1MO4A

Reca-atp-gamma-s complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
324
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RecA
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 89
structure length 324
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo4A01
2A9KA 5FOUA 1A1VA 4PZLA 3MUFA 3WMFA 4LBZA 2XXAB 5TARA 4A36A 1W36B 1E2GA 5FTMA 2Z83A 4IXMA 1GKIA 4XVRA 4BLQA 1P61B 3BFVA 2O5VA 3I1FA 4RZ3A 1JQLB 5F9HA 1QF9A 3OIVA 4K8OA 1E69A 4WA7A 5CYPA 3G82C 3ZIAD 3DO6A 4E5UA 2FFQA 1AA9A 5P21A 1DS6A 3R8FA 3GLFB 2V6IA 5JEEA 1I2DA 3EAQA 4BLRA 2G3YA 4DHEA 3ZVNA 3N70A 1TADA 1MABA 4MGZR 2BMFA 3A1VA 1MO6A 1RYFA 3QUSA 2QAJA 3UWOA 3PUZA 2BM1A 2GTPA 4B76A 4FMBB 1Z6GA 4WVFA 4B33A 3VR2A 5C18A 2KI5A 1KAOA 3IPYA 4DUGA 4G0NA 1D5CA 1U8YA 1ZC4A 2JDID 3R20A 4KBFA 3DKVA 3EG5A 2WTUA 2OHFA 2ZQ5A 3R9WA 4NCNA 2ZRFA 3HR8A 4TQ9A 1W47A 1F3OA 3GFOA 4JLMA 4V0NA 2I3BA 3D7MA 4IRUB 4DJTA 3TAHA 4OK5A 4DEXA 1W44A 1H8EA 1KNQA 2IXEA 5EXSA 2O8CA 1NSTA 3FFAA 1HE1C 1F2UA 4F4CA 3QKSA 2WJVA 3MFYA 4AD8A 1ZRHA 1ZD1A 3BH7A 2FEOA 2RGCA 2BMJA 4X8LA 3FHOA 3G5UA 3NXSA 4XSGA 3BIFA 3L0PA 1N5KA 1W49A 2RGEA 1N0VC 3KQLA 2OBLA 2H17A 3NEJA 2OAQ1 2REXB 4IFEA 1E9RA 2PMDA 2CE7A 2ZE5A 3SNHA 5BYKA 3AVYA 1PZNA 5DI3A 3QG5A 2VEDA 2CCJA 2O8BA 1XWIA 2J7KA 4A9AA 5CIQA 1TU4A 1JR3A 1L7VC 2R6GA 2IF2A 1T6NA 1G3RA 4PPGA 3CH4B 1P2SA 4ZKEA 4TQUS 4B32A 1NN5A 2GKSA 1W36D 3A58B 1W4BA 5FBLB 4NP6A 4OK3A 1ZP6A 4Q48A 3KJIA 2JJ8A 2Y8EA 3OHMA 1NIJA 3CH5A 5EE1A 3RS3A 5FBVB 2QA5A 1E9EA 1Z2CA 1CJMA 3QVVA 1DAHA 3IQXA 5DH9A 2QQEA 1E1QD 5JS7A 5J47A 1QG2A 3SFZA 4E09A 4BFTA 4W9MC 4R2IA 1DARA 2WIAA 1AGRA 1E9FA 2ZRHA 2ZR9A 1NVWQ 1CJTC 4JVNA 4KODA 4Q00A 1RVDA 2WIBA 4HDOB 1OYYA 2CL7X 5G41A 1YR6A 3NC1C 1E2QA 4OK6A 3K70C 3CRRA 1OFTA 2P2LA 4UNNA 4TLAA 1G17A 4OYHA 2RAPA 2IT1A 2FPMA 2ZYVX 1KI7A 1VG0B 2ZJ2A 2DFKB 2VRWA 4LHXA 4Q66C 3H86A 2OXRA 4HDCA 4B3CA 1Q0UA 5FL3A 4QG7A 3GEIA 4P3YA 3IGFA 1A4RA 3PUVA 4MKIA 1NL3A 3P26A 2CLDX 1Z22A 1BOFA 1HYQA 5H68A 4PR0A 4OBEA 2YNMA 1TF7A 2WKRA 3KXKA 2WMNB 5LB2A 2PT5A 1TQDA 1QDEA 2GZDA 2EYQA 2GBLA 2REOA 4O2RA 4B3BA 4ZKDA 5C2JB 4H1UA 3KXIA 2JLUA 1S96A 5CDFE 1IN8A 2R44A 4AKEA 5L3SA 2HJGA 5DN6D 1E0SA 4UXHA 1KDPA 3WYAA 5FI1B 3OEED 2NO0A 3EW9A 3N5CA 1R0WA 1S3GA 2RHDA 3GLIA 4A2QA 1OLOA 4BPBA 1Z6TA 1N6LA 2V1UA 1G3MA 1NG1A 3I5YA 4P4UA 1N6PA 4B2PA 2ZIAA 2V3CC 4HAVA 3TE6A 2AXNA 1EFRD 1XTRA 1Z0JA 4G5QA 3HWSA 1RRCA 4M8NE 3BOSA 4ASUA 2G1JA 4MRSA 5TV2A 1KMHB 4Q1FA 3BD9A 4XD7A 5L3VA 2J46A 4NCKA 3K0AB 2OLJA 4MGIR 3CWZA 3EWAA 3LH5A 2O52A 5JJLA 2BKEA 3QEJA 4IVQA 1N25A 4QBIA 1FTSA 4KLZA 4WXPA 2NIPA 2HYIC 5A4JA 4I81A 2FMXA 4BLTA 2O8EB 4RD1A 3C15C 2F1JA 4Z8XA 5SZJA 3E70C 3ZIAA 3BJIC 4LJ9A 2G6BA 4MKHA 3TSWA 1OFHA 3UANA 3ZZ0A 3TNFA 2FX3A 4LUCA 4F38A 2W6ID 4IOJA 4F7WA 4CZ2A 3LFUA 1FUUA 4LHVA 1XMIA 1G9XA 3CRW1 3I8XA 1MO5A 1COWD 4QXAA 4HAXA 3KJEA 2AXPA 3TRFA 2Q3HA 1WB9A 1ZM4A 4PO1A 1SVMA 4D4MA 2UVQA 1P73A 3EASA 2J87A 4QJ5A 2FSIA 2GDJA 4OKSA 4KITB 1ZCBA 1Z06A 3LVRE 2JASA 3MAAC 4F4JA 4PFSA 1WDTA 2WHXA 1OXSC 1U0HC 1LVGA 1Z3IX 2Q3MA 1U99A 1T0HB 4HUQA 1N6NA 2JDIA 5DIFA 1II0A 3BK7A 3F8TA 4LOAA 2H18A 2Z4RA 3GQBA 3CW2A 4LGMA 1YZKA 1Z83A 5LB4A 4US1R 1U8AA 2PLRA 5FPSA 4FWIB 5AK0A 3D3QA 3GLHE 2F1IA 4F91B 2VP5A 2OAP1 4Q03A 2H92A 2QEQA 2ZVQX 4US0R 2ZS8A 3MSXA 2ZRNA 2H57A 1XMVA 1DO2A 2JAQA 4PC6A 1OH6A 4ABYA 1KI4A 1YR8A 1NBME 4ZDIA 1SKQA 4GP7A 4JKYA 4KI0A 4QHSA 221PA 3A1WA 1Z47A 1IXZA 1DVRA 4E07A 1KJYA 3V9PA 4RD4A 5FUWA 5L8VA 2KWIA 4OI4A 1LY1A 5L3RA 1F48A 1RZ3A 3Q7QA 1N5IA 2FSGA 3K8YA 5JWRA 4MQBA 2ZRBA 4Q9KA 3T06B 2IX3A 1EX7A 1Q57A 2JIZD 2RKOA 4IJMA 3CR8A 2ZSFA 3OIYA 5TXGA 2EFGA 1V5WA 4DDWA 2WVJA 1GFIA 2BMDA 3TLXA 1PVOA 2QMHA 1KO5A 2WOOA 4FW9A 3H1TA 4NCJA 4RSGA 5TDHA 2YYZA 621PA 4XWKA 2BDTA 2W00A 4B43A 3SBDA 2ZI7A 1FOEB 1FP6A 2J41A 2JA1A 4RCZA 1HE8B 4YC7A 4GMXA 4ZI2A 5SZKB 4Q7MB 1US8A 4WW0A 3CKLA 4HLUA 1XEXA 2FEMA 1WBBA 3D31A 3GLFE 1GITA 2JLWA 3RWOA 1VMAA 3FFBA 4II7A 5EZ6B 4ARZA 2Q21A 1U0JA 4D82A 4OI1A 4C3ZA 3KB2A 4PTLA 1N5JA 1JI0A 1E1QA 1AZTA 1GILA 3AVPA 3BERA 4IVPA 3U6KA 4L16A 4DLSA 1O87A 1P6XA 4FMCB 1J2JA 3KQKA 1G7TA 2WKPA 2NG1A 1KIMA 4WAUA 1D2MA 5JI3E 2DWQA 4JBYA 4M9QA 2QRNA 1CJVC 3AUXA 4TMZA 3CR7A 4CDGA 4TYWA 2GJ9A 4XIGS 2ODNA 4B35A 3QF4B 1M6NA 1E2PA 4QRHA 4B75A 1Z07A 4TTPA 3ASYA 3VTKA 3SE0A 4QM6A 3ZD7A 3MWKA 4Z1MD 3OIWA 4M1KA 5K8UA 1OXXK 2AK3A 4JSYA 3EC1A 3FDIA 1DAIA 4PX9A 2B8WA 4IFBA 1HUQA 3QOFA 1P2VA 3AVQA 4YMTA 4A4DA 3A8TA 3ECCA 4NCIA 1U0LA 4TL9A 4L9WA 5EP3A 1HV8A 4A1FA 2O8CB 1W4RA 2GBLC 2HT1A 1F2UB 3QKSB 4YMVA 1T8UA 3Q5DA 2F3RA 4A6PA 3EPKA 4MYUA 2IWHA 3WYGA 3IILA 3TAUA 4C0BA 2QPOA 3I4LA 3BBPA 2ATXA 1IONA 4GT1A 1P2UA 1KK0A 3AVTA 1G7RA 3C41J 1EFTA 5DN6A 2OLKA 4FD2A 4IKEA 4ZO4A 3MRSA 1KSJA 2DR3A 3OEEA 1Q44A 2NO1A 5GJWC 3CIOA 1KO8A 5IK2D 2GXQA 4TL7A 1CF4A 2HYDA 1GL6A 2W2VA 3TVTA 5IDVA 2I4IA 2R9VA 3EPHA 2RGGA 4JYBA 2QM8A 3LY5A 4D81A 4QGHA 4BFSA 1EFRA 3U7FB 4RY2A 3FHCB 5BYJA 1TEXA 3LLMA 1JPJA 1J8MF 3GEEA 2J9RA 3FYHA 4GPTA 1QVRA 3EIQA 1CP2A 4GZMA 2YC4C 2ZS7A 5LPNA 2EVWX 1DADA 421PA 