1MO4A

Reca-atp-gamma-s complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
324
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords RecA
total genus 89
structure length 324
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo4A01
4LC1A 4PSVA 2WOOA 1E98A 3FHCB 5FBQB 2ZEJA 4PHHA 2PLRA 2F3RA 4KSBA 4GMXA 5CDFA 2FEOA 3KJIA 1NF3A 3BC1A 2F9MA 4M22A 2BIFA 5HE8A 3HDTA 3QE0A 2BJWA 2GHIA 1KI4A 3AUYA 2NO1A 3W6NA 3CRQA 1IY0A 2Q9AA 5FTNA 1E9AA 1VECA 3E70C 2GTPA 4TYWA 1VHTA 4QL3A 4HATA 3CZQA 1P9RA 2HLDA 5KNBA 4DZZA 2IUSA 5DLQC 4MITA 4Q7MB 5JEDA 4B32A 4N1AA 4QBFA 1E79D 3W5JA 1XMIA 2VF7A 1IXRC 1Z0IA 1G4UR 2HDNB 1G17A 1WDTA 4RSGA 1KSFX 1W36D 4LJ7A 4X8HA 3RS2A 2YWHA 2GNOA 1F5NA 3AVOA 1RFLA 4NBSA 3AF1A 4UQOA 1TQ6A 3X1ZA 4HAUA 3Q5EA 4N0DA 3GLIA 1HV8A 2XAUA 5LB2A 5FTKA 4LYHA 4PSAA 2EWVA 5SZHB 2HEIA 2F6RA 2FG5A 4Q4HA 3THXB 4TMVA 5JS7A 3I3SR 1DEKA 1AIPA 1OE0A 2OAP1 1R4AA 1MABA 2P67A 3AV0B 3K9HA 5JSZA 3T1OA 2P5TB 1OV4A 2VL7A 3D31A 4DUGA 3BERA 1COWA 3KKNA 3AGQA 3H86A 4JLDA 5HZKA 2YOHA 1YR9A 2F1RA 2XB4A 3RYTC 2MSEB 3QVUA 1FTNA 4B76A 1ZVQA 3NBYC 4DLXA 1PLJA 3NVAA 4KFTA 4FW9A 2OESA 3TAUA 1BKDR 2FEMA 2C99A 1XRJA 2GK6A 2J59A 1JR3E 2CHGA 1G3QA 4D6PA 2JLQA 4HB3A 4AG6A 5KPJA 2PH1A 1CEEA 1XJCA 4NYIR 3C8UA 2NG1A 4BFZA 3L8YA 4ZV4A 3I73A 4MUBA 3NDPA 1E9RA 4PXAA 4ABYA 2WPDA 1CR0A 2YJTD 1E2NA 1OSNA 4S35A 1JI0A 2ZIAA 3QEJA 1IN5A 2ZYVX 5E7IA 2FGJA 1VYVA 4RZUA 1TF7A 2R8RA 2XGJA 1XB2A 3FTQA 3GFPA 1XXHA 3DM9B 4AYTA 2ORVA 2DWOA 1UBEA 4BPBA 1OH6A 2A78A 1EK0A 3JZMA 2ANCA 2NO9A 1XBTA 3EAQA 5FBLB 3BB3A 3SC3A 1MV5A 3LY5A 5HTKA 3THOA 3KTAB 5B58C 1FOEB 1SHZA 3DEFA 2JLVA 5DN6D 1IY1A 1TL7C 1XJ0A 3A4NA 5AJVB 2ZJ8A 4EAQA 1HE1C 3IO5A 5D3MB 3K9LA 3MCAA 1G7SA 1NBMA 1W0KD 5IHPA 2IHBA 4NCNA 3EPHA 5AUPB 3WP0A 3CO5A 4ZPXA 4GZMA 4ON9A 3DKVA 4EPXA 4MYTA 1P61B 3P4XA 5G53C 3IIKA 2VBCA 1JEEA 3EG5A 3CRMA 3MRSA 1JEDA 4M0LA 2OUKA 3U6KA 2ZROA 1IOZA 1N6OA 3TK1A 3UWKA 5AR1A 3BS4A 2OFOA 5E4FA 3CW2A 2EFGA 4KODA 2O8CA 4ZDIA 3AF2A 2RGXA 4GOXA 3RLFA 4URXR 3JZAA 3OF5A 4B2LA 3A37A 4FMCF 4FCTA 4LHWA 1J8YF 3QPVA 4JVNA 4XWKA 4Q1AA 1E2IA 1Z28A 2ZU6A 1D2MA 5FI0B 3ADBA 2JLXA 4A8JB 5EE3A 2HXYA 2P6UA 2FMXA 1XD2A 3FKSD 3KFXA 4URVR 1E1QD 4BFTA 1OB2A 4LC0A 1XTKA 2OLKA 2GVZC 2CL6X 2V1XA 3EXAA 4MGYR 3WBKA 5C4MA 2SHKA 1XP8A 5EE1A 2GZDA 3PQCA 2C03A 3WRXC 4MYHA 2I4IA 4CEJA 2QZ4A 5G41A 3X1YA 5FFMA 4JJZA 4M4SA 2O8FB 2CE2X 1T0HB 1G8YA 4Q7JB 1KI8A 1PJRA 1UBGA 4OQNA 1MKYA 5DH9A 3RDPA 4LYAA 3QPWA 3WNCA 5LD2C 1S9DA 1SXJE 3AVWA 2QGNA 2ZJ5A 1XTIA 5AUQA 2CLCX 3CIOA 1NSFA 4BWYA 4B48A 3FHTA 1LNZA 2QRZA 2AR7A 2OCBA 4LZZA 2A30A 2F9LA 3ZVNA 1Z08A 2HT1A 2IS6A 2WAXA 2ZRIA 2WIBA 2LKDA 3BRWD 3AH8A 4TLEA 4TT3A 3K0SA 4P32A 4TYNA 1VG0B 2P65A 2VP0A 1COWD 2ZS7A 2NOAA 2E9SA 3RANA 4EQ6A 3HU2A 4KVAA 4A2WA 3M4YA 5TXGA 2BWJA 4L8GA 3CRVA 1U2RA 1F3OA 4HLQB 3HR8A 4TSFA 4US1R 4EDHA 3LBHA 1CULC 1E1RD 4RD1A 4EJSA 5EP3A 3SQWA 4A8JC 3QSYA 3RS0A 4FWTA 4V0OA 3M0EA 2BBWA 1R6BX 2QMUA 1W7AA 3BFVA 1SXJC 1ZP6A 3CWQA 4CGZA 4B75A 1KI6B 5LPNA 1BMFA 4L16A 3EX7C 2YWGA 4KFUA 4NCJA 2EU8A 2FE4A 3VTKA 4D0NA 4JLVA 5KYKA 2N42A 1E2FA 2GAAA 2CNWA 2PCLA 4K81B 3SU8A 4YXWD 4A9AA 1CR4A 4G1UC 4PSKA 3KKQA 1NBMD 1KJZA 4TTQA 4G5SA 2ZS9A 5FOXA 3CPJB 3DMDA 1FUUA 4QRHA 1XX6A 1M2OB 2Q0HA 4QHSA 4ZKEA 4O3MA 2JGNA 4PHTA 1ZYUA 5EE5B 2ONJA 4B74A 2ORWA 4DCUA 5DISB 5AJXA 2BCGY 4ACBA 5FUWA 2I3BA 2FOLA 2FGKA 4W5WA 4WZAE 3LAWA 4DLZA 1LS6A 2O8FA 1XXHE 2V7QA 4M21A 4EFLA 1T6NA 4QBGB 4YMWA 3K09C 3SHFA 4QM7A 1OFIA 2IEZA 1E32A 1LV7A 1GL9B 4MA4A 1XNJA 4NCKA 3TNFA 3J81k 2OCAA 2QTVB 2C96A 1YE8A 4AG5A 4PHGA 3NDBB 721PA 1QG4A 3U3OA 5TDHA 5UKDA 3SYKA 4CZ2A 4HAYA 4B6FA 1X86B 4LHZA 1WMSA 4OBEA 4JBXA 3QNUA 1ZUIA 1YZUA 1KSJA 3CLVA 4BLRA 4URUR 2QQEA 2FSGA 1ZM3A 4KJZA 3SDZA 2ZRFA 2WM9B 3SN6A 1UBFA 2EFDB 1F2UB 3SFVA 4C2TA 4DSTA 1P2VA 2J9RA 421PA 4WVFA 4Q7LA 4QGGA 3QKSB 4EUNA 4GL2A 3B5JA 1FTSA 2NIPA 4D4KA 3Q72A 3OE7A 2QUZA 1G3IA 2MMGA 2R62A 4CEJB 2EWWA 2WJIA 1G7RA 4TYPA 3MWKA 3Q7QA 2GJ8A 2WSSA 4NYMR 4IOMA 5B30A 1RIFA 1GWNA 1C1YA 4KI0A 2C9CA 3NH9A 4A82A 3IEVA 4PPNA 1IN8A 1JBKA 1LVGA 1R5OA 1P2SA 2XTNA 4Q9KA 4UNPA 4PZYA 1G8PA 3KXKA 4M9XA 5L3SB 1QHHA 3AP3A 2YV5A 3A1UA 4FWIB 4LPSA 4NH0A 1F2UA 4BQSA 1E2KA 1PZNA 1KAOA 3CUEF 1E2GA 4DDUA 1VHLA 4WIAA 5H8WA 4NYMQ 3B60A 5JRJA 2WKRA 4Q03A 2Q3MA 4PANA 4PTLA 1P2UA 3UANA 3CPHA 3IBYA 4OL0A 3W34A 1UBCA 2PEZA 3N2EA 3K8YA 4FD2A 2FFQA 4OI1A 5SZJA 5CIWA 1NRJB 1MR3F 4IDNA 4HZIA 1KKMA 1U90A 3DVLA 4JS0A 3ZD7A 1FNMA 2XSZA 4Q9HA 3IHWA 4JLKA 2ZJAA 2WAYA 5EJEA 2GK7A 4FINA 3Q5DA 4Q21A 1SVKA 4FMDB 3SI7A 1NP6A 4AK9A 2PBRA 2CK3A 4TLDA 1B23P 2ZI5A 3FYHA 2ZQ5A 1OXUA 2IA5A 4CT5A 1KI6A 1AS2A 4P4SA 4B73A 4YQFA 4L4UA 1GNPA 4DLYA 5IDVA 2IXGA 3EARA 5CLLA 3T1TA 1WE2A 4Q01A 1P5ZB 4Q4HB 4TQAA 4XJXA 3THXA 1ONBA 3B1ZA 1KAGA 2AHOA 1FP7A 1XEFA 3RABA 3ZH9B 2Z83A 2ZR0A 1W0JD 4JLJA 3QOFA 4HB0A 3SS8A 2GDJA 5M04A 4V02A 5JWRA 4YDSA 1KI2A 4KYIB 4ZI3A 2IYQA 2ZI6A 3ZZUA 1P4SA 1G6OA 2WBLC 3QF4A 4NL4H 3PV0A 4JIMA 2REBA 3LX5A 1N6PA 1WF3A 2BOVA 3AF0A 4JLPA 3TUIC 3TAHA 4TLCA 1E0AA 