1MO4A

Reca-atp-gamma-s complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
324
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords RecA
total genus 89
structure length 324
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo4A01
4B71A 1XTJA 1ZUIA 4GRAA 1KKLA 2WIBA 2CK3D 2ZJOA 3DOFA 1Z0DA 1W0JA 3VR4A 3REFA 2DYKA 2ZJAA 3K1JA 1XTRA 1JNYA 1VCOA 3GLIB 4TWZA 1US8B 1E79A 2ZTSA 5EUMA 1CR4A 2V7QD 4Q4AA 4BPBA 1QRAA 2IS2A 5KOYA 2BEKA 3KQNA 3VKWA 3SR0A 3GFPA 2FSGA 4PHGA 2EW1A 2IL1A 4TT3A 3MJRA 3MAAC 3BS4A 5FTKA 2F9LA 3DVLA 5TDHA 3QF7A 3H0KA 5D3QA 1LVGA 2ZS9A 5HZKA 1DOAA 3PUZA 1G7SA 3SHWA 2OXCA 2FN4A 1WB9A 1GKYA 2WKRA 1N5KA 5E7IA 3IGFA 2JDID 3C15C 4MRNA 3PCRB 1SKYE 1M1YE 2GJSA 4N0DA 1F2UA 4MRSA 4R2IA 5HZHA 5G40A 1X8KA 3AP3A 4ACBA 2OV2A 5EZ5A 4BFUA 4UQOA 4FMBB 4KVAA 5DGXA 4MKHA 2W6IA 1Z0KA 4ESVA 2O8EA 4M0LA 1BMFA 4MDFA 2VP0A 4DLUA 2AWNA 4V0NA 4NCNA 5K8LA 1OYYA 4EQ6B 1XTQA 3DPUA 2IEZA 3L43A 5CLLA 1TF5A 3W90A 2I4IA 2FX3A 4Z8YA 4W7SA 3THXA 4CDGA 5JJIA 5FR1A 3SI7A 4CT5A 2HLDA 1ODFA 4Q7MB 4PC6A 3W3ZB 3U7HB 1XNJA 1XBTA 3SJAA 2EFHB 1TADA 4FWTA 4GOKA 4LGMA 4Q1FA 3CNOA 1DE0A 1NY6A 4TYYA 1P9WA 1XWIA 1G41A 3UMRA 3W9YA 1G21E 4M1MA 3TIFA 2CEAA 4B3GA 4L5BA 4BZPA 4NCIA 1EFTA 1M6NA 1PJRA 1IN4A 2BBSA 1IJFA 3BBPA 5DI3B 4D6PA 2VSOA 2PZFA 4AIIA 1E0JA 1N3BA 4P3YA 3NEYA 1XEFA 2P67A 2ZRKA 2IS1A 2CE7A 2DFKB 2WJGA 2Y8EA 4OHZA 1GL7A 1SULA 1W46A 4GP7A 2ONJA 4B74A 1SVLA 2D7DA 3DZDA 2AXPA 3CPEA 1GG2A 3PJRA 721PA 1HY3A 4M22A 1G8HA 3IPYA 2QGZA 3VTKA 2C5LA 5EP2A 3B7GA 4WBSA 4ACAA 5JS7A 5JECA 2NOAA 4HAYA 2GF0A 4MKFA 3QEJA 4TQAA 1Q3TA 2YOFA 1WBBA 4AK9A 1XPRA 1E9AA 3H4MA 1RW4A 1YKSA 3REGA 4NYMQ 4QBFA 3IILA 5JWOA 1DG1G 2ZS7A 1AS0A 3GLIE 3I73A 3QOFA 2WM9B 2OSBA 2AK2A 2IUUA 3BE4A 4OYHA 2DWPA 1MOZA 5FTMA 4B3XA 4DUGD 3OFND 3THYA 2QP3A 4HAZA 5K8IA 1ZNZA 4PAQA 4BGDA 2WOJA 4QC2A 1BO6A 2LKDA 2ONKA 3AVTA 1CJKC 2CHGA 4YQFA 2A5JA 1R4AA 1TQ6A 3X1XA 4DLRA 4MKGA 2R62A 3W5JA 3CRMA 3UG6A 1ZINA 1HE8B 2J59A 3RNLA 1XB2A 4Q1BA 3SFZA 2C9YA 2DBYA 3M0EA 1E0KA 3EC2A 2HXYA 4HAXA 4TN1A 1Z6GA 4DSOA 5AUNB 2KBEA 1W48A 2J0SA 1MRNA 3FB4A 1OIVA 5KNBA 1OXTA 5L3QA 4LOAA 4DC9A 2QU8A 3IDQA 5C18A 3NEJA 1E9EA 5IDVA 5GJVC 3EXAA 1DG3A 3Q3JB 1CS4C 2ZRAA 3LWNA 2D06A 2JGNA 2PEYA 2XTNA 1W1WA 3RAPR 3WRYC 1QDEA 3GCGA 5IHPA 1K6MA 1P2TA 1GFIA 4IKEA 4Q4AB 5A5GA 3QKTA 4FD2A 4PAMA 3CRW1 5HCNA 3UWKA 1NKTA 1E79D 1XEXA 1Q22A 1OJLA 2HJGA 2JASA 4HZIA 2E9SA 1TEVA 1W36C 4WVFA 2OBLA 3OE7D 5KDOA 4B2LA 2C04A 4QL3A 4JLNA 2O0HA 1XXHB 4L9WA 2G9NA 4YMWA 4QJ3A 1M2OB 1CF4A 1W49A 1ZUHA 4HDOB 5AK0A 1E1RD 2FFQA 3HDTA 3N2IA 3K09C 1NLZA 1TF7A 3QJYA 1GIAA 5GVRA 4I1VA 1ZNYA 2BCGY 2CVFA 5DIFA 4GP6A 2JJ8A 1X6VA 4HSEA 1LB1B 4QG7A 4ZKDA 3HR7A 3I72A 4UNSA 4RD0A 4XSGA 1UDWA 1G291 1C9KA 2FSIA 3DL0A 3QKUA 4LBZA 4LSGA 3I62A 1NVUQ 3FDIA 4GOJA 1NP6A 1KYIA 4LJ8A 4CGZA 4PPGA 2WWHA 3L0IB 3Q7PA 4JBYA 4QGHA 1ZIOA 3F8TA 2WJYA 4RFSA 2AKAB 3U6BA 4ZDWA 4GMXA 5EZ6B 2QL6A 1BMFD 4G5QA 5GADl 3PITA 3WP0A 1TU4A 2IW3A 5G3ZA 2GBLA 1N6LA 3EIHA 3CB4A 2BJVA 3X1ZA 4EPYA 2ATVA 4U7DA 4LV8B 2OUKA 2B8WA 2AHOA 2GEVA 4H1UA 4MUAA 3K0SA 4DBLC 5KTYA 1F3OA 1ELOA 2GETA 5FPSA 1BH2A 2HLDD 2QZ4A 1CR1A 2ZREA 2NO6A 4TLCA 4UNNA 1OFTA 4Z51A 4BFVA 3IHWA 5FH9A 1YR8A 3QXSA 4M4SA 3X2SA 1FUKA 2BOVA 3OAAD 1KJZA 4L4UA 4AKEA 5JWHA 5FOUA 1NN5A 3CO5A 4DB2A 1GRQA 4BZQA 1W5SA 2KJQA 2ZRNA 3T06B 4D0LB 3S1AB 1OXSC 4DWJA 3C7KA 2WMOB 5DN6A 2WWIA 3GJ3A 2ZR0A 4BLPA 2J46A 1ZRHA 2HXSA 3NKVA 1EG7A 4F93B 3CF6R 1G6HA 2QNRA 4Z1MD 2CLCX 1KK2A 2VHCA 1FQKA 1KOFA 1CBUA 4II7A 3RLFA 2ODEA 2AX4A 2REXB 3A4NA 3B82A 4BEJA 1U9IA 2P2LA 4EFLA 4HLQB 2WJHA 5C4GB 2J0QA 4KJZA 4LYHA 4C3ZA 3BAFA 4QBHA 2RGAA 1P62B 2X77A 4QFMA 3UANA 1DAEA 1XU4A 4M9SA 1SXJB 3IBGA 2WMNB 1ZYUA 5CDFE 1WMSA 4M21A 1FMJA 1KO5A 3OEHA 4Q7KA 3ZD6A 2AD1A 1IHUA 4A0GA 4GNKA 1OHHA 3GJ4A 3GJXC 4FI3C 1QHSA 3B1YA 4JYBA 4WOPA 4TLDA 4DLWA 5LPNA 4HLUA 2H17A 1E0SA 1TQ2A 2OAP1 1CULC 3FMOB 5ANRB 3SJCA 1FUUA 2ZRBA 2DWQA 5HTKA 1T9HA 1E0AA 4FMDB 5FBRB 5FBVB 3AVWA 3OIWA 1C4OA 1Z2AA 4B2IA 2GJKA 1GAJA 2RGNC 4AKIA 2CCKA 4EFMA 2OHFA 5M04A 3ADDA 3VKGA 4GZMA 1G16A 2EYQA 2RAPA 3I8XA 4P4SB 4D0NA 4HB2A 4E22A 3AGQA 2O0JA 2XEXA 2QBYB 1ZJ6A 3C16C 2F1RA 5J47A 1OFIA 3EZFA 1OIWA 2J45A 4PZLA 1CR0A 2NGRA 2EFGA 4URVR 2Z0MA 5CDFA 1G7TA 1E2QA 1E3MA 1KI4A 3BB4A 1IBRA 3LBNA 3TUJC 3QF4A 4CRWB 3PEWA 3FWYA 1N5IA 3ICQB 2ZRMA 4DIEA 1F2UB 3AVVA 1G64A 2BJWA 2GXQA 4QXAA 5G41A 2O8CA 3SYKA 4UNQA 1N25A 3BFKA 4HLUC 4IXMA 2IWHA 2CLSA 2ZRJA 2VF7A 3VHLB 3TBKA 2HCJB 1WDTA 3GJ5A 3JZMA 4ASUD 3BB3A 2L0XA 1AS2A 2YWFA 4LJYA 3UKDA 4E5UA 2CMKA 5AWFC 2G88A 1FX0B 4FXPA 4MRVA 2WZQA 4DDTA 3LLUA 4N0EA 1Z3IX 4P4UA 3QXHA 4A92A 2PLRA 1SVSA 3MWYW 4X8MA 3RS0A 4ZDIA 1PZNA 2CLDX 1G3UA 1ZC3A 3QI2A 2VP9A 5BN5A 1E96A 2JJ1A 4RCYA 3AVYA 4B43A 1E4VA 3KX2A 2WAXA 1P2SA 1N6PA 2B7CA 4V0LA 3A1WA 2N46A 2ORVA 4LJ5A 2C77A 4H1VA 2O8BB 1AA9A 1P61B 4D81A 2F3RA 3TKLA 3WY9A 3CIOA 2IK8A 1H8ED 1FP7A 1Q1BA 4TLAA 5LB2A 3SE0A 4TQ9A 4JKYA 1NMXA 1UKVY 4QHTA 1NRJB 2J5XA 1E2LA 3W8NA 4M53A 4XD7A 1AKYA 3PR1A 2ZE7A 3LO5A 