2ZRMA

Msreca datp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
319
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 93
structure length 319
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrmA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrmA01
1II9A 1UFQA 5C2JB 3LFUA 2H17A 3NC1C 4OQMA 1XZPA 3MWYW 2D3WA 5J40A 2OT3B 1S8FA 3TUZC 4ITRC 1UAAA 1IN5A 2FWRA 5DI9A 2YV5A 4Z51A 5LBIA 3QPWA 2F43B 2QZ4A 3Q7PA 1Q57A 1XZQA 3QI2A 1N6NA 2Q9BA 3KDSE 2A5FA 2ZR7A 4LPKA 4EDHA 4PX9A 1FX0B 1YZNA 2J59A 4XTRA 1VG9B 4OL0A 5L3QB 4LCBA 1Z3IX 4NCJA 1F3OA 3TRFA 2H16A 3LW7A 5HZHA 2W6IA 1E3MA 2RKOA 4H1UA 1EFUA 4NBSA 1F6BA 2ANBA 2BOVA 1DEKA 1F2TA 3GLHB 4HAXA 1OV4A 4IOKA 3ZVMA 5F3WB 2FDCA 1XTRA 3U44A 1W44A 4R2HA 3ETLA 2W6JD 4KLNA 3VR4A 4M4SA 3QF7A 4PPFA 4E5UA 4L15A 1KAOA 3SEAA 1KI4A 4CGZA 1QVAA 4LJ8A 2FZ4A 4QG7A 4QJ4A 3QKTA 1GWNA 1U0HC 2CJWB 3NXSA 2IHYA 3B1VA 2X1VA 1IBRA 2BBWA 2QSYA 1TF5A 2OAQ1 1EFRD 2OEPA 1Z6YA 3CLVA 3AKDA 3OIWA 2JJ8A 2QM7A 2OCPA 3KKQA 3U4QA 2C98A 3K0EA 1TQ2A 2CMKA 3V9PA 2VSXA 3SQWA 4LV6A 5IT5A 1R6BX 1AM4D 1SVSA 3VR5A 3W34A 3W90A 3BD9A 1S4QA 3PVSA 1ZU4A 1R2QA 1SHZA 3QXHA 4GP6A 4DLVA 3B1ZA 1X86B 1KSFX 1EFRA 2AD5A 3VMFA 4BLSA 1P72A 5KNBA 4JBXA 3DO6A 4MRRA 2X2EA 2P67A 2ZSDA 4KSCA 2YWFA 2ANCA 3JVVA 2ZS8A 2ZSAA 1ZC3A 5FL7D 2WTUA 3UPUA 1OYWA 1KDTA 4G0NA 1E32A 1NY6A 1W36B 5AJYA 4BLQA 2QTHA 1QHSA 2ZIAA 1QHHA 3AEZA 3IO3A 1OF1A 1P2UA 4KBGA 4ZKEA 3T12A 4C0AC 1HQYE 4RY2A 4TL6A 4ARZA 4NYIQ 3B13B 4HAUA 4IOLA 2O8FA 2LCFA 3ZZTA 4QL3A 2HF9A 2J41A 3PUZA 4E09A 3TKLA 3WMEA 4BLRA 2CJWA 4FMCF 1VCNA 4URXR 2ZRCA 3K0SA 1FTSA 2J7PA 4TT3D 4DT1B 4PO8A 4Q4JA 5JRJA 2ZYUX 5FTKA 2F9MA 2IEZA 3AV0B 3QQ5A 4Q02A 5EP4A 2JLYA 3PJRA 2Z5FA 1X8JA 2BV3A 2REXB 3I4LA 4IEEA 3WMGA 3U44B 1G6OA 2ZS7A 1F2TB 3E1SA 1QRAA 1UF9A 1UDWA 2RGNC 5E3HA 1IN6A 4MGIR 1DAMA 5AJVB 4ZPXA 2G0TA 1MH1A 3AF3A 5HTKA 3EC2A 5FL3A 2YWGA 3BB3A 5DISB 5L3QA 3EIQA 1NG1A 1JPNA 2ZREA 1RYFA 2QAJA 3FHCB 1FP6A 3B1WA 4Q7LA 4ZO4A 2XZPA 4KHZA 3IUYA 2J0QA 3K70D 1XP8A 2CXXA 1E9CA 3QKSA 2W2TA 2P2LA 2DR3A 4DVGA 4HUQA 4KYIB 1M7GA 3Q9LA 4JMPA 1YR7A 1ZNXA 2DWOA 2WWIA 3AVUA 1OE0A 5JHHB 4NCKA 4HAWA 5DH9A 1QG4A 2HT6A 1XXHA 3HU1A 2R9VA 3AVWA 1SVMA 4I81A 2GXUA 1G7CA 2ZEJA 4LYJA 1S3GA 1GNRA 4C0LA 2ZJAA 1OKKA 2O8CA 4B74A 2FFBA 4Y0AA 4PC2A 4A4DA 3MWLA 3ND9A 5EZ5A 3ZZUA 1GOTA 1ONBA 4DSUA 4ZDKA 3Q7QA 5GVSA 4JLKA 4BEJA 1GNQA 1U9IC 3ADDA 1SGWA 3OF5A 2IBMA 2EWVA 3FKQA 1NNEA 2IYRA 1VMAA 5EP1A 3DM5A 3B5JA 4FMDF 5DO9A 3B60A 3GJ6A 2ZJBA 1AA3A 2GBLA 2HDNB 1TU3A 2AK2A 3R8CA 2AXNA 2V9PA 4LBYA 1NVXQ 1GNPA 2AL7A 3B1XA 4HLCA 3N2IA 5CYOA 1E9AA 4D6PA 4US2R 3CX8A 4R98A 4RZUA 5DI3A 1FNNA 3ZDQA 4GBMA 3NBFA 1E9DA 2GCOB 2IL1A 4QFMA 2WJJA 5GJVC 2QBYA 3LXXA 3RS7A 3IHLA 5HKKD 3RS0A 3SR0A 2DYKA 3FWYA 3LVQE 3THWB 3ADKA 1NLFA 1NMYA 1Z08A 4CT5A 1CKEA 5C4MA 4WBSA 2VHCA 5DIFA 4LJ4A 3KXKA 1UADA 1G9XA 1OXXK 1SVLA 1TMKA 1N2CE 1CJUC 5DN6D 1T4GA 3K9LA 4P4TA 4LBZA 2IX3A 1MABB 3I8SA 4UNNA 1LVGA 2QUZA 2NOAA 4WIAA 3A36A 3LV8A 3D3QA 2F1RA 5FTLA 2IXEA 3Q85A 4Z1MA 2ZAOA 4C7OB 2OFOA 2GK6A 4AURA 4P4SA 4CF7A 1U8ZA 5G53C 1HT2E 1VHLA 5G3YA 4QNMA 3QBTA 1GKIA 2GEUA 1D9XA 1F48A 2D06A 2PLFA 2SHKA 4X8LA 3DZ8A 4D0GA 5M04A 1NP6A 1OSNA 4LHXA 1IY2A 4CVNA 3U61B 5LD2B 3K70B 3DKVA 1S3SA 3CH5A 2LKCA 2WJGA 2FN4A 3BIFA 1SULA 3NBZC 2DFLA 5JS8A 3CR8A 1G8HA 4TMVA 2BBOA 2NGRA 5HR5A 1MRNA 2WOOA 4ZDWA 1I2DA 4RZXA 5LB2A 3EZFA 2OLJA 2QPTA 3A6PC 1AKEA 1M2OB 1KIMA 4LJYA 2BC9A 2VO1A 4JVLA 4Q7KA 4A8JB 3SS8A 4WOPA 2BEJA 4AYTA 4P4SB 5FOVA 1JXMA 1G3UA 2BKEA 4F4JA 4E07A 1D6JA 4K81B 5SZJA 4EPWA 4BZQA 2P65A 3GFPA 4YXWD 3Q72A 4Q1FA 4B3GA 2GJ9A 1E9BA 3SN6A 2ZRAA 2ZJ5A 4HB4A 2CLSA 4TLDA 2JA1A 4Q9LA 2DB3A 1E0JA 2Z6VA 2WWXA 5FUVA 2FFHA 1IHUA 1ZCBA 1KI8A 4URYR 1OFIA 2ODEA 2RGCA 1BS1A 4CEJB 5CK5A 3IHWA 1ZP6A 4B2LA 3MUFA 4KITB 4LBWA 4MA4A 1ZBDA 1QF9A 1YRAA 2I3BA 1RJ9B 3K0AB 1M1YE 3LAWA 2V4ZA 2VIIA 2QTFA 2XNDD 4RCZA 3BOSA 1FPMA 2ZROA 1QHXA 2VP5A 3TIFA 4XWKA 3L0IB 4D80A 4POAA 2JJ1D 2H57A 1OH6A 1XB2A 1DVRA 1J8YF 1I4LD 3H86A 5CJPA 4D4MA 4BZXA 1WDTA 1BOFA 1AGPA 3NEYA 2OV2A 3PIRA 3F5FA 2GCNA 5BW8A 2UKDA 3FHTA 4BUJA 4Z54A 3NWJA 1E1QD 3FMOB 5TARA 5HKKA 3UK6A 4TTPA 1PZNA 4LRWA 1QVRA 3OZXA 3BS4A 4LV8B 3SZRA 3GLFA 5LB4A 1NKTA 1YR9A 2QI9C 1RRGA 3FFAA 3T5DA 4A82A 5B30A 2FJUA 3AM1A 2QT1A 4PR0A 1DAIA 1Z2CA 3Q5EA 1ESNA 3CNNA 3LBHA 2I4IA 3NEJA 1KDRA 1GM5A 3A58B 4Q1DA 1W0KD 3IPYA 2G1JA 1N6RA 3ZVRA 1VYVA 1KO1A 3CNOA 5KNCA 4TYPA 2GWHA 4UJ3A 2ZU0C 4PANA 2H5EA 1JR3A 2DFTA 1TF7A 4WZBE 2OESA 1MO6A 4A8JC 3B2EA 4M9SA 3BGWA 3TVDA 2R44A 521PA 4BASA 1VG1A 4PQRA 3IBGA 4C0KA 2KBFA 1GP2A 1G4UR 4ESHA 5BN5A 3BJIC 4RFVA 3TVTA 1GTVA 3P26A 1HE8B 4AG6A 2FPLA 1VHTA 4DCVA 1FFHA 2B6HA 1XJQA 2OG2A 3GJXC 4DCNA 1HURA 1O87A 1P2SA 2QNRA 1KI1A 1R0YA 4LJ5A 1LB1B 3OE7A 4PC3A 3W3ZB 4N3NA 1P62B 4TMXA 3FFBA 5KDOA 2EYUA 1PLJA 3LNCA 3SJBA 2ZRKA 1DE0A 1G7RA 1CR0A 1G3MA 2VHTA 3EAQA 4FMCB 1AIPA 4KAXA 3DKPA 3VKHA 2QORA 1COWA 2AFIE 3FMFA 5JMTA 4QGGA 4Q19A 5H70A 1JQLB 2EFDB 4NYJQ 4MRPA 2W0MA 4DLZA 2NZJA 4URVR 2D74A 1YZTA 3P4YA 