1UBEA

Msreca-adp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords RecA
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 86
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubeA01
3KTAA 4RCYA 4MKIA 4KJZA 1RRPA 4PC2A 4C3ZA 2JDID 4ACAA 3U6KA 3CPEA 1KO1A 3TGPA 5E7JA 4CW7A 1S1MA 1K5DA 3LBHA 4NCKA 3QQ5A 1ZINA 2XJ9A 5LBIA 4C0BA 3UWKA 5EJEA 3FKSA 1KAOA 5K8IA 4LBZA 3GLGA 1X1SA 4D2IA 3CX8A 4J0QA 2F1JA 3IKJA 3O8RA 4GMXA 4Q1DA 4ERNA 5AJYA 2C9CA 4Q9LA 4ABYA 1AN0A 4ZCIA 4EAQA 4OI0A 5KDOA 4H9GA 1TQDA 3PXGA 4C30A 2ZVPX 2YZ2A 1NBMA 1E9AA 3GJ7A 5EE0A 3ZD6A 3PCRB 5DGXA 3IUYA 3U7EB 2YC2C 2IYWA 2FOLA 4M1TA 4P4SA 4Q19A 3THXB 1GAJA 2D4HA 4DWJA 5C1BA 1TF2A 1A5TA 3N2EA 4B34A 5JJLA 2QE7D 2QMHA 4A8JB 1P60A 5JJIA 2GAAA 1DAHA 3LQRA 1GVNB 4G3XA 1MOZA 1NY6A 2WM9B 1S8FA 3KJHA 4PO8A 1DARA 4P32A 3K9NA 5JS7A 2AD5A 1N6LA 2BC9A 4HUQB 1HE1C 4NYIQ 1DG1G 4Y0AA 3SDZA 4MKGA 2O8EB 2OLJA 2HDNB 3RLFA 3SC3A 2IK8A 3EASA 4EPWA 3FHCB 2JLZA 2GTPA 4PANA 4FCVA 3AVTA 5IK2A 3T06B 3LBNA 4AK9A 1GM5A 2ZREA 3AH8A 2GVZC 1UDXA 2NQ2C 1E79A 3IO5A 1QHHA 3T15A 3KQHA 1V5WA 3ZS9A 4E07A 1E96A 1CJUC 4M1YA 3IIKA 4IOMA 4RZ3A 3TSOA 4D82A 2GXAA 3ZLJA 2KBFA 5J5CA 1CJKC 1NY5A 4RJLA 4ZDKA 1TMKA 1BYUA 4EJSC 3V4RA 4FI3C 4Q9KA 1SGWA 3F8TA 5K8LA 5SZJA 4UJ5A 1X8JA 3KZ1E 2OFWA 5JS8A 2VHJA 4FCTA 4RFSA 4M1KA 3WHLA 5AJVB 1KY2A 3QOFA 3L0SA 2G0TA 1CTQA 2VH5R 5TB5A 2PJZA 2QBYB 1JAHA 2OESA 4OBEA 1NP6A 4B2LA 3AGQA 4XD7D 5JRJA 4BEBA 1GNQA 2QTVB 3AVWA 1RZ3A 2WWHA 3CRRA 4MITA 1P61B 2FPLA 3K0FA 3RANA 5HKKA 3VNVA 1J8YF 2A78A 2XX3A 3U3MA 5AUPB 1Z6XA 1VCNA 2CE7A 2FF7A 2A5GA 1W36D 1G5TA 2CEAA 5EP4A 3LRPA 4JKYA 5CYPA 2HYIC 2GXUA 3FMIA 1ZU4A 1Q21A 1E2MA 3AVUA 2ZSFA 4MKHA 2FZLA 1H65A 2QTFA 4D0GA 1N6KA 3F0TA 1R10A 