1UBEA

Msreca-adp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 86
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubeA01
4ACBA 4QBHA 3U60B 2J0SA 1NMXA 3KB2A 4U5XA 3AVUA 1EG7A 1P75A 3K70D 3FKSA 1YZQA 2DCUA 1E9DA 1L7VC 4EJSB 1S2MA 4LV6A 1E98A 1T3SA 2RGGA 5IK2A 2A7QA 1LV7A 1W5TA 1W5SA 1II8A 4B34A 4TSFD 2XB2A 2FSFA 2J46A 1T3LA 2GJ8A 2Q9AA 1S8FA 5B64A 1ZM9A 3HR8A 3IEVA 2DYKA 3CB4A 3U3RA 1NVWQ 3M0EA 4NYJQ 2P3SA 3NBXX 2IYYA 4LUCA 4IVQA 3AP1A 3ZD6A 5KHOC 3GJ6A 1ZRHA 3FGNA 5DLQC 4LI0A 4EPVA 3QF4A 4QNMA 1ZUIA 4TMTA 3WXMA 3BBPA 4OJKA 2OXRA 2ZU0C 1OIVA 4A2WA 4GFDA 2IYSA 1Z2AA 3LA6A 3DDCA 1M7HA 3SYLA 3LRPA 1XJ0A 3T1OA 3F3YA 3JVUA 1R7RA 3TBKA 2DFLA 4RFVA 1W2GA 3BB1A 3IBYA 4HUQB 3CW2A 3O47A 5KOYA 2IK8A 2ZJZA 3QUSA 1KAOA 3IIJA 4L8GA 2GILA 3W5JA 4Q4JA 4UNNA 5FL7D 3QSYA 3VKWA 5FOUA 2EVWX 4G1UC 4QHSA 1MABB 4LYHA 1P9RA 1UADA 2QE7A 3U6BA 4ZPXA 1XXHA 4BZQA 4QRHA 2A5DA 3GLFA 4MITA 2ZJYA 4S35A 5IDVA 4DT1B 2BMJA 4EFMA 4XOIA 1OPXA 4R2HA 4ZKDA 2VP0A 2Z5FA 2P65A 2IC5A 1GM5A 4UNSA 1ZC4A 3H0KA 1YR6A 4HLUA 4C0HA 2Z0MA 3NIBA 3B1ZA 4R9UC 2YNMA 2ZVPX 2VLIA 1DAMA 1QZXA 2JJ1A 2BMEA 4PZLA 3HU2A 5HCNA 1E79D 1GKYA 1N5IA 1P2UA 2C95A 2GHIA 1KDTA 2FFHA 5BWMA 1IQPA 1GAJA 2WM9B 2WAYA 4DIEA 3QPUA 5JEDA 5KO2A 4ERNA 3OE7D 1QHNA 4TL9A 5KNDA 1W2HA 421PA 1ZU5A 3DO6A 1E1RA 2WMNB 2OESA 4MGIR 2ORIA 5H70A 3RC3A 1KSGA 3O8RA 3OIVA 1NP6A 1DE0A 4RZXA 3TSWA 3U4QA 1YR9A 4KAXA 3ZZ0A 3UG7A 5JECA 2UZ3A 2P6RA 2WJIA 2W0MA 1YVDA 1TQDA 1AS2A 2YOGA 4B6FA 4Q01A 4C2UA 2IBMA 2B6HA 3CLVA 4TMZA 4BLTA 3EPKA 1NVXQ 4JSYA 4YMVA 1Q12A 1DOAA 3AVPA 3HU1A 3TNFA 3W90A 4XSHA 5J4HA 1T3HA 4RCZA 4V0ME 4QKQA 4NCNA 1KI8A 5GVRA 5C2JB 2FGJA 3D3QA 4HLUC 3KQNA 2H8KA 5CIWA 3SDZA 3L0PA 1BMFA 3X1ZA 3LBHA 1Z6TA 3CPEA 1RJ9B 3GEEA 2W2TA 4N1AA 3TW4A 3Q3JB 3ZS8A 4FMCF 3DM5A 4CEIB 5FBLB 2OAQ1 2V3CC 3ZIAD 5DHAA 2OLKA 2FE4A 2A5YB 1S1CA 3CX7A 2OE2A 3OESA 4Q7MB 5H68A 5KSZA 5EE0A 1Z63A 1DAKA 3K0FB 1NRJB 2GZHA 3GJXC 1KKMA 4QG7A 1U8ZA 4XJXA 4URUR 4Q66C 3V00A 4LYFA 2PLFA 4P0TA 1W49A 2ZS9A 1HTWA 5FOXA 2CEAA 1G7RA 2JLQA 1PUJA 3I61A 1AZTA 5DISB 3ETLA 1EFRA 4DUGA 2CJWA 4WXPA 3PR1A 1Z07A 3BFKA 3K0EA 3QXHA 1COWA 1OXTA 4ASUD 5GJBA 4MKHA 3HP1A 4V0KA 4PC6A 2VO1A 4C7OA 4IDQA 4BEBA 1E0JA 5LD2C 5JCZA 1E2EA 1TAGA 3OIUA 2XSZD 4OHVA 4CYMA 5TDHA 3THWB 2NO7A 3CNNA 3BH7A 3B78A 2WSSD 3UK6A 3F0TA 3WMFA 2VIIA 1D9ZA 2WKQA 4TYPA 2EU8A 3BERA 3WHLA 4CF7A 3PFIA 3AVYA 2XZLA 2DB3A 1YZTA 3EASA 3TUZC 3IPXA 3VKHA 1X86B 3PENA 5FOWA 3SBDA 2FPKA 2YC2C 1R0YA 3K0AA 2F43A 4HDCA 4KLZA 2QPOA 3T12A 1TQ2A 4EUNA 1TEVA 3LAWA 1XD2B 4BFZA 5J4LA 5P21A 4C0QC 4C4PA 4DIDA 2ZEJA 1Q20A 2HXYA 3C15C 4D6PA 4NCHA 3TJZA 3ZLJA 3BWDD 2PZGA 4HAWA 2AHOA 4Q1BA 3TW8B 2X19A 5CLQA 4TYYA 2NTYC 3EIQA 3QKSB 3SYKA 3B9PA 2ZI3A 4FIDA 2W00A 3U7GA 1CU1A 2Q0HA 4QXAA 1CR2A 4D2IA 3PUWA 2YOHA 5GJCA 4U7DA 3L8YA 4HAVA 1XPRA 3RRZA 3CRRA 3SQWA 4AD8A 1ZINA 3BIFA 4HYYA 2IYVA 3H84A 2V55B 1OH5A 1J99A 4QGHA 2H18A 3T34A 1H8EA 1KJYA 2MMCA 2REBA 2W83A 3EZFA 1CR1A 4WZAE 5FL3A 1KDRA 1RYFA 3CRMA 5KTYA 4D26A 3QF7A 3WHKA 4HLDA 2MMGA 4BGDA 2B8WA 3DOEA 1DPFA 5EP3A 5AWFC 1U94A 1HA3A 4GOJA 4EKDA 4PSVA 2ZYUX 3Q5DA 3GP8A 3G82C 4URZR 3OFNA 2XZPA 1N2CE 2QAGB 2QP3A 2BBOA 3VX4A 2FSGA 1M74A 2IUSA 3CPHA 1AN0A 3NC1C 3X1YA 5KNBA 1AZSC 3SBEA 2JJ8A 1JB1A 5KSOA 1TADA 2ECKA 4P31A 2ZM5A 3RDPA 3BORA 2AD1A 2KJQA 2ZI9A 4V0NA 1FTSA 3QI2A 1UEIA 4EPYA 2HV8A 4ZDWA 4UJ3A 3O8BA 2IWHA 4LJ7A 1XB2A 4FWIB 5JI3E 2NO9A 3B5JA 4TTQA 4Q5IA 1Q3TA 3A1VA 1AS0A 1GRQA 1FUKA 4M4SA 1N25A 2Q9BA 3AEZA 3MFYA 5FOSA 5GADl 1G3MA 4OYHA 1NLFA 1ZNXA 2JATA 4QBIA 3LH5A 3QEOA 4RD4A 1XXHE 1US8B 1ZUHA 4TMWA 1QHGA 6Q21A 1KO8A 3AVVA 1SHZA 1E9BA 3WNDA 4NYMQ 4W7SA 4IDOA 2CE2X 4DCUA 4OHYA 2JIZA 3ADKA 4US2R 1R8SA 2GXUA 4A82A 1MO4A 1SZPA 5E7JA 2NZJA 4D81A 3CR7A 2JLYA 2G0TA 5EP1A 5AJYA 4A8JB 4LYJA 5FR1A 3WMGA 3CONA 4MQBA 1R4AA 2AD5A 4RZ3A 1EFHA 5KNCA 2CHQA 4ABYA 2WJYA 1E9SA 1J90A 1P7CA 1R2QA 3SFVA 1P60A 3NHAA 3NBFA 3FMOB 5BYJA 3MLEA 4HLQB 2VHQA 3QEJA 1W0JA 1SVWA 4WAUA 2GVZC 1OJLA 3QPVA 5L8VA 1DADA 2QZ4A 1T9HA 2BC9A 2ONKA 3CBQA 2GZDA 2O5VA 4M9ZA 4B33A 2G6BA 1TX4B 2ZQ5A 3SN6A 1JXMA 2WWXA 1JR3D 1PVOA 2ZUBA 2C8VA 1HE1C 2FZLA 1ZD9A 5CDFE 3KJEA 5EXTA 3BAFA 5DO9A 3I92A 2ODBA 3A1SA 4DSTA 5K8TA 2RCNA 4KI0A 1HURA 3L2OB 3PEVA 4YLGA 5FUXA 4BFUA 4TL8A 3W3ZB 3RYTC 1MH1A 3CWQA 3QOFA 2ORVA 1GRRA 2CE7A 2OFWA 1QHSA 5G3ZA 3A1WA 1XJCA 1CIPA 3MWLA 1Z6AA 4C0SA 2Z6VA 2UKDA 5UKDA 1F2TB 1E99A 1KK2A 5G40A 5SZHB 1BYIA 4JVSB 2GZAA 2DR3A 4JLAA 2X1VA 3BFVA 2ODEA 5FPHA 4JLBA 4OI4A 4EPTA 2O8EA 5DE3A 2ZRLA 4A6XA 4UJ5A 1R0WA 4BFSA 2P5TB 2QM7A 2CCGA 1Z6GA 4L9SA 1G7TA 2AWOA 4HB4A 4MUAA 2XNDA 3FWYA 4RJLA 3RANA 2GTPA 4AIIA 4B6EA 4PSAA 2RMKA 2A2ZA 2WZQA 1G8PA 4Q7KA 3RSOA 4PHTA 5E7MA 3TSZA 1DBSA 2VP6A 1N0UA 1UEJA 4DB4A 1I2DA 2GRJA 3IBGA 4MGKR 3H4MA 4UXJA 2YWFA 3REFA 1P3JA 4BPBA 1G21E 3EIEA 1VHLA 4ZCLA 5DYIA 2EWVA 1G8YA 2DBYA 2IUTA 5F9FA 2JASA 5L3SB 4MYTA 3BOSA 2F3TA 5B30A 4ARZA 1AQYA 4KO8A 4QNRA 2JA1A 2ZYTX 3X1XA 4JBWA 1LTQA 1KY2A 4GPTA 4M53A 2RGNC 4JSTA 2TMKA 1DO0A 