MB 3GLIE 1E9FA 3KXLA 5JJKA 2FFHA 3HDTA 2JDIA 3H84A 4KLNA 4Q18A 3CPHA 3I32A 5CK4A 1T5LA 5EQTA 3TSOA 4IOMA 1WP9A 2BOVA 2VSOA 1BMFA 3CM0A 3CW2A 1FX0B 1G8PA 3IO5A 2XSZA 2IT1A 3D3QA 4TT3A 1E6CA 4DSOA 4OK6A 3VU9A 3T35A 2YVUA 2RGDA 1DG1G 1VDZA 1VG9B 4KO8A 1IN7A 2NMVA 4Z51A 5DI3A 5DSZA 4GI7A 2RH5A 1T6NA 3PR1A 2WKRA 1E9BA 2RHDA 4PSVA 4URUR 3EX7C 3I5YA 1VCOA 5HKKD 2AFIE 3OFND 1IY1A 1OIVA 4UNNA 1XPRA 5FI1B 2QUZA 2WV9A 2ZSFA 3B1ZA 3SFZA 2Z4SA 4NCHA 4OI0A 3RS4A 3QQ5A 3HPQA 3Q8XB 6Q21A 2XTMA 1G1MA 1AKEA 2IXEA 2XZPA 1B0UA 3IUYA 3TR0A 1ZNYA 4EIWA 4GMDA 3VKWA 2OM2A 3PUXA 1RRGA 5F9HA 3U3MA 3U7GA 2GHIA 3QPWA 4QRHA 1ZM3A 4V0LA 4WXPA 1QVRA 2QSYA 4LY6A 5FOUA 421PA 2GZHA 3D8BA 2DPXA 4P4SB 1ODFA 1Q0UA 1GL9B 1UKVY 3BB3A 2EU8A 2W2XA 3ND8A 1F6BA 1DAEA 3U7FB 4RFSA 3U44A 2F1IA 2JLQA 2GCOA 3KJGA 5FL7A 4Q00A 2IWHA 2XZOA 4WA7A 3RNLA 1PVOA 4MYCA 5DNYB 3I5XA 5M04A 4B3GA 2OFXA 4DEXA 4P4TA 2QU8A 3J81k 1MKYA 1NKSA 1Q3TA 1X86B 1PUJA 2ZVQX 3WNDA 4CVNA 4A4DA 1OLOA 1K5DA 4X8HA 3AF1A 1Z0JA 1CS4C 1OXXK 1SGWA 3AKEA 1KO8A 1SVKA 4W7SA 4D2IA 3T61A 3IBYA 4E09A 2X77A 4GRAA 4YDHB 2NOAA 2OLJA 4N3NA 5EUQB 3WYGA 1B23P 1FPMA 4E07A 1NNEA 2ZE8A 2LCFA 2ZI3A 3THWB 1W36B 2Z0MA 5EE3A 2GZDA 4GP6A 4AG5A 4M2LA 1BMFD 2ODWA 1AK2A 2BVNA 2GDJA 4TYPA 2QORA 3U6KA 1EFTA 5TVKA 4B34A 2ZQ5A 4NKRA 4R98A 4S35A 4DLRA 3QPUA 5B30A 8OHMA 4TTPA 2FWRA 3M6AA 2OEPA 1G3RA 3UANA 2W6JA 1FQJA 5CM8B 4PAQA 1QDEA 1R7RA 5FTMA 1D8TA 2PZFA 5IK2A 1P3JA 4C0QC 2B8WA 2OILA 1E2PA 5TV2A 2BJVA 2BBWA 2J9RA 1BYUA 1EFRA 1XJCA 1QF9A 3OIYA 3Q72A 3RS3A 1X6VA 3FDIA 3IQXA 1L4YA 1UKYA 3F0TA 2HYIC 3TUIC 1E9AA 2P6UA 1Y3AA 3QY0A 1G3IA 2BIFA 3DPUA 3K09C 1KZGB 4PX9A 4M1OA 1ZCBA 3PEWA 3T1OA 3CRRA 3ZLJA 2EFHB 2OCPA 4QNRA 2CE7A 3CNNA 4P0TA 2HJVA 3LXXA 4FI3C 4ZI2A 2WWXA 4JZKA 2WWGA 2YINC 4G5GA 1BH2A 4IOJA 1HQCA 5HTKA 2HT6A 4DCTA 3D7MA 3ZIAA 2B7CA 4KU4A 1NG9A 3I62A 2FZLA 1SVOA 4QGAA 4Q9LA 3GJ0A 1PLJA 2R2AA 5IT5A 2NPIA 1FFHA 1Q3HA 4DCVA 4BFYA 2YC4C 3P4XA 1XMJA 4QBIA 5FBWB 1L7VC 3ICEA 5J40A 3CB4A 1M2OB 4BZQA 2CJWA 4DSNA 2ZSEA 2YOFA 1ZYUA 3C8UA 4LX0A 1AIPA 4FWTA 4QNMA 3TGPA 3TSZA 3IBGA 3W6OA 5JI3E 2Q9AA 4Q21A 3ADKA 2GXAA 1W0JD 2V8OA 2JLXA 4URVR 2I1VB 1LF5A 1N25A 4K46A 3GP8A 2BV3A 5KTYA 3I72A 3KTAB 2GJ8A 3RWMB 4ZCMA 1TUIA 2BJWA 3PCRB 1ONBA 2VPPA 1A5TA 2QMUA 4DLSA 1Q22A 4OJQA 4QJ4A 1OF1A 2AWNA 5AUOB 4ZPXA 1NF3A 2CVFA 2IYRA 3THYA 4CW7A 4FMCF 2QQEA 4OHXA 2IS1A 2NO1A 2GXSA 5JJLA 3NHBA 1S2MA 1J8MF 1VECA 2C95A 1VG1A 4QL3A 5BW8A 4I1OA 2FA9A 4NBSA 4JLAA 1NN3A 4X8OA 1X1SA 2PLFA 5CIWA 2YWHA 5FOSA 1GSIA 4MGZR 4PXAA 3BK7A 5DI3B 1GNPA 2R8RA 2YZ2A 4URZR 4KLZA 1LVGA 2OT3B 1NY5A 1Z0FA 2AN9A 2VP6A 3CIOA 3VR4A 4YDSA 3O8CA 2VBCA 1NMYA 4PQFA 2QENA 1E2NA 3CONA 4QHYA 5K8IA 4NPHA 5C2JB 4YMTA 4HLUA 4LGMA 4TLBA 3TAUA 3AVPA 4O3MA 1KI4A 3FPAA 1I4LD 4AURA 2ZSAA 2PEZA 4I1UA 2QTFA 3HYRA 3U7HB 3ZIAD 1ESNA 2ZJ8A 2GCPA 4TL6A 2WPDA 4PC3A 4NCIA 2JIZD 4POAA 3BFVA 4EDHA 4RSGA 4JSTA 3EASA 4KSCA 4R9UC 4XIGS 2GXUA 2X2EA 1U8YA 1WF3A 5DLQC 2IYUA 2BBSA 1S3GA 2IC5A 2QAGA 1Q1EA 4QXAA 3HU1A 2J7PA 2WWHA 3UK6A 1YR8A 4KYUA 2ORWA 3HU3A 3FMIA 3FB4A 4IVQA 2JCSA 4HLDA 5FUXA 3R7WA 