2ZRMA

Msreca datp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
319
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 93
structure length 319
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrmA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrmA01
2NO9A 3ASYA 5DISB 1H8EA 1SVLA 2QAGA 5EP1A 5H70A 2WWYA 1N6IA 1W4AA 2FFAA 4KLNA 4MA4A 3PR1A 1E2GA 1GTVA 3SS8A 1N6PA 4QFMA 5JFGA 4XTRA 5D3MA 2B92A 4EPVA 2D7CA 2W2VA 3RRMA 5KSOA 1B23P 4EAQA 2OFOA 1NKSA 2YWHA 2ZE6A 5UKDA 4Q4HB 4UJ5A 5JJLA 2IS6A 3SBEA 4B2PA 1WRBA 4JL8A 1G64A 3FHCB 1U0JA 3BGWA 4KXFB 3GLIB 1SXJB 1U98A 1E0SA 1KSHA 3AF2A 2BMEA 4RFVA 5L3QA 2G77B 1D2EA 4MGYR 4QGFA 4HAVA 5DHFA 2ASEA 4PHHA 4DKXA 4M1YA 4ASUA 4DDWA 1NL3A 2RGGA 4I1VA 4F38A 2J5XA 5F98A 2GZDA 1W0JA 5HE9A 4GOKA 1RC8A 5DE3A 2RB4A 3B13B 3CNNA 3HU2A 3IUYA 2GEUA 4GNKA 4EPTA 4Q7JB 2AFIE 5AK0A 1Z0DA 1FMLA 3CKLA 3LXRA 5CYOA 1UEJA 2H8KA 5JLJA 1QHHA 1X86B 1OKKD 4WBSA 1US8A 3VHLB 1P9RA 4LPSA 3D3QA 3T5GA 3BFKA 2C03A 4JVMA 2WSSD 2DFTA 1XTQA 3T34A 5L3VA 4MDFA 2GK7A 4HATA 1YKSA 3MCAA 2O8DA 4DDTA 1W4CA 3AVYA 3ZVMA 2F43A 4OK3A 2CE2X 4BECA 3ICEA 5KSPA 1NLZA 2XITA 2ZVPX 3PEWA 4GFDA 1S96A 1NNEA 3PCRB 1ZCAA 2ZR0A 1ZUNB 2ERYA 2QP9X 3LWNA 1LY1A 2QAGC 3LVQE 5EUQB 4BFYA 5KDLA 1W0KA 3AKDA 1RYHA 3X1DA 4NPHA 4Q4AA 3PUXA 4FMCB 3AVXA 4QBGB 3GLIE 1NY6A 1SXJE 2CVHA 3HR8A 2OBNA 2OZEA 2ZJ2A 3CWZA 2CL0X 3Q5EA 4XH9B 1CR4A 2VQSA 1N5IA 1TU3A 1CR1A 1W36D 1XMSA 4G0NA 2P5TB 3VR6A 5GJVC 2GCPA 4BWYA 1IN6A 2I1VB 2KJQA 3FHTA 1IJEA 5DN6A 1MV5A 2ZUBA 2ZE7A 2IA5A 5JSZB 1NN5A 3ZGXA 1IOZA 2CE7A 4JIMA 3VNVA 3CF2A 3QIAA 4KU4A 1Z5ZA 1E79D 3EW9A 3FMFA 2G88A 2YYZA 3NBFA 5JJKA 2G1JA 4GDFA 4M9SA 2ZREA 4JT4A 2XXAA 2QMOA 4B75A 1AKYA 3QEOA 3AVWA 4FMDF 1RE0A 1U8ZA 3RNLA 4AYWA 3CRVA 1ONBA 1Z07A 4GZLA 3B6EA 4G3XA 5AJYA 1TUIA 2IUTA 5DI3A 4DCNA 1WE2A 2HYIC 2RKOA 3GFPA 1BO6A 1IONA 1XEXA 3CUEF 3DL0A 5SZHB 2DWPA 1YZUA 2ZROA 2BMJA 3W34A 2N1BA 3U3KA 5FBRB 1FZQA 3MAAC 1OKKA 4EQ6A 1OV4A 1SZPA 1XJ0A 2YWGA 1D6JA 5C1BA 2GJ8A 5DSZA 3WBKA 2WSSA 4DZZA 1MRSA 1QZXA 2FZ4A 1VKJA 2QM7A 4W5HA 2O8FB 1AZTA 1CBUA 1P62B 2DFKB 4NYIR 2F55A 1Z08A 1GDDA 2ZTSA 3KXKA 1LV7A 4UNSA 1U9IA 1Z0AA 1H8HD 1XRJA 4P33A 1PVOA 2C99A 1T0JB 2OBLA 3OESA 2J41A 2REBA 3IEUA 2P65A 1GG2A 2J0UA 4FCWA 4Q9HA 3L0OA 3WMEA 121PA 3VR3A 1E2NA 4PANA 5AJVB 3L0IB 3TNFA 1W4RA 1E9DA 2FEOA 1TTTA 3WMFA 2IXGA 2FGKA 1R5NA 4GMDA 5FOWA 2NMVA 1JR6A 2MSDB 3IBGA 2ZXUA 1Z0FA 1GFIA 4QGHA 4OJKA 4MKHA 4P4SB 2F3TA 2F7SA 3HDTA 3RANA 2IX3A 5DNYB 3CIOA 1ZAKA 3VU9A 4DCSA 2YOFA 4A92A 3GLFB 2QMUA 4CEJA 1U0HC 2QI9C 4XSHA 2VP0A 1KO1A 2E1RA 4QG7A 1XPOA 2EU8A 2X8AA 2GXUA 1ZMXA 2DHRA 1JI0A 2VSFA 2CLCX 2OBMA 2JIZD 2MSEB 3K53A 4NDZA 4XIGS 5CB6A 1WBBA 1YHNA 1Q1QA 4J0QA 1E69A 3BXZA 4C7OA 3AKYA 1UKVY 2FFHA 5F9FA 1AZSC 1IN5A 4UXIA 3QG5A 5AUPB 3HYRA 2CCJA 4HLDA 1NIPA 1CLUA 1P61B 4I4LA 3CB4A 1S8FA 3Q7PA 4C30A 2D06A 1W5TA 4BZQA 4EDHA 4E22A 3GP8A 2A5GA 3BRWD 4L15A 1W2HA 4HAZA 2OO7A 4BFSA 1E98A 1XTIA 5IHPA 3RRNA 3GLHB 1U9IC 3LV8A 3TBKA 4BFXA 2GAAA 1RRCA 5FR1A 2ZEJA 3WHKA 4B32A 2FE4A 1Z6YA 3U5ZB 4L9WA 1NJGA 1E2DA 3W90A 2J9RA 1ELOA 1WMSA 3HYTA 3AP1A 1DARA 2J59A 3P1JA 4IOKA 5JZVA 1KO4A 1UM8A 3B9QA 2G83A 4EPYA 1UPTA 4B34A 3X2SA 3ZD7A 1U8AA 4PZYA 2BOVA 1H8HA 3CX8A 4AURA 4DT1B 4DCUA 2GJKA 4OK6A 5E3HA 1W36C 3A36A 4GRAA 4CYMA 1XD2A 4Z51A 3GJ4A 1CJUC 2D7DA 3SFZA 2IS1A 3SNHA 4M1SA 3RS3A 4DB4A 4Q1DA 1NVVR 5FTJA 4CW7A 2VP9A 3O47A 4EPWA 1KI2A 2CL6X 1ZCBA 4M1WA 2ZI9A 3RWOA 5KUTA 4TYYA 3TH5A 3GJ5A 1SVSA 4V0LA 3TMKA 3X1YA 1GNQA 1EX7A 2GWHA 1IJFA 1SXJD 4PPQA 3UANA 4LBZA 5E7JA 1F2TA 2VSOA 1G16A 1VG0B 4AYXA 1N6HA 3CX7A 4TTRA 1CJTC 3WBJA 3QKSB 2PEZA 4TMVA 2NG1A 2UVQA 5JMTA 3H0KA 2RMKA 4UNNA 3LXXA 3P26A 4HI0E 3IHLA 5HPYB 2R2AA 1IXRC 3GLHE 1OFUX 1NG1A 3HP1A 4LUCA 3SC3A 5L3SB 2IBMA 2O5VA 2CNWD 2QSZA 3Q5DA 2AL7A 4YLGA 1Q1BA 2EQBA 1VCMA 2FOLA 2RGDA 3THYB 3MJHA 4D0NA 2GCNA 1TPZA 4BFTA 3R8CA 1KZ7B 2JIZA 4QNMA 2IS2A 3EWSA 2W0MA 1PJRA 1AS2A 4PX9A 1QHSA 4KSCA 5JCZA 1PLKA 3KUCA 4LV8B 5HKKD 4B33A 4JT2A 4WOPA 3GJ0A 4B44A 1A5TA 3SHWA 4GZMA 4F4JA 3I62A 1GM5A 5FPYA 3I8XA 4OQFA 1CR0A 3NWJA 5KNCA 3QVVA 3QY0A 3AF0A 3AP3A 3SU8A 2ZQ5A 5P21A 4BFVA 3K0AB 4IFEA 5F9HA 1OHHD 1IAQA 3OIVA 4BLSA 4CRWB 2QT0A 4KYUA 1A4RA 2SHKA 4XVQA 1KI7A 3HU3A 5AJXA 1Z63A 3FMOB 5LB2A 3IIJA 4W5WA 4WXPA 2YWEA 1V5WA 1G291 1R6BX 3C5HA 3JZMA 1P73A 1MOZA 5JWOA 1G17A 1SVKA 3A37A 1Z22A 4JJZA 2KWIA 2CL7X 1ZJ6A 4KVGA 3UMFA 3DOEA 3WHLA 1E2HA 1CTQA 4FMBB 1VG8A 4TMXA 3GPLA 5F2EA 4RZ2A 4S2EA 4DLRA 5HZKA 2BC9A 4MRPA 4ZDKA 1Y63A 2BHRA 2WWHA 3AKCA 5FTKA 1G20E 3K9HA 4G5SA 3ASZA 1BYIA 2QAJA 1L4UA 4KI0A 3MWKA 2IXFA 4RD2A 1CP2A 2BJVA 1T6NA 3ZDQA 4YDSA 3AUXA 2KB0A 2ZPTX 3P4XA 3V4RA 2H92A 2V7QD 3THOA 3BK7A 4XJXA 1DAKA 1JALA 1P75A 1D8TA 3QPVA 4R9UC 4X8OA 4Q4HA 4URXR 3SJZA 4LYHA 2Q3FA 3GLIA 1SXJA 3O8CA 4IOJA 1XMVA 3THXB 3B60A 4HAWA 3M0EA 2JLXA 1S2MA 4TYPA 3NEJA 4M1TA 4H1UA 2NO1A 3WRXC 4B2LA 2IW3A 4Q01A 3GD7A 4ZKEA 4OK5A 3PEYA 3AP2A 3RAPR 2CNWA 1GKYA 4ZI3A 3QXJA 2RGCA 4M8NE 2BMDA 1MR3F 5DYIA 1F3OA 2W2TA 1AJEA 4RZ3A 