1LW7A 4QGAA 1AA3A 5EE3A 3K0CC 1II8B 2QROA 4D4LA 3C8UA 5FTMA 4Q00A 1VIYA 1XZQA 1OYWA 2IHBA 3PUVA 1HUQA 3LO5A 3AVWA 4WZ6A 1KI3A 4HB0A 4GOKA 5CM8B 1OKKA 4JT4A 1JAHA 1E2HA 3ZVRA 3KJHA 5JLJA 4DKXA 3FKQA 4HDQB 1G17A 5FPYA 1WMSA 3RRMA 2VF7A 3LXXA 2W2VA 1TF7A 5TXGA 4BZXA 1SVIA 2ZR9A 2G1JA 3T5GA 2PJRA 3CKLA 3QF4B 2FJUA 4PQFA 1OLOA 1ZVQA 3LVRE 5CJ2A 1MO5A 1SQ5A 3IUYA 1SXJA 4OBEA 4QHYA 1TU3A 3PXGA 4IRUB 3T35A 5E7IA 1WP9A 4TQ9A 4GDFA 5FUWA 5HE9A 1N6NA 4TL6A 2CK3D 5HE8A 1IY2A 2F1IA 2WPDA 3KTAA 5ANRB 1IXRC 3FMIA 3K53A 4YC7A 1KZ7B 1E9AA 2Q9CA 1TUIA 1VYTA 1GRNA 3T1VA 3LQRA 5FBVB 2OBNA 2WWFA 2DPXA 3Q7QA 2BJWA 2WOOA 4LBVA 1Q3HA 4P4SA 2C96A 2JDIA 2QPAA 4B76A 2QAJA 4ESVA 4KBFA 1M7BA 3N5CA 3VMFA 4HZUA 4ITRC 2XXAA 1XXHB 3ZQ6A 4OHZA 3NH6A 3UANA 4BLOA 1CP2A 3AF1A 2HLDA 4M1YA 3GLFB 1E1QD 3VR1A 4E5UA 2P0EA 4NH0A 1KI1A 3OEEA 4DLUA 1GITA 1SVKA 2WIAA 4MYUA 1TEXA 3BB4A 2ZJOA 5HCIA 1O87A 2VHTA 1SXJC 4A0RA 4O3MA 1HE8B 2KI5A 5DN6D 1YZGA 3EWSA 3LLMA 2IYWA 3DPUA 4GBMA 4GP6A 1WBBA 4TQUS 2FFAA 1X6VA 5J4VA 3ZDQA 3QIAA 5JJIA 2Q3MA 2NO0A 5JSZA 4PPFA 2XNSA 5HPYB 4GZLA 3EC2A 4I4LA 4TL7A 3RS4A 2BMDA 4ZDJA 1BOFA 3GCGA 4YMSA 2FWRA 3OEED 1QG4A 3KUCA 3ADCA 3U4QB 3EX7C 3O8CA 1S3SA 4RKFA 5DSZA 2WKPA 3LX8A 8OHMA 2PZEA 2J7PA 5LB2A 3AM1A 1W36C 3EXAA 3LW7A 3A6PC 3VNUA 1J2JA 3KKOA 4JT2A 4RD6A 4V0MA 3DVLA 4LCBA 2FSHA 4AK9A 1Z06A 4LRWA 4ZDKA 4XH9B 2ZVQX 4P4TA 3GD7A 3MRSA 4IXNA 4DXAA 4TLDA 1DG3A 3SOPA 3GPLA 3SYNA 2ANCA 4I1UA 4BZPA 3C5CA 1M1YE 2GESA 1T8TA 3I8SA 2IL1A 5FI0B 2J5XA 3W8RA 1IN4A 3U3MA 3WBJA 4N3NA 1OW3B 1NN5A 2QMUA 2WWYA 3BGWA 4CT4B 4JL8A 3KB1A 5B58C 3GLGA 1H8HD 1W44A 1Z22A 5BXQC 2C9OA 1G64A 2PX3A 3AF0A 3B1WA 4NHOA 1A1VA 1B23P 4RD1A 1FQKA 1U81A 2B7BA 4AYXA 1X8KA 1UDWA 2C98A 2CJWB 4WZBE 4F4IA 3H1TA 3KQLA 3KXKA 5CM9C 4DDWA 2GXAA 5D3MA 3E1SA 4CEJA 1E9EA 2AL7A 2ZJ8A 4IEIA 2OM2A 2GCPA 2Z43A 3D6TB 3HWSA 4C7OB 4I99A 1VMAA 4JLNA 4KSBA 4L9WA 1NG9A 5JJKA 2ZJ5A 2QORA 3EA5A 4DSOA 4DB2A 1D5CA 3MGCA 4L5BA 5HKKD 3HU3A 3P4XA 1FMLA 4LWZA 2ZRNA 4C0LA 3K0AB 2F43B 3ZJYA 4MDEA 3N70A 3VR4A 4UNRA 4IW3B 2WAXA 2ZS7A 3B6EA 5AJZA 2GK7A 3HR7A 4LJ9A 2XTZA 1DAIA 4GSYA 1Z0KA 4TLAA 3RNLA 1GNQA 5JS8A 5TY0A 5FBQB 2B21A 3OIWA 5H1YA 2V1XA 5C4GB 3BXZA 1GOTA 2GBLC 2ZIAA 2QG6A 4FMBB 2NMVA 2VPPA 3V4RA 1TL7C 3I3SR 4A0HA 2AFHE 3AV0B 1KI9A 3CIOA 3ZZTA 1LF5A 4GP7A 2HDNB 2CVFA 821PA 1JPJA 1SVMA 2V7QD 4DLSA 2FX3A 1S9DA 1ZCBA 1P9WA 4OQXA 1YRBA 2V8OA 1Z47A 1CLUA 2VSXA 3GLHE 4TN1A 2C99A 3IDQA 1U0JA 4PPQA 2W6JD 4B3GA 2R6DA 3IIMA 3QKRA 4LHYA 2YINC 1K5DA 1E0KA 4IXMA 3T06B 3LD9A 2ZROA 3RHFA 4URYR 1AA9A 4G3XA 5FR2A 4GRAA 4RFSA 4KXFB 4NL4H 4FI3C 4D0GA 5HZKA 3BE4A 1NMZA 4LV8B 4OQNA 2VHJA 1ZM4A 4HI0E 1NSFA 4Q4LA 4LJ4A 3VX3A 3CRW1 4MRRA 3B82A 1KDPA 4X8HA 2RGDA 3EZ6A 3UMRA 1NY5A 4C9BA 3CF0A 1KNQA 3GEIA 4G5SA 4LPSA 3FKSD 1PLJA 5AR1A 1SXJE 3THOA 1UM8A 4LZZA 1G7SA 1YRAA 2GDJA 1AS3A 4AYTA 5IK2D 3R20A 2QT0A 3CRVA 3SJBA 3K70C 1KI6A 2H16A 1KJWA 2J7KA 1E2DA 4L15A 2ZRBA 2NO6A 4GOXA 3ZH9B 3FOZA 4JVLA 3WP0A 2D74A 2JLVA 3KL4A 4O0MA 1YQTA 1FMJA 2ZYVX 4PANA 1DARA 3C7KA 3SEAA 2IS1A 1UKZA 3CPJB 1KSFX 4C0BA 1G3QA 2WWWA 4Q7JB 1II0A 3C41J 3B7GA 2OFXA 1OYYA 4B73A 1ZP6A 3QXXA 2WJVA 2HYDA 4OKSA 5LBIA 2G88A 4JLPA 2R6CA 4JJKA 4JVMA 1KZGB 1QHIA 3G0HA 4AKEA 3AUYA 3Q85A 1JEEA 1ZD1A 2DWOA 1NG1A 1E9RA 2IX3A 1JEDA 2I3BA 3DL0A 4RCYA 1XPUA 1YZUA 1UF9A 4EPRA 3P26A 1X1SA 4A6PA 1Q1QA 2B7CA 2FZ4A 4OL0A 5AK0A 4O2LA 4US1R 2D4HA 1K5GA 4RVCA 2QT1A 3TSOA 4B47A 3T5DA 2D62A 3GJ0A 2XAUA 4MGYR 1XEWY 2GWHA 2EQBA 3CM0A 5D3QA 2QRZA 5KDOA 1CR0A 1CF4A 5IRCD 2Q6TA 2XEXA 3FPAA 2QE7D 3HJNA 2HCJB 4WIAA 1NJFA 2EWWA 1TU4A 4B3DA 2QUZA 3W3AA 2OHFA 2F3RA 3A4LA 4Q9KA 3KUDA 4Q4HA 3SJZA 5BW8A 2NQ2C 3MWYW 4I1VA 4M1MA 1SVSA 4PC7A 4PO9A 3RS5A 1E2MA 4DWJA 3LQQA 4LHZA 2BEJA 2H7VA 3BK7A 3SZRA 2RGXA 3AVQA 3FB4A 3IQWA 2WBLC 2VHUA 1NBMA 1Z2CA 1CJVC 2NIPA 4Z54A 5JCPA 3BFXA 5C4MA 3AGQA 4PZZA 4MYCA 4HB3A 2JJ1D 5DI9A 3D8BA 5CDFA 2KE5A 2WWIA 1P6XA 1LS1A 3KQKA 2IHYA 2BV3A 3AF2A 2ZSAA 3L8ZA 2VSOA 3SS8A 3FFBA 4JZKA 3DM9B 1R0XA 4LJAA 4UNPA 1JECA 4MRPA 3PITA 4GNKA 3SFZA 1E1RD 1S9HA 4E22A 2WOJA 3OAAA 2F9LA 4DLZA 5DNYB 2QMEA 1JAIA 4EPXA 1P2VA 1OSNA 1G291 3A37A 4JLMA 1G4UR 1GL7A 1EXMA 1NF3A 4IDNA 5L3RA 2HT1A 3FMFA 1KI7A 4D0NA 4U02A 3GLGE 1G20E 2BEKA 3GEHA 3I72A 4XVRA 4ZI2A 4B74A 2O8EB 4F4JA 4H9GA 1KO1A 1ZMXA 2ERYA 4W5HA 3IKJA 2WICA 3PCRB 5EUMA 2AX4A 1BMFD 1ESMA 3F8TA 3PUZA 2I1QA 2CCJA 1MRNA 1HQYE 1KNXA 1I4TD 2XJ4A 3TAUA 4DEXA 5FBWB 4QJ4A 1XFAA 2OO7A 1MOZA 1DEKA 2P5SA 2YYZA 1ONBA 3AKCA 1XMIA 3NHBA 4MDFA 3QQ5A 2VP2A 2V6JA 1ZIOA 2AWNA 4JMPA 4JL5A 2EYUA 1HQCA 2NO1A 4R71A 2I1VB 3NG1A 5ELXA 1DS6A 2YZ2A 1WDTA 1NIJA 3KQHA 3FTQA 3UWOA 4Q18A 4Q48A 3QY0A 2GNOA 4QL3A 4ARZB 4FN5A 3RC8A 3NEJA 5FUVA 5EE9A 1EFRD 4DUGD 1KSHA 4BFTA 2R2AA 3BS4A 3AVTA 1XTRA 3HYRA 3W6PA 4OHXA 1COWD 5F2EA 1NKSA 1CULC 1YR7A 5FTNA 3GLIE 3LV8A 1YKSA 2JLWA 4K8OA 3TVDA 4IOJA 1XMJA 1VHTA 2PH1A 5GJWC 4TYNA 4KJZA 3C14C 3W9YA 3B13B 4YONB 1IBRA 1C9KA 3REGA 3VAAA 4TZ0A 2QP4A 1ZD8A 5AUPB 3KJIA 2ZRFA 5BYKA 2F1HA 