2IYVA 1KSHA 2VP9A 5JLJA 1O3YA 3DVLA 3NDPA 3ETLA 5CYOA 5DISB 3I92A 2MSEB 3RLFA 1OF1A 1OH8A 4RD6A 1MV5A 2VP4A 1SHZA 4TLEA 4BRWA 1X8LA 2C9YA 5EP1A 5JEDA 2F1HA 1HURA 3F5FA 4AC9A 3QNUA 1YHNA 2QGZA 1XD8A 4IDQA 4V0MA 1XZQA 1Q12A 4JJZA 2RGXA 4BGDA 2A7QA 3Q7PA 4FN5A 1RFLA 2ZSAA 4LYAA 1Z5ZA 1ZAKA 3RSOA 4EQ6B 3X1ZA 4QBHA 2FNAA 2W6IA 5FL7D 2CNWD 4LC1A 4FIDA 5JSZB 1Z2AA 4U5XA 2XOKD 3LBIA 2XJ9A 4NKRA 3W34A 3WBKA 1JALA 4PPQA 1VIAA 5E4FA 1UBCA 1COWA 3IIJA 2QROA 5FPKA 5KSOA 4LBVA 1XDBA 4N3NA 3T1VA 3WNBA 2C98A 4EPTA 2WOJA 2BEKA 4GOXA 4DUGD 4EUNA 2C04A 2ZI5A 2D2FA 1ZCAA 2X2FA 5CK4A 2WAYA 5HPYB 4XWAA 4P33A 4YLGA 4D0NA 3KQNA 4YXWD 1RPZA 1SGWA 3UG6A 1KAGA 3PXGA 5E3HA 4JLPA 3SEAA 1UKVY 1GRNA 4X8OA 2ZI6A 2ZAOA 1Y3AA 4AG6A 1E0JA 2ZR0A 2ZTSA 3AKYA 1KMQA 3BFKA 4DXAA 4QGAA 2HF8A 1UM8A 1NF3A 3CONA 1ETUA 1EK0A 5L3SB 4Q18A 1WCV1 1TMKA 3EA0A 1HTWA 1AS3A 2W6JD 3DZDA 4V0LA 2MSCB 2GEUA 2DCUA 3RS2A 3NVAA 3PJRA 2ZANA 1Z6YA 1ESMA 2RMKA 4MRRA 3ADDA 4DCNA 4TL8A 2F43A 4OQFA 1XTJA 5HTKA 1D9XA 1KI3A 1BIFA 1RC8A 1RRGA 5C46F 2YZ2A 5DI9A 4CT5A 3IEUA 1JB1A 3GFPA 1N5LA 2WJGA 3ZYCA 3B1WA 3Q85A 1KSFX 3LXXA 3ONWA 2X2EA 2XX3A 1OB5A 2QAGB 2WKQA 3DKPA 2RCNA 3AGQA 3IBGA 3L82B 1JNYA 4GMDA 3E1SA 3QXSA 3RRMA 1S0UA 2RB4A 2BOVA 3QEOA 1ESNA 1W36C 3LDAA 1E94E 2ZRDA 2N46A 4HLUC 2A5DA 1SKYB 2GEDA 3BB4A 4DCSA 1JXMA 3HU3A 3L2OB 1KO7A 4KFRA 5BW8A 2XZPA 4C2TA 1IN6A 3U61B 2IS4A 5EE0A 4FCTA 1E9AA 3D6TB 3U6BA 2O8EA 1JBKA 2N1BA 4Q4HB 1EG7A 4LJ8A 3TJZA 3VAAA 3SYNA 5E95A 3C8UA 2GK6A 2IXGA 4BLPA 1G20E 2ZROA 1AKEA 1F6BA 2QNRA 2HCBA 3QI2A 4OI2A 2V55B 4D6PA 3CNOA 1ZC3A 4KYIB 4A15A 3WHLA 3H2YA 5JJKA 4A8JB 3LA6A 3G0HA 1G5TA 3OESA 5GVSA 4JT4A 4UNSA 1NRJB 3WRYC 1JECA 2NO7A 1OV4A 4HZIA 1GSIA 4HB3A 1KZ7B 4FMDF 5AUQA 2XZOA 1AZSC 2X77A 3SQWA 2NO9A 3FMPB 3NG1A 5JS8A 5C1BA 2AR7A 4Z1MA 3IIKA 4US2R 1G4UR 1D6JA 2OT3B 4XVUA 2ASEA 5DGXA 1OFIA 3PR1A 5G40A 1Y63A 1VG8A 4ACBA 1UBFA 2A78A 2ZRMA 1JPNA 2K5UA 3KXLA 1QHHA 2JJ1D 5J4YA 2AD1A 1XTQA 1R10A 1W2HA 3NBYC 2CLSA 1AIPA 3AKCA 1E9BA 3TW8B 5KDLA 1Z6AA 1BKDR 2QG6A 1FMLA 1TF5A 4B6FA 1CKEA 1DELA 2DWPA 5IK2A 1XRJA 4BASA 5IHPA 1SVSA 3LWNA 3CRVA 2QPAA 2BBTA 3CB4A 1UDXA 1ZU5A 2BEJA 4PANA 2PX0A 2AX4A 4NTZA 3NWJA 2ZJAA 4XSHA 4DCUA 3MWLA 4ZIRA 4QJ3A 4LK2A 3AV0B 1JQJC 2B7CA 3KB1A 1KOFA 2H5EA 2FF7A 4PHHA 5HKKD 4JMPA 3UMSA 1US8B 2GHIA 4GDFA 1OFUX 1XEXB 1DTSA 3IHWA 4NYJQ 3ZZUA 4DWJA 2FV8A 4C0QC 4YQFA 2EFHB 4ARZB 4PSKA 3BB3A 4HB2A 2DY1A 3K0CA 4HAZA 1VECA 2N42A 2IBMA 3GJ4A 4TYQA 2EWVA 2CBZA 2GJAA 5AWFC 1EGAA 1R2QA 1XNJA 2FN4A 3L0IB 1NMXA 3OAAA 3QIAA 3KQHA 1LNZA 3IBYA 3IO5A 1KK3A 3K9GA 1P3JA 3TSZA 2E9SA 4JVSB 5ELXA 4LJ5A 1FFHA 2YV5A 1Q22A 2OFOA 3S1AB 5FL7A 2CNWA 3AVOA 2XOKA 1E2FA 1N6RA 2EW1A 2C77A 4C0KA 3IPXA 4UJ3A 4H9GA 1I2MA 3FMIA 4L15A 4LYJA 4HLDA 2NMVA 1L4UA 1P2TA 3QF4A 5CLQA 1ZU4A 5H1YA 1X1SA 2CHGA 2V9PA 1FW6A 4YXWA 1OW3B 3AKDA 2W2TA 3B85A 3IDQA 2OSBA 3FHTA 2ZU6A 1KGDA 3NH6A 4OQLA 3M0EA 1G8HA 3HU2A 3UG7A 4B71A 2PEYA 2ZI4A 5B30A 5JZVA 2ANCA 1F2TB 3EPLA 2XEXA 1YZLA 2LWIA 2VYFA 2QORA 2NGRA 5KHOC 2FH5B 5KNBA 4M1YA 3V00A 1E2HA 4O0MA 1Q1BA 1SVLA 1YRAA 2ODBA 4PHGA 2GJSA 4K46A 1OB2A 3WP0A 1D2NA 2XAUA 1CRQA 1W1WA 2JJ2D 2HUPA 3QF7A 2W6JA 3GPLA 3FTQA 3SHWA 1S9HA 2MMGA 1X1RA 1I4LD 1OXUA 2GVZC 3RANA 1ZUNB 1U81A 1UKEA 1JR3E 1P60A 3EIEA 2Z4SA 1UKYA 4TYNA 3ZDQA 3BGWA 3MCAA 4BFWA 3FGNA 3PQCA 3WNDA 5JWHA 2OBNA 4TSFD 5AJXA 3RNLA 3REGA 4UXIA 3AVVA 2DWOA 1G3UA 1OKKD 1MRSA 3B1VA 1U8ZA 2YINC 3M6AA 2G0TA 3LQQA 3VKWA 3UATA 2WSSA 1T3LA 4WBSA 1R0ZA 2B7BA 2GA8A 4DCTA 4PAOA 4DIDA 5D3QA 1OJLA 5IRCD 3WXMA 1N3BA 4XJXA 4XTRA 1ZW6A 2VHUA 4LYHA 1YZQA 1T3SA 3VR1A 3A1TA 2AWNA 2G83A 2IYSA 1W0JD 2IF0A 5TVKA 1EXMA 4P4SB 2ZAMA 2W0SA 4YMSA 4M2LA 4BFUA 1JJVA 5F2EA 4EQ6A 2BBWA 2IK8A 3I72A 3K53A 1YJ5A 1B23P 2XB4A 3EZ9A 5AR1A 4LCBA 4EFMA 5JSZA 1E9CA 2J0SA 2Q9BA 4DLTA 4Q7JB 1NSFA 1U9IA 2IUTA 1N6HA 4Q4JA 4OHZA 1XPRA 4LHZA 3QBVA 2ZREA 2ODWA 4ZPXA 3TW4A 4BZPA 4RKEA 4ON9A 4URUR 4JVLA 2WWGA 2YVUA 4XH9B 4JYCA 821PA 1XJ0A 3VHXA 4CEJB 3LBNA 2FU5C 1MR3F 3ZQ6A 3VKGA 2G88A 1ZNXA 3T12A 3TUIC 3W5JA 5HE9A 1ZYUA 4DSNA 4DLRA 1XEWX 3W6NA 5CB6A 4Q47A 4B3FX 3QENA 4R71A 2QE7D 3P27A 4QM7A 1EWQA 2BM0A 4GBMA 5DHAA 3GLIE 3NEYA 1IXSB 1NY5A 1SULA 4G5SA 4PC7A 4HAWA 5JBQA 3DM9B 4RZ2A 2CDNA 2QUZA 2JJ1A 3PCRB 4CEHA 4TZ6A 1CR4A 4DDTA 3ADCA 5HE8A 3SFVA 3W3AA 1FMJA 4HZUB 3GJ5A 1VYUA 1SQ5A 5EE9A 3VX3A 3R8CA 3T15A 3PUYA 2WWYA 3BB1A 3QPWA 2F43B 4D0GA 3AP3A 3U7HB 1CRPA 4TT3D 1A2KC 3KFVA 4URWR 1J99A 4L8GA 2FJUA 4Q7KA 2AFIE 2J45A 3HR7A 2GAAA 5DYGA 1NLZA 3GFTA 4D2IA 4IOLA 1AN0A 4KVAA 1TAGA 2GAOA 1SKYE 2ZS9A 3WYFA 2QAGA 1KO1A 2A2ZA 2DYKA 3PITA 2ZRAA 2FFBA 3ICQB 4A6XA 2WPDD 5A0FA 4KVGA 1Z28A 3FB4A 2ZXUA 4M1TA 5HKKA 3B13B 4I1UA 2IHYA 2P6NA 1E2NA 1R8QA 2OXCA 2JCSA 5BN3A 2P67A 3K0CC 3DMNA 2D3WA 3MWYW 3QKTA 2BJVA 4WZBE 2R2AA 1II9A 2GVDC 4KO8A 4ZDWA 3SYLA 2D74A 1ZD9A 2FGKA 4PSAA 4Q4HA 3UMRA 4I1OA 1NKTA 2ZR7A 3SC3A 3A4MA 1K5DA 5J4KA 2QI9C 5ANRB 5JWOA 2PCLA 1SVIA 4F93B 5EQTA 1DAMA 1S9DA 2A3RA 3K0FA 3LNCA 5CJ2A 1GIAA 2X1VA 4DBLC 3FMOB 1B0UA 2FPLA 