4UNRA 4LYJA 1NN1A 1Q3HA 4F4IA 4C2TA 1YR9A 3B1VA 5J4HA 2C04A 1TL7C 3KX2A 3QENA 4ZKDA 4MRVA 2BBOA 4LOAA 5K8UA 5HKKA 3FDIA 2WV9A 3JVUA 3H84A 4Q21A 4CT4B 3L43A 1N0VC 2ZRLA 2BM1A 1KO5A 1SKQA 3KJIA 1NIJA 2JEOA 2XOKD 1PUIA 2FPLA 2JLQA 3HPQA 1OHHA 2ZRIA 3ECCA 2GAOA 3TK1A 3P4YA 2WPDD 1AK2A 1VIAA 3TIFA 1CF4A 3LRPA 1RFLA 1S1CA 4CF7A 2FMXA 3A4MA 2IXEA 1KJZA 1JAIA 3BERA 3W3AA 3FPAA 2ZRMA 1FQJA 2BDTA 2PZEA 2XTMA 2WWGA 1UBCA 2K5UA 2VYFA 3KJEA 5AUQA 1EK0A 2AX4A 1WQ1R 3SN6A 2VHCA 4JVLA 4Q1EA 2R65A 2ZJBA 2HXSA 1KO7A 4D0LB 2ECKA 1FL9A 2F1HA 3IQXA 2J0SA 1RRGA 5IK2A 2CK3A 1X8JA 4II7A 4IEIA 4A2WA 5JBQA 1SXJC 4YMWA 3UXMA 1HQYE 3GMTA 3CR7A 3CX6A 3TSWA 5BN4A 4PC1A 3ETLA 2GVDC 1HE8B 1R4AA 1TQDA 3AVPA 1XJCA 5JSZA 1BMFD 2EFGA 2WMNB 2BBWA 621PA 1OSNA 2X1VA 4PZZA 2V7QA 3FHOA 4PZLA 2OILA 3ZZUA 2NPFA 3OZXA 3NHBA 1Q44A 4B47A 3KKPA 1W44A 2EWVA 4BUJA 4D4KA 3DEFA 3KFXA 4TTPA 2AD1A 4AC9A 4BPBA 4DLWA 4LJ8A 2P6RA 2B7CA 2XEXA 2ORIA 1LFDB 4C7OB 4IDNA 1R0ZA 2PMDA 1E2LA 1UKZA 2XTZA 2YWFA 4Q19A 4C4PA 3WRYC 5KSYA 2E87A 2JDID 2JATA 2ZI3A 1P3JA 4OI2A 1CKEA 2H5EA 3KFVA 1JPNA 3VKGA 1DELA 3OEHA 3EC2A 5JECA 4LBYA 4PO9A 2CHQA 1YRAA 1O87A 1Z29A 3CPHA 2C96A 5FPSA 1R10A 4A1FA 4V03A 2JLVA 2QA5A 5FTLA 2VBCA 1NLYA 3PV0A 2F3RA 3UMSA 3QOFA 4Q4JB 4NONA 1OE0A 1E1RA 2Q0HA 2O8FA 1IBRA 2Z4SA 1P6XA 1DAGA 1FX0B 1RYFA 2AWNA 1ZM4A 2XOKA 4PAOA 5CIQA 3AGQA 1DBSA 1E96A 1LNZA 2FPMA 2XSZA 4W7SA 1VDZA 2VHUA 1G7CA 2IWHA 4C0BA 4RD1A 3EA5A 4D80A 1FTSA 4P4UA 2W58A 3KDSE 3VKHA 2VH5R 2WAYA 3NBYC 4WA7A 2HT1A 4POAA 1XNJA 4QNRA 1OXVA 1YZGA 1E0AA 4B71A 4BRWA 2NIPA 3C8UA 3WNCA 5C2JB 3QBVA 1E2MA 3CNLA 4DLVA 3AQ4A 1F2TB 2JA1A 3RHFA 2CLDX 2GJ9A 2X2EA 2ZVQX 3W8NA 2A5DA 3AF3A 1OIXA 3KKQA 1MRNA 4Z1MD 3ZH9B 3NEYA 2I3BA 3ND9A 4O25A 4PQFA 4TT3D 4WZ6A 1BMFA 2L0XA 4N1AA 3KJHA 5KHOC 1NP6A 1R0WA 1UBGA 3ZJYA 3CRQA 5EE3A 5KO2A 2YKGA 4M4SA 5FOTA 1KAOA 3WP0A 1FP6A 4ZV4A 1RRPA 2CJWB 2DY1A 4Q66C 5BQ5A 2WJHA 2CCGA 4K81B 2HT6A 2OFXA 4MH0R 2NGRA 4QBHA 1CJMA 3LVRE 1DTSA 4DBLC 2FSHA 2Z43A 2VP6A 3NXSA 5JEEA 1XPUA 3GJ3A 3LD9A 2PX0A 4JLAA 4KFRA 5FBVB 1C1YA 1CRQA 1GL6A 3TSZA 4X8LA 4U7DA 1WB9A 2JDIA 1KZGB 1AKEA 5AR1A 3GLHA 2C95A 4D81A 2V55B 3FVQA 4BLOA 3Q72A 4AWXA 2J1LA 3K1JA 4KFUA 3F0TA 1GZSA 2JGNA 2VEDA 1W0KD 5FOUA 3UG6A 2BKUA 4LCBA 3HU1A 4URZR 1YRBA 4NCJA 1XXHB 4TLDA 3E2IA 5KDOA 5F3WB 2GCOB 3TUJC 3DKVA 3OIUA 2YC4C 2QG6A 2G6BA 1MKYA 1SGWA 3B1WA 3SOPA 4RJLA 2JAQA 4W9MC 4C0AC 3GFOA 4KFSA 3LY5A 4DT1A 1HA3A 3LDAA 3KQNA 4BFWA 1X1SA 5DLQC 2J45A 2BV3A 4JLPA 4V0NA 2C9OA 5DN6D 4DRZA 2ZRNA 2Z4RA 3PEVA 1R5BA 2VP5A 4LX0A 1KKLA 1PV4A 3T1OA 2G0TA 3C14C 1HYQA 1DOAA 4I1OA 4JS0A 4OI4A 2UKDA 1KSFX 4Q47A 2LWIA 3U2QA 4RKEA 4DSTA 4FIDA 3OEEA 3CRW1 5LB4A 3GLGE 4JKIA 4CDGA 1DG3A 4LV5B 3I5YA 4MYCA 2AR7A 3AVOA 1OFHA 3QKSA 1QHXA 3PUVA 3C5CA 1SULA 1ZD9A 4M0LA 5EXSA 4CEHB 5GVSA 3RVBA 4Z1MA 3QPUA 5CYPA 1WA5A 1R0XA 4RSGA 2YZ2A 4B3FX 4TT3A 2ZRKA 1E32A 2IYTA 2ZYWX 4WVFA 5L3SA 4PHGA 2V6IA 3I1FA 4Q9KA 5TMPA 3THYA 2IF0A 3FMPB 1TQ4A 3EZ7A 3U61B 5BXQC 2PLFA 3W5IA 4JLVA 2EFEB 2EVWX 2YNMA 5KSZA 1XXHE 1A1VA 3CF6R 4TQAA 2P3SA 5H68A 1JQLB 5BYJA 4A8JC 5FUXA 4B3BA 5FTMA 4V0KA 4HB0A 1LS6A 5FH9A 3FGNA 1KI3A 3K0AA 4HUTA 4AG5A 3OF5A 1KY3A 5JJIA 2LCFA 3BWDD 1XEFA 3FMIA 1YR6A 5B2ZA 4OHZA 2VRWA 3H1TA 4KODA 3L8YA 4IXNA 2KBFA 4M21A 2QE7A 2N42A 3E70C 3N2IA 3WNBA 1NVXQ 3KXIA 2O8EB 3D8BA 3I72A 2OG2A 2FU5C 2HJGA 3CM0A 1WBDA 3EZFA 3X1ZA 3ZZTA 2O0JA 1R2QA 2Z0MA 4BEBA 3SYNA 1ZNYA 2MMCA 1VG1A 2V9PA 4FD2A 1E2PA 1J90A 1QHGA 1RIFA 1XCMA 3IGFA 2X2FA 1HUQA 3Q7QA 1E2IA 5GJBA 1U81A 3IEVA 4Q02A 4LGMA 4A0FA 2OT3B 4AD8A 4NHOA 1B0UA 5JEDA 2OCBA 4ZCLA 1X1RA 4AI6A 1GWNA 2WHXA 1DG1G 1LW7A 1OT3A 4FMDB 2FX3A 4YXWA 2CVFA 3C7KA 2D74A 1G7RA 1VYTA 1AGPA 2R9VA 1G21E 4L5BA 1J8YF 1Z0IA 1ZYUA 2QQEA 2HUPA 1GILA 4JLJA 3THXA 1JEEA 1K6MA 2R62A 2HLDD 3MSXA 1NMZA 1EX6A 3NC0C 5G3ZA 4E03A 1R7RA 3KB2A 2ZSFA 1PZNA 3FTQA 3BAFA 1OH8A 1GITA 2XJ9A 4QL3A 1EWQA 4B43A 2ZYTX 1M6NA 3U6KA 1IM2A 4N0EA 1HY3A 3AH8A 3WNDA 2OFWA 4Q7LA 4C0JA 1RZ3A 4Y0AA 1J7KA 1Q3TA 1W5SA 1XFAA 3JVVA 2C98A 3EZ6A 3BB1A 1KI8A 4JYBA 2WJVA 1SHZA 2IYSA 2OV2A 2R6DA 4ACBA 1AA3A 4EFLA 4NL4H 5KYKA 1GNPA 5B57C 1I4LD 2DB3A 3SBDA 4HEJA 1E9BA 1YZNA 5FI1B 3OE7D 5TV2A 4MQBA 4GOJA 2ZRFA 1R5OA 5EE1A 3B78A 4GMXA 1WF3A 2V54A 3LQRA 4S35A 2IYZA 2WOOA 2WICA 1XJQA 1P7CA 4JBYA 3KTAB 1F60A 1XEWX 1P5ZB 4PC6A 1DAIA 4ABYA 3ONWA 1K8RA 2WKPA 2XAUA 3NDBB 1S9HA 3I3SR 4BLQA 2GTPA 2IT1A 4YONB 4NYIQ 1Q22A 3UWOA 1P9WA 4KAXA 2NPIA 4WW0A 2Q3HA 3ZYCA 3SZRA 1RW4A 4KLZA 1LB1B 5C4MA 1TUEA 1N6RA 3OAAD 4QHYA 4R7ZA 5TXGA 2AXPA 4X8MA 5DGXA 3IIMA 3N2EA 4ILEA 4M1OA 1XEWY 3RSOA 4ARZB 4ITRC 5BN3A 4JLDA 3LA6A 4IHQA 1Z2AA 2OAP1 5TB5A 3TRFA 4NYJQ 1W47A 3ZQ6A 1XDBA 2ZETA 4DXAA 3X1XA 3KQLA 2A2ZA 3T61A 4I81A 1G3UA 1SKYE 2VL7A 2CHGA 3CPJB 1TF7A 3LLUA 3P27A 4IDHA 1Z06A 4NYMR 3BH6A 3TR0A 4QM6A 4NCHA 3RS7A 1WCV1 4F92B 3FKQA 2V3CC 1OYWA 1XCPA 4W5JA 2MMGA 4QKQA 1QHIA 2PEYA 1JEDA 4Q00A 1OXTA 4IXMA 1DPFA 1ZW6A 3U6BA 4LC1A 2A78A 2HLDA 2H17A 3ZZ0A 4B73A 5KPJA 5SZJA 421PA 3R9WA 1KI6B 221PA 1JR3E 