2HXSA 4Q9IA 3Q8XB 4JVNA 2QM8A 1G1MA 1SXJB 3U3OA 2VP4A 4Z8YA 3LBIA 3SNHA 4EQ6A 4KBGA 3KXLA 1DG1G 1XEFA 1KI2A 1Y63A 1XTQA 1XF9A 3EAQA 3HPRA 4TTPA 4W9MC 2MSDB 3NWJA 3H2YA 4ESHA 1JQLB 2XX3A 1OT3A 4GI7A 4B2IA 2F55A 2HYIC 3E5HA 5K8LA 3C4JA 3CH4B 2E1RA 2P6UA 3HDTA 3KTAB 2A3RA 1QDEA 3X1WA 1OV4A 2QBYA 3NBYC 3IO5A 2UVQA 2G0NA 4P4SB 1HV8A 2PCLA 1G3UA 2XJ9A 1U90A 2BBWA 2ZE8A 5KSPA 4V02A 4HUTA 2J3EA 4HZUB 4DCNA 1KHTA 5K8UA 5J47A 2QI9C 4LV5B 4OK3A 2XXAB 1W47A 1G5TA 1H8ED 1N5LA 2G1KA 2YVUA 2WIBA 3VR3A 1NJGA 3AQ4A 2VSFA 3UMSA 2FG5A 2GVDC 4QM7A 4HATA 3GJ4A 3CNLA 1VDZA 2ZAMA 4NZYA 1CTQA 1QF9A 1SHKA 1Z08A 3CF6R 4N0EA 4Y0VA 5HZHA 1XWIA 2IXFA 2IF0A 4OJQA 4AI6A 1FP6A 3FHCB 3OFND 1JXOA 1E2PA 1Z0IA 5B2ZA 1S3GA 3U3KA 2KWIA 2F6RA 5IF9A 1UKEA 3ZVNA 1FTNA 4OK6A 1FNMA 4LC0A 2QGNA 1KGDA 2C78A 3EWAA 3FMPB 5JSZB 1RKBA 5H8WA 1Q1ZA 1E2QA 1TF2A 3M4YA 4TTRA 2OEPA 3BH6A 1N6IA 4Q1AA 3W5IA 4TLCA 4IEEA 4F92B 1D2NA 4IFEA 1U8YA 1D8TA 2ZR0A 2EFEB 2A5FA 2IS4A 2HF8A 3GMTA 3IEUA 3PV0A 4XTRA 2BBSA 3DOFA 3UXMA 1T91A 3K9GA 4D80A 3LBNA 4WVFA 4HAXA 4CVNA 1MKYA 2IS2A 2OUKA 4U00A 1T0JB 2OBMA 1WE2A 5DI3A 5LPNA 2HJGA 2KSQA 5TB5A 2YKGA 5HTKA 4PHGA 2WVJA 1EX7A 1GWNA 1GUAA 1ZM2A 3WYAA 521PA 3WYFA 4D25A 4URVR 3KFXA 1IN7A 5F98A 3I1FA 3JZAA 1E2KA 2OSBA 2JIZD 1OF1A 1XZPA 2K5UA 4IOKA 1LB1B 2RGEA 5FTJA 2GF9A 1AQUA 3R8CA 4ZDIA 2JCSA 1NBME 1OFHA 2HCBA 3U5ZB 3MJHA 4YDSA 4DBLC 1V43A 2IYZA 3OEHA 4B2LA 1EX6A 4J0QA 1T5IA 1EESA 4NYIR 2OG2A 3DHWC 3GLGB 2J45A 5CLLA 4OI1A 4XSGA 5JWOA 1GDDA 1WF3A 1X3SA 3GQBA 3X2SA 4AKGA 3GJ5A 1VECA 5JZVA 1RC8A 2Z83A 3WRYC 5KYKA 1IOZA 2A5GA 4DRZA 1W0JD 4H1UA 5JRZA 2W0SA 4TT3A 1RRGA 2WMOB 5D3MB 4MRNA 1WB9A 1A4RA 2OFOA 4CEJB 1NSTA 1GVNB 3DKVA 1CJUC 3LX5A 4Q1DA 2ZRKA 3I32A 2H17A 1IAQA 4PPGA 2H5EA 4NYJR 4B2PA 4YMTA 2FEOA 3SJAA 2IXGA 3RAPR 2EYQA 1VG0B 2W58A 2RGNA 3AKEA 4BECA 5CB8A 3IIKA 1IN6A 3K0CA 3ZD7A 4QJ5A 1Q0UA 2XOKA 2ZUDA 2D7CA 3AB3A 4P3YA 4CEHA 1OH8A 1P2SA 5AUNB 2YC4C 1OFIA 1Z5ZA 4XD7A 1IY1A 1IXSB 5K8IA 4PO1A 1AJEA 2DFNA 2OCYC 1E0AA 4DDVA 4JYCA 2IYXA 4XIGS 3JVVA 1J8MF 5LB4A 5GVSA 1KAGA 2PX0A 1E2GA 1UJ2A 3QVUA 3T1TA 1IHUA 1Z0DA 1QRAA 2PEZA 2QP9X 3QKTA 1KY3A 2B92A 1XMVA 2CLSA 1Y3AA 3B8HA 5FPKA 1A2BA 1OFTA 3ZS9A 2XNDD 3W6OA 1G18A 2REOA 1U8AA 1CR4A 5JHHB 3B1XA 3RWOA 1DVRA 4IDHA 3GLHA 3NKVA 3QKRB 2VF8A 1VIAA 2SHKA 5JI2E 4IJMA 5AJXA 4DDUA 4A9AA 4DCSA 2ODWA 4RFSB 3VHXA 2FPMA 4BLQA 3SI7A 4NPHA 3VNVA 3LXRA 4Q1EA 1NLYA 4A4DA 2ZE7A 5CJPA 4XWAA 3DMNA 4LHVA 3RRNA 1YZKA 4B75A 3P32A 3ZGXA 3LY5A 2FU5C 3K9LA 1GNPA 1SULA 2GF0A 2IA5A 3GJ7A 1LVGA 1NKTA 1Z29A 2AFIE 1KI6B 4F93B 4DLYA 2ZYWX 4Q9HA 5EUQB 2DFTA 1BS1A 2F1JA 2W6IA 1XDBA 4X8MA 1GZSA 2QRNA 4YQFA 4M2LA 1G5RA 3ADDA 1OKKD 3C5HA 1S1MA 1SKYE 5FH9A 2C5LA 4X8LA 621PA 2WTUA 2ZREA 2OXCA 3AP3A 1E2LA 2G83A 4EDHA 1FQJA 1TNDA 4PX9A 4KODA 3MWKA 3NC0C 3I4LA 3EW9A 4NMMA 5EE5B 1XPOA 4A0GA 4DLVA 4KHZA 3THYB 4A2PA 1XD9A 5SZKB 1RRCA 1GNRA 1SXJD 4Z8XA 3KXIA 1B0UA 5G41A 3KKQA 2X77A 2ZU6A 4US0R 1CKEA 4QGGA 5FOVA 1EFTA 4LBYA 3DKPA 3A8TA 3WRXC 1XCMA 1T4GA 2BCGY 4KFSA 2WPDD 3U61B 2QSZA 3UIEA 3BH0A 2ZSDA 3T1QA 2FMXA 3EIHA 1EK0A 3DEFA 4DC9A 1YE8A 2JDID 1W0KA 4Z1MA 4H1VA 3FHOA 3OIYA 5JFGA 1ZYUA 1XMSA 3BJIC 4PC3A 3TKLA 3PJRA 1OHHA 1UDXA 4PAQA 1SKQA 2WHXA 3CO5A 1X8LA 4Q4HB 2GJ9A 4JLJA 1R5OA 2HLDD 5EXPA 2OZEA 5HR5A 4LK2A 2CL7X 1L2TA 1JR6A 2J0UA 1DTSA 4PSKA 1G41A 1PZNA 1ZUNB 2E87A 1X1RA 4GMXA 5FFMA 1FP7A 2A78A 2VA8A 3PEYA 1ZIPA 3IHWA 4Y0AA 3UMFA 2QENA 1U98A 2BBTA 1FX0A 5FPSA 1CJMA 4KVGA 3QENA 4OI2A 2GJKA 4Z1MD 2ZITA 2QA5A 3U2QA 1NNEA 1BO6A 3TRFA 1GP2A 2QGZA 4C3ZA 4D4JA 3ZQJA 3RSLA 4QM6A 3WY9A 5LD2B 3I62A 1NIPA 4HDOB 1KMHA 2J9RA 3QXJA 4JS0A 4WBSA 2NG1A 2ZANA 4O2RA 4C0KA 4M21A 1JR3E 3U6KA 1Z3IX 3NDPA 1FW6A 1NI3A 1S96A 2FGKA 4G5RA 3KQUA 2BCJQ 3ZZUA 3B60A 4LX0A 2O0JA 3KJGA 3L0OA 2ZRCA 3UG6A 2J7PD 3I8XA 4W5JA 4RD0A 2P2LA 2PL3A 1UPTA 3MCAA 3ICEA 4M0LA 2IUUA 4PR0A 2ZRPA 4ZI3A 2F1RA 4C2TA 1GIAA 1KO4A 1ZJ6A 4KYIB 1FUUA 3EZ7A 5L3VA 3EPJA 3LVQE 3ASZA 2IF2A 4PQYA 5FTKA 1E2JA 4P4UA 1G6HA 1P72A 2AN9A 1PV4A 1E69A 2R9VA 3MG9A 3SR0A 2DY1A 1BIFA 2GBLA 2J87A 1T5LA 3I5XA 3S1AA 1U9IC 2ZI6A 1M8PA 3AKYA 1XTIA 1NVUQ 3PEUA 2ZRDA 4TLBA 4RZ2A 5A0FA 4ON9A 2IEYA 1M2OB 2XTNA 2VL7A 2CNWA 2O8DA 1GKIA 4A8JC 4AKHA 5CK5A 3PUYA 1P73A 4F38A 3K8YA 4V0OA 2AXNA 4DCVA 1ZNWA 4DLXA 4ZCMA 3CX6A 4OK5A 1FZQA 2ATVA 3CNOA 3TUIC 4DVGA 1RPZA 5FI1B 4PZYA 2JJ2A 2R8RA 2P67A 1N6PA 1ODFA 2ZRAA 4Q21A 5G3YA 3TIFA 4LJ6A 5JRJA 4QOSA 1G3RA 2HEIA 4KV9A 2YV5A 1IY0A 5J4KA 4DSUA 2PMDA 3CWZA 1WXQA 3GLIA 2XTMA 4LYAA 2O0KA 2O8FA 3EZ9A 4Q9LA 2QTHA 1A82A 4PFSA 5EP4A 4YXWA 3QVVA 1LS6A 3EC1A 3A1UA 1EGAA 1P4SA 2GCOA 1G9XA 2CBZA 1NY6A 1OIXA 1R6BX 1YJ5A 4PO8A 2ZI5A 4LDJA 1I2MA 3K1JA 4Q02A 1XEWX 2CVHA 3P20A 4JLVA 1UKVY 4II7A 2YJTD 4TSFA 1HY3A 4DDTA 4KFTA 1AGRA 4MKFA 4MGZR 4JBYA 4P32A 4EQ6B 1ZU4A 2Z4RA 4RSGA 5EP2A 2Y8EA 3P1JA 3HYTA 4AWXA 1UBEA 2C04A 4A36A 3KDSE 1DAGA 5L3QA 1J70A 1E3MA 4DCTA 4ACAA 2VBCA 1GTVA 4FMCB 3K9HA 5G53C 4WA7A 4BLRA 5DGXA 2QBYB 1ZW6A 1G6OA 1KK1A 1XD8A 3MSXA 3ZVMA 4WOPA 