2QM7A 1T3SA 4GP6A 5KSOA 3KB2A 1OB5A 1I4LD 4GT1A 1GRNA 1JXMA 1K5GA 5B64A 2VHTA 2YOGA 5DI9A 1FPMA 3QXXA 1DAIA 2IWHA 3B2EA 3EA0A 3GEHA 4OK5A 2ZTSA 2WSSD 1U0JA 4M2LA 4HI0E 2GXSA 3L0PA 3L0SA 1FP6A 1MH1A 4ZO4A 1EG7A 2DHRA 3NEYA 3I5XA 3RC8A 1LFDB 1DAFA 2GJKA 5K8TA 1ZNXA 3TE6A 2AKAB 2Y8EA 4A2QA 4EJSB 1CBUA 2CLSA 1YR7A 5IRCD 3A1VA 1E99A 2ZRHA 4CF7A 5J47A 1G16A 1SVWA 2IYTA 4C0QC 3GEIA 4BEJA 1QHYA 5FR1A 4E22A 2XZLA 2YINC 1IN7A 4D4JA 1P72A 4B2PA 4PO8A 2JLRA 2JATA 4P31A 1NN0A 1GKIA 1QHIA 4BLTA 1U8AA 2ERYA 2J7PA 3VMFA 3U4QB 1X8KA 1CIPA 1N6LA 2O5VA 1C9KA 2ODWA 4AY2A 1TTTA 4Q9JA 5IK2A 5FOTA 2ZYWX 3B1VA 5EP1A 2A5YB 5AUNB 4P33A 3W3ZB 5JEEA 5EXXA 1CJKC 1Q21A 1MOZA 4H9GA 3CBQA 2DFTA 2RGGA 2OSBA 3LQQA 3AF3A 5FI1B 4BFYA 1UKVY 3ZQJA 4A6PA 2CVFA 2IL1A 4M1YA 3VKHA 4HEJA 2D62A 1GKYA 4KHZA 5DYGA 3KKOA 3LW8A 3DOEA 2LCFA 3K1JA 3LBIA 4PC1A 4U00A 1UAAA 1OFHA 2IW3A 2W58A 2XX3A 1W0KA 1ZMXA 2WZQA 2EQBA 4BZQA 1TQ2A 4J0QA 5KO2A 1Z06A 3K53A 3I8SA 2REXB 1S9HA 3L0IB 4BLSA 1Z3IX 3HR7A 5JHHB 3B1YA 3F5FA 1TAGA 3I5YA 1GUAA 4DIDA 2P6NA 2ZRGA 4PZZA 1KO4A 4Q48A 3AKCA 2WTUA 3TSOA 1BMFD 5JWHA 4RZXA 3QUSA 4LV8B 4GSYA 2B7BA 2QY9A 2LKCA 3HP1A 4OKSA 5FUXA 4EIWA 4JBYA 4ARZB 3U7HB 1W46A 2ZSFA 2ODBA 4M9QA 2EYQA 5HPYB 3D3QA 5JS8A 5K8LA 1VIAA 3SR0A 1MO5A 2QROA 1IXSB 5AUOB 1C4OA 1DAEA 3IUYA 3U5ZB 1CF4A 3MGCA 2OG2A 1US8B 1UKZA 1L2TA 3FKQA 1ESMA 2JLZA 2GJ9A 3IQWA 4F4CA 2ZRPA 1TMKA 3F3YA 4I81A 1N5IA 4BFXA 4XVRA 2DCUA 4TLAA 1PUJA 1RJ9A 4G5RA 2B8WA 4QG7A 3ZLJA 2UKDA 4GZLA 4AURA 2R6CA 4DCNA 4FCVA 1VIYA 3U7EB 2R6GA 2ZREA 2ATXA 3ADDA 4IW3B 1XTJA 2FH5B 2QA5A 3C14C 4K8OA 3RRYA 1RRPA 3QQ5A 2IYXA 3PENA 3H4MA 3K0CC 1UKYA 2WICA 2VP2A 2FV8A 4PX9A 5C1BA 5FOUA 1RPZA 4LBZA 4IDHA 1W36C 3K09A 4NPHA 1LB1B 2X19A 1VG9B 3W3AA 1PLLA 3TUZC 4U7DA 1XCMA 4C7OB 1AA9A 3RHFA 2OT3B 4GPTA 4CEIA 2KBEA 3TBKA 2JJ2A 4QM6A 2IUTA 1UPTA 3IDQA 2JJ1D 4B34A 1EESA 1T8TA 4G5QA 3RNLA 3HYTA 3UATA 2XOKA 4YMSA 2QMOA 2B8TA 1GRRA 4MKIA 1TF5A 5FUYA 1KI7A 2J5XA 3AB3A 3ZQ6A 2O8EB 4XTCS 3LH5A 4GOKA 2CBZA 4EPRA 4ZCMA 4E09A 3TUJC 2YWEA 3L82B 1ZAKA 2ZSAA 2G3YA 3IEUA 2HLDD 4PHFA 5KNCA 3EC2A 1WP9A 4MGZR 4JLMA 4DWJA 1CR1A 5HE9A 3LLUA 3OZXA 3VR3A 3H1TA 4Q18A 5DE3A 4ASUA 2YC2C 2R65A 2QTFA 1XCPA 2PT5A 3IIJA 1Q3TA 4M9SA 3NC1C 4KVGA 1O87A 1E2DA 1OLOA 2GBLC 1OT3A 2NZ8A 2PMDA 2VP6A 2VSFA 1IN4A 4MRSA 4D4MA 1Q12A 3QIAA 1Z29A 2XNDA 4B71A 5E3HA 3PJRA 3B6EA 1TEXA 3AKDA 3MAAC 1OKKA 4LY6A 4LPKA 1Z0DA 3ZGXA 4UJ3A 3VFDA 3AVQA 2ZRCA 1Z83A 1Q57A 1Z6GA 5F3WB 1KDTA 1NMYA 2X77A 1CRQA 1HH4A 3FFAA 1W44A 2IYSA 4UXIA 1UJ2A 1QVRA 2EW1A 2O0JA 4IEEA 2F1IA 2H8KA 4LJAA 4TZ6A 4M1MA 4HB4A 1F48A 4EKDA 5IT5A 1XEWY 3OESA 2A9KA 2KE5A 2BEKA 2BCJQ 1ANKA 1G8GA 2AL7A 4V0LA 5EQTA 1RVDA 2RCNA 4XWAA 2ZYUX 5FL7A 2OEPA 2BKEA 4DHEA 3ZVMA 3KQNA 3TW8B 3KDSE 2D7DA 1VPLA 1R0ZA 1DOAA 1HQCA 1D2EA 4QNMA 1OFUX 4TQ9A 5FOWA 3T1QA 3FPAA 3SNHA 3UKDA 2WMNB 4DSUA 1VCNA 2OFWA 1U81A 4RD2A 4DCTA 1WA5A 3UXMA 4ITRC 1NLFA 2XITA 4X8OA 1W47A 4N0EA 2WWFA 2VQSA 1II8B 2BC9A 2CJWB 1JNYA 1JJ7A 1KDPA 1OXTA 4QKQA 3K9NA 3OFNA 2WWIA 4AC9A 5JWOA 1Q0UA 1DAKA 3U3MA 1FQKA 2H1LA 4RFSB 1N0WA 3ZIAA 1J70A 5HKKA 3GLGE 1E96A 3W6PA 1RJ9B 3BH7A 3OIWA 3G5UA 4Q00A 1FQJA 4WXPA 4QOSA 1HURA 3ONWA 4X8LA 1ZU5A 1TQ4A 2NO0A 1J99A 4IFBA 3TKLA 1ZIOA 4QXAA 5L3VA 1IM2A 1RYHA 4DXAA 1P2TA 3CRW1 4NU0A 4XWOA 3KTAA 5JRZA 4P0TA 4D0LB 2KSQA 2GXQA 3T15A 3QXJA 1ZC3A 5JI2E 1OHHA 1TNDA 2WHXA 3WYFA 2CHQA 4KFSA 2QN6A 2ZSBA 3NC0C 3P4YA 2CJWA 2ZXUA 2IYYA 4HZUA 3PFIA 1WXQA 1ZNZA 3VR5A 3QG1A 2CCJA 3K0FB 3QKRA 3WY9A 5DIFA 1OH8A 5HCNA 2W0MA 1SVLA 1YKSA 3EASA 2DFKB 1SZPA 4B3CA 4WZ6A 1Q1QA 4PC2A 1NN1A 1QVAA 3FHOA 3M1IA 4NYJQ 4OYHA 1D6JA 3QENA 2WKPA 3LV8A 3BFXA 3ZZTA 1TF2A 1GITA 1N5KA 1R8SA 1XZQA 3NG1A 2KBFA 3LLMA 1BOFA 1Z63A 3BXZA 3RS4A 5AK0A 1D2NA 5FPKA 1EFTA 4Q19A 2ZS8A 1L8QA 3A8TA 3HWSA 3KUDA 4E5UA 4ESVA 5G3YA 1G291 3RAPR 4H1VA 2ZE8A 3EC1A 2ODEA 2OCYC 4B44A 2O52A 1U9IC 5H1YA 1ETUA 3KJGA 3AQ4A 3H2YA 3C5HA 3ZVLA 1XTRA 2V6IA 4LJ9A 2W6JA 4GRAA 2XZOA 1M74A 4L9WA 4DJTA 1MABB 3U4QA 1R10A 1ZRHA 2O8BB 2XXAA 3OFND 1P62B 1VCIA 1S1MA 4TYQA 2VHCA 1A4RA 2GRJA 3KJHA 2VHUA 1US8A 3PUVA 4LI0A 1OXVA 5CJ2A 3P20A 3NXSA 1QHNA 4D0GA 3LVQE 1FMJA 3NBZC 4KAXA 4LJYA 2W2XA 4V0KA 2RGNA 1HEIA 1Z0AA 4NYJR 4QC2A 5KSPA 4PO9A 1SQ5A 5E95A 2Z5FA 2WJVA 2W2TA 3UMRA 1AGPA 1J8MF 2QAGC 2QMHA 4PQRA 3GLFA 2F55A 3B1WA 2JASA 1A2BA 4Q1DA 3OIYA 1KNXA 1P75A 3MUFA 3C41J 4I4LA 4AKHA 1XEXB 4Q4JB 1ELOA 1AA3A 1XMJA 2QQ0A 1EWQA 4RJLA 3FFBA 1ZM2A 2GA8A 2ZRLA 2O8BA 2V6JA 2J46A 1OF1A 1ZD8A 2IS2A 3KB1A 4JT4A 1KO7A 3IKJA 1CKEA 2ZI3A 2O0HA 2IYLD 5DHAA 1KOFA 1M7GA 1S3SA 2QENA 2ZPTX 4XIGS 3E1SA 3SYNA 3B9QA 4LJ8A 2W83A 1XMSA 3BH0A 4L9SA 2OLJA 3ZJYA 2CXXA 1NG1A 4DCVA 1EFRD 4GMDA 3CF0A 4HAXA 3THWB 3QXHA 1XD2B 3QJYA 3GJ6A 1RE0A 2FPKA 1VYTA 2BM0A 2Q3HA 4Q9IA 4C4PA 5LB4A 1Q1ZA 2P5SA 4KLZA 1JB1A 2FPMA 5KDLA 4JSTA 4CEHB 1AN0A 1QF9A 1Z6TA 4CDGA 5IF9A 3R9XA 3IPYA 1YR6A 1XTQA 3NBFA 4M8NE 3RS5A 2J0SA 4EFMA 1JECA 1II0A 1ZD1A 1ZIPA 3ZDQA 5KDOA 1H8EA 2OXRA 3IHLA 1XJQA 4LGMA 4O2RA 3CH4B 4KV9A 3K0CA 