4EAQA 2F1JA 4PPGA 4XVQA 1HQCA 5EE1A 4IDNA 5J4HA 3TR5A 3OESA 1DOAA 1GL6A 3IO5A 4FD2A 1BIFA 1GIAA 4BFVA 4C9BA 2FSHA 2VA8A 3FMIA 2ZTSA 1CIPA 2WZQA 3FHOA 4TSFA 3T1TA 4EPYA 4KFSA 3EPHA 2R8RA 3QF4B 3C5CA 2QE7D 3WXMA 3QKRA 2NZ8A 1G5PA 3M6AA 2C9OA 4MYTA 3CWZA 3U3KA 3UWOA 2IS6A 2AWOA 1JECA 3K9GA 2ZYWX 2CNWD 2BDTA 1C1YA 1P4SA 4HAYA 1G4AE 1KJWA 2L0XA 1AQUA 1WE2A 3I72A 5FOTA 1P61B 5L3SA 4TMWA 2B92A 4LYFA 5FOXA 1XMJA 3THOA 2ZRLA 3MJHA 1S0UA 1JXOA 1KDPA 2RGEA 3T35A 1LF0A 3AVXA 2JDIA 3ZD6A 1R0WA 4QM6A 1ZD1A 2CEAA 2ZUDA 2IF0A 1C4OA 1RKBA 4BFUA 3B78A 3BFKA 2RHMA 3DMNA 4OJQA 1VYUA 1N25A 1CR4A 3QVVA 4YLGA 5BWMA 1XD9A 1A7JA 2WIAA 4HB0A 3HR7A 2FEMA 1U8YA 2G6BA 4WZ6A 1XTJA 2PZFA 2HJGA 4ZI3A 1W4CA 1T5LA 2QU8A 2QQEA 2B21A 4JT2A 4Q4HB 3ZJYA 4MRSA 4PHGA 3D8BA 5FR2A 2WWYA 1U8AA 1U90A 4DLRA 2BM0A 1ESMA 1KI2A 2CCJA 1Q20A 2ZR0A 3NH9A 4MH0R 3LY5A 3FMPB 3ADCA 3PUXA 2AHOA 1GSIA 1DBSA 3CR7A 3OIVA 4DRZA 4RFSB 2VP9A 4DLWA 2R62A 3QXXA 5JECA 1NN5A 2FV8A 3NHBA 4TN1A 4CEHA 1G20E 4B3DA 2EFEB 3GJ8A 1SQ5A 4B73A 3QPUA 5JEEA 4TYNA 4XOIA 4CEHB 5JRZA 4EIWA 3MRSA 4DEYA 4FWTA 1H8EA 2YOFA 2ONKA 1BH2A 3QKRB 1EFCA 4G01B 4UXHA 4BQSA 4XD7D 1BYIA 4JKYA 3L0OA 4XWAA 3S1AA 2VHJA 3H4MA 2IYSA 4HDCA 1TAGA 3BB4A 4HLQB 1YE8A 1N6HA 2VSFA 1E2LA 2WVJA 3KFXA 4IKEA 3MAAC 4ILEA 4KV9A 5EXPA 4FXPA 1E9FA 2OM2A 4FN5A 3W8NA 4TQ9A 1FUUA 2VF8A 3B85A 3BB1A 4F93B 4DLXA 1CJMA 1VIYA 4BZPA 2VBCA 4YC7A 2WMNB 1CRQA 4B71A 3LD9A 5FUWA 1E4YA 2BBTA 3KJIA 1CXZA 1W0KA 2ZE7A 5FBWB 4RZ2A 3OFND 3W8RA 3U3OA 3U5ZB 4DCTA 4RVCA 5AJXA 1YHNA 3T61A 3B8HA 2J7PD 1TEVA 2CL6X 3P27A 2IYWA 4QGFA 3A1WA 3UMRA 4B34A 4WXRA 5K8IA 4JL8A 3P32A 2CE2X 4M9QA 5EE5B 5F9HA 3AKYA 3BBPA 1K8RA 4IFBA 4PAQA 4UNQA 3ZVLA 2EFHB 1IY1A 3AVQA 3F8TA 5FR1A 1T3LA 3C4JA 1CU1A 2C99A 4TL9A 3L43A 4MKFA 3RS4A 2A9KA 4NYIR 5KOYA 4O25A 4KVAA 2ATXA 3DM9B 5BN4A 4URWR 3MGCA 3CRQA 4XWOA 1XTSA 2OCBA 3D6TB 1KZGB 4UNPA 2J7KA 1Z0KA 4P3YA 1JAHA 2J45A 5JZVA 1T0JB 5BYJA 2PX0A 3NHAA 4LI0A 2R6FA 2G3YA 4YMVA 1NSTA 3OHMA 4TYWA 2BJVA 2XTNA 1E2JA 2CHVA 2WHXA 4C2TA 4TSFD 2IXFA 4O3MA 1ZM7A 1UKYA 2X8AA 4OK3A 1G3RA 1XU4A 1F60A 2GEVA 1JQJC 4XVUA 2MSCB 2EVWX 4OI2A 2HT1A 3O8RA 4EFLA 5BYKA 1IM2A 1PLKA 3RRYA 2RGDA 5KHOC 2DCUA 1GVNB 1XJ0A 5CK4A 3HDTA 2ERXA 5DHAA 4A0FA 4OHYA 1DAKA 1MKYA 1XTKA 3KTAA 4GT1A 1M6NA 1XRJA 3CRW1 3ZQ6A 1E9RA 1FMLA 4CEJA 3SJCA 3GLIB 5K8UA 2QN6A 3PUVA 4AKEA 5A5GA 3GCGA 3MSXA 3MD0A 3AKCA 3KX2A 1L8QA 2I1QA 2P5SA 2ZRPA 4A0GA 4JKIA 1ZM2A 2HLDA 1LS6A 5IHPA 2PCLA 3VAAA 1TPZA 4S35A 1X3SA 1JR6A 1E2FA 3RSLA 1QHNA 1KMHB 1MV5A 221PA 2IUTA 2WSMA 2OO7A 1R8SA 2N46A 3C5HA 3VR6A 3FOZA 4I1UA 4IVRA 4AG5A 4ZV4A 1W0JA 3T34A 3I8XA 3RSOA 2GTPA 2VL7A 3K1JA 2BBSA 4IXMA 4U00A 1W4RA 3H84A 1COWD 4RSGA 3CKLA 3X1WA 1XEWX 3PXGA 4KO8A 1W5TA 2H1LA 1OXSC 4JSYA 4KLZA 3I5YA 1JPJA 1GZSA 4MRNA 1DS6A 4KSBA 2C9CA 1N6OA 5AUPB 3I92A 3F3YA 3THYB 1JB1A 1ZAKA 3RABA 2ZRFA 1AGRA 1G64A 1JR3E 2WKQA 1YZKA 1QDEA 1KJZA 3KQUA 1VPLA 2GZDA 2AWNA 2PL3A 2V3CC 4XTCS 1NJFA 4DLSA 4KJZA 5EE3A 3PEUA 3D31A 1RJ9A 4YMSA 4D81A 2WKRA 2ZSBA 1E0AA 4R9UC 1UDXA 3GJ7A 3BH0A 4HAVA 4EQ6A 2J3EA 1DAEA 2QL6A 5FTJA 5H8WA 2GILA 4L4UA 4B3FX 4Q66C 5FPKA 2IUSA 5J47A 2ZRJA 1WCV1 5SZHB 4UJ5A 1IXSB 4V0MA 5AWFC 1S1MA 5CDFE 4DB4A 3BK7A 1L4YA 3ZVNA 4D26A 1GITA 2HYDA 3OIUA 1P7CA 2F9LA 2WPDA 5SZKB 1CLUA 5KSOA 2BKUA 3ZLJA 1J8MF 1F5NA 2QRNA 4HB2A 3E5HA 3K8YA 2XSZD 4DDVA 1NLYA 4IEIA 2V6IA 1OIWA 2GCOA 3AF0A 4NYMQ 1DG1G 4MGYR 4GI7A 1FUKA 4YXWA 3B9QA 4ABYA 3CONA 3V4FA 2GF9A 2J0VA 3A1SA 3UWKA 4LC1A 5P21A 4M9ZA 3EC1A 3X1XA 2QE7A 2C8VA 4KODA 2GZAA 4CYMA 1E2NA 3IDQA 4I1SA 2C95A 1DO2A 3TBKA 3PR1A 2FF7A 4O2LA 5HPYB 4B3CA 3EIEA 4NDZA 1OH7A 2AXPA 1N3BA 2IS1A 2QM8A 2GKSA 4Q4AA 3MCAA 3CUEF 4U7DA 1HTWA 1IAQA 1E79A 3ASYA 5FPTA 3WNBA 2PZEA 4LGMA 1Z2AA 2IYYA 4NP6A 2D2FA 2WWWA 3QXJA 3U7GA 2V7QA 3AF4A 4C7OA 4NYJR 4AKGA 3PEYA 1XNJA 4RZ3A 1SXJC 1XCGB 1D5CA 2DHRA 3G82C 2ZYTX 1ZU5A 2OHFA 5CM8B 2C2HA 4A9AA 1KO8A 4ACAA 4B44A 5CITA 3U6KA 4D0LB 2OSBA 3EWSA 5KO2A 5FOSA 5C46F 3EPKA 4IOMA 3JVUA 2JIZD 4OQLA 3SFVA 4KCGA 1AZTA 2FH5B 5AUQA 1N5IA 5JS7A 2HXSA 1E2IA 2EU8A 1DG3A 1AS2A 2XTMA 3MWJA 4Q5IA 3CBQA 3RS3A 2XXAB 1DADA 4JL6A 1XWIA 3I32A 4W5JA 1FTNA 3WRYC 1NG9A 4KI0A 1Z8FA 2NO1A 1U94A 2I1VB 3THWA 2IHBA 4EUNA 1NI3A 2QBYB 1MRSA 3DPUA 1Q1BA 2PBRA 3EZ9A 2F1IA 4JSTA 4RD6A 2ZQ5A 4DDTA 1R0XA 1KKMA 5DI3B 5CM9C 3SC3A 4NKRA 2CLCX 2QG6A 4Q01A 5BN3A 4FW9A 2KE5A 3CZQA 2O8BA 1G7TA 1SHKA 3RRNA 1VG0B 1VECA 1XCMA 1GAJA 2JEOA 4TWZA 3R9XA 4PC1A 1XDBA 821PA 1ZC4A 5C4GB 2YVUA 4CDGA 2O8FB 1EK0A 4P33A 1D9ZA 2KJQA 3RHFA 4N0DA 1LY1A 2PJZA 2CL7X 5DE3A 4NU0A 2P0EA 2ZVPX 2CHGA 4V0ME 5B58C 4YMUA 4AKHA 5CYPA 4WAUA 5J4YA 1Z0JA 2O52A 4PPQA 4JLDA 2ZJ8A 1WXQA 5AK0A 1ZVQA 5JWHA 2ODWA 4JLBA 3M4YA 1NN1A 3B7GA 5DHFA 2C9YA 3AQ4A 1EG7A 1Q3HA 1X8LA 3QBVA 3EW9A 1CJKC 1N6KA 4M53A 3VNVA 4GNKA 3OEHA 4Q9JA 1KGDA 1G8PA 2Z4RA 1NBMA 1IN7A 2JCSA 4OQNA 1E2QA 3F0TA 4AYWA 4EPXA 2C03A 1WBDA 5H68A 4L5BA 4LDJA 2DY1A 3UG6A 1T8UA 1SKQA 3AUYA 1JBKA 3TK1A 1IXZA 1JEEA 2GK7A 4BRUA 4MYCA 4PSAA 2GAAA 1P5ZB 3FKSD 4M0LA 