1Q22A 1TUEA 1W7AA 1TQ6A 4L4UA 1FOEB 3HPQA 3EA0A 4JJZA 2ASEA 4TMVA 5CITA 1UAAA 1QHHA 3LWNA 1NVVR 3R8FA 2AK3A 2J1LA 3FE2A 3TE6A 3ZVLA 3K9NA 2HJVA 3L82B 1UFQA 2CL0X 1RW4A 3B9QA 4ZIRA 3VU9A 2BHRA 3GFPA 5FOTA 1KK0A 1C1YA 4FXPA 1ESNA 2GCNA 1KKLA 2CHVA 1SGWA 2XITA 4LJ8A 4PXAA 2ZTSA 2WJHA 4UXIA 3W8NA 3B1YA 5FL7A 2VTKA 1Q1EA 2VP9A 3UPUA 1DELA 4Q4AA 4RD3A 3RVBA 1XBTA 3SE0A 3E2IA 4E09A 1P62B 1GSIA 3TK1A 2XB4A 1P9NA 2GEDA 1CBUA 3THYA 2AK2A 5C18A 4G5QA 2ZE5A 2GAAA 2Q21A 1H65A 2FPLA 2ZJBA 3KKPA 4OHWA 5JHGB 2OLJA 4M9SA 3SHWA 3EZ2A 4ZCIA 1D9XA 4MYHA 2ZRIA 4GZMA 1EFUA 2HT6A 3R7WA 3VFDA 1NLZA 3QPWA 1KO5A 4JLDA 5TMPA 3DZDA 1E79A 5A5GA 2GEUA 1W48A 1KK3A 1XRJA 5CIQA 1YZNA 3G5UA 5DI3B 1UBCA 3OE7A 2CCKA 2EFDB 2V4ZA 4B3XA 2RGBA 4TZ6A 2QY9A 1JQJC 2FFQA 2QEQA 3QBVA 4DSNA 1G5PA 4I81A 2JEOA 4UQOA 2KB0A 2X8AA 3SJCA 1AIPA 4A2QA 2C9CA 2QMHA 1CJTC 3W34A 5A4JA 4NE2A 2X2EA 3EPLA 1OH6A 1JNYA 4IVPA 4RKEA 2QPTA 4G01B 2GEVA 3RABA 1A5TA 4CZ2A 2N1BA 4Q1FA 1XEXA 2JGNA 1Z0AA 3A36A 1JALA 2OT3B 4E07A 1Z0FA 2N46A 3PQCA 5EQTA 4C30A 2BM0A 3TR0A 2IT1A 4M1TA 4YMWA 1KDOA 3FHTA 4F7WA 1XCGB 3KFVA 1HT2E 5JWHA 3VR2A 4K81B 3FVQA 4OI0A 5IHPA 4JYBA 3U44A 5IT5A 4Q03A 3ZIAA 5BN5A 1OIWA 1VTKA 1W4BA 4FW9A 2R65A 4XTCS 3THXA 5EE1A 3TR5A 2Z4SA 3TQCA 2YWHA 1NBMD 3B1VA 1VYVA 2AKYA 1P2TA 2N42A 4POAA 5J5CA 2PJZA 1FPMA 4NDZA 1Z0JA 5JJLA 2OCAA 4CDGA 1W1WA 3QNUA 1XTJA 1F2UA 2CXXA 3KKNA 1ANKA 4PAOA 2ONJA 4PQRA 2V6IA 3AP2A 4Q7LA 2G77B 4CEHB 3P4YA 4HAZA 3AF3A 3I73A 4ASUA 4OQLA 2GK6A 2IYUA 1QVRA 2OCPA 2IYLD 3OAAD 5JBQA 3SQXA 1HH4A 2XSZA 4AG6A 4KFRA 1Z6YA 2WSSA 1YU9A 1AGPA 3PUXA 4B32A 1I4DD 2AKAB 2VHCA 3NBZC 1J8YF 3B85A 3IO3A 2ZSBA 1O3YA 1EFCA 5E4FA 2NPFA 1DAEA 1KO7A 1L4UA 2MSCB 3EARA 2LCFA 1TQ4A 3LLUA 1V5WA 3QXCA 1T6NA 4RY2A 4B3FX 2PBRA 1OXUA 4B71A 1RIFA 2D2FA 2GETA 1R0ZA 4MUBA 1KI4A 3KZ1E 3R9WA 2GXSA 3QG1A 4N0DA 2HF9A 2JLSA 3GLHB 3AF4A 3ADBA 3NDBB 3MWJA 1D2MA 4HZIA 4NU0A 4Q4JB 4MKGA 3WMEA 2O8BA 4BRUA 5F9HA 1GILA 4S2EA 4LHWA 2BJVA 2R6AA 4IOLA 1R10A 4TMKA 4R2IA 4LPKA 1VCIA 3SHFA 2CDNA 2QQEA 2PEYA 1GL9B 2ZSEA 3KX2A 5SZIA 1OB5A 3FFAA 1J7KA 3Q7PA 2ZSFA 2NGRA 1F3OA 1E2NA 4NBSA 3K0SA 3D7MA 4FWTA 4EPWA 3VR6A 3EPHA 1XTSA 1GFIA 1ELOA 3D31A 4LHXA 4BUJA 4MRSA 4X8OA 4BFXA 3OHMA 2IYRA 1FFHA 1E4YA 3A4NA 1XTKA 3X1DA 1A2KC 2IW3A 1E6CA 4FMDB 1ZNYA 5J4YA 2Q3HA 4M1WA 2O8CA 1Z83A 2C77A 4D0LB 4BFYA 4IOMA 3VR5A 2EFGA 1BYUA 2RGCA 2B8TA 1WBDA 1MO3A 2PMKA 2MSEB 1KTVA 2E9SA 3IHLA 4YDHB 1JJ7A 1G3IA 4EJSA 3GJ3A 2V54A 3Q5EA 4F4CA 1ZM3A 4G5OA 3TMKA 1F48A 4O25A 2VH5R 2C03A 1Q44A 2ZE6A 4JLKA 4Q1CA 2WV9A 4A1FA 3N2EA 3I5YA 1HEIA 1JPNA 1UKYA 2CMKA 4LC1A 4V03A 1W36B 2JAQA 4FCVA 4R98A 3TAHA 3TH5A 4B48A 4CW7A 3AVXA 4LBWA 4A15A 1NN0A 3NVAA 3QE0A 2OBLA 3CR8A 3C16C 5JMTA 4KVAA 4OQMA 4FCWA 3V9PA 2UZIR 5E95A 1E9FA 4PAMA 3LNCA 3RS0A 5KSYA 3GJ8A 4HEJA 2AR7A 2ODNA 1PUIA 3LDAA 1Z8FA 4QJ3A 1IM2A 1RYHA 2OAP1 4C0JA 2ERXA 5EXXA 2ZR7A 4QFMA 2QL6A 4EJSC 2ZJ2A 1GL6A 4RD2A 3RWMB 2J0UB 1U0LA 1CEEA 3SC3A 3WBKA 4PPNA 2FNAA 4HUQA 4B3BA 1Z28A 2RKOA 1OXVA 2J59A 1ZAKA 2QNRA 3AGPA 5TARA 2BOVA 2WJGA 1FX0B 2WWHA 4KYUA 1MABA 1IJEA 1VCNA 1VYUA 5SZJA 4UXHA 3GLFE 1NN1A 5CYPA 3BC1A 1DAFA 4NP6A 4CRWB 1ZC3A 2FDCA 1U99A 2KBEA 1RRPA 3WNBA 2PT5A 3A58B 1QHXA 4DT1A 2P6NA 3BB3A 2X2FA 4NCIA 4BRWA 1EWQA 1KMHB 1T8UA 3ASYA 1AM4D 2YHSA 2PT7A 1AKYA 3A4MA 1IN5A 4NCKA 3ONWA 4KSCA 2DWPA 1JR3A 1WQ1R 2PZFA 4UNQA 2FF7A 3L0IB 1CXZA 1SVLA 1MO6A 3MMPA 4HAUA 4B3CA 1U0HC 1L8QA 2FA9A 2R6FA 4BASA 3PG5A 3Q9LA 2GKSA 2ORWA 1GKUB 3RRYA 1FL9A 1N6LA 5EJEA 2JLZA 3NH9A 4XWKA 3N2IA 1Q1BA 1GG2A 1T0HB 2BKEA 4TLEA 3UATA 1NVVQ 2J41A 3TQFA 1N6OA 1SVOA 5AUOB 2LWIA 3SU8A 4KITB 1K8RA 2QTVB 3OF5A 2O52A 3AUXA 2XZOA 2RGAA 3FYHA 2LKCA 3E70C 1E0SA 1UBFA 1VG1A 3QBTA 4LBZA 1QG2A 2ZRMA 2FOLA 4M1KA 3S1AB 2RH5A 1W4AA 4KCGA 3TUJC 1OB2A 1K6MA 2FN4A 3KKMA 1KMQA 1RVDA 1MV5A 1FNNA 1KIMA 3OEHD 4A92A 1IONA 3CZQA 2QTFA 2O8DB 4TWZA 4M8NE 2FEMA 1A7JA 2JLRA 4R7ZA 4FMDF 1II9A 1QVAA 1RJ9A 1RFLA 4F91B 4TQAA 4YMUA 1IXZA 5AUQA 5TVKA 1N6RA 3F5FA 5FTLA 4MKIA 1BKDR 5EZ6B 1WA5A 4TT3D 3TVTA 2ZS8A 4CEIA 3CZPA 2C9YA 4M1SA 5BN3A 4AYWA 5JWRA 4RZUA 2VRWA 2RHMA 4MH0R 1KYIA 4B43A 1PLKA 3K0FA 1P5ZB 3TLXA 4BLPA 3GLIB 3OZXA 3IGFA 1M6NA 1UBGA 2O8FB 2RB4A 4I1OA 4JKYA 5FUYA 1G19A 3JZMA 3WP1B 2NPIA 2OV2A 3MJRA 4EAQA 4TYWA 2IXEA 1LNZA 1IJFA 4Q47A 4E03A 4D4KA 2GCOB 4LJ5A 4HSEA 1CJKC 3K70B 4AC9A 1U2RA 3DZ8A 4G5GA 4QHTA 5DH9A 4AURA 2WWGA 2XOKD 4BLSA 2L0XA 1N3BA 2GJSA 4TYQA 2FSIA 2IYTA 1TMKA 4XD7D 2O0HA 1E2FA 4LOAA 1OFUX 4XWOA 4IVRA 2G3YA 2CLCX 2H1LA 3T15A 3THWA 3QXSA 1KOFA 1XU4A 4GL2A 1NN3A 2QMOA 5E3HA 5JS7A 3TGPA 2REXB 1Q21A 4L16A 1VG9B 2W2XA 3WNCA 5L3QB 1I4LD 1MT0A 4MRVA 2I4IA 4AKIA 1VCOA 1XX6A 1N0WA 1AK2A 4FINA 1M7GA 5GJVC 2YWGA 1G4AE 5EXSA 4BQSA 1N5JA 5BQ5A 1WRBA 1XD2A 4URWR 3AH8A 4A0FA 4BE7B 3VHLB 1QHHB 4DZZA 5CK4A 1VPLA 1OXSC 3BRWD 2D2EA 4EFNA 221PA 1JI0A 2A30A 2LKDA 2FV8A 3ECCA 2RAPA 5AJVB 4ZIRB 3VU9B 5KU1A 2IS6A 1E94E 4BFWA 2BMFA 2CK3A 2AXPA 2QU8A 1KSJA 3EG5A 4ZKEA 3QKSA 4ZV4A 1Q57A 2RHDA 1HT1E 4PTLA 