1MO4A

Reca-atp-gamma-s complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
324
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 89
structure length 324
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo4A01
1ZMXA 1E2HA 1YRBA 4E22A 1GKIA 2QSZA 4A6XA 1F3OA 3WXMA 1VYUA 1H8ED 3ZD6A 1Q1ZA 2ZRGA 1Z6GA 1CU1A 4LV5B 2WBLC 3NBFA 4RD0A 3TKLA 3THOA 3VR2A 4LV6A 2IF0A 1XB2A 4QBIA 3ZZUA 2XSZA 4WZAE 1KI3A 1W7AA 1GKYA 1S8FA 1GL7A 1X1RA 1GRQA 1WCV1 2QEQA 4OQFA 3TNFA 5J4HA 4P3YA 3M1IA 3WMGA 3D8BA 2O8CA 3ADDA 4URVR 3UMFA 1VHTA 3KJIA 1AJEA 2PEYA 1AM4D 1E2EA 4A6PA 2O0KA 1W44A 2R6DA 1RRCA 1E2FA 3IDQA 4MQBA 4DC9A 3RS2A 2QA5A 4ZCLA 4US2R 4DT1B 1Q12A 2VYFA 2WJVA 1UEIA 1SVWA 1FFHA 1Z6TA 2CHVA 2A9KA 1OXUA 2XEXA 2WSMA 4GI7A 1OKKD 2IWRA 3RNLA 1GP2A 3ZS8A 4DBLC 1RJ9B 1XX6A 5L3SB 3R8CA 1DO2A 1KDRA 2J3EA 3SN6A 3CRW1 3DL0A 3FHTA 1Z8FA 1MABA 4TMTA 4JL6A 3AP2A 3CPHA 3I73A 1AQYA 2VRWA 1CBUA 4W5HA 4BFXA 1GWNA 2ASEA 3BBPA 2KB0A 1ZP6A 1B23P 2F9MA 1SZPA 2BJWA 3P20A 1ZD9A 4BFVA 3NBZC 1G7SA 2XOKA 4M9QA 5KYKA 4RZ2A 1CULC 5AJYA 1KZGB 3AP3A 2XNSA 4LYHA 4MRNA 1RIFA 3TVTA 4B47A 3CRRA 5TB5A 421PA 1US8A 1AS3A 3AVTA 3B60A 3PV0A 4A2PA 5J47A 3BERA 1IN8A 2DFLA 2XX3A 1A5TA 4KLZA 2RHDA 3DZDA 4JS0A 3LX8A 4LHZA 4XSGA 2C9OA 5TXGA 2FPLA 3TSWA 2ZRAA 2QGZA 4NCHA 1E79A 2NO9A 1VIAA 2QAGC 4JVSB 4NDZA 4U02A 1R8QA 521PA 2P6RA 1YVDA 3ZDQA 3LA6A 3TW8B 1Z0FA 4O2LA 3P27A 3K0SA 2RGDA 3ETLA 4B2IA 5F9HA 2ZRHA 1N6RA 1U8AA 4YC7A 3K0AB 2CK3A 5FL3A 1MV5A 5EXTA 3MAAC 5EP3A 4KJZA 2BHRA 5GVSA 1NVUQ 1Q1QA 4JYBA 4OK3A 4TMXA 3GEEA 3T12A 5FPTA 5JWHA 3IKJA 3K09C 1EWQA 2OBNA 1MKYA 3CZPA 4EAQA 3LRPA 3RRYA 4HDQB 3FDIA 2PX3A 1E0KA 1OFHA 1OYYA 2WJHA 5DYIA 2X2EA 4AG5A 4RFVA 3OEED 5FFMA 4NU0A 1YU9A 4QM7A 2HJGA 1Z0DA 3B8HA 5H70A 5AUPB 4GZMA 3F5FA 3CO5A 5DSZA 2V54A 1DELA 4N1AA 4CIDA 4ESHA 2NOAA 4OI0A 1G21E 3DO6A 2E9SA 1E2LA 1COWA 4DXAA 2QAJA 2WWFA 2ZRCA 5EXPA 3THYB 2YZ2A 2FFQA 1G3RA 4Q4AB 3IGFA 3TK1A 2C95A 1QHIA 1WBDA 1W49A 4GL2A 4NCKA 1MT0A 4BLRA 3M6AA 5EP1A 5JMTA 4Q7LA 4KBFA 2CL7X 1OSNA 3CPJB 1IN6A 1CR2A 2Q9CA 4I1OA 3L0OA 5SZJA 2QBYB 2WIAA 2RHMA 3QKSB 4HEJA 1Q22A 1G7CA 4DJTA 3CW2A 1UDWA 3ND8A 4D25A 3B6EA 3ECCA 5CK4A 2IUSA 1XXHA 1W4RA 2BMDA 2WJJA 3J81k 3C15C 2DY1A 2AK3A 3EIHA 3K0EA 2IYLD 2FWRA 5IT5A 1XTSA 4FD2A 1CTQA 4C3ZA 4JL5A 4BFZA 3W90A 2GTPA 4C0LA 4Q7KA 1J2JA 3L8ZA 4IDNA 5L3RA 1TMKA 2RB4A 5B30A 1OFTA 2WJIA 2J41A 4OL0A 4ESVA 1KGDA 1S0UA 4K8OA 4D80A 2HT1A 1G6OA 4DKXA 1DS6A 3LH5A 3TE6A 2VLIA 1J7KA 3IO3A 1MH1A 4FCTA 1UKZA 1FL9A 1SVIA 4GBMA 2JASA 4GRAA 4KFRA 4MYUA 4PAOA 4L4UA 2OCBA 2VBCA 2IS4A 2XJ9A 5FPSA 1ZCBA 1QBKC 1EFRA 3A37A 4MRVA 2JLQA 2FG5A 1IN7A 2DFTA 3KFVA 2NQ2C 1G20E 3O47A 4JLMA 2QP3A 4R98A 3B9QA 4LBYA 1E2MA 4HLDA 4DLUA 3BFXA 4M1KA 4LHXA 4C0QC 2GAOA 1BO6A 4ZI3A 1TADA 4PPFA 1PJRA 3LLUA 1BMFA 4Q9HA 4IVPA 4I99A 1UBCA 2WMNB 3SC3A 2BWJA 4B2LA 1DAGA 2ZRLA 3N2IA 4V0MA 1XZQA 2B8WA 3S1AA 4P4UA 2F1JA 2J46A 4PZYA 4EFLA 3KFXA 4DDUA 1HH4A 4MKFA 3ZVMA 4QNMA 1CKEA 3AF2A 1LTQA 3I92A 3QKRB 1YZNA 1X1SA 1D8TA 2XXAA 4NP6A 4OKSA 2JGNA 4OJQA 4HYYA 2GCOA 5EE9A 3K70C 3GLIE 2YINC 1II8A 1XD2A 3R9WA 3AKYA 4HUQB 4TSFA 2F1IA 1P75A 1SVOA 4TMVA 3TSOA 2NO6A 4UXJA 3RS7A 3CH4B 4B2PA 1KNQA 1MRSA 2JLZA 4Q5IA 1FQJA 4EFNA 4JLJA 1JXOA 5FBRB 4QNRA 2QG6A 4C4PA 1G4AE 2QZ4A 1KK1A 3ZVRA 1P5ZB 4HB3A 2UVQA 2ZU0C 4PPQA 3SQXA 1D6JA 1JI0A 2O8BA 3HR7A 4LJ9A 3REFA 1O3YA 4ZDKA 2QPTA 3PIRA 4K81B 1W0JA 2C77A 4WVFA 2QMOA 1GDDA 1NIJA 1OE0A 1FPMA 1Q44A 4KYIB 3O8BA 1KOFA 2XNDA 2CE7A 4V0KA 1Z0KA 3R8FA 1BOFA 2WOOA 4IEIA 1UJ2A 4A8JA 4BFSA 2HJVA 3U44B 1NVWQ 3IIKA 3KJHA 4HLQB 2IS2A 5DO9A 2GJKA 3GLGA 3UWOA 4HB0A 3ZGXA 1QF9A 3A58B 2WV9A 1ZNWA 3GLHE 1VG8A 3A4MA 4FCWA 4TQ9A 4Z8XA 3AVVA 5C2JB 3VAAA 4O2RA 2AFIE 1KSFX 3RAPR 3A36A 3CX6A 3GEHA 3CPEA 1OKKA 1EFCA 2BEJA 2A3RA 1JR3E 1VG9B 4JJKA 1OPXA 2XZLA 3U61B 5KO2A 1OIWA 2RGAA 5EZ5A 5DI3B 3ICEA 3KL4A 4GZLA 1NBMD 1P2SA 2J0QA 1VG1A 4DLRA 2IS1A 3WNBA 3PUYA 4OI4A 1VCNA 3SS8A 2WM9B 1VTKA 1GNPA 1GOTA 1N6LA 1N6OA 2J0UA 1E1RA 3VR1A 5KNDA 1KDOA 5B58C 1KI6B 5KSYA 1ANKA 1W36B 4US1R 5CIQA 3SEAA 3FHOA 4KODA 3WHLA 4Z51A 1YZLA 5B2ZA 2KE5A 3AKEA 1Z0AA 5JWRA 3X1DA 1XEXA 4GP6A 4KSCA 2CJWA 1NN5A 4NPHA 1P73A 2ZIAA 3KXIA 2WMOB 4ARZA 3LNCA 1XMVA 1BYUA 3KQLA 1OW3B 2BBTA 2GF9A 2VHUA 4AK9A 4AKIA 3CLVA 3RS3A 3EAQA 3BB4A 4BZXA 8OHMA 1ZW6A 4JSTA 4DDTA 2C98A 1G8GA 4LI0A 2DWQA 1KI2A 1JJ7A 2OO7A 3I5XA 4C30A 2Q3FA 4U7DA 2W6ID 4WZ6A 3MMPA 3ASYA 1N2CE 2V3CC 1G8PA 5BQ5A 1E9AA 3KX2A 1II9A 2GDJA 1VCOA 2WAXA 3AF3A 4YONB 4EPXA 3PJRA 2BOVA 1SXJD 2H92A 5KNBA 4CEJA 3MJRA 1U8YA 2YWHA 3IPXA 4EPVA 1NL3A 2DYKA 1E96A 1QHNA 2L0XA 4O0MA 1KKMA 3EIQA 3P4XA 2R9VA 4PQYA 4JSYA 4ABYA 1ETUA 1NY6A 1UBGA 3P26A 3OEEA 4MYCA 1CJVC 4DLTA 4KV9A 2CLDX 2I1QA 4JLVA 1XPUA 3L43A 2ZU6A 1X86B 1TQDA 3IILA 4ZKEA 4M8NE 2DPXA 2ZI5A 3BK7A 5AJXA 3WP1B 2J59A 3MFYA 3H86A 5LB4A 1EESA 1N0VC 4E09A 5KU1A 3LD9A 1N6IA 5CYOA 1VMAA 4WA7A 2F3TA 3GQBA 3DM5A 4ACAA 3LO5A 3THXB 2KBEA 5E3HA 4I81A 3KB2A 5D3QA 5JHGB 3R9XA 4G0NA 2OCPA 2PCLA 5BN3A 1K5GA 4XWOA 1WMSA 3TH5A 