4DCSA 4FMDF 2QAGB 3OAAD 1NVXQ 3E5HA 2O8DA 2F3RA 1SVIA 4TYYA 121PA 2IX3A 4EPWA 3EPKA 2VP9A 5J4LA 1W0JA 4HDCA 5L3QB 4DLYA 3SHFA 4D81A 4RCYA 1G8GA 1NSTA 2OCAA 2KBEA 5DYGA 1JALA 4ZKDA 1CU1A 2P5TB 1JI0A 3LLMA 2ZAOA 1KZ7B 1A2KC 3EZFA 2A2ZA 1XEXB 2HF9A 4LBZA 4DDTA 1LB1B 4NL4H 4AKHA 1J8YF 2F9LA 4AK9A 4M53A 2F1RA 2RGNA 3CRQA 2QPAA 3I1FA 2GNOA 1HQYE 2YKGA 1S3SA 1C4OA 4MYTA 3I61A 4RD4A 1QHSA 2R6GA 3AVTA 2AR7A 2HLDD 2EW1A 3AF4A 4JLPA 2REXB 3HWSA 3R9WA 3EC1A 4FINA 1NY6A 4IRUB 4C0HA 4M9QA 4TSFD 5JRJA 4LV6A 5L3SB 1HYQA 2FMXA 3IIJA 1MRSA 3QJYA 4JLNA 3NXSA 1SXJC 2ZXUA 5J5CA 4BFZA 2XXAB 5H8WA 2CCKA 1OXVA 3UXMA 5JHHB 3THXA 1MH1A 1OJLA 1ETUA 3FKSD 3LWNA 2DCUA 2C2HA 1KKMA 3K0AA 4AYTA 5JWHA 3B5JA 1Z29A 2QRNA 4D82A 3EC2A 1RYHA 2A7QA 4M1MA 1ZNZA 1R8QA 3P20A 4AI6A 4NYMQ 2BBOA 2RKOA 4LV5B 3SFVA 1M8PA 2FG5A 1MO3A 3WRYC 4A0HA 3U60B 1OH7A 1D6JA 1D9XA 4GOKA 5GJCA 2CHGA 3B9QA 5E3HA 3GQBA 1JJ7A 3E2IA 3NEYA 4LPKA 2BMFA 4B3FX 5E7JA 1SVSA 4B47A 4HZUA 4EQ6B 4RD0A 4NYIQ 3GFPA 4ZDWA 2NTYC 2PZEA 5KOYA 3RSOA 3N2EA 3QKRA 1XEFA 1NLYA 1DG3A 3UMSA 1VG0B 3LY5A 2V55B 4FW9A 4LJ7A 2FEOA 4P3YA 4A8JC 4NYMR 5JWRA 1EX7A 2QMOA 2ZU0C 3S1AB 3EPJA 2IEYA 2DYKA 1U9IC 5CB6A 2QM8A 4TZ6A 2J41A 1RRFA 2WOJA 4B3BA 4UXJA 1S1MA 3GLHB 1XU4A 1W4CA 1XTIA 1JXOA 2IYQA 2WAYA 4Q1FA 1R5BA 3WMFA 4ZDKA 3DEFA 1XPOA 1JAHA 3TH5A 2D62A 2A5GA 2J7PD 1Q1ZA 3OESA 4A0RA 4XVUA 2X19A 4L9SA 3KJHA 4ON9A 1NP6A 2G1JA 1R4AA 4CEJA 3BD9A 1RIFA 4TQAA 1D2NA 2Q3FA 2WHXA 3CH5A 2WJVA 3GMTA 3QXHA 1DBSA 3L0PA 1NJFA 4KODA 3DL0A 3EWSA 1QZXA 4GNKA 1E2DA 4TMZA 1RPZA 1COWD 4U00A 5SZIA 4CEHB 2LKDA 4TTRA 2XB4A 2JDID 4TWZA 3U44B 3AKCA 5JSZB 2YOGA 1XJQA 4A0FA 1KYIA 1TEXA 3FMOB 1G8YA 4NP6A 1US8B 2AKAB 3QXSA 3UIEA 3E1SA 4YXWD 1OFTA 2VSFA 1W2GA 2G0TA 3LNCA 3NH9A 4UNPA 3RABA 3T1VA 1E0AA 2A78A 4MRVA 1E4YA 3ZYCA 3QEOA 1J2JA 1XJ0A 3TRFA 2J46A 4M22A 3NWJA 4YMUA 4LJ6A 4PR0A 4KAXA 4Q47A 4AWXA 4PQYA 4JS0A 1QRAA 1R0ZA 3SJBA 1I4DD 1CRQA 1VYUA 3QKTA 1FOEB 4NCJA 4G1UC 3VHLB 4KFRA 1JPNA 4LJ9A 4UKDA 5AJWA 2VTKA 1GKYA 1TTTA 1UDWA 2KJQA 1SXJB 3EZ9A 3MUFA 3KB2A 4L9WA 2GCNA 2OCYC 1GNRA 5CDFE 4A1FA 1UKEA 1ZAKA 3W6NA 521PA 3MSXA 1R0XA 2PJZA 3TVTA 1WMSA 2ZJ2A 1W48A 3R9IA 5JCZA 1W46A 1KO7A 4L5BA 1UPTA 2H16A 5EJEA 1F3OA 5DHFA 3OEED 3I73A 3BH0A 3FE2A 3GJ5A 4QGHA 1F5NA 5C1BA 3AVUA 4JBWA 2YJTD 1G4UR 1NMXA 1TX4B 4MGIR 3F8TA 2GVDC 2BDTA 3RRNA 4ACAA 4DLZA 4Q4AA 1GL7A 2CBZA 2WIBA 2VP4A 2QE7A 1KK1A 1ZM7A 4S2EA 3NIBA 1TADA 2QMHA 3GLHA 3SBEA 2QE7D 3RSLA 2XNDA 1RKBA 3A4MA 1IY0A 4HEJA 1F2UB 1VPLA 1EESA 2VO1A 3T12A 2H18A 4DDWA 1DAFA 4XVRA 2J0UB 1CP2A 3CX7A 3FWYA 1YR9A 2WJJA 4M1TA 3FHCB 5EXTA 2QM7A 1GKUB 3VNUA 1Z07A 1TL7C 3OAAA 4LYFA 1SVMA 4D25A 3R7WB 5CLQA 1JNYA 5LD2B 3KQLA 3ONWA 4HAYA 3PUVA 2A9KA 2GESA 2FFBA 3LDAA 1KJZA 4M8NE 1CRPA 4KSBA 1JR3D 4TTQA 1QHIA 5FOXA 4CRWB 3FTQA 4AKEA 3EPLA 3HPRA 2JLRA 3QIAA 1FTNA 3LH5A 1FMLA 3A36A 4JL6A 4JLKA 4URYR 1T4GA 3ADBA 1NG1A 3O8BA 1Q1BA 1JQLB 1DE0A 2H7VA 1CEEA 5L3SA 4QJ5A 4JKIA 5KSPA 1G3QA 2GWHA 5FR2A 5BN3A 2GAAA 3L0OA 4B44A 2B21A 2V9PA 3UG7A 4V0KA 3WHKA 4LYAA 1KI1A 2F55A 4X8LA 4OI2A 1N6HA 4F92B 3IILA 5LPNA 3THOA 1CLUA 