1QHYA 5EZ5A 1W4CA 2CLDX 1RZ3A 2ZJAA 4QBGB 1CRQA 2KBFA 3PVSA 4Q4AB 2D7DA 4PC1A 3U7EB 1PJRA 3CF2A 2EFHB 4LGMA 3GFOA 4KLNA 5C46F 4JL6A 2Q3FA 3J81k 2R62A 3IQXA 3VQTA 3MD0A 4KU4A 4HAYA 4MA4A 3PEWA 3ICQB 2ZRGA 1TF5A 1E1QA 2BIFA 4PHFA 4IHQA 1C4OA 4NTZA 1AKEA 4DLWA 4LJYA 4AG5A 4JBXA 2IEZA 4IKEA 4CGZA 4QGFA 2IWRA 3IPYA 3IILA 3Q72A 4UKDA 2GXQA 2W6ID 4WXRA 2NOAA 4I1SA 1YZLA 5DIFA 2VEDA 2YWEA 5DN6A 5CB6A 2J0VA 2R44A 2QSYA 2A9KA 3R7WB 4C0AC 2WSMA 4K46A 2OILA 2QAGA 5C1BA 3QJYA 2PLRA 1N0VC 3R9XA 2ANBA 3LW8A 2A5JA 5TV2A 1WCV1 2ZETA 4Q9JA 2ZUCA 1Z6XA 1M34E 5DHFA 1IN8A 3B2EA 3U3JA 2QN6A 1W46A 1ZBDA 2H57A 3WYGA 2BVNA 4XVQA 5KDDA 4B44A 1YR8A 1W36D 3LFUA 4DJTA 4B35A 1VCMA 1E2IA 1S4QA 4NKRA 3U7FB 3AKDA 4LY6A 4BEJA 1E32A 3UWKA 5CYOA 4ILEA 4FD2A 3K09A 1E9CA 4ZO4A 2JLXA 2R6GA 2DHRA 1XEXB 1P61B 2WJJA 3ND8A 3RLFA 4Q19A 2EFCB 1EWRA 1US8A 1OXXK 1W0KD 2FH5B 3ZYCA 3L0SA 2QAGC 2V9PA 1ZCAA 2H92A 1OHHD 2C2HA 3L43A 4PC2A 1F6BA 2YOFA 4NCJA 1U9IA 4AY2A 1VKJA 2ZRHA 1S0UA 2BKUA 4HLCA 4M1OA 3U7HB 5KDLA 1R5BA 2VP5A 3U44B 2DWQA 3QG5A 1TPZA 2ZXUA 3MAAC 3NEYA 3GFTA 3RS3A 5J40A 4A8JA 5AJWA 3THXB 1N5KA 4DEYA 1H8HA 4QC2A 4FCTA 1E4VA 4EIWA 3T61A 5M04A 1W4RA 1JJVA 1F2UB 1XJQA 4PHHA 3VTKA 3CUEF 4CT5A 1D2EA 1LY1A 3K09C 1R5NA 4BFVA 1QBKC 3P27A 5FPTA 1OE0A 1F5NA 2D3WA 2GJAA 2V1UA 4TMXA 5DYGA 2XGJA 2G9NA 3H86A 1MR3F 1DAHA 1ZM7A 3FDIA 1NMYA 1DO2A 5KPDA 121PA 2QQ0A 5BN4A 1LFDB 1VG8A 1G7CA 1BH2A 3CH5A 4IFBA 2GAOA 4HB2A 721PA 5HKKA 3VKGA 2ZPTX 1LF0A 4QBFA 1E96A 4M9XA 2OCBA 3AVOA 2ATXA 4OQFA 2BM1A 4D4MA 4GMDA 1CS4C 5JEEA 2VYFA 3MUFA 5B57C 3R9IA 1L4YA 1NL3A 1OH7A 2D06A 2J0QA 1F60A 2ZI7A 4JKIA 3BD9A 1CRPA 4G0NA 3CX8A 2EW1A 5FBRB 1XP8A 1TTTA 1XNJA 1F2TA 1PLLA 1XCPA 5KPJA 4LSGA 4JIMA 2O8BB 1G8GA 3NXSA 1KJZA 3A1TA 4P33A 1ZNZA 3QKUA 1X8JA 3PIRA 5F3WB 4XVUA 3V4FA 2ZI4A 2CNWD 4Z51A 1RRFA 2F7SA 2V7QA 5KUTA 4M22A 2JLUA 3NTUA 4DLRA 4NONA 3RS2A 2ZAOA 2HUPA 2PCJA 1D6JA 2FFBA 3O8DA 2ZRJA 2BDTA 1RE0A 4NYMR 1HYQA 2W6JA 4GT1A 3RS7A 1G16A 2JJ2D 3UKDA 4EFLA 4BWYA 1G8FA 3CRQA 4CIDA 4IDPA 1N6HA 1N6KA 2CHGA 4D82A 3DMDA 1MRSA 1YHNA 4V0LA 2GA8A 1G8HA 4URXR 1R8QA 2CL6X 2NZ8A 4DLTA 4WW0A 2BWJA 2WKRA 2F9MA 4W5WA 5L3SA 4KFUA 3M1IA 4JLOA 3M6AA 2IYQA 3ND9A 1JBKA 2VQSA 5LDDC 2O8CB 4NYIQ 1ETUA 4YXWD 4DHEA 3W6NA 4M9QA 2DFKB 1SKYB
chains in the Genus database with same CATH superfamily
4LXQA 1VL1A 3U60B 4KV7A 3D4IA 1EG7A 1BSVA 4W8GA 2DCUA 5KQPA 1E9DA 5U4XA 1T26A 3ZE6A 3HXOA 4X1YB 1DC5A 4FSHA 1E98A 2RGGA 3D43A 3L9XA 1LV7A 3I0ZA 3QVGB 3AI1A 4MUMA 2G1UA 2JGDA 5ITSA 5JYBA 4TSFD 3R1IA 1GGFA 2XB2A 5GIPE 3O9MA 2NUTB 4K6FA 3VR6H 2W4MA 3EPRA 3RFFA 5AM3A 1KPGA 4JQZA 4AZSA 4C6HA 1D2AA 3PWZA 1TUGA 3MXOA 1D4FA 3UK7A 3IEVA 2IIQA 5H0IA 4EJFA 4QO7A 2N75A 4A1OA 3M0EA 3L4BC 1AUXA 1KMNA 1O9GA 2P3SA 4K6GA 3SDSA 3WKBA 3UMYA 2IYYA 1Y4UA 1Y7PA 2G6TA 3JAKB 1Z5NA 4KE7A 3ZD6A 3TFQA 3FGNA 1H1LB 3GFRA 3I6ZA 4MHSA 1GRCA 3HXQA 1Z8NA 1MAHA 4LI0A 5A7HA 1BDJA 3FETA 4TMTA 4GW3A 1OAAA 1NOKA 1QCCA 1B00A 4RQUA 5AM4A 3WHIA 1A8UA 3D7RA 4GFDA 2IYSA 1M5UA 3GGSA 4QG3A 2I67A 2XA9A 3DDCA 5CM2Z 4ZOLB 2NV6A 5E1BA 3GDGA 1UXGA 5ECYA 4EVSA 4R2MA 3HBMA 1P3Y1 1OFUA 2D5IA 1JEOA 1JR2A 2FW6A 1CRZA 2OORA 3HGMA 4G9EA 4Q3DA 3TBKA 4PLPA 2FPGA 3OFSA 4HUQB 4MWZA 2ZJZA 4L8GA 3IIJA 1FRFS 3TIIA 2WDZA 4Q4JA 1P6QA 1JE0A 4J16C 4XYBA 1D04A 1CIVA 3EMKA 3VKWA 2EVWX 4WX2B 3U19A 1P5HA 1MABB 4M0PA 2H3HA 3D3JA 1P9RA 4LYHA 5TF0A 2FHPA 3TMYA 4CHTA 2FSVA 4ZPXA 1RQLA 3WWYA 1W35A 4DLKA 1NVKA 2RI6A 1PJ8A 5ALHA 3GLFA 2FFRA 5IDVA 4DT1B 5JH7B 4HNGA 4CMJA 1IVNA 4WLOA 1GGHA 4Z7NB 4R69A 4CQMD 4ZKDA 2PL9A 3KZXA 1P1IA 4GRIA 2B0JA 5IAGA 1J56A 1OBHA 2F48A 3DULA 3CWCA 1PR2A 4H35A 4C0HA 1CY2A 2VAPA 1QFMA 2ZYIA 2BMEA 1RYDA 2Q1YA 3N75A 4KK3A 1KDTA 4Q4DA 1JFFB 1BMDA 1GAJA 1ORDA 2GPJA 4DMCA 3WHPA 4X85A 3NVKI 4UVEA 3GZTB 1W93A 4IINA 1V9SA 5KNDA 1W2HA 421PA 3BAZA 4AP6A 1ZU5A 2WUDA 3DO6A 4L5JA 2PZJA 2OESA 2GJ4A 2I7VA 2Q6IA 2W22A 3KT6A 4U7GA 4IM7A 4EHJA 5D7BA 3OIVA 3UFBA 2WF6A 3TSWA 2Q1WA 4MICA 4I3GA 2P6RA 3UG7A 4CKCB 2JFQA 1MEOA 1FXUA 2O05A 3TJRA 1BRTA 3RU7A 1XLTC 4AG3A 3DT9A 4ARSA 3WIDA 2ECFA 5BT9A 2Q4TA 3CLVA 5CT9A 3TO5A 4R2LA 2IH5A 1DOAA 1J09A 3TLKA 3VHQA 2DR2A 4CV2A 4KRXA 1H0RA 3O75A 1NQTA 2WY2D 1T3HA 2AEMA 4G4SP 3V1LA 4V0ME 3WB9A 1R0CA 2R87A 4GPEA 4L74A 5C2JB 4HLUC 5FXMA 3F71A 1FTWA 4FN4A 3SDZA 2O1EA 3H5RA 1U0RA 1BMFA 3KXPA 5BWNA 2PRJA 2D5CA 1GU1A 1Z6TA 3KSUA 1C1XA 3CPEA 5HBGA 1OX4A 2W2TA 3QJ5A 3SQDA 1U3DA 3ZI0A 1V95A 1U2GC 4Q7EA 3TW4A 4QTXA 2QTNA 3ZS8A 3E3OA 3Q8KA 1L7PA 3OU6A 1L4GA 4ER0A 1N8TA 3VRHA 4UAUA 2Y1KA 1SOWA 2PUTA 4DQKA 3BIOA 1U5BA 1CK4A 1KVTA 1UJBA 2VK1A 4WK0B 5B1IA 3ZIAD 1W59A 1ZH4A 5C5DA 1ZRSA 2FE4A 2YWXA 3OESA 1UOQA 2ENWA 3STVA 5KWIA 3ZHUA 1D4OA 4G6ZA 3G2OA 3V00A 3O8OA 1W49A 3CNQS 5FOXA 1JF8A 4M49A 4KQHA 3U1TA 2Y1EA 3ETLA 4A23A 5A6VA 3G2NA 3N8DA 4DUGA 2CJWA 4OXNA 1OROA 3FJ1A 4G0XA 4TRMA 3BREA 5JU6A 3EG9A 1BHQ1 1A2OA 1Z07A 3SFTA 3F5SA 2XOXA 1ISMA 3DAFA 1ZJ5A 3HP1A 3S6JA 4PC6A 4C7OA 3P0JA 5HIKA 4TS1A 4C88A 1T4BA 2HA2A 1ULZA 1AA6A 3I1JA 5LD2C 4R8MA 