5CJ2A 3T1VA 1UKEA 5CM8B 1LTQA 1E6CA 1W5TA 4PX9A 4B34A 4DEYA 2O8EB 1CP2A 1HUQA 1P3JA 2VO1A 4N1AA 4BFSA 4ITRC 5FUVA 1YR7A 3F5FA 1NJGA 1YZTA 2V1XA 3PUVA 4JIMA 1N0UA 4U00A 4TL6A 1E94E 4B47A 4C0LA 4HDCA 1AGRA 1LS6A 1TUEA 1SHKA 1N6RA 4E07A 2XJ4A 1PV4A 3PEYA 2WICA 1QBKC 2QMOA 5B64A 3NIBA 1E69A 2FA9A 3ASZA 3PENA 1ETUA 1D2EA 2G0NA 2IYWA 2VP4A 4LHVA 1VPLA 4DKXA 2GVDC 1Z29A 5AJYA 3O8CA 4A2PA 2D3WA 1R8QA 1O87A 2BM0A 3CH5A 3K0CC 2BWJA 1E2KA 3B13B 3QENA 1E2FA 4MH0R 3AM1A 2FSHA 2PL3A 2YKGA 3OAAA 5KUTA 2XNSA 1HT1E 1X1RA 3K70D 4RKFA 2RGGA 2YJTD 4JLVA 3JVVA 2J0UB 3QNUA 3TSOA 3O47A 1B23P 3K0FA 1ZNXA 2GESA 3HPRA 4A0FA 4HZUB 3VU9A 2FFHA 2JLQA 2ZE5A 4RCZA 5L3SA 1YRBA 5KNDA 1OKKA 3W8RA 4R7ZA 2JEOA 3KB2A 4JJKA 5JRZA 2FFAA 4Z1MA 4Q9LA 1X3SA 2EYUA 3LW7A 1U90A 4PC1A 3VHXA 4CEJB 4OI4A 5G53C 3SOPA 2EFCB 4NYJQ 1UBFA 1LF5A 4DCVA 1NJFA 2GKSA 4IDHA 3ZGXA 1ZVQA 4RD4A 4MYCA 4TYWA 3WBKA 5AUPB 1IN7A 1I4DD 4DLTA 4YC7A 1KO8A 2ZRFA 4C0SA 3BORA 2ZITA 3UMSA 4PXAA 2BVNA 3J81k 3KB1A 1QG4A 3U6KA 3I32A 1XTKA 1FTNA 2RH5A 4DCSA 1OH7A 1I4TD 3AEZA 4EDHA 1M7GA 3Q7QA 3SJZA 2OEPA 2YYZA 2FGKA 2CL7X 2ZR9A 1JAHA 5TY0A 3NC1C 5BYJA 3HU1A 2QENA 1GM5A 1XEXB 3BGWA 2I3BA 1E98A 1OH5A 4GFDA 3BK7A 2QN6A 4AG5A 1Z6YA 1NVXQ 1RRFA 1XTSA 2CDNA 2FOLA 3I5YA 1S0UA 2CCJA 3FFAA 4QNRA 1IXSB 1Z6AA 3G5UA 1U8AA 4HB0A 2XTMA 2XOKA 3O8RA 5EP1A 2NIPA 2O8DA 3OEED 1P5ZB 2F43B 3TNFA 1OYWA 3QPVA 2BMEA 2BEJA 5UKDA 1U99A 4IVPA 5FTNA 1QHHB 1DAHA 2VF8A 3B1WA 1TQDA 1RIFA 2AFIE 2J3EA 4HEJA 1VYTA 1Z08A 4KAXA 1T4GA 1ZW6A 5FUXA 2QSZA 2WIAA 4LX0A 3U2QA 1WCV1 4JLDA 4D4MA 2V3CC 4B3FX 5DI9A 3ADKA 4CEHB 1WA5A 2ZI5A 2PZGA 3IIKA 2PT7A 2IEYA 4GMDA 3EAQA 4Q9KA 1TMKA 2OFXA 3E1SA 2YV5A 3B85A 4Q01A 1NSTA 1VG9B 2VP5A 3RRYA 4BLSA 1Y63A 4V02A 4BASA 3CNLA 4JKIA 4L15A 1FW6A 4PQYA 4TYQA 1G6OA 2OLJA 4QM6A 3HWSA 2PZEA 3N5CA 2EQBA 4DCTA 2BIFA 3GEIA 3WYAA 1HQYE 8OHMA 4KI0A 1Q12A 2DFLA 3LLMA 3IBYA 4KFRA 2G83A 2IS6A 4O2LA 4D0GA 2FEMA 1CRPA 2R8RA 1OB2A 2NO0A 1AN0A 2VYFA 4B6EA 4YXWA 2VHUA 1LY1A 1H8EA 2J87A 1O3YA 1YJ5A 1W4CA 2HCBA 3O8BA 4IDNA 4US0R 2Q3MA 4TZ0A 1AQUA 4DCNA 1CU1A 4M1KA 3F3YA 3TRFA 3EZ9A 4Y0VA 2Z4SA 4D80A 1JJVA 2OAQ1 5HCIA 4FIDA 1NMZA 1RE0A 1KDPA 1QHHA 2GVZC 2WWXA 1SVOA 3DEFA 1ZU4A 2F3TA 3EASA 2GCPA 5EJEA 2B7BA 2HJVA 1X8LA 1AQYA 3EZ6A 3X1WA 4BWYA 4C30A 4D2IA 1UEJA 3I92A 4M1YA 1VCNA 4JLOA 4P4TA 2HYIC 1T8TA 2AXNA 2RGDA 1JI0A 1XZQA 1XXHA 1RYHA 3CH4B 1FTSA 3KL4A 3KUCA 621PA 3KQHA 1GTVA 2C96A 5TV2A 1SQ5A 5DH9A 3PQCA 5LD2B 5JJLA 3KKPA 1Q1QA 2Q3FA 3VR3A 4TYPA 3ND9A 3PFIA 2C03A 5JBQA 5BXQC 1KDOA 2QQEA 4OK5A 2JLWA 1ESNA 2QE7D 1ZCAA 3R7WB 1NLYA 3GEEA 4LJ9A 5CLQA 1DAFA 4P4SA 5B57C 1NIJA 2V7QA 1L7VC 5FBQB 3ZDQA 2XSZA 1YZGA 3I8SA 3RC3A 3VNVA 4C0HA 3EARA 4Q4LA 3AV0B 2QI9C 2BDTA 3L0SA 3OHMA 4BFXA 3NTUA 4WA7A 4LUCA 2QAGC 4HDQB 4WIAA 1OKKD 3GLIA 1CJVC 1OSNA 2F9MA 3B1XA 4Q7LA 3LBIA 2TMKA 1G19A 1YZLA 4RFSB 3T12A 2BKEA 2KE5A 4OHWA 2GZAA 4KBGA 2CJWA 3U7GA 2JDIA 5J4KA 3DKPA 1DAIA 2GA8A 3T35A 1T3HA 2CXXA 2VLIA 2AKYA 4TMWA 2W0SA 4S35A 4EPRA 2FGJA 4RSGA 4YMUA 1RPZA 1Q3HA 2X2FA 2H8KA 3LQQA 2ANCA 3A1TA 3M1IA 4A2QA 4KYIB 3VR1A 2W6ID 3IIMA 4AKGA 3AVXA 4IDOA 5LBIA 3VR6A 3GJ0A 4GT1A 2V54A 4PANA 1FFHA 2ZSBA 4LJ7A 4JL5A 1E1QD 1MRSA 5E3HA 3RHFA 3W5IA 1EWRA 4I81A 1VDZA 1KK1A 4H9GA 2BMFA 2RGNA 1JEEA 2VRWA 1PUJA 1R5OA 3JZAA 3GFOA 4TMTA 2ZE6A 2XAUA 2O8BA 4GPTA 2X19A 1W4RA 4MUBA 1VHLA 1G17A 1LFDB 3FKQA 3ZZTA 1FPMA 4PAOA 3U4QB 3ZS8A 5FPHA 4BLOA 5EP3A 3EPKA 1Z6XA 1IY2A 1AJEA 3CONA 2OESA 2P6UA 2XOKD 2AR7A 4JT2A 4D4JA 2V6IA 5KPDA 1E9FA 1BYUA 1SVMA 3TR5A 4B6FA 2DFNA 3EW9A 2I1QA 3WYGA 1E2HA 1TF2A 3NXSA 3U7FB 2H1LA 2XGJA 4EQ6A 1XTIA 4K8OA 5L3QB 4R98A 1Z0JA 1L8QA 1NNEA 4MRPA 1KSJA 2I1VB 5JCPA 3L0OA 3CR7A 1TU3A 1D9ZA 4URWR 5JWRA 1DADA 4EFNA 1A5TA 2N1BA 2BMDA 1EFUA 3MWKA 2NTYC 3ZVNA 4V0KA 4M1WA 1CEEA 1Z07A 4LI0A 3K9HA 3ECCA 2RB4A 4V03A 2QGNA 1IM2A 1DAGA 2ZXUA 5A0FA 1II8A 3PEVA 4Q9HA 2ZRLA 3CRVA 5CK4A 1KDRA 1KI8A 4RKEA 1AKEA 1Z22A 4JT4A 1MO6A 2GXSA 2VSFA 2O52A 1A2KC 1P7CA 4QJ4A 3LXRA 2ZVPX 4BFYA 4Q1DA 2OBMA 4WZAE 2F1IA 4DLYA 4ZCLA 1F6BA 1AZSC 4FW9A 1EX6A 1IQPA 1YU9A 4NYIR 2XZOA 1KTVA 4QHYA 4LV5B 3SU8A 2GAAA 1XP8A 5JI3E 1KSFX 3LV8A 1G5PA 2FZ4A 4A8JC 2XB2A 1JB1A 1R5NA 2GEUA 3SYLA 1G4AE 2ZUCA 1BKDR 4DIDA 1ZP6A 2V9PA 2ZJYA 3EG5A 4LWZA 1PLKA 1FMLA 4CEHA 1W47A 5JSZB 5CIQA 1SVKA 5HE9A 1V43A 3FE2A 1OF1A 1L4UA 1RKBA 1B0UA 4A9AA 3U3JA 4F38A 2PT5A 3GLGE 1NN3A 2ZEJA 5JSZA 1ZD1A 3PVSA 3HYRA 1Y3AA 1G9XA 3HYTA 3OF5A 4QHSA 3SHFA 2GCOA 2RKOA 3EX7C 3NBYC 2JLYA 3DZ8A 2X1VA 3RRZA 5HR5A 1UKYA 1XCMA 1SZPA 1XJQA 3Q8XB 4EJSA 2ZROA 5JHGB 4QBGB 3THYB 4TTRA 4KITB 4TMVA 5CK5A 4M1SA 1NKSA 2R6CA 3ICEA 2W2XA 2OO7A 1G8GA 4MGYR 4NL4H 1KO4A 5C4MA 1S9HA 1JJ7A 1U81A 3GD7A 3BC1A 1KK3A 4KFTA 3BRWD 3L82B 3EZ2A 1R5BA 3C5HA 2AWOA 1KJWA 4OHYA 3QY0A 2QE7A 1OXUA 2QMHA 3PUWA 2J0UA 5BQ5A 2ZJZA 2UZIR 2J7PD 1J8MF 3A4MA 4OBEA 4P31A 3X1YA 4YMVA 1UPTA 4US2R 3U3MA 4TZ6A 2AFHE 1NF3A 4HLDA 5B58C 4XTRA 2NZ8A 2VHJA 2ZI6A 1HE1C 4KFUA 4UJ5A 4AD8A 3CR8A 4AI6A 4BE7B 2WJIA 4KHZA 4EJSC 3NBZC 4O0MA 1E1RA 