4A8JA 4DC9A 3TSOA 4ZV4A 1W48A 5JECA 2ZJYA 3K9NA 5F9FA 1GNPA 2DBYA 4PZYA 4Q4AB 2GEVA 3DEFA 5GVRA 1N2CE 2HJVA 1NVUQ 1P9WA 3FKQA 4TMKA 4G5RA 5LDDC 4HATA 1H8HA 4PHFA 3W6OA 1FQJA 1SXJB 2ZUDA 4IDPA 2D7CA 4Q9JA 4KJZA 4B2LA 4UNRA 1QBKC 1G7CA 2QT1A 2C96A 2OV2A 1YZNA 3UXMA 1QRAA 4S2EA 4BZQA 1GOTA 1P9NA 1R4AA 1Z08A 3ADBA 2Z5FA 4TN1A 1KSGA 4P4TA 1QHHB 1V43A 4X8HA 4EIWA 1G7SA 3C16C 4Q9LA 3T34A 4U7DA 1G64A 3FKSD 4R9UC 4V03A 5EJEA 4LPSA 1RJ9A 3VHLB 2FFHA 2FSHA 3DL0A 2G77B 4QGFA 1K6MA 3DOFA 1ZVQA 5LBIA 2KB0A 4TLDA 4POAA 1XZPA 1E79D 3IUYA 4S35A 3WMGA 4KAXA 2GZAA 4DRZA 2XJ4A 2JJ2A 4UXJA 3KKOA 5E7JA 1NMZA 2FSFA 3NH9A 3JZAA 2QU8A 4C4PA 2MMCA 3C7KA 3O47A 2PH1A 2QP3A 5FR1A 1UPTA 5FTKA 1S2MA 3TH5A 1ZINA 1IY0A 2R6DA 3VR5A 1MH1A 2C8VA 2QT0A 4OHWA 4LSGA 1RE0A 3BORA 1HH4A 3GJ0A 4TSFA 2IXFA 4ZIRB 2ONKA 1ZMXA 3B1ZA 2IYTA 5FBWB 1ZD8A 1OKKA 1GL7A 5FOVA 2WM9B 4IEEA 2F7SA 1KZGB 3C4JA 4C0LA 4NONA 1DG1G 4CF7A 2GXAA 4A82A 1TL7C 1ZM2A 1ZIOA 3EZ6A 3UIEA 2QZ4A 4PQRA 3HYTA 1KI6A 5H8WA 2CVFA 4C0AC 2NPFA 4FMCF 4E03A 2YKGA 1GG2A 2V1XA 4NYIQ 4AKHA 3N2EA 4KSCA 4QBGB 4C7OB 4NYMR 5KOYA 1ZUIA 1KY2A 2W58A 4M1SA 5HCNA 3A36A 2BBOA 2EFCB 1W0JA 1M74A 1LFDB 2G0NA 1ZIPA 2IEYA 2RGNA 3FE2A 4URVR 4RVCA 3P20A 4MA4A 4PQFA 3S1AA 1U9IC 2QGNA 2W2XA 4ACAA 4P0TA 2NPIA 3QXHA 1YRBA 3TKLA 1E2DA 1E99A 2WV9A 2VSXA 4JL6A 1VDZA 3EX7C 3EXAA 3WNCA 3CPHA 5IT5A 1VCNA 4ESHA 1NLFA 4JLKA 2ZM5A 2WMOB 3F3YA 4G01B 1SXJD 2J0UA 4TWZA 4DVGA 5LD2B 2R6CA 1YQTA 3REFA 4A0FA 1LB1B 2OCYC 1M7HA 1VCMA 4L9SA 3CM0A 4NU0A 1XTIA 3MG9A 2A5YB 2CK3D 1EFHA 1F2TA 3MJHA 4IOMA 2QE7A 2P3SA 1P72A 3EZ2A 4LV5B 5CIWA 1G291 2GESA 5CK5A 2BCGY 1R0XA 4IHQA 3U3RA 1G3QA 1K5GA 2VQSA 4Q1DA 4RZUA 4IXNA 4B2IA 4DIEA 1WRBA 3CO5A 1NVXQ 2CVHA 1OT3A 3IEVA 3EC2A 5GJCA 3BH0A 2PX3A 1GUAA 4LJ6A 4M1MA 3GP8A 1AKYA 2PL3A 1ZUHA 4EJSB 4Q19A 1M7GA 2VP6A 4TT3A 5DLQC 3W8NA 2JLYA 3ZS8A 1QHIA 2IYXA 3V4RA 1MKYA 4TMWA 3RABA 3SI7A 1N0UA 4ZCMA 1WXQA 4YMWA 2NZJA 3ZLJA 3WRXC 2ANBA 2YOGA 2QAGC 5J4VA 1NP6A 4C0HA 4DLVA 1ELOA 2ZI3A 2C03A 4W5JA 5J5CA 1IN5A 1W4CA 4V02A 4J0QA 3U3OA 3SS8A 5JCZA 4V0ME 2QQ0A 4B74A 2WPDA 2ZE6A 4EPVA 1FQKA 3A4NA 2ZRKA 2J1LA 1W5TA 3NHAA 1NN3A 1R5OA 3BC1A 1JEEA 1XTKA 5FI0B 4KV9A 4LBWA 1XXHA 2KBFA 4I1VA 1G3IA 3TBKA 5KYKA 3T35A 3E2IA 3OAAD 1CTQA 3VQTA 2UKDA 4Y0AA 1FL9A 3A1SA 5FTNA 3SJZA 4HYYA 2G9NA 1R8SA 2KE5A 5JI2E 5DSZA 4V0KA 4MKFA 4AG5A 2JLQA 4P4SA 2GXSA 3I73A 2Q9AA 4B3GA 1OIVA 1E98A 5TMPA 2QMEA 2ZJ5A 2CHQA 3EZFA 4Q4LA 4QL3A 4Q4JB 2QTHA 2JEOA 2JLVA 4A8JC 1IJFA 1IHUA 2D2EA 3K0SA 2O8FB 3O8DA 4JBXA 3QE0A 4MYHA 3FOZA 2ONJA 2WWHA 4RJLA 4D4LA 1OHHA 4DSOA 1M7BA 3X2SA 1JR6A 2OUKA 2GILA 3IKJA 3K0EA 3BWDD 5KUTA 4OI0A 4CEJA 1G8YA 1M34E 4E22A 1SZPA 2F9MA 4LHWA 3GJXC 3X1XA 5E7MA 1PLJA 3KKNA 3AF1A 1AA3A 1WE2A 3RSLA 5K8LA 2WSMA 3CX7A 3QBTA 3CNLA 1E2JA 2OILA 3CRMA 4OQMA 5KSZA 4P31A 2CCGA 1DAKA 1PV4A 1G4AE 2H7VA 2GNOA 2ZJOA 1QHYA 2EWWA 4CEHB 4M21A 2WAXA 2GF9A 4WOPA 3FKSA 4DLXA 2DHRA 1T4GA 1AGPA 1KKMA 1RRPA 2V54A 2IS2A 1KHTA 4URYR 5EXTA 5J4HA 1OYWA 4HZUA 5FPHA 4RD3A 3U4QB 1U94A 3KTAA 1E79A 3P32A 4JJKA 4FCWA 1CXZA 1SVWA 1KY3A 2P5TB 3THYA 2VIIA 4XWOA 4JZKA 5CJPA 3VMFA 2WJJA 4KFTA 1UAAA 1E0AA 3LLUA 3A6PC 5AJYA 2BBSA 4KXFB 1LW7A 3ADKA 3Q72A 4RFSB 1CBUA 3TQCA 3ASZA 5K8TA 3W8RA 2AWOA 2FE4A 1QHSA 2GWHA 5M04A 2LKCA 3SBEA 4KCGA 3CUEF 3CX6A 2WSSD 4LBYA 4GOKA 4EFLA 5KSYA 4C9BA 1SVOA 4NBSA 1X8KA 1KDOA 2XITA 1QVAA 1G5PA 2ZU0C 2IYQA 1XPOA 2VHJA 4NYJR 4I99A 2P65A 4JL5A 2A5JA 1GZSA 2CCKA 1LS1A 1CR0A 3LV8A 4LC0A 5KPJA 2DFTA 3DOEA 3B8HA 2IYLD 2ZPTX 4QBFA 1IAQA 4LJYA 3OIUA 3PEUA 2VP2A 1LV7A 4YMUA 3KQUA 1P4SA 2ATVA 2F9LA 3DMDA 2FGJA 3PEYA 1PUJA 1ZNYA 4KYUA 3THWB 4LPKA 2X8AA 1IJEA 4B48A 1KJWA 1P9RA 4R2HA 5CM9C 3TUZC 3KKPA 1BMFD 3K0FB 4YDHB 4HUTA 4URZR 4BFXA 2DPXA 1M1YE 2VLIA 3MMPA 5EE5B 4FWTA 4MDFA 2QL6A 4ZDKA 1XEWY 2VF8A 5B64A 5FH9A 4O3MA 3LQRA 4WZAE 4A92A 1UADA 1KK1A 2ZE7A 3KKMA 4LDJA 4Q4AA 1Z0KA 3K9LA 3P4YA 1XTSA 2XZLA 2KSQA 1NMYA 2GETA 1KTVA 3AP2A 3RS5A 4GP6A 2KBEA 1CULC 4JS0A 4W5HA 2P6RA 3PUXA 3U44B 1SXJA 3CX8A 2ZRGA 3OFND 4D4JA 4RKFA 4PO8A 4ERNA 1GDDA 1YR7A 3TR0A 2VA8A 3JVVA 1HT2E 2V6JA 3NIBA 2EYUA 2Z6VA 2ZSDA 5KDDA 2FFAA 4UQOA 2CK3A 1AQUA 2AKAB 1AK2A 3B9QA 2LCFA 3OE7D 4LYFA 2XNDD 1OXTA 1RJ9B 2IYWA 3H84A 2QY9A 4M9SA 4NPHA 5JRJA 3BXZA 4X8MA 3HU1A 4LJ7A 4G1UC 4RFVA 3RRYA 5KO2A 1CJKC 4C0JA 2YHSA 2VBCA 1P7CA 4Q21A 5HZHA 1TPZA 3CZPA 4AI6A 3CBQA 1DAFA 2HXYA 3ZQJA 4A2PA 3ZJYA 2Q6TA 3P4XA 5B2ZA 2YOFA 4NCHA 3TK1A 1FPMA 4G3XA 1E6CA 2J0VA 1XP8A 2ZRJA 4HB4A 3WP1B 2H8KA 2LKDA 3GLHB 3KDSE 3LAWA 2ZITA 1FTNA 1DOAA 5EUMA 2JGNA 4NDZA 3RC8A 2ZUBA 3GLGA 1S4QA 4U00A 1KO4A 2PJZA 2PCJA 4JIMA 2VO1A 4QNRA 1E32A 2QP4A 2OZEA 4LZZA 3TUJC 5AUOB 2FA9A 1KI9A 3QPUA 1NVVQ 1QHXA 1UFQA 1ONBA 1E9SA 3Q3JB 2WJYA 1KI6B 3KX2A 2C9CA 3NKVA 2AK2A 5JHGB 1MOZA 3DPUA 3SN6A 5KDOA 1ZM3A 2AD5A 4OQNA 2ZRIA 3VR4A 3WMEA 2ZJBA 1D2EA 2AN9A 2OFWA 1II8B 4C7OA 1CEEA 1NY6A 4DZZA 2QM7A 4Q7LA 5AUPB 4MDEA 3CLVA 2OE2A 5AJWA 1IN7A 4MGYR 3UMFA 2RH5A 1KI1A 4B44A 3QSYA 4Q02A 1GKUB 4D25A 4KSBA 3VFDA 1HY3A 5DHFA 