4AKGA 2IYUA 4TTQA 1FP6A 2XTNA 4JLBA 1F2UA 3W6NA 1TEVA 3HYRA 3DVLA 4II7A 4LBZA 4P33A 4AIIA 1FUKA 4IDPA 2IA5A 4D0GA 5CK5A 2Q21A 5EE3A 3JVVA 3SJBA 2NGRA 1G17A 2N46A 3FYHA 1VHLA 2YNMA 4EPRA 3M4YA 4DCTA 2O5VA 3MWJA 4B73A 4LX0A 2IYZA 2CCKA 4JLNA 2KJQA 2ZS8A 2BC9A 3NHBA 4LCBA 2FSHA 2W2TA 1XD9A 4AKHA 3U3OA 3QPVA 3RC8A 3I5YA 5CDFA 3TAUA 1W1WA 4C0HA 3KDSE 1KAOA 2A5DA 1XPOA 4WZBE 2FGJA 2ZUCA 3MD0A 3PR1A 2AR7A 4Q1CA 2GXAA 1ZINA 2EQBA 2ZSBA 1TPZA 4YXWA 4TYNA 4CEHB 4BGDA 3GFOA 3QXCA 4A8JC 5DLQC 1NVXQ 3W5JA 2BBWA 1PV4A 3RS5A 1VYVA 3VR3A 1QHSA 4OHXA 2JLSA 3B1XA 2V6IA 2C78A 3B85A 4ZIRB 1EGAA 1Q20A 1JR6A 2OLKA 4RJLA 4OI2A 3K0FA 3ZYCA 1VYTA 4OBEA 1XRJA 4NYIQ 1E2DA 4G01B 5AUQA 5TMPA 2MMCA 3V4RA 1OJLA 3RRZA 1XCGB 4I1VA 4EQ6B 1XTJA 2QRZA 1DAFA 1JBKA 2BBOA 2YWEA 3Q72A 1NMYA 3AF0A 1E1QA 4UNPA 4A15A 4DLYA 4H1VA 1Z0IA 1H65A 2OSBA 1TF2A 2G6BA 3WYGA 2XTMA 5EP4A 2EYUA 3F8TA 3GFTA 1HE1C 4JBXA 3AQ4A 4BZQA 4IFEA 1KO4A 4IHQA 1W47A 3T15A 4BLOA 4QGGA 5IF9A 3OE7D 2YWFA 2ZETA 1AGRA 3SYNA 3LY5A 1I2MA 5FBWB 2QMEA 1S3GA 5D3MA 4EUNA 1I4LD 3R20A 2ANCA 1BKDR 3EX7C 1SVSA 2YOHA 5G41A 5JHHB 4M1OA 1OXSC 2REXB 5J40A 5CJPA 1ZNYA 2B8TA 2W58A 3R7WB 1FUUA 3WYAA 2PJZA 3C16C 1J8MF 4TL7A 2OCYC 2GBLA 4DCUA 2O8FA 3BRWD 1AZTA 3FMPB 2EVWX 1P9NA 1N6PA 1I2DA 5E7IA 1RRFA 1IJEA 2WVJA 3SHFA 3WY9A 3CF2A 2Y8EA 3DMNA 4G5GA 2ONJA 4TYWA 1T3LA 3K0CC 2ODEA 4QBFA 1XCMA 4PSAA 3IUYA 4QKQA 1T4GA 2QTFA 5DISB 1X8KA 1CJMA 1T91A 2PH1A 1DARA 2V8OA 5C1BA 2JLUA 2ZR7A 5EE0A 2EWWA 2FEOA 2NO7A 1S9DA 4QC2A 4FINA 4K46A 4TLBA 5DNYB 3PEWA 4PHHA 2IX3A 2KI5A 1S9HA 2C03A 5FTNA 1E2IA 3NEYA 3U7GA 2FFAA 3KJEA 1Z2CA 2DB3A 1KJZA 3G0HA 4D0LB 2NTYC 3QXHA 1FTSA 2RAPA 1AS0A 1G6HA 2NIPA 3EIEA 3WRXC 1NBMA 1V5WA 2FX3A 1Q1EA 4CEIB 3AEZA 1G291 5A4JA 2JDID 1FTNA 1EG7A 1ZM4A 2HYDA 2FPKA 3PUVA 2FZLA 3H1TA 4ASUA 1II0A 3EZ6A 4ZCMA 1SVKA 2CE2X 1DTSA 2DHRA 1OB5A 5EUMA 2PZFA 1ZD8A 3WMFA 4IEEA 2P3SA 1KTVA 1NN3A 4A92A 2AXNA 4B35A 5CLQA 4QBHA 4URXR 3GJ4A 1G3MA 1Z0JA 1W0KA 3CR8A 5L3VA 3DMDA 4B44A 4KI0A 4KO8A 4MGIR 1Z06A 4P4SB 4MRPA 2ZANA 2LKCA 4RFSA 5FI0B 3SFZA 3ZH9B 4PC1A 2Z5FA 3GLHB 4XSHA 4KHZA 2TMKA 5JZVA 1MO3A 2ZYUX 3UIEA 1T5LA 4QXAA 5GJCA 4LYFA 4PHGA 2C9CA 2DWPA 1KAGA 1KDTA 5LPNA 1J70A 5HCNA 1L4YA 1GIAA 4M53A 3IQWA 1KK0A 2OESA 3QENA 5KTYA 4U5XA 1D2NA 1G18A 2G3YA 3TSZA 5EUQB 5HE9A 3VR5A 5K8IA 2FMXA 2RKOA 4DCVA 4WOPA 3WRYC 4ITRC 1SXJA 2FSIA 4WXRA 4OHVA 2F7SA 5CLLA 2ZJ5A 1FX0A 2V9PA 5JS8A 4CYMA 2Q0HA 4BQSA 3SFVA 4B48A 3TRFA 3W6PA 3I62A 1M8PA 1W0JD 3B1YA 3K9NA 1M34E 2VP5A 2XNDD 3OIVA 3BB1A 3T1OA 4B6FA 3SR0A 1H8HD 1TF5A 4NYJQ 4Q48A 4Y0VA 3C5HA 2ZSAA 2DCUA 5DN6D 4I1UA 4B76A 2GRJA 3H84A 2P0EA 3K8YA 4JVMA 4O25A 1OFUX 2VSXA 4B6EA 4XVUA 1CS4C 3NBYC 1CLUA 2XB4A 3PEUA 4M1SA 2ZJBA 2XTZA 3LQQA 4IKEA 2GEDA 2HF9A 3CBQA 4TQUS 3EZFA 4JVLA 3HU2A 4C7OB 3WBKA 3UKDA 3CNNA 4LBVA 2VHTA 3U5ZB 2XB2A 2YOGA 3AF1A 5GJVC 4DUGD 3AKCA 2QI9C 5LD2C 3LDAA 1E94E 3NXSA 1OH8A 3U7EB 2GVZC 2FU5C 3PITA 1OH6A 4R9UC 5KHOC 1U0LA 4Z1MD 1XJ0A 1JQLB 5CM9C 1SKQA 3BFKA 1E1RD 1LF5A 5FOSA 1CJTC 1XDBA 1LV7A 3KQKA 2IYVA 5AUNB 1KI8A 1HV8A 1AIPA 3LV8A 1R2QA 1CR4A 4PFSA 2V1UA 4V0OA 5F3WB 4DIDA 2BM0A 2CNWA 3KB1A 4FI3C 6Q21A 5JCPA 4OQMA 4B75A 4MKHA 5E95A 4LJAA 5JJIA 1GL9B 3SYLA 1D2MA 3EASA 2QAGB 2GBLC 3KTAB 1NY5A 4V0ME 5SZKB 3SYKA 1R5NA 2R2AA 1XEWY 4TLCA 3THWB 3CRMA 4LYAA 5KNCA 4LJ4A 1QHXA 4R71A 1ONBA 3TR5A 4LPSA 1C9KA 4FMCF 2WPDD 3Q3JB 1UM8A 1OIVA 621PA 2EFDB 3UK6A 2C96A 1R0WA 4TQAA 1ZAKA 2A5YB 1F2TA 3AUYA 4PAMA 1GRNA 2BIFA 1R5BA 4HATA 4IVRA 4ZV4A 3EW9A 3CF0A 2AD5A 1RW4A 1A2BA 2GXUA 4JIMA 4XIGS 1E3MA 5BWMA 3U3MA 1G7TA 2Q3MA 1Q3HA 1DBSA 1U94A 3LW7A 1MRNA 5DI9A 2VPPA 4CGZA 3DKVA 3BH0A 4M21A 1JEDA 2XZPA 5FTKA 1R5OA 2CVFA 3LQRA 3X1WA 4QM6A 3AGPA 3X1XA 1G5PA 3CWQA 2QT0A 2W0SA 3W6OA 1WDTA 2D2FA 4XVRA 2AWNA 3MCAA 4RKFA 3WBJA 2H16A 4JL8A 3SQWA 3RWOA 3RRMA 2CBZA 1Q1BA 3Q5DA 2ZI7A 1IJFA 1E9DA 3LBIA 1F48A 4HAWA 1ZCAA 4M9XA 4TT3D 5JBQA 4H9GA 4P32A 4URWR 5HR5A 2O0JA 2GA8A 3OE7A 5C46F 1N6HA 2QM7A 4UQOA 4LHVA 4Q4HA 4GDFA 2WWWA 4LJ8A 5FOWA 1C4OA 3PVSA 4ACBA 2YHSA 4QBGB 5DE3A 4KFSA 4YQFA 2QPOA 1NNEA 1IY0A 1CEEA 4W5WA 1YR8A 2C5LA 2D62A 2RMKA 2JA1A 3NWJA 4B32A 2VQSA 4QGFA 1X3SA 4W5JA 4BEBA 4GFDA 4Q1DA 3QUSA 3ZQ6A 5J4LA 1PUIA 4MH0R 3QF4B 4KVAA 4QG7A 4UNSA 4MKGA 4F4IA 2GAAA 4OHYA 2JJ8A 1SHKA 2OCAA 1X8JA 2F9LA 4PO9A 5K8LA 1CRPA 4FMBB 2H57A 4B3CA 2VHQA 4LWZA 2ONKA 5LB2A 3T1QA 1ZM7A 1QZXA 3EPLA 2O8DA 5FUXA 1HTWA 1VIYA 1Z3IX 4PC3A 3NDBB 1AQUA 2RGEA 1NP6A 1SXJC 3GEIA 1PVOA 4N0EA 1TL7C 4AURA 3GJXC 2I4IA 4IOLA 3KKMA 5FUVA 3T06B 5E4FA 1WQ1R 1CRQA 5FPYA 3EA5A 5G3ZA 3QIAA 5FR2A 2IWHA 4D4LA 2O8CB 1XFAA 5SZHB 1E2NA 3BAFA 4G5QA 4YXWD 2RGBA 1YQTA 2GK7A 3EWSA 4TZ6A 3ZZTA 2QUZA 2ZUBA 2PMDA 1VG0B 4KAXA 1WXQA 3Q7PA 2JDIA 1D9ZA 2F43A 3K53A 4I1SA 5KPJA 3LFUA 2X19A 3ZD7A 5J4VA 2W83A 3DKPA 1CP2A 1KK2A 4NONA 1ELOA 1E9BA 1HY3A 1N6KA 2ZM5A 1L4UA 2FA9A 3P32A 4ZKDA 2J87A 1SULA 3JZMA 3KQUA 2F3RA 3E2IA 2G1KA 3B7GA 1MABB 5FH9A 2FDCA 2D7DA 4AKEA 2ATVA 3TUIC 4DDVA 4ZPXA 4CVNA 3K70B 4RD1A 2FFBA 2GESA 4DB2A 