4TLEA 2J46A 4BFTA 1SXJA 3I5XA 1UBGA 4IFEA 4DHEA 3RYTC 2WJIA 4DCUA 4EFNA 1QBKC 4YDHB 1KI6B 2OLKA 4FCVA 3TGPA 2E1RA 1CEEA 3QG5A 3EZ6A 5KYKA 1XXHE 3FDIA 2NIPA 4TMKA 1KI6A 5KSYA 3KKMA 1XMSA 5JCPA 4K46A 2ODBA 2ZE8A 3QEJA 4OBEA 2OFXA 3FTQA 3K09C 1O3YA 2ORWA 4BLOA 4ARZB 2FPKA 4BFWA 2MSDB 2KI5A 1CTQA 2ODNA 2W83A 3O8BA 2BMEA 5HCIA 1WQ1R 2C04A 2B7CA 4QJ3A 1EX6A 3R9WA 4KBFA 4UKDA 4PTLA 1KI3A 2BCGY 2F43A 3EASA 3KZ1E 3T06B 2ZJZA 2VP6A 2IS4A 2IYXA 1T3HA 4OI1A 1KK1A 2OE2A 4C0QC 1US8B 1I4DD 3EZ7A 3SI7A 3AGPA 1E2GA 4BWYA 1KO7A 4B2PA 3A4NA 4TZ0A 4OQFA 1UKEA 3WHLA 1CF4A 3R8FA 2ZR9A 3EG5A 3KB2A 4HLUC 4LY6A 3CB4A 5CDFA 1G41A 4RJLA 1KY3A 3HWSA 2AK3A 3NKVA 4G5QA 4PXAA 5KSPA 3AVVA 2FA9A 3VR2A 2BEKA 4MKHA 1H65A 5FTNA 4LV5B 4H9GA 4M1YA 2DWPA 2MMCA 2FEOA 2GRJA 3Q8XB 1Z6GA 2QAGC 5G41A 2XXAA 2XITA 2W6JA 1VG8A 2ZRNA 4PPNA 4LJAA 3SJZA 1JJ7A 5KDDA 3KUCA 3C7KA 2GHIA 4LX0A 1YZGA 2D62A 4AC9A 3U60B 2W58A 5E7JA 4OHZA 4WW0A 1FX0A 5EXSA 2GXSA 2J0SA 1M7BA 2R65A 3EXAA 2W2XA 2IA5A 3E2IA 4V0OA 4IOJA 4L8GA 3LQQA 4LHYA 5FH9A 1Z83A 1S9DA 1XMIA 2A2ZA 2D7DA 2V54A 4MUBA 4AD8A 1FOEB 4II7A 1KK0A 1ZJ6A 4L16A 5FPSA 4URZR 1T5IA 3N2EA 3U2QA 3CF2A 4A92A 4DIDA 4NE2A 1HT1E 3R20A 1E9SA 4JL5A 3GJ3A 4AY2A 4Q03A 3AP2A 2OCYC 5EXTA 1U0LA 2XOKD 3TQCA 3LRPA 3RRZA 2WV9A 121PA 3EWAA 5TV2A 3GEIA 4ZIRA 2H18A 4TL8A 1G16A 1XF9A 1AJEA 5KTYA 3G5UA 3GMTA 3W6OA 1OH8A 1HY3A 3DOFA 4HDOB 3QNUA 3L0PA 5FBRB 4Q7MB 1LW7A 4GMXA 2QMUA 1UKVY 3ECCA 1P73A 2QSZA 3H2YA 4A0HA 2RCNA 2DFNA 4IW3B 1UBFA 4AK9A 2GEDA 4AI6A 1SVOA 1E2HA 3LDAA 4LJ9A 5UKDA 4TLCA 5D3QA 1E2KA 3QY0A 1TQ4A 3RAPR 3B6EA 1NF3A 3C15C 4CIDA 3MLEA 3KB1A 4NPHA 3GJ5A 2Z0MA 3HYRA 4DDWA 3GLIA 4URUR 2NPIA 2JLWA 3DOEA 3GD7A 4GSYA 3EARA 2F1HA 2R6AA 4LHVA 3RLFA 3ICQB 1AS0A 1E2PA 2REOA 4B43A 3LBIA 2BMFA 2PEYA 3IEVA 4Z8YA 1XPUA 1XCPA 1D2MA 4AIIA 3WMFA 4XSHA 5D3MB 2CNWA 2GBLC 2QAGA 1OW3B 1G7SA 3VU9B 4A2PA 1VCOA 1X1SA 1M74A 3EA5A 1NVWQ 3THYA 4MYHA 4JJKA 1NY5A 1T0HB 1P2TA 4IHQA 4HLDA 2ZRBA 2MSEB 3CWQA 1C9KA 1M8PA 4LPSA 2AR7A 2CL0X 2ZRIA 3E70C 2YZ2A 5E7MA 2GVZC 3DVLA 4RD3A 4BFYA 1KI7A 5JBQA 2XB2A 4FIDA 1R10A 3AF1A 4B75A 3UANA 3R7WB 1G8FA 1ZM3A 2QP4A 2QMOA 2RGGA 5H1YA 2JATA 2PH1A 4R71A 4R7ZA 4QRHA 3GQBA 2BMDA 4LSGA 3KKPA 4C0HA 2X2FA 3KJGA 2IUUA 3RC3A 4H1VA 2ORVA 3AP3A 1VCIA 3HYTA 2JLRA 1YZLA 5JWRA 1UBCA 4YDSA 1MO3A 3FKSA 3IEUA 1KMHA 3JZMA 1KY2A 2QRZA 2EQBA 3QG1A 3NC0C 4HDQB 2Q9CA 5AUNB 1NVVQ 4ON9A 4TLBA 1ZUHA 2XX3A 5EUMA 5B2ZA 1NL3A 1ZCAA 5IDVA 4BE7B 4YQFA 2XOKA 3SDZA 4TQUS 2XAUA 4IDOA 4UQOA 1KTVA 4PAOA 3W3AA 3EA0A 1HEIA 3N70A 5JFGA 1IQPA 4QBGB 4PAMA 1HH4A 2VHUA 4P32A 2IS2A 3QVUA 1IOZA 3A1TA 2JLUA 5EP3A 4CRWB 5L8VA 2C78A 4GOJA 1PUIA 1E96A 4P31A 1VKJA 2PLRA 4X8OA 2O8DB 3MWKA 1BMFA 5AUOB 2CE7A 1G3IA 2VQSA 4MGKR 4Q9IA 1GDDA 2D2EA 3H0KA 3UMFA 3ZIAA 2QGZA 2AN9A 4W5HA 5KPJA 3TQFA 5F9FA 3UIEA 1KI9A 2O8EA 4BLTA 4JLOA 4QOSA 3ZH9B 4RFSA 2PJRA 4TZ6A 4OHVA 3W6PA 1GFIA 4A2QA 1GKUB 3VFDA 1A4RA 3WHKA 1N5JA 2ZANA 3WBKA 4ZDIA 1F2UA 1KK3A 421PA 5JWOA 3BWDD 3PEWA 2J5XA 4JBWA 3P4XA 2MMGA 2PMKA 2FPMA 3WP1B 2ZSFA 4C3ZA 3L82B 4QBFA 5KPDA 2GDJA 4PQFA 4WZAE 5FUYA 3SHFA 5GJWC 4EPVA 1W2GA 1QHYA 2JAQA 1KJYA 2YYZA 2C5LA 1IN8A 3MMPA 3KUDA 4E22A 1S96A 3BE4A 4DSOA 4QGHA 5JSZA 4ZCLA 1Z28A 4DJTA 3KQNA 1Z5ZA 2XZOA 3IILA 2A30A 3WYGA 2GXAA 4OYHA 3ICEA 4QNRA 4I99A 3REFA 4HI0E 4W7SA 1Y3AA 3VTKA 1W36D 3W6NA 2CCKA 3TH5A 4C2UA 3GP8A 5EE9A 3UATA 5AJWA 5F98A 3JZAA 2CCGA 4TYQA 3R9IA 1US8A 3SOPA 2Q21A 2NO7A 4OK6A 4QHSA 1OB5A 1G17A 3RANA 2RH5A 5FI0B 1XEXB 2UVQA 3CPHA 4C30A 2RGNA 4QC2A 4IXNA 2JIZA 3VNUA 1G8GA 5L3SB 1HA3A 1OT3A 3LWNA 3CF0A 3HU3A 3WNCA 4MGZR 2QEQA 4D82A 1PVOA 5IRCD 2B8TA 3TSWA 4EJSC 4TLAA 2W6ID 1Z0DA 2LKDA 1KO5A 1ZD8A 2VP2A 4DB2A 4KU4A 1Z0AA 2WAXA 5EXXA 4AKIA 2ZITA 4NCNA 2DWQA 5FOWA 1YKSA 4FMDB 1OPXA 2ZJOA 2NG1A 1YU9A 4G5SA 2VRWA 1RE0A 1HV8A 2ZI9A 2O5VA 1NIJA 3RRMA 4KXFB 2ZE5A 1UPTA 1TUEA 1H8HD 1SXJB 5C1BA 1H8ED 4N1AA 3O47A 3TR0A 3UMSA 4DUGA 2PMDA 1XEWY 5FTMA 1DTSA 2JLZA 5L3VA 3OE7D 4Q18A 1Z6AA 2YC4C 1R0ZA 4A0RA 2GJAA 2IYVA 2YWHA 2Z83A 1M34E 5FPYA 1W47A 5TVKA 3RDPA 2XGJA 1ZD9A 2J1LA 1UJ2A 4LBVA 1U9IA 1CS4C 2XJ9A 2CVFA 2N42A 3I3SR 1YZUA 2E9SA 1N6PA 3PG5A 4I1VA 1KMQA 3QE0A 4Q4HA 1Q3TA 5CB8A 3KJHA 1WRBA 3BAFA 4M1OA 5DSZA 3SBEA 3ZZ0A 5DYGA 4J0QA 3GLHE 2XJ4A 1NMXA 3K9HA 3K9NA 4MRVA 3L8YA 4EPTA 3UXMA 1FNMA 5KUTA 2A3RA 1OFTA 2V6JA 3THXA 3GLGB 1NBMD 1KK2A 3OEHD 3TLXA 1E4VA 2IW3A 2UZIR 3T15A 1R5NA 2QQ0A 2J9RA 3QENA 3D7MA 2OCAA 1R5OA 3ASZA 3IQXA 4US1R 5DNYB 2OXCA 4MQBA 3OEED 3QF4A 4NCIA 2VTKA 4XJXA 2G9NA 3A1VA 2WWGA 2G77B 2QA5A 2YWEA 3FPAA 3HPQA 3QKUA 1J7KA 2EFGA 4B2IA 1WF3A 1G5TA 3MFYA 5J4VA 4NYMR 4B6FA 2YINC 1FQKA 1AKYA 4TMTA 1E69A 3CPJB 4MDEA 1W1WA 1BMFD 4V0NA 4BECA 1V5WA 4HUTA 1N6LA 3CX6A 1QHIA 4M21A 2RB4A 4QJ5A 2BMJA 2JJ1A 1UBEA 5BXQC 4CEIB 2O8DA 4NTZA 2R6DA 3P1JA 1ANKA 5CIWA 1DAGA 3HP1A 2ZAMA 2OZEA 2GESA 1IJFA 4OHWA 1QHGA 1BYUA 4HAZA 1W7AA 2GA8A 3OAAD 3AH8A 1FMJA 1K5DA 3IQWA 4F38A 4JT4A 3RS5A 3HPRA 2O0JA 4EJSA 1NVVR 1W48A 4JVMA 2C77A 4RD4A 3U6BA 4G5GA 4JLAA 3KJEA 5FPHA 