2ORIA 3WRYC 1VG8A 821PA 1EFUA 2G1KA 3MFYA 4IOLA 1UF9A 1NN3A 3AVPA 4I1SA 4R71A 1LTQA 3KQHA 1A1VA 5FBVB 2J3EA 4F91B 2XOKD 1G6HA 1ESNA 5JCZA 3EZ2A 2JJ1A 2YWFA 4D82A 2IBMA 4MRRA 1FX0A 4DKXA 2WV9A 4IOJA 5HR5A 2Q9CA 5FTMA 2J41A 2GEDA 2ZRNA 2E1RA 2P0EA 4D2IA 5KSZA 4TQUS 1JR3A 2IT1A 1BIFA 3VX4A 1HA3A 3LNCA 2GVDC 1T3LA 2BM1A 3CNLA 4YC7A 3AVXA 1FFHA 1WCV1 1NIJA 4Q4AA 3FDIA 4C3ZA 2D06A 1DG3A 1E9SA 3AF4A 1NLZA 2BVNA 4P4UA 4B43A 4DT1B 2XTZA 4II7A 4W9MC 1X1RA 2KB0A 4NHOA 3VU9B 1NIPA 5JFGA 5DNYB 1VCOA 3OEED 1WQ1R 3ETLA 4V03A 3X1WA 4BASA 2ZRBA 1M1YE 2GILA 2ATVA 4BZPA 2WWGA 4G5GA 5D3MA 5EUMA 2JEOA 4JYBA 3KQLA 1Y3AA 3N5CA 2PLFA 4C0AC 4U5XA 2H5EA 2OAQ1 2ZE5A 4DLVA 3CF2A 3FVQA 1FL9A 2PZEA 4HLDA 3IQXA 4MDEA 2ZYTX 1CJMA 2AD5A 3VX3A 5KU1A 2BMDA 1GIAA 3EWSA 1E69A 1UADA 1TX4B 2GJSA 3GFTA 2XNSA 1W4CA 2W00A 4POAA 1IY2A 5L3SA 1JXOA 521PA 4KCGA 4DLRA 1QRAA 4A4DA 5BYJA 5GJBA 3T06B 2ZSEA 4G5OA 2HUPA 2O8DA 4TMWA 2ZVPX 5EZ5A 1F6BA 3R7WA 2ZRAA 1BYIA 3MMPA 3ZZ0A 3V4FA 2UZ3A 4OQMA 1AQYA 2PJZA 1KJYA 4BFWA 3S1AA 2KWIA 3BB4A 4JZKA 4DLUA 5TVKA 4NYIQ 3CX7A 2R6AA 4PPGA 2X2FA 1HUQA 1D9XA 3GJXC 4OQLA 3DPUA 4QBHA 3VQTA 4NTZA 4B3GA 2YOFA 3GCGA 1RRGA 3AGPA 2VYFA 1GFIA 5CB6A 1XCGB 1VMAA 3E2IA 3FKSA 2A3RA 1QDEA 2XJ9A 4C0KA 1W4AA 2BMFA 3H0KA 4I99A 2C04A 3LWNA 1XD9A 4KO8A 2LWIA 2GWHA 4XSGA 3P27A 5A4JA 2QM8A 2AWNA 3TR0A 4PC3A 3GLGB 1H8ED 2V1UA 4MKHA 1EFHA 1NLYA 1NI3A 1IJEA 1U8ZA 4HDCA 3C15C 3HU1A 4ACAA 5J4VA 4O0MA 2QMEA 2QE7D 3TSWA 3TQCA 4OHWA 3QXCA 4S2EA 4QJ4A 3Q9LA 3GFOA 2CL7X 1OIXA 3BK7A 4QJ5A 4R2IA 1KSGA 2QT0A 3RVBA 3TQFA 4LYJA 5KPDA 1AS3A 2QPAA 3A1TA 3BB1A 4YDHB 3MSXA 3AVUA 1R0WA 2JLYA 1G4AE 3CX8A 3K9GA 1U98A 2L0XA 8OHMA 1Z2AA 1NMXA 2J0UA 5KSYA 5KNDA 3E5HA 3VR4A 1XFAA 4HLUA 2EFHB 4O2LA 2Z4RA 1AGRA 1OIVA 2IYVA 3K0AA 1S8FA 4LV6A 4OHXA 4EPWA 4M1SA 4RKFA 1NKSA 1RRFA 4DBLC 3CNNA 3GJ3A 5J4HA 1XTSA 4BFUA 4UNRA 4RD3A 3VHXA 4QGFA 1BS1A 2MSDB 1GNQA 2FDCA 3SFZA 3SHWA 3IGFA 4NE2A 4Q02A 4Y0VA 1YJ5A 1Z2CA 3QKSA 5FPHA 3UG6A 1G3RA 4V0NA 1YQTA 2NO6A 1GDDA 1YU9A 2VH5R 1Q1BA 1ZD9A 5DI3A 4D81A 2PCJA 3AKEA 1N6HA 1OXSC 3SQXA 3K0FA 4ZDJA 2R44A 2EFEB 2GXAA 2ZAMA 2AK3A 3UWOA 2G0TA 2H57A 1KK1A 5J4KA 2V55B 1W4BA 1E0KA 3CONA 4G3XA 3X1XA 2YHSA 2Q6TA 3TH5A 3TGPA 1ZJ6A 2VPPA 4R9UC 2QL6A 4JL5A 3GLHA 2C78A 3PEUA 4UNQA 2FX3A 3D8BA 3OEEA 4EPYA 1TUEA 4DLWA 3K0AB 4DIEA 2NGRA 3OEHD 2O0KA 5F9FA 3L2OB 5JLJA 4QJ3A 1SKYB 3BIFA 1Z07A 2YYZA 4Z1MA 4B3XA 5EP2A 2VIIA 4IEIA 2IHYA 1JAHA 3JVUA 3ICQB 1U8YA 3LO5A 1W2HA 1S3GA 3ADCA 1KTVA 3VR1A 5DI3B 1MRSA 4UXJA 3FMIA 4Q1FA 4FMDF 1UEIA 1N5JA 3IO3A 5CYOA 1NNEA 2QBYB 1FNNA 3WHKA 2RMKA 1IXZA 1KSHA 1DBSA 2VA8A 5SZKB 3OAAA 5TMPA 2RKOA 3Q3JB 4IVRA 1GL6A 1Q1EA 1RW4A 1T5IA 2F1JA 3MJHA 5GJWC 3JVVA 4ZCIA 3LXRA 1LF5A 1KMHB 4QFMA 4HLCA 4A0FA 3EA5A 3U3RA 1Q44A 4QGHA 2VP5A 3B8HA 4M1TA 1D9ZA 2DPXA 4RD6A 4OJKA 1G3MA 1BH2A 1E2JA 4XVQA 3T34A 4ZI2A 2IXFA 1ZM7A 1R2QA 4F7WA 2D7CA 1KI9A 2HJGA 5FUVA 1X3SA 3RSOA 2ERXA 3CWZA 4LK2A 3G0HA 2QI9C 2BV3A 3NTUA 5DSZA 2W0SA 2PT7A 3PG5A 1G7CA 1EFCA 1S2MA 2VRWA 3BD9A 1AKEA 1RKBA 4MQBA 4QNRA 1KK2A 2QAGA 1N5LA 1MO4A 5TB5A 2F43A 1UKEA 3QKTA 2Z4SA 1ZCAA 2ASEA 4F4JA 5CM9C 3DL0A 4HSEA 4TYYA 4HAWA 4JLNA 4KSCA 1A5TA 3AUXA 1YZGA 1QHHB 4MH0R 4RD0A 5C2JB 1E2PA 5JZVA 3UMFA 1P3JA 5HZHA 2ZM5A 2HF8A 3BWDD 5CK5A 3THWA 2OILA 1R7RA 1E9FA 2GCNA 3NWJA 3OAAD 1XXHB 3A4LA 5FPSA 4DEYA 1AZTA 2AFHE 3EIQA 2QPTA 5ANRB 4A1FA 1ZUNB 3D7MA 4D4LA 121PA 3RRMA 4TN1A 1K6MA 1M7HA 1NSTA 2CDNA 3KUCA 2ZI4A 4MKGA 3SJAA 1ZU4A 4DDTA 2H92A 5JI3E 1A7JA 2GEUA 2ZITA 3NKVA 3WYGA 4B2IA 3B1XA 2QBYA 2Z0MA 3EPJA 3GEEA 1FMLA 4JBWA 4C0HA 2WWWA 2G1JA 2C8VA 1ZC4A 1Z8FA 1KGDA 1IN6A 4MRPA 2FN4A 3RS7A 1G21E 2IYWA 4W5HA 3IILA 3ASZA 1DAHA 2D74A 3U44A 4IDPA 3VR6A 4HUQB 6Q21A 1E9CA 3L8ZA 1W1WA 3RRZA 2X2EA 1KK0A 4WW0A 4JLOA 4W5JA 4BGDA 4D80A 3UMSA 5JCPA 3CPEA 5LBIA 3A58B 1G18A 2XNDD 1KJWA 4XD7D 2J0QA 2HCJB 3THYA 2FFAA 3VKWA 2O8EA 3AP2A 1LY1A 4CIDA 4AKEA 3EZFA 3U6BA 3A4MA 3KQUA 2A7QA 1R0XA 2JDIA 3A1WA 4V0MA 3AKYA 4NCHA 2CVHA 4DCSA 1E3MA 1DO2A 3NBXX 3KL4A 4ERNA 1OW3B 2FNAA 1E9BA 2X8AA 4ZIRB 2G77B 1SVMA 1HY3A 1CJTC 4Q5IA 2WWYA 1X8JA 2YKGA 2OHFA 2G83A 4OJQA 4NDZA 4LBYA 1E4VA 1Z6AA 2WWXA 3A36A 3EW9A 2PMKA 1FX0B 2DWPA 4NZYA 1NVVR 3I72A 1KK3A 3QF7A 4E07A 4CRWB 4AYWA 3PUWA 4US2R 2XEXA 5KTYA 2GF0A 4RZ3A 5FOVA 4MYUA 1JQLB 4XSHA 5BXQC 1EWRA 1T0JB 3F8TA 4LUCA 4XOIA 2GCPA 2ZJYA 3FE2A 1IHUA 2BMJA 2KI5A 2Z6VA 1HT2E 2RHDA 1CR2A 1GSIA 2RGDA 3REFA 2V54A 4MYCA 1II9A 2RHMA 4HZUB 4DDVA 2W2VA 5DYIA 4A15A 1NY5A 2ZJ2A 3GJ0A 5F98A 3HYRA 2GZHA 3WBJA 5FL3A 2CCGA 2WJJA 1T91A 4PC7A 4Q47A 5L3RA 2Q9BA 3UIEA 1ZM9A 2ZJZA 3KKPA 5HKKD 5LDDC 3ZIAD 1GOTA 1AS0A 1E9EA 1LW7A 3P32A 1CTQA 2D2EA 4Z1MD 4C0SA 1T3HA 4A92A 4ESHA 3LRPA 4EPVA 4LHVA 5J4LA 3MG9A 3PEYA 1GTVA 4UNNA 3LA6A 3TRFA 3WNDA 3GLIB 1M6NA 1P73A 4BE7B 4XVUA 3GLHB 5CLQA 1X1SA 2FZ4A 1H8HA 2EVWX 1NL3A 2IWRA 3TW4A 1II8A 5DHFA 3X2SA 1OH5A 3T12A 3CH5A 3I1FA 1EX6A 3R8FA 2C5LA 1KYIA 1A2KC 2ZJOA 4URWR 2GBLA 5TARA 5C4GB 3W6OA 1Z6XA 4PR0A 2G88A 3HPQA 4TTRA 2B92A 4PAOA 1G7TA 