3KUCA 2E1RA 4Q19A 1E1QD 1HQCA 2ZEJA 4XTRA 2GXSA 4HLUA 2ORVA 3VU9A 3RSLA 2QL6A 1DG1G 3AUXA 3SBEA 3D31A 1RVDA 4KSBA 2G88A 4CT5A 3BOSA 4C0BA 3HPRA 1QG2A 4Q4JA 4BUJA 1US8B 2EW1A 1E2KA 4XVQA 4XTCS 3L2OB 1RPZA 1VKJA 2O8EA 1AN0A 2IYQA 3FKSD 3MWLA 3U3JA 1IONA 1K6MA 2AL7A 3U4QA 3KXKA 5CB8A 1DOAA 1U0JA 4M4SA 3TGPA 3Q8XB 1R0XA 3CH5A 4GP7A 5J5CA 1GSIA 5HZHA 3IHLA 1NJGA 4IOMA 1RYHA 2ANBA 3QE0A 3GP8A 2GF0A 4MRRA 2QPAA 2QSYA 2R65A 3DHWC 4BE7B 2SHKA 1LVGA 1AA3A 3KQNA 1H8HA 2IUTA 2ZE7A 3C41J 1NKTA 1X6VA 4OK5A 4LJYA 3H2YA 4TYPA 4HLCA 2QRNA 1KMHA 4NBSA 5DN6A 3NKVA 4RZXA 2FNAA 3U3RA 3T1TA 5FTJA 1IXZA 4JMPA 1E99A 3A1WA 3CONA 5BN5A 3I8SA 4HAXA 5IDVA 2X2FA 3U6BA 3GJ3A 4TWZA 2GZDA 1ZM2A 2OFWA 1NI3A 3UMSA 4B3DA 1GKUB 2KWIA 3TBKA 2WWIA 1QG4A 1QHHA 3CR7A 2JEOA 4NZYA 4PO8A 1CR1A 1J99A 1I4DD 1W4AA 2WWXA 4MA4A 4DUGA 5CDFE 3H4MA 3LBHA 4NYMQ 4IOJA 3UG6A 2GILA 1YHNA 4DZZA 4XWAA 1Q0UA 4TLAA 4PHTA 2A5GA 1T0JB 4EJSA 5HE8A 4MRSA 4Q4LA 3SI7A 4IRUB 1XNJA 2DR3A 4RD3A 1DG3A 4NE2A 3SJZA 4UNRA 4Z1MA 1G64A 4FCVA 2QP4A 3DDCA 1G19A 5HTKA 4OJKA 5GVRA 1TUEA 2X1VA 3EWAA 4Q21A 3B5JA 4LJ7A 5JSZA 4TTRA 2V1XA 5EXSA 2G0NA 4JJZA 3U3KA 1UKVY 4ASUD 4GPTA 3Q9LA 3LXXA 3CX8A 3WYFA 1DAIA 2C2HA 3MUFA 1FMLA 4YMVA 4DCSA 2OXRA 1KIMA 1KHTA 3L8YA 821PA 1TQ2A 1ZVQA 1W0KD 3LXRA 2G83A 4P0TA 3AVYA 4JVNA 3C4JA 4DRZA 1XXHB 4BASA 2VP9A 4MYTA 3BD9A 1AS2A 4BFYA 5KDOA 2IF2A 1UFQA 2P2LA 4Q03A 2GKSA 1ZYUA 3GLFA 4BECA 4DHEA 2BEKA 4TYQA 1S4QA 1J90A 2WPDA 2QROA 1MO6A 3T34A 2PLRA 4QHSA 1G41A 2GCPA 2IBMA 2QQ0A 3D6TB 4UJ5A 3X1YA 3Q85A 2ZE6A 4PC6A 1R8SA 2WKPA 1P9RA 2IYXA 3SOPA 5F9FA 2GCNA 2YOFA 3BWDD 2ZROA 4TL9A 1LY1A 1E98A 1VCMA 3PFIA 1JPJA 2HCJB 1IXSB 4V02A 1T3HA 2PCJA 3TMKA 1YE8A 1U8ZA 2QMUA 3FMIA 3DOEA 4LBWA 3OFNA 2FZ4A 2J7KA 4XWKA 5BXQC 2Q6TA 3VFDA 5GADl 2ZRKA 1FP7A 3HYTA 4KBGA 4NCJA 2WTUA 4HB4A 3C5CA 4D82A 4M1WA 3RWMB 5G3YA 1P7CA 4LGMA 3A1TA 2MMGA 5JWOA 4TT3A 2NMVA 5DHAA 2VH5R 2GETA 3N2EA 3LX5A 1W4CA 3IEVA 1G16A 2QQEA 2RH5A 3KKQA 1XTRA 3S1AB 5DH9A 4MUAA 4HSEA 3VTKA 4TN1A 5G40A 2ZAMA 2R6FA 5L3QA 1JNYA 4DLSA 3EPKA 3QBVA 1NVVQ 1IM2A 1GILA 2OBLA 1TQ4A 2XXAB 1OXXK 1TU3A 2J5XA 2ZREA 2PX0A 2BCGY 2GJ8A 1E4YA 2LCFA 1FQKA 2GCOB 2XZOA 3RVBA 5ELXA 1II8B 1XD2B 3LVRE 5DYGA 1T0HB 4DSTA 3U6KA 3GLIA 4EDHA 4OQLA 2GVDC 2IYSA 2P5SA 3BXZA 3VMFA 5GJBA 2ZI4A 1IN4A 1XTQA 3HJNA 4JZKA 4QGAA 3NTUA 4G5RA 2IL1A 3AVOA 2IT1A 4JYCA 4PC2A 3PUWA 5LBIA 1S2MA 2BJVA 3LAWA 1A1VA 5HCIA 5JECA 1XEWX 3RC3A 2IUUA 4PZZA 1XBTA 1CJUC 2O8BB 1XD8A 1LS1A 1NKSA 3QNUA 1NMXA 2ODNA 2XAUA 3A4LA 4NKRA 1Q3TA 2O0HA 4WBSA 4PZLA 2D7CA 5TY0A 5SZIA 1PUJA 2CNWD 5H8WA 4TMKA 3OF5A 2BMFA 4DIEA 3M0EA 1ZNXA 1OHHD 3CF6R 1DAKA 2EYQA 4A8JB 1P60A 3IBGA 3UXMA 4HAZA 4JLDA 1NN0A 2ZE8A 4Q9LA 3GLGB 2YJTD 4LJ5A 3T5DA 3BB3A 4Q9IA 2PMKA 1WBBA 1IXRC 2IYWA 1S1MA 1DAHA 4D81A 2DBYA 4M9SA 1DVRA 1ZIOA 4D4KA 1G7RA 4C0AC 1NG1A 2F1HA 1MOZA 2H7VA 2WJYA 5F2EA 1WP9A 4Q7MB 4HZUA 2GJ9A 1Y3AA 4HI0E 1TNDA 1QVRA 4Q66C 1V43A 1ZC4A 4DLWA 1EWRA 2ZS7A 4JLOA 1M7GA 2YKGA 1JECA 4DSOA 1Q57A 1SXJE 4MITA 3RDPA 2X8AA 3EC2A 5TARA 2ZJOA 4YMWA 4DLVA 2PZGA 4EJSC 5EE5B 2NPIA 2J0UB 4CRWB 4EKDA 4MDEA 2IXFA 1P2UA 4AG6A 4NHOA 1NLYA 2AKAB 2ECKA 4Y0AA 1B0UA 5JCZA 1LF0A 4BLQA 1XEXB 4AYTA 1VCIA 4V03A 3W5IA 2CJWB 3B2EA 3EPHA 2KSQA 3B82A 3UATA 3NIBA 4IVQA 2OM2A 3QEJA 4ARZB 4CT4B 4URZR 3I4LA 4OHZA 5B64A 4RCZA 4M9ZA 4O3MA 4KYUA 2QGNA 3EG5A 4BPBA 3FKSA 1LFDB 4TZ0A 2WKRA 4ZCIA 2VSFA 4DT1A 3RRNA 1JPNA 2J7PD 3TR0A 3FMOB 5FOXA 4PPGA 2RCNA 2IW3A 3REGA 3QXJA 1T5IA 2PLFA 1GUAA 2Z4SA 2K5UA 3CIOA 3WMEA 1U9IA 4MDFA 2ZRPA 4UJ3A 1RJ9A 2IXGA 4EPWA 3EZ9A 5L3SA 1EFTA 1U0HC 2WWHA 1YJ5A 2JATA 1E69A 2IS6A 3CB4A 4CEJB 3OIWA 4LZZA 4Q9JA 1AKYA 5FTMA 2W6JD 1Z07A 2MSEB 4FMCB 2QM8A 1W36D 1N5JA 3OAAD 3OIYA 1UBFA 3G5UA 4B43A 1UKEA 1G8YA 2UZIR 3U60B 1HEIA 2JLYA 5EXXA 3NC1C 1D9XA 1IY1A 2HXYA 5JRJA 2FEMA 4QOSA 5EP2A 1FMJA 5EZ6B 2YV5A 2ZRDA 3HP1A 4I4LA 1WE2A 2LWIA 1E2QA 721PA 4U00A 1CIPA 1G8FA 1YRAA 2WICA 3R9IA 2MSCB 2NZJA 3I3SR 4DSNA 221PA 1NMZA 1JJVA 1T6NA 3B78A 1RZ3A 3OEHD 4R2HA 2VP6A 1YZKA 3VKWA 3QXSA 4A9AA 4IXNA 4A0FA 4X8OA 4KITB 1KO5A 1ZBDA 4FMDF 2REBA 1Z22A 2ZJ2A 4A2WA 2LKDA 3CNLA 2VTKA 2PL3A 3K0AA 1JAIA 4Q47A 1BH2A 2HLDD 1P3JA 2H1LA 1GZSA 3JZAA 1TU4A 4A4DA 2ZR0A 2W2VA 3OIUA 4FIDA 1QDEA 4Q01A 3VR6A 1OF1A 2QU8A 1ZJ6A 1F2UB 1UF9A 3B1ZA 4B3GA 2B6HA 1Z28A 4QRHA 3F0TA 2JIZD 3CZQA 1GL6A 3TLXA 3H0KA 5CYPA 3N70A 1RRGA 2FFHA 2C99A 3ADBA 3GJ7A 1WB9A 5IHPA 4OK6A 4AD8A 3RABA 1G5TA 2EFEB 1SVMA 5A0FA 1QHYA 1KI9A 1GVNB 1KO7A 1MR3F 1NJFA 3MG9A 3QY0A 3KQHA 4F7WA 2VP4A 3FTQA 4JBWA 3O8RA 1E9FA 3L82B 1N3BA 4KU4A 3THYA 1M6NA 1AZSC 2D4HA 2RGXA 4Q4AA 5TVKA 2ZRNA 5E7MA 2OE2A 2YYZA 1NSTA 4P31A 1KK3A 1Z6YA 2D3WA 1EX7A 4Q1EA 3RS0A 1ZD1A 2NZ8A 1EXMA 1NVVR 3IIMA 1U99A 2BM1A 1C1YA 1NG9A 2G9NA 3W9YA 1ODFA 4IDOA 4ZDJA 2QBYA 3QKSA 4L9SA 4B3XA 5GJWC 3LW8A 3K0FB 3CRQA 1KKLA 1R6BX 2VP0A 1R0YA 1XXHE 2ZPTX 5AJZA 4X8HA 4M2LA 4QGHA 1ZUHA 2HXSA 1OXVA 4PQRA 4PSKA 4B34A 5JI3E 2ERXA 3BFVA 4BEJA 4M1YA 5LD2B 1OXTA 1ZRHA 2AWOA 5KOYA 1W4BA 2P6NA 1DEKA 