1DAFA 4BFZA 3J81k 4Q1AA 1EWQA 2OAP1 1W2HA 3P20A 4M1TA 4GDFA 3K70C 5LD2C 5JJLA 1OJLA 1WMSA 1OKKD 2ASEA 1VTKA 1I2MA 1EX7A 1UM8A 4I4LA 3EPLA 5HE9A 5JI3E 3U3MA 1DPFA 4OHXA 3IBYA 1II8A 2NTYC 3LH5A 2JLVA 2ZJYA 1BO6A 2HJVA 5GJCA 2N1BA 5LDDC 5A4JA 1LF5A 4JLVA 3QXCA 1R5BA 1P9NA 1TF2A 4IVQA 4BFXA 3LQRA 3QUSA 1UEIA 1GRNA 1ZINA 1IJEA 1OFHA 2G88A 4TT3A 1GKYA 2V7QD 3LLMA 2QGNA 4JIMA 2FOLA 5EUQB 1KSGA 4DLUA 4Q4AB 1E1RA 4OQXA 1HUQA 4NZYA 1SVIA 1MO5A 2IT1A 2G83A 2O0KA 1T9HA 1S9HA 1AS3A 3GLFE 3SBDA 3EIHA 1Z06A 5JHGB 1T3SA 5EZ6B 5DLQC 3CIOA 1EFHA 5KNDA 2QPAA 3SYLA 1E79D 3CW2A 4PO9A 3BORA 5CLLA 4PZYA 2AKAB 3AGQA 4JLNA 4PSKA 1ZMXA 1P60A 1NMZA 3A4MA 3N5CA 1UEJA 3RVBA 4XSGA 4ZKDA 2VP4A 3Q5DA 3GLFB 3U7FB 3GEEA 4B47A 1IXRC 4BEBA 2HYIC 1WB9A 1TUIA 4NL4H 4XIGS 3W5IA 3NVAA 3U7EB 4A36A 4G5OA 2ECKA 1K6MA 1KNXA 4PFSA 1MOZA 3BH6A 5ANRB 2NO9A 3KL4A 4Q00A 1QZXA 2ONJA 2RGXA 3VKGA 4TQAA 4ZCIA 1R8QA 2ZYVX 2DPXA 4M1MA 3RWMB 1MABA 3T1VA 4C0SA 4F4IA 4LJ7A 5DN6A 4YONB 1Q1QA 1X6VA 2ZI4A 1U2RA 1YJ5A 2JLQA 4QBHA 5TY0A 3T1QA 3ZS9A 3OEEA 4C0JA 1SVWA 4HEJA 4P4UA 1B23P 4IDQA 4EPRA 3ZGXA 2WAYA 2WIBA 2R6GA 4JVSB 1NJGA 3K0AA 1CJTC 6Q21A 1JEDA 2IYUA 1E2MA 2V1UA 4EFMA 5EJEA 4B3BA 1YR6A 2WKPA 3MG9A 3PCRB 3KXIA 4GFDA 5JCZA 1VDZA 2GF0A 5TDHA 4A6XA 4US0R 3TSOA 4DCSA 1N0VC 4MYUA 4A8JA 1MT0A 1E98A 1ZIOA 1FW6A 2QTVB 4RCYA 1ZM4A 5CLQA 3LXRA 4W5WA 3TUIC 3ZYCA 4MDFA 1XBTA 2FSIA 5FOUA 2Z4SA 5J4LA 2ZXUA 2ORIA 1ZW6A 2FMXA 1G3QA 2V1XA 3WBJA 1Z0FA 1A82A 1U98A 3C16C 2RGAA 3LLUA 1OLOA 1N0UA 1RRPA 3AUXA 1Q12A 1KSJA 2D4HA 2Y8EA 4X8MA 3NDBB 3M0EA 4GL2A 1P6XA 2WICA 2Q3FA 3BFVA 3U3RA 2AFHE 2X77A 1VYTA 2VYFA 1NKSA 1KYIA 1E99A 3L8ZA 1RZ3A 1KSHA 5G3ZA 3I1FA 2FU5C 2FNAA 2HXYA 2VLIA 1LNZA 1EFTA 1LV7A 2WBLC 3NH6A 4MITA 2H92A 2DBYA 1RRCA 2CVHA 3TSZA 1II8B 4BLPA 1A2KC 1W49A 1KDOA 1W46A 3TE6A 1XPOA 1Z63A 1EESA 4D4LA 3EPJA 4ESVA 3DEFA 3FYHA 3PEVA 4Q1CA 3GEHA 4ERNA 3B9PA 4KYUA 1X1RA 3SE0A 4K8OA 4RD0A 4LYHA 4XH9B 2JJ2A 3AVOA 1G19A 4V0KA 5A0FA 5LPNA 2EWWA 4HUQB 4B3XA 4HB3A 3KTAB 1UKZA 5J5CA 4EJSB 3KKNA 1ODFA 2JGNA 3NBYC 1XTIA 1CP2A 2EFCB 1BKDR 1U81A 2P6RA 4Q47A 3AVYA 3PUYA 3O8DA 5FFMA 4NHOA 2NO0A 3LA6A 4DLTA 4IJMA 5J4KA 2ZUBA 4LK2A 3PUWA 4CEIA 4OK5A 1AQYA 3ZQJA 2IYZA 1FQJA 2IYQA 3PITA 4FCTA 4F92B 1W4AA 1OXUA 2D7CA 5DYIA 1TADA 2Z43A 5F2EA 2HCBA 4DKXA 4JVNA 1G291 2NO6A 3O8CA 3T5GA 2Q3HA 2WJHA 4OKSA 4NH0A 3TMKA 4B35A 4RD1A 1Q1EA 3CRMA 2P5TB 3LVRE 4X8HA 1E6CA 3X1DA 5K8LA 3ZS8A 4F4CA 1RPZA 1VCMA 1U99A 2ZI3A 5L3RA 5B64A 3QEOA 2WSSA 3V4RA 1A1VA 2KBEA 1E0SA 3X2SA 3RS2A 3WRXC 4BFSA 3BC1A 5IF9A 4JLMA 4BPBA 3TAUA 3SYKA 1T91A 3SHWA 2O8CB 2DFKB 4LYAA 4D4KA 2P6UA 3SJAA 1NRJB 3QSYA 3RWOA 3X1YA 1S2MA 1XX6A 4G1UC 1CRPA 1OB2A 2CHQA 1WBBA 2WSSD 2HV8A 2WOJA 1P3JA 1LFDB 1ZNYA 3LX5A 1E1RD 1KO4A 1TNDA 4GPTA 4A15A 4Q1BA 1D2EA 1Z6TA 5FI1B 3QOFA 4NONA 1G21E 5FBLB 3DDCA 3QIAA 4Q7JB 3VR3A 3CH4B 2ZM5A 3FVQA 3ADBA 3DZDA 4WXPA 2QENA 4OI0A 4M22A 3KKOA 1Z6XA 1DAHA 2IK8A 1SZPA 4LWZA 4QKQA 5JI2E 2AKYA 3OFNA 4PSVA 2OBLA 2W00A 1XXHB 2OBNA 3K53A 2P6NA 1JJVA 3U4QB 2KB0A 1NN0A 3DL0A 4V02A 3IIKA 1AZSC 4PHFA 2VH5R 4JLPA 5GADl 4DDUA 4GOXA 4I1OA 3QKSB 4Q48A 2CBZA 5JJIA 3SYNA 2ZU6A 1ZM9A 2GJSA 5KU1A 3A1UA 3TW8B 3HR8A 4HZIA 2JJ2D 3S1AB 2IC5A 1JAIA 2KSQA 4B76A 2ATVA 1TL7C 2OXRA 4RD2A 2H7VA 2GETA 1G1MA 2RHDA 3NIBA 5HCNA 1IN4A 1Z07A 2OUKA 2BJWA 3HJNA 2IF2A 4OJKA 2QP9X 3L2OB 621PA 1Q22A 2PEZA 3CZPA 3IIJA 4FINA 2WMOB 4Q4JB 4DT1A 1NBME 1OXTA 1W5SA 4Q21A 1Q21A 4V03A 2FFAA 5KDLA 1NIPA 4M1WA 3WNDA 4TYYA 4JBYA 1OH5A 2RAPA 1GRQA 2PCJA 2FSGA 3U7HB 1NN3A 4CZ2A 2OFWA 4FI3C 1E2EA 2ZSEA 1N5KA 4D25A 1G8YA 1CBUA 1QHHB 4QGAA 1AK2A 2VHQA 2W0SA 3OAAA 2JDID 3GLGA 1P9WA 4GP7A 2ZRGA 3GFTA 3NG1A 2ZRMA 2IYTA 3THXB 3CM0A 5DGXA 5JSZB 4LZZA 4W9MC 3VHXA 2CK3A 1CJVC 1XEXA 4G5RA 3TAHA 4DWJA 2OBMA 4DSTA 3GPLA 1WA5A 1JALA 2XTZA 2ZVQX 4PC6A 5IK2A 3VHLB 1YVDA 3TUJC 2BCJQ 3BXZA 4LJ6A 3GLGE 2GJ8A 1E9EA 2BM1A 2J87A 2NQ2C 4WVFA 1YR8A 1P2VA 4JS0A 1TU4A 2QROA 3WYFA 5JEDA 1R7RA 1E1QA 3C8UA 4QBIA 4M1SA 2ZETA 3B1YA 4HATA 2O8BB 5GJBA 2A5YB 4Z8XA 1PJRA 2VEDA 3IKJA 3VQTA 3C14C 3WP0A 4BRWA 1SKYB 1G18A 2F55A 3LW8A 1HE1C 1L2TA 1T8TA 2ZPTX 4GMDA 4CT4B 5C18A 1OHHD 1RRFA 1LS1A 2X19A 4M1KA 1Y63A 1H8HA 1E2DA 2YOHA 3VKWA 2O0HA 4ASUA 1XEFA 1J90A 4JLJA 1XD2A 2HEIA 3MJRA 1SKYE 2CDNA 2F6RA 3GLHA 4PZZA 5GVRA 2Q0HA 2O8EB 3A8TA 1L7VC 2IYLD 1RW4A 4EKDA 4QHTA 2KWIA 4UNRA 4Q4LA 4F91B 1T6NA 3LO5A 5K8TA 2VF7A 2QT0A 4KFUA 4KFTA 2V8OA 1SXJE 1KNQA 1ZNWA 4XVRA 2PT5A 3TJZA 2UZ3A 3KQKA 3CPEA 3K0CC 4HYYA 3GLIE 1GL7A 2BIFA 3NBXX 4L9SA 2GCPA 3KXLA 4IRUB 2WJYA 3IGFA 2JLXA 2BWJA 4HSEA 1Q44A 4WA7A 1TTTA 3LBNA 3SFZA 3HU2A 2K5UA 3NDPA 4F7WA 3CNLA 3AF2A 4MUAA 2NPFA 4YMTA 1ZYUA 4QHYA 2EYQA 3VR1A 2EW1A 3SNHA 2A7QA 1XMVA 2GXQA 3AVPA 4DBLC 1NVUQ 2ZI6A 1OXVA 5FUXA 3QPVA 4DSNA 5HZKA 1TQDA 1JI0A 2LWIA 1Z22A 2V55B 3NTUA 4HZUA 3U3JA 1SXJD 2W2VA 3A4LA 2B7BA 2YC2C 4O0MA 4M8NE 2XZLA 4IVPA 2VP0A 1DO0A 3K09A 5TB5A 3PFIA 1FZQA 1GG2A 5EP2A 1B0UA 2FE4A 2GZHA 3Q3JB 2ZI7A 3AVTA 4DLYA 1A5TA 3PENA 4O2RA 4LHZA 1W36C 1N0WA 2TMKA 