1SKYB 1GDDA 1GVNB 1W36D 3QIAA 4P32A 1KAGA 3IUYA 4Q47A 1XD9A 2RGEA 1VYUA 4Q66C 2PX3A 2IYTA 5BN3A 1NLFA 2ZJBA 3BFXA 4GSYA 3KJIA 1KI7A 5KU1A 1QG2A 3IEUA 4I4LA 1DEKA 5JEDA 1R6BX 1NI3A 2HT6A 2H92A 1KKMA 2IUSA 2C8VA 3SQWA 4PPFA 2GXUA 1Q21A 2R6AA 2H5EA 5KDLA 4LHYA 2Z4RA 4RFVA 2WAYA 2QTHA 4TMKA 3D31A 1A7JA 3IO3A 4BECA 2QMEA 4LC0A 3ASYA 4LBVA 1SVIA 3VKHA 4QGFA 4JLJA 3WHLA 4RJLA 2EWVA 5AJWA 3TW8B 1DAKA 2QQ0A 2WWYA 5JJKA 5DI3A 4K81B 1RJ9B 2EFDB 2QT1A 2R9VA 4W5WA 4FCTA 1E2NA 4R2HA 3R7WA 4J0QA 3QUSA 3IPXA 1ZM2A 4EAQA 3TUZC 3TH5A 5C46F 3L8ZA 2IYSA 5EE1A 3QXJA 4IHQA 3K0CA 4ILEA 2KI5A 1KZGB 4POAA 4XWKA 3U5ZB 4DLSA 3V4FA 3CRRA 1WBDA 4YDHB 1OH6A 1VKJA 4DLZA 2F55A 2OFOA 1S8FA 1S3SA 1XCPA 2YVUA 3AP2A 5E4FA 5BYKA 2WJJA 4PR0A 3CWQA 3FYHA 1E2GA 1ZM7A 3BB1A 1J99A 2CJWB 3ZLJA 2YC4C 3WYFA 1S9DA 1EFCA 3MSXA 5E95A 1T5LA 2ZIAA 4UKDA 5K8TA 4A82A 4EPWA 1RFLA 4NKRA 3EPLA 4TYNA 2WTUA 4DB4A 1UEIA 1P9RA 4OK6A 1U94A 3ZZ0A 2ODNA 3IIJA 2ZU6A 4LPKA 5EXPA 3RC8A 3KXIA 3FGNA 3ZD7A 4Q00A 1XD8A 2HF8A 3OEHD 2WBLC 2O0KA 3TLXA 1N6IA 3NH9A 4TQUS 2Z83A 4MYUA 2NO9A 1OHHD 4JVNA 1Q1ZA 2IYZA 3LY5A 2DFTA 5FI0B 2F1HA 3CWZA 1P6XA 5JHHB 4C2TA 2GK7A 1MT0A 4MGKR 3IQXA 2QP9X 2GJAA 4WZBE 3PUXA 5ELXA 2A5FA 1CLUA 1Z5ZA 3GLFA 3I61A 1KY3A 3LX8A 1WXQA 3DKVA 1CXZA 3WRXC 1TEXA 2JAQA 1FP6A 1UJ2A 4NE2A 3ADBA 5F98A 1XXHE 1AIPA 4LJ4A 5F9FA 3VX3A 1G3RA 4Q1EA 1FX0A 2ZI4A 4D82A 1OT3A 3PUYA 1N6NA 3P1JA 1JQLB 1TUIA 2W6JA 2ZPTX 3WP1B 4C7OB 4TMXA 1R10A 3GJ8A 1P2UA 1XD2B 2IT1A 2OFWA 4JLBA 4JZKA 1D5CA 3Q5DA 1KI1A 3QG1A 2A5YB 5H8WA 3U3OA 1VG0B 3KTAA 3T5GA 2IHBA 3F0TA 3NG1A 4AKHA 4ASUA 2WSSD 3SC3A 4KYUA 1RRPA 2A5GA 1G5TA 1LNZA 4CT4B 3AGPA 4RZUA 2P0EA 2GDJA 1JPNA 1E2DA 4YMTA 1P75A 5AUQA 1T8UA 2ODBA 4G0NA 5EE9A 5B30A 2RCNA 4W9MC 1EESA 1BYIA 1YE8A 2JJ1D 4IOJA 4B3CA 3RRMA 1A82A 2WWFA 3HJNA 1D9XA 1LW7A 1JXOA 4MRRA 4KSBA 4ZV4A 4JS0A 1IJEA 5CJPA 2A3RA 3EIEA 1J7KA 1KNXA 1MR3F 2H7VA 2Q6TA 2QG6A 1XF9A 1CR2A 3WNBA 2QORA 3SEAA 5JLJA 2W2VA 2QM8A 4JL8A 2W58A 4URZR 2WKQA 2VA8A 3AUYA 3FPAA 4FCVA 4B44A 5AUOB 2RMKA 2AL7A 1UDXA 4GBMA 1DPFA 4DEXA 2BBWA 2ZJ8A 3CX6A 2W00A 4G5SA 3G0HA 3KKNA 3V00A 2SHKA 4XD7D 1TL7C 4YDSA 2IYLD 3UK6A 1OV4A 1GKUB 4O3MA 1MO4A 1K5GA 4M9QA 2OILA 1V5WA 1R8SA 1QF9A 1YVDA 4G1UC 4XH9B 2NMVA 1S2MA 2WWGA 4X8OA 2VSXA 3T61A 3SJBA 4PHHA 2MMCA 4UNRA 2X8AA 2O8FA 1Z83A 4ARZB 2DPXA 4WXRA 2ZS8A 3MUFA 4DSNA 2J7KA 2QPAA 2QM7A 2R6FA 3CNNA 4V0ME 3FHOA 1Z0AA 3W3AA 4HAVA 3T1OA 4A36A 2F1JA 3AVQA 3RS3A 1E32A 2PMDA 1JR3D 2KWIA 3K0FB 3T1TA 1TTTA 3BH0A 2C9CA 4B35A 3RSOA 3SS8A 1ZCBA 1E2IA 2HV8A 3M4YA 3K70B 1HA3A 5FL7D 3GJ6A 2NO7A 2E1RA 1LV7A 2A2ZA 4TSFD 1KMQA 1OFUX 2JIZA 3W34A 3ZVMA 1G1MA 4ZDJA 1JEDA 1R0WA 1YQTA 5H1YA 5TMPA 2A5DA 1NG9A 4FN5A 3FHTA 1IN6A 3KDSE 3LA6A 1A1VA 4C0AC 4PFSA 2G1KA 4JYCA 1VMAA 4Q9JA 1EWQA 3N2EA 4QBIA 2OE2A 4OI0A 1VCMA 1XX6A 2BV3A 4JLAA 3R9IA 1UM8A 2E87A 4L9SA 3NDPA 2GZHA 3CM0A 1NMYA 3P4YA 3BJIC 1KO1A 3MGCA 4A15A 1VECA 4QJ5A 1EFRA 3PV0A 4AG6A 4NCHA 4WZ6A 3RWOA 5CITA 1M74A 4K46A 2MSCB 1W4AA 4OHXA 2UVQA 3GFTA 4UNPA 2PH1A 2Z6VA 4FMDF 2YC2C 1JBKA 2A30A 5JMTA 5DNYB 4D26A 2FDCA 3TR0A 2IS4A 1U0JA 4ZCIA 5FPYA 3QE0A 3KFVA 2GJ8A 5L8VA 1DO0A 1T0HB 2CL6X 4DLXA 1E9SA 4P0TA 3KFXA 1E9RA 4QRHA 4NYIQ 3G82C 3AVPA 2QBYA 2D7CA 1G3MA 2WV9A 3GLHE 1OW3B 2K5UA 4CYMA 4OL0A 2IBMA 1RJ9A 2CNWA 1G7RA 3R8CA 4MQBA 3K0EA 2P5SA 3LDAA 2GWHA 2BCJQ 1GKIA 5F3WB 4ZI3A 3ZIAA 3ND8A 2GEDA 4PQRA 2JJ2D 5DISB 3RDPA 2C2HA 4AC9A 4XIGS 2YWEA 3WNDA 1NBMA 1KI3A 4PC7A 2D4HA 2R6GA 2VIIA 4X8HA 2XXAB 3TJZA 3GLGB 2HDNB 3UMFA 1X8JA 1U9IC 3THXB 3AVUA 1H8HA 5DSZA 1R7RA 3OEEA 3SNHA 4CW7A 4TMZA 4FMCF 2OG2A 3B1VA 3H84A 2ZSDA 3B8HA 1E99A 1AK2A 2F6RA 1XCGB 2ZSFA 4TTPA 1UFQA 4QNMA 2KBFA 2NO1A 3AP1A 2FG5A 3B1ZA 2DB3A 2W6JD 1NN1A 4MYHA 1X1SA 1DBSA 1KMHB 3GLHA 3GPLA 3Q72A 4MYTA 2Q9CA 4N3NA 3AKDA 4QGAA 1T0JB 1N6OA 3DM9B 4URXR 2D2FA 1ZBDA 5TVKA 1YR9A 1W2HA 3TUIC 1WQ1R 2GHIA 1CTQA 2YNMA 4PO8A 1XEWY 4I1SA 4G3XA 4TL7A 3FKSD 5GJCA 1Z28A 1E2JA 2P5TB 4DXAA 4O25A 3GQBA 3SYNA 4BLRA 2O8DB 5DO9A 4W5HA 2XZLA 2J41A 1S3GA 1OFHA 2QTFA 2G6BA 4PSVA 2ZVQX 2NQ2C 2CVHA 4EPXA 5KHOC 1XMSA 1QVAA 3T1QA 5KSYA 5DE3A 5FOXA 3CBQA 3TSZA 2QPTA 4KO8A 2REBA 5GJBA 1CKEA 2GK6A 4HYYA 4CZ2A 3OESA 5DHAA 3ZJYA 3THWB 3UG7A 2GCOB 2ZSEA 1IY1A 1Q44A 1RRGA 1Z06A 4RY2A 3NHAA 1OXVA 4BLQA 1TQ4A 2FF7A 3AF1A 3MWJA 1GRRA 1QHYA 1KDTA 1P73A 4LCBA 4Q02A 5HPYB 5KYKA 3SDZA 1II9A 3EPHA 4TL9A 4JSTA 1GILA 3TW4A 2IUTA 3CX8A 4DSTA 4ZO4A 3Q9LA 2HUPA 3TVTA 1KMHA 3MWLA 3KJGA 4ZKEA 5CIWA 4M1OA 4A0RA 5C2JB 5KDDA 5FOVA 1XDBA 3CKLA 4HLCA 1XMIA 3DHWC 1W2GA 3BD9A 3GEHA 3TQFA 5TXGA 3RABA 2ZI9A 2IXFA 2VH5R 2YOHA 4NH0A 2JA1A 4NTZA 5FTJA 1CIPA 4DT1B 1HYQA 2YZ2A 5FBWB 4MA4A 3RANA 1ZUNB 4HUTA 2ANBA 2C9OA 4U5XA 1JPJA 5AJZA 3U4QA 1N5JA 3QPWA 3A58B 4RD1A 1J2JA 1J90A 1G3QA 2D62A 2J1LA 4IOKA 1F48A 2IX3A 1ANKA 3GMTA 4TSFA 3EIQA 3QKRA 3EA0A 4U02A 5H68A 1G8YA 4E03A 4KVGA 2JLXA 1KI6B 2ERXA 4M9ZA 2XSZD 4MDEA 1AA3A 1DARA 2FPLA 3FMFA 4RZXA 4UXIA 3B5JA 5SZKB 2OZEA 2BBOA 4C9BA 1W44A 1FNMA 1XRJA 2RHDA 1RYFA 1EXMA 1II0A 