5KSPA 4XOIA 4BLTA 4PR0A 1T8UA 1M7HA 2A5FA 1ZU4A 1WA5A 1XU4A 4GMDA 2Z83A 5AWFC 2WJGA 4ZI2A 4UNNA 1OH5A 2J45A 1G9XA 2QTVB 3GJ8A 3QG5A 3DM9B 121PA 2W00A 3Q5EA 1DPFA 1JEEA 2QP9X 5FR1A 4GOJA 3I61A 5D3MB 1A2KC 4BZPA 5EJEA 1N0UA 1S96A 3L0SA 4XD7D 2F6RA 1N6NA 2ZYVX 1KI1A 2ZI3A 2WZQA 1KY2A 1E9CA 2CLCX 2Z6VA 3UPUA 3KXLA 4IW3B 4PHFA 3C8UA 2R6AA 3B1WA 2FE4A 2OZEA 3FB4A 2V4ZA 2D74A 2ERYA 1ESNA 2O8FB 4PX9A 4Q1AA 3I72A 4JKIA 4B74A 3T61A 4GT1A 2ZSFA 2VIIA 3W3ZB 2PEZA 1QHGA 2QY9A 2ZJZA 2QT1A 4NYIR 4POAA 1OHHA 5K8TA 4HZIA 4E07A 2G77B 2FF7A 2ZYTX 1U9IC 2ZAOA 1OB2A 1G3QA 4LPKA 3WNDA 1PLJA 4NL4H 1W48A 3G82C 1XJCA 5FTLA 1XTKA 4RSGA 1WF3A 2G1JA 1XJQA 3QKRA 3QPWA 3UANA 5BN4A 1HE8B 2BVNA 4BRWA 1E9RA 2JLRA 1N5IA 1TQ6A 4OQXA 2OEPA 2EFHB 4HAYA 3LWNA 3ONWA 3U2QA 1KZ7B 2WKQA 3A1VA 3W8RA 3E70C 1HURA 1KI7A 1ESMA 1SVLA 1XZPA 3K9GA 1OFIA 1U2RA 1YZGA 4KCGA 4HUQA 3ICQB 1GNQA 3TW4A 1R4AA 2JJ1A 3U7FB 4TYYA 5FL7A 5IK2D 1O87A 4PSVA 3FFBA 2WSSA 2FSFA 2HF8A 1BS1A 3QBTA 4DSUA 1CXZA 3PEYA 3OFND 4M1TA 3TIFA 3CX7A 4QHYA 4F93B 2R62A 1AKEA 1JQJC 2GWHA 2ZI9A 2ZQ5A 4KLNA 5JS7A 1E0SA 3IIJA 1P72A 3I8XA 4UXIA 2VP2A 4TLDA 4QFMA 4W9MC 3EPJA 3NEJA 2OG2A 5CIWA 3NDPA 5C4MA 1Z83A 4NH0A 3U44A 5FUYA 1EK0A 1GTVA 2QNRA 3GLGE 4OI1A 3B9PA 4LV8B 1IOZA 1ZM3A 4UXHA 2FN4A 2I1VB 3PEVA 5FOTA 3SNHA 4TL8A 4MUBA 3GJ6A 4RFSB 3X1ZA 2ZYWX 2ZRJA 1DO0A 4CDGA 2CLSA 2XGJA 3EZ2A 2J7PA 2OBMA 1G1MA 4YDHB 4HDOB 4WIAA 1D2EA 1M2OB 2IYRA 2BV3A 3EXAA 5FBLB 3DZ8A 2ODBA 1S3SA 5DI3A 3B13B 4LY6A 5EE1A 1EFUA 4A0GA 1NSFA 2IEZA 4N0DA 2NO1A 1I4TD 1SXJB 1IBRA 3B1VA 1XPRA 2ZE5A 4DLXA 1GM5A 3KJGA 2VSOA 2ZJ8A 1IQPA 4BLSA 3VHXA 1JXMA 1FX0B 4MYHA 2W6JA 1KI6A 1GNRA 2AKYA 2B92A 5AR1A 4YMTA 1YR7A 4XH9B 3U7HB 1AK2A 3KKOA 1NRJB 3OAAA 2P65A 3OZXA 4MGYR 1RKBA 1NIPA 2FPMA 2JAQA 2WWGA 5CB6A 1KSHA 2ZS9A 1JAHA 5IRCD 1W5TA 4LDJA 5B57C 1Z5ZA 1G4UR 2EFGA 2J1LA 4HAUA 4DDWA 3ZIAA 3CRVA 4PTLA 3ASZA 1GITA 1GG2A 2GZHA 4FWIB 4Q18A 4D6PA 3PXGA 2H18A 3N5CA 3GLFE 3OEHA 3IHWA 1UBEA 3L0IB 4JLKA 5JJLA 1TEXA 4WXPA 4KFUA 4OYHA 3A6PC 4IDHA 2V7QD 3FFAA 2F1RA 2QE7D 2AHOA 3QVUA 4ZDWA 5K8UA 2A5JA 1KDPA 1P62B 3NH6A 3VHLB 4A2QA 1XEFA 4FN5A 5TDHA 4WW0A 4F38A 2OHFA 3AVUA 4C2TA 3QVVA 1M74A 1Z47A 3UMRA 1JR3D 2HLDA 2JJ2D 4GOXA 2Z0MA 3BJIC 2ORWA 2OUKA 4A0HA 4R2IA 3VX4A 3T1VA 3WHKA 3W34A 4L9WA 2B7BA 3VKHA 4A82A 2QTHA 4AYWA 3I1FA 3QQ5A 1YKSA 3SJAA 4NCIA 2FJUA 2H5EA 1BYIA 2J9RA 2JIZA 4NMMA 3SJCA 3BS4A 4F4JA 5HPYB 4TL6A 5FBQB 2PJRA 2UKDA 4X8MA 4DCNA 3ADCA 1LW7A 4AYXA 5JRZA 2G0TA 1VDZA 4RD4A 4YDSA 2Z43A 4Q02A 1CJKC 2OAQ1 4BLPA 1F60A 5G53C 4JLPA 1K5DA 2ZRIA 3CNOA 4NYJR 5AUOB 5DGXA 3WNCA 2OT3B 3QXXA 1W2GA 1F5NA 2IYTA 4GMXA 4KXFB 2RGGA 3SZRA 1LS6A 1TUIA 1KSJA 4QJ3A 1A7JA 3GD7A 2GK6A 2VEDA 2EFCB 2C04A 2E87A 5AJWA 1JALA 5J4KA 1Z08A 3BH7A 4L5BA 1ZIPA 3THXA 3OESA 3ZJYA 4D4MA 4E03A 2VF7A 2CMKA 3LVQE 1WRBA 1DAMA 1F2TB 3VQTA 2ZSEA 5BYKA 2WOJA 4Q00A 5BW8A 1L7VC 1KJYA 3FVQA 5L8VA 2BCJQ 3WP0A 1NN1A 1SKYB 5M04A 3FKQA 3A1UA 1KY3A 2I3BA 2ZXUA 2J0VA 1IAQA 1H8EA 1RFLA 1UAAA 4TTPA 1ZU5A 3CM0A 5FOVA 5CM8B 1G5RA 2ZITA 1ZC3A 4IXMA 1HYQA 3VKGA 3VR4A 3FPAA 3TAHA 4EIWA 3KKPA 3DPUA 2H8KA 1VECA 5A5GA 3TUZC 5AK0A 2GEUA 3SBDA 1U81A 2P6UA 3HDTA 4G1UC 4M1MA 4Q1BA 1UPTA 4YMUA 3OHMA 4JT4A 1XTIA 5CITA 3NBXX 1KO1A 3HU1A 4J0QA 4Q4HB 1KMQA 4RD6A 4G3XA 4F92B 4CEHA 2IHYA 2ORIA 1FZQA 2REOA 4XD7A 3TUJC 3BIFA 4PANA 1CR0A 4AWXA 2OV2A 2AXPA 3MWYW 3GJ0A 4DVGA 3DOFA 2QMHA 3BORA 4LC0A 3MWKA 1Q21A 4GOKA 4ZIRA 2FGKA 4DEXA 5HKKD 5KDDA 4Q7JB 1F6BA 4BWYA 4OHWA 3ND9A 3FMFA 3CUEF 2PT5A 1E4VA 4YMSA 3K9HA 5JI2E 3PQCA 1XCPA 1XMIA 2GZAA 2AFHE 2P67A 5TV2A 3RANA 5UKDA 4EQ6A 3BE4A 2DFNA 2P5TB 2RGNA 1SHZA 2ZI6A 3MSXA 3PUXA 2O8DB 1YZUA 2A30A 4C0SA 3NVAA 2W2XA 5C4GB 2ZSDA 4ILEA 1U90A 2V55B 2B7CA 2D06A 4AC9A 5LDDC 4C2UA 4B3BA 4LHYA 4PC7A 1R10A 4URUR 5EQTA 1HQYE 1R7RA 2R8RA 3BGWA 2BKUA 4B3FX 4CW7A 4D26A 3NH9A 2IEYA 2Q9BA 2C9YA 2HUPA 1ZNZA 1FNNA 1A4RA 1E2JA 1W36C 4TMWA 1QRAA 4D2IA 1TAGA 1MO4A 2MSDB 5JFGA 3ZVNA 2R44A 1XWIA 4ZDIA 2XITA 1OLOA 1NLFA 1P61B 3RHFA 2O52A 1KO8A 5IK2A 1HUQA 4Q9KA 5F98A 4H1UA 3IBYA 1XMJA 2Q3HA 4LOAA 2OAP1 3R7WA 2AN9A 3GPLA 2F43B 4PO1A 2ZUDA 1J8YF 1M7BA 4LJ6A 3QJYA 1DAEA 4YLGA 1MO5A 1HT1E 3K0CA 2ZRBA 3MRSA 3CWZA 3AM1A 1AA9A 3AVXA 1PZNA 4QJ4A 3TVDA 1P2VA 4A1FA 5ANRB 4A0RA 1T9HA 4TLEA 1L8QA 3ZS9A 1EFHA 1D5CA 3PENA 1RYFA 1G3IA 3QG1A 4HAVA 3ZQJA 4ON9A 2DWOA 5BYJA 3BC1A 2CCGA 3EARA 3IO5A 4FMDB 3GCGA 2HV8A 2RGCA 3LLMA 5KDLA 2WHXA 1S1CA 3QOFA 2IHBA 2OFOA 1KYIA 2CL0X 3FGNA 4MKIA 2OXCA 3QPUA 3VU9B 4DLZA 1ZM9A 2XSZD 3X2SA 4UKDA 3RSOA 1W2HA 3QKUA 3AGQA 5FBVB 5DIFA 1FW6A 4URYR 4L16A 3TQCA 3T35A 1RE0A 4HLUC 1OT3A 4Q4JB 2WIBA 2WAYA 4GSYA 3Q7QA 3QKTA 1M1YE 4JKYA 2VF8A 2IK8A 2O8EB 4BRUA 1P9WA 1NBME 1ZUNB 3GFPA 2VHCA 2CHGA 4E5UA 2W0MA 4G5SA 3HPQA 3SHWA 3U4QB 4CEIA 1E32A 3MJHA 1QVAA 4RCYA 1RC8A 2IXEA 5JEEA 2VHJA 4XJXA 2GEVA 2NG1A 4HB2A 1XP8A 2OLJA 3AB3A 3O8CA 2CXXA 1K8RA 1YR9A 3QF7A 4BFUA 2FV8A 3SE0A 1Z6XA 3T5GA 3MGCA 4R7ZA 4MGZR 2QN6A 4F91B 4DEYA 4B33A 3F3YA 4HUTA 3JVUA 1T3SA 3NHAA 2HCBA 4N3NA 