3UKDA 2ZJ2A 1JR3D 4JZKA 2ZUCA 3X1ZA 2HCJB 1PUJA 2AD1A 4N0EA 1IY0A 4ZCMA 5SZIA 4ZDJA 1TX4B 4A6PA 1F2UB 1GUAA 2AX4A 5FL7A 1KZ7B 4CW7A 1W4BA 4Z1MD 1WP9A 1CR2A 2JASA 5TXGA 1D8TA 1IONA 4UNSA 1P75A 2IEYA 3BRWD 3W9YA 1A2BA 1RFLA 4R2IA 1OYYA 3R7WA 3K0FA 2F7SA 3QJYA 5IK2D 4S2EA 1Z47A 2NMVA 1FP7A 1AA9A 1VIAA 3REGA 1NSFA 2PT7A 2QAGB 2CK3D 3ND8A 3VU9A 1YRBA 1P9RA 2GAOA 4DIEA 4EQ6B 4TL7A 2Q6TA 2FSFA 5FBQB 4Q9KA 1PV4A 2HUPA 2XEXA 3SQXA 2JLSA 3FB4A 4AWXA 2ZI5A 5AR1A 1XJCA 3I62A 4HLUA 2FFQA 4NMMA 4GOKA 2J0UB 1NLZA 3BFXA 1II0A 4NCHA 1S1CA 1TQ6A 1EXMA 5G40A 1RIFA 2FX3A 2CLDX 2IWHA 1E94E 2R2AA 2J0UA 4D2IA 5FBVB 3B82A 2ZRHA 2XNDA 2ZRDA 2YHSA 1YZQA 3EZ2A 1X8KA 4JYBA 4GRAA 2QP3A 3L0SA 2BHRA 721PA 2IXGA 3AB3A 3CRRA 1EGAA 1TEXA 2IWRA 3OIYA 4Q1EA 5E4FA 1KHTA 3VX3A 4A2WA 4PC7A 1HYQA 1OFUX 2A78A 2WWHA 1GRRA 2A5DA 2FG5A 2GNOA 2QMEA 3EX7C 4U5XA 4C0BA 2RMKA 2QMHA 1MO4A 1ZNZA 2OILA 2WM9B 2BVNA 4PO1A 2HF8A 2QY9A 3K0CA 1Q1ZA 3CF6R 2YOGA 2YJTD 4PZLA 2XNSA 2F3RA 4B6EA 4DUGD 4M2LA 1U0JA 3BERA 3RNLA 4XD7A 3KQLA 2HLDD 1N5LA 1RC8A 2QPOA 2P3SA 3I73A 4QM7A 4Q9HA 1J99A 1ZIPA 2Q3MA 3H1TA 2ZE6A 4IDPA 1ZUNB 5JJKA 4PHTA 4C4PA 3CX7A 3GFOA 1W0JD 1LTQA 1KKLA 2YNMA 3GJ4A 5KSZA 1ELOA 1CR1A 4ZI2A 4FWIB 5JLJA 1PLLA 4JYCA 4KVGA 2GJKA 1SVKA 3AP1A 2R6CA 4BGDA 1RVDA 4UXIA 3W5JA 4YMWA 1J70A 1XFAA 5TMPA 2REBA 5CB6A 1ZUIA 1I4TD 1K5GA 4PQYA 3FE2A 4FCWA 3TW4A 4D4JA 3AKEA 2XB4A 1D2NA 3GJ0A 4E03A 3KQHA 5D3MA 1Z0IA 2G1KA 4ASUD 5B57C 3LX8A 1E0KA 4LHWA 4B48A 3KFVA 4DXAA 1G6HA 2H8KA 1KOFA 1N6IA 2G0NA 1AN0A 3IIMA 4TTQA 2WWFA 3K0FB 4QXAA 5E7IA 1L4UA 3T1OA 1FL9A 4TTRA 3C41J 1OHHA 1JNYA 1V43A 4DEXA 1RYHA 3CO5A 1XD8A 2A5JA 1XD2B 4DZZA 3CRVA 4RKFA 4LUCA 1OIVA 4JJZA 1ZRHA 4D0NA 2WPDD 5ELXA 1M7HA 4B33A 4RKEA 2YKGA 1Z29A 1QG2A 4TMZA 2A5GA 3IPXA 2FZLA 2XSZA 2ZS9A 3DHWC 3UG7A 4AYXA 2E87A 2VPPA 3ZD7A 4LOAA 3ZIAD 3SU8A 1OIXA 3V00A 2WJVA 3PV0A 4FMBB 5E95A 3PQCA 3I61A 1ETUA 4GZLA 4KFRA 1XPRA 8OHMA 3VX4A 5EE0A 5BQ5A 2ERYA 3QXSA 2F3TA 5CJ2A 2PZGA 3WYAA 1J2JA 1Q0UA 4IDHA 4M9XA 1XTQA 5HE8A 3WY9A 3TNFA 4DC9A 1CULC 3FGNA 4ACBA 4UXJA 4GZMA 4Y0VA 4MKIA 4P0TA 4ZIRB 4G3XA 1MR3F 3A37A 4B32A 4A1FA 1DELA 1R4AA 3M1IA 4OI4A 4MKGA 2VSOA 2RGBA 3DMDA 4PHHA 5CIQA 3RC8A 3BH7A 1EWRA 2C96A 1YQTA 4HZUB 3ONWA 1GL9B 2FGJA 2B8WA 1DARA 4LC0A 5AJZA 2GVDC 1GILA 1KAGA 4U02A 5EQTA 4L9WA 2Q9AA 3G0HA 2FGKA 4V0LA 1G5RA 2PX3A
chains in the Genus database with same CATH superfamily
4QE3A 3MYYA 4M0FA 5AVXA 3JR7A 1A9RA 1L7PA 4YHBA 2JGKA 2YQ5A 1H2BA 2FWPA 1ZCJA 1MB3A 1S8NA 4HK4A 3D4PA 2I80A 1UAAA 1NE7A 5EWMA 2CXNA 3OQIB 3QPWA 1B26A 1P6QA 1N0HA 3MMNA 4QUHA 3RF6A 4F2GA 1DNPA 4ZXFA 1XKXA 4CQMD 3V8RA 5IBRA 1NDHA 5F64A 1VG9B 3CWCA 4MO2A 3T0GA 4F3RA 3FZGA 4LCBA 1HYEA 1Z3IX 2OWDA 2B7LA 3LW7A 3O9MA 3TRFA 4CMGA 5LYJB 2OZKA 4GU5A 2QVGA 1EFUA 3EVGA 4FOOA 4RV9A 4U7JA 5EHIA 5I8WA 3EEBA 5KYYB 1F2TA 3SKVA 4HAXA 1OV4A 2PZJA 1PDVA 2Q1TA 2X14A 3PRHA 1U2ZA 2Q5CA 3WGZA 3U44A 4R2HA 2ZJ1A 1YSCA 3AJ9A 2W6JD 3KG2A 4KLNA 3VR4A 5J1SB 1QIHA 1ORIA 2GQ0A 1F6WA 2VRCA 4QUBA 4WD3A 3X1MA 2RJNA 1KI4A 3BE8A 3HM9A 1M0EA 2FZ4A 2B98A 1NUAA 3H9CA 4RV5A 3SF8B 4V1CB 3A6JA 3MAGA 1U0HC 3QKTA 3B1VA 4LDZA 3ORHA 3L92A 4GMHA 4Z53A 6CHYA 1QWSA 1GN8A 2BBWA 1TF5A 1XCLA 5DB4A 1DAOA 1Z6YA 4AO6A 1Y8ZA 3ND5A 3WGNA 3KKQA 4TTJA 2B4QA 3U4QA 2B3TA 2XOXA 3Q15C 5CDUA 1FYWA 2CMKA 3V9PA 4LXTA 4MS3A 1A8QA 3V1MA 2ETXA 4KN6A 4EO4A 2QRLA 1AM4D 1DQNA 3I9NA 3W90A 2YUTA 3PVSA 3R0VA 5CVVA 4TXNA 1PUXA 4IIYA 4E88A 1V9LA 2WABA 5GIPE 1X86B 4F4DA 1KSFX 1PX0A 2R48A 3AG5A 3MS7A 3SHWA 3HABA 4DSAA 1QE5A 5KNBA 1JEYA 3VH3A 3DO6A 3UQZA 4H0NA 4DMRA 1KJIA 5JS6A 4HDNA 2ANCA 4JLUA 2GA9A 1ISRA 1UQUA 2ZS8A 3HBMA 4E5MA 5KX5A 4WCFC 1KDTA 3UPUA 1Y48E 1MB4A 2QN1A 5AQEA 3D7SA 3PPXA 5G0TA 1QHSA 2V97A 1QHHA 3BRSA 5TT1A 1OF1A 3CYFA 5IT0A 3K31A 1F0NA 4RY2A 2XDAA 3LBAA 1O6BA 3OTWA 4GPZA 1PEAA 3GDOA 4JNCA 3ETEA 2O8FA 3NETA 3CNBA 5ALJA 4QL3A 3FN4A 3ZDFA 3PA6A 3MZ0A 1K06A 3NFRA 5DGCA 4E09A 1B3RA 1T4MA 1Y8QA 3FPEA 3TKLA 3WMEA 5CB4A 5IXSA 4NQZA 4URXR 1D6NA 2ZRCA 5AM4A 3K0SA 2IHZA 1FVXA 1RZRD 4AUKA 4DT1B 3CKYA 4KK3A 2GCIA 2ZYUX 2F9MA 3ODGA 3QQ5A 3PHGA 4FZRA 3GGCA 5EP4A 3ZK8A 2JLYA 1P0PA 2NUPB 2R6ZA 2Z5FA 5CA1A 1GFWA 2REXB 3KL2A 4IEEA 2PUEA 4MX8A 5JXHA 2R96A 2G08A 3A2MA 4C7KA 1EK6A 2A0YA 5BNZA 3E3AA 3ZD9A 4OQ4A 1DAMA 3E1KA 2WLSA 4V0SA 4TKVB 4QZVA 3FB1A 1MH1A 2I6XA 3MWFA 1U1CA 4UOQA 3EIQA 1J6UA 1NG1A 2TRSB 1PYDA 1RYFA 1HFEL 3QPDA 3QVGB 4E2XA 2R8PA 5D6OA 5GGXA 1F0YA 5I51A 1WNTA 3C3XA 4N6GA 3CX3A 1CRLA 4KHZA 4L73A 4WINA 1XP8A 2CXXA 1W6UA 4YT8A 2W2TA 3P2EA 4DVGA 1X7ZA 2QF7A 5BT8A 4X1YA 6LDHA 5F2NA 5K0BA 2YVQA 3KJXA 1JGTA 3X44A 1ZNXA 1ZITA 4FNMA 4WESB 2WWIA 4C4YA 3AVUA 5P8WA 1OE0A 3ROTA 3N53A 5JLAA 3D3EA 4XKJA 1QYVA 2KM1A 1GZ4A 1U04A 2HDHA 1XSEA 3AJAA 3GPCA 1KJ8A 1Q7CA 4ZVQA 1GFSA 3BPSA 1SVMA 4I81A 2XT9A 2GXUA 1G7CA 1HXHA 4DJFC 1S3GA 2I22A 2PPVA 4N39A 3KOXA 4C0LA 1LSOA 1TM2A 1ZQ9A 1EVQA 3DONA 1GPNA 4HWKA 4E5PA 3WLTA 3RG2A 5JUWA 2WKWA 4OG2A 1IJBA 4PC2A 3ND9A 4QREA 4Y2YA 4J1TC 4HTFA 1GOTA 1ZSVA 5IH3A 3H6GA 4KR6A 1BE6A 