2J9XB 1GV0A 2XSZD 4OHVA 1HNXB 3NDRA 2NO7A 3CNNA 5F1YA 3BH7A 3QELA 3EGDA 1T2DA 4XQ0A 5B58T 3OH8A 4R7TA 1N8KA 3WMFA 5ALYA 1LQUA 2LE0A 3BERA 4CFSA 4CF7A 3AVYA 1X8XA 1YB6A 3NBKA 1EEXB 2PQ0A 1O95D 3Q3EA 3TUZC 3VKHA 1MDBA 3DDOA 2LW7A 2GYYA 5AI4A 2BGTA 5HFAA 5FOWA 1OFVA 3GYBA 4NATA 1QIKA 4IZIA 1FUIA 2QPOA 1KPHA 4LJSA 5ALNA 3HCAA 4ZVOA 3LAWA 1XF1A 3LCMA 4IP0A 3B51X 5P21A 3U31A 3IAXA 3V7UA 3TS1A 2HXYA 2ZTHA 3C15C 4ND5A 1YASA 4D6PA 3ZLJA 3HKDA 1C9JA 2BFFB 5JS1A 4BP3A 1IQUA 3GC6A 1TO6A 2X19A 3N0WA 3P96A 2HD4A 3EIQA 5CFLA 3INRA 4TSRA 2VDNB 2JFVA 1FDUA 1XDUA 2W00A 1WHTB 3FKJA 3PXAA 4R2JA 5DW3A 3KPVA 3C5EA 3PUWA 1THTA 4GS5A 3T94A 2WTEA 4WGFA 3DKRA 3A9RA 5EMJA 4GPIB 4B6JA 2GZ2A 2I9KA 3TMAA 2JBWA 3A27A 1LJ8A 3CRRA 3IDSA 4OREX 3JQ8B 5F73A 3M5PA 3JPWA 4AD8A 2YN0A 2IYVA 3H5VA 3AZQA 3H84A 4HYYA 1OH5A 1J99A 3FUXA 5CHEA 3IP9A 3MBKA 4RVSA 4YJHA 2VZ0A 3O7MA 5GINE 4P9NA 5GOTA 1ZCZA 1E5TA 3LE8A 4BB0A 1CR1A 1W4LA 3ESQA 3ETDA 2D2VA 3SKYA 3WX0A 3JAMA 2BCEA 4IAOA 2FCRA 4D26A 2G07A 1P1CA 1C41A 1OAOA 1IUPA 1QGZA 5EP3A 1U94A 1EDOA 2Y27A 2B35A 4DLNA 1UAGA 5CTJA 1KYVA 2O2CA 2EBHX 2P9TA 1I7SB 3Q5DA 3VUFA 1QGED 4X7MA 1Y4ZA 1JEQA 3HADA 3TXYA 4EYGA 4JJEA 1O94C 1B0ZA 2J6IA 4LRQA 3PRHA 2YXPX 4RGVA 1YQGA 4HNQA 3L1KA 4REQA 1DQRA 3DEJA 5LIRA 4QELA 1Z17A 2Q1TA 2VDLB 3DEZA 3ROZA 3X1YA 5HQTA 1U3VA 2DHDA 2VYNA 3TXAA 4MS1B 5AW3A 1MQSA 2QW1A 3ED5A 2AJCA 1R27A 4P31A 4I66A 4YS6A 2CEKA 2ZWPA 3EDOA 3HN2A 1M34A 2AD1A 5KKCA 4P5PA 1O89A 1OLSB 3UAVA 5CB4F 3KHUA 4B84A 1WPGA 1QH8B 4W1PA 4Y2PA 2GR9A 1WM1A 1XB2A 3GX1A 4OHPA 4P82A 3THRA 5A5VA 4GH5A 4CV1A 3UHPA 2QQGA 4Q5IA 4F5WA 4PFKA 1Q3TA 3AI2A 4RTMA 1DWOA 2P1ZA 3A1VA 3ANYB 3PQEA 5GADl 1TGYA 4LYYA 3C48A 3LH5A 2JZNA 4FWBA 3EH1A 5E1OA 2GSDA 1TAQA 3OIGA 5SYNA 4IZHA 5LBUA 4YRPA 3H0EA 4RK0A 3N8GA 6LDHA 1E9BA 2MYNA 2AMJA 2YX1A 3PPXA 4ME6A 3WNDA 3G2MA 1T2EA 1LI4A 2SCUB 1YUNA 4OUDA 4NEQA 3ADKA 1BXZA 4US2R 2CL5A 2E1PA 5HG0A 5HF6A 4C7VA 3MWDA 3KP1A 1Y6RA 1RQGA 3T7TA 1RXWA 4W7IA 2AJBA 2W2NA 3CR7A 2Z4TA 1V4VA 2R48A 4KPGA 2VJYA 5FR1A 3VYVA 3WMGA 5EGNA 5CBPA 3UTCA 1FCJA 1R4AA 2AD5A 3RVNA 4EYEA 4AF8A 3CUUA 4HS4A 4ABYA 2I8CA 3P2KA 1E9SA 1RMQA 4P38A 1J90A 4EYQA 4HZGA 2X9GA 3O1IC 1EBFA 1M0TA 2G08A 3CZRA 4DMLA 3FMOB 4R2XA 3MLEA 2EBUA 1M76A 2VHQA 3QEJA 4HLQB 1SVWA 1ZUD1 3PGXA 2GVZC 4J1TC 5DM2A 4F5DA 4YV0A 5ALPA 4H17A 2H06A 2BC9A 2ONKA 5K6AC 4HRAA 4M9ZA 4B33A 1M1YA 2JFWA 1SPBS 3AUAA 1FFXA 2RSLA 2ATIA 2WWXA 2Y99A 1NONA 2ZUBA 3CRZA 3CVVA 1QRTA 3N7TA 5KSWB 2ECOA 4E4YA 3VPFA 2D8MA 1QO0D 4B7ZA 2UYYA 3OBIA 5DO9A 3JU3A 3I92A 3IB6A 2PD6A 4XVCA 3CX4A 1B41A 3A1SA 3BD7A 2XMDA 4DSTA 2AT1A 2RCNA 2Z3WA 4FGLA 2QT9A 2O07A 4UU7A 2QX9A 3OTHA 5B37A 4DMGA 2XADA 4TYMA 3QTTA 4KC0A 2BELA 4OUKX 1WXXA 4UTXA 3F1KA 4LDNA 4CF6A 4TL8A 1C9MA 4NIMA 4YJDA 2RE8A 1GGVA 5A6SA 3C39A 4WZBA 1T36B 5GONA 5JZOA 1JTVA 1MH1A 1U4NA 2YUTA 2ORVA 2CE7A 3CWQA 3HDQA 4K9QA 4F3TA 2XHZA 3A1WA 2G9VA 4ZVNA 1AGXA 4B4WA 4R1QA 3ZCXA 5C1IA 2NZVG 3S2EA 1NNI1 1I7PA 3FOEC 4NMLA 4JLAA 2XMZA 4BGUA 1X9HA 3OZUA 5K2MA 1IOWA 2FPOA 2JK1A 5ALFA 4BGIA 3JQPA 2RGUA 4IIBA 5BNTA 1TVKA 3A6EA 1R0WA 4JJ8A 4Y2YA 4HVCA 1QE3A 3KSRA 1LBIA 4CU2A 4R05A 3PQFA 1SUAA 2XUDA 1PX0A 3HK2A 3E9ZA 1FYFA 1ZUWA 2I2CA 3LSTA 3JYHA 1XZNA 1A7AA 1JHZA 3RSOA 3BE5A 4PHTA 4EMUA 3HKCA 4DR3B 1KC1A 1Z8DA 4Z4QA 5IXJA 2JIPA 3I0NA 2CXTA 3G0BA 1WCIA 4QICA 1Y9EA 5CVCA 2GRJA 4MGKR 4QNNA 3FCUB 3TLEA 2JARA 3TPCA 2IHNA 2ZZNA 4QPPA 4B4OA 5EOVA 4YDQA 3EIEA 4UREA 1VHLA 5EKDA 3UA4A 2N47A 3NHMA 1SK8A 2DBYA 2IUTA 4P4LA 1Z7WA 1G9TA 1ISRA 3VXKA 1ENOA 3BOSA 1C1DA 4I8DA 5B30A 1ZBQA 4IIJA 4ZVTA 1SZDA 4BMPB 3B3FA 4KO8A 2O4UX 2JA1A 3MT0A 1WXEA 5PNTA 3KYCA 2J9FB 2HH9A 2ROQA 4AVYA 1DO8A 1SC6A 5ER9A 5KYXA 5EMLA 4FS3A 2I71A 4FONA 4IQ0A 3PNPA 4JSTA 2TMKA 4QGAA 5AICA 3EDCA 5L7TA 4BQEA 2QK4A 1II8B 4D4LA 3SJ7A 2W5UA 2FKAA 2XODA 2CJPA 1XZQA 4YK7A 2K87A 1DIAA 1EQUA 3KLBA 1HUQA 3EUWA 3LO5A 4WZ6A 3IR5A 2Y92A 2WE7A 1JAHA 2V5VA 3DVSX 2JGFA 3C3XA 1TRHA 3N3BC 4DKXA 2B2CA 5CGQB 3I9FA 1ZOLA 2ZBVA 4QEDA 1G17A 2FWPA 2W6MA 1N9GB 2VBGA 2X0KA 3FUCA 2VF7A 4HWPA 3S27A 2O59A 4BZXA 2ZR9A 5DM70 2PJRA 3T5GA 3OJ0A 1OLOA 1ZVQA 3D8HA 5CJ2A 4OBEA 4QHYA 2QD2A 3MMNA 1JIUA 5KQLA 4P34A 3P9PA 4I36A 2QD1A 4DILA 1SXPA 2PBLA 3H1PA 4BX2A 4ZT3A 2HSWA 3P2JA 1N6NA 3ZBTA 5LP6C 4BJ5A 4TL6A 4TM8A 4YAIA 5BSVA 2PV7A 4RADA 2JI7A 5HE8A 1WCWA 3W9YA 3E8SA 2WPDA 1W76A 4MOWA 3GD5A 1OXMA 2RHBA 3B8EA 3K1ZA 1CDEA 3QVLA 4E5PA 4ESVA 1JT9A 1TUIA 4MQ5A 2OBNA 2WWFA 1YOVA 2DPXA 3Q7QA 4FLEA 4LBVA 4P4SA 2QPAA 4E2WA 1C50A 2ZIGA 2VTBB 3TIVA 2QAJA 1BE6A 3F2IA 1P77A 4KBFA 3N5CA 2Y93A 4LS3A 4P3XA 1VP3A 4RK7A 5I7AA 4HZUA 5IVDA 3VMFA 2XXAA 3ZQ6A 3HUUA 5AJTA 4GLJA 1RJEA 1BDHA 1DWUA 2A57A 4BLOA 4W6ZA 1CP2A 1FLDA 1V7QA 3VNRA 3DWIA 4G5FA 3VR1A 1QM5A 4QARA 3OEEA 4DLUA 3D2AA 2IDMA 1K4YA 2JAHA 3D6AA 1SVKA 4RXTA 2YXDA 4GI1A 4AG6A 2ZJOA 2QRMA 4O1MA 1RI2A 2BJHA 4E51A 4Q3LA 3DLBA 3OJCA 1KIFA 3GNSA 4NBKA 2GMWA 2KYRA 1N7GA 2OCIA 3LZ6A 3OE1A 3EWSA 2WU8A 2JCBA 3DPUA 4GBMA 4RELA 4F6CA 3CVUA 3ZY2A 3NDJA 5CT5A 1B14A 1X1CA 