4CYMA 1GM5A 2RGDA 3UK6A 3AUYA 3CPEA 4JVMA 4CGZA 1P5ZB 3C5CA 2WBLC 4TL6A 1H8HD 2DFLA 4IVRA 5KSPA 1N6IA 3OZXA 4JBWA 3I61A 2E1RA 2B8TA 3B6EA 3CPJB 2GXUA 3IHLA 4TYPA 4AYWA 5B58C 3PUWA 4TLCA 1BO6A 3DDCA 2J0UB 2XSZD 4CEIB 2GCOB 4OHVA 4JLOA 4W5WA 3H4MA 4PQYA 3WY9A 3MGCA 4Q5IA 1E1RD 1J7KA 1BYUA 3QXXA 3U5ZB 4PC1A 2NTYC 2BWJA 2F3TA 3ZH9B 1XD2B 5FUVA 4BFYA 1G41A 2QBYA 2YWHA 4A0RA 3QKRB 4JSTA 1W7AA 3NBXX 1I4TD 2P0EA 4A2WA 4QC2A 1OIXA 2FWRA 4GI7A 5GADl 1KDRA 2QENA 4URXR 1NIPA 4OHXA 3MD0A 1Z8FA 3AKEA 1H65A 5G3YA 2ZYWX 4LJ4A 1CR2A 2C78A 1IN4A 5GJVC 1Q1EA 1RKBA 3TMKA 4DKXA 2HT6A 1YVDA 4ILEA 4EJSA 1TUEA 3A37A 3QQ5A 2MSDB 4KLNA 3U3JA 2AL7A 4XTCS 5KPDA 3EWSA 2WWXA 1QG4A 3LVQE 1F60A 1UBGA 2O0HA 3TQFA 4AIIA 2NO6A 1ZM9A 5BN5A 1T5LA 1K8RA 5EE3A 3LXRA 3SU8A 4IDHA 5DO9A 1WA5A 3PFIA 3OEHD 1LF5A 4XVQA 3VR6A 3J81k 2CEAA 5AJVB 4JLBA 2WZQA 3I5XA 4JT2A 5FTLA 4NL4H 1X86B 4MH0R 5CITA 1WBDA 1NBMD 5TB5A 3SZRA 1HQYE 3AF3A 1L4YA 2GZHA 4JLDA 2ERYA 4AYXA 1XXHB 3ZVRA 3JZMA 4DB4A 2QSZA 5EP2A 1HQCA 3CNNA 3ZD6A 2NOAA 3JVUA 2WWIA 1D8TA 4Z8YA 1IOZA 3R7WB 4MUAA 1CR1A 1EFUA 4ZDJA 4EPXA 2IUUA 3O8RA 2WWFA 3O8CA 2KJQA 2O0JA 4AKIA 5FOSA 3QG1A 4PPFA 2OCBA 1G16A 3QXCA 5G3ZA 3U60B 1GWNA 2Z0MA 2XTZA 2V7QD 3TVDA 1IY1A 2B21A 4K81B 3X1DA 1DBSA 1BMFA 2PEZA 2ZJZA 1E2KA 1T5IA 2VP0A 2VHQA 4FI3C 3ZZTA 4QOSA 2JLZA 2BCJQ 1OH7A 4LHYA 2O8FA 3HP1A 3AGPA 4Y0VA 1Z63A 1A5TA 2VF7A 3LBHA 1W0KD 5JCPA 2F55A 1CLUA 2VHTA 2PZGA 2W83A 3VNUA 1GNQA 3W3ZB 3B78A 2IYZA 3L0SA 1SXJC 3TR5A 2VHCA 1KDTA 4M53A 4M1WA 2DFNA 3B2EA 3MWJA 4U02A 1KKLA 2CLCX 3OFNA 1XCMA 3RYTC 4CW7A 4AY2A 2VPPA 1IM2A 4M9ZA 5UKDA 3LD9A 1LTQA 4M0LA 4BQSA 2BHRA 4L5BA 3OE7A 2OCAA 2XNDA 1UJ2A 3NBFA 4ZCIA 3VNVA 4IDOA 1X3SA 4LJAA 2BMEA 721PA 3B1XA 3GJ8A 2RGAA 3KTAB 3CF2A 3I3SR 1RIFA 3HPQA 3VU9B 4B3DA 3SJBA 2H16A 3U4QA 3RWMB 3AF2A 3P1JA 5HR5A 1EWRA 2CJWB 4R98A 3THYB 1GVNB 1YZUA 2PZEA 2XNSA 3PVSA 3ICEA 3DM5A 3MJRA 4RD2A 5C4MA 3B9PA 3SDZA 3FWYA 1DPFA 4WXRA 1AQYA 1VCOA 3D8BA 4XOIA 1OSNA 5CM8B 5J4LA 2P5SA 3FVQA 2I1VB 4RFSA 3HYRA 3QVUA 4MYCA 3CZQA 1YE8A 4MRPA 5J40A 1CJUC 3BE4A 1PUIA 4HB0A 4LX0A 4Q01A 4DDUA 1TUIA 5FPYA 1ZNZA 4DLWA 5SZHB 2P6UA 4JKIA 5CDFA 1XJQA 3QY0A 5JRZA 1A2BA 2PZFA 4JL8A 4F4IA 4NE2A 5FUYA 4M1OA 1E96A 4NYIR 1YZTA 2HDNB 4LRWA 3GJ7A 1C1YA 4QHYA 4V0OA 4Q1BA 2CE2X 4DLYA 3E5HA 2PBRA 3AP1A 4QFMA 4BFVA 2ECKA 1XPUA 3THWA 1G5RA 4GNKA 1NI3A 3HDTA 1R6BX 4LV6A 4DSTA 3KJHA 3PEWA 3KFXA 4AKGA 5A5GA 3R9XA 1T3HA 3THXA 4W7SA 4FINA 3UWKA 4Z51A 1JAIA 1AM4D 1FX0A 1DEKA 1U2RA 1OE0A 4BUJA 2CL6X 2VH5R 1OHHD 5CB8A 2OEPA 1S1CA 4KU4A 3FPAA 4PZZA 2FPKA 1E4YA 4YDSA 4HAUA 4R7ZA 4WZ6A 4PSVA 1KJZA 4HSEA 4M9XA 5LD2C 1IBRA 2XSZA 3T1OA 2EQBA 5AUNB 2Z43A 3PEVA 3U44A 2CHVA 1GRQA 1GAJA 2A5GA 1X8JA 4HLCA 1YR9A 5FBQB 3K70B 1E1RA 3GMTA 4HDQB 2J59A 4IDNA 5CLLA 1TQ4A 1XCGB 2CL0X 1VTKA 5D3MB 1MO4A 5KNDA 3QJYA 4NH0A 1VCIA 2ZSBA 1ZBDA 2C95A 4B73A 1G21E 4DSUA 3U3MA 1YZGA 3PENA 4OJKA 3ZS9A 4RCYA 1J8YF 4BEBA 1XMJA 1C9KA 2O8DA 2I1QA 4EJSC 5L3QA 3K9HA 4Q1CA 5FFMA 5FUXA 4D4KA 3CWQA 2PJRA 2WWWA 3KJGA 1ANKA 1HEIA 5KNCA 4MUBA 4PHTA 4TLBA 2B92A 4GSYA 1QHNA 2AFHE 1NJGA 3BRWD 4MYTA 1E2IA 3GLHA 5FOXA 4D0LB 3GLGB 2V4ZA 2REBA 1N0WA 1KK2A 1MO3A 1Q20A 3TGPA 3OEHA 3QXJA 1ODFA 521PA 3Q8XB 4LY6A 2Q0HA 4EKDA 1G18A 2JLRA 3AVXA 2BVNA 2G1KA 1OXVA 2OBMA 1Z0DA 1E0KA 1S3SA 2HCJB 1NBMA 4OHYA 1WQ1R 3L0OA 4PC3A 1NG9A 3RVBA 2J3EA 2JLSA 2FZLA 2WJIA 3QKUA 3M4YA 1QHGA 2VL7A 5C4GB 3NTUA 1XU4A 2ZUCA 3UKDA 2V8OA 1G6OA 6Q21A 5IF9A 4DT1A 2Q3FA 3CF0A 5JJIA 3H0KA 4DDVA 1II8A 3V4FA 4B3XA 1E4VA 4NZYA 1IXRC 3U3KA 2WJHA 2YWFA 2XXAA 1M2OB 3OF5A 4BZXA 5EXPA 4BRUA 3PG5A 1E9DA 2D7DA 3RHFA 4IEIA 4KFSA 1P75A 2V7QA 3EZ7A 4YONB 2D62A 3W6PA 3EIHA 1LS6A 3NDBB 2CMKA 4DB2A 4TMVA 4TMTA 4IW3B 3T61A 3AVWA 2RGBA 1L2TA 1VHTA 2J7PD 4B34A 1T0JB 2CXXA 1TQ2A 1TU3A 1W0KA 2A5FA 2ORIA 4WIAA 2DB3A 1JEDA 1MABB 3GLFA 1KNXA 1XEFA 4CEIA 1Z0FA 4LWZA 2WICA 2GCOA 1VYVA 121PA 3K70D 3ZGXA 1SHKA 2NQ2C 3K1JA 5AJZA 2ZVPX 2GF0A 3RRNA 3GJ6A 3RC3A 5KU1A 2QBYB 2D06A 2OG2A 4N0EA 4TTQA 5B57C 1Q21A 1XD2A 4OQXA 1A7JA 1N6OA 3X1WA 4ZCLA 2HLDD 3SHFA 3GEHA 3QKRA 1UEIA 4Q1AA 4QNMA 2R6AA 4AURA 3SJAA 3NBZC 2BIFA 3AEZA 3ZVLA 2H1LA 2IS1A 2VSFA 4P32A 2YJTD 2IEZA 5JFGA 3BH6A 1WP9A 1EFCA 2ZYUX 1JAHA 2F1RA 3VKHA 4HEJA 1P62B 4BEJA 4DLUA 1HT1E 4JLVA 4HLQB 1VKJA 3AB3A 1PJRA 3T5DA 1YU9A 3AQ4A 2HEIA 1XCPA 4AK9A 4HI0E 3BS4A 3VX4A 1TEVA 3LX8A 1XX6A 1L8QA 3W9YA 1MT0A 1F5NA 1CU1A 1XXHE 5EP4A 5HCIA 2IHBA 1RW4A 2IS6A 5F98A 2ODEA 3K09A 4C0SA 1W46A 1UBEA 4PAMA 5FR2A 1XFAA 1U90A 1GRRA 1FP7A 3WHKA 1XJCA 3B60A 4ZI3A 3LO5A 3B1YA 2C5LA 3L8YA 4MRVA 5DI3B 1N6KA 3LW7A 3RS7A 1R7RA 2O8BB 2RHMA 1VG1A 3LX5A 4I1SA 1DAGA 2QPTA 4Q9IA 1RYHA 2X19A 2ZRPA 1WF3A 4O25A 1J70A 1NJFA 1VIYA 2GJKA 3R7WA 3RDPA 4DEYA 3HPRA 1G8PA 1G19A 4GRAA 5HZKA 2EFEB 3ZVMA 1UKZA 2IA5A 2BJWA 5EXXA 3EARA 3KKQA 2FG5A 4MRNA 1EX6A 2R62A 4KBGA 4LV8B 1NN0A 2ZSEA 1TF2A 3HJNA 3GCGA 1SVKA 1Z29A 4MGKR 1G6HA 1DAEA 2QP9X 2B6HA 1AS0A 1RRFA 3L43A 4TMXA 2QTFA 3CF6R 5FBRB 1E2EA 1DO0A 2VSOA 1KI2A 4QGGA 5H70A 3RS4A 3TIFA 1UEJA 