1S7GA 5HKLA 3ADDA 3OF5A 1L3BA 1MXHA 3X43A 3ANTA 2W90A 1WM1A 5EP1A 5GM2A 3QRWA 2PU5A 3B5JA 4FMDF 5DO9A 3FPBA 1ZR2A 2FXIA 5L45A 2IVFA 1A8SA 5IFLA 3H16A 1I3LA 1LBTA 4RK7A 3SYMA 1TU3A 2JI6A 5B1DA 2V9PA 2X22A 4QX6A 3U7RA 3VSAA 2VTBB 2BONA 3G5LA 1L5HA 4D6PA 4US2R 3IMCA 3CX8A 4R98A 4D0RA 2I6SA 3VOSA 1DUIA 2KX7A 2V45A 3WO0A 2G1UA 5F23A 3GEPA 4L9RA 3L7AA 1UMCB 3NHUA 2ZAGA 4MR8B 5D2CA 3RS7A 3IHLA 3RS0A 2UUBB 2Z3ZA 3FYDA 1K8XB 3R09A 4RYLA 1NMYA 1Z08A 1FRZA 1Y5MA 1Z4JA 2XT0A 5CD1A 5T6MA 4WBSA 3TNJA 3B3QA 3TZEA 4MCHA 1V71A 3QU4A 4KIGA 3U4CA 2F1OA 4BBJA 4DC0A 2B20A 3MJFA 1UADA 1RM4A 3F90A 3OJXA 3RTDA 2B0CA 3VBEA 3MFQA 4FYKA 3V46A 4UM9B 3GROA 4NRDA 5ED4A 2PRZA 1L5VA 3F4KA 4TTSA 1SCQA 3ZDAA 4GPIB 4D6XA 5JARA 2XRYA 4D43A 2JBWA 4DJDC 1Q91A 3EPRA 5F2KA 1LVGA 1VL1A 3IUEA 5TSDA 4WIAA 2RI6A 1CEXA 4YVFA 3RIEA 2H2IA 1W29A 5FTLA 4KNWA 2P2DA 3JZFA 1I3OA 4PRLA 4NK5A 3DZBA 3TRKA 5H82A 3SQDA 3ERCA 1GPYA 1KS9A 3S2UA 2J3HA 1JFFA 5G53C 1HT2E 1VHLA 4FYJA 4XI9A 1JFLA 3HXKA 5LZ2A 1D9XA 2AF3C 1QZZA 1OPRA 4XEUA 3UB3A 1PT5A 4BV2A 4LHXA 2QIPA 1UPAA 2VAWA 5K45A 2EW2A 3LNTA 1BU8A 4CVNA 5F7XA 3U61B 1MO2A 5LD2B 1GZDA 1PK7A 3CH5A 1E62A 3PC3A 3IKMB 2RH9B 3EE6A 3GFQA 5IKOA 3MJDA 1D6SA 4HGQA 2DFLA 4YP7A 4J0IA 4RZIA 1KIAA 2B2CA 3BJZA 5JIBA 1T4CB 3QKIA 2R8ZA 2BBOA 1HLPA 1ONOA 2Y1EA 1N2XA 2WOOA 4ZDWA 2D5CA 1DRWA 2W37A 2ZATA 1PFGA 3HZRA 5LB2A 1I1HA 2O2GA 4QYXA 3PI7A 1KIMA 4RCVA 4JVLA 2RH8A 3QTBA 5TGDA 1E92A 1NW6A 1QFJA 2BEJA 3SS8A 3FOAA 5FOVA 4HD8A 4LHSA 3HP4A 4E07A 1CZKA 1B8VA 1D6JA 3KP1A 2C7RA 2BISA 2I78A 2YY7A 5LLTA 5AI5A 3BDVA 4AJHA 1THMA 1M0TA 3GFPA 2DEUA 3GFSA 3OJCA 1GQ2A 1SOWA 4B3GA 1E9BA 3LP6A 2ZRAA 1Q6ZA 1WSAA 2ZJ5A 2YUIA 3NHZA 3F5DA 4RADA 3FUWA 2CLSA 3IXQA 5H5JA 3ZHBA 1P1IA 2JA1A 1U0RA 1AGYA 4KQWA 4NMLA 4HNGA 2QN9A 4BCDA 1Y6FA 4JJ7A 4LE0A 3G2IA 3NHPA 4CEJB 1WR8A 3ROKA 1TT7A 2HX1A 1ZP6A 2XA1A 1NBWB 1XDDA 2R6HA 4KITB 1QF9A 1RJ9B 1GG8A 4ZCRA 3IR6A 3V8NA 4UM8B 1C8KA 3LE8A 3S70A 1FPMA 1ZA2A 3JALB 1E5DA 4XWKA 4XM1A 4N12A 4OAPA 2O0MA 3P2YA 4D80A 3EXFB 7REQA 2JH8A 4ZJPA 4KBYA 4M87A 1W8DA 4CKCA 1I4LD 1WCXA 2L2QA 4MW7A 1BOFA 4CQLA 2N3ZA 2QUAA 1HSOA 1E77A 2Y1GA 3NEYA 1H1DA 1K3TA 1VL2A 4YP6A 3A9VA 3RYIB 1N5MA 3PJFA 4YRFA 4E3ZA 4EYOA 1QQAA 4GBED 3NWJA 3KXPA 4KREA 5TARA 1SFRA 3UK6A 1IG0A 3URKA 2C7QA 5DWVA 4YLYA 3V4LA 2F8LA 1RLJA 1RYEA 1YCDA 1EE1A 2V7GA 4LRWA 1O4VA 4LV8B 3IPAA 5LB4A 3A1DA 1P2GA 3N6RA 2C3YA 4PSDA 3KLPX 3T5DA 3AM1A 3M49A 4I2VA 2CV2A 4PR0A 3OA0A 4C7BA 3K72B 2FMFA 2NADA 3JR3A 3LBHA 2I4IA 2AJBA 3Q5EA 1FVFA 1Y81A 3RVDA 4EHFA 5C1OA 2Q3BA 1GM5A 1EUQA 3IPYA 3OO1A 2HHHB 2G1JA 1N6RA 4O1HA 5TQVA 5EIBC 1CX9B 4C3VA 3M6IA 4QYIA 3I5MA 4K1LA 3IT0A 4Q3DA 4TYPA 1D4ZA 2ZU0C 4PANA 2H5EA 3IYLW 1TF7A 3EDCA 1MO6A 1UT6A 2C7GA 3IQEA 4OYLA 3WKDA 2QTZA 4N65A 1N2EA 4DNPA 3NEPX 4ZYLA 2QS9A 3DD1A 4J0DA 3IBGA 4HAOA 4JBIA 4MQ4A 2GJ4A 2VHEA 4JP1A 4O6VA 5FHQA 1HE8B 2XAAA 4DKJA 1LPMA 1SXGA 2B6HA 1UKBA 2OG2A 4Z2YA 3RRFA 1HURA 4PC3A 1P2SA 1SCUA 3M82A 4DCUA 1JL3A 1LB1B 3GLUA 1ORDA 4N3NA 4QEZA 1P62B 4PZAA 5TPZA 1QAMA 2J32A 5KDOA 2PUAA 1DFIA 5DX1A 3KEFA 2ZRKA 1DE0A 4FMCB 2VHTA 5ER9A 2QV0A 1W8IA 2O6HA 4P1ZA 1HF3A 2GPBA 3T7SA 5HZMA 5FWDA 5JMTA 3E5RA 1VFNA 5H70A 1R88A 3GLRA 3IVXA 4HMPA 4NCXA 4RTPA 1JQLB 4D9BA 2NZWA 1U7PA 4U6QA 2ZYGA 4CF5A 1MP0A 5HMLA 2NZJA 3RPEA 3R23A 1CUWA 1H85A 1J2UA 5AVQA 1H2RS 1YZTA 1UIMA 1NULA 2Y0CA 1WPRA 2I6GA 2OHXA 3IOYA 3QELA 3RC9A 3SZ3A 2FPGB 4BN5A 4XVQA 2J4DA 1HQCA 2PXCA 1CS0B 4IDNA 2MJLA 3REQA 1YOVB 3HKDA 1KPHA 1RTKA 3L7KA 3M4ZA 5ALWA 2FSHA 5EPOA 2VUSA 1EAMA 1CIPA 2WZQA 4LZLA 3T1TA 1QK3A 1U6KA 3IUMA 2C8LA 2I2XB 4ZU6X 3ZZMA 4KFSA 4EY7A 4DR5B 2R8RA 4BEVA 2QE7D 4OFBA 2OD9A 4BBAA 4BOYA 1G5PA 1Z2DA 1E6EA 4KO3S 1XRRA 1T3GA 2FPIA 1TW3A 4QASA 2J9GA 4MVYA 2AWOA 1JLRA 4XOUA 1GTG1 3OPVA 4LXQA 2Z8YM 3O93A 4HAYA 5CMLA 1T8SA 2VATA 1AQUA 3QA9A 1ZX1A 3I3OA 4KKXB 4ZQBA 5FOTA 1NJ1A 1G2OA 2C2XA 1Z68A 2B92A 2GNAA 3QTTA 1FTGA 5T8KC 4E08A 5IDWA 3THOA 3NI2A 3H5IA 4Y2RA 3T7TA 3GRFA 4WXMA 1LH0A 4KW7A 3K8ZA 5EIHA 4I4CA 3A6KA 4B1FA 1IK4A 4MP3A 4IKOA 3U1BA 3W6UA 5JSKA 4JJFA 2XF2A 3ZD6A 1R0WA 4IHJF 2ET6A 3NOOA 4KE6A 3RHTA 4AMBA 3UO8B 4BFUA 1C4OA 3KBBA 1V95A 2B4KA 1AMOA 2IYOA 1M2KA 2RHMA 3GQVA 1VMIA 4OJQA 4XJSA 4EG5A 3EUEA 2IXTA 4BB0A 4GZ6A 1SM4A 5MN5A 3EQ6A 1CR4A 2C59A 5CCXA 3SQOA 2PXHA 4OBXA 1XD9A 1UBSB 5LA6A 2JAUA 4DDKA 2ECFA 2WIAA 4YQEA 2CDRA 3HR7A 3ZJVA 1JDSA 2G6BA 2WIDA 1I2CA 1YDHA 2PMBA 4AWBA 4MVXA 3FOFC 3UMCA 4L95C 4LCJA 4ZI3A 1M2EA 1ICEA 1TCAA 1FU7A 1SU7A 3T7JA 4CT0A 3ZJYA 4MRSA 4PHGA 3FIUA 4URFA 1T35A 2NVUA 2Y2VA 4IUDS 3IPCA 1BJKA 4O4IB 3LHIA 3UOAB 1YUNA 1JEQB 3LWZA 3OHSX 3SC2A 3N2LA 2Q6OA 4A1OA 1ESMA 1Q20A 1BHO1 4QJBA 3ADCA 4ITUA 2IGTA 4ZOQI 1RMYA 4C21A 2R1TA 4RFSB 3T9EA 5DRYA 1T36A 1E8MA 1HYGA 3JAKB 2ZB2A 4NEHB 5F7ZA 5FB3A 4DWWA 4PYJA 3VA7A 5IJ9B 1JHUA 1LI5A 1RQXA 3FBTA 3TR6A 3QPUA 5JEEA 4TYNA 5DCWA 4B8WA 2PGXA 2HGSA 1XZMA 3DOUA 4EIWA 1K3UB 1F6DA 2MINA 1BH2A 2EG5A 2ONKA 3QKRB 4G01B 3GO4A 5FQOA 4EUFA 1BYIA 5JXJA 3HL0A 3OUZA 5HFAA 3H4MA 4F6LA 4HDCA 5IJ0A 1PNQA 4LZOA 