1HH4A 3BFVA 4NMMA 1SGWA 4IOMA 4IJMA 1OIXA 1I2MA 1I2DA 4RD2A 4P33A 2OXRA 1XD2A 2Z43A 1G8FA 2JATA 4FCWA 4NONA 4JVMA 3RS2A 3CPHA 3EZ7A 4C7OA 1G5RA 4KCGA 4KLNA 4O2RA 3GLHB 3MLEA 5H70A 1Z2CA 2XZPA 1E2EA 1MH1A 2ZI3A 5EUQB 2ZRIA 1P9NA 3DMDA 1GP2A 3K53A 5A4JA 2C98A 4BQSA 2CK3A 2H57A 2ZU0C 1OB5A 2XITA 4HAWA 3S1AA 1W0JD 3R9WA 3LVRE 1Z47A 2IHYA 3QF4B 4NYJR 5KSZA 2IXGA 3SN6A 2XTZA 4RD3A 3WMFA 2H18A 1GITA 4FMCB 1MO3A 2BC9A 3ZS9A 1PUIA 2UKDA 2B8TA 2FPMA 5BW8A 2R2AA 2IYRA 3FHCB 1E1QA 4LHWA 1COWD 2GBLC 2YWGA 3NH6A 2WJVA 1AGPA 4LHXA 2FZLA 2DWOA 4PPNA 2CNWD 2ZAMA 3BIFA 4XVQA 2XXAA 5DYGA 2D74A 4TT3D 1XJCA 1JXMA 2FNAA 5E7JA 3QKRB 1P60A 1MABA 3P4XA 2JJ2A 3FTQA 2ZYTX 1NBMD 3RS7A 1GNPA 3SFVA 2AD5A 3K0AB 4EPTA 4KV9A 1W4BA 2JLSA 4Q48A 1MV5A 1EK0A 4KBFA 1XEWX 3HU2A 1H8HD 1GRNA 4Q21A 3VR5A 2GCNA 4IEEA 3RWMB 3HU3A 4ON9A 2LKCA 1OH8A 1R0ZA 1QHNA 3A8TA 2EVWX 3LNCA 3A1VA 3AQ4A 1VIAA 2O5VA 1DAMA 1LF0A 4V0MA 4EJSB 3AKYA 2UZ3A 3RRNA 5J5CA 1U2RA 4AYXA 2ORWA 4XWAA 3P27A 1W36B 1KHTA 4Q9IA 5JI2E 3BH7A 4L16A 4OQLA 4C0KA 2YHSA 4IFBA 2FEOA 3TAUA 3LFUA 4AWXA 1H65A 4NCKA 3GLFB 4PZYA 1KI2A 3WMGA 3U7EB 4DRZA 5AR1A 3WHKA 4F4CA 3U61B 3TAHA 4IFEA 4F92B 4A1FA 1S1CA 3KXKA 3WNCA 1MO5A 3U60B 4C0JA 1NVVR 1L4YA 2ECKA 3AF0A 3NBFA 4JLKA 4ZI2A 2VHQA 3N70A 3THWA 4OHVA 1NSFA 4OQFA 1N5LA 3OIUA 4NDZA 5LDDC 1F60A 4JSYA 1R0XA 5EXSA 4LPSA 1F2TA 1SXJA 2IXEA 2FWRA 2NPIA 2QMUA 2R44A 3CLVA 1JR3E 3LXXA 4D4LA 2VBCA 3FMIA 3TQCA 4CVNA 4IVQA 2BM1A 5SZJA 4D25A 5AJVB 4B3DA 1BOFA 1X86B 2IYUA 1GNQA 3C4JA 1T6NA 2ASEA 3AF3A 4HAUA 5JRJA 5EE3A 3I3SR 3QG5A 5IK2A 4XWOA 2N42A 1KZ7B 1VTKA 3LX5A 2ZM5A 3QSYA 4NZYA 1WF3A 2OCYC 5AJXA 4C0QC 2MMGA 1SVWA 4PO1A 3GP8A 5EQTA 1D8TA 4WXPA 4JLMA 4KXFB 3VU9B 4BEBA 1RRCA 3CX7A 3T34A 5FOSA 2ZQ5A 4JJZA 4EUNA 3AB3A 1W0KA 3MJHA 3AKCA 2F43A 4DZZA 1IN8A 1HQCA 2QRZA 2GXAA 2VHTA 1SXJE 1XMJA 1UBEA 2VP6A 4OQXA 5JS8A 3GLFE 4NCJA 4V0OA 2PJRA 2ZYVX 2WOOA 4GI7A 1Q0UA 4W5JA 1G20E 4ZIRA 1UAAA 1IN5A 5DHFA 3ZQ6A 4QM7A 4DUGA 4Q5IA 3BERA 3OFNA 1GWNA 2QEQA 3C8UA 1ZM9A 3QKSB 2HEIA 1EFHA 2ZYUX 4Q7JB 1U8ZA 2OCAA 2DR3A 2XJ9A 2Q0HA 2FH5B 2ZANA 5BWMA 2J7PA 3ETLA 4GOXA 4LZZA 4PHTA 3V9PA 3VMFA 4TLEA 1P4SA 3UPUA 5F2EA 4AYTA 3CF0A 2XNDA 1Z0IA 3ZZUA 4QGGA 4ARZA 2ZR7A 1IY0A 3MMPA 3MG9A 1VIYA 5LB4A 1OLOA 2FSFA 1KO7A 1KGDA 3K9NA 5GJWC 2Q9BA 3KTAB 1DVRA 1R2QA 2CHQA 2BMJA 5JZVA 2ATXA 3IHLA 2YINC 3THOA 2IYXA 3U44B 1Z0FA 2CHVA 4Q1CA 5CYPA 1E2PA 1HV8A 1NBME 4FWIB 5KSOA 2QA5A 3U3KA 5FR2A 4G5RA 3A6PC 4EKDA 1JECA 1NY5A 4LBYA 4MGZR 3MCAA 4MKIA 2ZE8A 4KLZA 1P2VA 2QSYA 2EU8A 2W2TA 2OCBA 3KKMA 4BRWA 3FMPB 1UBCA 1KAOA 3VQTA 1FOEB 2AN9A 1G3IA 3QPUA 2C95A 3LRPA 4OI1A 3OE7A 1MABB 4URUR 4JLPA 3PXGA 4I1OA 3KJHA 2A9KA 2PJZA 4JBXA 2VPPA 1COWA 2WHXA 4DSUA 4Q4JA 4ZIRB 2VTKA 1G8PA 1ZNWA 2QAGA 3P20A 3PG5A 4M2LA 4F91B 1Z63A 4F4JA 5FFMA 4HB3A 2WWWA 1IXZA 1QHIA 2RGBA 1N6HA 2JLRA 1GL9B 4DVGA 1UBGA 3DOEA 5FPTA 2CBZA 2ZJ2A 3VR2A 5CYOA 3SBDA 3VX4A 3R20A 2FJUA 4RVCA 821PA 2ZUDA 3FVQA 1E4YA 4BLTA 4DCUA 3AF2A 3Q85A 2P3SA 5KO2A 4CIDA 3D6TB 2VQSA 5BN4A 2LWIA 1UADA 3NC0C 5FTLA 2P6RA 1ZM3A 5KSPA 1PLLA 1J8YF 1AM4D 1M7BA 1T91A 3U44A 3W6NA 3IQWA 4KFSA 2ZYWX 2QT0A 2V55B 1I4LD 5IF9A 4JL6A 5J4HA 1U0LA 3DO6A 5E7MA 3LW8A 1IONA 4DHEA 1IOZA 2DY1A 3UXMA 4I99A 4NHOA 3B60A 1S96A 4LYAA 2IC5A 2QAJA 4IDPA 1VHTA 1VYVA 2A7QA 3D3QA 1FNNA 3TK1A 1TAGA 4UJ3A 2ORIA 4Q4HB 3WBJA 4OJQA 4HI0E 1GOTA 521PA 1ZM4A 2W0MA 3JVUA 3ONWA 3C41J 3VAAA 2GZDA 3QQ5A 4Y0AA 4DDVA 4C0BA 4Q4JB 1E2MA 2ZRCA 4ZDKA 2VL7A 5EE5B 5DN6D 3IO5A 4AURA 1FQJA 1DO2A 1SXJD 2ZRPA 2IYYA 4LDJA 2CL0X 1XPOA 2R6DA 3DM5A 4IRUB 4KSCA 1ZD8A 4FINA 2GAOA 4JBWA 2QUZA 3BXZA 3T15A 3OZXA 1XMVA 3H2YA 5IK2D 4GZLA 3OIVA 2BKUA 1AS3A 3CRQA 4ZPXA 1C1YA 1OE0A 3X1DA 1QVRA 1N0VC 1T3LA 2GRJA 3EWSA 4IVRA 6Q21A 2FMXA 3B78A 2C99A 4KU4A 1KNQA 2JLZA 1ZC4A 4A8JA 3B9PA 3I1FA 4OQMA 2IYQA 4JVLA 3T5DA 4XOIA 4RZ3A 3SZRA 3FOZA 4PTLA 1NVVQ 1WP9A 2BHRA 3NVAA 1A2BA 5JFGA 2IF2A 2WSSA 2Q9AA 1W0KD 4PHFA 2WVJA 2ZUBA 3CW2A 1ZU5A 4B76A 2PLFA 3Q5EA 1FZQA 5TB5A 2FPKA 2Z5FA 3QBTA 1M34E 3K8YA 1F2TB 1YZUA 2FV8A 1E9DA 1E9BA 2A78A 3QVVA 4NU0A 5L3RA 4CF7A 2QAGB 5EP4A 4M8NE 2ZJ5A 3K9GA 4YONB 2B21A 3I5XA 1JAIA 3KQUA 5FPKA 4LV6A 5J40A 5FBLB 1N0WA 5CB6A 1VG8A 4BUJA 4PPQA 3DMNA 3KXLA 4EPVA 2ZRGA 2YWHA 3H1TA 3RS5A 3L8YA 5FUWA 4B32A 4XVUA 1M8PA 2KB0A 2XX3A 4YLGA 2Q21A 4PO9A 4MITA 2ZI7A 3L2OB 3RSLA 2XNDD 4X8LA 2R65A 3CZQA 1G18A 4B3BA 4TTQA 1E9CA 3EC1A 3QEOA 4Q03A 5LD2C 2QTVB 3ADCA 2OM2A 4OJKA 1CJUC 4UXJA 1SHZA 1R0YA 1Q1EA 1HT2E 5EE0A 3W6OA 1ZAKA 3LVQE 4XJXA 2V6JA 3O8DA 4QKQA 5FL3A 5KNCA 1RC8A 4CEIB 5L3VA 4XTCS 4PSAA 5DYIA 4Q18A 3E2IA 4ESHA 2O8CB 4TL8A 1YZNA 121PA 1Q20A 3LAWA 1EGAA 1BIFA 4AYWA 5HKKD 2HF9A 1KY2A 3E5HA 3LBHA 2ERYA 3P32A 1KSGA 1JR3A 1NL3A 1WE2A 3FFBA 3A4LA 4URYR 3AH8A 2IWRA 4LC1A 3ZVRA 1YHNA 4Q19A 3EWAA 1NN0A 5FL7A 3C14C 1G7CA 3QKSA 3RYTC 3D7MA 4G5OA 2JIZD 4XVRA 3D8BA 5J4VA 1TNDA 2QPOA 4Q1AA 5C1BA 2F7SA 4MGIR 1ONBA 2LCFA 1ZD9A 1OXXK 2QP4A 4LBWA 2OCPA 3UATA 4C4PA 1XJ0A 3HR8A 1S1MA 1F5NA 4LY6A 3HPQA 1ZIPA 2MSEB 1RZ3A 4EIWA 