3N2IA 4ITRC 4NYMQ 4L4UA 1C4OA 5BQ5A 4G5OA 4MITA 1U98A 1W2GA 2D4HA 5TY0A 4EPRA 2IYUA 4JLJA 1NLYA 3SYKA 4CT4B 1Q3HA 2ZRCA 1ZNWA 2A30A 4GL2A 2GRJA 4NHOA 4UKDA 4DLZA 2YWGA 1YKSA 1FNMA 1XBTA 5JMTA 4D26A 2J5XA 4PAQA 4EAQA 1UF9A 3AF4A 3RS0A 2SHKA 1VG9B 2ZJ8A 2IW3A 3DHWC 2QMUA 1T8TA 2OO7A 2Q9CA 4RD0A 1XF9A 2ZRLA 4PO9A 2IUSA 2QN6A 4KFUA 3ND8A 3PV0A 1BYIA 3VU9A 2L0XA 2IL1A 1H8ED 3C14C 5G53C 3AM1A 3NHBA 1DE0A 1NKSA 1KYIA 2CJWA 2W0MA 3A1UA 3RAPR 5BWMA 1TNDA 1NNEA 4Z54A 1CIPA 2PLFA 4N1AA 5FPTA 4EPWA 1X6VA 2C99A 2PT7A 3B7GA 2ERXA 1IQPA 2BKUA 2YC2C 1E2MA 2C2HA 5SZIA 3MLEA 1R5BA 4TQAA 1OIWA 1I4DD 2GJ8A 3GLIB 3IIMA 3B5JA 4FCVA 5EZ5A 2IWRA 4CRWB 1PLLA 4UNQA 2J0QA 4EFNA 1ZM7A 2YOHA 4UNPA 2XGJA 1DG3A 1HA3A 3GD7A 5DYIA 1NVVR 1VPLA 2VTKA 4BFZA 2JIZA 4RZXA 4AYTA 3T1TA 3F0TA 3KL4A 1S1MA 2ZEJA 2FDCA 3AF0A 1Z6XA 4B6EA 4TZ0A 2E87A 1GNRA 1JR3D 1KI8A 3SOPA 4AWXA 5F3WB 1Q1QA 1R0YA 4I4LA 3U7GA 5E7IA 1KMHA 3BAFA 2UZIR 4A0HA 3GJ3A 4G5GA 2GCNA 2RGNC 1AJEA 3SJCA 2ORVA 1XB2A 1BS1A 1LF0A 2R6FA 4EPYA 3U7EB 3K0AA 2UZ3A 2ZE8A 3IO3A 4C30A 1T91A 4Q1EA 4QHTA 4F92B 1E3MA 4GFDA 5EUQB 3R9IA 3EPJA 3THXB 2QMOA 2F6RA 1W4AA 1FZQA 3L8ZA 2ZYTX 4H1VA 1FX0B 1TQ6A 4KHZA 4LI0A 4JLNA 5GJBA 1SXJE 4GOJA 1TX4B 4TYYA 2FOLA 2O0KA 1QZXA 4BECA 1CS4C 1FUKA 2OM2A 4UJ5A 3SR0A 3I62A 1EESA 1GL9B 4QKQA 2IC5A 4GZLA 1WMSA 2QTVB 3LW8A 2J7PA 2YWEA 2IYYA 2HV8A 3A4LA 4JLAA 4QJ4A 2GK7A 3B82A 3LRPA 1VYTA 4MKGA 4B47A 4EDHA 2ZETA 4O2LA 4PPNA 3SQXA 5DE3A 3M1IA 4CIDA 3KZ1E 4HAYA 1Z0IA 2BC9A 1XMSA 1GP2A 1J90A 2AHOA 4N0DA 1S8FA 5BN4A 5JHHB 4DCVA 2ORWA 2ZI9A 2HF9A 3AH8A 2EU8A 2OFXA 3NC0C 1M8PA 1PLKA 1TTTA 4NMMA 1BH2A 1E2LA 2JATA 1OPXA 1VHLA 2OCPA 3CRQA 4HUQB 3VR3A 5D3MA 2R8RA 4A0GA 2HLDA 2XTNA 5FOTA 4BE7B 4M4SA 5K8IA 4C2UA 3W90A 1G1MA 1NN1A 3UPUA 3KUCA 3C5HA 3O8BA 3BFXA 4FMDB 3IQWA 4D80A 2O8DB 2C9OA 4M22A 5L3QB 2AKYA 3U2QA 5FTJA 5KTYA 3GLGE 3THOA 1FNNA 1W5SA 3ND9A 3RRZA 8OHMA 1T9HA 5DNYB 3WBJA 1G8GA 4PC2A 1Z0AA 4PXAA 4FXPA 2PMKA 2HXSA 1GTVA 1JJ7A 2QRZA 3Q5EA 3X1YA 3EA5A 3I8SA 3T5GA 4BWYA 4Q9HA 1AS2A 2TMKA 3Q9LA 4BLOA 1IY2A 3W5IA 3QPVA 1R5NA 4CVNA 1Q3TA 1G8FA 1JXOA 1GKYA 3K09C 2FZ4A 3AVUA 3I32A 3T1QA 1OH5A 2QSYA 3KUDA 5BXQC 2XTMA 1MRNA 3DZ8A 1A82A 1UDWA 4ASUD 2JLXA 2EFDB 3PIRA 1D9ZA 2BV3A 4OL0A 4IOKA 1ZJ6A 4OJQA 3FMFA 1Q1ZA 2OESA 2IYRA 2NZ8A 2R65A 4TTRA 4XD7D 1XD9A 5FOWA 4BLSA 4DT1B 2XB2A 4ESVA 2GCPA
chains in the Genus database with same CATH superfamily
3DULA 4N76A 5LBTA 4PZLA 3STUA 2AW5A 3MUFA 1I2CA 3EY9A 3R76A 5C8YA 3V33A 3QNMA 5BSTA 3VOTA 5LQMA 2XT6A 5FTMA 2VYCA 1C1DB 3TG2A 2C97A 4O2BA 2VJPA 1VE3A 3FNEA 4ZOAA 4IIFA 3AETA 4QOGA 1LWNA 3PT5A 4PAGA 4XR9A 4ZV7A 4RZ3A 1KAQA 1VP9A 5LP6A 2RHRA 1QF9A 1JLHA 4K8OA 1E69A 1T9GR 2XDYA 3F96A 2HREA 3A70A 4E5UA 1NQAO 1AA9A 5P21A 3RIGA 4K26A 1N57A 1YHZA 5JEEA 1JQDA 3EAQA 3KUXA 1WW8A 2VDOB 4INPA 3N70A 2Z2YA 2CMGA 4ILKA 3VKVA 4NBWA 2NYUA 2ZB7A 3OECA 3QUSA 1CS0A 1FIUA 2QAJA 1QU2A 2BZGA 4DWWA 2Y6UA 3DOUA 5ALYA 4XDZA 3NBUA 5D2CA 3VR2A 4E2ZA 1TYAE 3H2BA 5C18A 1GU1A 4GC9A 1EGMB 1GPUA 4EJ6A 1NUUA 3O1LA 3JPYA 4DILA 4EWLA 1PO7A 4G0NA 2DM6A 4IMRA 3NHUA 3R20A 3ASUA 3DKVA 4IEFB 3EOAI 4G41A 3EG5A 4QYWA 2DFDA 4J0IA 3F8WA 5E4TA 3I0MA 3R09A 1BS9A 4NCNA 4W5TA 2H54A 5FNVF 1VGQA 1XU7A 1RACA 1W47A 2CLFB 3GOHA 3GFOA 3MGGA 4GZ3A 4JLMA 4TQ9A 4DCCA 2JLAA 4Q4DA 1CUYA 4DJTA 1UMCA 2FN3A 3U3ZA 5JDIA 5DPMA 3RYFB 1H8EA 2O8CA 1NHWA 4PXSA 1MNAA 1Z7WA 2PFSA 2DRIA 3E05A 2J48A 4Y2VA 4AAYA 3FFXA 4ND8A 2CNBA 4P5PA 1Y1TA 2P1RA 2VT2A 3BXPA 4Q3KA 2DFPA 3ZI7A 4F9TA 1X38A 3ZE1B 5L45A 4JB0A 2HPHA 4N7JA 5EIAA 2BMJA 4X8LA 2RAUA 3G5UA 4NBVA 1PBNA 3NXSA 3BIFA 1H3FA 3L0PA 1W49A 1BXGA 3GDOA 3IRUA 1N0VC 4G84A 2FJ0A 3SKVA 5I45A 4D74A 1FJXA 4UVIA 4ZJZA 3OPQA 2H17A 2OZVA 3DOJA 1TVKB 2REXB 4IFEA 2CFSA 3LC0A 4G25A 5CTAA 3RFXA 2CE7A 3GQVA 4FBMA 3VOBA 4RDCA 3D8RA 2PU5A 4Q3NA 4I46A 2F59A 2H3HA 1HTTA 5A5EA 9LDBA 1BCRA 2BTQB 3OKCA 2Z8YM 5DI3A 2HA0A 3QG5A 1VGRA 1AT1A 2VEDA 2Z2IA 3HB7A 3BWVA 4JJEA 5H7XA 2HMYB 1TU4A 4K1XA 3HC7A 5I7VA 1JR3A 1L7VC 2IF2A 2X22A 1G3RA 4OMCA 3N6VA 1GCOA 1UPAA 1P2SA 3DE0X 1W36D 1Y9EA 4KR7A 1H2EA 4UUBA 2CHFA 4EG0A 1W4BA 5FBLB 3LWDA 4I50F 2R6HA 3DFKA 5EE1A 2JGEA 1EXNA 3IAHA 5F1KA 2ZJ6A 2EIHA 4L1KA 4NENB 4KQ6A 3KYIB 4I4CA 2PX6A 4JMLA 2VS1A 1VA5A 1Y4UA 2W2KA 3D8SA 1FDSA 5JS7A 5J47A 1Q84A 4KK4A 1MFPA 1JW9B 2C42A 4R69A 4R2IA 2O48X 4F9FA 1GGMA 2ZR9A 1NVWQ 3QTBA 3DOIA 3JASB 1RVDA 4KODA 3ZWXA 1H6DA 1P8JA 4BO7A 3PHIA 4UUNA 5G41A 1YR6A 1E2QA 3R41A 3K70C 2DVMA 5A03A 2XUPA 4P1ZA 4PCLA 1GXSB 1AE1A 4FR0A 1G17A 4OYHA 5BRJA 3HEBA 2IT1A 3VPDA 3K5PA 3QYPA 1VG0B 1RM5A 1UDBA 2ZJ2A 2P6PA 2VRWA 3L8HA 4J2HA 3ILVA 2FUEA 3H86A 1QUFA 1Z56C 1RFGE 3ML1A 4MPRA 1HM5A 3SYTA 3P5SA 2OECA 1W1UA 1ZK0A 3BULA 4HQ0A 5I51A 2UUBB 2G9VA 4MKIA 3OX4A 2AUNA 3TRDA 3Q2OA 2ZBQA 2XQVA 3RK0A 4IVNA 5CDTA 2J07A 2O50A 4OBEA 5K0ZA 2YNMA 3H1PA 2WKRA 3KXKA 4OBXA 4XA8A 4X1KB 2CXNA 3D3JA 3DB1A 1XRMA 3BSSA 2WF5A 4P58A 2GBLA 3I9OA 2REOA 3H5OA 5GY7A 4QUEA 3G9XA 4B3BA 1M34B 4AQYB 4S12A 4ZVOA 3N9IA 5DRYA 2OQRA 2JI6A 3LVBA 1IN8A 2R44A 