2J1LA 1O3YA 4LV5B 4Z54A 4DLTA 1Z0AA 1WMSA 1XD2B 1E9BA 4MRVA 1XWIA 4MRSA 4TT3A 4Z1MD 3GJ4A 3ZDQA 1KK1A 2R65A 2PEZA 5F9FA 2WTUA 2F9LA 2IYTA 5DH9A 3K8YA 4I1UA 1KSGA 4OQNA 5DE3A 2CLDX 1T8TA 4MGKR 2ZROA 2F1RA 2VHUA 3VR1A 2RGNA 1ZNZA 2WWWA 4LSGA 4TMXA 3KKNA 1ZCAA 3ADCA 2PZEA 1TQ4A 1XCMA 2LWIA 4HI0E 3AV0B 1SULA 3ZIAA 4KFSA 1R5OA 2FDCA 1N0VC 4GRAA 3TUIC 4GZLA 1COWA 4WW0A 5CJ2A 2BM1A 1EESA 3O8DA 521PA 4B6FA 1FX0B 4R7ZA 5DHFA 3G5UA 1MO4A 4CGZA 2ZE8A 3FPAA 4DSNA 3VFDA 4FN5A 4OQMA 4DB4A 4JLDA 4JVSB 2A2ZA 2MSCB 4A36A 4MA4A 3Q85A 1R2QA 3CRMA 4N0DA 1E2JA 4B3BA 4HAWA 1QHYA 1YR6A 3JVVA 1G7TA 3QVVA 3T5GA 2NO6A 4HLQB 3SBDA 2C98A 1OLOA 1GUAA 3GLHB 3UMSA 4NH0A 2WPDD 1D2EA 4A0HA 4C2TA 4A8JA 2GWHA 2QORA 4QHSA 2N42A 4URYR 1FW6A 4PTLA 4CVNA 4QM6A 1X8LA 3GPLA 3I8XA 1U8AA 3NBXX 5F98A 3VHLB 1EFCA 3QI2A 1EFRA 3RS7A 3TMKA 2ZI9A 3AVYA 2JLRA 2ZE5A 1QRAA 3X1YA 1CIPA 3QJYA 3QXJA 1X86B 2D2FA 3RRYA 1P3JA 4X8LA 4EIWA 1JJVA 4BLSA 3B1VA 2JLVA 3RS4A 2PCJA 3GJ3A 2DCUA 2G77B 4OK3A 4NCHA 4AC9A 4IDPA 5D3MB 1Z8FA 4BUJA 2ZUBA 1KI8A 4GDFA 4N1AA 3LLUA 1LY1A 1TPZA 3A1WA 4K81B 3NDPA 1KK3A 4Q5IA 4G5OA 1Z08A 3GEEA 3BFVA 1EX6A 1D9XA 3WHKA 1Z63A 1ZM9A 2G88A 3MCAA 1TF7A 4Q9HA 1ZCBA 3OIWA 2O8BB 2BBWA 1GTVA 3P1JA 4LJ6A 4KODA 2FFAA 4TMVA 3TSWA 2GAOA 1NRJB 2QBYA 1W0KD 1XPRA 4TMKA 2REBA 3SEAA 2JAQA 3QKUA 2QSZA 2W2TA 4A15A 4BFXA 4LY6A 4QG7A 4TL6A 4ASUA 2ZITA 4LJ5A 4EFMA 2QEQA 3IEVA 3FFBA 2YWHA 2Z83A 1D2NA 2VA8A 4AD8A 1E1QA 4DSTA 5KYKA 3EPKA 1AZSC 1R6BX 4PSVA 4LWZA 3TIFA 1LS6A 4Q01A 5BQ5A 3B6EA 1HQYE 1JR3A 2UZ3A 4RCZA 4TN1A 2ZYVX 3C41J 2AXNA 4V0MA 4C0JA 2OEPA 5KHOC 4Q9IA 4S35A 3DPUA 3OFNA 1VHLA 1ZC3A 3TH5A 1XD2A 3WNCA 1N2CE 5FOTA 1E9SA 1EK0A 1EXMA 5LD2B 3EZFA 5CITA 1T8UA 1VKJA 3CONA 2D2EA 4L16A 