1YZQA 4BRUA 4OKSA 4GDFA 5GVSA 3ZVLA 2ODWA 3KKOA 1J70A 2FE4A 4OI2A 3KQKA 4RD6A 2WPDA 3B6EA 2FU5C 1NVWQ 2B6HA 1K8RA 2FFBA 3CPJB 4PC3A 3RS4A 3SBEA 4DDUA 4LYJA 4US1R 1EFRD 2Q3HA 1MKYA 3RVBA 4LRWA 4B73A 1DS6A 5DLQC 3TMKA 5IT5A 3AF4A 1SKQA 2RGCA 1NG1A 2C78A 4G5GA 4A6XA 1KI9A 4B75A 1T3SA 221PA 4PZZA 1VCIA 1ESMA 3ZYCA 5SZHB 5JCZA 4HZUA 5L3SB 1A4RA 2EFEB 2J9RA 1P72A 2NPFA 5F9HA 2PCLA 2MSDB 2OT3B 4OQNA 2DHRA 3AKEA 3A37A 5J4YA 1DTSA 3M6AA 1HTWA 3GLGA 4HATA 3WMEA 1PVOA 3EPJA 4A0HA 1XFAA 3LH5A 1W7AA 5D3MB 4ABYA 3LD9A 4G01B 4PSKA 4AY2A 4HB4A 2G3YA 1Q57A 4Z8XA 1US8A 1HURA 1GL6A 3KUDA 2CE2X 4XSHA 2PEZA 3ZIAD 1WRBA 4TLBA 1SXJC 2GJ9A 2JCSA 1GSIA 1N6KA 4JVSB 2IF0A 1XZPA 4Z54A 2H16A 3U3RA 3V4RA 3GJ7A 1PLJA 2ZAOA 4RZ2A 1UKZA 3WXMA 5FOWA 5FOTA 4BFZA 3LQRA 3NBXX 4B48A 1Z8FA 4QOSA 5P21A 4A8JB 3H86A 4GL2A 4CEIA 4E09A 4YMSA 4DDWA 3NHBA 2ZRDA 4WW0A 3UWOA 2QRNA 2OLKA 2ZETA 2G1JA 1NIPA 2YOGA 1BS1A 3BOSA 3ZQJA 3QVUA 2G77B 2P65A 2GILA 1KIMA 2VEDA 1FL9A 3K09A 1AZTA 1Z6TA 4B2PA 2D2EA 4A2WA 2WSMA 1U0HC 5EXXA 421PA 2OBNA 5EXTA 3TVDA 3A36A 2W83A 3KJEA 1TPZA 3PEUA 4NBSA 4PC2A 5JEEA 1QHXA 3EA5A 1JQJC 2PX0A 1QZXA 1EX7A 1N2CE 3FKSA 2XB4A 3PIRA 2JLVA 3IKJA 3NDBB 4JMPA 3K9LA 3B9QA 3KQLA 2RGXA 3C5CA 3MRSA 4IEIA 2GF9A 4M1TA 4ZCMA 3UIEA 4BFTA 5D3MA 3R9XA 2QROA 1OPXA 3QBVA 2V1UA 4LYFA 3BWDD 3R8FA 2KSQA 3DDCA 2ZSAA 5IRCD 3B2EA 1KSHA 1ZMXA 1CJMA 1M7HA 3MFYA 2EWWA 3A1SA 4NYMR 5G3YA 2REOA 1YZKA 4R9UC 1RVDA 1JR6A 1CJTC 3TE6A 2J0VA 1QHGA 1L2TA 3AVOA 1GZSA 2IA5A 1D6JA 4A4DA 2PMKA 4D4KA 4LK2A 4IDQA 3IEVA 3TGPA 1KK0A 1CRQA 4ERNA 1LS1A 3A1UA 1YRAA 3CF2A 3KZ1E 3P26A 4PQFA 2AK3A 4IW3B 2IYVA 2NG1A 4M9XA 2DCUA 4S2EA 4C2UA 4IXNA 2NZJA 3SQXA 4IOLA 4F7WA 1KJYA 1JALA 2GTPA 4BZXA 4I1UA 4WAUA 1U8YA 1IXRC 1YR6A 4CEJA 4L8GA 5FUYA 2QY9A 5HE8A 2G0TA 2GNOA 5HKKA 5B2ZA 3OIYA 5KPJA 3HP1A 4KODA 1S4QA 4A6PA 4LJ6A 2VP2A 4Q4HA 5CM9C 4R71A 3K0AA 1U98A 3L0PA 3QXCA 4B33A 3QXXA 1XPUA 3CUEF 1K5DA 4UXHA 3CZPA 3TSWA 3ZH9B 2PCJA 1II8B 4BFWA 2ZRHA 1UF9A 4YXWD 1T5IA 4DJTA 5K8UA 3K70C 3VFDA 3BH6A 3VNUA 3W6PA 5SZIA 1GUAA 2JLUA 5CB8A 1TX4B 2P6NA 3I4LA 4OK3A 1IAQA 2O8FB 2X2EA 3MD0A 4F4IA 4DT1A 2B92A 2HT1A 4HUQA 2CCGA 4NPHA 1D2NA 4DLVA 5J4LA 2RHMA 1G4UR 3AUXA 1VG1A 3KKQA 2PBRA 2BBTA 2WPDD 2V4ZA 5TARA 3NWJA 4NP6A 4HUQB 2HYDA 2V8OA 4LHZA 1D2MA 4LJAA 5FI1B 1GNRA 3E70C 1HEIA 2WKPA 1DELA 1KI6A
chains in the Genus database with same CATH superfamily
5LKAA 1WSAA 1CZUA 1ZUIA 3O94A 1Z9BA 1QPBA 4I08A 1ULBA 4R8MA 4Y18A 1GDHA 4AJ2A 2A8YA 3RS8A 1GZ5A 3H1BA 5A6VA 2XCQA 5IARA 2AMLA 1VA4A 1L8AA 3GLIB 2O05A 2DAPA 3DZCA 2QRKA 1D03A 4JGBA 1BE0A 1WCWA 1I0IA 3JZDA 1VDMA 4I14A 5H4GA 2QTCA 3TXAA 1CR4A 1HFJA 2NVUB 4WASA 2RJNA 3H13A 3O0DA 2XRZA 1R37A 3GARA 1VI5A 3M83A 1V95A 1K7CA 2NV0A 4JWTA 5BN5B 2M9MA 4AZTA 5CA1F 3DUFA 2IS2A 5IUNC 3R7LA 4UUQA 3C8ZA 4ZP1A 5AHXA 5T64A 4UQPA 3GFPA 1VLVA 3ZG6A 4AKTA 2IL1A 4TT3A 2H3HA 1YA6A 3MJRA 5JJBA 4N3BA 2XOEA 3OE1A 1B6GA 1K3TA 5C5DA 3E22A 2F9LA 3IMFA 5AMXA 5TDHA 1OROA 4MNTA 3WGLA 3L0DA 2X14A 1R4NA 1GA6A 2F48A 2G72A 3QWAA 3R41A 4D56A 1G5FA 1HQKA 1CUSA 3JVIA 4ZO7A 3W9SA 3ZE9A 3C3YA 3PUZA 4QT0A 4EKNB 1RI4A 2FN4A 5G0UA 2PYZA 1E3IA 1XIVA 2JA2A 2JDID 3IGFA 2PTHA 3KTDA 3LE8A 3OC6A 4S0XA 3T3HA 5JW6A 1GFSA 2FWMX 3D2BA 3PCRB 3STHA 4R2IA 4N0DA 1F2UA 3KKKA 4MRSA 3C3JA 4D42A 3HXTA 1N36B 3D3WB 5G40A 3PDJA 1X8KA 4DPMA 4HQOA 4DR6B 1HGXA 2P79A 4BVAA 1NVDA 3GVXA 1S89A 3FOEC 2ECFA 1WNFA 2PSEA 1L5SA 4KAAA 1EGHA 2B1JA 4OAQA 1RPNA 3H3JA 1SNYA 3W2HA 5DNAA 5ELMA 1BMFA 1J9GA 1T13A 4MDFA 2AOTB 7YASA 3M6LA 4IO1A 3U7RA 3MPUA 4I55A 4RTMA 3FYUB 4BJ1A 5K8LA 1UMKA 1JDJA 1VIVA 4DV0B 2AYYA 3QJGA 3L04A 4JLWA 5CLLA 1ILWA 1TF5A 2I4IA 2BM8A 3C5EA 3OKCA 3VOAA 3WL7A 4X92A 3H8JA 3P2JA 1SXIA 4OXNA 1AVTA 3ONEA 4JB2A 1J1ZA 4RHCA 1ODFA 1RI5A 5KVSA 3U7HB 3ORQA 1L4EA 1XBTA 4N03A 2EFHB 1C7RA 1TADA 1UJNA 2QRGA 3AVXA 4JKOA 2CXPA 2F8TA 4CETA 1Q14A 3E35A 4WACA 1G41A 4YFYA 9LDBA 3OWHA 3PRYA 4Y67A 2Q28A 3BD8A 3MRXA 4L0MA 4G8JA 1I10A 2BRUA 3UF0A 2CEAA 1XEAA 4ZALA 5H5JA 4O1IA 3SC2A 4QJBA 4EHAA 1IJFA 3BBPA 3PSAA 4MKXA 2IYOA 3CVOA 3CHYA 4NBVA 3F6CA 3QM1A 2Z6AA 1STOA 4BNJA 5KYXA 2XWPA 2PGDA 3EEOA 2GN8A 1QRSA 2P67A 4E31A 3C24A 2ZRKA 2OLEA 1ISRA 2DFKB 2Y8EA 1MQ9A 4ZEWA 2ONJA 4Z4QA 4GP7A 3SF0A 4RVHA 1Y3HA 2XQVA 2Z3VA 3R7NA 4F5EA 1I3CA 1CZNA 1Q91A 1GG2A 4C2BA 5CBPA 4HGRA 1FVOA 5C5CA 3DDWA 1M5TA 2CJFA 2K4MA 4IG9A 2AF4C 2XY4A 2WPNA 2AEFA 2DECA 2Q5JA 3A70A 4GO1A 4LQDA 2C5LA 3NHWA 3ITEA 3B7GA 3PC7A 4ZQIA 5EP2A 2FEPA 2Y68A 3SZLA 4CCSA 3H83A 5JS7A 4GE3A 4QLBA 4HAYA 2IP2A 3V8EA 3RRXA 2GF0A 4MKFA 1Z37A 3QEJA 4TQAA 3RVDA 4EA9A 3FGZA 3J80A 4FYJA 4MJLA 2HLPA 3UWPA 1T1GA 1U0EA 5E2IA 3GLFA 1CY1A 3IILA 3GK3A 2ZS7A 3PC2A 2UYGA 1X0VA 4S3MA 2A1UB 1ZLYA 2P9CA 2RAUA 2H2AA 2XBUA 2C1XA 2E1PA 2V7TA 2G9RA 3ILYA 4AO6A 1RBZA 1TRKA 3C7DB 2AK2A 2FF5A 3BE4A 2GVNA 2VPWA 1YJXA 4B3XA 2C7RA 3EGXB 3FPGA 4PYMA 1K6EA 5KTSA 1ZG3A 4BO7A 2QP3A 4QUHA 1GTRA 1MLDA 1SVUA 2OTCA 4BGDA 2DTXA 4TKUA 2CNBA 2ETXA 4I9FA 1RLMA 2RI1A 3EXG1 5EPOA 2GN0A 4IILA 3IAAA 3ZXYA 3FPKA 2ONKA 