2ZR9A 2IYYA 1GRRA 1KMHB 1N0WA 1P2TA 3IQXA 1ZUIA 3C14C 4G5OA 2OFXA 3K70D 4P4SA 3LBNA 4RVCA 4CF7A 3FWYA 1GAJA 3SDZA 3TJZA 4M0LA 4QHTA 4IJMA 4NTZA 3GLHA 1E0AA 2PT7A 4KVGA 1IN5A 2GXQA 4Q1FA 1FNMA 2XOKD 3EC1A 2H17A 4Z54A 2V7QA 1KSGA 2QE7A 1U98A 1QHHB 4D0NA 1G8HA 3BH6A 3K1JA 4HDCA 4C9BA 4A36A 4LHWA 3P1JA 3UWKA 2A78A 4IDQA 2D2EA 2JJ1D 3P4YA 1JR3A 3VNVA 2JJ2A 1SGWA 4V0LA 4EJSB 1OH7A 2ZTSA 5FL7D 5E7JA 3GMTA 1IHUA 2A2ZA 4IFBA 4M22A 2WSSD 4AI6A 1P6XA 2CDNA 5JEDA 2IC5A 1NF3A 3IEUA 1E79D 3IPYA 3AVWA 5JSZB 1IY2A 1XF9A 2BDTA 3E5HA 4JLAA 1Z29A 2VL7A 2JLVA 1G3UA 1JB1A 4EPTA 4LUCA 1LNZA 1T8TA 2GHIA 2CK3D 4MGKR 3NG1A 3FHCB 4ZO4A 1UKYA 2A7QA 1P4SA 4P4TA 3AV0B 3ZLJA 1YZQA 2UZ3A 1TTTA 2ZVPX 3AVQA 1DADA 2AD1A 3ADKA 4PPNA 2Q9AA 1L2TA 3UG7A 4LYJA 1BIFA 1W46A 3K9LA 4JBYA 1E9SA 3E1SA 3VNUA 2YC4C 3L0PA 3PG5A 1E0JA 3FE2A 2JLWA 3GLFB 2XJ4A 3AF4A 3GJ5A 3RYTC 1E9EA 2BMJA 5FI1B 4C7OA 4FWTA 2RGNC 5J4YA 4AY2A 4US0R 4RZUA 3CKLA 2ODWA 2JCSA 2V6JA 3HR8A 3V4FA 4C0KA 2OILA 4LC1A 1COWD 2FOLA 2YVUA 3D7MA 4LK2A 4NYMR 1HA3A 4RD2A 4EPYA 5KUTA 4TMZA 1E2GA 3EZ7A 4V0NA 2ZJYA 1UADA 1Z63A 1PLLA 2HDNB 1TX4B 5C18A 2EWVA 1X8LA 2BBSA 2PBRA 5FPKA 3HWSA 3KKNA 4X8LA 2HT6A 1KI4A 2CEAA 1NLZA 2GJAA 3AVPA 1N5KA 2N42A 4S2EA 2JLXA 3KUDA 2B21A 2R6CA 1XMSA 1Y63A 2CHQA 4L15A 4EFMA 4ERNA 3FOZA 1TF7A 3W3AA 1RRPA 2ATXA 3AH8A 5AJVB 4UNQA 1LB1B 5JJKA 3A4NA 2R6GA 2C8VA 1E2PA 3C7KA 2Z4RA 1HT2E 2YWGA 3ZIAD 4RKEA 2KBFA 1GFIA 3D3QA 2QAGA 3KTAA 2BMEA 3QI2A 2QORA 5FPHA 4D4JA 3RS4A 4IOKA 2VO1A 3RLFA 2J0SA 3W8NA 4W7SA 3THWA 2HYIC 4QL3A 5L3QB 1CF4A 2EU8A 5HZKA 1E6CA 5H68A 1PLKA 1YZTA 5KSOA 2WWYA 4BFWA 2X77A 3PUZA 5FUWA 1KNXA 3AP1A 2DFKB 1W5SA 4GNKA 3GLIB 1Z6AA 3K09A 2GJSA 5HKKA 4C0JA 4DWJA 1OV4A 1OIXA 2PZEA 1Z2AA 4CZ2A 2FSGA 2CCJA 1EX6A 1AGPA 3ZZ0A 3TQFA 1SKYE 4LRWA 3HU3A 3NC0C 4OQNA 1EFRD 4S35A 2ZVQX 4FW9A 4Z8YA 3VX3A 3A8TA 1FOEB 1KJWA 5DHFA 5FOUA 5KSZA 2BKEA 1N5LA 1UDXA 4KFTA 1N25A 2ZRFA 3QEOA 1SQ5A 2AK2A 2ZJAA 5JLJA 4FXPA 1BMFD 2NO0A 2GNOA 4L8GA 4DB4A 2CVHA 5H1YA 1OYWA 4RY2A 2AX4A 2YC2C 3O8DA 2ZRMA 3ZVLA 4PAQA 4F4CA 2VA8A 2NPFA 3V00A 5P21A 1VPLA 4PQFA 3PCRB 4BFTA 3KZ1E 5CJ2A 3I32A 1UEJA 4PXAA 4B71A 4RZ3A 1A82A 2HEIA 4LSGA 1DE0A 4QJ5A 3A1SA 4WAUA 1R0ZA 2N1BA 3V9PA 4NCNA 2F55A 2W6IA 5KPDA 3MLEA 4TSFD 3AKDA 4HZUB 3QF4A 3SU8A 2CL6X 4JT2A 3EA0A 2QENA 3DEFA 1YR6A 3QSYA 2FH5B
chains in the Genus database with same CATH superfamily
1KYWA 4AICA 4Y6RA 3E81A 1E2HA 4KQFA 4YQEA 5CMLA 3OZFA 5HKAA 2PMBA 1F3OA 3GN2A 1VYUA 1I5RA 3NONA 3PGA1 3QWBA 4M0EA 1Q1ZA 1MC5A 5JMPA 3M6VA 1Z6GA 4JUBA 4RIEA 3HJFA 4LV5B 2FY8A 4DRXA 4RD0A 5EMKA 3THOA 3MT9A 2IF0A 3OTHA 2Z95A 3FSGA 2SCUB 2X2OA 4UU7A 5BWCA 5ICSA 4C0XA 5AI9A 1Z2PX 2DRIA 1DAOA 2ZDQA 1VHJA 3P5SA 2QQFA 4KV7A 3R77A 4LX8A 1T13A 2X5NA 3ZLUA 2B6NA 2P9TA 3ADDA 1JJBA 3KR9A 3ND7A 1H4QA 1F14A 1Y6RA 1E2EA 3TNDA 2ARKA 1Y6ZA 1N92A 4UHDA 5F7XA 1LGYA 2R6DA 4Y7CA 1EAYA 2A7XA 3IQFA 3KS9A 1SUDA 1E2FA 3IDQA 5EJAA 5IUKC 3STHA 4ES6A 1GKLA 3RS2A 1UC9A 1A4XA 1TAHA 3COPA 4DT1B 2VYFA 3F67A 1SVWA 2JEYA 2VG8A 4KEAA 5IYZB 5IZCC 2NXJA 2A9KA 1ZHOA 2G04A 2I6TA 4RAOA 2IEBA 2NO5A 3W0LB 2EFYA 2ZTUA 1HE3A 3JZIA 3EWIA 1YC2A 1RRKA 5HFNA 2IWRA 3EYWA 3F71A 2EBUA 3RNLA 4ENWA 2O5CA 1RJ9B 3KPJA 4KK4A 4P22A 1PX2A 3H5OA 1HTTA 2XWSA 2J3EA 3H9QA 3M3HA 4OGWA 3H6GA 3I30X 3GBSA 5EJIA 3CRW1 3ZEAA 3FHTA 4L4YA 2FLKA 1MABA 4KRXA 3KZXA 4MRMA 3HXPA 5JIBA 2NZ2A 2VF4X 2IPMA 4BBZA 3IRVA 1KY5A 3ER6A 4BFXA 1GWNA 1U9YA 4B79A 4KI7A 1ZP6A 4FKMA 2F1OA 1T2EA 1STOA 3P20A 4KQJA 4KXWA 4BFVA 1G7SA 4RZ2A 3RJ5A 2GAFA 1M3SA 4JCOA 2DFVA 4AUNA 2KMLA 2Q41A 1CY7A 2L19A 4BLWA 4MRNA 1ZN2A 1MT3A 2PM8A 3D8SA 3LCJA 5I9LA 5DXFA 1A5TA 1S02A 8MHTA 1ESCA 3DZDA 4JS0A 4XSGA 3UV7A 1P1RA 2ZRAA 4FR5A 3HJGA 5GONF 2GF2A 4DWWA 2OAGA 2JGDB 4NDZA 2OORA 2J9XB 4U02A 3DE5X 1R8QA 5BUZA 3UA3A 5T4EA 3MS7A 4OJMX 3K0SA 3HACA 2D59A 2F3SA 4BP1A 2JCYA 1BAPA 1FSFA 5FL3A 1J49A 4FHGA 1CETA 2DERA 3HJCA 3MAAC 4ROSA 3IUPA 1W1UA 4COKA 3CKMA 1AXGA 3HP7A 3P5BA 4F4DA 2AN3A 3HA2A 3KAJA 3OCUA 1KVSA 1Q1QA 3LK6A 1QG6A 3O9VA 3M3DA 2J30A 4OK3A 3PF8A 3GEEA 1JLLB 3T12A 4BV8A 1REQB 3K4PA 5J2UB 4EHAA 4GH5A 2NN3C 3I2JA 1EWQA 2X5OA 3LRPA 3RRYA 3PPWA 2BFMA 4ZT4A 5ILGA 1J97A 1OYYA 2GN2A 4OXRA 2AN5A 2W6ZA 4NU0A 2H11A 1U3FA 1YU9A 1FP2A 3PKJA 4ALIA 1Z0DA 1AXEA 1IK6A 3B8HA 3U3DA 5H70A 5A6SA 2KLBA 4GZMA 3CO5A 3LKDA 1R50A 2VCEA 1DELA 1F51E 4LGVA 4PRZA 4EJ6A 3OCCA 2QUHA 1Y3BE 4ESHA 2NOAA 4HDSA 3GCZA 5H4GA 4YWJA 3ZD8A 2VPIA 2WWFA 4KWHA 1A7KA 1EINA 5EXPA 2NU9B 4WZBB 3RKUA 3RO7A 3LKVA 4M8KA 1UIRA 1G3RA 2GRAA 4UOEA 2C95A 1V48A 2ZUVA 4EF4A 2QYSA 1W49A 2C5EA 4NCKA 2WSBA 1NXQA 5E6SB 1P5JA 5E9QA 3M6AA 1WKBA 5JD5A 1VC2A 3PCTA 1CLEA 2Z2XA 2XDQB 1C2YA 1XCOA 1YO6A 1WR8A 3PQ7A 2C42A 2ZPUA 1CR2A 1EEHA 4Y6OA 3L0OA 5SZJA 4CN9A 5D00A 1VJDA 4EW6A 4MW9A 1ITZA 5GV7A 1RQXA 4I8DA 4EW1A 3F6RA 1G7CA 2PGJA 4D5GA 4PG4A 3S55A 2P4QA 3ND8A 2ZZKA 1U3VA 4ND7A 2V0CA 1EJ2A 1WTCA 5K3OA 1XXHA 5SYNA 3T3IA 3BSSA 2II6A 4KLCA 1CP3A 5JISA 4IWXA 3MIZA 1TTHA 2CDRA 3ITKA 1ML3A 3LIIA 2IYLD 2Q6KA 1FE8A 1RM3A 3FSJX 