2IYRA 2JJ1D 2YOGA 2GRJA 3O8RA 2R6AA 2PZFA 2EYUA 2G9NA 1XU4A 1C4OA 2RGAA 4P3YA 1NVUQ 3BS4A 4PPGA 2C77A 3CW2A 3KQUA 2WIAA 3DKPA 4ERNA 4FWIB 2H57A 4TYNA 1TEXA 2Z6VA 4G5QA 3IO3A 2IEYA 2OM2A 4KCGA 3T35A 3QNUA 2D3WA 2J7PA 2HCJB 4R2IA 4QJ5A 6Q21A 5KTYA 2PH1A 2UZ3A 4XWOA 1QRAA 2B8TA 4M22A 1W49A 3R7WB 3W9YA 1S4QA 3OE7A 5FPTA 4A8JB 1KI4A 1XF9A 2EFDB 4H1VA 4IVQA 5EUMA 4F7WA 4Q4JA 1QVAA 3BBPA 3B1XA 2P6UA 1P72A 4R71A 4IVRA 1N6NA 1ZIOA 4PQRA 5C18A 1FX0A 3V4FA 1TQ2A 4A6XA 2R6FA 1Q20A 5CDFE 3QJYA 3HPRA 4DDUA 3EASA 1KKMA 4D82A 1XX6A 4ACAA 2X77A 3H86A 3U60B 1C9KA 2HYDA 4O3MA 1AQUA 1N3BA 2PCJA 3DZ8A 1R8QA 2JJ2D 5BWMA 2FPKA 2O0HA 4LHYA 4ZCIA 3OIWA 4A82A 1E6CA 5HZHA 4LJ6A 2NO0A 4IDPA 4JKYA 4OL0A 3VR5A 3GQBA 5CJPA 3OAAA 4A36A 4I1UA 1FNMA 3ZS8A 1GVNB 2EYQA 4FI3C 2XJ4A 1X3SA 3VAAA 2VP4A 2JASA 4BASA 5CB8A 4IFBA 2WKRA 1AS3A 2J3EA 4Q5IA 3TUZC 4D25A 4JBWA 4Z8YA 1RRFA 3P32A 5L8VA 2QGNA 1F48A 3UWKA 1SVOA 4MYTA 3RSLA 4RFSB 1E94E 1G8PA 1I4DD 3EIHA 1ZNXA 4DIDA 2OLKA 4YQFA 2IUUA 1OYYA 4KVAA 1GSIA 4ZIRB 2A5YB 3DVLA 4KFTA 4E09A 1JBKA 4I1SA 3N5CA 2CJWA 1U99A 2RCNA 2H7VA 2VO1A 1S3GA 4HSEA 3SI7A 2IC5A 1NRJB 3KXLA 5LD2B 4LY6A 3EA0A 3GLGA 5G53C 1WXQA 4IOLA 2ZRHA 1IQPA 4DCVA 2JJ1A 1E4YA 2F6RA 2GJAA 3HJNA 1KK0A 3IIKA 1T3SA 4UNPA 5CK4A 1Z2CA 4QXAA 2ANCA 1G9XA 2ZRAA 4PSAA 1T91A 5HCIA 1L8QA 1Q0UA 2G3YA 3EWAA 1G4UR 5JS8A 3C4JA 2EFHB 4NP6A 3LQQA 2ZRJA 3PVSA 5SZKB 1AGRA 1HV8A 3GJ8A 1XXHA 4GOXA 4Q48A 2XB4A 2GCOA 2WJIA 2ZJZA 1A82A 2F1JA 1G3MA 3QVUA 1Z6XA 1SQ5A 2W6IA 1GIAA 4M2LA 5IK2D 1ZRHA 2CK3D 5HE8A 1NI3A 3W6OA 2D62A 3TQCA 1YZLA 4G5OA 2BBSA 1GNRA 2JJ2A 1FMJA 3OHMA 4EKDA 3RC8A 4Q9IA 3GEEA 2QQ0A 1AIPA 2TMKA 5EQTA 4JJKA 3EX7C 5FI0B 1P2SA 4LZZA 2WVJA 1U2RA 1XB2A 4UKDA 2ZE8A 5CLQA 1EG7A 5G40A 2O8CB 2WSMA 2W83A 3BORA 3LO5A 2D2FA 1ZM9A 5JI3E 1ZM2A 3CZQA 5G41A 1AN0A 1T8UA 3VR1A 5EE5B 3C15C 2QP3A 3AF4A 4CEHA 1NN0A 3EG5A 4M53A 3TVTA 1NY5A 4G5GA 4B48A 1NSFA 2JLRA 1ETUA 2VF8A 1W1WA 2NOAA 4TLBA 5JS7A 1XTJA 4PC2A 3SDZA 4DUGA 1OB5A 1NMYA 4F93B 3J81k 1TF5A 4TMZA 2XNSA 3LAWA 5FL3A 3CWQA 3I4LA 4WXRA 4YMTA 4OHYA 3Q85A 3ADKA 4RZUA 1G1MA 2F1IA 4F91B 3OEHD 4JLKA 1XMIA 2Q9AA 4AYTA 3IO5A 1KTVA 3QQ5A 4Z54A 1UBFA 3ZLJA 3I5XA 2FNAA 4QHTA 1M8PA 3LX5A 4XVRA 4OQMA 1F2UB 2QEQA 5IT5A 2P2LA 3EPJA 4C0HA 4ZO4A 2AK2A 3W6NA 2RGEA 2REOA 2C8VA 1GKUB 2W00A 3MRSA 4HZIA 2ZJ8A 3R20A 1HT2E 4PPNA 1E1RD 3A1UA 4M1KA 5EXTA 3A58B 4Q1CA 2YHSA 2C5LA 4US0R 4URYR 3T5DA 4ZDIA 5KNBA 1KAGA 4QC2A 3NDPA 4MGIR 4GP7A 3MMPA 1N0WA 3OFND 2XSZD 2HCBA 1M1YE 1ZNZA 1E9AA 3T12A 2IYYA 2OLJA 3VX3A 4LRWA 2BMFA 4OI1A 2O8EA 5JWRA 4AKHA 2ZI7A 1PLLA 3ND8A 4BLTA 1FW6A 3TGPA 1T0HB 3WMGA 721PA 1OPXA 1W46A 4YDHB 4HUQB 5LDDC 4DLYA 1KMQA 1G3RA 1P2TA 4MDEA 4EJSC 1KSJA 1L4YA 3CZPA 4HYYA 4JVNA 4L16A 2O52A 4HLQB 4JMPA 3FFBA 2GZHA 4BZXA 1HQCA 2F9MA 4DLZA 4TTQA 2VHQA 1VYVA 2YC2C 1PUJA 1D9XA 1G7TA 3SYKA 1Z6TA 3K9GA 2CEAA 1ZUIA 1I4TD 2CDNA 2O0KA 1EXMA 2RGNA 1UKYA 2FEMA 2OCYC 3TSOA 3QKUA 2RGBA 3AVUA 5AJZA 4LI0A 3EAQA 1ZUHA 4CEIB 2NQ2C 1RJ9B 2J87A 5CIWA 4Q4LA 2AKYA 1ZD8A 1E2JA 4ZDWA 4TMWA 1DS6A 5KPDA 3BE4A 5FTNA 1KI9A 3KQKA 2JLSA 3B8HA 3TLXA 1G4AE 1G8YA 1T3LA 3B2EA 2JLWA 2VHTA 5KDDA 1OFIA 1E9SA 3VFDA 4EFNA 4NTZA 2J0QA 4UQOA 1U94A 1VTKA 2QU8A 1UF9A 1E2QA 2IUSA 2MSCB 3LNCA 3PUZA 1GAJA 1XPRA 4DEXA 3E5HA 1P4SA 3M1IA 2CCKA 1W4BA 3VR4A 3QKRA 1II8B 3W3ZB 3NH9A 1N6LA 1OH5A 1MO3A 5EE0A 4LJ7A 4JBXA 3R8FA 3CH5A 2HXYA 5TARA 3BH0A 1UFQA 5IF9A 3TJZA 2OUKA 1JB1A 3RC3A 1FTNA 2QL6A 3B1ZA 2DBYA 3KTAA 4DVGA 4MYHA 1GRQA 4LSGA 4LHVA 5EP3A 4FINA 2H18A 3OFNA 5AUOB 2WWIA 3QE0A 3AKEA 2E9SA 1MO6A 3M4YA 1YE8A 3L8ZA 2R6GA 5EE9A 1XZPA 1SVIA 1UDXA 1EWRA 2PL3A 5LPNA 4ARZA 4OQXA 2RHDA 4AKGA 3BFXA 3KB1A 4GPTA 2RGNC 2ZRGA 3CRRA 1T4GA 3KQHA 2XGJA 1I2DA 2X19A 3OEED 3RRZA 3I8SA 1Z28A 3HR7A 4RCYA 4A4DA 2A3RA 5TVKA 5CDFA 4KHZA 2C9YA 2ZU6A 2OEPA 1D9ZA 3PFIA 5J4YA 2REXB 4D4JA 3ADBA 3ZVLA 2IYVA 5EXPA 2CBZA 1KGDA 2GZAA 4M9ZA 4PAQA 1QVRA 1MT0A 1EFHA 4PTLA 5A4JA 2GVZC 4IKEA 4LHXA 2WWXA 3PITA 5CJ2A 2AXNA 3AGPA 1QG4A 3U7EB 1N5JA 5FOXA 3SFVA 2NZJA 5CK5A 4HAUA 5J47A 1VIYA 4C0KA 1NKTA 1FPMA 4IRUB 1KHTA 2GJSA 1IY1A 3MD0A 1HT1E 3A4NA 1KI6A 1OJLA 2QM8A 4PHFA 3PIRA 1FQKA 2PJZA 2IEZA 3MG9A 1R8SA 2FSIA 3GLGB 3PUYA 2QRZA 2ZUCA 1IN7A 3B9PA 5EZ6B 3TKLA 2BKEA 4JL6A 4TYWA 1EFRA 2A5FA 2BBTA 2NO7A 1QDEA 1VHLA 2A7QA 3QF7A 3RS0A 2DFNA 3K0SA 1FP7A 3T1TA 1BH2A 2QTVB 3CONA 3NIBA 2OCAA 3P20A 3Q9LA 2RGXA 4QGAA 5HR5A 2DWOA 4TSFD 3B5JA 3IPYA 1YQTA 3PXGA 3LBNA 3SE0A 5FOSA 3RRYA 2VTKA 4DLXA 1P9NA 3BJIC 4Q9LA 3R7WA 4BLPA 2ZI4A 1UEIA 2QE7D 2XTNA 1E4VA 4A8JA 4RD6A 2A9KA 3AM1A 1O3YA 1NN3A 3NTUA 5FFMA 3MGCA 1Z3IX 2FSFA 1KK1A 3DMDA 4FCTA 1N5LA 2ONJA 3FOZA 5ELXA 2GETA 1NJFA 5SZIA 2GHIA 2OAQ1 2CXXA 4OQNA 2FSGA 4Q7KA 2GXAA 4GT1A 3NBXX 4XSGA 3MWLA 3KKNA 4E5UA 1CIPA 1XTKA 4UXHA 2QTFA 3U7GA 4RZXA 1KO8A 4Q18A 4ESVA 3ZS9A 1VECA 1A2BA 3VR2A 3CLVA 3G5UA 1N6KA 5FBLB 4EPXA 3A6PC 3DM9B 2FWRA 4LJYA 2GF0A 4JLBA 1G8FA 3MFYA 1G18A 2VLIA 1TEVA 3NH6A 4DJTA 4PSKA 4HDCA 4TMTA 4NBSA 1KDTA 4YXWD 1M74A 4V0ME 3K70B 1ZC4A 3DHWC 1E0KA 