3F90A 3AVTA 2CHGA 3GWGA 4LZLA 3OZSA 2V0CA 1VPWA 1KWGA 1R4AA 2CFOA 1ZI6A 1Q6ZA 3Q9UA 3AW8A 4MKGA 1V5EA 2HGSA 3CRMA 3QGMA 2AG5A 2EZ8A 2K7FA 3SFZA 2J4DA 2OP1A 5I3CA 2XUKA 5FULA 1EVIA 4HAXA 2HXYA 3PR3A 5AUNB 1Z6GA 3JW8A 4WUTA 4F60A 1MRNA 1BNCA 2O7QA 3FB4A 3OCZA 1Z2NX 2R00A 1NPYA 1A7KA 4FFLA 4KTTE 5CCDA 4BVLA 4M89A 2AJLI 2P2CA 5KNBA 5HQ3A 2O59A 1CEEA 4R1MA 3E3LA 2QU8A 1EBUA 3IDQA 5TGDA 2HFJA 3RVJA 1JE0A 4BRSA 2WIDA 2M2IA 4H0NA 4L57A 3R7SA 1DG3A 4I5FA 3RIYA 4ITVA 2P62A 1CS4C 2CBXA 4J16C 3QPAA 1Z15A 4J75A 2PEYA 2XTNA 4HGNA 3P2IA 1FYXA 4KR0A 4MWSA 3GCGA 2Q5FA 1K6MA 5JZBA 2JANA 2RHRA 5KC9A 3JQ8B 3QKTA 4R0MA 3CRW1 1I0ZA 4UMDA 5HCNA 2WWVD 3ZKWB 4AJ9A 1NKTA 3RBZA 2JASA 4ENRA 1QCDA 1EGVB 4Z6KA 3SHVA 4HZIA 1Q15A 1C5KA 4HPWA 2Z09A 3W79A 5KDOA 1BCRA 1QWSA 2NYUA 4UAJA 2CY0A 1M1YB 3FGOA 3N2LA 3OEYA 2GDZA 4IYRA 4LHEA 3A10A 3IVAA 1VSTA 1T5OA 3JQ7A 3JYNA 4HEQA 2VF4X 2C2GA 1M2OB 3JQRA 3ZBUA 2NYRA 4QT4A 3AUTA 5BPFA 5JFOA 2PO5A 2XE8A 4CMJA 1K7FB 2VYND 5AK0A 2FFQA 4R84A 2NU8A 1I9GA 3QLEA 3EDRA 2GHTA 3G9TA 1Q5PA 1NLZA 1GIAA 2VATA 2P9HA 3SEFA 2VT2A 4YAUA 1Z8DA 3QELA 1QMPA 4YT2A 1C8KA 1UBHS 3UMJA 3E4DA 3HEBA 5DIFA 1P1JA 3ROGA 4GP6A 3DFIA 2BONA 4HSEA 4GR5A 4QG7A 3HR7A 1GV0A 2BR4A 4NE7A 5K4AA 4WCVA 1UDWA 1G291 1C9KA 1Z2OX 4LSGA 1T6XA 1YL5A 2FDRA 3DAHA 4AQYB 2PG3A 4MR7A 4GOJA 4B0PA 3OU7A 1Z5OA 3I23A 1SCUA 2Z2ZA 4PPGA 2H5LA 2WWHA 5HF8A 3DZJA 4CGZA 5JCOA 1ZIOA 4PSUA 2CYAA 3F8TA 1A8SA 1Y8RB 3WGUA 2AKAB 3U6BA 2JD0A 3C3KA 1BDHA 1U2DC 4DA8A 4GMXA 1PU2A 2MINA 1VCHA 3PITA 3WP0A 2ACWA 5G3ZA 5D84A 1BE1A 2H4YA 5IS2A 4BVHA 1P33A 3OD1A 4J03A 3MJDA 1Y7TA 2O3RA 2ATVA 2IHTA 1FFBA 2VEOA 1NMQA 3PIIA 3BK2A 4NFSA 4LXYA 3W3AH 2C61A 1OXBB 1SH7A 1LK5A 3NASA 3KSUA 1F3OA 4U8GA 3TZEA 1FU8A 3P97A 4ZHQA 2EFJA 1BH2A 4X45A 2NZUG 2NO6A 4BEVA 4UNNA 1DCKA 4B2YA 3M4XA 4LRSB 3ZBPA 1MQ8B 3IHWA 4XPIA 5FH9A 5A62A 4POOA 3QXSA 3L4BC 1FUKA 4M46A 1CHNA 1J7JA 2BOVA 3IR7A 4KE6A 2Q7DA 3SVZA 3WYCA 3MIZA 1TTQB 1QORA 5FOUA 1NN5A 1E0DA 1L9XA 2IPMA 4DB2A 2ADFA 2G0AA 4X6UA 1WX1A 1T9KA 5AKHA 3TEMA 4YVFA 3S1AB 3VZCA 4DJAA 4DV6B 4JBLA 5CDTA 2WWIA 3E8XA 3JQFA 1T2AA 5DX8A 4DCPA 2ZR0A 4LWQA 2VI5A 4XA8A 5K3BA 1QGYA 2HXSA 2VXYA 3NKVA 2OP0A 3OURA 1NE2A 4F93B 1G6HA 3LI2A 4Z1MD 4C29A 1U4OA 4Q3OA 1KOFA 2H1HA 2PS1A 3FYTA 4M36A 4A3SA 3S2YA 2AX4A 4Y3UA 4U7JA 3D7KA 4CQMD 3EUWA 1WPXA 4YR7A 1LX7A 1D0SA 2OGSA 1AV7A 1U9IA 4BEJA 4JEIA 2HRDA 2JF0A 3D1VA 4RV5A 2P78A 2FZ5A 5DLYA 3ZUGA 3IODA 3MELA 4HLQB 5C4GB 4X44A 3UUWA 4KJZA 4LYHA 4AMUA 4D3XA 3RYCA 3TIXB 3D8UA 2GPTA 5A02A 3F73A 1P62B 2YJ5A 4YAFA 1DAEA 1XU4A 2AQ8A 4EPVA 4Q93A 4HKTA 2WMNB 5HS6A 1ZYUA 2WM2A 1WMSA 4LDNA 1ABBA 1PL7A 1KO5A 2JI7A 1RWVA 4HOYA 4Q7KA 5E0OA 3S2ZA 3L7DA 4MV1A 2BFWA 2X9QA 2CXOA 3HYLA 1NHWA 1OHHA 3GJXC 1HXHA 3G89A 1S2LA 3F2IA 5DULA 5FFFA 3EBOA 4BX2A 4PIPA 3OIFA 4ZTBA 2H17A 5LPNA 4RCVA 2OK8A 4ALJA 3SJCA 1FUUA 5HTKA 1R9GA 2V6GA 3HZOA 3PPIA 1QIEA 2C2MA 2OO5A 4ALMA 2I2FA 2WE8A 4IF6A 1V8FA 3OIWA 2YV3A 3E9RA 3GPDG 4B2IA 2RGNC 3DE6X 1K8XB 5JVDA 2FX2A 4R0NA 2YVKA 5IW8A 3TL2A 1IUNA 2EYQA 2RAPA 4D0NA 4PS0A 4HB2A 4E22A 1SCIA 2R0QC 2RGUA 1O9BA 2UVPB 5JXJA 2I7VA 1EHCA 4JJ7A 1ZJ6A 5T4HA 4COOA 2QBYB 1E89A 2EJUA 3BXGA 3KD3A 2F1RA 1AXEA 2WWRA 5KNBH 3P9RA 1JSXA 1ZA2A 4DA7A 1M1XB 4J1TC 1PHRA 6YASA 4I8IA 3C1AA 4UDNA 3UJHA 1TM3E 1U63A 2XBMA 1GPKA 2MSKA 2G9QA 3GV0A 4JAVC 2L19A 1U5BB 3H6GA 2H52A 1E3QA 2HAEA 2XMSA 3QTLA 4PZ9A 2P9GA 4MMYB 4CRWB 4MRMB 1LLQA 2ICAA 3T38A 4JI5B 4NATA 3PEWA 3ICQB 1BCSB 3HXPA 4WD3A 1AMOA 4EGJA 4ZT5A 3HKCA 1DIRA 2BJWA 5G41A 3T99A 3ED1A 1H3EA 2AE1A 3HVJA 2ZIEA 4CQNA 1V6SA 3G5LA 3QV1A 2HCJB 1E6LA 4AMVA 4YCNA 1WDTA 3ZK7A 2FUNB 2MSNA 5AM4A 1E6MA 3UKDA 4X6YA 2QZSA 5AWFC 5ENZA 1FX0B 2COUA 3VAYA 2BTEA 1ONSA 4DDTA 4CQMB 2DEUA 4C7BA 3OOSA 4DKJA 1CQXA 1CDEA 2PXHA 4NWIA 4ZT6A 4BTLA 1AN9A 4ZO6A 1PQUA 1U3TA 4ZDIA 5IBCA 3JVEA 3WGQA 1N78A 5BV0A 3FCAA 3TK1A 2B4QA 1E96A 1KYWA 2AA3A 3CLTD 1Q7GA 4C14A 4ZHSA 2IFTA 1NR7A 3DGEC 3H99A 4IQ8A 3LUKA 2XUZA 5E9QA 4B43A 3H16A 3ZWOA 1JQ5A 5ER6A 1M2WA 2P6PA 2DFVA 2DBRA 3B36A 3TW6A 2O7SA 1X1CA 3G0GA 2O8BB 4ZU1X 3VC2A 1AF7A 2H1WA 4FHCA 3O9VA 4GX5A 5IFKA 2C2XA 3ZE0B 2F3RA 4Q0MA 4MRAA 3CIOA 1QOQB 3KM0A 1FP7A 4FGLA 4TLAA 2DPYA 4F3TA 2P35A 1YDWA 2IXDA 4BV8A 5I01A 1K9SA 1NRJB 2J5XA 3QVLA 1GNSA 1QU2A 1QO7A 3OJXA 4BYMA 4R81A 4M53A 6ADHA 3LO5A 2B61A 3LU1A 3EFBA 2FTKE 2WFMA 5CM8B 4R3NA 3NM5A 5FWYA 4QYMA 1I1HA 2IZZA 2XYQA 4DMRA 4QSHA 3ZCXA 4QUJA 2W93A 4N1AA 2Q1UA 1TPYA 3G2HA 1A27A 4ITRC 2D1FA 4BNVA 4IIBA 3RUAA 2OWEA 3L1IA 2V1XA 4HAIA 2YVLA 4JIMA 3MTAA 1E7YA 1VE6A 3DEYX 2JLAA 4JJFA 3W1WA 1R12A 16PKA 4B47A 4F04A 3DBHA 4C0LA 4HDCA 5ADWA 3TEJA 1AGRA 2OO5C 1T5BA 3O1LA 1B14A 4I2VA 1N6RA 2MCFA 1RM4A 1H05A 4D8XA 1GLGA 2Q0SA 2SCUA 5F9MA 3VM6A 2WICA 3VI3B 3B2QA 5DLPA 2FA9A 2C2YA 1RLIA 2UAGA 1QGUA 4UVEA 4E4YA 1Y4ZA 1RAAA 3UK2A 2VP4A 1YONA 1WKVA 5DYWA 5AJYA 1O87A 3GNSA 2PVSA 4ZCQA 3K0CC 3NYWA 2ZRQA 5FTWA 1AQJA 4GRDA 3T3EA 3DE7X 3L1UA 1E2FA 2Y2VA 4MDYA 3DWFA 2YW9A 3PQ4A 4INAA 3EA4A 3OF2A 4Y30A 1JMYA 3V1UA 2YKGA 5KUTA 2XNSA 