2Q3FA 1QZXA 4M53A 4M9ZA 1KMQA 4LV5B 3ND8A 2I1VB 2QP9X 5FTJA 4DB4A 4C7OA 1Z0KA 2PJRA 4Q7KA 3ND9A 1DVRA 2PL3A 1G5RA 1RRCA 2X1VA 3W90A 4A2PA 3EPLA 1YZKA 3THYB 5JMTA 2J7KA 3PUXA 5EE0A 2A5JA 2YVUA 3BJIC 3RWMB 4EPTA 4OK6A 5AJZA 1KNQA 2RB4A 2XZPA 3FMPB 4ZIRA 3DZ8A 3K0EA 4DLTA 3T5GA 1QHSA 2WJHA 3KZ1E 5JJIA 3P1JA 4TMXA 1K8RA 1N3BA 3PXGA 4OI2A 4KFRA 3AP1A 4TMTA 1OYYA 1Z0FA 1L7VC 4A0HA 4GOJA 1TEVA 4JVSB 2QGZA 1T9HA 4RY2A 1Y63A 1ZM4A 2AXNA 3B7GA 1XPOA 2HYDA 3BAFA 2KJQA 2PZGA 1X8LA 1ZUHA 4B3DA 3U2QA 4KITB 3FB4A 1I4DD 4FCWA 4FN5A 2F1HA 1P60A 4IHQA 4X8MA 3V9PA 3TIFA 4D25A 4WXRA 3T61A 4BLPA 1VDZA 4JJKA 1NKTA 5CIQA 2H18A 4QBIA 3DKPA 4TZ0A 3AM1A 4XH9B 3R20A 3R7WB 2PX3A 1TU4A 4RCZA 5AJYA 2C95A 3GLFE 1SVOA 2JLWA 4Z54A 1G64A 3W8NA 4JVMA 4EFNA 3GLIE 2BJVA 1N6RA 1S0UA 2B21A 2ZRDA 1VYUA 3WMEA 5TV2A 2ZUBA 4P4SB 3WYAA 3CNOA 3QY0A 3SJCA 2QEQA 5CYPA 4I1OA 2JDID 1ODFA 3KXIA 1QG2A 3O8RA 1EGAA 2WMOB 4Q9LA 3OHMA 3EPKA 4IVQA 4NCIA 1HYQA 4PQYA 1XEWX 4MGKR 1GZSA 5FBRB 1XPUA 1WBDA 3LQRA 3S1AB 1T8UA 2VHQA 1SKYE 1J90A 3U61B 3C16C 2QNRA 3QEOA 5L3QA 3CM0A 3CR8A 1SXJB 5G3ZA 1XEXA 1SKQA 4Q4JA 5KUTA 2VLIA 4DUGD 1PVOA 1E2QA 5CDFE 1UDWA 4GDFA 1WRBA 1GNRA 1GILA 3I61A 3A1SA 1FW6A 4M1KA 1L4UA 1R8QA 2E87A 4W7SA 2JA1A 3AEZA 3U3KA 4Q66C 4K46A 3W9YA 2OM2A 5GADl 2NPFA 4PAMA 1JPJA 1NBME 2RGCA 2PZFA 2AXPA 1PV4A 1DG1G 2P2LA 3VU9A 2JLSA 1F2TA 4DB2A 4BUJA 4UJ5A 1KI3A 2RH5A 5B2ZA 4N3NA 1H8HD 1YZNA 1BO6A 3GP8A 4US0R 3ZS8A 2FFHA 3REGA 1N6KA 2JIZA 2ZANA 3TLXA 1ZNWA 5F9HA 2A5DA 2GJAA 4PFSA 1JR6A 3F0TA 4YMTA 2RGBA 2C9OA 2J1LA 5KOYA 1IQPA 2D2FA 1G20E 2FSHA 2HV8A 4B47A 1J2JA 4CEHA 2Z43A 4RKEA 1TADA 4NMMA 4BLOA 4YLGA 3VNVA 2G6BA 4WOPA 2VSXA 3CKLA 2CK3D 4KU4A 1E2MA 4TWZA 4CVNA 4PC6A 5D3QA 3DO6A 1IJFA 2WJYA 4C0LA 2OFXA 3SBDA 3A6PC 3NHBA 1KY2A 1OFTA 3ASYA 1G5TA 4BRWA 2QORA 4LJ4A 5JJKA 1KDRA 3GJ7A 4FMBB 2ZR9A 1AM4D 1G3UA 2BDTA 1DE0A 4PPQA 3SE0A 2FA9A 4ZDKA 3QBVA 4OI0A 3SZRA 3QVVA 3LBNA 1AK2A 3SBEA 3O8CA 4IXNA 3ZYCA 2TMKA 4OI4A 2J45A 4LBWA 2OBLA 1IAQA 1XMVA 4EJSC 4JMPA 4MUAA 2G0NA 2IXEA 2RGNC 4RFVA 1G1MA 1MRNA 1E2HA 2PX0A 4BECA 1YRBA 2C77A 2IF0A 3MJRA 1DO0A 3BBPA 3FMOB 2ZRJA 4ZKDA 1RC8A 2IUUA 5A0FA 3UK6A 4DC9A 1NJGA 1J7KA 2D3WA 1OYWA 2ZRKA 2GCOA 3R8CA 4GP7A 2OE2A 2QAJA 1G8FA 2VP4A 1XPRA 2ZRMA 3QF4B 1GM5A 4D26A 4AKIA 1E2EA 2W6ID 5JBQA 1XU4A 3Q8XB 2QP3A 2GEVA 1EXMA 4I1VA 2WVJA 3AVVA 3QPUA 5EZ6B 2R9VA 3D6TB 3U60B 3CR7A 4XD7A 3WMGA 5EXTA 4GBMA 1U99A 4A8JA 2B7CA 5FPTA 3EZ9A 1SVIA 4AI6A 1U94A 2ANBA 1SXJA 2ZJBA 3HJNA 5J4YA 4OQFA 5F2EA 2WWHA 2CHVA 3SEAA 3OE7D 4BZXA 1E0SA 3PR1A 1T4GA 3I8XA 4TL7A 2NTYC 4JKIA 4BFSA 1YZQA 1AQUA 3PUZA 1YVDA 2DY1A 4WBSA 4C30A 3OEHA 2MSCB 1G8HA 2A5FA 1GP2A 4LJ5A 5FBWB 2UVQA 2O8DB 3IIMA 4F93B 1GVNB 1WBBA 1GG2A 3TJZA 3VHLB 5L3QB 2NMVA 5JECA 4TL8A 2BBSA 1Z22A 1I4TD 2V4ZA 4JLBA 4LDJA 3K70D 3KKMA 4KLNA 1WB9A 1KO1A 4JL8A 4BFVA 2N46A 1KKLA 2AK2A 2DR3A 2OXCA 4JLAA 4JKYA 4LOAA 1DPFA 2W6JD 4E03A 1HT1E 1UM8A 1HE8B 1OIWA 4C2UA 1E0JA 1KO8A 2G9NA 4TTPA 1W48A 5K8IA 2WOJA 1KMHA 1QHGA 4F92B 1K5DA 2V7QD 4BEBA 4CW7A 1NVWQ 4KXFB 2F43B 3LD9A 3EWAA 2BBTA 2B6HA 4PPFA 1D5CA 3IPXA 2CEAA 1TU3A 1NVVQ 5SZIA 1DARA 5E7JA 2FPLA 1XWIA 3CX6A 1X6VA 1OKKD 5BW8A 5EXPA 3U7GA 1VKJA 3OIUA 2GZAA 4FMCB 2H16A 3KX2A 1P9WA 5BN4A 4TL6A 2XB2A 3RRNA 3OIVA 3W8RA 2AD1A 1W4RA 2FFBA 3FMFA 2F7SA 4FXPA 3IBGA 4HYYA 3QBTA 3I92A 1V5WA 2ZAOA 4A36A 2OBMA 3GQBA 3M6AA 4ZDWA 4ASUD 3QXSA 5B57C 3DM5A 5LD2B 1W2GA 3BH6A 1MO6A 3RC3A 4B35A 2IYZA 1UFQA 2BBOA 4ZCLA 3SYLA 3X1DA 2REOA 4AKGA 5C46F 1Z47A 4IKEA 3CZPA 1E2LA 3L0OA 3T1VA 4QHYA 3PITA 2VEDA 3SOPA 2ZE6A 4TSFD 1G9XA 4LHYA 2V9PA 4C0BA 2QSYA 3B82A 4DRZA 4URZR 2AKYA 2IF2A 3L43A 2OBNA 4FIDA 1E4YA 2QG6A 4DDWA 2XJ4A 1YRAA 2C98A 2CE7A 2K5UA 3UPUA 3GJ5A 2QPOA 2RGEA 2AX4A 4CEIB 1R5NA 1W5SA 2JJ2D 1QHXA 1YHNA 1NVXQ 3MD0A 2R6DA 1F60A 3ICEA 2YC4C 4IDQA 4RD4A 5AJWA 1QBKC 2NO7A 2JIZD 2BMEA 3T5DA 1JPNA 2NQ2C 2GF9A 2IK8A 1E94E 2NPIA 4M1WA 1E9DA 2CMKA 3ZVRA 1NMZA 2GAOA 5JHGB 5ELXA 621PA 3DZDA 5HCIA 1F2TB 1D8TA 3N70A 3EIHA 4IRUB 5CB8A 3DOFA 1AZSC 2ZI9A 3O47A 4LHXA 2A2ZA 5A5GA 1M8PA 4UNSA 5H68A 2J87A 3TMKA 3FGNA 2IX3A 3ZD6A 1AKYA 1ZBDA 2OV2A 4Z8YA 4DEXA 3Q7PA 1JJVA 2FSIA 2Q21A 4PAQA 4WZBE 2ZUCA 3BORA 5TY0A 3WXMA 4MGIR 3CRRA 3O8BA 3LXXA 5EE9A 5BN5A 3I4LA 1DAMA 4KBGA 4B3BA 2J0UB 2GETA 2R2AA 2FZLA 2A5GA 1CXZA 1UEJA 4P3YA 4GNKA 1DAGA 1XDBA 2OZEA 3ZS9A 4UKDA 1XD8A 4IVPA 3WNBA 5J40A 1ZINA 1M34E 1GKUB 3B9PA 3EZ7A 2MMCA 3FOZA 4Q1CA 3R9IA 5L8VA 2ECKA 3C5CA 1W49A 2IC5A 3GPLA 4IFEA 1OJLA 3NIBA 4LSGA 4PQFA 4WAUA 1PUIA 4HAVA 2FJUA 2HT6A 4M1OA 4RCYA 3W5IA 2FSFA 4YXWA 2DWQA 2IYRA 1HQYE 2CNWD 3FWYA 5CM8B 2HXSA 3G82C 1OH7A 5DN6A 2FWRA 5GVRA 4AIIA 4DVGA 5KDDA 1KZGB 1O3YA 1KY3A 2VF8A 4MRVA 2VO1A 2QRNA 2AFIE 3U7FB 4HB2A 2C9YA 2QE7A 4O25A 3UG7A 3N2IA 3NH6A 3SJZA 2HCBA 3QKUA 4CT4B 4F38A 3PUYA 5K8UA 1E1RA 5AWFC 1XZPA 3DDCA 2R6FA 3SJBA 1DTSA 3I32A 4Y0AA 2WIAA 1FZQA 2V8OA 2DBYA 3O8DA 2JCSA 3MWYW 4AYXA 2VSOA 4AD8A 2ZI7A 5IK2D 5FTLA 4PZLA 1ZW6A 4TT3D 4PO1A 1P9NA 3BOSA 2ZR7A 3LDAA 2V3CC 1ZCBA 2DFNA 2J7PD 