4C2UA 2VIIA 4BEJA 2EW1A 4R2HA 1LS1A 3A1SA 4NCKA 4K46A 4UNQA 1ZP6A 4EJSB 3L82B 3NG1A 3SQWA 2GILA 2WOJA 4HLCA 3SHFA 3U3MA 4RFSA 3UG7A 4IDQA 3L0PA 3PENA 1AM4D 4IEEA 4O0MA 4QBIA 2FDCA 1MO4A 2OESA 2JLUA 3FKSA 1RKBA 5J4LA 5CITA 1UAAA 5E95A 1OW3B 4CIDA 1JXMA 4ZIRA 4YMUA 4ZDJA 1FUKA 4RD4A 2VHJA 4YMVA 1HH4A 3RS5A 1R0YA 4LYFA 2C78A 3D31A 5DIFA 2OXCA 4PHTA 3SYLA 4URVR 1BOFA 1FOEB 5HTKA 1KNQA 1K5GA 2KBEA 3A1VA 4DLSA 3CR8A 3DM5A 5A0FA 1MABB 2XZOA 2IYQA 4OQLA 3GFTA 1UBEA 4RD0A 3ZIAA 2D2EA 3U44B 1Q57A 2GKSA 2VA8A 3SQXA 1NSTA 1KI1A 1GRRA 4K8OA 4LC0A 5FL7A 2ODWA 2ZUDA 3UATA 2WWWA 5KU1A 4JVSB 4OHWA 4QHSA 3KKMA 2F1RA 3H4MA 4TSFA 4JLMA 3F3YA 2LKCA 4GSYA 4TQ9A 5EZ5A 3EARA 4ZCMA 3REFA 3VQTA 1M34E 4D4MA 2FZLA 3B82A 3U7FB 1CEEA 1N0UA 1CULC 4QM7A 3EZ9A 4PO8A 5CM9C 5GJCA 1FUUA 1G19A 2PX3A 2ZM5A 3FYHA 3IKJA 4C9BA 3LLMA 1WP9A 1VCNA 4XWKA 5DO9A 1GL7A 2EFCB 4DEYA 3IILA 1HEIA 3JZAA 4DDVA 3N70A 2Q9BA 1Z47A 4L8GA 1BKDR 4HAXA 4A0HA 4Q03A 4B35A 4LK2A 3QXSA 3DPUA 2ODNA 2YOHA 3QUSA 4TL9A 5DHAA 3DOFA 3BFVA 3ZQJA 1HTWA 1ZM3A 4B2IA 1IN8A 1IN4A 3NBZC 4NKRA 1E3MA 3QF4B 4D0GA 4OJQA 1E2EA 1YU9A 4US1R 5FR2A 2DR3A 3UMRA 1OIWA 2WJYA 2ODEA 3A4LA 2C2HA 4OHXA 3IPXA 2O8CA 2VPPA 4AK9A 1RVDA 1ZD1A 2Z5FA 3GJ7A 3EPKA 1J2JA 2ZAMA 2QP4A 3LX8A 4IOMA 4EPRA 1U8YA 2BEKA 2F9LA 2FV8A 4ON9A 3EIEA 2VSXA 3VTKA 5LD2C 4FMCF 1FNNA 1SHKA 3RWMB 1KDRA 2H1LA 3NC1C 3IQWA 1U90A 3BD9A 5EXXA 5B64A 2FN4A 4DSOA 4CGZA 1W2GA 5M04A 4PC7A 5FBQB 3M6AA 2Z83A 1DEKA 4R98A 3KUDA 1SKYB 4Q1AA 4D26A 3NKVA 5GADl 2KE5A 5DH9A 1ODFA 5CM8B 4QJ4A 2NTYC 1VHTA 1CR2A 1NBME 3K09A 2YV5A 2O8BB 3CBQA 1IY0A 1CS4C 4A2PA 1HURA 2J7PD 2PT5A 2ZS8A 1F2UA 2YINC 4URUR 3W8RA 3QKRB 2DYKA 1G5RA 2GBLA 4B6FA 4EIWA 4MKFA 4HLUA 2FGJA 3CPEA 4LBVA 1G8HA 4C0QC 2W6JD 2V6JA 1SVMA 4D2IA 3K0FB 1TF2A 4M1MA 1M7BA 3BC1A 4D4LA 1QF9A 3VHXA 1DO2A 2ZU0C 1AQYA 3I61A 2ORWA 1EFTA 1XBTA 3PEUA 3TW8B 1DAMA 3QPWA 4AG6A 1ZC3A 4NMMA 1G3IA 4QBFA 3BH7A 3FE2A 4KO8A 4Q9JA 3TQFA 1D2NA 3ADCA 4HUQA 1IXSB 2QPOA 1QG2A 3QXHA 1ESMA 1NF3A 1XMJA 1DVRA 4X8HA 2B6HA 5AWFC 4C3ZA 2WTUA 2ANBA 1YZTA 1XTSA 4JLNA 1T9HA 3U3RA 4HZUB 1OXUA 3TE6A 5HCNA 4HB3A 2HDNB 4G01B 2ZR7A 3FB4A 2GXQA 2AD5A 3V00A 4FXPA 2QTHA 4NYJR 3G0HA 2OXRA 2OCPA 2IWRA 4BLRA 3THWB 4NYMQ 3I32A 4CEIA 1RJ9A 821PA 3K09C 1II9A 1QBKC 5KNDA 1JAHA 3ZD6A 1XWIA 2FF7A 4U02A 3W6PA 2N46A 3U4QA 1DO0A 5JHHB 4Q1FA 4ZPXA 3SJAA 4Z8XA 1UADA 2GBLC 2ZRDA 2AWOA 4KV9A 4QJ3A 4DHEA 1E9FA 4FW9A 4HLUC 3S1AB 3WXMA 2JLZA 2AN9A 2BCJQ 2HJVA 4LDJA 3MUFA 4MRRA 1D2MA 4QGGA 1T8TA 2HF8A 1QHYA 2A5JA 3CF0A 2FH5B 4LJ5A 3TAUA 3QXCA 1E79A 1II8A 1Q21A 3IDQA 2BJWA 3QI2A 1G41A 4IW3B 3GJ6A 2QENA 2VF7A 3ZVRA 1N25A 2ZS7A 1UDWA 2ZI6A 4CT5A 4KITB 1II0A 4M9XA 4DB2A 2ZRBA 1JXOA 1T5IA 1YVDA 1ZNWA 2PBRA 2J46A 4AY2A 2IS4A 3G82C 4H9GA 5FOVA 5AJWA 1W48A 4MKGA 1KOFA 3O8DA 1COWD 1MH1A 1S3SA 2CMKA 2W6JA 3R9XA 1GKIA 2FFQA 4TWZA 1KYIA 2W6ID 2BM0A 2QORA 2Q6TA 2BWJA 2QBYB 4GBMA 4I99A 1P2UA 1TAGA 1XZQA 1EESA 2H16A 4JLOA 4N0DA 2FFBA 4F4CA 5JRZA 3U7HB 1M2OB 1VPLA 3TUIC 3Q3JB 4P31A 2R44A 2DWQA 1KMHB 1E99A 1ZM7A 3MLEA 4JSYA 4LJ9A 2ZIAA 4G5RA 5L3RA 1NG9A 5JWHA 3EZ2A 5TY0A 3K70D 4LPKA 2A30A 1OLOA 4WIAA 3TW4A 3VMFA 3IBYA 2ZYUX 2WMOB 2XZLA 2ZJ5A 2I4IA 4LV6A 5EP2A 3GLFE 1BIFA 1NVVQ 3AV0B 4TZ6A 4YC7A 2JLYA 2QMHA 3OIYA 4RD3A 5FUVA 3UPUA 1U0LA 4NCIA 2R6CA 3PUWA 3EXAA 1KDPA 2ZITA 3QG1A 4FN5A 4HB4A 2DCUA 2QAGB 2KSQA 1UKEA 2EWWA 2QN6A 4MRSA 5AUNB 1G3QA 4DUGD 1AA9A 4B3DA 4TL7A 1GRNA 5D3MB 4EFMA 1KIMA 4MITA 5FPKA 2PMKA 1YZQA 1ZU4A 3GEHA 4QOSA 1OFTA 3EC1A 5E7IA 4V0MA 3WYFA 4RKFA 3B7GA 4B3XA 1Q1EA 4NU0A 2CHVA 1S9DA 1J70A 3QEJA 1BYUA 2D4HA 521PA 2QMEA 4RCZA 5H8WA 1L2TA 4YMSA 2LKDA 2GESA 2BCGY 4ESHA 5L3QB 2DFLA 1FFHA 4OHVA 2GNOA 2ATXA 1M7HA 2WIBA 3RLFA 3F8TA 5J40A 1JQJC 3EPLA 3RS4A 3C41J 2UZIR 1E1QD 4P4TA 4MRNA 5BN5A 3FWYA 1HE1C 3A8TA 2P0EA 1ZINA 1AS0A 4U00A 4TN1A 1CJKC 2ZAOA 5K8IA 2IYXA 3KJGA 1NBMD 2IF2A 2QT1A 1OXSC 1VYUA 1X6VA 3DZDA 4P0TA 1QHHB 2WAXA 4DSNA 3AEZA 3L2OB 3LFUA 2ZJAA 1US8B 4QRHA 4C0SA 2OE2A 2P67A 1D5CA 3VKWA 4BFZA 4EUNA 2XNDD 5C4GB 2O8DB 1P2VA 4HDQB 3TAHA 1COWA 2F43B 4A0RA 4G1UC 3T06B 2WBLC 3MWYW 3DDCA 4PAMA 1XD8A 2WKQA 3K0EA 4KSBA 4DC9A 3UKDA 3WYAA 2WZQA 3QKTA 5D3QA 4HDOB 3B1YA 2ZSEA 4BFUA 5JCPA 4N3NA 4DLUA 1SVWA 1OIVA 2JCSA 3PG5A 5J4VA 2KI5A 3ADDA 1Q1ZA 3X1WA 4DCTA 1KDOA 1W7AA 1ZU5A 2FA9A 3E1SA 4L4UA 4Q4AB 1E9CA 2QROA 1DAFA 3I73A 2FG5A 1YJ5A 4KBGA 5H1YA 3SJCA 4TZ0A 2GXSA 1IY2A 2P5SA 3D6TB 4FWTA 4EJSA 1P60A 4PSVA 4BE7B 4B6EA 4AKIA 4XD7D 2Q3MA 1F6BA 3LW7A 2I1QA 2IK8A 3B85A 1VCOA 3UK6A 5E7MA 2ZSAA 2XB2A 5DI9A 3U3OA 5DYGA 1LVGA 3ICQB 3GCGA 2W2XA 2QPAA 4HB2A 4GP6A 4XOIA 4PC3A 5FUYA 4TMKA 5ANRB 3DO6A 4UXJA 5FPHA 4MUAA 2QPTA 4Q7MB 3REGA 4RVCA 2BIFA 2JJ8A 2HEIA 2DPXA 1CRPA 1S1MA 2ZSBA 3RYTC 1MABA 2XXAB 1DAHA 3L0SA 8OHMA 3SJBA 3U44A 1VCIA 1EFCA 1F5NA 2PCLA 4DWJA 2V8OA 1JR3D 2ZYVX 5GJWC 5BYKA 3CO5A 5DI3B 1RPZA 1CXZA 3CH4B 1E1QA 2ERXA 4NCNA 1GOTA 1Z6GA 4C0LA 2GEDA 3BOSA 1XEXB 2XX3A 1N5KA 1E9EA 3K0CA 3VX4A 1NBMA 2XZPA 4LJAA 3WYGA 1CU1A 3KZ1E 4IDOA 4KJZA 1NVWQ 3DMNA 