1HT1E 1TCVA 1U7OA 1PWZA 3RUEA 5K9ZA 2W70A 3FR7A 2NVWA 4PWYA 2ZPUA 4UHBA 1Z2PX 2ISSD 2VUIB 1GGEA 2AR0A 3R3UA 4RCZA 4DSAA 4F97A 4JXZA 3W8RA 3VJLA 4R7ZA 1M67A 1YE5A 2JEOA 5GINE 3QVSA 2B35A 2ID8A 1QANA 1QQ5A 2HN9A 3N2GB 2W71A 1TUGA 3H4VA 1EVEA 2IODA 4Q9LA 3O26A 5DT2A 1X3SA 5JE8A 4A27A 1SHLA 3IV7A 1MC4A 1Q11A 1U0GA 3JTMA 4XQEA 4XDHA 2C7QA 1R66A 4K40A 2YKQA 1LF5A 2VRCA 2F1OA 1GNLA 3IMGA 4ZVNA 3ZGXA 4JNCA 2IPAB 2ZYDA 5CXXA 1Y6FA 3BORA 2FPUA 4LY9A 1QTQA 1UMBB 3LKZA 4N5HX 4URHA 4J9UE 3PQ8A 4J3JA 4QUGA 3QA3E 4AS1A 1XTKA 1FTNA 4MQ5A 3HBLA 5ENVA 4K9DA 4DCSA 3GJTA 1SMKA 1CB7A 3JAWA 3QVGB 4RKYA 1A9XB 3A3KA 1M7GA 1ULUA 1RACA 2FGKA 2CL7X 2OECA 1R8JA 3K72B 3EIXA 5HA5A 3TJRA 3TLJA 1MORA 1XQVA 2QENA 1P7WA 1I7QB 2FWNA 3ONNA 1KFBB 1LBQA 1QDLB 1SC6A 3EMDA 1OH5A 3C6XA 4GFDA 2PNFA 4QX6A 1OQAA 2X3FA 3GFFA 3LT5A 4WKBA 2HJSA 1RRVA 1LQTA 5KYXB 1I30A 3ANNA 3AUJB 1XTSA 3QEMB 5U4XA 1YTLA 1QS0A 4N49A 5MN6A 1WEKA 4E21A 3AO0B 4BP9A 4EFKA 1VJ1A 4AULA 4I9HA 5BYBA 1AGYA 2WVGA 2QUKA 3O8RA 5EP1A 3PQ2A 5ITWA 3OEED 1IUKA 1SG0A 3QPVA 1M10A 2BMEA 3C98A 1PFUA 2BEJA 4DWVA 1QIFA 4UUBA 1YFJA 1DXQA 4ER7A 2BFFB 4J0IA 1ETHA 2TS1A 2R6ZA 2VF8A 3B1WA 2AFIE 2J3EA 3U3ZA 4OXIA 3ZU5A 1Q0QA 5FPQA 2JCGA 1QSGA 2QUIA 3CINA 4FFBA 4EMBA 3DBIA 1T4GA 1U31A 5ES4B 4LF5B 2QSZA 3KZNA 3PIDA 3V1MA 1FDIA 2L17A 3GMIA 2QLMA 3JALB 4ESOA 5DI9A 1U7XA 3FPCA 3ADKA 3KSBC 1WA5A 2ZI5A 2PZGA 3AR8A 1GHTA 1SOAA 3MYYA 4BJ3A 4YMHA 4Q9KA 1OX5A 4Q01A 1EG2A 4RF5A 1RYEA 2QVCA 2YVAA 3LOUA 1KQNA 3ZDAA 3Q3GE 1FE8A 3CMCO 3N8HA 4V02A 1UDBA 5CA1B 3CNLA 2ALJA 3LGSA 1VHWA 3KSAC 5BSRA 3M6IA 4N01A 2HU8A 2Q1YA 2CXSA 4NX2A 2A58A 4QXOA 4UBJA 5SICE 2OLJA 5KX5F 3CN9A 3N5CA 2I55A 1LPNA 2B20A 4K9MA 3SJ7A 1UBLS 1UPAA 3O31A 3P5SA 4TM8A 5B1DA 3M6WA 5H80A 1I4EB 2DBZA 1SQ0A 1XVUA 2RGWA 3GRRA 3WYAA 4W9NA 5KTOA 1N7IA 1Z38A 4XZ3A 5JVDB 2FQYA 2HF2A 3CQ9A 2QTGA 3EIUA 5LFAA 3T7DA 4R9SA 3A9WA 3G1WA 3GQBB 4O2LA 5JAZA 4PYLA 3IUBA 1QCYA 3NIWA 1GPMA 2VHUA 1XQ6A 1TCCA 4M8LA 4EG4A 1H8EA 4XX0B 4US0R 5EZYB 1W4CA 5B53A 4BVKA 2DTEA 2HA6A 4I5DA 1XL0A 3KC2A 4MEJA 1GT91 3T7SA 3C6YA 5FLYA 1TD1A 2HBRA 3EZ9A 4Y0VA 3W5CA 4HHEA 2P0AA 1KIFA 3HUTA 1MAUA 1BWPA 2Q8QA 1NMZA 1M2GA 2H8GA 3BCRA 1RE0A 2JZCA 1XGKA 3TSCA 1KDPA 3RYCB 5HGJA 2ZBEA 2YXBA 2PS0A 3DEFA 3K8QA 3I5UA 2C88A 2FRVA 4CQLB 3DBRA 2B7BA 3LCVB 4TVBA 3UO8B 2BGGA 5T4FA 3L0YA 5I7OA 3X1WA 4BWYA 4C30A 4FJ2A 4HWKA 3RBAA 1RYYA 3USES 1UEJA 4M1YA 1GRCA 1TD9A 4KVFA 1F0KA 4CV1A 1T8TA 2R2GA 3CRZA 3X2FA 2NYAA 4OSEA 5JNWA 1FMFA 1RYHA 1FTSA 4MIEA 4PYKA 621PA 1NE7A 2CVPA 5E6UB 5TV2A 1SQ5A 3PQCA 5ERXA 3KKPA 1DRUA 1Q1QA 3QH4A 3VR4D 3UTCA 3BRWA 3ZWBA 2VQFB 3AJRA 1NUSA 1R9JA 3ANLA 2H63A 1QQAA 2EGGA 5JBQA 4JI8B 3N8NA 1ZJWA 1ESNA 2QE7D 3RFTA 1P0CA 3A9VA 5KOJA 1LPMA 3OU2A 5BSFA 2HTFA 3L4BA 4X1YB 1NIJA 4C89A 2V7QA 3NW9A 1L7VC 5KVCA 5FBQB 3V5NA 3ZDQA 2IHVA 3I8SA 4JR0A 4EUEA 3EARA 4HRAA 3EH2A 2P8JA 2QI9C 4JFRA 5G1OA 3S6JA 4D8VA 4RK6A 4HEA1 4ZCPA 3NTUA 4QU8A 3PRHA 3AILA 3OLVA 4LUCA 4OO3A 4OREX 1SKBA 3Q3IA 4G07A 3AHHA 5DTJA 4BQNA 5MFPA 1OKKD 2H9AA 1CJVC 3LDHA 4JUIA 3B1XA 4RFSB 1C29B 2TMKA 1G19A 1QAMA 3T12A 4E15A 2VDUE 3OE5A 3EAFA 3H3XA 3A6KA 1PJLA 3P7MA 5EZSA 4DR4B 4PX3A 3V2UA 3BFJA 3LY8A 2XWSA 1H22A 1N1GA 2CJWA 3FSGD 4IJ5A 4KQEA 1PT9A 2DQZA 3VYUB 5J4KA 4O4JA 5F5LA 1F3LA 1B6RA 2GA8A 3JD0A 4PLCA 3GMDA 4QDZA 3T35A 1CJCA 4CF5A 1ZK3A 4J0GA 4FDAA 2NZVG 2W98A 2EJTA 2KS6A 2R8YA 1BXRA 4KXQA 4S35A 2FGJA 3KWLA 5LYJA 4YMUA 1RPZA 2X2FA 8OHMA 1V16A 3A1TA 3GY0A 5CPFA 1GA4A 1K3FA 4KN6A 2O14A 3OMLA 3VR1A 3ZI7A 4OHCA 1ZGZA 1OASA 2IEGA 2RONA 4ND7A 1JDVA 4WXHA 2P2ZA 5LBIA 3S8MA 1EGQA 1MFPA 2DT5A 1N8TA 2H2FA 1CFJA 2VG8A 3O2JA 1TC2A 4GT1A 3M2TA 4H7HA 2V54A 1K8ZB 1GPH1 4BMPB 3H9QA 4CM8B 3IQIX 3B3GA 3OFVA 4JY7A 1QC5A 1FFHA 1SOWA 5JAIA 4JL5A 1E1QD 2VAPA 4RADA 4PYJA 2Y0PA 5FP0A 2GPSA 3I1YA 2HRBA 1MP0A 1RLOA 4H9GA 4WADA 2H48A 4F85A 1FY2A 2RGRA 1JU4A 1Q1NA 1UPXA 1V9SA 3FAZA 2JVJA 2NZYA 4JCCA 4TMTA 3TW0A 3ORFA 1VL1A 3T6KA 4YJ2F 4GPTA 3QFCA 5T7BA 3PHCA 2RIRA 5E2BA 3TLGB 4AUMA 3RYIA 3ZS8A 1Z6XA 2ZXFA 4GI5A 4NU5A 4Z0NA 2JH8A 3CONA 2K2WA 3I2YX 5KPDA 2IKSA 1BXZA 2YMLA 1CDDA 2J6HA 4B4OA 2AT1A 3EW9A 1JZTA 4OVKA 3VPDA 4E7OA 1E2HA 1SRQA 1TF2A 2JK0A 3OZGA 4IJUA 3INNA 3UPDA 1XTIA 1ZESA 4D02A 4EITA 4K8OA 1ECGA 1NNLA 2PD6A 5D5QA 3UJ6A 4CLXA 5L3QB 4O1HA 1L8QA 4K05A 3CUWA 5BP7A 1NNEA 4MRPA 2I71A 4PIMA 5DW3A 4GYKA 3V4PB 5JARA 3TI9A 1C41A 2QQFA 5E4TA 2NU7B 3L01A 5IVIA 1A5TA 2N1BA 1YS1X 1EFUA 2BMDA 3E9CA 3IP7A 2FY8A 4ZZ1A 4M1WA 1JILA 1Z07A 1WUIS 2LUOA 5I7RA 3IERA 4NZPA 1PL6A 1YR2A 3U4CA 3RNOA 3BQNB 1U04A 2IX9A 5FNVF 3IT3A 5TQ2B 3WV5A 4Z7OB 2ZXUA 3BE5A 3KZMA 3R3YA 1CNMA 5IASA 1KI8A 4NOLA 3VZSA 1U28A 4EJ6A 1GTSA 4NV0A 4G5HA 1ZBQA 3B12A 2Q7OE 3WGYA 5B6PA 2VAMA 2GXSA 4OXRA 2VH1A 4G0YA 4BBPA 3UBTA 1I7LA 2UUCB 1VRVA 2F1IA 2G4VA 4ZCLA 1H9AA 2BI7A 2EIXA 1TYBE 5IC6A 5B4UA 5IJ0A 3CKMA 3G0CA 3DXXA 2XZOA 2I22A 3KV1A 4JC8A 5G1NA 3WKBA 4LV5B 4YMGA 2FEWB 1JEQB 4RETA 4DARA 1EDOA 1KSFX 2QNBA 3L6UA 2FZ4A 2A9JA 3SGLA 3GZJA 1CS0A 3IP9A 2IU6A 1WZIA 2WJAA 4QREA 