4O2LA 2N42A 2H17A 1M7HA 3CPEA 2NO7A 3FKQA 4E03A 1AS2A 1VCNA 1ANKA 4TQ9A 4WXRA 2EFGA 4C0BA 2WBLC 3ZQ6A 1WBDA 5JCPA 3QXCA 2HF8A 1PJRA 4AY2A 2VHJA 1DELA 3NHAA 2ZRJA 1G21E 2R9VA 1YJ5A 3CNLA 2IHBA 3VAAA 4FMDB 1ZUNB 2GA8A 2R44A 5IDVA 1W7AA 2XTZA 4IOKA 1DPFA 3GD7A 1TUEA 4LJ8A 1NBMD 2XX3A 3QI2A 1KTVA 5G40A 4EFNA 2QEQA 4TMTA 4XD7A 3QXJA 4A6PA 3QF4B 2GXQA 5AJZA 1AZTA 1U81A 1R0WA 1A2BA 2XSZD 2QP9X 1F60A 4LJ5A 3ZS9A 4F93B 3EZ6A 1E2MA 2ZJOA 1XD2B 4V0OA 2FFAA 3MWYW 3H4MA 4LOAA 3Q3JB 1GILA 1J99A 2IYXA 3PQCA 1EWRA 4PAMA 5FBVB 1MO6A 1G5RA 1GKIA 1Z08A 3LBHA 4KFUA 3I8SA 3SYLA 2WJGA 3ZH9B 4D6PA 4DKXA 4GFDA 2ZS9A 4QFMA 1R5OA 1KK2A 2CJWB 3CF2A 2FGKA 1KAOA 4CIDA 2C78A 1E4VA 4LJAA 3KUCA 2DFLA 1X1RA 4M4SA 2OHFA 2AFHE 4HB0A 4PFSA 5P21A 1A82A 4Q03A 5HCIA 1SHKA 2W2VA 4B43A 2FN4A 3C15C 3SN6A 3MGCA 2C9CA 2HV8A 2CL6X 2XITA 2ZJZA 1UAAA 1IXSB 1MABA 2BKEA 2WJIA 1XF9A 2ZVPX 2Q21A 4CT5A 1FMJA 4EPVA 4MRPA 3AVXA 3SE0A 1XTJA 3R9XA 1IOZA
chains in the Genus database with same CATH superfamily
3KZ1E 2O3TA 2Q3MA 4ZI5A 1C0KA 2WWVD 4CJXA 3DMFA 4J1TA 5DVZA 4TZKA 5ESRA 3ENWA 2A6PA 5REQB 3WLOA 3ZJUA 4MROA 4ZQGA 4YN3A 1T6ZA 2HF7A 3UG6A 2P9YA 3UMYA 4KGDA 4TTSA 1PJSA 1HT1E 1E98A 4TVBA 1KPGA 4TVSA 1IXYA 2HU2A 4TROA 1POXA 5BN3B 5JVDA 1WRBA 1D2RA 3OJWA 4UU8A 4JUAA 5A3VA 2I4IA 2WHPB 4G8CA 2V7BA 4QU0A 4YB8A 1XZEA 1GU7A 1OBOA 4W5HA 3HLYA 4BPRA 1FW6A 1E8DA 4LFCB 2ZXFA 1Z26A 4CF4A 1FQKA 4GBED 3OQJA 4NHOA 1RDFA 1DO0A 3AYXB 3N0TA 5JAQA 1U8UA 1WMAA 4WW0A 4JK3A 3FMVA 1U4SA 4ESOA 1J2RA 2REOA 1OASA 5AW4A 5MDHA 1BSVA 1GVHA 4L8FA 2WYOA 4G5QA 3MD0A 1QV6A 4C22A 3CWCA 3RSFA 3EY4A 3JARA 1FDOA 3JQPA 2PUCA 1KOJA 1F2UA 5B4VA 1C3OA 3EMKA 1EM8B 4Z49A 3OFJA 5HF5A 3VV3A 5B7QA 1TE2A 3IT0A 3OQVA 3D2AA 5H3HA 4M46A 2PQ6A 2CD9A 3M6VA 2IZ7A 1AUXA 2ENUA 4B17A 4BO4A 1E2HA 2XI4A 4OV6B 4X95A 3TAXA 4XWWA 4PPQA 4C0KA 1X7XB 1W8DA 3MWGA 2GM9A 4CEJB 3H1BA 1H85A 2HD4A 1R1DA 4YFVA 3RYCB 1V6CA 1YRWA 3IGFA 4IIBA 4LDRA 3VHXB 1PBNA 3WK5A 1ZXLA 2AI2A 4ARZB 4ZDIA 1SA0B 3IP3A 4P4UA 2JI7A 3E4CA 4LPSA 2Q5LA 4R2MA 5CUQA 3SVZA 1JT2A 2YS6A 3I9FA 4HN4B 4V0ME 5IAEA 4I1PA 4H3VA 4HGPA 4EHAA 3LZCA 2ZEJA 3U1VA 4MZXA 3TXAA 3VPSA 5ELXA 4KKVA 1SCJA 1P9OA 1SULA 3EW7A 3KWJA 4JNCA 1UBOS 1LQ2A 4RAQA 5A71A 3AKYA 3C3JA 3I76A 2G36A 2Y9PB 3PFGA 5KSYA 1NL3A 1ZOSA 3RF7A 3KETA 4X61A 4D3FA 3QVSA 3GDHA 2QAGC 3HKCB 4AXXA 1WUKS 1BMQA 2YZKA 3AVOA 2AXNA 2VJBA 1VFNA 3FFAA 5A03A 3TIVA 3G2LA 4PYLA 2PZJA 2HQRA 4BMSA 4BKOA 3O74A 5EP1A 1VLZA 4GGOA 3QH4A 1TAUA 3I83A 3V48A 5CLIA 3ILSA 3V7FA 2FZKA 4EZBA 4QDXA 1NQOA 3DZDA 1NVTA 2CNLA 2ZSDA 4F5WA 1H8HD 2QMYA 1JI3A 5IJZA 4BLOA 3AQIA 5EIAA 2OZLB 4HPXB 1CRWG 4IHQA 3EAGA 4NOLA 5GONB 3DM9B 2QJOA 3HFGA 3OKPA 5FBLB 3T9EA 5K8TA 3GLGB 2JLUA 2FF7A 5KOHB 4BO1A 4FYYA 1MJGM 1P0FA 1B6RA 3PV0A 1N2JA 2XNJA 1ZVQA 1E1RD 1OH5A 4JOBA 4S12A 2OQVA 3UBMA 4LA4A 3TW8B 4DMHA 1UXKA 1E32A 2PO7A 4EB3A 3L8DA 2OBMA 1V37A 4S0ZA 4TS9A 1BXGA 4DT1A 4ACBA 2W2LA 1PUXA 3RDPA 2ID8A 4K9SA 1MHPA 1OH6A 5AKJA 1IFXA 2HIGA 1NBOA 3BD8A 5CXQA 4CETA 1J70A 2XOXA 2ODAA 1O6FA 2VHTA 4J49A 1JEAA 4JBIA 2CZQA 5DZSA 1VJRA 1EBBA 5KYNA 2FW6A 1QGED 5FXMA 1M33A 