4P34A 5IT5A 1P9OA 1K9VF 3QPDA 4ZU3A 1IG3A 3KAPA 2YNMD 3R6DA 1O6ZA 3W90A 4ZC1A 3KWMA 2YQ4A 1J2JA 1QP8A 1R9JA 1RWWA 3JYPA 2P9ZA 4IDNA 5E1BA 2PWYA 5ECWA 5L3RA 2RB4A 2VQ3A 5ESXA 2H2HA 3ZJTA 4OL0A 4RH0A 2JHGA 3PFBA 4UHFA 1R3DA 1GZVA 1KDYA 3BKXA 1QFXA 5I9MA 4DKXA 2HT1A 3DYBA 4RZQA 5EEGA 1JG3A 3LH5A 3SF0A 3TE6A 5H9VA 2PSSA 1DFHA 5AW5A 1PL8A 2H1OA 2XKAA 1L5OA 4HQ6A 1CUVA 1CPYA 2ETXA 1L4LA 4IXWA 4AECA 4L4UA 4B9AA 5B2FA 2IS4A 5FPSA 1A9TA 1LLCA 1EFRA 2X0RA 1X42A 5K3FA 3KFVA 4JLMA 1G20E 4UZSA 1F7UA 3CB2A 1Q0LA 4R98A 2BSQA 4IX1A 3V1TC 1DX4A 4M1KA 4Q3LA 2CBGA 4J16A 4B1FA 1E1CA 3EDQA 1CCWA 2HA2A 3LLUA 1NNI1 2BFAA 3EOAI 3W7BA 1ZA2A 3MXOA 4UAVA 1UBCA 1ISGA 3SC3A 1UXIA 1E9VA 2BWJA 2E18A 3TD2A 2DXIA 4QREA 3GI1A 3N2IA 2BGJA 5DEOA 1YKFA 1U2GA 1VRCA 4KQXA 4X90A 1BU5A 3I2GA 4U9HS 1LA2A 3NHLA 3KFXA 3CNHA 5CDTA 3ZVMA 2P2YA 1GUFA 1FLDA 3QKRB 4RHUA 1X1SA 2KLHA 1NUHA 4HTAA 3RFFA 5I4CA 1G42A 2YJ5A 1E2UA 2AI1A 1O96A 2ID9A 2BF4A 4LY9A 16PKA 3W5BA 3MJCA 3GLIE 1ODSA 5EVCA 3PJFA 2GD1O 3ZW7A 3GG2A 3WGGA 1SUWA 3AKYA 4HUQB 4TSFA 1SVOA 3S0JA 3QLVA 2VDOB 2VJAA 4UXJA 4RMHA 1TVKA 3LQFA 2H2IA 1MRSA 2YL2A 2GPSA 3F8WA 4RY9A 2R96A 3OZSA 3G8AA 4EG8A 2WJ3A 3HBLA 3FZEA 2QG6A 3HJTA 4QNRA 3UYLA 1KK1A 1F12A 2UVQA 1BS9A 1IXKA 1PR4A 1ZK3A 1JI0A 2PNJA 4C7JA 1NQ5A 1O3YA 4DL9A 4MV5A 4A8PA 5KWJA 1LBEA 4MUXA 1AA6A 3S7ZA 1QZTA 1W0JA 5AT1A 4ZVPA 4UTPA 1NW8A 4M55A 1GDDA 2GCIA 1NIJA 1OYVA 1FPMA 3CR3C 2Z1NA 3IRUA 4MV4A 4OSOA 5LZ8A 2XNDA 4C5CA 3RODA 3V4LA 3FTEA 4O4IA 4HDNB 2ZPAA 3DB2A 5DBHX 5A4DA 2XMDA 3TXYA 3IIKA 1OGYA 3JATB 2Q2NA 4L75A 3UEOA 1YBHA 3VAYA 3E5MA 5ALDA 3BSFA 5DO9A 4DLLA 3CEHA 1D2HA 4RTMA 1U1CA 1O8CA 1X8XA 2ZBGA 2O57A 2HU8A 5C5EA 1KC1A 1MNQA 1VG8A 5FLXA 3BFJA 3Q7RA 1URPA 4TQ9A 4X1KB 1B4DA 2NX2A 1Z75A 1PJAA 2FKNA 3OTOB 2HPAA 1SXIA 4QUKA 2X0EA 3PUKA 5LBTA 1H9AA 3V3TA 4KVFA 1EE1A 4KYTA 4BJ1A 2AZMA 1MBZA 3LL7A 2FQYA 4BNWA 4G24A 2DLNA 4P7KA 4ZK6A 4HNVA 4OOEA 1QNFA 1P0FA 1FFYA 2FQWA 4QXOA 5LMZA 1D8AA 2H00A 4GZLA 4BMZA 1DNPA 2CYCA 3CGWA 4LE0A 1VG1A 3W77A 4GPBA 2IS1A 3IEPA 3Q40A 4QBKA 3IR5A 3SS8A 4BX8A 1VTKA 4MA0A 3AR7A 8AT1A 1GOTA 5T7BA 1N6OA 4LF8B 4DOMA 1E1RA 3NM4A 4LXHA 2VJNA 4TWAA 2QF7A 1KI6B 4IIJB 1XEAA 1W36B 4DLAA 2HRRA 1AUOA 2JA2A 4KODA 3FDFA 2C92A 3IE2A 4Z99A 1G8KA 5C34B 3EAFA 5ES4B 2IZ7A 4HX5A 3X1DA 3K05A 2ZBDA 3ZGVA 5FV7A 4R8LA 4WZAB 1NN5A 5JH7B 3UT6A 3ANXA 1C80A 4O4LF 2AEEA 4C2AA 3OQHA 4B4UA 5WRFA 1C81A 3FLBA 4ARZA 2FDRA 2IVZA 4IGKA 5GMOA 4AK9A 2GF9A 4LXXA 4NY1A 4AKIA 3BVPA 3EAQA 2J4CA 2E3JA 3H1FA 1ZW6A 3U0VA 1G8GA 1OZHA 4DM7A 2DWQA 3LZCA 1NE7A 1WVGA 2Q8NA 3OWHA 2GPWA 2P69A 2QY6A 2VDRB 1EJBA 4GP9A 4YI3A 4EATA 1VJTA 5U4XA 2Q3FA 5HVNA 4HFNA 3W5SA 5HXAA 2CT8A 2PE5A 4GC9A 3RVRA 4NV1A 4P7JA 5BQ5A 2B82A 5CT8A 2HKIA 1KJNA 4U7HA 1WNTA 2P2SA 2GDJA 3RAGA 1E92A 4D79A 4ZAGA 2BD0A 1V7ZA 4C6SA 1SXHA 4L73A 3HXQA 2WAXA 1A9PA 4KR3A 3RCBA 3PJRA 1EAMA 1LD3A 3W2FA 2E37A 4HTFA 5J1SB 4BB6A 1C3EA 2HFJA 2D0PB 3GFRA 1U8YA 4FVTA 2YWHA 4WOBA 1T1IA 3GELA 4N3BA 4UBLA 5KYVA 1E89A 1P74A 4J2TA 1KKMA 1U0TA 1LBIA 1RXUA 1J20A 5AI4A 3VR2D 4CUJA 3P26A 4RLSA 1OREA 3OEEA 3AG6A 4YHHB 2EDCA 2F4VB 1OGIA 2D7JA 4DLTA 4KV9A 3KVOA 1OTXA 3RFUA 4BFCA 1JDNA 1OA1A 2JK1A 3BGDA 5CB4B 1FXUA 5GM2A 3T0GA 3KLMX 4WINA 5MFZA 1LLFA 2LUOA 4BLVA 1ILEA 1TQDA 4M8NE 3BK7A 2JCVA 3ETHA 4DIOA 1WDLA 3K2BA 3WZLA 2J59A 3NKFA 1NQVA 3ZY3A 4C20A 2RE8A 3SHOA 2GZMA 2BTQB 3SQDA 2C7PA 2BJHA 3T94A 1Y8ZA 1OTYA 4EJMA 4GRDA 1FDOA 2HPZA 4HR7A 2M9MA 4BCDA 1QO9A 3LD9A 2VT2A 3WZMA 1G2OA 2F00A 3GF4A 1VMAA 4IGAA 3COJA 1T6XA 2OR3A 1D7AA 1Z5VA 3THXB 3ZDDA 4RELA 1AGXA 1Y37A 3HDJA 5D3QA 3E18A 1C41A 3PDIA 4F5YA 4OF4A 4MCHA 3MOIA 1K4MA 1Q0QA 1VKHA 4G0NA 5LLSA 3ZWCA 5BN3A 3IP5A 4Y9RA 5JCXA 5FDFA 1BEZA 1K89A 1S2OA 4U8GA 3TH5A 1FP6A 4BTLA 4GMHA 2FZEA 4JP3A 1D4ZA 5BP7A 3W6NA 4AIIA 3DVLA 4L0CA 4P33A 2VH1A 1FUKA 3VH4A 5JDCA 2WA2A 3O6VA 5CK5A 2PX5A 2Q21A 3SJBA 4D0GA 5JC1A 2NGRA 1G17A 3IIIA 3UHJA 1W8DA 2ZBQA 1M0SA 1QRRA 4BB0A 4EPRA 2A1TS 5HTOA 4DCTA 1QTNA 3GT0A 3MWJA 4YP6A 2DBVO 1SZJG 3N05A 1Q7BA 5H0IA 5KYGA 4X95A 4JLNA 3M6MD 4PE5B 3TFWA 4MICA 3WRYA 2VKQA 1XD9A 2W2TA 3QPVA 1GZ7A 3OJLA 1O6BA 3UKOA 5CYGA 3KDSE 1ZA1A 1KEPA 3WX0A 1MQ9A 3RVQA 1XPOA 4M0CA 1MPTA 3PR1A 4ZOLF 1OZGA 1ZINA 2COKA 2ZSBA 4TKLA 1TO6A 3BGOS 5J43A 2O3QA 2PZBA 3QUQA 5DLQC 3V9AA 5HUHA 1PV4A 2RC6A 4JYZA 3RS5A 3Q41A 1QK3A 3HN2A 2NADA 3I34X 4TUYA 1N5OX 4UHJA 1L5HA 1QHSA 1XZLA 1F9EA 2WZDA 4BRZA 3B1XA 2QN1A 3B6ZA 5DIZA 4HDMB 3X2EA 4RWEA 3TLGA 3N7AA 1QUEA 1TXGA 1YSCA 3U4MA 3C8DA 2OLKA 4EYGA 1JDTA 2ZDGA 3GO4A 3WZ2A 3KOWA 5AW8A 1DLIA 1T9AA 2FUNB 2R85A 2VDKB 2PTHA 2Q4DA 5JCJA 1R0SA 4F4FA 1I6KA 5DT2A 3FAZA 3ZG6A 2Q2WA 4AJ9A 1A76A 2J6HA 3RRZA 2QK4A 4GVXA 4EQ6B 3V8BA 2VF2A 1C9JA 3A9TA 1R00A 3W6UA 1JBKA 1QYCA 2HF2A 2ZUWA 5AJTA 4FFBB 4U7TB 1JU9A 3LGXA 4ZQCB 1RXEA 3FFWA 1ORRA 4CR7A 2VRBA 4UNPA 1N57A 2HK9A 3SZMA 4DLYA 1Z0IA 2OSBA 1ZI8A 4JC4A 1TF2A 1EM8B 1M9NA 2XTMA 3LC0A 3UENA 3WYGA 2FVYA 2VPYA 3H4VA 3LPDA 4JBXA 2OHVA 3AQ4A 3I4FA 3OIFA 3H05A 1W47A 3WGYA 5KS2A 5LP6B 1N7JA 2Q28A 1GNSA 