1Z82A 4P82A 2Y76A 2J09A 4QRDA 3ESAA 4GG1A 2F90A 4DIDA 1ZP6A 3DA8A 1N2SA 3KOWA 4DJFC 1Y9JA 5ALHA 2M1ZA 2XOXA 4OLAA 3IE2A 2AN4A 1JU9A 1MPTA 1CB0A 1F12A 5CIQA 4F3YA 1V43A 1L4UA 2R4QA 4J0KA 3EQ2A 3KZKA 2GPBA 1B0UA 1EU1A 3FROA 4M60A 5ILGA 4GBJA 2VYCA 4A9AA 4F38A 3U3DA 7ABPA 4ZOLF 3SYMA 1RWNA 4FKBA 1Y3AA 2HDHA 3SHFA 2GCOA 5IJ9A 3NBYC 3DZ8A 2OFFA 4LZJA 1E62A 1K0FA 2X1VA 5HR5A 5EMMA 1XCMA 4BE9A 4EJSA 2X8JA 4BHTA 4FOTA 1PQPA 1PFWA 3IP6A 5HIIA 3THYB 1YRLA 4TMVA 4ZZ2A 4M1SA 4GKKB 3AL2A 3ICEA 3U48A 4H1TA 4NZOA 4K0RA 1KAEA 1SZJG 3PC3A 4LRXA 4KXWA 1YIAA 1S9HA 2QJTA 1JJ7A 1UCFA 3GD7A 1HDCA 4BV9A 5BORA 1T2EA 3WIBA 3BRWD 3ETCA 3QEMA 1QQ6A 3GFGA 4N5DA 3EZ2A 4EMSA 1R5BA 3C5HA 3HKBA 4UEWA 4OHYA 2W2NA 4JODA 2QE7A 2BGKA 2E3JA 3LMKA 3PUWA 4JA0A 4QOHA 5BQ5A 4EA6A 2WILA 4Z0HO 4US2R 4YMVA 3LIPA 3ZV5A 1UPTA 3IAEA 5EJAA 5DHTA 4O29A 3RTEA 3M9XA 1VMDA 2AFHE 5LJIA 3B5EA 1NF3A 1UUFA 2QJOA 4AJLA 4MWZA 2VYVA 4UJ5A 4TX1A 2NUTA 3CE9A 2XZDA 3ANYB 3K4HA 4ENPA 3FNFA 2D0IA 4BE7B 2L82A 4KHZA 3B1FA 2Q5EA 4O0MA 1PR1A 4RK0A 2QR5A 1GDDA 3FYUA 3NHLA 4I46A 1TMYA 4NULA 1N32B 1CUIA 1ULZA 1KAGA 4EYGA 4L95C 3DTVB 1DC4A 1I32A 1KFCB 2R6HA 2J33A 3LUGA 4Q66C 2PX3A 4FHFA 5I51A 1YL6A 2IYTA 4TLLB 5AVOA 2Y71A 2I4RA 4NFLA 4S1WA 2FLWA 2NXJA 3F6YA 1NI3A 1JV2B 2AQHA 4BZZA 4XYEA 3CXUA 3ZZ1A 2GXUA 5EMHA 1M6YA 5LU9A 2H5EA 3E5NA 3VOTA 1K7SN 4LHYA 4MOWA 2WAYA 3E22B 4Y9SA 1XYVA 4GSLA 4BECA 3C3AA 1HDIA 3WFZA 1FW6A 2QMEA 4J4HA 4H0CA 4MJXA 1KFKB 3JQAD 3VKHA 2WU3A 1CUUA 1T2DA 2AYZA 1PFKA 4C88A 3CTPA 3V8RA 3H5WA 1G8JA 4JEUA 5AJWA 1DAKA 1EE1A 5DI3A 1WMDA 3L06A 2J3DA 3UXEA 1TMGE 1RJ9B 2EFDB 2QT1A 3WWCA 1ZPDA 2XAAA 3USCS 3L18A 3O74A 1ZM2A 3IAHA 1TA4A 2IH4A 5EE1A 3S44A 2VNHA 3CV3A 4IHQA 2HIAA 2GD1O 4RLHA 3MC1A 2WUVA 3OTWA 1NI4A 4UEQA 4WJLA 3DP7A 3U5ZB 5IVPA 4DLSA 3A1FA 3K05A 4H27A 4OOEA 2CL5A 2B25A 3DJFA 3E82A 4I9UA 4DQDA 4L4ZA 2ZB7A 3DLAA 4ALLA 4CJXA 4RTRA 1QM5A 1QH8B 1S8FA 2A0UA 2VXCA 3JYLA 1DKLA 3MT9A 4AUEA 3HJBA 2FYTA 3F67A 5AW0A 2HL6A 1ID8A 4WKPA 3IP8A 2NUBA 3DCJA 4MUIA 4OMUA 1R0CA 1E2GA 1OTYA 1ZM7A 3BB1A 3E18A 4MHSA 5FKJA 3UTDA 5I9LA 1J99A 1NBEA 5KQRA 2PZMA 2YC4C 1TJ5A 1XTPA 4MAFA 4WY5A 3WYFA 2EX1A 4AO7A 1T5LA 1NXTA 2QV7A 4BNKA 4UKDA 3R3HA 4EKEA 3E9MA 3N0XA 4UFOA 1NDUA 1YK0A 2A33A 3GLSA 4IPTA 4RACA 2BSXA 1RFLA 8ADHA 2QW0X 1Y4AE 1LDEA 1MD9A 3Q5GA 1THMA 4RMNA 3E8MA 1P9RA 2QX9A 1U94A 5JJCA 2CSUA 2FKNA 3DOOA 4I55F 1I7DA 5IZCC 2ZU6A 5EXPA 4LMBA 3RC8A 1EAYA 1ENPA 3KXIA 3Q3CA 3ZD7A 3FNIA 3UKOA 3OKAA 1UAGA 1M2KA 2WBLC 1NJ6A 2O0KA 1PT5A 3A31A 1EFVB 2Z83A 2QRHA 4REQB 2JRCA 3LY5A 2HXGA 5FI0B 2F1HA 4I50F 5I9TA 3F71A 2G67A 5JHHB 1C8VB 2YXDA 3N5KA 1MT0A 4EB6A 3RSFA 1OX4B 2HFKA 3HB0A 4J16A 5AHKA 2QP9X 1O7JA 1P7YA 2K87A 3CZMA 1CV2A 2UYYA 5ELXA 1CLUA 4KGVA 4B84A 2IZ1A 3E9ZA 2CDAA 2JGIA 3EDMA 1KY3A 3IUEA 3LX8A 3PXXA 2JFOA 2O3JA 3DKVA 3WRXC 4KDRA 2FW8A 2Q4DA 8AT1A 2WJ6A 5JSKA 1UJ2A 3BTUA 1XXHE 4ZOLA 1AIPA 4H4CA 1VMIA 4LCEA 5I7FA 5F9FA 1JKFA 1ZJZA 3FCEA 3QLUC 4HZGA 4M38A 3FX2A 5DM0A 2B0CA 1BW9A 3U0VA 3R6WA 3MJFA 1ZN7A 4KB5A 5ER9A 5FJJA 1FX0A 4JD5A 2D0DA 2JS7A 3RU2A 4D82A 1OT3A 5DMXA 2C42A 3EBLA 2EATA 2ZKIA 2YCLA 3SQOA 3WP1B 1XAIA 4TMXA 1R10A 3GJ8A 4AZWA 2IT1A 4JLBA 2O50A 1KI1A 2B37A 4LE2A 1Q17A 5LZ5A 5BSMA 4RIEA 3HXMA 3OCVA 4YRJA 3F0TA 4QEKA 2WD7A 3RTGA 4AKHA 3VKVA 3DLHA 2ATEA 3SC3A 3P9XA 1UWVA 4R31A 3WWOA 2C9ZA 1MAWA 2M32A 4XEHA 4Y7CA 2Q46A 4IHJA 5K8CA 5KREA 1LNZA 4EY6A 4HNAA 1X1DA 3STVA 4JC4A 1U65A 1A8IA 2VPIA 4RZUA 1YI8A 3QX8A 5C52B 1JPNA 3LHDA 1IXYA 4G0NA 5EE9A 1Y8ZA 4YALA 4U7GA 3GLVA 3DCNA 3ES9A 3N2ZB 4HR7A 2JJ1D 5FAXA 5G4LA 1XHEA 1L4LA 4FW8A 4WXEA 1EFDN 1T8YA 4NHEA 1PVVA 3PHHA 2GWRA 1EQUA 4ZZ0A 4KSBA 3NNDA 4PNHA 5DPMA 4ZV4A 5F4BA 4B3SB 1PRYA 2WT8A 2QMZA 2ZBQA 2Z2IA 2G70A 4Q3KA 5K6RA 1KNXA 1MR3F 1RRKA 2B94A 2QG6A 3ZCTA 4F4DA 2Y3IA 2YJ4A 1JIUA 3LC0A 5C1DA 1FUYB 2BCEA 4LISA 4JL8A 1ORWA 2OG1A 4FJ1A 4URZR 4B44A 3PC8A 4FCVA 3SP1A 2PFGA 1V5GA 4N5NA 1T9AA 5K3CA 3Q9SA 4E2WA 3ENQA 4DEXA 2OGWA 1K68A 3CX6A 4LSZA 5JTTA 4DXHA 4G5SA 2Q1WA 4G0MA 5LP6B 1VHJA 3LZDA 1KQ3A 1LDYA 3SLGA 3FVVA 3E81A 5AVZA 1H5UA 1BW9B 1ZGCA 4MK4A 1OV4A 2WKSA 3EB9A 3LKBA 1GDTA 3C48A 2PUEA 1K5GA 4M9QA 4MGHA 4QYIB 1I51A 1JT9A 1V5WA 1R8SA 3K6KA 1YVDA 4G1UC 4RDIA 3HV2A 3TQTA 3HVHA 1JDZA 5T57A 3UT5A 4IIFA 2B6NA 2WWGA 5A3SA 1CVRA 2D1SA 5DVZA 2YWRA 3PDIB 1JG1A 1F0PA 3WNZA 4BE4A 1KEEA 3INRA 1PT6A 2O8FA 1Z4MA 1VJ5A 2QUHA 3PU6A 2ZS8A 3QU7A 3DOCA 2J7KA 2QPAA 2BKAA 2QM7A 3FCCA 4IIJA 4UUNA 4WLNA 5JHGB 1MX3A 1Z0AA 2Q99A 1EFAA 1GAEO 4BWGA 4UHJA 3CLUD 1SXQA 5K3DA 4DADA 4KUEA 4UCXA 4BCCA 4BQQA 1RWKA 3GVIA 3M6XA 2R1TB 4F1WA 1JR3D 4EY8A 4EL0A 1TTTA 1O5OA 4CIVA 1X1AA 3C2QA 4E1VA 1KH3A 3RSOA 3UA3A 3M4YA 3TQSA 4N8DA 2QXTA 2PX6A 3GJ6A 1PFYA 2NO7A 5FL7D 1KYVA 3KSZO 3WO0A 4YGYA 4TXHA 5AI4A 2HMSA 4RA9A 2GSWA 1ECCA 2DQSA 2PKQO 3QXGA 5H1YA 2FEKA 1DUIA 1RTKA 1X39A 4INZA 1FXSA 4GR4A 4FN5A 3ECAA 3EXFA 2GZMA 1OWLA 3OI7A 2O5CA 2G1KA 3G8YA 4RLFA 3LS2A 4Q9JA 3C39A 1EWQA 4HDMB 5BOVA 4OU5A 3SZMA 3ESBA 4OI0A 4ND2A 4Q7QA 5T41A 5JC1A 1XX6A 1HR0B 4UMVA 4MIOA