4ZKDA 1NG1A 5JZVA 1W7AA 3EPLA 4IDOA 1LTQA 1QVRA 3HYRA 4M0LA 2WWIA 4QNRA 2ZJYA 5E4FA 1NIPA 3TKLA 1OYYA 1NLFA 2DFLA 5FBRB 1E2KA 5FUXA 3EAQA 4BLQA 1TEXA 4KBFA 1MRSA 4DXAA 4URZR 2H16A 4QGHA 3UWOA 3M1IA 1RIFA 2VYFA 4A0RA 2R62A 2H57A 3A4MA 4CT5A 1G18A 1ESMA 1FNNA 3QPUA 4L4UA 1NVXQ 1FX0A 1M2OB 1KNXA 4H1UA 1KDTA 1M7HA 2ZJ8A 2CVHA 2V4ZA 3RC8A 3BH0A 1H8EA 4JL8A 2QUZA 4WOPA 1KI7A 4KSBA 4JL6A 1N5IA 4M21A 4QBFA 3BE4A 4QJ3A 5BYJA 1SXJD 3U3OA 2X2EA 3ZGXA 3U3KA 1W47A 1IN6A 2RB4A 2GVDC 4KSCA 2RGXA 4QBGB 2ASEA 2CE2X 1GKIA 2V8OA 1ZVQA 1WF3A 3PFIA 2ZYTX 2XB2A 5EXPA 1CBUA 4BGDA 3GJ6A 4NZYA 4Q7JB 5J4YA 2RHMA 3K9LA 4BFZA 1JAIA 1WCV1 1X1RA 4GOXA 4BASA 5DIFA 4PAQA 5F3WB 3F3YA 4LHYA 4D4MA 5LPNA 1E9DA 3AP1A 2IXEA 4B48A 3KKPA 3BD9A 1R4AA 3CPJB 1E2GA 1R8QA 2GJSA 2R6DA 1YZUA 3AB3A 4FCWA 3BH7A 2QL6A 2DB3A 2OT3B 4RSGA 2XXAB 4BFYA 3LD9A 4I1SA 1KKMA 1U81A 2IYVA 1AZTA 2W83A 4D4LA 2HLDA 2QPTA 4I99A 4V0LA 3OEHA 2ZJAA 3AP3A 4A8JC 3OEEA 5FH9A 1ZD9A 2JCSA 5D3MA 2NPFA 2IYQA 4HB0A 5FOXA 4NDZA 1XFAA 2HF9A 4GNKA 5E7IA 4YXWA 4XSHA 5HCNA 5AR1A 1G4AE 4Q4AA 1NMYA 5HE9A 1C4OA 4PC7A 4JLOA 3EZ7A 2O8BA 3QKRB 4G5RA 2HJGA 2TMKA 3IEUA 4QKQA 3K70C 1J90A 1J99A 3K1JA 3X1WA 2CK3D 4WAUA 1P73A 1SVKA 3IO3A 2XNDA 2ZI4A 5GJBA 2REXB 4BLOA 4YDSA 3TW4A 1JNYA 4NL4H 4A2PA 4CF7A 3SOPA 5EE3A 5JHHB 2F3TA 1VCIA 3U4QB 4MYCA 3K0SA 4NE2A 2V7QA 1RRCA 2GCOA 3AVPA 121PA 4C2UA 2JJ2D 3SI7A 1AS0A 3GJ8A 4C0AC 4PHFA 4Q7MB 1ZNYA 3DKPA 4UXHA 4R2IA 5L3VA 3TE6A 1F60A 5BN4A 1BS1A 3DL0A 3W6NA 3TSZA 2B21A 1FMJA 3AF4A 2UKDA 1N25A 1Z0DA 5HPYB 4RKFA 3W6PA 1IOZA 3LX5A 4DVGA 4N0EA 2R2AA 3VMFA 1P9WA 2OE2A 3L0PA 2ANCA 1TQ6A 4LJ9A 3TBKA 1T3HA 1E9CA 3X1DA 1QVAA 3FKSD 1P2TA 3CWQA 5KDLA 3VR2A 2PMKA 4IFEA 3ADBA 1UF9A 1XJ0A 2C99A 2QZ4A 