3RK0A 4DV4B 1Q44A 3EXG1 2D2EA 4LF8B 3WP1B 3PQ4A 3GZ4A 4DIDA 3S4YA 4H3SA 2YY7A 2O20A 5GIOE 3WQSB 1MJHA 4F72A 3INGA 4UULA 4DWJA 1EJ0A 3I5YA 4EI8A 2CLSA 1NP3A 2CEAA 4F12A 1HBJA 1QCCA 1TZMA 4L4RA 3WRVA 4ZQHA 4BMVA 2XODA 4OJNA 5EE5B 1RFLA 1HEIA 5BYAA 1KK3A 1UBMS 1FJXA 3ELYA 1YC5A 2J08A 1W4RA 1M1NA 3K9HA 2IW1A 9MHTA 5FUWA 3A9CA 1KP9A 1S0UA 1GGHA 3HCPA 2AFVA 3BSFA 1RXIA 3MT7A 3F78A 3HJCA 3VDRA 4C0WA 2FN7A 1V26A 1Z0KA 2ACVA 2ACKA 2AI3A 1A8QA 2JFNA 3N2YA 5A9SA 1TJ4A 1DQSA 4JJ7A 5AM4A 4HI0E 2BUBA 4JAVC 1LSUA 4P31A 4I66A 1NGSA 3FBTA 1KFJB 1B14A 1R88A 1T2NA 3FWHA 4EKNB 2MMCA 1X15A 3ED1A 4BAUA 4B5KA 1U0HC 2GK7A 3VR1A 2QD4A 1B0AA 3EA0A 4TUYF 4UAUA 4HEA6 5J4VA 5IBRA 3T7RA 3TLXA 2BGIA 1O97D 3EVFA 4D57A 1A9XA 3I52A 1E5TA 3ETEA 5HK9A 2H1RA 3FG9A 4JUFA 4P7FA 2I65A 2MDTA 3PSHA 4KH0A 1NI5A 2OGZA 4CDRA 3OH8A 2WD7B 3CY6A 3NYRA 1N0WA 3CW9A 3PG5A 2W8BB 3BJIC 4IUBS 4DR3B 5KO2A 2OD9A 3C45A 3KU1A 4ZT5A 2OAP1 3WB9A 1RMTA 1T6YA 2HN9A 3IV9A 3LUHA 2YICA 3WXMA 4F04A 2RE8A 2D5LA 3L01A 5CH5A 3BMCB 3SICE 3SOPA 4GXQA 4CKXA 1EU1A 2H3EA 2JCGA 2VDOB 2ECKA 3H18A 5BYKA 4JLMA 3P45A 3QBEA 1P3Y1 1TGYA 5GP1A 5I5GA 3UHJA 1T9CA 3AM4A 1PYGA 4J7CA 5EA2A 3DCIA 1MN6A 2FOIA 3UPUA 1RRCA 4UMEA 5LQAA 1MAAA 2A58A 3EF0A 3LCJA 3MCTA 3NHRA 1U3TA 4IYJA 2XV1A 4BFXA 1T5HX 5HZHA 1CF9A 1E79D 2YXPX 3L1IA 4R2IA 4NNJA 2AZDA 3NTQA 1Z82A 1DTWB 4HX9A 4COKA 4JI0B 4IEFB 1B42A 4DJAA 3W2EA 1UKAA 4RWEA 4I6GA 3KZCA 3WTCA 2XXJA 1QQ6A 4DCNA 2ILTA 4FX2A 2QL6A 4KAAA 1M83A 1ONSA 2VLIA 3X0DA 2ZSUA 2A3RA 2AL7A 1PG5A 1Q0TA 2FSHA 3AFIA 1G5HA 3QLUC 1P2BA 1PJCA 3VFDA 4EZEA 5AW6A 2DKFA 2YHSA 5AVJA 1P72A 2GHRA 3D6MA 3N8HA 2B25A 4UE6A 5FLEX 3DQPA 4BVEA 3O4IA 1N4DA 3BXOA 4EVIA 4ZYYA 1PSZA 5G53C 4B6FA 2IUFA 4N40A 4BXOA 2W2QA 5KQSA 1G3MA 2NUPA 2PLRA 5L4SA 4I14A 1OIWA 2C4MA 4QDTA 3BA6A 2QX8A 3GFFA 4QODA 3OCXA 2WWFA 2O8FA 3TKYA 1CIVA 1ZH0A 2LRHA 1KRWA 4J0CA 4FK8A 4MVWA 2OV1A 4JJ4A 4TMXA 3WIBA 4B84A 4ARCA 4RU1A 4XFDA 5DBIA 1Q7CA 1QE3A 2AZTA 2ZDHA 1DRWA 2FNAA 1QS0B 2FFQA 4FWIB 4EUSA 2R6FA 2ZRCA 4BO9A 3T1TA 3K0FA 2SCUB 4FVTA 2P9JA 3BXXA 5GQSA 3C1TA 3M81A 3UY4A 1QGZA 3MMNA 4CKWB 2AOTA 2D7JA 3KQMA 1VCIA 4WK4B 3I30X 1GJRA 4PLYA 4Y18A 1J0AA 1YKSA 3ETHA 4U8HA 4A6DA 2BEUA 1G5TA 4LHWA 5IVIA 2A0UA 2Q99A 4AJNA 2HPHA 4EVRA 4FDAA 2WKPA 3B78A 1KK0A 4GI3A 3BG5A 2GN2A 4NAUA 1NHWA 1T13A 2H07A 3QX8A 1TEZA 2AYXA 3RU3A 2Q4TA 4BX8A 3UK2A 1A7AA 1MAVA 2C99A 2PQMA 1HLDA 1NKTA 2B6NA 3ROXA 1JQAA 4UEQA 1E2EA 1WLYA 3C5WP 3EZXA 3HY3A 2XB8A 4EJSB 1OA0A 2IYYA 1QOPB 1SD1A 2JVKA 3G2HA 2OG1A 2PXCA 2NVUB 4EW1A 4ZGBA 3FNIA 3COVA 1G41A 1KJYA 1RKUA 2OQIA 3PP8A 4RSRA 3G0IA 3OFKA 2R8PA 3SSAA 3U3KA 1MORA 3ZOZA 5CFQA 2DH5A 5JRDS 5DBEX 2RHLA 2FRXA 4H7HA 1MW9X 4NFHA 1ZQ1A 1KYZA 3NLLA 1NYQA 3OECA 4GOXA 3T0GA 5AMXA 4CKZA 2VRNA 4PHFA 3F6PA 1ZUIA 2GRJA 3K5HA 1A5AB 2Y8EA 2ZJBA 4P35A 3ROTA 3EPRA 1N6OA 1P2GA 1H1LA 2HMUA 2P8JA 3BRSA 4WASA 1PLKA 1VIVA 3ZDXB 1VA4A 2WP0A 3FYDA 4B87A 2Q8PA 4MJ7A 3FYSA 1FSPA 4QM7A 2Y0CA 3RANA 1G9XA 2A5JA 2G17A 3REGA 2BBTA 4IJMA 3VZCA 1UZLA 1NVUQ 2WV7A 3BAFA 4RTLA 1L4UA 4YI3A 4ZVLA 4Q0MA 1G1AA 2FW0A 3EE6A 2I4RA 3H9CA 5K3EA 4Y0AA 