3OE7D 3ABIA 3NTLA 1CQXA 3BMOA 4RVFA 2ACWA 2NO4A 5D3MA 1I4LD 3AL2A 3R74A 4NRDA 3DWIA 1SVSA 1ECBA 3U9TA 1VCHA 2YOHA 5C1OA 1C30A 5G41A 2PUAA 1DCKA 2UXCB 1GU7A 2A33A 1ZNYA 2VRNA 4LZPA 3R7WB 3WYAA 1APBA 1PNQA 4DV2B 1WABA 2DUUA 2RSLA 5C53B 4CKYA 4O1MA 1V7PC 2IY9A 4GWLA 3BRWD 4B84A 3FMPB 3SE7A 5IT0A 2WT4A 3SHFA 3P8ZA 3HYLA 2X9NA 2J3KA 3GP3A 3UNXA 3DMNA 3ZHYA 1ZK4A 4JLSA 4TYWA 1NF8A 2OHOA 2P0AA 4ZT6A 3EVGA 3K0CC 4G8CA 4KPEC 3JQ9C 1R4NA 4PSAA 3O8OB 4TZKA 1XZJA 4BXOB 2EQAA 3EH2A 1WD5A 5COBA 3H2BA 1CJMA 4LVNA 5K6RA 2H07A 1P8AA 5C1BA 2HO5A 1WXHA 1WXDA 3CV3A 3GFVA 3L79A 4HNAB 4Y2XA 2EWWA 1IN1A 3UMYA 3T4XA 4M8LA 3KHTA 4J91A 4K46A 4PLGA 4TLBA 3T5BA 1J07A 4CKBA 5JV5A 5JBNA 1M6YA 4HQRA 4TRNA 2C7OA 3L4EA 3KJEA 3IUEA 5JALA 2DB3A 1LU9A 2ZIXB 3G0HA 4D0LB 4DG5A 3GA7A 1LJ8A 3BWVA 4E88A 3QXHA 3L18A 1H3NA 3J7AC 2JJMA 3PEFA 4GR4A 2J3DA 1AS0A 2NIPA 3GLRA 3HHEA 1F0KA 5A3VA 4Q93A 1JWLA 1J2YA 3AEUA 1ST3A 5A4JA 1ZWLA 1D07A 1EG7A 1WIWA 1PV1A 1A5BB 1CRZA 2FPKA 2HYDA 1RAIA 2ZXEA 3RRXA 3PD0A 1Z88A 4ND8B 1IBSA 3WKAA 4CQLA 7GPBA 4KC0A 3NS7A 3NWOA 5KWEA 3BZUA 5EUMA 3B3FA 3NW9A 5K0NA 1KARA 3DL7A 4KX3A 3QYPA 4WUVA 1KTVA 5L4LA 1RNLA 2QV0A 3GJ4A 1G3MA 1B6SA 1GYRA 1Z0JA 5KYYB 1D6NA 1GQYA 1KVQA 1W0KA 5L3VA 3DMDA 2IV2X 3HDHA 3GT4A 1WV1A 3KQQA 3U80A 4XVHA 3OJFA 2RGYA 4G1CA 3ELBA 4MRPA 3NBAA 2UZ1B 5AI8A 4BB9A 4PC1A 2M32A 2Z5FA 3GLHB 3N74A 4XSHA 1YUNA 3LQ2A 4JZYA 3MPUA 3FJ1A 5B1EA 4D9IA 5K0SA 2ZYUX 1IRIA 4I9UA 3UIEA 1JHZA 1RYDA 1RFGE 2VDJA 5GJCA 4PHGA 2VPZA 5C3UA 2DWPA 4DZTA 5HW0A 2Z98A 2OBYA 3NTRA 5HCNA 4EABA 4N41A 4RTKA 1KK0A 1T36A 5DMXA 2OESA 4B5LA 3LUJA 3PKZA 3OFJA 3OM9A 1G18A 5EUQB 1C8KA 1SQSA 3VR5A 5K8IA 2VI5A 3E9NA 4IZOA 2WLSA 3MMNA 4I4TB 3HJUA 3I42A 1AV7A 1SXJA 1XA0A 3CLHA 4UAGA 4OHVA 2Q27A 3PGKA 4G0VA 2XE7A 4PO3X 1FX0A 3OCVA 4BQSA 3R4VA 3D1JA 1ETHA 1QGUB 2IIBA 1A9YA 1EK5A 2PX4A 3IH5A 3B1YA 4P84A 1XELA 2A59A 3P2OA 1X77A 5H59A 4BNIA 4LNAA 3GA5A 1RWKA 2HMSA 1DIRA 3DBHB 1GQQA 4PLWA 1FX1A 5TQVA 4MDYA 5CRIA 1G6Q1 3OIVA 4MAFA 4WLOA 2GZ2A 3UWSA 3GPDG 1H8HD 4PYOA 2YZNA 4JJ7A 2EX4A 3ZWAA 1UOPA 4OSPA 4TS1A 2J9FA 5DN6D 3AESA 1TM3E 4G07A 3LUKA 4B6EA 4JVMA 2YFQA 3R3ZA 4X45A 1QH0A 2H0QA 3ZTYA 4HQOA 4XVUA 1CLUA 3PEUA 1J7JA 1U8FO 3JAMA 3A6EA 4WACA 2ZJBA 5DBEX 5DPMA 5TPZD 1GNTA 1FMTA 3CBQA 3PDWA 4HG2A 4HK4A 2Q7DA 4U7PB 4UM9D 5ENZA 1SKUA 2WJPA 5F52A 4J0JA 3RHZA 4MMYB 3AYZB 3DHVA 2BT4A 4A7PA 3L4BA 2CLLB 3IUQA 1HKHA 4LBVA 4HMOA 3U5ZB 2Q5CA 1I3LA 2YOGA 3Q6IA 5E9AA 5IN4A 1NVBA 3GAMA 2XB2A 2QI9C 1LDEA 5IDYA 3LDAA 2Q6VA 3WIEA 3NXSA 3DMYA 4NZMA 1M8FA 4PW0A 5AW4A 2JLBA 2FU5C 1IBCA 3VTZA 3SVLA 1OH6A 4M86A 5C8XA 1FFXB 2DT8A 3UUEA 1XJ0A 3CE9A 3C74A 2YBDA 2YIMA 2FVXA 1I5OA 5BNIA 4X1IA 2WYWA 3EZNA 4K1XA 1V16B 4ZFNA 4YXFA 4IDEA 1T8WA 3MTEA 1TW3A 4B6RA 1RPTA 2CW5A 4YVFA 4NXMB 1N2BA 4OH7A 4N82A 3WK6A 2JZCA 2PN1A 3TDKA 2GFHA 1B14A 4QOHA 4Q05A 1WHSB 1YQ9A 2BFEB 3LV8A 1R2QA 4QJBA 3GGSA 3DEZA 3ISTA 1R15A 2MT9A 4HLNA 4V0OA 4DILA 2V1UA 2BDUA 1JILA 2CNWA 4FI3C 1NT2A 3RPEA 4DIDA 4F5ZA 3PQDA 1RXYA 1H2BA 2W9XA 4LJAA 1GL9B 3SYLA 3YASA 3QHAA 2YHAA 1ULBA 3KTAB 4I5DA 3SYKA 2A6PA 3BX1A 4ZHQA 1R5NA 5JNRA 1HDEA 3I9JA 5GINE 5F1KA 5HS4A 4GLOA 3T3GA 2AG5A 3NFYA 1YU6A 4LJ4A 4CFSA 2HM7A 3GFFA 3NHWA 3MQFA 4CL8A 3TR5A 3NLLA 4H3KB 4CR6A 1C9KA 4HWTA 1GGMA 4FMCF 2YYYA 3VISA 5JS1A 4PF1A 4DQKA 2RK3A 2Z9BA 4FGSA 1FW8A 3C4VA 5BVHA 1F2TA 1M1NB 2ZT8A 4I3HA 1W0CA 3BJMA 4LQCA 4G63A 2NU7B 4WJLA 4ZT7A 1R5JA 2J5BA 4KZKA 2AD5A 1CZLA 3DAFA 2GXUA 1V6AA 3B3GA 4MARA 2E5LB 4IYRA 4O1HA 4ZOLA 5FWYB 3U3MA 4E5SA 5LYJB 1EB9A 2F17A 5LWQA 2Q1SA 3C3KA 4C5BA 4LIPD 4LKRA 1CUIA 3GRAA 5DI9A 4D98A 3ZLVA 2VPPA 2X3FA 4UTVA 3BF8A 1BJRE 2EL7A 4QFCA 5EIEA 4LDQA 5I9BA 3AGPA 4F8YA 3ANTA 4LQLA 1DJQA 5ALLA 4C7VA 5C8YF 3NX4A 1EFDN 4CMIB 5I5EA 2W0SA 5DSXA 3GHHA 1WDTA 5JUWA 2WAOA 4AMVA 2DR2A 4KHPB 3WBJA 4RKFA 2DJ5A 2H16A 3UMVA 5EJ9A 5IXJA 5J63A 5H9WA 3NNSA 2IEIA 2ZI7A 1IJFA 1WUIS 3LBIA 4HDKA 4HAWA 2KM1A 3CCCA 4M9XA 4TT3D 4IHAA 4P4NA 1JDUA 2JC3A 3WLLA 4H9GA 1XI2A 4F1JA 1PJ8A 3DFFA 4UBNA 2GA8A 2VQFB 5C46F 4UQOA 3HSKA 1C1DA 3ZU6A 4CIYA 1I9CA 2IKSA 2WWWA 1SUAA 1TFUA 3VJKA 1TRKA 3H83A 1GLGA 4OD0A 4QBGB 5FHRA 1X13A 3DEKA 4KFSA 4JAVC 4OMUA 3KSBC 3AIOA 1JGTA 2AGVA 2J8ZA 3KP1A 3GD5A 4FFSA 1YR8A 2RMKA 3H3FA 4KIUA 4M8IA 2EHDA 2JA1A 1WDMA 2QRVB 3A6JA 4MGHA 2B98A 1DQPA 2XA1A 3AKZA 4E12A 1WB6A 1XKXA 4LSMA 4Z86A 1X3SA 1NM5C 2BH9A 1YOVA 3NDJA 3WWOA 4D9FA 3QUSA 3ZQ6A 5KJ1A 2JGKA 1GPNA 2IEGA 5EWMA 4DR5B 3CPSA 1PUIA 4B3SB 4UBIA 4QG3A 1CE8B 2JJ8A 5B4VA 1SHKA 5CYFA 1X8JA 1CEXA 3DBLA 4D9NA 1CRPA 1A9RA 1F4PA 2C2OA 1KRWA 2ONKA 3ZHQA 3K6SB 1T4CA 1ZGJA 1OV6A 4HNTA 1BH6A 3LI2A 5IMBA 3N0VA 3NYWA 4E08A 1P1FA 3BG5A 3FRJA 3G9TA 3NGXA 1GCIA 1WMAA 1HTWA 4HH4A 3TI9A 1AKUA 4ZMSA 1Z0ZA 2O2GA 4INZA 3JQ8A 3NDBB 3DHYA 1AQUA 2RGEA 3WB1A 1DQSA 1QR2A 3QH4A 4DRXB 4PZ9A 4FS8A 5DM0A 4D3SA 4W6QA 5K3CA 2G8LA 3RIYA 1T35A 5JQGA 1BEUB 3DMPA 5I3ZA 4I2VA 3KKMA 4G86A 3DDUA 4YI5A 2H4XA 3C70A 1QZ3A 3EA5A 3KOYA 4LEIA 5G3ZA 2VAPA 3BD6A 5KQMA 3F7MA 2HRCA 3ZWKA 4G5QA 1GT91 2RGBA 3JARA 