1SGWA 3Q85A 1EFRA 2HJVA 3TR5A 1JAIA 4C9BA 3NEJA 1GRQA 3KFVA 4Q4AB 3KXLA 3GJ8A 1JALA 2C2HA 2FU5C 3NHAA 3K70B 4EQ6B 4OHYA 1EX7A 2D4HA 3EIEA 2IEYA 2GXUA 4NKRA 3TVDA 3GLGA 3GLFB 1AJEA 4OHVA 4U02A 1I2MA 1CLUA 5FPYA 4OQXA 5GJCA 3LVRE 4LYFA 4V0ME 4BLQA 5BYKA 3AVTA 4ARZA 3U44B 1W5TA 1NJFA 3RS3A 4OK3A 3HU3A 2P6RA 2UZIR 2F3TA 2N1BA 4HDQB 5JJLA 4H1UA 4L15A 4OHZA 5P21A 2JLUA 3GLHE 1SULA 1YZTA 4HDOB 5C18A 2QTHA 5CITA 4TL9A 5DO9A 4B33A 1I2DA 4DLSA 1LF0A 1UDXA 3CB4A 4KBFA 2VP9A 4QHTA 3LX8A 5E7MA 1E1QA 1CS4C 1P7CA 1KI1A 1YZLA 4F4IA 1G19A 5BWMA 2QT1A 4LCBA 4MDFA 3WHLA 1Q3HA 4YMUA 3QG5A 1CP2A 1JQJC 2RAPA 2CLDX 5GVSA 2CL0X 1S1CA 4TMKA 2I1QA 1NN5A 3C7KA 5EUQB 2WSMA 3QI2A 4R7ZA 1L4YA 3EZ6A 4Q1EA 2HF9A 2ONKA 1KHTA 4B3FX 1N2CE 3GD7A 2XXAB 4LJ6A 2GKSA 3T35A 1LS1A 4NONA 1VCMA 3GJ4A 3K70C 3VNUA 1JR3D 5BQ5A 2AN9A 3KQKA 1FUKA 1XF9A 1B0UA 2VTKA 2P3SA 2IS1A 1N0VC 4IDOA 1CU1A 2QAGB 4UXHA 4HAZA 5J5CA 1Z0JA 4KYUA 5FR2A 4HUTA 4Z51A 1MT0A 1R5BA 1TPZA 1MO3A 2RGAA 4ILEA 1G5PA 4L5BA 3I62A 3U3JA 221PA 5EXSA 4I1UA 3H84A 4HUQA 4MRNA 1T5LA 2XSZD 1NY6A 1GL7A 5EP4A 4QGAA 1V43A 1S4QA 1S96A 1YR8A 1OXXK 3VAAA 2QP4A 4HLUC 3V4RA 2ZUDA 4R98A 3BFKA 2XTMA 3BE4A 4RZ2A 3B78A 5FH9A 1DADA 3ADKA 1KIMA 4BRUA 2ZU0C 4JSYA 4NP6A 4Q1BA 4WA7A 2WPDD 1NVUQ 5JSZB 1Z5ZA 2O8CB 4A6XA 1N0UA 1U9IA 1OHHD 3MWLA 1VTKA 2QU8A 1RZ3A 4JYCA 1CRPA 2DB3A 3R9WA 1A82A 1RYFA 3CF6R 3P26A 2IS4A 4FI3C 1TUIA 3AVYA 1CJUC 2EYUA 4GI7A 3TVTA 4LWZA 3PCRB 1BYUA 3HPRA 4CYMA 1W36B 2JJ8A 4A0RA 3PEVA 5CJPA 4IJMA 4JVLA 1TQDA 4GFDA 2GESA 4TMZA 3KJEA 3TSZA 1CJVC 2OO7A 4XTRA 1GAJA 2ZE7A 2BHRA 1VG1A 3QKRB 4LBVA 3RWOA 1PLKA 4B6EA 1DS6A 1OPXA 4JT2A 2J0VA 2DYKA 1KDOA 3PIRA 2EFCB 5CK4A 4LRWA 3RSLA 1SXJD 4DSNA 3LW7A 2YZ2A 2ZSDA 1SHKA 2IYUA 1Q20A 2CCKA 5FOSA 4URYR 4AWXA 2ZETA 4G0NA 2WJGA 3MLEA 4G01B 1P6XA 3PVSA 1KZ7B 4IXMA 5G40A 1M7BA 4A0GA 5BN3A 3C4JA 2W6IA 3ECCA 3BGWA 1E6CA 1W0JA 4Q4LA 1N6IA 5H70A 1H65A 1DELA 1Z6YA 2ODNA 2DFLA 2FF7A 4TLBA 5FL7D 3WP1B 3PEWA 2GCOB 1SVSA 4Z8XA 3V00A 2PEYA 1U0LA 4YONB 3LFUA 2AWOA 2QSZA 4MKFA 1N25A 1U0HC 3B85A 1NG9A 1E79A 4LX0A 2WKQA 2HYIC 2BKUA 5KHOC 4RVCA 4RFSA 4C0JA 2JAQA 2VHJA 3DHWC 2NZJA 4IOKA 5GJVC 4DSOA 3VKGA 1ZNYA 1IBRA 1Q22A 2H7VA 3MWJA 3DMNA 4DT1A 1N6NA 3VR2A 4YMVA 1G41A 1IONA 3B13B 4JL6A 2OCPA 2YNMA 3GMTA 1HTWA 5DGXA 1R0YA 2ZVQX 4R2HA 1KO5A 3WMFA 2H17A 4P4TA 2BEJA
chains in the Genus database with same CATH superfamily
2R751 5DF1A 2UZ1B 1JAYA 1OD6A 1E98A 2O7VA 3D8NA 5FBQB 4PHHA 2E48A 1OBFO 2PLRA 1V71A 3G5AA 4KSBA 3IT2A 4YQEA 3QX7A 4XGQA 5CFQA 3QWIA 5AVXA 2FEOA 5ENZA 1AUPA 4E46A 4M22A 3BC1A 4YCJA 3BVPA 5KYTA 1GTJ1 2XZTA 3ICWA 3W2HA 1LDNA 2GHIA 3WAGA 1KI4A 1U2DC 1W5EA 5BNZA 1YK0A 1IHDA 2NO1A 5H7XA 2AOTB 5REQB 2Q9AA 3MF4A 1LPSA 1Z73A 2AEFA 2NU7A 2CNBA 5IJ0A 2GTPA 4TYWA 2PMWB 2QMQA 4QL3A 1TVKB 2EF1A 4DZZA 4EUFA 3FVVA 4MWEA 5CT8A 4M8KA 4Q7MB 3FX2A 7REQA 4G0XA 1EQ2A 4Q16A 3E3OA 1XMIA 3A3PA 2VF7A 3P9SA 1JF8A 2Q2VA 3ZNNA 1NONA 3Q3IA 1X7DA 2ZBUA 2ECOA 4LJ7A 4MS4B 2X0KA 3RS2A 3URMA 4D9MA 1YZHA 4UQOA 1TQ6A 5JCOA 3EMBA 3N05A 4XJSA 5F23A 4N0MA 4Q3NA 1UMCA 4II2A 3WWEA 2GB4A 1VSTA 3JYNA 3L8MA 1EE9A 4ZCTA 1QF6A 3HKEA 4PLPA 2F6RA 2HA2A 3KEMA 5K0JA 3I3SR 4AY4A 1L4EA 2OAP1 1MABA 2P67A 3PD0A 4R40A 3GROA 5D3ZA 3TPFA 4EMTA 1J5EB 3QJGA 3T1OA 2HA0A 2P5TB 5LA6B 4HDNB 4HWTA 3A2NA 4HJXA 2O2SA 4PVDA 1JLHA 3BERA 3G49A 3E9QA 1JEYB 2YR0A 3F7MA 1INLA 2P91A 3HXLA 3KD3A 5D7BA 1QOZA 3FLEA 4OQDA 2XB4A 3RYTC 4C07A 3QVUA 2GTHA 2WJWA 3GLRA 1P77A 4JROA 5ECYA 4R1QA 5EQDA 3H17A 3SP1A 4KFTA 3BMCA 4D3SA 3PGJA 1BKDR 1L1FA 2FYTA 1KYVA 1C14A 3R0VA 2H1HA 4DIMA 5JG7A 4RVHA 4X44A 4ZAZA 1JR3E 2QU7A 1VKRA 1XZDA 3C7TA 4HB3A 4HEHA 2AW5A 3HXQA 1FU4A 2PH1A 1CEEA 1XJCA 5LYYA 3JWHA 3C8UA 5CW2A 4YJ2F 4LYYA 4ZGGA 4ZV4A 3L77A 2JAPA 3L8YA 5FQNA 4MUBA 2FLWA 4C3VA 2IHNA 3GPCA 3QXGA 4PXAA 3W3AH 1ZJYA 4ABYA 2CEKA 2EKZA 4NMHA 3TG8A 1ISSA 1QQ6A 2HK7A 2JJYA 2C2MA 2JKYA 4PG7A 3TNLA 4S35A 4EHAA 2ZYVX 3FNBA 2RJ3A 2AI2A 3TTSA 2DLNA 2FGJA 3I9V6 4D79A 5C37A 4FBLA 1TF7A 3L7NA 3I45A 3TPZA 3TZBA 4IUDS 3DM9B 3I2HA 4X90A 3K31A 4GVXA 5ITWA 5GGYA 2DWOA 1UBEA 5HM6A 5LOVB 3KR9A 2WB2A 4DA7A 1UFKA 1RXEA 1IM8A 1QO7A 2AE2A 4N5DA 1Y48E 3CT4A 2XT9A 1TAQA 2ANCA 1XBTA 2NO9A 4JYPA 3TLEA 4EATA 3BB3A 4FZ5A 3KJXA 3LY5A 1CX9B 5FFNA 2PRSA 1O95A 4GGOA 2O06A 4NXNB 5B58C 1MAUA 2ZP1A 3DEFA 1EP1B 4RESA 5CAEB 1P80A 2HBRA 3GG9A 5B53A 5I8WA 3TIXB 3D6VA 3KSUA 4LDPA 2OZLA 4CMJA 4GP9A 5BUQA 5AJVB 1NVEA 3E9NA 3AI1A 1HE1C 2G67A 3MCAA 3O31A 4OP1A 1W0KD 1ISIA 1NBMA 2I03A 3IVRA 3KQYA 4X1IA 2Q5FA 4V0QA 4CQMB 5IHPA 4IS2A 4RQBA 1EFVB 1H66A 4LZLA 4CM4B 5EMKA 3EPHA 2NVUB 2NQTA 3WP0A 5AJHA 2GH1A 4J75A 4H4CA 2ACWA 5F78A 1UR5A 3RHZA 5BR8B 1P61B 1YS7A 1KMNA 3RF7A 4G5HA 2VBCA 3I0ZA 4PRKA 4ITVA 1JEEA 4M0LA 2VOJA 1JEDA 2OUKA 5I47A 2ZT7A 4UZSA 5AYVA 1SD2A 4CQJA 4FKBA 2VHYA 3I9V1 3RREA 3TK1A 4D9NA 4EW1A 2OC4A 3M2TA 3S0JA 1X1AA 3M5WA 2WD7A 2B4YA 2QOEA 1MC5A 1ZUWA 2QSUA 5ALOA 3AF2A 4FVTA 4ARUA 4P8RA 4EMUA 4CLDA 3JZAA 1YQWA 3S1LA 2KMLA 1DQNA 3OF5A 4FC7A 4B2LA 3O2SB 3DZCA 1Z0ZA 3EEQA 