2FQQA 2Z9BA 4K9KA 1LPMA 3HCRA 4E15A 3JQ6A 2PBRA 2Q6IA 1EZZA 2UUCB 3FTNA 3A4IA 4XB6B 1OXUA 5C32A 1N7GA 1NJ8A 5KPJA 1KBOA 3SIXA 2E4YA 1EPUA 3PENA 1CQPA 1U80A 1VCMA 1E62A 4G26A 4X8MA 3RVNA 5LKAA 5HILA 1ND5A 2WYUA 3T1YB 2K7ZA 2ZYVX 3WRXA 4CEIA 2EWVA 1LBIA 1IPHA 1YK0A 3FOAA 3HH8A 5BN5A 5DM2A 1PEYA 4MPDA 3I2HA 3O4VA 4J9UE 5FOTA 3ZLBA 4CQLB 3HVRA 1TUGA 4KO4S 4NWIA 1V11B 1TO2E 2PKWA 2RGUA 2YJNA 3JQDA 3EXFB 4QTZA 4B7UA 5CAEA 1OTYA 2ZIXA 3AYZB 3V2UA 2D5IA 3AB8A 4WVFA 5DBOA 3PXAA 1WF6A 2O1SA 1T3ZA 2F3TA 2OC9A 4GR9A 1T8TA 3RV3A 4G8BA 1TLLA 2VTVA 4IBOA 3PGXA 3T5DA 4EPRA 5IW8A 5H83A 4LUCA 3GPIA 3A6GA 3HL0A 4RYDA 2LUOA 3BEDA 4Q01A 1KDOA 1V3QE 5JNTA 4WEQA 3FUCA 1YQXA 4LDZA 4J7AA 4YMSA 1QTIA 2OESA 3AQ4A 4S1PA 3LF2A 3K9LA 1W581 2SHKA 4C88A 4ESEA 3OCJA 5GJBA 2UYCA 3VA7A 1OE0A 4ERXA 3K8OE 3M1LA 1J39A 1I01A 1C1XA 1E61A 2AUNA 2Q7XA 3A25A 1Z47A 3EXIA 3JYNA 1P45A 3VAZA 5K0ZA 3TIGA 3CE6A 2W2NA 3H19A 4ZEOA 2IZ0A 2G71A 4PTLA 5G0TA 1TMKA 3VTKA 3GZNB 3F46A 1RP1A 3IP9A 3O8QB 3OIWA 2R1VB 4TUYB 4N5IX 2DB3A 4QQRA 3IKTA 4JLSA 1NFRA 3EPHA 3TI7A 3A8TA 1MB4A 2Q45A 1B6TA 5G1NA 2GAFA 1DRVA 5E9QA 5JATA 3HJRA 2NYVA 2E6KA 1JQ5A 3RBAA 3RAPR 3GRZA 4KITB 2HAEA 1UIMA 3KDPA 3I9JA 3LZDA 2ERCA 2XA9A 3FA2A 4WXEA 3HR4A 4YCCA 4YMVA 3VH4A 1NJSA 4BNKA 3UCFA 5CFLA 4U7DA 2QLNA 1E2GA 2W6ID 2R6DA 5GONF 4L2IA 4AZ3B 4MPRA 5FV4A 3MTAA 2ONJA 5JZSA 1J2TA 3HYTA 5KHLB 1YVDA 5GZ3A 1RLTA 4WZBE 4TM8A 2REQA 3EZYA 3D1VA 5G1OA 3PT5A 4DTCA 1LS6A 1NASA 1F20A 2BMJA 5IAJA 5HFAA 3N8IA 1KOFA 1CJBA 1WQ1R 2A9OA 3SJAA 1RRMA 3OIGA 4D42A 3NHSA 5IBCA 2JLBA 3EIQA 1NVVR 2AC4A 3M0EA 1B73A 2XHEA 3FYCA 4ZU3A 3DVLA 2ZPTX 4URWR 1GTL1 2V3VA 5CA0A 3U4QA 3EEFA 1DS6A 4MRMB 3BK2A 2W43A 5H68A 3RYHB 3NVAA 3KFXA 2G6BA 3JWEA 1K8QA 2H54A 1JL3A 1P1RA 5EMNA 3QUAA 2QB5A 3WGMA 1GRRA 5C8VA 4J7UA 5I8WA 2XTJA 3ZWQA 3RAFC 3WGGA 3EZNA 4REQA 1PT9A 2C98A 1F17A 2D2FA 3BRWA 3F71A 1WDMA 4FBMA 3LYHA 4GX2A 4ZAFA 3UJAA 4DIMA 4UCFA 4XGRA 2RHHA 2FSVC 13PKA 1RI5A 3Q11A 3S81A 2J87A 1UZAA 4I1VA 2PUGA 3PYXA 1OI7A 1Q16A 3WWEA 3V7YA 5C1IA 3NM5A 4QDKA 1W88B 4FS3A 4MQ5A 3PC2A 5JRZA 3HR8A 3FUVA 1QIIA 3NT2A 4MKXA 4JV5B 1NNLA 2XWPA 3OPYI 2WHQA 4PX5A 3LYAA 3DDWA 2NADA 3NATA 3GEHA 4TTAA 4R1TA 4HUQA 1W59A 3MYRA 1AHHA 1KAQA 4WXYB 4S24A 3UGKA 3RFXA 3LRTA 4PNPA 3HYCA 3QEKA 3KQUA 4OK3A 4PPGA 1RXYA 4GLLA 2JAOA 2BMAA 5DNDA 5IG2A 3NTUA 3AOGA 4LXIA 4QSHA 4ROTA 1P1KA 1TT5B 1EIZA 3WYBA 4DUGD 5LUAA 2VT2A 2V54A 3INTA 3EZ2A 5E6SA 1U5BB 4JZYA 2ODBA 2WG2A 3N87A 5E7IA 4ARVA 2DHRA 4I1YA 4DA4A 5AUQA 5KYXB 3ZI7A 5F5LA 4EG3A 4JYMA 2ADMA 4IMIB 2V45A 4B4KA 5ED4A 5LP6B 3L6RA 5JI2E 5KQGA 2XQKA 4R0NA 3K70B 3MGAA 3P19A 3GRVA 5IKEA 1MZPA 1EHYA 3E9NA 1T4DA 1Y8RB 5CIYA 2UUPA 4J90A 3WP0A 2YHUA 3MTQA 4QAJA 1Y3BE 1N6KA 4MCIA 4ND4A 4B3IA 4J16C 1TM5E 4ZOBA 2B61A 3KOOA 3WYNA 4HN2A 3RUEA 1A4RA 3RARA 4YEDA 1NULA 1SC9A 3QBTA 3TTUA 1SIUA 4XE5A 1N2CA 3C3PA 3MD9A 2H48A 4M0DA 2BI4A 2IH4A 3TRKA 1X1CA 2DF8A 3UHOA 3RADC 5E3JA 3FZEA 2AG0A 4CDGA 2B8NA 3FYHA 1VLLA 4C08A 3OCWA 4NCNA 5F4BA 3OWHA 1DUSA 3A1WA 4DNFA 4XWTA 2ZTSA 5KYKA 2FB9A 3FAKA 3PQ3A 1Z4NA 5F12A 1P7PA 3H04A 4DIOA 1B8NA 3JWGA 