1ZPDA 2M6RA 1U65A 2EEPA 4EG7A 1VE7A 2XYPA 3FW1A 4LSWA 4BAGA 5EJ8A 4KAXA 1ZJYA 2JDIA 5CVDA 1PJ2A 4EVRA 4HBGA 1W8IA 5KPJA 1O4WA 4ICIA 5EHNA 4PRYA 4C06A 1PZHA 3L49A 4N47A 4NONA 1E9BA 2FCAA 3QMMA 3CLSD 2JIDA 1L4UA 1WULS 3CLTD 1DGQA 3KQUA 1FDIA 4M0FA 1E5QA 1QIEA 1ABBA 1MABB 3SHVA 1UBHS 4MRMB 1ECPA 2OZLA 3HR4A 3K6JA 1M6VA 1UZLA 4KAAA 5FJIA 4AKEA 3C0KA 3C24A 3H17A 4DDVA 4CVNA 2FFBA 2GESA 1OU0A 1N8KA 4RJKA 2VJPA 3U7JA 1EG2A 1FTGA 5C1IA 3RC7A 1UIMA 4NICA 4YRBA 1HQCA 2ZEJA 3DMGA 1RWVA 2GXSA 4C22A 1F6WA 2ORVA 5BV7A 1XZGA 2NZXA 5EERA 1E5DA 4MVJH 1R6DA 2B4TO 4C4ZA 1MRZA 4CDRA 1P0PA 1RVDA 4PINA 3VO2A 4C0BA 5H83A 4ALKA 4ZO6A 3MD9A 1MG0A 4P93A 4NPCA 5AVRA 2F67A 2JAXA 4FGZA 1E3LA 2Q4EA 2QJOA 1VKJA 4MR8A 4KMOA 1D6SA 1ZUNA 3MWLA 4F86A 3U3JA 1NT4A 5CB8A 4L9AA 4ZVLA 1DOAA 4H6XA 4DQ0A 1HI9A 1XLUA 4K86A 4P35A 1CJCA 4XM1A 3HXMA 2N3ZA 2Z1MA 5HZGA 1LWOA 1LI7A 3IHLA 1J0EA 1TE2A 1IE3A 1Y6JA 4R4JA 2ANBA 4JYMA 1PJZA 4H35A 1E3WA 1Q0RA 1GZUA 2TMGA 2VXCA 4JROA 4WK2B 3TI7A 2P3LA 3HNOA 3VGPA 4B4DA 2IUTA 2ZE7A 4OK5A 1YZFA 4GKVA 4PYQA 3ZEIA 3RC9A 4HLCA 2BP7A 4RZXA 2FWPA 1FSSA 1J1ZA 1I2ZA 1IXZA 3QWFA 3TPCA 3JU3A 2AG0A 4X00A 4F9TA 3I8SA 5D85A 5F5NA 2X2FA 5C5DA 3U6BA 2OFWA 2GZDA 1ZM2A 1HLFA 2KWIA 3C7DB 4YAUA 4X44A 4ARIA 4D45A 2DECA 1QHHA 3INNA 3IKMB 1W29A 4KO3S 5A6SB 1PJTA 1BC5A 1WZIA 3ZHTA 5KI6A 2H65A 2WWXA 1I4DD 3AR4A 4MA4A 4RS4A 1EGQA 3H4MA 4ENPA 4OXKA 1NPDA 1YHNA 3OQIA 3E3OA 4HDSB 1Q0UA 4TLAA 4PHTA 5DM70 1T0JB 1X7DA 4IGFA 4GSLA 3F1KA 5IAEA 3UCFA 1QLJA 2ILVA 4JEUA 3SI7A 1TJPB 3FNEA 1XNJA 2DR3A 3B6KA 3HCNA 3ILVA 1TO2E 1YOBA 3AEKA 1TZCA 1JTEA 3DDCA 2HIAA 1ZCFA 5HTKA 1UKBA 4DQLA 1C1XA 5JSZA 3A1CA 3EWAA 1B6GA 4EHDA 5HBGA 5EXSA 2V1XA 1GSOA 1NTOA 1OAOA 3QPAA 4HNQA 4AU1A 1AZWA 1LI5A 3LDHA 3EQ7A 4HS4A 4Q3CA 4MQ6A 3UCXA 5ITZA 1DAIA 4BN4A 5K6AC 1OOEA 2C2HA 4CQNA 1FMLA 4ZAXA 1MGPA 3HLTA 3SSNA 5CVCA 5EHXA 3BYZA 5AIBA 4MW7A 1KIMA 1KHTA 1WNFA 3JRWA 3QE2A 4NU6A 2JK0A 1DUVG 4JVNA 4UD6A 1XXHB 2OC9A 4XGRA 4BASA 3D3JA 2XVAA 3PICA 3OE1A 3GDWA 1ST2A 4JC8A 4ZRNA 1C4KA 3BM5A 1P9LA 1QF7A 3GLFA 4JODA 1X70A 4NZZA 3W1EA 3O1HB 2ZT5A 4KKVA 3ZXSA 2YXLA 2WPDA 1CUHA 1L5ZA 1ADGA 1YRLA 2QROA 3PDJA 4B9EA 1JZTA 2I4TA 3JAKA 2PLRA 3I9LA 2XV1A 2IBMA 2QQ0A 1F8XA 2UUBB 3GRCA 4UAUA 2ZE6A 1BHQ1 1RSZA 1U0RA 2WU3A 3PWTA 4OX9B 2Y2UA 4NCXA 1DFIA 4OBBA 4BQFA 4RHCA 3OT5A 2FXVA 4ANFA 1TA9A 1SQGA 2PY6A 3BWDD 1S89A 3A06A 1LY1A 4EB3A 1IUNA 3NWPA 4H15A 3UCEA 3MGBA 3OX1A 4HGZA 4J3JA 3BIOA 2ZWIA 2PCJA 4JU9A 1XDGA 4UEOA 5THKA 3TMKA 3ZE6A 1U8ZA 4CCSA 3FMIA 3E03A 2EX0A 1HLGA 1JL3A 2PGDA 1MB0A 2C3MA 4JBLA 5K3FB 1O77A 5AKIA 3GB9A 5I7EA 3OP4A 1IIRA 1FP7A 1IZYA 3HYTA 2WTUA 2XNJA 4MLZA 3QE3A 2WHRA 3U31A 3AC0A 4M1WA 4ARUA 4D82A 3RWMB 1X15A 1GZ6A 1E1CB 3EJ6A 4KZPA 5A71A 4DA6A 3STVA 2OQIA 3WGQA 3A1TA 5JWOA 2DPMA 3VYSB 1JWAB 3N2EA 4YP0A 1F0YA 4FIZA 1V6SA 1VJ1A 1W4CA 4JP5A 1G16A 3IEVA 1G63A 3MMXA 1MVLA 1RAEA 4R2LA 4EVQA 5FOQA 3VTKA 2FJPA 2R6FA 4UZEA 1XQ1A 2CHEA 4IAOA 2H5JA 3SP1A 5HFAA 3EPKA 2GN8A 1N2SA 5DWDA 5C8YA 3S81A 3NVDA 3WRVA 1LBTA 5KBYA 2H9YA 2B1RA 2FUG1 4FSHA 2WTAA 1O96B 2GT1A 5G4KA 3WWDA 1JIUA 2XZOA 3IL2A 1L4NA 3MCVA 4FOSA 2VATA 3OG9A 4L6IA 3LVRE 5DYGA 1T0HB 4GLFA 4TKUA 4BMYA 2PWPA 4TKZA 4EITA 2XBUA 5BQFA 1TMYA 4KXQA 2O2YA 2GVDC 3BXZA 2P5SA 2VNSA 2UVDA 3Q8LA 1D1SA 1IXYA 1IN4A 1PW5A 3BTSA 4UCWA 2AZDA 1TVKB 1TW2A 3ZWYA 5ABPA 2IT1A 4JYCA 3DDZX 3EHDA 4IUBS 1UZNA 3W5HA 1SBIA 3L07A 3LAWA 4PCUA 4PGHA 1A1VA 3G8CA 2CUKA 2BR3A 4FDAA 5M3BA 3SOOA 1OROA 3RC3A 1XBTA 1ZIDA 2O4CA 1VI2A 1XWFA 2I78A 2PHZA 2YDXA 3D1VA 2QUKA 3MJEA 1YGPA 4Z0PA 4F1WA 3FPJA 4WBSA 3ZDYB 2O0HA 1Z6ZA 4PZLA 4QDZA 5H8WA 1EWYA 3N2ZB 1DXOA 2O8VA 2NYAA 4OHRA 4G26A 1ZNXA 1OHHD 5BNZA 3CF6R 1DAKA 4O4IB 1NLUA 2EYQA 3L84A 2XODA 1P60A 1M10A 3PDCA 3DZGA 4PONA 7MHTA 2I4NA 1W6UA 3AV3A 3EGCA 1L5QA 1OWOA 4FEAA 3WWYA 3C5WP 4NDAA 4JLDA 2V6GA 4KKXB 4J0EA 4Q9LA 5G1PA 1Z56C 2JHFA 2XE4A 2IDZA 3BB3A 4YMHA 1UJNA 2R7KA 3ROTA 2X7JA 2PMKA 1VZ3A 4L50A 4NZNA 2B2XA 4PFJA 4DXDA 2W6QA 5M5BA 2XLBA 1SIWA 4JWTA 2FSUA 4WCDA 4M9SA 4RV9A 3M6WA 1RKXA 2YIDA 5ALJA 2P2DA 4YUXA 1ZIOA 2VOEA 2FX2A 4E30A 3JD1A 2YUTA 1UMDA 3L40A 4M0MA 1JHDA 1Y3AA 1TNDA 4TKMA 4W1QA 4YNBA 3VZDA 3R5XA 1KEWA 4CG3A 2PTGA 4XQGA 4WERA 3FCYA 1Y33E 4ARAA 3G5TA 1U2TA 1AN9A 3CINA 3GR6A 4MITA 2GQ0A 2OV3A 3V8EA 3QEBZ 2GPYA 1Z5UA 3EY9A 5U9CA 4LYGA 2PZGA 2DZDA 2HUNA 4PTZA 5EE5B 5TEWA 3SM3A 3RJZA 4CRWB 4EKDA 2X8BA 2AZ4A 3SYMA 3V1MA 3KU1A 1MFPA 4AG6A 5CVUA 1R0BA 4E33A 2AKAB 1JJFA 4REOA 4WBNA 2F1KA 5AKJA 2Q4OA 3QBDA 3WS7A 4R7GA 2IYEA 4BLQA 3H5RA 3A6FA 4MV8A 5ECGC 5IPFA 4AYTA 3K15A 1VCIA 1POWA 3KEMA 3GZNA 3U1TA 2YWXA 4HT3B 5EIWA 3I9OA 4IVQA 1ICEA 1XCBA 3PFCA 5COQA 1CJSA 4ARZB 2EKBA 4URZR 1HLDA 4BNLA 2SNIE 3TQHA 4ENQA 1LQUA 2QRPA 2VJMA 4UEWA 4OP1A 4OHZA 1F8UA 4IBOA 2YKOA 5FLKA 2QGNA 1EVZA 3P9IA 3FN4A 2I76A 2WF5A 3FKSA 3S28A 3G8DA 1JHMA 1KYZA 3UA4A 1ZZEA 5NULA 2O7VA 4DMMA 4EG1A 4E21A 4TZ0A 4EVSA 3E3MA 2IHKA 3K9WA 3UKJA 3TW0A 3MLBA 4OLBA 4ZYWA 2RCNA 2YCLA 1U0GA 2QJTA 4YHBA 1EK6A 1T5IA 1U7XA 1ISPA 3DUFA 2FEPA