1S4QA 3MRSA 1RRFA 2WHXA 2UVQA 5DO9A 1J7KA 4JVMA 4B76A 3MSXA 3K09A 1XTIA 4IRUB 4OQLA 3AF3A 1NBMD 1AQUA 221PA 2B8TA 1XEWX 1OIVA 4IEIA 4RY2A 2WJYA 3PUZA 2J59A 1Z2CA 5TV2A 1A4RA 2GDJA 2FA9A 1CU1A 3NBZC 2Q3HA 5CM9C 4X8MA 5UKDA 1WE2A 3WBJA 3RRNA 1HUQA 5TY0A 4ARZB 1E2HA 2ZI6A 1A2KC 1DAFA 2IYSA 2A5FA 2WJIA 4DZZA 1S9DA 3AM1A 5EQTA 2OCBA 1MO6A 1P4SA 4P31A 3ZQJA 2HYDA 4W5WA 5DYGA 1E9FA 1P7CA 4OHXA 3W9YA 4G0NA 3AKDA 2N46A 1EG7A 1TF5A 2IEZA 5DN6A 5HCIA 5EE5B 5A4JA 2VP0A 3UPUA 1NVVR 4DDWA 2G9NA 2Z4SA 1NMXA 4Q4LA 1E3MA 3BXZA 2AD1A 1L7VC 2R6AA 5IK2D 2AKYA 3QXCA 4P4TA 2ZRKA 1KI3A 1TU3A 4PC6A 1E79D 2WSMA 4GMDA 1OF1A 4BFSA 2XXAA 4II7A 1XCPA 2H7VA 2IUTA 2F43B 4BRUA 3VNUA 3LQQA 4QHTA 3T5DA 2F6RA 3QBVA 1OW3B 1Z06A 3U2QA 2Z43A 3HJNA 4C7OB 5DISB 1S3SA 1Z07A 2ZU0C 5FPTA 3FVQA 5JEEA 2ERYA 2OCPA 2EWVA 2ZJZA 2JIZA 2QT0A 3AVVA 4ZDJA 1II8B 4QOSA 1XTQA 4Q1EA 2ORWA 4AG6A 2J45A 4B75A 2X77A 1W4AA 1YZKA 1XXHE 5JI3E 1QZXA 5D3QA 1G16A 1NLZA 5HKKD 1JBKA 4LYFA 4QXAA 1XEWY 2OILA 4X8HA 4UXIA 3X1XA 3PR1A 4ZPXA 5DLQC 3AF1A 4DLXA 2WICA 1YHNA 1ZBDA 2CL7X 3U4QA 1IXSB 2ZSEA 2ZSDA 3NDBB 3SHWA 1XJCA 2FV8A 5EZ6B 2X8AA 3EPHA 1G6HA 3I1FA 1Z28A 4Q1CA 1E0SA 3CUEF 4V0ME 1S1CA 3VAAA 2L0XA 1N3BA 1R5BA 3VR3A 2EFDB 3THYA 4LCBA 4XVQA 4KVGA 4DCNA 2GF0A 2Q3MA 1NN5A 2RH5A 2IW3A 1HY3A 3RVBA 4FINA 4TWZA 2D74A 3KJEA 2OBLA 4Q03A 2CLCX 1FOEB 1K8RA 4QBHA 2YINC 3CZPA 3B1ZA 2JJ1A 1Q22A 3FWYA 4M2LA 5FI0B 1AS3A 2H17A 1HE8B 4XIGS 2V9PA 1Z6TA 1GDDA 4DJTA 3ZIAD 4C0SA 4EPRA 2ZETA 2CVFA 2IT1A 3KL4A 2YHSA 4G5SA 1COWD 4HZUB 3G0HA 2AWNA 4QL3A 4JIMA 1D6JA 5FOUA 1RFLA 2IEYA 2BMJA 5LD2C 3TR0A 4KCGA 1U8ZA 2OCYC 4GOJA 4DLUA 1E9EA 5E3HA 4ARZA 4AKGA 2Q6TA 2ZJ5A 1XMIA 1YQTA 4MUAA 4NP6A 4E22A 3GLHE 2QTHA 2NO0A 1AKEA 