4X95A 3EFHA 5DN6D 1E0SA 2UUPA 3NMUF 4PONA 2VH2A 1KDPA 3OQVA 1GTJ1 1TUBA 3IQGX 4LF7B 4A0QA 1PFQA 4E12A 2MSWA 5TC4A 3GLIA 3ZV3A 4ZQFA 3CX4A 4LKRA 2Q6LA 5C1OA 1RXUA 3TOXA 5LJLA 3NNNA 3MA0A 4HRXA 3H11B 5A6SB 2PE5A 2V1UA 1SXHA 1HKHA 1N6PA 4B2PA 2Z98A 1L5FA 1THZA 4RLSA 3TQQA 3IDSA 2O3SA 4TZKA 1KFBB 3A9CA 2GD0A 4M8NE 3BOSA 1Q6ZA 2IZ7A 4QQKA 1KMHB 3BD9A 3WRWA 4MWEA 4ESEA 1JKMA 4A10A 4XD7A 5BNTA 3SG0A 2J46A 2UDPA 4KQHA 3CCCA 4HEQA 4NCKA 2AFIA 3IAAA 4TQGA 2RE8A 4YAUA 2VC2B 3EWAA 1A5ZA 3KWLA 2O52A 4GX5A 1GUBA 3EXG2 1W36C 4PN7A 1T1RA 4AXXA 5JJLA 1JHVA 3E27A 4IVQA 1N25A 1A96A 1X1QA 2C4KA 4R54A 5LP6C 3C3KA 2HYIC 4OLBA 4Q16A 5GP1A 2CXTA 4EY8A 1XHEA 2XNHA 3LK7A 4R8LA 4BLTA 2O8EB 3ZDFA 3OTWA 3LGAA 3QIVA 4KE9A 1I7LA 3E70C 1UPXA 3EVCA 3QVWA 4HGZA 4NBLA 3BJIC 4LJ9A 2Q49A 4OXQA 2RH8A 5CT8A 3UANA 2GZMA 3B6IA 3HA3A 1H2YA 4GLLA 4DV0B 1KVQA 3P2KA 1Y1QA 4P92A 3TKYA 1MQ8B 4EYEA 4F7WA 1FTGA 4YRPA 3LFUA 2D1SA 2D54A 4LHVA 4UBKA 1G9XA 3CRW1 1G9SA 1COWD 2C5FA 3D7NA 3LCUA 3RHSA 5YASA 3HEAA 3WB2A 4AZ0B 3GGPA 5BN4B 5C81A 4C01A 2TS1A 2Q3HA 5ER9A 2YKPA 1SVMA 4OHBA 3OO1A 4LN1A 2UVQA 4QJ5A 4GW3A 4CF6A 3S2SA 1T3ZA 1Z06A 3BSYA 3COJA 1Z3IX 3WIUA 5LP1A 1WCWA 1U99A 1NDHA 1MPXA 1YK1A 3AIKA 1N6NA 3LYAA 1M1YB 3BK7A 4HUQA 1A5SB 4LOAA 3WDMA 1L5OA 2JCXA 3GQBA 3UJHA 3VDMA 1Y1RA 1USIA 4IJUA 5BSFA 3UZUA 1Z34A 2Y4NA 5FPSA 1WSAA 4BNUA 4OXYA 1E61A 3D3QA 2QLFA 5I7FA 5JDIC 1H22A 4HXGA 1F51E 1OAOA 3KD2A 3KKKA 1CX9B 2QDXA 2H92A 2XA1A 3ZHCA 2Q1XA 3EVDA 3OZVA 4PYLA 4US0R 4K6OA 4ZT4A 5FULA 1C4XA 2H57A 4MJ7A 5JMWA 2PN1A 4W6QA 2DSTA 3QU4A 1Q7TA 1AHIA 3JQPA 3TYXA 2V7WA 1LDGA 4ABYA 1WW2A 4QUJA 1SKQA 4GP7A 2VJQA 3LOPA 1G5QA 6ADHA 1U2DA 1EVJA 2EZTA 1DVRA 3V4OA 3HDHA 4BJ6A 3TZEA 3W5DA 2CVZA 1DZ3A 4D8YA 4CLDA 3H5AA 3TRIA 1LY1A 2P5YA 3FMVA 1BX1A 3Q7QA 4QE3A 3NT5A 1J8DA 2A0YA 1OASA 4Z9BA 4QREA 3HYLA 5F76A 1XZMA 2IPXA 2Y9PB 1ATZA 3DWIA 2O0LA 3PHLA 4I1RA 3NX4A 1UPBA 2FXIA 1P1KA 4OX9B 2J5BA 4IJMA 1NXTA 3ZNNA 3RSHA 1C50A 1LZKA 5CH3A 5CD9A 5KQRA 1PR6A 1P81A 2EFGA 1R37A 4LOLA 4UD6A 3HCAA 4I9NA 5E6SB 1C8VB 1HOXA 2YHIA 5EKDA 4BS9A 5BMOA 1KO5A 4ER7A 3O8OA 3H1TA 4R41A 5L40A 1SBNE 2EC5A 2QE6A 5FD8A 2H1VA 3STWA 4CPDA 4RORA 4W1QA 1TGYA 3UMGA 1CFJA 3DAFA 4EHDA 2E4UA 4YC7A 4RHTA 3H1BA 5DN9A 1D4AA 1NYTA 1KAHA 3LMKA 5HIIA 4O2AF 2ACKA 3FWNA 2QSUA 3EXHB 3G2MA 2IU6A 4GVPA 4N6GA 4Q7MB 4WK2B 2QG4A 5HXAA 1C1DA 5ITSA 4RTJA 2R5FA 3CKLA 4HLUA 4MROA 1YVPA 1ADYA 5JMOA 3D31A 2AOWA 4LISA 4UPVA 1GITA 5EZ6B 1E4OA 1O03A 4FZJA 3LUCA 3RVRA 3ISJA 4D82A 1GYPA 5I9BA 3NIFB 3KB2A 4PTLA 4MWSA 3CQ9A 4J76A 4NFLA 1KIFA 4MLCA 3A6HA 3WK7A 4FZRA 4BO8A 5KWJA 1JI0A 5GONA 1KEKA 1MAAA 3T52A 4JI7B 3AUFA 4IVPA 2MDTA 4L16A 3RJ5A 4DLSA 1AF4A 1K5PA 1P6XA 2WKPA 2EJCA 4OUDA 4Z7NB 5A7FA 3WIDA 2FUG6 2NG1A 2L19A 1UJ5A 3JWPA 5CPBA 1T36B 1J23A 3MINB 4RTSA 1K7XB 1J09A 4HGQA 4EZEA 2CXPA 3AEKB 4CCSA 3WMXA 3FI0A 1SHLA 5ALLA 4JBYA 3W5VA 4E6PA 3FJ1A 3GDHA 4L5AA 4PR3A 5JLAA 1BVRA 4XIGS 4ZICA 3OPMA 2ODNA 3NTXA 4D8XA 4F3TA 1Z33A 1Z07A 1A3CA 4LXUA 3SE0A 4QM6A 1MG0A 4BVAA 4G0ZA 3WK8A 4M1KA 3VO9A 1MX1A 1EXDA 1YDWA 4UTVA 1W73A 2HTFA 2VN8A 3FDIA 2VRBA 4D97A 4ECEA 4XB1A 1D2CA 2RIRA 1G0OA 3AHIA 3G5MA 3QOFA 3PQ4A 3AVQA 4YMTA 4A4DA 3ECCA 3TO5A 1DJNA 1U0LA 4MMYB 4A1FA 2I62A 3PE4A 2YWJA 2GBLC 4IMPA 1IQUA 1BKYA 4YMVA 3QLVA 3PQ2A 5GWXA 1V5IA 4A6PA 1Z4KA 4H0NA 4FFWA 3IILA 4K9OA 1WXXA 4RVDA 1OUMA 2VG8A 3S2ZA 3I4LA 2W2QA 4FTWA 4GT1A 3GNSA 1GQRA 2ESRA 3MW8A 3C41J 1GQOA 4EG6A 5AKHA 5CBKA 3JD4A 2I2DA 3OT4A 3IFSA 3QRWA 1F1JA 5EWJB 1DIAA 3KG2A 1KSJA 2GK4A 3C43A 1DIRA 1U2TA 2BJHA 2JGMA 3TVTA 1XQYA 4JI4B 3ZWMA 1TFUA 5IX8A 1V25A 3MWDA 4QJIA 2BTQA 1GN9A 2GWRA 1EFRA 1R18A 3S40A 1XYGA 4KJXA 3U7FB 5K0JA 3ICOA 3GMDA 4ZCPA 3RCBA 3V3KA 2J9RA 4GZMA 4MUFA 1QVRA 1ZMOA 3EIQA 5D5PA 4QZVA 5I9TA 3DBOB 3W5BA 1E7RA 1TMGE 2FK8A 4MV0A 3V8MA 1BN6A 2FKNA 2AN1A 3CGGA 5LBUA 3UT5A 1PNOA 3ZDZB 1WZIA 1YB2A 1O3YA 5JLJA 3AR5A 4I1IA 5CYOA 3S7TA 5K0CA 5DISB 4QUAA 4LNUB 2PX4A 1OZAA 4UASA 3KT6A 4G85A 1KJ9A 5EINA 2FLWA 2VP4A 1NURA 1Q1AA 2ETVA 2EL9A 3G79A 1UC9A 2CW5A 2VR1A 4RU1A 2OC4A 3OETA 3BE6A 3RT1A 4GOND 4IWYA 2EDCA 3QFTA 4NENA 4YPOA 2G5GX 2XBLA 4IDQA 4KRXA 4V0MA 3ZU6A 1NBAA 4BGDA 4K6GA 1RJDA 1TK2A 4JBIA 4LYAA 1QQ5A 4HQKA 4RSRA 1AK1A 4NEQA 5IEJA 3TOSA 3W5AA 3DD1A 3F6CA 3NPMA 1S4MA 1E7YA 2CNWD 1A5AB 1LQTA 4HH0A 1FP1D 3JASA 4QBKA 4BMDA 3O93A 2V5VA 5E4FA 3S4YA 3IIJA 2QROA 3FRIA 1GXSA 4LBVA 1XDBA 3H5VA 4Z53A 2C98A 4EPTA 2OD7A 1T3TA 1B8OA 2JIRA 4B7UA 1IL0A 4EUNA 2ZI5A 5CK4A 1ZCAA 4CV2A 4EG1A 5HPYB 3D4IA 4BNLA 4PYOA 2OXEA 4YUVA 4FKZA 3PJGA 1RPZA 3V3TA 2H2GA 2IYFA 3G5TA 1EVYA 1KAGA 3RAEC 1EB8A 4IS2A 2VXCA 3PXGA 1F8YA 1XQWA 3L6BA 3K4PA 3KDPA 5E3HA 2NO4A 3SEAA 1VJGA 1Y6ZA 4X8OA 1Y3AA 5FYQA 3L9XA 2AF4C 2ZR0A 1IHYA 3JVIA 1KMQA 1HLDA 4DHWA 3MD9A 4DXAA 1W19A 5ABPA 2BSXA 3EAGA 4H27A 3W9UA 4DS3A 3ZU4A 4ZO7A 5KYVA 3IAM6 5LZ4A 3VVBA 3TQSA 3TTVA 1ZMBA 1M34A 5L3SB 4OEHA 1RZVA 2DY0A 2E55A 3MOIA 1U2DC 1AS3A 1L4KA 3FSGA 1EIWA 3WI7A 1OGIA 5GAJA 1G6KA 4BMPB 3M5DA 1NWCA 2FN8A 1CE8B 1Z6YA 2RMKA 4CLHA 5LQUA 1XT6A 3ZBQA 