1L5GB 4ZCQA 1E18A 1ODCA 2C54A 1B8OA 1YE8A 3D5EA 1WMDA 2D54A 3EWNA 4H1TA 4IKEA 2GM9A 3D8UA 5HWSA 1JTVA 3R4CA 3I9LA 4FXPA 2P40A 3W8NA 3QLVA 3R0ZA 3B9RA 1Q14A 3CX4A 2ZK7A 3R24A 4P93A 3KZNA 4MHTA 3BB1A 3L9WA 3RIYA 2JHCA 3CZ9A 5TQ2B 4DLXA 1NM5C 13PKA 5SYNA 2HHJA 3WK4A 2H9IA 1BG6A 2VBCA 4WUTA 1CRQA 4FFWA 3LD9A 1W1IA 2O2IA 2V96A 3KJIA 2BGNA 3SP1A 1KEEB 3S99A 3NHFA 4W99A 2ZDHA 3S8EA 3AUSA 3W8RA 3U3OA 2BZ0A 5BSRA 4RVCA 3E23A 4IJ5A 2VJAA 4LRSB 1JG1A 4QYSA 1Q77A 2Y1DA 5DF1A 5GP1A 1Y7LA 2JKZA 7ABPA 2CL6X 3R6LA 3P27A 1MPXA 1QYIA 4FHZA 2XTAA 3A1WA 3DAPA 3WG9A 3ZXSA 1PJAA 5K8IA 2D1FA 2RD2A 2E85A 2RHGB 3DAHA 1NXVA 3F6PA 4BC0A 4AQYB 1Y4SA 3QNMA 4RTNA 4F96A 4M0DA 2HMYB 4UNQA 2EFHB 1NJ8A 2OECA 1IY1A 3AG6A 3EY9A 2BFEA 2WYVA 3H1AA 1T3LA 1XK7A 5JAPA 4JJIA 4RKFA 1CU1A 5IMBA 4LXXA 4TL9A 3CJQA 1UZUA 5H3LA 4MKFA 3ZLTA 4U0JA 2IV2X 4JGIA 4MUNA 1PJCA 2HZ7A 4NYIR 2SCUA 3WICA 4O25A 5TF0A 4CFSA 5LSAA 1AQJA 3F1KA 1DIGA 1G55A 3S4YA 4H6WA 1DRUA 1DWUA 1T1SA 1G0OA 3S44A 3Q3CA 4Q15A 3T99A 5A9TA 2H9YA 4EG8A 1DC7A 4Z9YA 1HDEA 3VM6A 5KIAA 3VZBA 5K6RA 3QSYA 5EPEA 1J49A 4GR9A 4R8LA 1VJGA 1XTVA 5G4LA 3W1EA 5DU2A 3ZI7A 3ZU4A 4BNLA 4FDAA 5K99A 3KHSA 1NW4A 1PSZA 2ZQZA 5THKA 5KC9A 1AO0A 2IBTA 3V5NA 1U3WA 1HMPA 4RQBA 3L40A 1NSTA 2IIQA 1NDQA 1A5SB 2C97A 1O03A 3NQ41 1IHOA 2XTNA 3CRNA 4KQXA 4MQEB 3T9BA 2P9HA 3WMWA 1R8XA 2FSUA 3BHMA 5I4KA 1LCIA 3IP1A 2ZBVA 1UKYA 4ME6A 8GPBA 5AKYA 3D7RA 1G3RA 3F46A 2IPMA 5ALVA 1HLFA 2IW1A 5LVAA 2HC9A 2FUNB 2MSCB 2HT1A 4PGGA 4RQUA 2V0CA 2AH5A 3O8RA 3C8DA 3ZV5A 4MV0A 4YV1A 4EVIA 1KZ4A 2EL7A 1GVNB 5ALYA 5CK4A 3HDTA 5J59A 3TG8A 3O8QA 4Q37A 1DAKA 1MKYA 1XTKA 4GT1A 3A2LA 5F4BA 5JQGB 4B40A 4MNTA 5AD1A 2XT6A 4Y9RA 3SJCA 3GLIB 2QN6A 1CUBA 2DHCA 3P94A 3PUVA 4G25A 1P80A 2RG1A 3PGMA 4JQOA 4RQTA 3K35A 1FRNA 1W5FA 3KX2A 1FFXB 1YA8A 5ICFA 3E84A 3BHJA 5BSKA 2P5SA 4D8WA 4JKIA 2QR5A 3VPSA 2YFQA 1LS6A 4XIYA 1N9ZA 2IY8A 3U37A 5IHPA 4JSRA 2Y4OA 4LWPA 3DZFA 2P4HX 4XVHA 5HUHA 4YV2A 1E2FA 1JR6A 4EK9A 1ADCA 1MV5A 3S2ZA 221PA 2WSMA 3DXZA 4LNAA 4BNUA 3Q3EA 1R8SA 2N46A 5G4KB 5GOZA 3QHQA 3FOZA 3UN1A 1SZCA 3UXEA 3I8XA 2DKNA 2LCIA 1ULBA 1QK5A 1Z26A 4Q7EA 1TM3E 4H4EA 5JANA 3K1JA 4ZWNA 1FK8A 4EGCB 2BBSA 3WIDA 1W4RA 3L02A 3WNZA 4RSGA 1NUQA 2IOFA 4GKBA 1W5TA 2OBBA 3IJEB 4IHKA 1MFZA 4MRNA 5IVPA 3PFFA 3MMXA 1DS6A 2EKBA 4HDMA 3WZLA 3MSCA 4XW2A 3VZCA 3RFCA 4UZSA 3NM6B 1RI5A 3PXCX 1SZJG 1AKQA 1GCAA 1JB1A 1NJ6A 4DCPA 1R4MB 3E3MA 3T1NA 4Z5XA 1V45E 1A9TA 2XGSA 2KMLA 2C1XA 2NW6A 2ZRFA 1NC3A 4UPEA 1G64A 3PX7A 1DC6A 1JR3E 2XNKA 1IG3A 1QDEA 1JJIA 2OC9A 3OPYB 3JQFA 4ZT6A 1TLTA 1VPLA 1UWLA 2AC2A 3HLYA 4FYHA 3WDMA 3JWGA 1T8YA 5ALUA 5E38A 1CNFA 4UW9A 2P1DA 3BZWA 3R76A 1R0KA 4H7PA 2HIAA 4D81A 2YY6A 4UM7A 4EEZA 2B2NA 1QONA 2GB4A 1UDXA 3GJ7A 2AW5A 4EQ6A 2J3EA 1YQEA 3L7LA 1RQRA 3TBHA 5FTJA 1I0ZA 1ZGAA 2GILA 2PRIA 3AFHA 4Q66C 5FPKA 5M29A 2D4AA 4JOCA 5JYEA 2HJSA 4X1IB 3IAM1 1Z7BA 4J7AA 5CHEA 1N7HA 5IVHA 1QGYA 3UK0A 4BKRA 4V0MA 2A58A 3HY3A 5EUCA 4DB4A 3H87A 3IA2A 1L4YA 2IDZA 4D26A 3WDLA 1GITA 2HKIA 4AZVA 2OK8A 3T95A 4BEWA 3M3HA 4BE9A 2JZOA 4PNZA 4TKLA 3UHOA 1ORRA 5C8YA 1F5NA 4HQ6A 4IWXA 3E5HA 4GRDA 3MLAA 3W5HA 1GEGA 2Q41A 3QX8A 2H2FA 4NYMQ 1OWLA 4GI7A 4NU8X 3WKBA 4D46A 2ORYA 1FUKA 4EUHA 3CB2A 3HMKA 4HGPA 3STUA 3TXXA 3LQ1A 3A9SA 1CQJA 3O4FA 3Q87B 5FQNA 2J0VA 2BZSA 5JRDS 4J1SA 3TINA 3E1GA 1WG8A 1YIDA 3QVOA 1RWNA 1ZGHA 2C8VA 3VHQA 4KODA 3LHDA 1E2NA 3OCVA 1KJNA 2C95A 5HPYB 1SR8A 2FF7A 1LDGA 3KAQA 2XCLA 4O0LA 2VWHA 3E9NA 4EW1A 2JCBA 2GKSA 2V03A 2JIOA 4ZZ0A 5KMGB 3TTWA 4BQPA 3DHEA 4CF3A 3JQ9C 3OC6A 1EUYA 3LUCA 4U2DA 3ASYA 4M8IA 3TCNA 2PZEA 4NCAA 2AFIB 3PK0A 2IYYA 3R5KA 4NP6A 4M1EA 2D2FA 4WK6A 1ZI8A 3O6VA 3STHA 2NO4A 2V7QA 3VJRA 2HRZA 3PEYA 4RZ3A 2Q1UA 3CLSC 3GJSA 2AZMA 2DHRA 4P4LA 4XPIB 2ZYTX 4D79A 1VMKA 4M7OA 1KMMA 2JNWA 4A9AA 4CM7A 4PRZA 1GXSB 4QU9A 3CUSA 4B44A 1FJXA 4D0LB 5TF4A 4R3WA 5KO2A 3E8SA 3MWGA 2H63A 4O3FA 3T7AA 1HQDA 2WUFA 1QG6A 5CRIA 3S2SA 5BOSA 1JHRA 4Q3KA 4FLFA 3WYNA 1TKCA 1ZOSA 1JLKA 1NP7A 2R6R1 1AS2A 2XTMA 3BYZA 3G3EA 2XXAB 2A9RA 3I32A 4HL6A 1NG9A 4PZDA 1UOQA 2DBQA 5CFRA 2D00A 5AXDA 1Z8FA 2Y1CA 1F51E 3DZCA 3SIXA 4EUNA 1DV2A 1NI3A 2EJVA 1WMEA 2QBYB 1TZJA 2H5LA 2PBRA 3WNVA 1TA4A 2B3DA 1A50B 1RQ2A 1D4FA 1OWNA 4PN3A 1ID1A 5CM9C 4NI5A 3F6BX 5KVVA 1DHTA 2PX2A 1T3ZA 5BUZA 3F71A 1RD4A 4UCWA 3RVOA 1QQ6A 3ENZA 1BD3A 5BN3A 2NAPA 1PYGA 2GYYA 2KE5A 3CZQA 3ZHUA 3LOQA 2O8BA 3RRNA 3P45A 1ZGJA 5CVCA 2WU4A 2NVWA 4YDRA 2PJUA 4B6PA 3ORQA 5HA5A 3HUDA 4RS3A 1RXYA 3L1KA 4TWZA 2L18A 2TMGA 5C3MA 3R9XA 3QUCA 3UNXA 3W4JA 4PC1A 1PNOA 3DE5X 3SYTA 3PQ4A 3WK5A 2VQ6A 4AZ3A 3DFKA 4BVAA 3PP8A 1XRPA 2F3PA 2NTVA 2DXIA 3K2BA 2CY0A 4HH0A 1LY1A 2BHLA 4B3IA 3O8NA 2MHCA 4DYDA 3FSEA 5DE3A 2B61A 1PZFA 2VCEA 2P0EA 4QO7A 4EG7A 3JPWA 4AKHA 3E4DA 2DT5A 3T7DA 4R2XA 1JS1X 2HO5A 5CB4F 1HK7A 3FZQA 2X0IA 5AK0A 5B3JC 4HDRB 4JLBA 2NTJA 1EG7A 1WXXA 2R85A 3G85A 1N6KA 1A3CA 3ENVA 4TSRA 1Q7RA 3PJGA 1G8PA 1GA1A 4F12A 3I45A 4I46A 1G9SA 3SHVA 4Z7OB 5IULC 5IWCA 2ATEA 4ZYWA 5A7GA 2JCSA 1E2QA 1FS5A 4RHXA 3Q5GA 3QX3A 1QU2A 