4XIJA 4FMCF 3L92A 3E1KA 3K8QA 2MOKA 1Z28A 4J76A 2J8ZA 3WWCA 3H1EA 4WFIA 4LYEA 2H1IA 5BQPA 3RVPA 4CTMA 2VI5A 1Z4MA 2W48A 2OD9A 1Z39A 4Y6GB 4URVR 2JFXA 1RJEA 2PGXA 4I5IA 4BFTA 1H9CA 5JSUA 1GV1A 1GADO 2CL6X 2GVZC 2X0FA 4FYYA 1SHJA 2Y1LA 4NH4A 5CDSA 5JCOC 3T3PB 1QQTA 3PQCA 2C03A 1UINA 4KQMA 1XROA 5ESDA 3AYXB 1R37A 1FU7A 2D8AA 4J16A 2C5SA 3PNBA 3QFSA 4K26A 4OD0A 2QZ4A 1E3QA 3I4CA 5G41A 4D41A 4X97A 1VFNA 5FFMA 2QL7A 4BNDA 2PMCA 3AL2A 3DBRB 3EIUA 3CIFA 4QIHA 3ZYZA 2FK7A 4CMAA 2CE2X 4RTJA 5J1SB 3OSUA 4LX8A 1G8YA 3COSA 1U80A 4DM4A 1FS5A 5CFZA 1JYSA 4OQNA 3D0QA 2WWTA 1E60A 3NWPA 4Y2PA 5F3RA 4WNIA 3WL7A 1K3FA 3KHUA 4F8YA 3AVWA 2WLSA 4KRGA 2J0EA 2VCEA 1AUOA 1XTIA 2NUTB 3COYA 5AUQA 2CLCX 4K7JA 2RH8A 3ZI7A 3C6KA 1MUUA 1K2VN 2WMYA 3CIOA 4TXHA 4Q4CA 5IKXA 3FHTA 1A9TA 5KWSA 4DCJA 4H0FA 2QRZA 5TT1A 4TV8F 4Y18A 3WHPA 5EHGA 2ZRIA 2WIBA 4TX1A 3ET4A 3AH8A 3RBVA 4C20A 5IDQA 3GFFA 2R1UA 2QVCA 4YJ2A 5BQFA 2QG9A 2NOAA 4KO4S 2E9SA 4ECAA 3RFTA 4EQ6A 1QLHA 2PQMA 1D4FA 1N8SA 4UFNA 5AKHA 2XMCA 1XRRA 1U2RA 1F3OA 3F98A 3R3JA 1ZEJA 3UYLA 3RJZA 1K0FA 4TSFA 5DNCA 1F7VA 4AJIA 1NYQA 1ZZGA 3LCRA 2L42A 1E1RD 1VSUA 4LA4A 3QSYA 3ROGA 2YICA 4V0OA 1R6BX 4MR7A 1K7XB 1G20B 2QX8A 2QX7A 3QYPA 4J94A 4QPJC 4Y30A 1B0PA 3ZHRA 3T6KA 1W7AA 2CVQA 4BNWA 3EXG1 1BMFA 4L16A 4QYXA 2G4LA 4HN9A 1F6DA 4LGYA 5ELMA 4ZU1X 4AQDA 2YWGA 1IJKA 4WEOA 3ZKWB 5CEFA 1GPJA 1L4FA 2FE4A 2HNBA 4D0NA 4UAVA 3DE7X 2C5EA 3FNQA 2BFMA 2AJBA 1E2FA 3GN2A 3V5NA 2IQIA 2PCLA 3KL2A 4D0SA 3WRVA 3VRHA 4G1UC 4OXNA 1VE6A 1NBMD 3KKQA 2QN8A 3L1IA 1WOYA 5KWEA 4TTQA 5JS8A 2YFYA 4F2DA 4KREA 3AJRA 3MD9A 2Q0HA 4QTUB 3OOEA 4G9BA 1T9GS 1X7ZA 2HA7A 3G5LA 3R5TA 4GRIA 4M54A 5EE5B 3V8EA 1VQ1A 2QQ5A 4ZODA 5DISB 4JI4B 1T3ZA 1UDAA 3AWIA 5AJXA 1FXSA 1OBVA 2DUJA 3K1AB 3NJ8A 2PD3A 2H31A 3QU9A 4N6NA 4ZJYA 5HUQA 2GCIA 4L0CA 4WZAE 3SWWA 3LAWA 4RS3A 1LS6A 3O4IA 1I8TA 2V7QA 2F3PA 2O8FA 1T6NA 2UAGA 4QBGB 4YNBA 3EXIA 5DT2A 3V8RA 3SEZA 2JFZA 2BFFA 1DAPA 2A9OA 2RGUA 3C3WA 3CLHA 4RACA 3VGJA 3U4MA 1LV7A 4L08A 4I4IA 1XNJA 3MQ4A 2DOKA 4NCKA 5JSZA 3KHSA 4L3VA 2QTVB 3OIGA 3N8DA 3WL6A 1AC5A 4BC0A 3VC1A 4L5JA 5BNWA 4R6WA 1E5TA 3C8ZA 3OE5A 3QTLA 4PHGA 4UQPA 3NDBB 3U3OA 4WCFC 1UK7A 3SYKA 4CZ2A 3F90A 1K7FB 2DM6A 3EIXA 5DT9A 2MTBA 3RC2A 3ZJ4A 1SVUA 3KYIB 2H0QA 2WMDA 1YZUA 1C7IA 1F14A 1JLLB 1RPAA 2J3JA 4URUR 2NSLA 1ZM3A 5IARA 4OP3A 4CCAA 1QIJA 1HDGO 1KZ6A 2EFDB 3SFVA 2J3KA 3GCXA 421PA 2CLIB 1GZVA 2JCXA 3TQHA 1Z7WA 3ASUA 2XCTB 4GL2A 4EUNA 3KZKA 5IJZA 1KGSA 2BFFB 4DQKA 4MUEA 4D4KA 2H1RA 4CN8A 5TQ0B 1A88A 2BGGA 3FZYA 3B2NA 1CFJA 1T1RA 1X80A 3FOEC 5C1OA 1G7RA 3LKBA 4OA8A 3QELA 4EUEA 3OHSX 3DTNA 3DZHA 3B38A 4UVDA 3ROFA 2R68A 1ZLXA 3OPQA 4WZZA 4DLAA 1CC1S 2XHEA 3HCOA 4FKMA 3M2PA 4KI0A 1C1YA 3P45A 4TS9A 1KFCB 3IB3A 1JBKA 2WF8A 1R5OA 1LDBA 5HVNA 5A3SA 1ONSA 4UNPA 3HO6A 1FBTA 1WY7A 3HDVA 2RIPA 3R3YA 1IPHA 4JP8A 4BWVA 5IX8A 1YA4A 2E18A 2HHCA 4BIIA 5L3SB 1BMQA 1JEQA 1RP1A 3ANLA 4LPSA 1CSEE 1F2UA 3R44A 4NH0A 5DV9A 4PQEA 1KAOA 1TO2E 4DV7B 1E2GA 1AO0A 4DDUA 1UDRA 3PVZA 4RDHA 4WA8A 1BN7A 1VHLA 3QU5A 4WIAA 3SQNA 4W6QA 2ZTMA 5CBPB 5JRJA 3U3ZA 1JE1A 3OFJA 3AY7A 3DYVA 4UCQA 1Y1LA 2Z57A 5IT0A 3HUFA 4IFTA 5T8KA 4YIHA 1D4AA 4HNSA 3IBYA 1QFMA 4ZQBA 1ZR4A 4OL0A 1JHMA 1MX9A 1FRNA 1Y1TA 2I3AA 3E7WA 3PYLA 4ZALA 4FD2A 5CNKA 1QYRA 1N2BA 1B7GO 1SHUX 1RYEA 4XOUA 3GVHA 3HXMA 1SOMA 1TMOA 2QV7A 2IDMA 4TZTA 2I71A 4WNAA 5K3BA 4FDLA 3CISA 1TM4E 2XVZA 2I99A 4YK7A 2XSZA 3GBVA 3FRHA 1IBMB 2VUTA 4ZP1A 1H0KA 2ZYGA 2EDCA 5EJEA 1E63A 1DXHA 4JJ7A 2JI4A 2B30A 4FINA 4DG5A 1B23P 1NP6A 3C98A 4AK9A 5CBKA 2WUDA 5ITVA 4IHKA 3FYHA 2IPXA 2V7PA 3FDJA 4YRFA 2ZQ5A 3O92A 3R0QA 3KTOA 4KO3S 2ORED 4PZ0A 4B83A 3D43A 4CT5A 4LMAA 1KI6A 5C7IO 5IWAB 1RLUA 1BDBA 3H6HA 1JG2A 2C9MA 3LRXA 4L4UA 4MUIA 5JD4A 2X1HA 2IXGA 4EKGA 1XLWA 4GYYA 2MINA 1WE2A 4P7KA 4Q01A 5HFNA 3THXA 4TQAA 2B4KA 1KAGA 4J1QA 1AKTA 1PV1A 3P9KA 5C4IA 3O0TA 3UN1A 3OZFA 1NFFA 3QOFA 4HB0A 4P4LA 3VTAA 5IMBA 5HF5A 5M04A 5KQRA 5SYNA 1V8BA 5K0BA 5M34A 4GF5A 3A1NA 4MYSA 4FE4A 1U7HA 4YDSA 2GN0A 3P9YA 4NJOA 3UY4A 4YRZA 3VV2A 4ZI3A 3VH1A 1KYXA 3LHDA 4J0GA 4CM9D 2N47A 2REBA 1VBKA 3LX5A 1F51E 2O5EA 1R4MB 2H6EA 3TAHA 1RYMA 3OQOA 4NHEA 2Q29A 2QM7A 5LKAA 4MCHA 4DT1A 5E3IA 1A77A 3U40A 3NBUA 5KSOA 1PGPA 4GT1A 4F04A 1DBQA 2BTQB 3C87A 2QX4A 3QY9A 5DI9A 3DAOA 4GI5A 5BURA 2JLAA 1FPMA 4CDMA 2F48A 3ZNQA 3WYEA 3FNGA 1EVIA 4P7JA 2CYBA 1NMSA 1N92A 4O63O 1IM5A 2BJHA 2BMWA 1G8MA 2R48A 5T4FA 1H9AA 2ZXFA 3VZQA 4PSDA 4GR4A 5LBUA 3NBMA 1SUSA 5LQJA 5TIIA 3NEYA 3HP4A 3I5XA 3MQ2A 5FPPA 4CM6A 5K8TA 1CQZA 1P8JA 3LQ4A 4EJSB 1YR7A 3ITEA 5EMNA 2AW3A 1CZNA 1G16A 1RKXA 4K6HA 4AMVA 2XZLA 4JEIA 4E22A 3LQ1A 3AFMA 4M88A 1FJ2A 1ODSA 4FI3F 1DBIA 3AT1A 4CCWA 3I2YX 2WU3A 4GO1A 1NN0A 4OIMA 4ID9A 1BD4A 1NF2A 2BDEA 2Q5CA 2A9QA 2GCGA 1NI4B 1CIPA 2Y1FA 4I2NA 4AY2A 3KQQA 1PNVA 5IK2A 1JZTA 5EP1A 5FOTA 3V80A 5AUNB 3ZWYA 3U31A 4JMLA 2OZPA 4P33A 1Y8AA 2PL1A 2CXQA 2UV8A 2XA1A 2HBYA 3R09A 3IEPA 1M2OA 2O4CA 3DDNA 1Q21A 2G9QA 3IJ5A 4F45A 2DFTA 4DMKA 1BN6A 2XWQA 2HXGA 3NTXA 5KQPA 1WCIB 