1XTJA 5HTKA 1K8XB 1NE2A 3I8OA 3DLTA 1PSZA 5C46F 2B4QA 1H42A 3NTLA 4HWSA 1ZJZA 3L5KA 1E60A 2WJGA 3EBOA 3LXXA 3EGDB 4B8ZA 1EE9A 3JVEA 2RCNA 1NPTO 4HXEB 5KQGA 3RT7A 1MIHA 3B51X 4KPUA 1JNYA 5ILGA 2PXCA 5LR6A 1CYDA 1KPIA 5E6RB 1J2YA 1R6AA 2RB4A 4EECA 1GUZA 3QEOA 4EG7A 1E94E 4TVBA 3MZ0A 4HLUC 1YQXA 1RZUA 1SKYB 2XYHA 3USCS 3RBAA 5BN3B 3E0XA 5BW8A 1Z39A 1IN6A 4R5MA 3KEOA 4DNXA 4UPEA 3U61B 5EE0A 2WVAA 4EHAA 1GNSA 2Q4EA 1GAEO 1U8XX 3ZE9A 4ZOCA 4RK1A 3GGSA 2O8EA 2OENG 2BGKA 1K92A 4Q4HB 3VAAA 3SYNA 4M98A 4RF2A 4MWZA 1EJ2A 1TKBA 2YV4A 4MVJA 1OZFA 4FXOA 3C8UA 4F46A 3R3WA 1SXIA 2DJ5A 1KKUA 2J9FB 5JALA 1UWVA 4WZBB 2FP4B 1AKEA 3QI2A 1GUDA 5BSKA 3CNOA 1FDIA 2VAWA 2PSJA 1S7CA 4RIEA 3WHLA 3J81A 1MJGM 4A15A 1QOZA 1RM0A 4AZ0A 3O6VA 3OESA 3H9GA 2ENWA 2EJVA 5AQEA 4HB3A 1JHZA 3KPWA 1J00A 4FMDF 2XZOA 4IIJF 1U3TA 1AZSC 4ZOEA 2AMVA 3W2EA 5C1BA 2AR7A 1YWGO 3IIKA 1M1YA 3ENQA 4US2R 4MGEA 3CVUA 4LFBB 4BVEA 3LTEA 4IXTA 1P44A 2XT9A 2NZUG 4WZAA 3HB5X 5SY4A 1OC4A 1BTOA 4N12A 3DFZA 4M83A 3LZDA 2GD1O 2J3QA 3QLVC 1C4KA 3WB1A 4UD2A 3KXLA 3LHDA 3O1IC 5AJTA 1GPDG 1CNEA 3G1UA 5HBGA 1Q74A 3F2IA 2NU9B 2FQ1A 3W3AD 2JFFA 1I0LA 2QVGA 1R10A 1JI3A 2H51A 5FUBA 1USKA 1W2HA 1Z13A 4GXRA 3PWTA 1UJ4A 4BE9A 4J03A 1E9BA 3TW8B 2CLLB 4MQMA 1L7NA 1LQUA 1BKDR 1KBOA 4FE4A 3H7AA 4KO3S 3U1BA 2VZ9A 4JOSA 4Z99A 1Z7EA 1CKEA 1E3LA 1W6UA 3N8HA 5IK2A 1XRJA 4MUYA 1HFKA 2JCYA 5DM0A 1SVSA 2HWWA 3TDKA 1S6YA 3NO4A 2CLOB 2BBTA 1G21B 2DUJA 3CB4A 3R6DA 5I9MA 4RZQA 3W8FA 1THTA 5E6SA 5EWLA 3VR6H 3R5TA 1V8DA 4HJXA 4R83A 2E89A 3ZWCA 4EKNB 4ZIRA 2PQ0A 3H0EA 3ONNA 3VHQA 2FSSA 4LK2A 1LFAA 3IAEA 1P4GA 5AOAA 3TLMA 4DRYA 4KXLA 1NULA 1KOFA 2H5EA 1YDMA 2K2QB 5F5XA 4LTNA 3FWHA 5JH7B 5HKKD 3UMSA 4N5HX 4AZSA 2GHIA 3L7OA 1DTSA 3AZOA 5CP8A 2B25A 2ZDGA 3U5TA 1Z2OX 1OX5A 4CODB 2F48A 2QF7A 5C5EA 1KJ8A 1YUMA 4PSKA 3AYXB 2DY1A 1YGYA 4PRYA 1YU6A 2AOXA 3IDFA 1F8XA 1FU4A 2IBMA 4HGPA 2C4VA 2CBZA 3EF1A 4EJ2A 1O5IA 5JAUA 5FWYB 3OIDA 1JFTA 4KKXB 2VHEA 3WNZA 1JDTA 4CIBA 1IRIA 3QIAA 2IHUA 2JI8A 3PSHA 2UZ1B 3QVJA 1Q92A 4C06A 4ZCRA 3SQNA 1GJRA 2I4NA 2JH3A 4NJEB 4QDXA 5ELXA 3H4VA 2H1OA 1T36A 3MINA 1PDWA 4LOJA 3KQOA 1E2FA 3IQEA 5EPEA 3AEKA 3BA6A 4Q3EA 3AIIA 1L4FA 4MCHA 4KDFA 1I2MA 4LYJA 1TMYA 5H1YA 1X1SA 2CHGA 3L7JA 1OBVA 4X90A 4QFCA 1FW6A 4HDRB 4YXWA 1OW3B 3AKDA 2W2TA 4TV9F 3WWPA 4Z8XA 1LX7A 4X7RA 5JFOA 2QLTA 2ZU6A 3VZDA 4CQJA 3NH6A 5FRDA 3WZMA 3ZD9A 4X84A 4H16A 4JZYA 4B71A 2PEYA 1YCGA 2NUTB 5DBHX 2ANCA 1F2TB 2XIQA 4DA7A 1F7UA 2VYFA 2QORA 3H05A 4K0RA 5JW6A 1QIDA 3H1GA 2QX7A 3SS9X 4M1YA 3DWEX 3LLSA 3FVTA 4MOWA 4LGVA 4XM1A 3UH0A 4AUMA 1XRNA 2ODBA 2IOHA 1EWTA 2BGMA 5B4VA 3T4UA 4NNPA 1VBKA 2XAUA 3UAVA 4DREA 4BMOB 4YAGA 4RLQA 1QQTA 2EX0A 2ISSD 4ETMA 1BROA 1YFKA 2WYVA 3AU9A 1UAGA 3URKA 1I4LD 1OXUA 5EWJA 2BGGA 1JIUA 1U81A 2X0IA 1OX4B 1P1FA 1DWUA 2PAFA 2WKWA 1C0KA 3LBYA 4YRQA 1YHYA 2KMLA 4YWHA 4P5EA 4QPDA 3BGWA 2RK4A 3PFHA 4IQFA 4BFWA 3ET4A 3KVOA 1NJ5A 1T2FA 3FGNA 2ZJ4A 1QGAA 3D7LA 3WNDA 1HYBA 4TSFD 2QPLA 5EYPB 3K5HA 3RNLA 2YDXA 2P40A 1EDEA 3TM5A 3KB8A 5JPIA 5DNAA 2D0DA 3OQJA 1MRSA 3DVQX 1S3FA 2UZ0A 1GNTA 2Q1TA 3A9UA 4CQMB 1PJTA 1O97D 1MGOA 4NOKA 2BMVA 1T3LA 4KGXA 1RAEA 4ZT7A 3PDIB 1P3DA 3L02A 3A0UA 4OGGA 4DIDA 4YAWA 1A9YA 3JWIA 4OQPA 5EESA 1H6BA 3UH1A 4O1HA 5IRCD 4ZTUB 2G8NA 2YZNA 2IH4A 4ETIA 1WY5A 4C4SA 2QD4A 1ZW6A 1T6YA 3KOWA 2VKQA 1Q19A 1V3VA 1KFKB 2LBPA 3NORA 1DEHA 2J33A 4RMNA 4K28A 4QOHA 2O3TA 4IJVA 3C5EA 4U8GA 1Y5NA 5TVKA 2ZAMA 1QH8A 1EHYA 4MUEA 1KYZA 1RP1A 4BFUA 1R00A 5E4YA 2FSPA 2IK8A 5JD4A 4CMAA 2CJXA 1Y1KE 1YJ5A 2PD4A 4MKZA 4EUSA 4BP1A 4LCBA 4EFMA 1E9CA 1NQOA 4UEOA 3O2NA 1T6BY 1EK5A 1U9IA 4PYMA 4Q4JA 4OHZA 4LHZA 4XDGA 2GVNA 2JAOA 1ZWLA 1TO6A 2ZWIA 1E92A 2WSIA 3IODA 4HVCA 2RH9B 3ZIUA 3CN9A 2GBGA 4EGAA 3C7DB 2WWGA 1Q7EA 4N3CA 2NTVA 2PXHA 1U8TA 5FO0A 4D8TA 3MS7A 1H2AS 5AXCA 4CEJB 3UKJA 3NM4A 3DAPA 1VL1A 1LSJA 2QN8A 1V0JA 3DT9A 3G2JA 1Q7GA 3M3PA 4EQZA 4KR3A 5HW0A 5LQDA 1UM9B 1ISHA 1YKFA 4DRXA 3AR7A 2R2GA 4ML3A 3TUIC 2FR8A 1CNFA 2HBYA 3O82A 1JIKA 1RR6A 1IFXA 1Q5PA 3BGOS 3W6NA 4F0JA 4WBNB 4ETWA 3QENA 1OTXA 2QE7D 3Q7EA 4QM7A 1BE6A 3L7CA 3A27A 3BG5A 4ZFNA 4PC7A 5LZ7A 3S68A 5T8KA 3ND7A 3NOOA 4HAWA 3GGDA 4GP9A 2JAXA 3ABOB 4MV4A 4N54A 5ALIA 2JJ1A 2O57A 3ZIDA 1HDYA 3WA6A 7REQA 4CEHA 5TEWA 2VZ8A 1JHMA 5EHZA 3OCUA 1C5KA 4F96A 2WNIA 4P7JA 2W4QA 1SQ5A 3VX3A 2WZCA 3FN4A 1Z4PX 3R8CA 3S2GA 2NTEA 3T15A 1CE8A 4TT3D 3AEYA 1A2KC 4DLAA 3ZV6A 2YXNA 4URWR 4XKJA 1JXAA 1ZRMA 2CHEA 1SD2A 2EEPA 3JR3A 3NOVA 4MLDA 1GAQA 3HR7A 3C6XA 1EIZA 1M6EX 3G2LA 5DYGA 4AIRA 3MT9A 4D2IA 4M87A 4GF5A 2OL4A 4DV7B 5ALGA 5HF9A 4EVQA 5FFFA 1N77A 3KCQA 1TAGA 1C0EA 3EGDA 1SKYE 2ZS9A 2W6QA 2M32A 4EF5A 2A2ZA 1H6AA 4IIHA 1XCBA 3A1NA 3GUZA 4NZPA 3MCWA 3QMWA 4I3HA 3U48A 3ANSA 4CM6A 2D1QA 4A6XA 4J1QA 2QTNA 4KVGA 1V8OA 1FLDA 1Z28A 3AHCA 3Q9SA 4P6VF 4X92A 1FA9A 3RD5A 3LOUA 3N58A 5IDWA 2IH5A 4M1TA 4LKOA 3B13B 2YWXA 2P6NA 3P94A 3Q1LA 1R9GA 2JCSA 3O2QB 4MGHA 5BN3A 5T5QA 5B36A 5K5EA 3RADC 3V8EA 5BVGB 1OYOA 3OCJA 2BJVA 3P0HA 1IY9A 4WZBE 2BR5A 1FNCA 1L5YA 2FN7A 4DQVA 