4N3GA 2WFLB 4P86A 4DSUA 5A2QA 1Z6GA 5K3SA 3V4VB 4RS4A 4XYBA 2PKXA 3U40A 5CBPB 1DFHA 1R4NA 2Q27A 4DPLA 5C8DA 3BRWD 4G9GA 3ECCA 1K0FA 4HVLA 5FOWA 1SCIA 1V16B 5AWFC 1YL5A 1KZ1A 2X1HA 2E87A 1Z0AA 4IHJA 4Y2PA 4EQ6A 3FPEA 4DDVA 4G6ZA 2GJSA 1J9EA 2NU9B 5A3JA 4AKSA 1T5IA 3CR8A 1C50A 3QYPA 2XOKD 3G85A 5KDLA 4A0QA 5LQKA 1Z2EA 3MJSA 4GSYA 4RAOA 4DV2B 4AIRA 2J0UA 2O1XA 4R71A 2C5EA 2XJ9A 4KXQA 1XALA 2WSYB 5IARA 4A92A 1W88A 5CX4A 3PR2B 3LOUA 3GLHE 1PCXA 2ZM5A 3FTFA 4Q9HA 1AGYA 1G7RA 1Y7HA 1ZNXA 2JARA 1JYFA 1V9SA 2Z8ZA 3DKVA 4Z9BA 3W9YA 5K8CA 1TEVA 3QY9A 1N0HA 2I66A 5DX0A 3WGUA 4DC1A 3DAFA 1N0UA 1RJ9A 2V4MA 1TJNA 1W0KD 1V7ZA 2IS2A 1D5CA 1KMHB 1C0EA 2C82A 5FYQA 2VQ6A 1JT9A 4XW2A 1JWBB 4H4EA 4J03A 1CIPA 1Z6XA 2Q5OA 3KAQA 2HHLA 3GYGA 3QMMA 4UHHA 5H1YA 2C4NA 4CFYA 2JATA 5G0SA 3R6TA 3CUVA 2FSSA 3WA7A 3HB0A 1AJEA 4YCMA 4K3UA 1OYYA 1GN8A 3K1YA 1E18A 1JIQA 2G06A 1L5RA 3G5LA 3OTQA 3GOQA 5A06A 4XIYA 3CVUA 3LGSA 3F74A 1IJEA 4XVHA 3TMAA 2NYRA 2DWPA 3SNKA 3AESB 3KTDA 4Y2VA 1HFKA 1E1MA 1VP9A 1SBNE 1UPFA 1K2WA 3M1AA 2R8YA 4JL8A 4UNRA 8MHTA 4UVEA 1JLLB 1WAMA 5H82A 2I8LA 4XR9A 3SEZA 1Y9JA 4CODB 2ZWOA 1XVVA 3E9RA 2R5FA 3Q85A 3VYUB 2H2FA 5I01A 3W2FA 4Y2QA 2RGNC 1RYYA 4PBSA 1BCRB 4MVJH 4EY4A 4O4IB 4G0OA 4CF7A 3F47A 2YJ6A 3DLAA 5CH8A 4R7GA 5AKIA 5KOJA 4C2UA 3MCAA 3FNFA 1E2KA 4HS9A 3UENA 3H17A 3GRKA 2O2DA 1RLOA 1R4MA 2DFKB 3BEOA 1V48A 1PR4A 1I0ZA 1TVEA 2BWJA 4RHTA 1K3TA 3G88A 1AO0A 2DWQA 5DT9A 2P27A 1R2QA 2PRKA 4OB8A 5BSHA 2YWDA 2PRYA 3ZD6A 5EMLA 1L1RA 1WL8A 2FPSA 3GNTA 4K03A 1GZSA 1SCDA 2EWMA 3WWPA 2HHJA 3BKXA 2GTHA 3IALA 3TQRA 5IEBA 3ZVNA 3BIOA 1OTHA 3OZTA 1L5LA 3BTSA 5F77A 3IT3A 3O91A 1JR6A 2VSNA 3VO1A 4TWIA 5AVSA 1GEGA 3BXEA 3NV7A 4OX9Y 1ZRHA 3DEKA 1YBMA 3K1AA 1YA8A 5IJ0A 2BMVA 1JQEA 5H70A 4LC1A 3F90A 9ABPA 1JR3E 2VCHA 4F3KA 1U31A 1EE9A 2C2ZA 4L4ZA 4CLRA 3DJFA 5K45A 2I8CA 5CXXA 1KWKA 2A9VA 2J1LA 3R7LA 3WFZA 3S28A 3JCZA 1WX1A 4FGJA 4KR3A 2C04A 5HE8A 3OEEA 4CFSA 5DT2A 3IMFA 1KZ9A 1B1AA 2FE4A 4CTJA 3RS9A 5A6SA 1Q0SA 2UZ3A 5T6MA 1I5RA 1R12A 2FP3A 2QPTA 1GVNB 1A88A 2G5PA 1U2SA 4QUBA 3P5BA 4WCDA 1KHHA 1JQ3A 4HQNA 2DQYA 2AEJA 4US0R 3C16C 4AF6A 3ZY5A 1I7SB 2KBFA 2WRZA 3L3BA 2BFNA 4Y2HA 2X23A 3GI1A 3NAGA 3N8GA 1Y9EA 4KC0A 4WESB 4B8ZA 4OU5A 2I6FA 2OUIA 4YCNA 2G9QA 4BRSA 4LC9A 2IU4A 4G07A 4DLKA 2VRWA 3FBGA 1TVKB 3D3NA 1NIPA 3R3WA 4MCJA 4PIPA 3MTIA 3CZCA 4EHKA 1W4LA 1KZYC 1BW9A 3NW9A 2H1FA 1HZZA 1JG1A 1C3OB 4YT8A 3EZGA 1QYRA 2GF0A 1BC5A 2HJRA 3CG4A 3RI3A 4HAVA 3TYXA 3O47A 2ZETA 3QUQA 1IZZA 4HYEA 1VYHA 4BY9E 1U3DA 5AVRA 1KORA 2G77B 1X39A 1Z5PA 1O0SA 2GLXA 3GUZA 5ALFA 3KJZA 1K9SA 1QHYA 4URFA 4Y1GA 3TO5A 4I8IA 4R8VA 4C9BA 1Y8CA 4Q34A 5BRNA 1C41A 1YBHA 1VE3A 3H42B 1REQB 4MQ4A 4GW3A 2P4QA 5I7AA 4E5UA 2JIDA 1TJ3A 4IDOA 4JJ8A 5I9NA 3NORA 2JAUA 4DGQA 1LZLA 1I7LA 3JSAA 4B6SA 5F98A 4K2HA 3TW4A 5EJ6A 4TL7A 1CQIA 2E4VA 1RKVA 4NH0A 2WILA 2XUQA 4GC9A 2WG1A 4M8IA 2GVZC 2YRWA 4F91B 1O95C 4OHFA 1UXHA 2PFKA 4MKFA 4ZTZB 1TPZA 1N2IA 1V35A 3KTOA 4K3VA 5BSUA 5EJ9A 1NJ5A 3QKUA 3U61B 2EX4A 1SNYA 2CYBA 5KWSA 2RD2A 5EKUA 2HL6A 3BN3A 3H7IA 3VTFA 1ZU4A 3LUJA 4EEKA 3BXPA 4DNPA 5T4BA 