4NYMR 1RKBA 3GEIA 3GJ0A 4PC1A 5DSZA 4BFWA 1E4YA 3KJGA 4TYWA 1TNDA 4PXAA 1F48A 1KZ7B 1G3IA 5BN5A 4HAYA 1QHNA 2SHKA 5B2ZA 3B1YA 5FOWA 1UJ2A 4P3YA 1Z47A 1QG2A 1IY2A 3FMOB 3CX7A 3FMPB 3DZDA 3T1TA 1GSIA 4WVFA 3BJIC 5CK5A 3L2OB 3IDQA 4S2EA 1PUJA 1Z0KA 5EZ5A 5JBQA 1ESNA 1UBCA 1VIYA 3Q8XB 5FL7A 1EFTA 4C9BA 3DZ8A 4PAMA 3WRYC 3BOSA 1NVVQ 1UDWA 1J70A 4LV6A 1CKEA 2AX4A 1SVIA 4TYNA 2F43A 2D06A 3ZZUA 2IHYA 1XTKA 3FFAA 4XWAA 1O87A 3VKHA 2DHRA 3DVLA 4LPSA 2N1BA 3VR5A 3WBKA 4BLPA 4NMMA 4C7OA 2DYKA 2JASA 1Q12A 3KKMA 4GI7A 5JWHA 3FB4A 1IN7A 1KNQA 3CNNA 3IBGA 1GILA 1GP2A 2K5UA 4JLAA 421PA 1OH5A 3LXRA 3R8FA 1Z0IA 2XGJA 2PBRA 2ZI7A 1BMFA 2IL1A 1II8A 3FTQA 4OI2A 2VP6A 3TK1A 3IIMA 1HT2E 2JLUA 1SKQA 2PZFA 3RABA 2HF8A 3R20A 1E0AA 2CXXA 4MGIR 2HCJB 4AG5A 3C4JA 1R0WA 2WKRA 4KAXA 4ASUD 5DI3B 2QMUA 5FFMA 1XZPA 5FPKA 3ZVMA 4A92A 1GG2A 1W4BA 4IFBA 5BYKA 1II0A 3ZVRA 2B92A 1DADA 4HUTA 2GXQA 4L9WA 4EPXA 1N6RA 4MUBA 3GJXC 3JZAA 1E1QD 5FR2A 3A6PC 2ZAMA 1K6MA 3V4FA 5C2JB 1E1RA 5GVSA 1XJQA 5JHGB 3KB1A 4KFUA 2W58A 1DO0A 3MJRA 3FHTA 5KTYA 3CW2A 1JR3D 4BFUA 4D0NA 4DLVA 2P6NA 3OFND 4TQUS 1T3LA 5M04A 5G53C 1R7RA 4URWR 1WRBA 4JBXA 3EC1A 4OHYA 2HCBA 3E5HA 3THOA 3FYHA 4BLRA 2CL6X 1XZQA 2QMEA 4U02A 4YMWA 2QQ0A 1UKYA 1Z83A 4LUCA 4XWKA 4ILEA 3A1UA 1OIWA 1VYUA 2F3RA 4CRWB 3W8NA 3K70B 4FD2A 3TRFA 4I1OA 5F9HA 3JVUA 2LKDA 3V9PA 5EP1A 1JXMA 1JQJC 5H70A 2VRWA 3CPHA 1XPUA 1KO7A 2AK3A 2CHQA 1CULC 2ZPTX 3PV0A 4HZUA 4NCJA 5FI1B 3IBYA 3ASZA 3HWSA 3OZXA 2VP9A 4DLWA 1LF0A 1UAAA 5TMPA 1YE8A 3NG1A 1H8ED 3QXSA 3P20A 4PAOA 2J7PA 2Q3FA 2E9SA 2OG2A 2OCAA 3Q72A 4DCVA 5CIWA 4MDEA 2ZRIA 3GP8A 2O8FB 1KO5A 1U99A 3C7KA 4D25A 1YR8A 3LDAA 4OK6A 1Q1QA 2EW1A 4CYMA 1XXHB 4K8OA 1FL9A 4D4JA 5EP3A 1G20E 3MUFA 1E2EA 