4F6RB 1J0CA 1Z2PX 3D1JA 1SU8A 1YMQA 4PSAA 4Q4HA 1HSOA 1Y6JA 3UMRA 2CHUA 4I1OA 6PFKA 4JASB 3ZCXA 3GRZA 4ZMBA 4PYJA 1K86A 3U40A 1G2QA 1CUZA 1DMRA 4INJA 5J4KA 2BFPA 5JWOA 4FJ0A 2VK4A 3K20A 4J49A 3HVIA 1RXSA 1DAMA 3KSUA 1S9DA 3H2ZA 1Y4DE 1LC0A 2V59A 3MELA 2FN9A 3EFEA 3HJAA 1WZUA 3FMOB 1B0UA 2J6CA 4LMRA 2IIBA 1C7ZA 3C2QA 1V26A 4PZYA 1ZXLA 2D3TA 2OGSA 4OY3A 1ZQ1A 2WJ6A 1N2CE 2HJVA 3FKQA 4OOEA 3R75A 2WV7A 1Z4NA 4NQRA 3ZXSA 3AM5A 4C04A 5HOQA 5LDDC 1LPOA 4UPDA 3BK1A 1KBQA 3TDMA 4ZZ3A 1D6SA 4NF2A 2ZDQA 4CMKA 1M5RA 4OKIA 3Q11A 1D7AA 2R86A 4PG5A 8ABPA 1GLVA 1QBKC 5JTUA 2WT8A 3JARB 4ZQHA 3L7YA 1WF6A 4PQEA 2B99A 4S2EA 1H1DA 2OYRA 2COUA 1FU8A 2FZ5A 2NNLD 4E1AA 1NW3A 4NARA 2VT7A 2Z5FA 3ZBUA 3ADBA 5JY1A 3N2GB 1G7SA 4Q9LA 4EVRA 3FKSD 3GPCA 3N7AA 1TJPB 3R7SA 1CSEE 3NNSA 2FSHA 3DL0A 5U1PA 3L46A 4D9GA 1QONA 2OLEA 2VYND 4YJ2A 1ZVQA 3P2OA 4GXNA 3V1LA 1EI9A 4B4KA 4E4YA 4DR4B 2G1UA 2KB0A 4TPKA 1OLXA 4AROA 3IUYA 1NJ1A 4RC9A 2WUDA 4DRZA 3FLBA 3WXBA 1AY0A 1NMZA 4MKXA 4YMIA 4YUZA 1Q1NA 5BORA 1VKHA 4Z0NA 1DSSG 5FTKA 1PTJA 5IKXA 2ZSUA 3N2KA 1HETA 1M1XB 3TH5A 1RHQA 4MDYA 2H52A 5G0UA 3VDXA 3WWOA 4EA9A 1MH1A 4TSKA 2GHQA 5HRAA 1FC0A 2JLCA 1G21A 3BORA 2DLNA 2PQMA 4EITA 4JHXA 1KMNA 5B5SA 1DC4A 5I7EA 4RM3A 1ZMXA 3O3MB 2J3JA 1I9GA 3DP9A 3F2VA 5EI5A 4AUNA 3H2IA 1GL7A 2IHTA 3ZDEA 1S2NA 4IEEA 1T9KA 2F7SA 2AG6A 1KZGB 1QYXA 1A7AA 3O1HB 2ZBEA 3WLIA 5JH7A 1JSCA 2IX9A 3KOMA 2HOQA 3NQ41 3NZEA 4OAOA 1MOQA 2D13A 4A82A 2P68A 4DVJA 5KAMA 4Z9XA 3OF2A 4O63O 5IDYA 5IDQA 2G80A 1YL6A 4LJLA 3WSVA 1CZOA 3FOCA 3ROQA 1YJQA 3C45A 4RV5A 1FYDA 1DX6A 1E3SA 1KI6A 3TI9A 3JAKB 3QYJA 5IZ4A 2QJFA 2WIDA 5DHPA 1RMTA 2RHTA 3IKVA 4NYIQ 1E4EA 4UVEA 4YRLA 3INYA 1HYEA 4UCWA 1ORRA 4H4DA 1ZUIA 3OLXA 2W58A 4H7HA 4K6CA 5AVRA 1DDOA 1KEPA 1ONPA 2ZYSA 4HWKA 4P80A 4RHYA 5ADUS 1PNQA 2Q2NA 2P75A 2UZ1A 5IM4F 5A6VA 4F2WA 4ZC1A 3IP7A 3P20A 4EO9A 2M6RA 3UN1A 3SSNA 3TJRA 4Z3DA 3C7TA 2V97A 2XCUA 3EZLA 1U9IC 4BN5A 3H04A 1QIHA 4CUKA 3HFSA 2HA5A 1NQ5A 2QIPA 4KXVA 4V0RA 3ZGZA 2PVPA 1YL5A 4I4TB 1U3FA 4AXBA 3MVEA 1YRBA 3BXOA 3EX7C 2C4UA 2ORED 2VSXA 1R9MA 2HMSA 4LFCB 3EXAA 4CTOA 2UVDA 1RAAA 3HJFA 3CPHA 2X5OA 1KMIY 4MQUA 5D1NA 3NW9A 1Z38A 3VZCA 2PWPA 3F71A 2BH2A 4FFBB 4G01B 1J0DA 2PVCA 5DBEX 1M8GA 2IZ5A 4DVGA 2GN8A 5LD2B 2FR8C 4HV4A 3CZ5A 1GZDA 1YQTA 3AC0A 1QZTA 3STXA 3VNRA 1ST2A 1VCMA 4L9SA 4M99A 3CM0A 4A16A 3KEGA 4CM4B 1WKBA 3QE4A 1SOMA 5HJEA 3NBAA 1FFAA 3ZGVA 1F2TA 5FNZA 4IOMA 2SBTA 3MTDA 5KYXB 4D26A 3G59A 5T8KC 1P4AA 1OXBB 3SDSA 2H4FA 2BCGY 2NX2A 2DH5A 4CG3A 3UAGA 3IVRA 5A4KA 3ZE0B 1H9CA 3U3RA 1NZFA 5CB0A 1DEOA 2VQSA 3JQCA 2DERA 4DIEA 1WB4A 3TLAA 1NVKA 3ROKA 4AUKA 4N39A 3VKUA 1ZFNA 1QAQA 1GUAA 1JEQA 3IR7A 3WLJA 2KLHA 1U2PA 3G2QA 4BV8A 2PL3A 4EJSB 1GPYA 5DLQC 1OX4A 5AICA 3R7NA 3A11A 4DCMA 1SUFA 4TMWA 1ZK2A 3MPOA 4DE5A 2OSVA 1N0UA 1S89A 3I01M 1WXQA 2NZJA 4N6NA 4W99A 5J9FA 2G28A 1PJ2A 1TO1E 4DLVA 3ANYB 1ELOA 1F8UA 2VDWB 4KMOA 4X9XA 2C03A 3RPEA 3GG2A 1WMEA 4BO0A 1DCKA 3QUTA 4KAJA 2ZM6B 2R1ZA 4PCUA 4WADA 1JQBA 4V02A 4KEAA 4CQMA 2H85A 2BRUC 5HK9A 2OGTA 5JCZA 4ME6A 3UVEA 1JE1A 5A0TA 4JI6B 3PDIA 1A50B 1CUWA 2CGEA 3JRXA 1I94B 3NHAA 2VZLA 1NN3A 5EKUA 2G71A 3O92A 2YUIA 1LA2A 5F51A 2LW7A 5FI0B 4G1MB 1DHTA 1JU9A 1XXHA 2HHAA 2JFUA 5DEOA 1QGYA 5KYKA 3OAAD 2OV3A 4UDXX 3VTFA 2UKDA 5E2AA 4G5FA 5DWQA 3WE7A 3IQZA 2X5JO 3A4IA 4MKFA 1WZEA 3DR5A 4NE9A 3L1HA 4ZT5A 2GXSA 2AR0A 1ZLXA 1SVNA 3F6BX 1H5QA 4HFNA 4RVHA 4B3GA 1T15A 2NTNA 4JJAA 2HC9A 4UTOA 4NR0A 4Q4LA 4BXOA 1D0SA 2XKKA 2JEOA 5D5QA 3Q87B 1KVUA 4ZQBA 1HDZA 1NT2A 2O8FB 1H0KA 1CY0A 2MIIA 3N0WA 1X7WB 2YASA 1ENOA 3NM6B 3ELUA 3PRYA 4O33A 4REQB 4RJLA 2J6IA 1CZKA 2RBGA 5JSUA 2E18A 3NHFA 1KP2A 1XHLA 4D7AA 1KBZA 4ROTA 1UK8A 4JX9A 3C3PA 4EHIA 1JLKA 1V16B 1ZWKA 2AEFA 3BWDD 4W82A 4CEJA 4LXHA 1YIDA 1FVXA 5DLYA 2WUFA 5J2TB 4G09A 4MWDA 2P69A 4LHWA 3KDAA 1L5RA 4OGKA 1UM9A 5KU7A 5L53A 2EP8A 3SSAA 1MH9A 2N1MA 3AF1A 3C8DA 3MCZA 3N28A 4L2IB 2WSMA 3CX7A 2EF0A 3QHQA 3RSLA 1VFPA 1E2JA 1CZNA 1X0VA 4YRTA 1CQJB 1X92A 2H11A 1A8UA 2CCGA 4ZO6A 3I5UA 2MWMA 1ZSVA 4B0PA 3WC4A 1MORA 1G4AE 1PV4A 3PPYA 3G2KA 4XX0B 3PNPA 3U4GA 4HYEA 3QA3E 1J5XA 1QHYA 2EWWA 4LMPA 4M21A 4WOBA 2GNAA 1LK7A 1U9ZA 4ZCSA 1AGPA 1RRPA 5GGXA 3EOBI 3LHIA 4NICA 3R0ZA 2BDUA 3M2PA 5DLDA 4URYR 1WD7A 5FWAA 3NC4A 1DQRA 1OYWA 3U4QB 1E89A 3SIPA 1UODA 5BR8B 3KTAA 2OZLA 4CBVA 4PVCA 3GJYA 4GI1A 4U6NA 1XDUA 4JEIA 4RWZA 1PTJC 3EJWA 3ZDBA 4FEEA 5CCDA 2EAUA 3UJ3X 3THYA 2QM0A 4YGXB 4LRXA 4JI1B 2WJPA 2WRZA 3N0RA 1PDOA 2QMZA 2DTXA 2FKAA 4BO9A 1F0NA 5CB4A 2WTNA 1DU4A 2QW0X 2BBSA 2WZBA 4KDEA 3RK1A 3D7KA 4D3DA 3Q72A 1MX9A 2VAPA 3QXGA 2YZMA 5HNKA 1FLVA 3BHJA 5H3HA 1CBUA 3G0OA 5AESA 2X8BA 3DE5X 5IJ0A 1PGOA 3K1AB 2AWOA 5AHXA 5K8TA 3G0BA 3KTOA 1X13A 1NV8A 3HBAA 3CVWA 3K73O 4KCGA 3R0IA 1DBPA 2Y67A 3VOAA 3FTEA 3WICA 4BKUA 1PZHA 4EFLA 5AI4A 1IIRA 1WDLA 4RADA 4WXHA 5EL0A 4NBSA 4Q3LA 1KETA 1NZJA 4LOHA 1QVAA 4CN9A 3IR5A 4RTPA 1G5PA 5EHGA 5TX7A 3UT6A 1LBHA 4DMGA 3NPAA 4B6RA 4NYJR 1A88A 5U4QA 5IT4A 4I99A 3OZ7A 4FIZA 2X9GA 3V7UA 2A5JA 1C41A 1GZSA 1PT6A