4EQ6B 3LBIA 2QGZA 5EP4A 4A15A 3KL4A 4CVNA 5K8TA 1T5LA 2XNDA 3K70C 1KK3A 3O8BA 1G8GA 2QNRA 3HWSA 2W0SA 3LBHA 4O2LA 2IL1A 4TLCA 2VP2A 4US2R 1PLJA 1XP8A 4HAYA 1EFUA 3EIQA 1BS1A 3F5FA 3K9NA 5LBIA 5IRCD 3RDPA 2WJGA 1QHNA 4LHWA 4Y0VA 4DLTA 1EGAA 2J0UB 4TLEA 2Q9CA 2ZE5A 3QF4A 4O2RA 3IHWA 4MGZR 5C46F 4PQYA 1OF1A 1N2CE 5TDHA 2HV8A 3W5JA 2ZANA 1JJVA 2AFHE 4TYQA 4WAUA 5B30A 5JI2E 3MWJA 1KNXA 4GI7A 3BB4A 1TNDA 2ZRPA 2YVUA 4A0GA 4BRUA 5GVRA 1XTRA 4MYUA 4A2QA 4B3CA 2BEJA 1T3HA 4XWAA 4URWR 4XD7A 5G3YA 2WWFA 4V02A 1W36B 3SEAA 1G5TA 3VU9B 3U4QB 4CEJB 1A7JA 3R9IA 1ZVQA 1EFRD 4V0OA 3MJRA 4CZ2A 4MUBA 5J4KA 2ZI5A 2O8BA 1Q12A 1Z0JA 3C16C 4JZKA 3PJRA 2QRNA 3BIFA 2OHFA 4P32A 4BQSA 4FCVA 2Q21A 1S0UA 2PLRA 3K0CC 1WDTA 2ZSDA 2Y8EA 2J7KA 4LHZA 2B21A 2PT7A 3H2YA 1YR7A 4UJ3A 1JNYA 3V9PA 4BGDA 1NMXA 1L7VC 5FBWB 2J0VA 2HF9A 1VMAA 1JR3A 5E4FA 3K0FA 4D6PA 2ZJYA 4WZBE 3LW8A 1G6HA 1GL9B 1M7GA 2G1KA 5KOYA 5EJEA 3LH5A 3U3JA 2ZJOA 2ODBA 1OH7A 1Z8FA 3UIEA 4ZI2A 2RH5A 2WJJA 2AHOA 1YR8A 2R8RA 5J5CA 2G0NA 4TQUS 2ATVA 2ZRCA 3QBTA 1ESNA 2QY9A 4M9QA 1TU4A 1OXXK 4OYHA 4A6PA 4B76A 1G5PA 3TR5A 2QUZA 1KJWA 1DAEA 4IVPA 2GK6A 3AB3A 4PR0A 5FUWA 3NHAA 2IYUA 3BB3A 5B58C 2IHBA 2WPDA 1J8MF 2V1XA 4HZUA 1UJ2A 4OBEA 1MO5A 1H8ED 3T1VA 4BZPA 4RY2A 4TL8A 3TVDA 2GA8A 3FKSD 2QZ4A 3GEIA 2GDJA 1OB2A 5A5GA 1NLFA 1XD2B 2IHYA 4JYCA 2AKAB 4PPFA 1XCGB 1V43A 1JPJA 3K8YA 3THWA 4B3GA 1LF0A 1E2KA 1G6OA 4NE2A 1ZBDA 4DIEA 1XD9A 4KYIB 4NH0A 2OSBA 1OH6A 4P4SA 4MGKR 3AUYA 2FJUA 3RS2A 3K9LA 2IYWA 1A2KC 5JRJA 3GLFA 1X8LA 1Z83A 2RHMA 2PJRA 1TMKA 3Q8XB 2V1UA 3S1AA 4ASUD 2IYLD 3ZIAD 3CRMA 3D7MA 3PQCA 2GEVA 1W0JD 2PZGA 2QSYA 2AK3A 4TLAA 1E2FA 5FL7D 3WY9A 4B74A 1ZIPA 4KBFA 4XVUA 1DADA 3A1WA 4IJMA 4LYAA 3AVVA 1Y3AA 2NZ8A 4AIIA 4U5XA 2NO6A 2BVNA 3KKOA 1LTQA 4XTCS 3T1QA 4OKSA 1TX4B 2B7BA 2ORVA 5BW8A 1G7SA 4WZAE 1KSGA 3AVQA 5IDVA 2V4ZA 3QXXA 4AKEA 1H65A 2B8WA 1ANKA 1TADA 2P6NA 1E9RA 5JHGB 4JSTA 2RAPA 5K8LA 3SR0A 4LBWA 2C9CA 3CNOA 4PFSA 1CJVC 3AVTA 2ZR9A 1YZKA 1Z6AA 4TL6A 2ONKA 4PO1A 1E0JA 2QBYA 3EPHA 1JJ7A 2YJTD 1GP2A 3I92A 4MKIA 2WM9B 1DE0A 1KMHA 2CLSA 4PXAA 2ZS9A 3VNUA 3QSYA 1KK2A 4A9AA 1IXZA 3RABA 3T15A 1JECA 1I2MA 4LJ4A 4DSUA 4LWZA 3AF1A 3A1TA 1Z0KA 3NVAA 4NZYA 1TQ6A 4Q1BA 1J99A 1LF5A 3WP1B 4OI0A 3FFAA 1KJYA 3GJXC 4JL5A 1KY2A 1IHUA 4GL2A 1X8KA 1K5DA 2GF9A 1VG9B 5CLLA 1GUAA 4E07A 3ZVNA 4L9SA 1N6OA
chains in the Genus database with same CATH superfamily
3RHTA 5SY9A 2Q49A 2XUIA 3DFIA 1JSXA 1H8EA 1R88A 1O6CA 1YH3A 4NJOA 5EP1A 1N6IA 1W4AA 1NKVA 5BR8B 2AIRA 2P35A 2VJKA 1E2GA 1JQ3A 2G7MC 5A4DA 1UBJS 2HWXA 3ANTA 1N6PA 3K0HA 3KVNA 4NS1A 5SY6A 3VYTB 1IUNA 1B23P 2D7CA 3PS9A 2BEWB 3L7MA 1NKSA 4XEHA 5EKXA 4U63A 2VK4A 3LT0A 5T4HA 5UKDA 3U80A 2XRMA 2B2NA 4JI0B 2IS6A 1R00A 5JJLA 3MJDA 4B2PA 3AYZB 1G64A 4J4HA 4KQFA 4D3SA 2WP0A 3IE0A 1XNGA 1FFEA 3SHTA 1U98A 4CHGA 3LPNA 2H52A 1XPJA 2CWDA 3OPMA 1FJXA 5L3QA 4UMDA 2G77B 4L0MA 5DJ5A 4D9BA 2QR2A 4EJ0A 2H48A 2EP5A 2PANA 2D0OB 2UDPA 1W88A 4C7JA 4B4OA 1ISJA 1JFRA 1NL3A 1YR1A 4HGYA 5F98A 3QE2A 2J5XA 3ZHRA 4ZI7F 3HUEA 2GZDA 5HQTA 1DEOA 1RWVA 4DXHA 1ZCFA 5JCJA 3B13B 3IV7A 3IUYA 4FBMA 2FW9A 4PBRA 4EPTA 1Z6PA 3WDMA 1HDIA 4C7KA 4I55A 2NYUA 1V41E 1NDUA 3PUKA 3HZRA 4DYDA 2D54A 1DSSG 2V7TA 3MOGA 2WKWA 1DJPA 1VSTA 3C8MA 4TWAA 5C8ZA 1F7UA 2X9GA 2MU1A 2QYOA 5EHXA 4UTZA 4I1IA 1E8NA 2CMDA 3GH3A 3T5GA 2WSSD 4UCWA 1J2UA 5L3VA 4V24A 2GK7A 1WW8A 2O8DA 3W4IA 3AEYA 2DHDA 4OK3A 3LIIA 4O1HA 1WPGA 2CE2X 5LUBA 2I7CA 1VXRA 1YONA 3UZUA 3RV4A 4DMMA 3NTVA 1ZL0A 2XUFA 3LX4A 2R1VB 4X24A 1UK7A 2HO5A 1EGQA 1O4WA 2O7QA 3KHUA 5HJ5A 3RTDA 3ND7A 4BAUA 1MOSA 4GFDA 3OLQA 3RU9A 1U11A 1NNEA 3AFNA 4HWGA 2R7MA 2VRCD 1EH5A 1ZCAA 2ZR0A 1ZUNB 2ERYA 2QP9X 1NE2A 3GPDG 3M6IA 3NFYA 4KH0A 3R3UA 3ZE6A 2HA2A 1JG3A 1QYWA 2LZ0A 4GSKA 1SXGA 4JEIA 5EUQB 3QWHA 4LE1A 3EEFA 1HT3A 5KDLA 1RYHA 1V8ZA 4NPHA 4Q4AA 5D5QA 1WG8A 3PUXA 6PFKA 5M2QA 2UXCB 1E5LA 5HIJA 4ENWA 3GLIE 4MLPA 1ZOPA 3HR8A 2CVHA 2ETVA 4DPMA 4I3HA 4BN0A 3HJAA 2RBKA 2CL0X 4OJYA 1MOQA 5FRDA 3L1VA 2VKTA 2VQSA 5FOQA 2CJFA 1N9ZA 1OYVA 5IAAA 1LX7A 1QS0A 1TU3A 4A2CA 4LF7B 2QW0X 1W36D 4MV7A 2I8LA 3RIEA 1L9XA 2VUTA 4ICIA 4QLOA 4Y2UA 5CGZA 2FUCA 3GB9A 1AXGA 1LI5A 4YJKA 3RJ9A 1JSRA 5CAEB 5EJ2A 4YRJA 3ZWKA 4BJHB 2OV1A 1IOZA 3W78A 3M83A 3IDOA 3A0RB 4Z9BA 1EWKA 4Z49A 5HM6A 1E79D 1V96A 5IXYA 2G88A 1GA1A 2G1JA 3IT1A 4JYAB 1N2CA 4M9SA 2IE8A 2AFHA 2C4KA 2QMOA 3NBQA 5D6OA 3T7CA 3V9AA 3W9UA 5E0OA 2ZULA 3DSRA 2GAFA 3D3WB 3G5TA 4FMDF 1EVIA 1E7MA 4RH0A 3RNLA 4P3NA 2HN9A 2HMTA 2ODQA 3PUJA 1ZZGA 2WILA 4AYWA 3CRVA 5E6UA 1U2SA 3D7RA 3RSQA 1IK6A 2PZLA 1X77A 4G3XA 4B6PA 4DCNA 3PYMA 5TGTA 1I94B 1GTSA 2C3MA 1T4DA 2RKOA 2C7VA 2WF6A 4DEVA 3GFPA 4ETNA 1BO6A 1XZNA 1IONA 5DXAA 4WSOA 3DL0A 1SUAA 4BQFA 2XUHA 5FYQA 2QXYA 1YZUA 1A8QA 4B8YA 1N2JA 2XLBA 4RABA 3RYIB 3GBVA 5A5GA 5IYZF 4NESA 1WQ3A 4RKRA 2RGWA 1ZK1A 3PHCA 2HY7A 4OH7A 4M1EA 2YWGA 3OY2A 3SEQA 4FSXA 4YIHA 1PZXA 5HQ3A 1R0RE 1KC1A 1JFLA 1Y1QA 3A26A 2WSSA 2B2XA 1IBLB 2PRZA 1U1CA 2BW0A 3GN2A 1FS6A 3ND6A 4Y9RA 2R00C 1ECFA 1FTWA 4UE3S 