5BUSA 2P35A 3KQNA 3ECAA 3A10A 4Z9XA 5L3SA 1CZLA 4R41A 2WWRA 4GDFA 2O4CA 1RWXA 5CA0B 3LT4A 3GFTA 3HRIA 1EIWA 3QW4B 3H1EA 2CFOA 5I7WA 3GEMA 1LWOA 1CY0A 1XD8A 4RGVA 1ODSA 4MULA 5CM2Z 1X1BA 3CZPA 3VR6A 2P4EA 1G5FA 2PS0A 3LQKA 2JASA 2WUWE 1XJWA 3IHTA 1C30B 1XL0A 2NU7B 3QSYA 3ZBTA 2GAJA 1HZJA 2WD7A 4JLWA 3AP3A 5ALXA 4BMDA 1G5PA 1XC7A 3IPCA 5F51A 4CCWA 4RPCA 1ENZA 4B33A 5BNFA 1T8UA 1MT3A 3A32A 3C3MA 4KPEC 1YR1A 4PTYA 5LN1A 2GJ4A 2XBLA 4U2EA 4DXHA 3T52A 3VR3A 1I30A 4GT1A 1IC6A 4CIAA 1AY0A 1UXOA 1V9CA 2ZI4A 5ITZA 2IXDA 4H4DA 3W05A 1J5EB 1LNQA 3RG2A 2DR2A 3TJZA 4N8SA 1ORHA 4U39A 5GONA 4JFRA 1V8BA 3ESBA 4L7VA 4HLQB 5J2TA 3RRJA 3CW8X 5EHXA 5IH3A 2VQEB 4O0LA 1Y6FA 1E1YA 4X85A 3CA8A 4JITA 4TRMA 3TLCA 1GEEA 3QX9A 1WZNA 1US8A 3FOZA 3CYFA 3PUYA 3SDBA 3IC5A 3H97A 2NSJA 2EFEB 2IF0A 2P40A 2X2FA 1EXVA 2XT0A 3WJ2A 5J58A 4RVOA 1WPGA 3QYJA 4E12A 2DZDA 4POOA 2QD3A 3OPNA 4TYNA 2YWCA 1BFDA 3ICQB 3JR3A 3WMEA 3IRUA 1WZUA 5J4YA 2QX6A 1T4MA 3D3JA 4TQUS 4UUMA 2JHAA 2NG1A 5EJMA 3C43A 5CFZA 3PFKA 2EP7A 2GLTA 4LZNA 3W8NA 4AAYA 3D3WB 1B4DA 5AK6A 2XXAA 3KT8A 4X93A 5DHSA 5F64A 2VJDA 2XWSA 1RAFA 2JLYA 4QPDA 1JTEA 3F7OA 4W1QA 4TLCA 3O94A 3PFCA 3IAHA 3NCTA 1QIFA 3H8SA 3QMWA 4NFLA 4N01A 4H60A 4X00A 4RKYA 1YQGA 5K7SA 1S89A 4W9MC 4EMBA 4TMFA 1QGAA 3W5AA 1YU9A 3CF4G 3RRXA 4CKCB 5F2NA 1ULTA 1HUQA 1JQBA 1XMQB 3ZTWA 2NNLD 3PHJA 4ZQCB 5JXHA 4KSYA 4N49A 4EECA 5TQ0B 1MB0A 3A9TA 1UBFA 3FMGA 3IQFA 3QE0A 1P44A 4F21A 2DH6A 2R6HA 4ERNA 3A1UA 1CNEA 2WZDA 1XP5A 2C8VA 2IFTA 4TLDA 4BQSA 2Q5CA 1EUCB 3A7EA 4KI0A 1G20B 2J3IA 3Q0IA 4GOND 2QTHA 2WSBA 1OPXA 1AKNA 1S5PA 2XEXA 2YXEA 3L0IB 1YRHA 1U7DA 3M1YA 3NDRA 2AXPA 4XEUA 1ZIDA 1ZGZA 3BJEA 1R9NA 2OG2A 3AIMA 5CJ2A 3BVPA 2W4IA 3FRHA 5J3JA 1W2WB 2HQSA 3JARB 1PP4A 3K0FB 4IINA 4R5MA 2Q1UA 4EGCB 1J0EA 5B5SA 1KI6A 1UFKA 4CN9A 5JC8A 1D5WA 3ZGLA 3M89A 2CD7A 1FDSA 3B82A 2YWGA 1UFQA 1PWEA 4LZOA 2WY2D 2CDNA 3WLIA 1P4RA 1E2BA 2PBLA 3MWJA 2IK8A 3HO8A 2DPGA 4GXTA 4FR5A 1VBFA 3K9WA 2D2IA 2AOWA 1PZNA 4LNAA 1IWPB 2AW3A 1WTAA 3PQEA 4AZVA 4IIHA 3ACBA 1UPXA 3DVAB 1P62B 4F1JA 4M0MA 3Q7SA 1X1TA 3GGOA 1UDAA 1BWSA 1G17A 4D4LA 1TK2A 1TVCA 2JJ1D 2PUWA 5IDWA 2HT1A 2J5BA 3LDGA 3VVCA 1HO3A 4DDUA 3OPQA 4RK6A 3CRMA 4Q3LA 2XYGA 4DMLA 2MSDB 3N2IA 1R6BX 4X97A 4ZT6A 3HBJA 1WB9A 3CX4A 3RGWS 1DAHA 2CLKB 1EDDA 2A4MA 1CFJA 1VHTA 4YR9A 1XMSA 1CK4A 2B3TA 4N18A 4OAOA 3OICA 3T8YA 3GIDA 4M49A 4HV4A 1Y3FE 3ZV3A 1GA1A 1DJOA 4CUZA 2NQ2C 5T4EA 2AFHB 5BYJA 5ELMA 1NQAO 2G67A 1H2WA 3JWJA 2YXDA 4V2IA 1AKRA 3K4QA 4HB4A 2QUKA 2IE8A 1H23A 2JBHA 3A4NA 1KPHA 1SQ5A 3UC5A 3ZD7A 1U7ZA 3UFXA 1V9LA 4KO1S 4LNHA 3TDMA 4F5YA 2G5TA 4JIMA 5JADA 4OQNA 1UFOA 1CZUA 4UUQA 1JLHA 4YT2A 1EFKA 5KTOA 5CR9A 1MB2A 1ULHA 1NMEA 1XRLA 4I5DA 4W9RA 3S3TA 5IBQA 2F9MA 3HSYA 5AVTA 1A5SB 5GVSA 4ALNA 5AKXA 5EWLA 1S6YA 4G5RA 4PZAA 4KFCA 2CUTA 4Q7KA 3PWZA 4ED9A 1SKQA 5DTEA 1A9ZA 1JG7A 3NAZA 2J3KA 2IUYA 4F1KA 4ZRMA 2VWPA 1N0VC 1ZXBA 1M5TA 2Q0XA 3ONVA 4FMCB 4NE2A 3LQRA 3V42A 4U8GA 1YO6A 2PLNA 4B3CA 4BE7B 3NGXA 2XQVA 2F17A 2DSTA 2L19A 1PSWA 1QVWA 1KBQA 5P8WA 5EJAA 2YOHA 3WNCA 2WB4A 3WQQA 4DRZA 4IIJA 3JQ7A 2QM3A 4DCGA 