4X6YA 4A2CA 1JDUA 1FB5A 1HTTA 3PC8C 1W25A 4XCXA 2W4QA 3WXBA 1KH1A 5MFPA 4C5BA 4HWGA 4BC1A 5CTAA 4PPFA 4PONA 1FYXA 1RC1A 1ECLA 1Z33A 5HPYB 4GKJB 1UBSB 4TL7A 3A3PA 2DUJA 2AG1A 3GN2A 3RS4A 5I7WA 1A8IA 3BSWA 4EMBA 1KKUA 1N1GA 3OJEA 4C22A 3KSMA 1BOFA 1J9ZA 2G71A 2HA7A 2XMPA 4MB2A 4D6XA 1QG4A 1T5OA 3NWPA 5K3CA 3KUCA 1ENPA 3VU8A 5IJXA 5ELMA 1U0OC 4N01A 5MHTA 4HNTA 3GB9A 3LX8A 2C7VA 2PZEA 1YZHA 2PGDA 3D6VA 5LB2A 5BUSA 2G40A 1WSAA 1E58A 1SC9A 4X9XA 5BNFA 3SSAA 1TRKA 3A6PC 5HDBB 4L4XA 3RD5A 2ZB2A 3OZFA 4AN4A 1QU3A 3R09A 5BR4A 4RD6A 3D3WA 1EK6A 1GPUA 3PKJA 4K9KA 4V0MA 5CRIA 5DT2A 3TLBA 4AK9A 4JASB 5DLDA 1JSCA 3MLBA 1X1AA 4I9HA 3MRSA 4Y2XA 2DT8A 3ZU4A 1JDPA 1E18A 4TLDA 1C7EA 1CDDA 3N2YA 4UAJA 3A6DA 1UQRA 3DAOA 3GMSA 3GW8A 5ALVA 5KQSA 3RKRA 2IL1A 1AXRA 4U63A 6ADHA 3G9UA 5HOEA 3U3MA 1KEEB 1MC4A 1TJNA 1MPTA 1UAYA 2DKNA 2LD4A 1MXFA 4UVHA 3JQ7B 2OCLA 3BZBA 3H1FA 2WWYA 1ADGA 4BRSA 4CT4B 1QFZA 2ODTX 1T1SA 1UDCA 3IQEA 2QXTA 1PFKA 1Z6ZA 2H4YA 4E46A 4NOJA 3PHIA 2IP4A 2C9OA 2PX3A 3AI3A 1XU7A 2RHWA 5BXQC 3ZE0B 2D13A 4RD1A 2JCYA 1ABBA 1A1VA 4Q3BA 2H63A 1V48A 4AYXA 4M60A 1YWGO 3RO7A 4YP5A 4F4IA 1BU8A 3KQLA 4K87A 1Z0SA 4C4XA 2P2GA 1JHAA 3FTPA 3QM1A 2QRPA 4G9BA 4HGQA 2GXAA 1OLUB 2ZBFA 4XUCA 2LXNA 4LF5B 2AL7A 2ZJ8A 2JGEA 2OM2A 2GCPA 2I0FA 2Z43A 3D6TB 4WN9A 4D8WA 3A31A 3TQOA 5FV4A 2AG0A 1N2GA 4XQCA 4D97A 3NGLA 1VMAA 4JLNA 3DCYA 2H4JA 4L9WA 4I14A 1NG9A 1SXQA 1REQA 3ORFA 2C97A 4QFBA 3KCQA 1VIVA 7REQA 2CNBA 3R5SA 1N2OA 4JUAA 1D5CA 3NLLA 3BF7A 3L6OO 4MUNA 4Y9RA 5C8ZA 2EJCA 5A9RA 5JCOC 1D6SA 3DQPA 3ESXA 5A5DA 5BN1A 1FMLA 2C8JA 4LWZA 4TWIA 3AR9A 3CLHA 1WV1A 5DN9A 4C0LA 2YYYA 1EEHA 3N70A 4P1ZA 3NM5A 3VR4A 1W5AA 3RBVA 1VSBA 4L51A 1QP0A 4XUGB 1Q16A 1ABEA 3ZGLA 4BFTA 1VLVA 1B3RA 1DU4A 1XRNA 4IW3B 4KQCA 2Z2JA 5AJZA 3S5UA 4LJ9A 4GSYA 1H1TA 4S1TA 1RWNA 3L4BA 2JGJA 4LNAA 4OHOA 2Q3BA 2YIJA 5FBQB 3OIWA 5DM4A 2H9YA 4MO2A 3RWBA 1Y48E 3LQYA 4P7BA 3DF9A 4UD6A 5JAUA 2VPPA 5K4GA 2GPSA 5E8JA 2DQ4A 1KI9A 1E3TA 1X1QA 3N8IA 5T64A 5DP1A 1LF5A 2H1VA 1SUCA 2JCVA 4M0FA 2CVFA 3BQ9A 821PA 4WNIA 3VH3A 5CH5A 1S9DA 1ZCBA 3CMCO 1PQPA 3CT4A 4KAJA 5FO0A 4BCDA 1M2GA 2C9MA 2VSXA 5CNKA 1E3WB 1TA0A 2C99A 2Y77A 4Z0PA 3HCEA 1TZ2A 2W6JD 1SA0B 3JSAA 5IG2A 2YINC 1K5DA 1J2YA 5CFNA 2ZROA 5CLFA 3DLTA 4URYR 1Z16A 5FR2A 1ENZA 1USVA 4UASA 5CD9A 1KYYA 2W42A 2G17A 3F9CA 3N9IA 5D3ZA 4D0GA 5HZKA 1KERA 2JS7A 3C6BA 4YI3A 2AR0A 3LC0A 4LV8B 3ZE1B 3WLFA 4Q4LA 3FPFA 3O5AA 2P8JA 2F1KA 3JD2A 4QBTA 3GJSA 5KQRA 4CF3A 4F71A 4FYIA 3RJTA 3GROA 3CRW1 1M8FA 2OXEA 1EHYA 3BQNB 4MDHA 4R83A 1QK3A 1E7SA 5ICCA 1EM8B 3R0VA 1A4IA 4C2AA 5AJHA 2P40A 4GQBA 1XWWA 1PLJA 5EIOA 2P9HA 4E1BA 1UM8A 4G5XA 4DANA 1AS3A 5IK2D 2XEDA 4CLEA 2Z9CA 1EYZA 2E89A 2QD4A 2YXBA 4K3VA 5DCUA 3B20A 2OB1A 2Z98A 3C6YA 5I9NA 3Q3IA 2ZRBA 4GOXA 3ZH9B 2YHUA 4JVLA 1IAVA 1SVNA 3IT2A 1U1FA 3NM4A 4JH0A 1BCRA 3EXEA 5JRDS 2JLVA 3UAWA 1FMJA 1DARA 3C7KA 3FCOA 4AJHA 5AUPB 3WZ2A 4EA9A 1KSFX 3GWGA 1S6YA 1G66A 2Y0PA 5AW9A 2MSWA 4UNIA 4G4IA 1JI3A 3C41J 2WTXA 4IIUA 5HHTA 1TKBA 3KSAC 4XARA 1WTAA 4B73A 3DP7A 1A5SB 5KNBH 1YJ8A 2WJVA 1QCYA 2XNCA 4RVNA 3N53A 4JVMA 4R1LA 4XRRA 1UMBA 3C6XA 4IFTA 3ORHA 3QA3E 4A91A 4BNHA 3F67A 2H85A 2HIGA 5IBRA 1ZD1A 2P5UA 5KNLA 1E9RA 5TQJA 3I3OA 4K9SA 2FJ0A 3BK2A 4NOMA 3SCZA 1X92A 3PP8A 4IG4A 4OL0A 4O2LA 3ACDA 3WIOA 1T2FA 2JGIA 1LC3A 3MIZA 5FQNA 3T5DA 2C0QA 4L5IA 3DEKA 3CM0A 2QRZA 5LQSA 1CR0A 4AFNA 4W4TA 5IRCD 2XEXA 1F5SA 2QE7D 2ZSIA 1YFKA 2EWWA 4B3DA 1Q1GA 3W05A 3W3AA 2OHFA 2X1LA 1L4NA 2ZCJA 3KUDA 4YJKA 3B9BA 2VHEA 4TM7A 3ROKA 3MWYW 4OEHA 1R1DA 3S40A 4EM6A 4LOKA 5KAMA 3LJKA 1K6EA 4PC7A 4PYLA 5F64A 5LZ7A 5IP5A 4I3HA 3RS5A 4BVGA 4MR9A 4C3UA 4FNAA 2CLFB 2YJ5A 4NK5A 5A5EA 2Z6UA 1ZUNA 2BEJA 3W1EA 4QQNA 4UOQA 4QGBA 1MIHA 3FB4A 5BSRA 4BZWA 3I8OA 4NICA 4AULA 3UMMA 2NIPA 2SECE 3NYRA 1XA0A 4ZGWA 3JQEA 4MIOA 4KDCA 2JJ1D 4Q6BA 5DWQA 2SKDA 1NI4B 2WSYB 2WWIA 4DG5A 1P6XA 4UEQA 3HUDA 1AB5A 4KWHA 5E0OA 5AM2A 4CLOA 2E55A 3HUEA 1JEYB 5LN1A 2VSOA 2CZGA 3I9KA 1FQOA 4XQ9A 3SS8A 3AERA 4LVUA 1MB4A 4OLHA 2COKA 5TNXA 4U8GA 2FAXA 5KZMB 3M2PA 1YVPA 3SFZA 2CZCA 2JI9A 3LCVB 4D02A 1KGSA 5K0ZA 3BXPA 3WLAA 1Y3HA 3SAJA 4FHEA 4MHOA 4EMTA 5FDFA 4PFJA 1UXOA 2PZLA 1O9BA 3RTBA 3A37A 1W94A 4E5NA 1GL7A 1R88A 4JEIA 1SKMA 1NF3A 3ZJ5A 4DREA 3G2PA 2A88A 3FMFA 4F2GA 4D0NA 4DV6B 2ZAGA 2HT1A 1CV2A 1G20E 4FOTA 4YBZA 4B74A 2P91A 1G0NA 1N1EA 4RQTA 2MYPA 5DHRA 1E89A 4AX4A 4AW9A 3T3OA 3E4CA 3AUKA 4O5OA 1DCTA 3ETJA 5FNZA 2I2XB 1T2VA 4LMBA 3BHJA 1CZRA 2ZCVA 3LKBA 4OYLA 2Y2VA 3F8TA 4HFMA 5I4KA 1TU0A 4X97A 2I1QA 1AB6A 2CCJA 2XJ4A 1HQYE 1KNXA 2ZDHA 4M36A 3TAUA 5FBWB 2IV7A 3ELWA 5CVEA 1MOZA 1J2UA 1ONBA 2AYYA 3QEMB 1GQFA 1T43A 1VE6A 3I76A 5EY5B 1MA3A 3PE3A 1BU5A 1Y42X 2BDUA 4BTEA 2O1WA 4AS1A 1ZIOA 2EYUA 2QLLA 1HQCA 4P36A 3KT3A 3FW1A 3DBRB 4YT5A 4UOEA 1WDTA 1WABA 2WC1A 3FTQA 3HR4A 3M3PA 4GM1A 2DH6A 2WZDA 3UWOA 2L42A 2QY6A 3LBYA 3QY0A 1OZAA 4WD3A 1U4OA 4EY5A 3FDZB 3T3IA 2GNOA 4CL3A 5D84A 4QL3A 1ZD5A 4FT4A 3WGHA 4BKUA 5HF9A 3CH6A 3R77A 2JD0A 4LZPA 2IGTA 3NEJA 2BTQB 3VNSA 