1VMIA 2B1IA 2O8FB 2DFKB 1ZWLA 4MTCA 4PSDA 1GDDA 4CUKA 1LV7A 4UNSA 4JDUA 5DGDA 4ESEA 1DT5A 1Z0AA 3WTBA 2ASVA 1XRJA 3E5MA 3O21A 3D2LA 1T0JB 2DUMA 3LT2A 4EABA 5KQPA 4QPZA 3F73A 4B3GA 2UZAA 2DF8A 2J41A 2UAGA 5AHXA 5KYUA 2VRCA 3V7FA 2WR8A 1LKZA 3LQ1A 3VR3A 3WB1A 5JYDA 3ZGOA 3QYFA 4EHFA 5HM8A 3AHCA 3RSZA 4PANA 1QWSA 3SJUA 2N1MA 3HB7A 3VO9A 4JI8B 2JFNA 3CEHA 2COEA 4Y2GA 5B53A 1USGA 2JJQA 3F6PA 5KOJA 2IXTA 3WMFA 4GMDA 4LTMA 3CYFA 3AT1A 2MSDB 3TTTA 3QU2A 5DGIA 1GFIA 1FMTA 1LPPA 2C5AA 2MJLA 2VXCA 3FPJA 3LUAA 4OJKA 4G0VA 3QNWA 1Z4QA 2YZMA 4NVRA 1U80A 1XALA 1AE1A 2G4CA 5CXQA 2PS9A 2XOXA 3RANA 4DG5A 1B3BA 3QOXA 5DNYB 4DCSA 2QRJA 2YOFA 4MYDA 3CY6A 3GLFB 4CEJA 4J91A 2VP0A 4L3OA 3Q7TA 3SEZA 1WETA 1KO1A 4YTEA 2FWBA 2C3OA 4FGKA 3WL3A 4GBGA 2X8AA 4RHUA 2Y05A 1K68A 1O58A 1VL5A 2CXQA 2DHRA 1E20A 1SJ9A 1RT9A 1U9CA 1N3LA 1QK5A 2PLWA 1UT8A 3D6JA 1POWA 1V8FA 3A1EA 4DBLE 1Y9DA 4KIGA 5A0TA 1HF3A 4B17A 4B81A 4MVJI 1ZIYA 5BSMA 2C82A 1WBBA 1YHNA 3PX7A 1N8TA 4GLLA 4AZ0B 2OBFA 4C7OA 1RPNA 3GEBA 5A6VA 3EVEA 4Y67A 5DOVA 3AVVA 3IQDB 3NM4A 3V97A 3CKYA 4E31A 3HJFA 4YQZA 4UXIA 1FSPA 3LCUA 3BL8A 4W9NC 1SRQA 1NIPA 1X2BA 2ZJ6A 3PICA 3T1HB 1S8FA 5LMZA 3OQOA 3T3GA 3EPPA 4C30A 3ZDZB 2PWBA 4L4YA 3W5HA 5I7SA 4LMAA 1JN0A 4BZQA 2OK7A 4KHPB 3NONA 4E22A 3GP8A 1WPXA 1T0UA 2DTDA 4BLUA 1V11A 4TXNA 1SVNA 1W2HA 2OCXA 5ILGA 2ZYHA 1E98A 2NU9B 3VKUA 1RQXA 3TBKA 5TS2A 3LV8A 5ARBA 1TTPB 3ND5A 4F9TA 3GJZA 3AR9A 2GGSA 4B32A 3TI7A 5ED4A 2FE4A 4WZAA 4PYMA 2V7GA 5CB4A 1DRJA 1DTWA 4N12A 4EQZA 1ELOA 1KFKB 4YUYA 1CT9A 2DPHA 2VBIA 3VZPA 3VC1A 4ARSA 4IY1A 4I9UA 4W6QA 3AFOA 3AFHA 1M5TA 3NHRA 2AYXA 2BFOA 1UPTA 1QU2A 2EOAA 3X2SA 5E9JA 1PU2A 3ZD7A 3TX6A 2YWXA 4PZYA 3IX7A 3UMBA 4FLFA 3EXFB 4U2BA 3DDOA 4CN8A 4FB5A 1QCDA 2UUPA 4OK6A 1CZLA 2W70A 4EH1A 2RD2A 1PSZA 4MVJG 4IVNA 3GJ4A 1ZN8A 4B83A 4HNUA 1FP4B 3AI1A 3HB1A 3SFZA 3A1CA 3VV2A 1PHRA 2I6GA 4DLLA 4DB4A 4P83A 5FTJA 4EPWA 3V6LA 5KUTA 2HW8A 1ZCBA 3JAMA 4TYYA 1AX9A 2PZKA 3WO1A 3GJ5A 1OX5A 4V0LA 2YQ5A 3G13A 2HI0A 3HR4A 6LDHA 1IJFA 5AKIA 3PF8A 3ZWWA 3JATB 2VSOA 3KWMA 4GGPA 4MQ6A 1T6YA 1G16A 2R8OA 5JY6A 2CLFB 4H6WA 4AYXA 1P6QA 3CTPA 2DE0X 1GKKA 3IP1A 4JENA 3WBJA 3JD3A 3T99A 4BVFA 4HT3B 1CNFA 2QRQA 1KA9H 1PEYA 2UVQA 3I6QA 3JPWA 4FOLA 4KLAA 2RMKA 3LXXA 4HI0E 1QWOA 5HPYB 2LDBA 1IXRC 3EVNA 3H2KA 4WDQA 3GLHE 1QMGA 1DHTA 3K4QA 2HM7A 9LDTA 3I3OA 5L3SB 3GARA 4J3JA 4YLGA 2FOLA 3QVXA 3Q3VA 1W73A 4BFTA 3R8CA 4UD6A 1J97A 3IFSA 4HYQA 1QIKA 3T9AA 1SBYA 1PJRA 1PR5A 3KYDB 1DI0A 4KSCA 1LC0A 2WVHA 3DF9A 3PT9A 1NZDA 5FEMA 4HRYA 2ZDGA 3ZWQA 3SHWA 4GZMA 1JDBB 4F4JA 2BMWA 2P4HX 3FOWA 4OQFA 1IRIA 1CR0A 3NWJA 3C8ZA 2ZWMA 3QVVA 4GGMX 2GZ2A 5JZOA 4EA7A 4YBRA 5F9HA 3OZ7A 5F3DA 3OZFA 4YAIA 7ADHA 1IAQA 3OIVA 5JVDA 2E0IA 4MDFA 3JPYA 1OX4B 3KDAA 3RM3A 2C7OA 2RB5A 2SHKA 3LUCA 5AJXA 3LUJA 1Z63A 4QGSA 1C7RA 4P3XA 3G6WA 3IIJA 3N74A 4Q1VA 4WXPA 1DKUA 3F5MA 5LFAA 4M0MA 2PKCA 3W3AD 3W5AA 5ARDA 2HL6A 1G291 3DD1A 3I8OA 1USWA 3JQ9A 1P73A 3RIGA 3W9SA 5DWQA 4YWJA 2BZSA 4PGHA 4DWWA 2MHCA 3HRKA 4G6ZA 1XZDA 3KHTA 2NWQA 4KVGA 3WHLA 3BTUA 3AX6A 4BO6A 1E2HA 4DIOA 1CTQA 5AUNB 3R5XA 3DBRB 3L4BC 4JH0A 1YK0A 4TMXA 3GPLA 2UU9B 3KCQA 3SLRA 5HZKA 5LMNB 3OCUA 4O2AA 1KGSA 2BC9A 2HBZA 1Y80A 3ZZNA 5IXJA 1Y63A 2BHRA 2PGDA 3AKCA 4IFIA 1G20E 1U5CA 3K9HA 3ASZA 1E5DA 3IPCA 3B53X 3PNKA 4KI0A 2I2WA 2E4XA 2G9RA 3MWKA 4YUXA 4OQEA 2WSIA 4PCVA 4XGQA 2XMCA 5DHRA 4ZAZA 1JHQA 1J39A 4BNJA 1MQAA 3TTYA 2A9VA 3BK7A 2UUOA 5ED0A 4XJXA 1A9TA 1IWPB 1P75A 3THOA 1NQUA 3ER8A 1V8BA 3CX4A 4X8OA 1V45E 2X6RA 4Q4HA 3ROTA 4JROA 3SJZA 3VM6A 2R7NA 3SVTA 2IVZA 2P5YA 4L3VA 5HFNA 1EM8B 4JNKA 5KINB 3AUSA 2Q3FA 3GRYA 3NYWA 4INZA 1KERA 1IOLA 1T8SA 2AZDA 2ZIZA 3DNFA 4OB7A 4IOJA 3MWGA 2EGHA 4LQDA 4XM2A 4BGVA 3B60A 1M33A 2BSAA 2JFHA 2Y6VA 2KS6A 1S2MA 1DAOA 3M0EA 4TYPA 5FWDA 3RTCA 3NEJA 4H4CA 3VDQA 2B36A 1TJ4A 4UOQA 3U0VA 1J0AA 5FO0A 4E5VA 3NVDA 2BFCB 3K9CA 4C4XA 5DIZA 1ODKA 4HEA6 5AP9A 2WU0A 4HPJB 2RHRA 2F3PA 1GJRA 4ZO7A 4YQEA 4CKCB 1Z2EA 4ZKEA 3RYHB 3KT3A 4OK5A 2KX7A 3HE3A 2ZJ1A 3IULA 4FC7A 3RAPR 1FA9A 3PEYA 1GKYA 1NX6A 4JJ4A 3VR6H 1R0CA 4M1QA 5CUQA 5HYVA 4XLLA 4PQEA 1MR3F 3T3PB 1F3OA 2NYAA 1SBCA 1AJEA 2CVOA 4QTYA 2UV8A 4LYJA 4RK1A 1NN1A 3OTQA 5CVUA 4BNWA 4E5KA 4F4IA 3UHPA 3QUBA 2IV7A 1ADGA 1NUPA 3HB4X 1ORIA 3JV7A 4LZWA 2VSNA 1F0KA 2C04A 3QENA 4N0PA 3SKXA 4ZKDA 2BBOA 1BWPA 7YASA 4FC6A 1X80A 3D0OA 3JVUA 1YJAA 2R6HA 2VNAA 3L43A 4RCVA 5CFLA 5ICEA 4F3RA 3KJIA 1X42A 4YX9A 4ZGBA 1RADA 2JEOA 1S2GA 4FEYA 5BV1A 3RAEC 5DPMA 2HTFA 1PK9A 2JLQA 2NT3A 2OLEA 3ECCA 4YAJA 3TK1A 1F2DA 5MN4A 1SR8A 2DQ4A 3GVCA 4G1MB 3FNGA 2B4TO 2CFTA 1YDGA 1S1CA 3GZNA 1KPHA 3A4MA 5HIIA 3AXSA 4CF7A 3HO1A 2IXEA 3OZGA 3BERA 3W3AA 4I6JA 2PZEA 3DKIA 1J07A 1S8AA 3CH6A 1UBCA 1T9AA 2K5UA 1NBAA 3GIWA 4GOLD 2ZATA 5EFOA 4A03A 2KQUA 3VKVA 5KEIA 3VMMA 4M0UA 4RF5A 4JVLA 4Q1EA 5DX1A 2R65A 2ZJBA 3RB8A 1PT6A 1KO7A 4D0LB 3LKVA 5AXAA 3IQXA 2F1HA 3SQLA 5K3CA 3T7AA 3AESA 1V8DA 3LGSA 5AXDA 4KR2A 3LDHA 1YBAA 1ZN2A 4CGYA 4E2XA 2PRIA 5K1ZA 1BNCA 3F4KA 3TSWA 3KTOA 5BN4A 3CX6A 5LLDA 