4RQTA 5TEVA 4BFYA 5T6BA 4KNWA 4O2BA 3GGGA 3EAFA 4DMGA 1CZOA 2O3JA 1X42A 2GJ4A 1BMTA 1OLXA 2H07A 3CU5A 2PPVA 3ZU6A 4XDGA 1MB4A 4KPGA 4BX8A 3VKHA 2FZKA 1EBUA 5ES4B 1GKYA 1P81A 4M9RA 1V9CA 2P2ZA 2AVNA 2WAMA 2DG2A 1ND5A 4F6CA 2B94A 1NZDA 3LW8A 3D6UA 3KVOA 4URFA 3RSHA 4CIAA 1NI5A 4JHLA 1N0IA 1U02A 3K1JA 1XNQB 3DUWA 4PC1A 1LRLA 1PNOA 1V6SA 4IR7A 4WUTA 4MOWA 3R5KA 3V8QA 2OGZA 4LF6B 1OFHA 2DWUA 1EP2B 1BEUB 3TDMA 1JHZA 1ZMXA 4C06A 1Y7PA 1RWPA 1T4BA 4BZQA 2NVOA 3L84A 4J0QA 1L5WA 3RS8A 5KO2A 3IP6A 2XADA 5DGHA 5LDHA 3I12A 1YNOA 3F5FA 2Z3ZA 1GPWB 4DIDA 4FEGA 4KDEA 4G6ZA 2ZRGA 2H4XA 2AZDA 1KO4A 3FRJA 3K30A 4H4DA 3E23A 3MOSA 4Q48A 3V7FA 4MR9B 2NSDA 4C5AA 1X14A 3QUSA 4GSYA 3TCKA 2B7BA 4CLHA 1MOQA 1EEXB 5G0UA 3RB8A 3S27A 1MDBA 1F0YA 3COVA 4M7PA 3EISA 1HZZC 4OKSA 5ALRA 4AVYA 1X1CA 4E70A 3K4PA 3TLMA 4L9RA 4AQ7A 4M0DA 1L5KA 5LBTA 3K0BA 4I3GA 4KXLA 3DAPA 4GWKA 4ZRDA 1XMXA 2FP4A 1DB3A 2X0NA 4CKBA 4D9EA 2ODBA 2WF5A 2ZJ4A 1IBCA 2V3WA 5K8LA 3EYAA 5LQNA 2O05A 1IXSB 1Z4KA 3PC8A 4MCIA 5AUOB 1CF4A 3QU2A 1IPEA 1UXIA 3HABA 5D5PA 2H4FA 5I7FA 3MGCA 1W59A 1LUAA 2EJTA 3PUHA 4R5MA 4UE3S 4EITA 2PUEA 1L2TA 2C61A 4YQZA 2JLZA 5D2CA 5IAEA 3LC1O 5ESXA 3THRA 3GDHA 1USUA 4GLFA 4YUAA 1RJ9A 4QG7A 4DMFA 3NYWA 4MR9A 5EQFA 1UC5B 5A05A 3S99A 4O0LA 4FCVA 4NBRA 1EM8B 2ZREA 4V2UA 3ZGOA 2ATXA 5AH0A 4EGSA 3UJPA 4PLGA 2X42A 1CUIA 2JLCA 1XKQA 2QA5A 5ALIA 3F97A 5KJ1A 1OGYA 3L18A 1VP9A 3IAUA 3WB1A 1R8JA 1J97A 4G5YA 3H4MA 3KU4A 2VYND 4B4KA 4JC4A 2EZ8A 3DXZA 5LUBA 2VP2A 3BWXA 2UYCA 2L2QA 4ODIA 2Q50A 5FOUA 3NU1A 4LBZA 4OA5A 2PNFA 5KNLA 4NPHA 5CRIA 1A97A 5EZYA 2RSLA 3FFTA 3W3AA 5C52B 1L8LA 3FW1A 3VC7A 3FSEA 1AA9A 2OT3B 1HFWA 4QELA 1E1CA 2P9HA 3X1KA 5DPMA 4GKKB 4QM6A 1A1SA 1PQUA 2CZCA 1PG0A 1PJ3A 2YJ6A 3ACCA 1T8TA 2VUUA 1GYPA 2FE1A 3HKCB 1N2ZA 3HYSA 3EVZA 4QFBA 2QMOA 3LGAA 1KC1A 4R69A 2B8TA 2H4HA 4W5RA 2PSFA 4FSDA 5TPWA 4DA9A 2G5TA 3LH5A 1U8UA 3EGXA 4RJJA 2SICE 3VM6A 2WILA 2ZKLA 3WB0A 1K92A 1YQ9A 3TL6A 2CBZA 1B14A 2H11A 1M10A 1JHXA 2Z98A 2ZSAA 4RAOA 2B5WA 1Y3DE 3KYBA 5KNCA 1AURA 2AF3C 2C0CA 2VJDA 5F1OA 1WP9A 1XVTA 4MGZR 4UUPA 2ID8A 3M5CA 2YTZA 2JK1A 3AFNA 1P44A 3KRTA 3WQSB 3B3AA 1IXKA 4HZGA 4Q18A 5MGBA 1FSZA 2ODQA 2XWBF 3F7OA 3IFSA 5I9BA 1QGUA 4K88A 4UC0A 1QH1A 1T2NA 2R65A 5JMOA 4E30A 1B2RA 1Q3TA 2C9ZA 2F4NA 3LWDA 3NDRA 2D59A 4PZDA 3TS1A 4DNQA 5BY2A 2W6ZA 4L22A 4AUEA 2JD0A 3PB3A 4ZI7F 5HQ3A 1E2DA 1OLOA 4QUJA 1OT3A 2WB4A 4NCXA 3CBGA 5EEHA 4DJJA 1IWPB 2RG7A 3B36A 3TVYA 5E3HA 1U6IA 5DGDA 3QI7A 2ERCA 3B6EA 3IVCA 2Q6OA 1C8BA 4JITA 5PNTA 1NQOA 3W6UA 5B3AA 4XQ0A 4EQZA 2QRUA 1JLLA 4TV9F 4CKCA 3IXQA 2ZRCA 2VDQB 3OPYI 1MX5A 5KIAA 4M6WA 4Z1OA 3OJLA 1CRQA 1VL8A 2IEDA 4GKVA 2V7WA 1A9XA 3LY7A 3I2KA 1EFKA 3O8OB 4PRYA 4HFMA 1UK9A 3DQZA 1M1XB 3RW9A 1YBVA 2EW1A 4LZJA 5C31A 5THKA 3GFQA 2F1IA 3ZWKA 1X9GA 4LJAA 2VDLB 1H42A 5DLYA 3IOMA 4EKDA 2OXFA 1XEWY 5IT5A 3UUEA 2HCFA 3DBLB 4PGAA 1ANKA 4FHGA 1UAGA 2QN3A 1RCTE 3IQFA 4IIBA 3U1VA 5K8CA 1ACJA 2QTRA 4XWAA 3EFBA 3S8YA 1QC5A 4FZJA 1YF3A 2E21A 1QPZA 2XE6A 1ZIYA 3IVXA 3EXIB 2HU2A 5J2TF 3KQNA 3NVKI 3KKEA 4BO6A 3ZV6A 1P19A 4TQ9A 3UTDA 3UKDA 4DSUA 3CG4A 2IPMA 4O4HA 1TD9A 3C5WP 1WDMA 3RD5A 4C5CA 1NLFA 4X8OA 4EG3A 3TEFA 1TJPB 3TSYA 5H0IA 1JNYA 3F6YA 4XQEA 4P38A 3U3XA 5IEJA 4GMHA 3JZDA 2H1SA 3EX7C 3OZTA 3PK0A 1VI6A 1J00A 3AJDA 3GLGE 1E96A 3CINA 4S12A 4AXBA 3OIWA 4F3NA 4Q00A 2EJVA 1FQJA 3F8SA 5AW8A 5IUNC 3G2PA 3TRIA 2NO0A 4L73A 3UQYS 4J0HA 3CCCA 3TKLA 4RGBA 1UCFA 5INTA 2YRFA 2VDJA 4MVJP 4XE5A 5C8VA 4P0TA 2DH5A 4TWAA 4ND3A 4O1IA 3QOWA 2GF2A 3H16A 4TTSA 3QXJA 3EVNA 4JUIA 3TXXA 1TYBE 5JI2E 3GZJA 1H1LA 1QNFA 4DBLE 5J5AA 2WHXA 1L7OA 1N3LA 2W2QA 1EWKA 3OO1A 4KFSA 5ABPA 3NC0C 1P7WA 4PGFA 1SC9A 4ALLA 3MJEA 4QVGA 4MAAA 5ALXA 2MINB 1B76A 3C3EA 4BNZA 3VZBA 2OVBA 4C3OB 3VR5A 3OQ1A 4DFDA 1XU9A 3K0FB 3QKRA 1JA9A 2YFQA 2GM4A 1WDKA 2NTEA 2AYXA 1GNTA 2V7VA 3FCCA 3QZUA 1IH8A 3IEMA 1QV6A 4KSYA 1YKSA 3CNHA 5L4NA 5IDYA 4P08A 4B3CA 2DBVO 1DJOA 2CUNA 2XQJA 3CE6A 2FDRA 3IAM6 4YV0A 2BGLA 4OYHA 2AJCA 2FPPA 4NYJQ 1YV9A 1D6JA 3LTEA 2WKPA 2MCFA 2M1ZA 3BFXA 3SM3A 2Z5VA 1PGJA 3DV9A 3PFGA 4KDRA 4XUCA 5BNIA 3BXZA 4CM7A 3FPEA 1GPMA 1EGMB 3G7SA 3T9CA 3QX9A 3RYFB 2XRFA 5FPKA 1RZRD 3MNFA 2Y3IA 3IB6A 1W8IA 1RWNA 1SZCA 1L8QA 2I1LA 1WULS 1ORDA 3IQIX 1G291 3JCZA 3P94A 2JCVA 3HKDB 4CMHA 3AIOA 3DEIA 5H1YA 1RLOA 3IP1A 2IHKA 1JMVA 2W6JA 2CN1A 4J0KA 5DW3A 4KXMA 5D1NA 2JKZA 3OF2A 1H4VB 2VATA 1P9LA 2JGRA 4EG5A 5I3CA 3R7FA 5AVZA 4WN9B 3U4QA 5EXEA 1C1DA 3CGWA 5E4YA 1EFLA 5I7EA 2Z2ZA 4EL0A 1RYNA 3D81A 1CQWA 5IM5A 2Z8YA 1GQSA 2FQ1A 3GUCA 3JD2A 3N3BC 1J33A 2VHUA 4K9NA 4LI0A 5F77A 4BVKA 5D5QA 1N34B 4GZ6A 1NM5C 4TRMA 4J4TA 5KOJB 3LVQE 5TVGA 1RHKA 4JWKA 1DCTA 1L5SA 1T13A 2RGNA 3NP9A 3OQPA 4V0KA 3UF0A 1NVFA 2IFTA 4E32A 2GK4A 5B1DA 3TR6A 2H2DA 2Z5FA 4MWCA 1TYZA 1AGPA 3Q0IA 2QAGC 3F74A 4PQRA 5JBIA 2X2OA 3F4KA 5DHPA 4D3FA 5CDYA 3CVVA 4HOYA 3D59A 1T1SA 1KNXA 4BBPA 3F6BX 3C41J 3PIDA 4U9HS 3CLSC 2YCBA 1XEXB 4Q4JB 1ELOA 3UHPA 5A4DA 2A0WA 2JFOA 2G72A 2QQ0A 4YAOA 3QMVA 1GAEO 2O8BA 2X86A 2XD4A 1OF1A 