2PVPA 4GZ6A 4HBZA 2X6TA 3WLJA 3VO8A 2J9ZB 3PDWA 5EXSA 2QTNA 1C9JA 1C7EA 3CZ4A 4WD3A 1YZKA 2H4JA 4XYMA 3K3PA 1CULC 1DIOB 2EG9A 1RC0A 1K68A 1BS1A 5CX1A 3I2YX 1JE1A 3OO1A 3OJXA 4FWBA 3OKAA 4OM7A 3A58B 2P6RA 4F0JA 1VIYA 2Q1TA 2XTAA 1JKIA 2B8EA 3BIFA 4Q19A 4F56A 3TMKA 3U56A 5T3UA 5L6MB 2C4UA 2EHJA 1P18A 1V2GA 3D6JA 4GKAA 3TK1A 4PGGA 3RUIA 5CDTA 1P0CA 1Z0IA 2ZJ0A 5FEUA 2CXRA 1TQ4A 5K8JB 1L7BA 1WTCA 1CR0A 1P8AA 3HCWA 4EX6A 4IDDA 4CU5A 3ROFA 3HEMA 1KU0A 2C0QA 2OLKA 4CG3A 2ODQA 2O8EB 5AVKA 4UNIA 1GSAA 2J6BA 3L8ZA 2B0CA 3HZHA 4JUIA 5FBRB 4MVJP 4IP0A 5CIQA 4ZI7B 2ZYWX 2EKDA 4DL9A 2JW5A 1QCZA 5KNCA 1U1DA 1Y6QA 4MVJM 4ZJYA 2HIMA 4DHEA 4DA6A 5LMCA 2ORED 1E6LA 2J9FB 3QLVA 1QG4A 2BSAA 3HVHA 4H6XA 3AI2A 3RYFB 4CMIB 4RVGA 9LDTA 3C87A 3LM8A 1KSHA 1Y42X 1C9YA 3LVQE 3SZ3A 2Y1EA 3DG9A 4L6AA 5HWSA 3TZBA 2C2XA 1DV2A 3HDJA 3NG1A 5J2UF 1K1EA 5AKZA 1RT9A 1U99A 3S1LA 1TNDA 4TYMA 5DGTA 1BKDR 4GWGA 3OJOA 1WDLA 4RKWA 1D7OA 4LQ4A 1KI6B 2BGJA 1C7FA 3T3MB 1AKQA 3ZI0A 1GRVA 1LJUA 3B1YA 3ETJA 4A2QA 4DG8A 4NHEA 3CVOA 3FCUB 3PDUA 1XO1A 3UT0A 4HH4A 2B6HA 2NWQA 3NYIA 2IDMA 1EYZA 2UZ1B 4ETMA 4EW6A 1XMIA 5AVWA 4BO7A 4M0FA 1D1SA 1JV2B 4Q9JA 1TUBB 5EMJA 5FI5A 4C29A 1FDRA 4KFTA 1MPTA 4RD1A 5IMSA 3I9V1 1GNQA 3JU3A 3CUWA 2WSSD 4R7ZA 4PSKA 4AMVA 4F11A 2P2ZA 3O4JA 4L3OA 3FSGA 4EHJA 3H9GA 3R8FA 4PWZA 4GGPA 3KWFA 4M0PA 1PZXA 2HXYA 2Q2NA 1AE1A 4MUFA 3B20A 1J4AA 3CX8A 2O0JA 4JEIA 2RCYA 2LGJA 1L8QA 1K6EA 3K0SA 4E33A 2O5VA 2C54A 2IZ6A 4K26A 1BJTA 1M1XB 4US2R 4EI2A 2AOUB 2J6HA 2VRBA 3AUTA 3FNQA 3OZEA 5DLPA 5FH9A 1OV6A 2VF7A 1Y7LA 4ESHA 3DUFA 3LX4A 3M9LA 1L1QA 1YZGA 4PC7A 4XVQA 5BQFA 1F7VA 1XZJA 2QBYB 2IUTA 3OT1A 5EMHA 3JYLA 3OPYB 4NR0A 1X7YB 1BDHA 4QNNA 5AHXA 3SMVA 2G88A 3C5EA 4GPTA 3T7DA 3L41A 2XKJE 2YV3A 2J3HA 4HD8A 2GS9A 2J59A 5A1TA 2VP3A 4KXYA 4LMAA 2O8BB 3VC2A 1YQTA 2QYHA 4UMVA 2H51A 3L1JA 1II9A 4HNGA 5TEVA 1A9XB 3UOGA 4C0JA 1E3WB 2EKQA 2F3SA 4DR1B 6PFKA 4ZO6A 5KKNB 4YNBA 3E70C 3B38A 2FPMA 2LP4Y 4X1KA 4UW9A 4CTOA 4DLNA 5C5IA 4OBXA 4QHSA 4U2GA 4V1CB 4UUBA 1P31A 3LKVA 2QLMA 3IDFA 1YK1A 4KBYA 1SVUA 1IOLA 3UV3A 3WLLA 3UCXA 1V71A 3V7UA 1B43A 4RF2A 3MELA 1UFRA 4C7JA 3PNPA 1MT0A 1T9HA 3A2KA 5T8KA 1WPXA 3BOSA 3E4DA 4JEHA 3KZMA 4PHHA 1B93A 2Y6VA 3S70A 1SBQA 4LXUA 3IAS1 2OXRA 2NU6B 4K9MA 4YIKA 4AY5A 4KLRA 1IEQA 3QPBA 2YHIB 5IPFA 4UEKA 2P91A 3B1JA 3QHPA 1EK0A 3CQ9A 4J0QA 2PIAA 3GRAA 2I3GA 4PLFA 5AVQA 3CPSA 3G8YA 1H8ED 1HT2E 2WIGA 2BMWA 3HBLA 4RMIA 4HQ6A 2BM8A 4QGSA 1KAHA 2RJ3A 4GMKA 5ALVA 1NRIA 2GYWA 2ANBA 2PX6A 3DFKA 2LD4A 4PINA 4DQVA 5BWOA 1XZMA 3DFIA 1WXXA 3HMKA 4I5EA 1YD7A 5SZHB 1I3KA 3DLPX 4X7MA 1QIKA 1FS5A 2E21A 3TRDA 3PR3A 7AT1A 3EIWA 1TZCA 2G08A 2XOEA 1SU7A 5MFZA 3DH0A 1GYRA 1N5LA 3QVLA 1G19A 4RZ3A 1E0JA 3NOOA 3NHKA 3JXEA 3ZDEA 4KREA 5C9ZA 1V5WA 2A86A 3PNBA 3RT1A 3C8ZA 4Z4HA 3EW9A 1UC8A 1GAJA 4LTMA 3R7DA 3RAEC 1IXKA 3L43A 1W5TA 4X9XA 1KH1A 2BT4A 2BGGA 1MIHA 1V8FA 1YZTA 1JPJA 3H2YA 1TJYA 1L5WA 2QVXX 2VNAA 5FAXA 2W37A 1XXLA 1FLVA 2DQSA 3DVAA 3O90A 1O6ZA 2P65A 4JGBA 4KACA 3ZCUA 3A2NA 2G28A 1U98A 4M3NA 3ECSA 2XDQB 3QF7A 1Z28A 5LP6A 4WN9A 4JL5A 3RVKA 1PSDA 4Q9KA 4BP1A