3BD8A 1JG2A 3W7AA 3Q3CA 2GVDC 2VZEA 4RHTA 4OFXA 3IQZA 3B6MA 5JH7F 2O0MA 1T6ZA 1FXWA 1R4AA 1MG0A 3AFIA 4R6XA 1TQDA 1B43A 1CY2A 2O7NA 1VLMA 4O2BA 2ATIA 2W6PA 2WMNB 2BBWA 1DXYA 3BEDA 1OSNA 2X1VA 2IFTA 3STVA 1M73E 4PU0A 1OT5A 1A50B 1X2EA 4E0BA 1XU9A 4ECEA 3M6UA 4B47A 3KKPA 2FZVA 3K73O 1WDMA 4DA0A 4W5NA 3SKVA 4GWKA 3QKWA 4D0SA 1QLWA 4BMOB 2HIGA 1XZGA 1EXWA 3DEFA 4MW6A 1DRKA 2C58A 2FPPB 3GXBA 4AC9A 2HADA 4IWXA 4EGQA 1OAKA 3BRQA 4LJ8A 2B7CA 5DEOA 3PQ7A 3NETA 3X2FA 3C1TA 4DMUB 3AWDA 4MVJD 4IIGA 2P27A 4BNFA 4IDNA 5CLFA 2VN8A 2P90A 3BM5A 3FYUB 5IJ0B 4H4EA 4KAJA 5DX8A 2XUKA 3FNIA 1UKZA 3F5DA 5HK8A 2YWFA 2C8LA 1JVNA 3F6RA 3WRYC 1FQOA 3LIPA 3MERA 1ZEJA 2JDID 4R9RA 4BGIA 4DBVO 2PXXA 4OI2A 2H5EA 3KFVA 2ZWAA 1JPNA 3F1KA 1DELA 2ZYIA 3G79A 3S6JA 5JECA 1ATZA 2QVYX 3IOYA 2GEJA 4LBYA 3VH2A 1I33A 5ITSA 4DV0B 4K03A 1JVSA 3OX4A 2H2AA 4V03A 3B6IA 4YCDA 3DVQX 3S2GA 3LS2A 3L46A 3T5MA 4IDCA 5FTLA 4LCJA 4OHOA 3JD1A 4IMRA 1IUKA 2IDKA 2VJYA 3HCPA 4P3OA 1NXTA 3MTGA 2Q5CA 2H7XA 4WLUA 4I08A 4N7BA 4EVQA 3DUFA 1OFVA 1FX0B 3RTAA 2AWNA 4GX0A 3N87A 1GG8A 2A58A 3C1UA 4PAOA 3AGQA 2CV2A 4BQPA 4F45A 1IFXA 3QMWA 3ECAA 4KZKA 4L8LA 3T5TA 4C6HA 2Z98A 2BEVB 1VRCA 4KXWA 4D80A 2FETA 1FTSA 5DV9A 3W5VA 2IPXA 4BZZA 1XZJA 3H5VA 4OM7A 3VKHA 3M6FA 3HZZA 2G09A 4BWFB 1T5OA 3I04M 3L4KA 1VI5A 2VZ8A 1PWYE 4AUKA 3BWEA 1YZGA 3GLRA 2FRXA 2DETA 4N18A 1G5QA 3QZUA 2OC9A 4KO1S 5DCUA 4EJMA 2NIPA 2BFBA 3EE6A 5H3CA 3QBVA 3PBKA 1D7AA 2CKDA 2HEGA 4RXMA 1A3CA 1F2TB 3KB6A 2CBXA 4HDKB 2ZVQX 2OGWA 3C0KA 2A5DA 3RVDA 5DM2A 1HXHA 4OY3A 2OR3A 4P6VF 4MWZA 2I3BA 3ND9A 1TAUA 4PQFA 1F14A 3KSBC 1BFKA 1WZCA 3GFBA 1FNBA 2Q4RA 3C98A 1Z16A 1Z26A 1CFJA 3EFEA 4EYSA 5JXHA 3D5QA 1KFBB 1S8OA 3KJHA 3TPFA 1I3NA 1KDVA 3ZK7A 4CLHA 4NY1A 1FC0A 2AH5A 2BGRA 2JH3A 4RLQA 4L1KA 1UBGA 4X44A 3ZHQA 2NUTA 1OYOA 1C9JA 3KD3A 5C81A 2YKGA 2QRVA 2DY1A 3LVBA 5SV2A 4AF8A 1RI2A 3TQIA 2FN8A 2O50A 3O03A 5D85A 5HJ2A 3NBAA 4MH0R 2NGRA 3D6NB 4X1IA 3L8CA 1Y8RB 3DMYA 4DBLC 1TU0A 4DJDC 5AVWA 2UUBB 3EHEA 1Q0QA 3KXPA 3TG2A 4QSHA 2NN3C 5AVZA 3ETDA 2ZXFA 5LA6B 5TR9A 1T35A 4YR9A 5BPFA 1CUXA 1GLGA 5FBVB 1CRQA 3LQ4A 1X7DA 3I2FA 1YIAA 2GD1O 3L7IA 3F6YA 4IHJB 5IM5A 4A91A 2JDIA 1WB9A 1V16B 3CZ5A 1AKEA 1JKFA 1P0QA 2ZYGA 1HDYA 3TOSA 2JD2A 4L28A 1RI4A 5JO9A 1WZUA 2B99A 4IYJA 4IUYA 2PPLA 4QPCA 2VDLB 3FNQA 3K1JA 4KFUA 5GIPE 4UUAA 4YJHB 3KVOA 2ZKLA 3VOAA 5CA0B 4KQGA 1PQWA 3RRFA 4JJ8A 3I6BA 3E0QA 4KX5A 4R31A 3RQIA 1L9KA 2SECE 3E2IA 3O1IC 4TV9F 5KDOA 2LIPA 3BK2A 3TDMA 1UJBA 2GCOB 2VCHA 5BQ3A 1NJSA 2XUJA 1O0BA 3FTDA 1FJ2A 4AO7A 2G6BA 1YSCA 5B7PA 2JGDA 1OREA 1VKNA 2JAQA 3LBAA 3M4ZA 3R0ZA 1RLJA 2GERA 2OHOA 4OA5A 1VJ5A 4IS3A 5FWAA 1IMOA 3DA8A 1P81A 3VH3A 4L75A 3VR6D 2QTMA 5JAPA 2NTNA 4FDTA 4V0NA 3WGTA 4BMZA 2HWWA 2DKFA 1FDRA 2NUAB 3THRA 4DMCA 1R5BA 3DHNA 3T1OA 1KEPA 4I1OA 1R4NA 1KYXA 4MA0A 3R7BA 4KOEC 1KSFX 3KQSA 4O0LA 5AESA 3Q8WA 1RKXA 3WLRA 2LWIA 3NP9A 1VI2A 2JLBA 1RWNA 1E7SA 3P52A 3SLGA 4UM8B 3T1NA 3U2QA 1DPGA 3EH1A 2J3QA 3ZE0B 3BXOA 2XA2A 2JIBA 2HB6A 4QT4A 3B36A 4N5DA 1J5EB 1DG3A 1DP4A 4JR0A 3E82A 5JS1A 1M8KA 5JXWA 4G9BA 3C5CA 4WGFA 1VP9A 3LF1A 5GVSA 1GV1A 1OROA 2B5OA 2CJYA 1FRQA 2XIQA 3ZHVA 4RSGA 3FMVA 1GPLA 1UPBA 2OMKA 1MGPA 1E32A 4B3FX 3HC7A 1U1GA 1YHZA 2H2WA 3UXEA 4PHGA 3PTAA 4REOA 1SB9A 3THYA 3Q7IA 1XHLA 3E61A 4EX6A 2BKXA 4IIYA 1TQ4A 4JI7B 1NHGA 5BXQC 2ZIEA 5A6SA 3N76A 1P0IA 3ZIUA 2YNMA 1Q0HA 3PFHA 2IP4A 4NHEA 2PUCA 3NAMA 3CF6R 4DZRA 2BP7B 1R9JA 5THQA 2COUA 3EQ7A 3WGGA 3UK7A 4JUAA 2O48X 4NK5A 3TI9A 4CG0A 2E89A 2J9GA 4RW0A 1KOJA 3R9KA 1QUEA 4V0KA 1GUDA 3P9XA 3JAWB 1T5DX 3ZDYB 1KI3A 4AF7A 4HUTA 3NR2A 5F51A 1ARZA 2IHZA 1KY3A 3DO8A 2XUZA 5JISA 3JASA 3LBYA 1A9PA 1R1DA 2XGMA 4KE8A 2PVCA 2PS3A 1UEXC 4R9SA 2M9MA 5B2ZA 1PS8A 1CUSA 3G0CA 4R1MA 5T4FA 3WK5A 3ZHYA 2QHXA 4CKBA 3FOEC 2PZBA 3GFGA 3H1TA 4B09A 1SY7A 1QO7A 2OKGA 2Y66A 4IAOA 3GNTA 5KQGA 2N42A 2EX1A 2HSDA 2HQOA 1NVXQ 1NNUA 2IIBA 2RHBA 3IKVA 3L6EA 3N2IA 3PE3A 3SWWA 2O8EB 1IJBA 3VUEA 4J3NA 1WXGA 2FU5C 3CM0A 5I8WA 3GLTA 4HYEA 4OVKA 4YGYA 4ZTUB 4QYXA 2Z0MA 2NU6B 4L73A 4BEBA 5AVSA 3C5WP 3PD0A 1VG1A 3FFWA 3OKCA 1UBMS 4K28A 3HCFA 1M2FA 2M1ZA 5CNMA 3S2SA 4EDFA 1XCMA 2CY0A 4B6OA 5FPQA 3BRCA 1HUQA 1W96A 4KIJA 3DEAA 1H2FA 3G5LA 2ROQA 3VOTA 3Q6MA 4B6GA 1NP3A 1HKHA 3DYBA 5L6LB 1JV2B 2XD9A 3KOXA 4U2GA 3OICA 1VE6A 4HNSA 1XDZA 1NAIA 3C3PA 1BW9A 1O6BA 3G0BA 3PL5A 3U9TA 3MM4A 4TXLA 3AJ8A 1BN6A 1LW7A 1SPXA 1V95A 2VK1A 3L5OA 4Q3BA 1OT3A 1QYVA 2FX3A 3I01A 3MYRA 4FDVA 4R7TA 3C7KA 4K88A 2H2IA 2PQ6A 4RX1A 1D7OA 1I10A 2VPQA 3PKIA 2HUPA 3HFGA 4I9GA 4NWIA 3QLJA 4S0ZA 1FNDA 2NZXA 2R62A 3MSXA 4E6EA 4HDSB 4FQ8A 4M7PA 1H0SA 2JGKA 4I0WB 3VYRB 2PX5A 4UATA 4YRZA 1RKVA 1V71A 1ZRNA 3L18A 1KEZA 4QL3A 2BRUA 2ZYTX 1IHYA 1M6NA 4YACA 2GBFA 1KHHA 1IM2A 3U6KA 1HY3A 1Z0ZA 1IEXA 3AH8A 3WLMA 4QJIA 3QBEA 4C0JA 3LQ2A 1RZ3A 1J7KA 1Q3TA 1W5SA 1BX1A 2WYUA 3KWJA 4HJXA 5AXCA 3GCZA 4BUCA 5L95A 2YCBA 3H0EA 3BB1A 1KI8A 4PN3A 4JJIA 1AA3A 2LDYA 4DJFC 4ETIA 3WFJA 4HDNA 3GHHA 1QQ7A 1CVRA 1G9TA 3DMHA 3G68A 3Q3EA 2GZMA 4I1RA 4WX2B 2GR9A 4E08A 