3QBEA 4N47A 2IS2A 4CKXA 2FEAA 4MPPA 4I50B 2IOYA 1CKEA 2QR2A 2QR5A 5K0ZA 1M7GA 5CVTA 4ZGWA 2VSQA 4OHPA 3E1SA 5A03A 3SYNA 3WLFA 3QE4A 3PQ2A 3OA0A 4JGBA 1XMSA 1OFVA 4L9SA 4LJ8A 4X1OA 2OYRA 3MHPA 4I1YA 3ZJYA 1UJBA 2CXXA 4BDTA 1CERA 1EFRD 1JJBA 1EWTA 2B2NA 3CF0A 3QXHA 1XD2B 3CW9A 1Q0RA 5A02A 4UU0A 2RHJA 1AUQA 5DCLA 2R47A 1NR1A 3N2NA 4YAUA 2Q3HA 4Q9IA 4S05A 2BE9A 2POCA 2HEGA 3DF7A 2C4VA 2LR0A 4N3AA 4R2LA 4XCVA 2Z2YA 4LJLA 3I37X 3VR3D 1GDHA 3IAM1 3M81A 4C7VA 2JIPA 5EG5A 4EVRA 2JHCA 3JU3A 3NBFA 1U28C 1XTQA 4M8NE 4CNQA 2ZBGA 4N3CA 5F35A 5ICGA 1Y7HA 3AIMA 4QE3A 1UEXC 5IH3A 1H8EA 3HBNA 1ORTA 2Z2JA 1Z6QA 3PGVA 2J48A 3CH4B 3NB0A 3K0CA 1RNLA 4UE2A 2G8LA 2X0JA 3QU4A 5PGMA 4Z7NB 1E5DA 4CETA 2BP7A 1EFUA 1REQB 4P83A 3RC1A 4QDTA 3TZLA 4I1SA 1UBRS 1MVLA 3CTPA 4UUNA 3ZWNA 3CKYA 2CJXA 4F91B 5HS4A 2O2CA 4RHFA 2DQYA 4CKBB 1ESNA 5JCZA 3EZ2A 4H17A 2P9CA 4IIGA 2P5UA 4HAOA 1FX0A 1H22A 4L72A 3PDIB 4OVKA 4DCMA 4X24A 4UOEA 5EHIA 1PL6A 2WFLB 2XIQA 4V1CI 3JQ8A 1SBZA 5KSZA 4TQUS 1G5FA 2IT1A 1DKRA 1Y5MA 1HA3A 3LNCA 4G81A 1T3LA 2D0PB 4GOND 4YC7A 3VYSB 4B8WA 3M33A 1FSGA 4Q4AA 3LLCA 3CTMA 3L6UA 3MUNA 1YR2A 2Q1WA 1NRWA 1SD1A 3Q87B 4EBFA 5DGCA 1ITZA 2D00A 2RAUA 2CUZA 2P6OA 2D5LA 1E9SA 3AILA 1NLZA 4IH4A 3W05A 1FYDA 1KEZA 5KAMA 4NQZA 1REQA 3ZI4A 3DVAA 1UBOS 2KB0A 3G2LA 3MCZA 4TRNA 4JI8B 1NIPA 4LDNA 2W43A 3L6BA 3LT0A 1WQ1R 3B70A 3ETLA 3NHMA 4BASA 1M1YE 4GUDA 2WUGA 2GCEA 4DADA 5GV8A 2QVYX 5I01A 3OFSA 5EUMA 3JVEA 3N5CA 2AR0A 2G6TA 5BOSA 3FCOA 2JVKA 2GD2A 3OX4A 5ED0A 5SICE 4U5XA 2M98A 1I2CA 2X9VA 1UQTA 2Q3LA 1FL9A 2ID9A 1BCRB 4HLDA 1KS9A 4GPZA 1QQ5A 3AFHA 3DHEA 3OC0A 4MQFB 4P4NA 3TTVA 1CJMA 4NNOA 1DBRA 1LGYA 5CA1B 4J29A 5F33A 1A8PA 2H5JA 1GIAA 3EF0A 3OQHA 3EWSA 1UADA 4BX9A 3FTEA 2W6NA 1TX4B 5F73A 3BSSA 4EW6A 3C3XA 1DWPA 2GJSA 3ZE0B 4X60A 3WLLA 4ROTA 4MLZA 1JXOA 521PA 1U2QA 4KCGA 4DUPA 3BQMB 3CZ5A 3Q6NA 1BWQA 3CR3C 2CT8A 2DGDA 1TIKA 2AT1A 2FSPA 1YIAA 4JQZA 3E2PA 4PCVA 1F6BA 1N4DA 2ZRAA 5AHOA 1BYIA 3BE8A 5JSFA 2UZ3A 3DQPA 3T4XA 4NAVA 2PZKA 3Q3VA 4BFWA 1KJYA 5I9SA 5BUCA 3H2HA 3OEYA 5AW4A 3HO1A 1A69A 4ARIA 1JG1A 4B46A 1NVGA 3DOOA 4PPGA 1VBMA 3GJXC 4B8YA 4QBHA 4G97A 4IHJF 3GCGA 3ZXUB 3GFSA 1EBFA 1RRGA 3AGPA 2VYFA 3ACDA 1Z13A 4O4IB 3ZK8A 1V5EA 1JG7A 3FKSA 4O1MA 1PJ4A 2A3RA 3RT9A 1QDEA 2Q2OA 3D2CA 3IQDB 3SLGA 2BMFA 4WNAB 4YP6A 5TQ2B 1LKZA 1JWBB 4MZXA 1R12A 3JTEA 5D85A 2QRGA 2GWHA 3IVMA 1SCKA 3MWFA 3B7PA 2VUHB 1Z5PA 3NCHA 4DC1A 4NABA 1EVJA 2HB6A 4WKBA 4DAEA 4MKHA 5ALTA 4WECA 2VBGA 3V4LA 4Q9NA 5JY1A 1U8ZA 1VRCA 2AOTA 4ACAA 3HU1A 4OQQA 4WKCA 5J4VA 4O0MA 2QMEA 3B6MA 4IWYA 4WK6A 4DWOA 1GUYA 1RACA 2Q27A 2ZDQA 5IJAA 5K0GA 3EFEA 3QXCA 4QO7A 1TYDE 3RHSA 3F6PA 4R2IA 2QT0A 1W1UA 1AS3A 1MJFA 2VAMA 4P2BA 5HA5A 2QPAA 2NVUA 3BB1A 1XR3A 3AVUA 2I3GA 1EXWA 2CJFA 2JLYA 1G8SA 2QUAA 4LE0A 1U98A 4AFNA 4G24A 2BFDA 3ZE6A 2YFKA 3Q98A 1Z2AA 3CCFA 1WBJB 3CZ9A 4ZEVA 4CIWA 2J0UA 1SIBE 2ZGVA 3RIHA 3ZOZA 3Q12A 3F2IA 5HX7A 3WFJA 3FOWA 4N7JA 4LRYA 4OQPA 3VDQA 4O2LA 3NPAA 3ZCPA 4PRLA 1V5IA 2ATIA 4Q3AA 5CLGA 1FDIA 3P19A 2FHPA 1MH9A 4R31A 3W5VA 4RKFA 4DBLC 1PT9A 3R24A 5I6DA 2A5LA 3GJ3A 5JIBA 3K9FC 3BRQA 3F4BA 7ABPA 1G8KA 4YRNA 3VHXA 1RRVA 3W2TA 4C6HA 2XMPA 3CVOA 2QTMA 4N12A 5EIAA 3RRFA 1PWXA 4QTTB 4PX5A 1YJ5A 1Z2CA 3UG6A 1RI4A 4EAAA 4CLEA 4MGHA 1ZGBA 3S2ZA 3WC4A 1R0CA 1Q1BA 3EFHA 3F9IA 3WGGA 2I9PA 2O8VA 5KYUB 3KZOA 1Y9ZA 3K0FA 2V5UA 3AF6A 2PMEA 3HNPA 1VJ0A 3ANNA 2ZAMA 5DBHX 2EDAA 2YUIA 2CJPA 3R0ZA 2PK3A 4OOFA 3VKFA 1F8FA 5EMLA 1V1MA 1SQ6A 3X1XA 2ZUSA 3RTDA 3ZJTA 4EYSA 4BJ3A 4QOFA 2HD4A 5KYVA 1ZRNA 1ZJJA 2GBCA 3Q3HA 4MGEA 4XVHA 2OFFA 3K0AB 4YROA 1MTZA 1QORA 2TMDA 2N3ZA 2O0KA 3AXTA 4XA8A 4DWWA 1N2CB 2YY6A 3KKLA 2CXOA 4MI1A 5F2NA 2VZ9A 5IUJC 5EP2A 1NPDA 4L57A 2DR0A 1I94B 4IEIA 3G89A 4IPTA 1VMIA 1U7UA 4LHSA 3JVUA 3MGGA 2R8BA 1JR2A 2Q99A 1DZ3A 2HN9A 4E08A 3WK6A 1YA6A 2EQ5A 4FGKA 1ABFA 1PDOA 5KYUA 3KDAA 4IX1A 1UEIA 1Z82A 3UCFA 1NNEA 4XRGA 3D7NA 4R8VA 3WHKA 1LBIA 1X1DA 2QF7A 3AXSA 3LMKA 4IO1A 1UBNA 3UAGA 1IXZA 3GJZA 4H0CA 1F1BA 2VA8A 4Z4HA 1BG6A 1Z9BA 5KZMB 1JLKA 3E7DA 1VLMA 1ESEA 3ICCA 4IVRA 1K98A 4ZT2A 4A0FA 2RC5A 3H19A 3BZWA 3PGLA 1JVSA 2VP5A 3HWWA 2NU8A 1LCIA 4MR7B 2DPXA 1G3MA 1KVTA 5KWIA 2IXFA 1ZM7A 2GQ0A 1CZRA 4N5HX 3STHA 3EQ2A 1ILEA 4MHOA 1MC4A 4R2JA 3WX0A 2V58A 4EHIA 2WT4A 2ERXA 4AN1A 3AETB 2BV3A 1PDWA 5TQVA 2PT7A 2H8GA 4KWIA 4ZGBA 3B6JA 3BD9A 5A3RA 4EENA 3PC4A 5DEIA 2CXRA 4QNRA 1B8OA 4PZAA 5BYAA 1N5LA 3OECA 4L75A 2PQ2A 2G80A 4NV0A 2Y67A 4S1TA 5TB5A 4PS1A 3SZGA 3ENQA 1UKEA 2YY7A 5KEIA 2I2WA 2ASEA 3IIEA 4U39A 1IVYA 1D7OA 1MDFA 3R0XA 4GXQA 1MNQA 4TRRA 1YUNA 4KB5A 4KR7A 1JL3A 3PJDA 3FTFA 1A5TA 1SBIA 4MH0R 5C2JB 3KXDA 3HL4A 1WCWA 1E2PA 1YDEA 5IAKA 2IPOA 3FI9A 1FC0A 3R5JA 5HZHA 3RK1A 3J7AC 1S2LA 4KP7A 5JJCA 5EC8A 3BXHA 1XP5A 2P2YA 2OILA 3NWJA 1VP3A 3OAAD 1XXHB 3A4LA 5FPSA 4ZYTA 1I2BA 3R6TA 5IYZA 1JXAA 3LPNA 4HL6A 4IG9A 1QOPB 1VB5A 3DMTC 1EP9A 2RKWA 3IT0A 4J0JA 3Q41A 1RHQA 2IHUA 4TN1A 4XZ3A 3KUCA 4NESA 4I6JA 5IVKA 2D7DA 1NKVA 1ZU4A 3SQLA 1LQTA 2VVTA 3V8VA 1O1YA 4ZOLB 4B2IA 3NKVA 2XXBA