1JR4A 1EK5A 2AI1A 2LBPA 2DY1A 3JQ7B 4L5BA 4LDJA 3MXTA 4P3KA 3R77A 4MVWA 1ZCZA 1VL5A 1YL7A 3FPJA 2NU8B 3UG6A 2C5HA 2G07A 4JXXA 4OQZA 1KP3A 2GD1O 2FVYA 4MYCA 4KNVA 4BO1A 4PSAA 1M66A 1T2DA 4JA2A 3A9WA 3JD3A 3LPMA 4B6QA 1KOLA 4B3MB 3V1LA 1JSLA 1P5ZB 2RBGA 1GCIA 3T7IA 2VK2A 1P33A 4M0LA 4ZO6A 2J46A 4BFTA 1SXJA 5T6BA 1UBGA 4RF4A 5JR3A 3RYTC 4X5OA 1H93A 2OOKA 1IHXA 2V6BA 3DZHA 5DP1A 3V7WA 2MIIA 3QK7A 2P9CA 3VO9A 2OLKA 2QD5A 4FCVA 4BRSA 1CEEA 2HU8A 1XP5A 3GT3A 4BJ3A 4ZOLB 2NIPA 2CWWA 3FHJA 5DT9A 3U9SA 4UAUA 5DXJA 3GRZA 4D96A 1XMSA 4YI3A 1ZIYA 3UVEA 1WB6A 4MUKA 4G0WA 2C2WA 1KYWA 3ZCQA 3GJTA 1KVTA 3K09C 1O3YA 2G17A 4J7UA 2Q45A 4P3PA 1W4LA 5J5VA 4YCLA 3VZRA 1EVKA 1O58A 1FU4A 1XLTA 3O84A 2W83A 1T26A 4QJ3A 1A96A 2XW6A 3R9WA 1L4GA 1Y42X 4K6KA 4KBFA 1JG4A 4TN5A 4PTLA 1R5JA 3IVRA 4WLEA 2F43A 4IDBA 2R0QC 3HG7A 3L8HA 1C3VA 3T06B 4OREX 4OSPA 5HF5A 2MR6A 2R1VA 3ZHQA 5K0GA 1KOGA 5AW4A 2IYXA 2Z9CA 3HEAA 1BCSA 4OI1A 1JVBA 3FUVA 1DLJA 4FQ5A 4DG8A 4FYYA 4QGSA 4C0QC 1YDFA 3K1AA 3W4IA 10MHA 4ER3A 1VB5A 2GZ1A 2PYIA 3EZ7A 3ASUA 3AGPA 3DCJA 1AQIA 4F5DA 1PDWA 2J3DA 5BNIA 4J0FA 2AEFA 4V2UA 1FFAA 2XCIA 1NXXA 5CW1A 3GJZA 4NNOA 1UKEA 4Y6QA 5BQPA 3TLCA 4ZGGA 1O8BA 2YR0A 1EJ2A 1I5RA 4DANA 2JCXA 4ML3A 2JFVA 1MG0A 2UYOA 4ZO7A 5LNK1 1N77A 1QU3A 3RVLA 4RDHA 4CM5A 1NQWA 1GGJA 3R8FA 4G1VA 2ZWAA 3ZDBA 1YT5A 5EWJA 3CB4A 4P8RA 5CDFA 4ANFA 4RJLA 1KY3A 2A67A 2XHZA 3HWSA 4G5QA 3S7ZA 1XHLA 3PC6A 5EVCA 5KSPA 4YN3A 2C0CA 5A4IS 1UL1X 5CDYA 3K1YA 3OZIA 3UMVA 1ZSYA 3VDQA 2QN8A 3ZWCA 3UC9A 3LXUX 3PNVA 2BEKA 2WZBA 3NYRA 3AR4A 4N5IX 4OPMA 4ZVUA 3NTRA 5FTNA 2FHPA 3J81A 1PVVA 4DA7A 3A25A 2DWPA 1V5FA 2H31A 2FEOA 4OP2A 2M6SA 3TNYA 1DV1A 1UEXC 2Q4OA 1VG8A 2W6JA 3H9JA 4PPNA 2WTMA 2GSDA 3FNHA 5KDDA 2NV2B 1PTJA 3CY6A 1HZJA 3KUCA 3UJ3X 2W6NA 3C7KA 1BDHA 3I5AA 1TYEB 1YZGA 4NV3A 3RSHA 1GTJ1 2VDUE 3S27A 2C8KA 1MVLA 3HUUA 3MT9A 1EWYA 4O2AA 5DPMA 1EZ1A 3IMEA 4MKRA 1WLYA 3GWZA 3STWA 1ZH6A 2GXSA 1GYRA 3H0CA 3MD9A 1RLUA 1CQWA 2H4YA 3EXAA 3A31A 3PNSA 4QXQA 2J0SA 2I87A 3PXBA 1I13A 4V0OA 4IOJA 1ODTC 4BO0A 3EVCA 2VPYA 3LQQA 4LHYA 5TT0A 1F9AA 1S9DA 3D6VA 3PF9A 1XMIA 4OVKA 4P7FA 2V54A 4U7PB 4X71A 5E1BA 5E1DA 4II7A 2GMWA 1KK0A 2GBPA 2IYNA 3RFUA 5HS4A 1OZAA 2JC3A 4A26A 4J1QA 4XQ9A 2PGAA 1RHQA 2ATCA 3P5BA 5DTMA 4G9EA 5CFZA 3RGWS 4A92A 3D0QA 4OMCA 5ABPA 1RIIA 4L8LA 4KDEA 3KZMA 1CB7A 2LPMA 3AY0A 2GASA 1NGSA 2GTIA 4Q03A 4BMDA 3TZQA 2PZKA 3WFZA 3EVTA 1OI7A 1SB9A 3T7EA 1U0LA 3COYA 3ECAA 4YRBA 4P22A 3K5PA 3LRPA 1NLUA 3G9QA 4A16A 3RRZA 4RJKA 121PA 4H7HA 5TV2A 2ONZA 2Z8XA 3P2JA 4QOJA 4QUJA 4NZZA 1RHJA 1P5RA 1NVBA 4KXQA 2G1AA 4WHMA 2H18A 4TL8A 4ZIRA 3CUVA 3L41A 5CURA 2FSVC 4ZYYA 1AJEA 3G5UA 5FLKA 3AY3A 4ZGBA 3DOFA 1ZK3A 4YIKA 4QBKA 4XR4A 5FXMA 1Y4UA 4Q7MB 5K0CA 1N3IA 1UKVY 1N1DA 4P3XA 5BPHA 4A0HA 3DZGA 4F45A 3DFUA 4YP5A 4HHEA 1ZY2A 3SOOA 1UBFA 2RI0A 4G8JA 4IW3B 4B83A 3A3PA 2ZDQA 4UBKA 1PQWA 4HP8A 4PLTA 4INZA 1SVOA 1E2HA 3RBAA 4D5EA 5CIYA 5UKDA 2YICA 5D3QA 4YR9A 1GUZA 2GD2A 3EQ7A 5KWJA 4UUPA 1R6XA 1QFYA 4BNIA 1IU9A 3RK1A 1F0KA 1P2DA 3RAPR 3ACDA 4NPHA 1YDMA 1KR5A 1OVGA 1YD7A 2K4MA 4DDWA 4B3TB 2IYPA 5BV7A 2C1EA 1J23A 3TD2A 2JLWA 3GD7A 3UK1A 2BKAA 1C4KA 3HTXA 3UWDA 4UMEA 3PIDA 1W1UA 2D2VA 4YAEA 4AS2A 3RLFA 3ICQB 2W4QA 2REOA 1E2PA 2VNSA 4RSRA 2JCGA 3CIFA 4B43A 4HVCA 1N2ZA 3U40A 3LBIA 3KAPA 2OHVA 1T2CA 2PEYA 5IDXA 3Q8KA 4O59O 3IEVA 5JXIA 1JXAA 2ISQA 2V7WA 3ESAA 1D2MA 3KNZA 3QVWA 1O4WA 4AIIA 2JEYA 4BJ5A 4RF5A 4XSHA 4MWCA 3WQHA 2CNWA 3VU9B 4A2PA 2BGWA 3EA5A 4J4TA 1KFCB 1V5GA 2DZDA 3DZKA 4MYHA 2ZYSA 4ZQIA 4BMOB 1G21B 1T0HB 5B3KA 2IXDA 1KQOA 4I9HA 2PGNA 1RWKA 2C61A 1CQIA 1C9KA 4TTIA 3HB0A 3I6BA 4QU5A 1PS0A 3KPJA 4PR3A 2FJPA 3ELDA 2LR0A 4IJUA 3OPYA 5H81A 3GAZA 1I14A 1HDXA 1C7QA 4YJDA 4E5YA 5A0VA 1PV1A 3JQRA 3HZOA 2EIHA 3DDHA 3NJ8A 3VXKA 6NULA 3F8SA 2SBTA 3I9V6 4KN5A 3DVLA 1PWYE 4FDUA 1Y7IA 2VHZA 3RFVA 4DLKA 1R4MA 4AB1A 1KI7A 2PZ8A 3LUPA 5CCBA 2Q3EA 4HWPA 1GAXA 1R10A 1CDOA 4QOHA 3AEKB 3QX9A 2LGJA 2XNCA 1J09A 3UANA 4B75A 1IUPA 2E4VA 2DGDA 4HDMB 4X3CA 2A9FA 3RV4A 2GSWA 2WU1A 1IEQA 1ISJA 2BW0A 2RGGA 2RKBA 2JATA 3KE9A 1VHQA 2LE0A 2VXOA 3TOSA 1RQPA 3AEXA 5CBKA 1QH9A 4EJ2A 4C20A 3CJRA 3AW9A 1L4FA 2PRJA 4ZAZA 4CMIA 2VT7A 3GQBA 1MENA 3I8OA 1N57A 3K6KA 1J5EB 1WCYA 3RTAA 4BP3A 4HVAA 4OQPA 2IUUA 4GSKA 1PG5A 3BTVA 4RKYA 2JLRA 1YZLA 5T41A 3WADA 4LA4A 4E31A 4GX2A 1MX3A 5B55A 1QV6A 2F2TA 3EIXA 4ZRDA 3NONA 2IZ5A 3FKSA 4R1OA 3VR4D 5JU6A 4F6CA 4KUGA 1XFDA 2FOIA 2X42A 3FYUB 2A9JA 4L8VA 1E89A 4HDQB 4LECA 4UOEA 2PSJA 4TLBA 2DPYA 1FDTA 1WMBA 2YWBA 5KOJB 2D1RA 5JCJA 2UYHA 3N2ZB 1CJCA 1Y3BE 2E55A 4Y6SA 2RONA 4ZI5A 2XUDA 1R6UA 4QPNA 4G4SO 4XB1A 4YRTA 3FMVA 1LJLA 1NX9A 2VDWA 3A9TA 3VNBA 2YVLA 1IQPA 5ENVA 2PDAA 2VHUA 4P32A 3A1TA 4TUYF 4BPRA 5HJ5A 3QM1A 2I2WA 5KYTA 3VI4B 2C2MA 5K3OA 2NWQA 3LT1A 5AVTA 2E49A 4OX9B 5L8VA 1MEEA 2XMGA 2QTGA 1RYMA 1E96A 2O3UA 4P31A 4XXHA 4BQOA 4F9FA 2XCRB 4P82A 4RTOA 1KDVA 3RVKA 4C88A 3GNQA 1QANA 1R15A 5EA2A 4B4OA 4CF4A 2CE7A 3RSCA 1F4PA 3DEAA 1V1RA 1BXRA 1QM5A 2C42A 3EBPA 4TKUA 3ZTYA 5BSFA 2N1MA