5LNK6 3PQ5A 4B46A 4XEUA 1B8OA 5B4TA 1E9BA 4PNEA 1YZNA 5TV2A 2ZRFA 4DYVA 4XUDA 3A2KA 3WOHA 3KSUA 1NR5A 3UJ7A 4CMJA 4EELA 1YU6A 5BOSA 2YXEA 4S35A 5LR6A 5IT9A 2WG1A 1I0LA 3WVNA 5IKMA 4LJLA 4F4HA 2WU8A 1BC5A 3EMDA 4FW8A 3ZXUB 1GCGA 1VIVA 2BJHA 3HKBA 1P5ZB 2D2XA 4J49A 1EVZA 4PZ0A 2VXBA 3IQHX 4ALIA 4BO5A 4EEKA 3ONWA 3FCUB 2XAUA 3OU6A 5L53A 3P0EA 4BLQA 3M6XA 2PIDA 3DZKA 1C3OA 2I8AA 4K9OA 2M6SA 2W6OA 5KOIA 2IT1A 3NX4A 1SCAA 2JGLA 4NYIQ 2AJ8A 1AG9A 5EXDA 4OQZA 2NPIA 2O0LA 1A71A 4UCXA 1PL7A 2R85A 3NWPA 4XPIA 3CTMA 3IMFA 4OGLA 1ZONA 1IZZA 4X8MA 5GZ6A 2X3YA 2HLPA 3GT7A 4ILEA 4PF1A 4ARZB 3JS5A 4MUNA 4JLDA 1X9IA 1FYFA 1ZK4A 3CLUD 3S2UA 4D02A 4UNRA 4B3TB 5EZYF 3USES 1Z2AA 1Q84A 4RE5A 1MIHA 1PZHA 2QUIA 1NYTA 2A2ZA 4D5GA 3WIVA 5HDBB 2NP6A 1L7EA 2J08A 1X1AA 3VC7A 3F49S 4YRGA 2VL7A 1XKXA 4L5CA 1Z06A 3TR0A 3ZDXB 4S2UA 4BY9E 4AZVA 1LJLA 2YFKA 1CIJA 3Q2OA 1WCV1 4GXTA 4WRRA 4NMWA 4YAEA 1WW3A 2O1WA 4X63A 1UC5B 4KQIA 3ZJTA 2MMGA 1KEUA 4U7FA 1K4KA 5D1HA 3VJLA 3S4YA 3RK1A 5C7LO 5DXFA 1M1XB 4F5WA 1JEDA 1YS7A 2I7DA 5LZ2A 4GBJA 4MRMB 4Q00A 1DPFA 2WG2A 4LC1A 4U2DA 3WSTA 2H17A 5KPJA 1M9NA 1P4JA 1F12A 1M75A 5FAKA 2PMBA 2VA9A 1CDDA 1K98A 1E2UA 1WB5A 5DBFA 2Y0PA 3PDWA 3DT6A 4Z0TA 4CWAA 4AMZA 2R6AA 1SPBS 4MQMA 3HADA 2BGNA 2A9PA 3K05A 3MK31 4MEBA 2IW1A 2RGAA 1C4OA 2X42A 4OMFG 4P3YA 5CT5A 1EJ0A 2FCAA 3PHGA 3MCVA 4IF4A 4X41A 2Z6VA 2WVGA 5TQ0A 3GUCA 1SXQA 2A0XA 1ADJA 2OM2A 5HMMA 5GMOA 3AR7A 2HC9A 2X76A 2B69A 3FAKA 3KEOA 4JUBA 2HCJB 4QJ5A 3WGIA 1L5HB 2CLOB 2PH1A 2UZ3A 5H82A 1IAVA 3IIIA 3CHYA 4M22A 4JOBA 1W49A 3R7WB 1IQUA 4R7GA 3VISA 3VU3A 4HRVA 3B70A 3KSDO 2EFDB 3ICVA 4H1VA 5EUMA 3BREA 5BVHA 2A94A 3SM3A 1OD6A 5ALOA 3OOWA 1KR2A 3AY3A 1U2DA 3D3KA 1Q20A 1Z4MA 5D01A 3ZWMA 3BXGA 1CUUA 3N2KA 3NZEA 4WN9B 1XX6A 3FGPA 1KEVA 4X66B 3IHTA 3U60B 1KWGA 3IR7A 4O3MA 4MIOA 4OKNA 3H5IA 1AQUA 1IWBB 3WMWA 1RXYA 5BWMA 2FPKA 3HCWA 4INPA 4LHYA 5ERYA 5BRNA 1L4BA 2MYUA 4YT4A 4MWEA 4A82A 1E6CA 2AG8A 5HZHA 2CB0A 3CEJA 5LQJA 2FYTA 5J2UA 4IDPA 4BVAA 4NOLA 4OL0A 4V3CA 4KGZA 5K4AA 1U3DA 4HHEA 2G82A 3MQFA 1AQ6A 4ZT6A 1JJFA 2GO7A 1GVNB 2L69A 3DWIA 3A1DA 2OWEA 2WV7A 2XDYA 4XCVA 3FRJA 5I9SA 1XDGA 3Q40A 4Q82A 4WY5A 1XELA 3HWWA 1KORA 4CF6A 2J3EA 3MNFA 1A8IA 4ZYYA 2Q3DA 1RPJA 2YZNA 5L8VA 3KKEA 2QGNA 1F48A 3UWKA 4DV4B 1EFPA 3GA7A 1VE5A 3BF7A 5F12A 3FR8A 2DOKA 4BMNA 1L1RA 2P2ZA 2CUKA 4JXXA 4OXNA 5HDQA 4I4TF 2NQ8A 1Y7PA 4WEQA 4YMHA 5H4GA 4MMXB 5DF1A 1G0OA 1ZL2A 4KVAA 4L78A 3TECE 3G17A 3BTVA 4A8HA 1GSIA 4E09A 3RCBA 2W2PA 2I6QA 4I1SA 2WHPA 5LXTF 8LDHA 2CJWA 3GJRA 2RCNA 1IB6A 2WA1A 1WX1A 2HLNA 3HVKA 4HSEA 5GWXA 1VMKA 1AKTA 2IC5A 5DKFA 3GLGA 5G53C 1WXQA 4IOLA 4UHCA 2JRBA 2G63A 2CUNA 3HUUA 3T52A 3WTCA 1IQPA 1JF8A 1RLUA 3IVGA 2PSHA 3MTJA 1O7JA 1E4YA 3QKIA 4BP3A 4CN9A 9LDBA 2EDCA 2IPMA 3IIKA 1OFGA 4BWVA 3L0BA 1Z2CA 3OIDA 2ANCA 4GKKB 1G9XA 1I0IA 3WYBA 1WQ4A 4G0XA 1DNPA 3CKMA 2OSVA 3CUWA 2ZRAA 1WHTB 2W4MA 2I6FA 2RONA 4PSAA 4PLWA 2V9CA 3L07A 4HRXA 1M6YA 1A9XB 5JS8A 1DIRA 5B12A 5EPUA 3H16A 3P2KA 3PLRA 4NP6A 2E1PA 2XVYA 3K31A 3UV3A 4P93A 2Y1KA 4XZ3A 1AGRA 2OHIA 3GJ8A 2HA0A 3HKDA 5A5FA 1RS0A 1XXHA 5KQRA 4TWJA 5GONB 3RU7A 4G2TA 4AVYA 3IP5A 1HNZB 3PWKA 4XDHA 3KPJA 1SQ5A 1ND5A 2X9VA 3UOWA 4OHMA 3I6YA 2CK3D 4C3UA 4CKWA 1Q3KA 4C4ZA 1LVUA 3W6OA 2Z3ZA 4NEHB 3TKAA 3TQCA 3BA1A 1JQEA 2BZ1A 2WABA 5B3JC 3NUZA 5D3KA 3F98A 4CL3A 1GUBA 3OHMA 4M8LA 4YFYA 2XH8A 2P4EA 3WJ7A 1JU3A 3PJDA 3A6DA 5KTKA 1AIPA 1XT6A 3WGJA 2XBLA 3PI6A 4JJKA 4CIYA 1EVEA 3EX7C 1GTL1 3LPAA 4AXXA 1QOPB 3ETGA 3A1NA 3V46A 2ZE8A 3IV6A 2K7ZA 3LHFA 5CLQA 1EG7A 1JYSA 5ALIA 1M2VA 2YVAA 1OBCA 5G40A 4ZI7A 2VDMB 3CNEA 3SJ7A 5JUWA 2W83A 1KP9A 2O8CB 3F2VA 1C4KA 3DWFA 4WCVA 3SC4A 2QB5A 5G41A 4IQGA 1A5AB 3OFKA 9GPBA 5B6IA 3C15C 2QP3A 4CEHA 3K6SA 1NY5A 1Z62A 1H2YA 4G5GA 4B48A 1DQRA 1M6EX 1NSFA 1V9CA 3V7YA 3WLFA 5DFAA 5JS7A 4Q3LA 1G5IA 1QF7A 1FFSA 4PC2A 2QTBA 4GI5A 4F93B 1SCUB 2AYZA 1PFKA 2PTHA 3DMFA 3UJ3X 2DVMA 1TYCA 4BNDA 2F1IA 3OEHD 3CFYA 5FQNA 1E4EA 2OKCA 3ZLJA 3X0DA 2Y71A 5ALMA 3TCNA 3AL0C 4JU8A 2CV1A 4HMPA 1FCJA 2M6KA 4KP7A 3LX5A 1F2UB 2AFVA 2P2LA 3B1FA 4BN5A 1X14A 3V3KA 4C0HA 2DEUA 2RGEA 3PFGA 4YMGA 1J8FA 4HZIA 1F8XA 4LIPD 2PIAA 2IBSA 1QKJA 1HT2E 3GLUA 4PPNA 1HLDA 4GH5A 4ZOEA 2QM3A 4QDJA 2X5OA 5C0OE 3S68A 5B3KA 2C2GA 3TZQA 2HQBA 3WK7A 5KNBA 5LDHA 4MGIR 2K6GA 3MMPA 1N0WA 5E2IA 4D9FA 3MWDA 1YBHA 2Q1SA 1HGXA 1QCZA 5KCMA 2NTVA 4K9SA 2YR0A 4QUAA 2UYOA 4NATA 5G02A 3VX3A 1Z4NA 2BMFA 1R8YA 3TIIA 1IIBA 3O31A 3OZUA 3SF8A 1PLLA 3ND8A 1AD2A 1DCFA 1VOTA 2K2WA 1W2WB 1G59A 1BJRE 1FW6A 1D0SA 4BTLA 1GAWA 3F7MA 1X7XB 2Q46A 1U4OA 3AL2A 2PUGA 1CS0A 4Y2YA 1NVAA 1WO8A 2KLHA 3IXQA 5LDDC 3HLKA 3CLSD 1ZDMA 2WIGA 4RVNA 1BCRA 4MQFB 2WSYB 4U6SA 1P2TA 5JAQA 1Z5PA 2OWDA 5EHGA 2P68A 3CZPA 2HBRA 1NW4A 3HSKA 3MT9A 3KHSA 4HLQB 4L76A 1RXIA 3CT4A 3EUEA 1L7AA 3EVGA 4TTQA 1QIFA 2VHQA 3WWPA 4KTTE 1TAHA 3K9GA 4L5IA 2GLTA 1I4TD 2O0KA 2PMWB 1EXMA 2RGNA 2WMYA 3HXMA 3FNHA 4NS4A 3CJQA 1UKYA 2FEMA 3TSOA 5JNTA 4R0NA 4MWCA 1STOA 2PQ0A 4Q3EA 5LMCA 1JQDA 2O3UA 1W59A 3CE9A 3TZKA 4Q6BA 5BY2A