3KZKA 2JPDA 2XUPA 1Z2PX 5EE9A 1O96A 2AC7A 1T6BY 1ORRA 4FZ5A 5ENVA 3VC2A 2R2AA 4Z4FA 3AVTA 2VSYA 3OX2A 2BHSA 1TI7A 3JWJA 3SMVA 1LLQA 1YJAA 1NVTA 2QNIA 2Q4BA 3OY2A 4EVIA 4CKWA 1UBRS 1JJBA 4Y1EA 3E5NA 1UBTS 3P0IA 4O4LA 1RYEA 3D3KA 2IPNA 2BHTA 3F6RA 1S8AA 2Q2OA 3DS8A 3AILA 1EUDB 4KZKA 4BAUA 5JMPA 3AJ8A 3FZEA 3MS7A 2E4VA 1H2WA 1F7VA 5KCMA 2HTFA 2DY0A 1NRXA 1Q7EA 2R60A 3P52A 4MVJH 4YIHA 2BUCA 2H9AA 4XJTA 3CYFA 5ILQA 4UE2A 3V46A 2EOAA 1UJ4A 3D0RA 3R7SA 4MB6A 2NYUA 3REGA 3E0QA 1PNQA 3A06A 3D4BA 2HBZA 3CZAA 2ZRFA 1Z2NX 1F1JA 1WPRA 2C31A 2NSJA 4AAYA 4E2XA 5GV8A 5AVTA 3FCAA 2XPCA 4LOLA 5EC8A 4D56A 4DRXB 3KZCA 4OH7A 2YJZA 5KVCA 3SNHA 4EQ6A 4KWCA 2Q50A 4OMFG 1DG1G 1XEFA 3HPRA 4OFXA 5IUNC 1FJXA 1M66A 1GR1A 2AFIA 3EAQA 1JQBA 2W70A 2XCSB 4UEWA 5KJ6A 4YA6A 1T1EA 3KYBA 3ESRA 3UA3A 4GI7A 3VTZA 4B2IA 1SXGA 5K8LA 4R8SA 2JFPA 1I0IA 2IPLA 1F38A 2C3MA 3HDTA 3NS7A 4NDAA 5CB0A 1M1ZA 3CLRD 3J80A 1KQPA 2Q4OA 1QP7A 4FNGA 1E5QA 5KVAA 1OGYA 1YDWA 3T1HB 2G0NA 4FIZA 1N0IA 2HSJA 2ZBRA 4KIFA 3TD9A 3AV3A 3U7IA 4D8XA 4MHTA 3U49A 4D4IA 2QI9C 4LV5B 1E63A 1U7UA 2H08A 4OK3A 3DE1X 4JBIA 4AJPA 1FF9A 3RVKA 3S1SA 2WIBA 3FF4A 4I8IA 4MX8A 5BW6B 5JAHA 1NJGA 3AETA 4X5OA 5IKEA 3G1UA 3I34X 2RK3A 4X3OA 1GZVA 2CMFA 1JHYA 5AXBA 3SF0A 1YBFA 4HATA 1QYDA 4E6PA 3FTEA 3CNLA 3LT5A 4LJKA 3GVCA 1SHKA 1NBAA 1TGVA 3ZXUB 3A3OA 5GONF 1GLVA 2IF0A 3MWEB 4OJQA 3FHCB 2H0AA 1E2PA 1Z0IA 3I42A 3LUCA 2FEAA 5B2ZA 4UHJA 3FIUA 1YMQA 4K6KA 1UKEA 3ZVNA 1FTNA 1P80A 4OP2A 2TECE 4YRAA 1NWHA 5K6AA 1KGDA 4R7GA 5H8WA 3QMPA 3TTWA 5K0JA 1MIOA 1Q1ZA 5IC5A 5TRTA 2VNKA 3I5AA 4NMWA 4ZAYA 5H3LA 4DLBA 3M4YA 4U2EA 5JOQA 3IOBA 5C37A 1IDN1 4IEEA 1U8YA 2ZR0A 2CUKA 3H2IA 1CQIA 1FDWA 2A5FA 2XVMA 4BVJA 2J6BA 4XTRA 4FMPA 2BBSA 2C7OA 5KTPA 1NW8A 4UUNA 3UHJA 1EVIA 3LBNA 2QN7A 1FNBA 5A03A 1PVVA 4OSPA 3GZNB 2OUKA 2IS2A 2JH8A 1FYDA 1BQEA 4O33A 5DI3A 1ZD2P 2Z58A 3N76A 2KSQA 5TB5A 2FEPA 4EMSA 2E4WA 3K6JA 4PHGA 3SVTA 3DHVA 5FEUA 3WYAA 1ZM2A 2PU7A 1CY1A 1H69A 3KFXA 4URVR 1J9EA 2XKJE 1HE2A 4Y9DA 2PGXA 4C6TB 4YRIA 3JZAA 1E2KA 3FJOA 4E70A 2GAJA 3ONEA 4B6GA 1YCHA 2JIZD 5AW7A 1XZPA 1V3TA 3EIUA 4V3CA 4FDVA 4ZCQA 1COZA 4NJMB 4PX3A 3EUEA 4JA2A 4YT2A 3D0OA 3KLPX 2MINA 4JKOA 4RM3A 5AHXA 5JS6A 3MJHA 3PB3A 3R24A 3VZPA 4DBLC 1XYYA 3F6SA 4J0QA 4NYIR 3H9GA 4ALNA 3DHWC 5CLJA 5KNCD 2ZATA 3CB2A 3ZXXA 2VJMB 3R3ZA 3ZX4A 1Y8RA 1GDDA 5GGXA 2A4KA 2R6HA 3GEPA 3T38A 4QOIA 4DIFA 2C54A 4L9RA 1IULA 2NPOA 2YASA 4M6WB 1NQUA 3AHIA 3LTEA 1F12A 1Y8QB 4MW2A 5TPWA 2PUJA 3IJ5A 1W0JD 2K2WA 4DRZA 5BPHA 1L5ZA 4Z3KA 1RRGA 1KP3A 2WMOB 1RD4A 2AFVA 3BPSA 1PZMA 4LC9A 5IF3A 5D3MB 1Q7CA 2LCQA 1A4RA 4CEJB 1PE0A 3LX5A 3C3AA 2LZ0A 1A9OA 4N39A 2ZRKA 3OQHA 5E6UA 1CFZA 5DRYA 1S2LA 5LWQA 4OKIA 1U2DC 1G8JA 4KXLA 2Y67A 2D2IA 4D3ZA 2FWNA 2H5EA 1AXEA 4FFBA 4EHKA 5CHYA 1EBUA 3HVJA 4BNDA 3AHFA 3FOWA 1C9EA 2R00C 4UZEA 3QXGA 1V3UA 3K31A 3RAPR 1SQ0A 1T0BA 2P2ZA 2JZCA 4JC5A 4BECA 5GWXA 1A9PA 2HN9A 1OWMA 4MVJP 3TQIA 2DOKA 3ED1A 5M29A 1SBIA 3LF2A 4CFZA 2HRDA 2ZUDA 3AB3A 4P3YA 2BAGA 5IVKA 3NJRA 5J1TB 1JKFA 4U6NA 2YC4C 1OFIA 1W1IA 4XD7A 5HJ7A 3L8MA 4LVCA 1J1UA 1D0IA 4FOLA 3IRVA 1XK6A 2IXDA 3HRKA 3STUA 4EVQA 1KAMA 4OXKA 2Q1SA 1NMQA 2V97A 4C21A 1QBGA 3W06A 4CIYA 3MA0A 1E0AA 5JSFA 2AN1A 5DLPA 2QX7A 4WKBA 2UXBB 1LBTA 2IYXA 4M87A 5B3JA 1MNQA 4Q05A 1PFYA 2XWSA 3JVVA 3S70A 1J8MF 4AS2A 1VBNA 5GVSA 4JNCA 1KAGA 1E2GA 1S7GA 4PFQA 4XM2A 4BNZA 4K03A 5B1YA 2VPWA 2V5AA 1Z0DA 3NASA 2NU8A 1IG3A 2FZKA 1KA9H 3O31A 5ESRA 3TAXA 1XMVA 4ALKA 3RVRA 2X6QA 3GT4A 1GPWB 3MTGA 4KDRA 4Z7JA 3EEBA 1A2BA 1TJ5A 2WKWA 3R44A 3ZS9A 1PZHA 2VUUA 1TEZA 3VHRA 1AMOA 2GPYA 4RDHA 4AZVA 5A7FA 4YYEA 1VSVA 3B1KA 3D4NA 4WKNA 1Z26A 4C76A 3RWOA 1RPJA 3PHHA 2P9JA 4S3MA 1VJRA 5BWBA 2Q5CA 4QDUA 2VF8A 2GN1A 4ARIA 4DDUA 1SCDA 2CD7A 1SIUA 2ODWA 3C24A 3OKAA 3EDQA 5CYGA 3F47A 3PUHA 4A8HA 1J5PA 5JXIA 1ZGJA 3VH4A 4NENB 5F52A 3SI7A 4PR3A 4QYIB 4KLCA 4BLQA 5L53A 1MEJA 3KVRA 3M9LA 2Z04A 3N28A 5CJPA 5HMLA 2CLEB 5T3UA 3PHLA 3RRNA 5B6PA 5JZ9A 5HQJA 5AW0A 4W5RA 5B7PA 1CETA 4L6CA 4ZMRA 4U9IS 3ZGXA 3T5TA 3VKVA 1SRQA 5B1DA 4GU5A 1X2EA 2XT9A 4G65A 4UPVA 3C6QA 4LMRA 3JZDA 3TFOA 1LVGA 1BE1A 2JLBA 3IP5A 1Z29A 5HP4A 1KI6B 3HCCA 4OQ4A 2YW2A 1BS1A 2E3JA 1OC2A 3K2QA 1IBCA 1X7YB 4X8MA 3PVZA 2WZBA 1RAFA 2J4CA 2Q3LA 3SIRA 3N0RA 3L7NA 3BJRA 3NDIA 1ETHA 1S1MA 2P4HX 4JCOA 3VSAA 2C5LA 4X8LA 3IS3A 1XMOB 2OXCA 2G83A 3FFWA 3ND5A 3MC1A 3AHCA 4IGAA 4ARVA 5C7YA 1C2TA 3KU1A 1AF4A 3MWKA 4AQYB 1T1JA 1EAMA 1CZHA 1V8DA 2QX8A 1E8MA 1PN3A 3WLHA 4PS1A 3K05A 2P75A 4BGEA 3LFTA 1WEHA 4DXDA 1N0HA 3E1KA 1GNRA 1SXJD 2J5RA 3BUSA 2PKQP 2P11A 4FC6A 5B12A 4YUWA 1QTIA 2PTGA 4OSEA 1B8VA 1QZZA 1YSCA 1CKEA 2WM3A 3QUTA 3IUEA 2GM9A 4LBYA 5TQ2B 5A2QA 2MYUA 3MCVA 3TGWA 1XCMA 2DWCA 4YV7A 1DEAA 3TLZA 1NV9A 4D4GA 4UTOA 4NBNA 4P53A 1VKHA 1QV7A 2ZSDA 2FMXA 3EIHA 3T9DA 2R86A 3H4TA 1EK0A 3DEFA 4N82A 4RS4A 1YE8A 4C4RA 5CCXA 1FBNA 2VPYA 2XGGA 1N1MA 3FNHA 3MINA 4H1VA 2J9YB 4MUFA 3OIYA 4P6VF 1ZYUA 1J0AA 2HU2A 4BYGA 5AHRA 4I0WB 1SKQA 1QYRA 3MB8A 1Q50A 3CO5A 5TGZA 1BDIA 1YT5A