1W5SA 2O0HA 4US2R 5IF9A 3QIAA 2FEOA 1GL9B 4HAUA 3SJZA 2QENA 5J4KA 3HU3A 2C5LA 3N5CA 2Z0MA 2GBLA 1AA9A 5CIQA 1FTNA 4DIDA 3P27A 1IN4A 2FFQA 4IOJA 2WMNB 4JLMA 5EUMA 1M7BA 1Z6AA 2FFBA 3CZQA 1QG4A 1VTKA 2A3RA 2OLKA 2P2LA 4M22A 2HLDD 3BIFA 2WJVA 4Q00A 3OEHD 4M9QA 4M1OA 2BDTA 3OEED 4V03A 1CR4A 4UJ3A 1Q44A 3ZS8A 4YXWD 3BBPA 3KX2A 3HR8A 2YVUA 1UFQA 2FSGA 1VYTA 4B3GA 1KAGA 5CYOA 1DAIA 2IHBA 3B1WA 2BVNA 2KI5A 4DC9A 2IWRA 1KSJA 1TQ2A 3MLEA 4GP6A 3VQTA 1V43A 1R5NA 5H8WA 1E6CA 3NH6A 1WP9A 5FBQB 1ZAKA 1M74A 5B64A 4UQOA 3L82B 3TJZA 4NKRA 3H4MA 4PZYA 4ZCMA 3GLIE 3BS4A 1JEEA 4Q47A 2XNDD 1G5PA 4PO9A 2HEIA 1HA3A 4F91B 4I81A 1Z2AA 2DFKB 3R8CA 1CRQA 1TADA 2JATA 3I72A 4EPYA 1BIFA 4TMZA 1OXTA 2V7QD 1HEIA 4EPTA 4AKIA 3AUYA 4MH0R 4C0QC 4WXRA 2OHFA 4O0MA 4L15A 4LGMA 3THXA 1BKDR 1P9RA 2HT6A 2OUKA 2X19A 2J41A 4YLGA 5FBLB 3DOEA 2RGCA 3B8HA 2VP4A 3LXXA 4R71A 4QM7A 1KOFA 1UEJA 1E0JA 1EFUA 4IKEA 1PVOA 3VR4A 5G3ZA 3IPYA 4CEHB 2NTYC 3ONWA 4TLDA 3WMFA 2ZE6A 2VP5A 5JMTA 3EC2A 4MKFA 3PUVA 4PFSA 3E1SA 1IHUA 1UKVY 4IDHA 1F2TB 3FE2A 1VCOA 4HUQA 4B3XA 3W3AA 1EX7A 1W4RA 5GVRA 5B58C 2O8EA 2G1JA 2XTMA 1Z5ZA 3QF7A 5J4LA 4FXPA 3RRZA 1CF4A 4TLBA 1ELOA 3LY5A 2YV5A 2V3CC 5FBWB 4P4UA 3SE0A 4RFVA 2H1LA 3HR7A 4MYUA 2A9KA 2IA5A 2O0JA 3T35A 2C8VA 3RRMA 3EA0A 2XB4A 3WNDA 4CDGA 5KDDA 4ZI2A 1YR7A 4KYIB 4I1VA 2OAP1 4RD6A 1G3UA 2DFNA 1KKLA 2FH5B 2RGBA 4DUGA 4HAXA 3RS3A 1KY3A 1MKYA 4HLCA 5AJXA 1KSFX 1OFTA 4BPBA 4G1UC 3K0AB 4KYUA 5KUTA 4JLNA 2GHIA 1OXSC 3K9HA 1KHTA 2EFEB 2O8FA 1FTSA 3U44B 4OHZA 2GK7A 1GITA 4FWTA 3ADKA 3RWMB 3EPJA 2VSXA 1T6NA 4TLAA 1WQ1R 4HDCA 5ANRB 1J8MF 1XXHA 3KXIA 2QQEA 5EXSA 1ETUA 1N6OA 3NWJA 2GEVA 2IF0A 5DN6D 1M1YE 2ZTSA 2QRZA 1F5NA 3CKLA 2AFHE 4QRHA 1YU9A 2XSZD 4GBMA 1E32A 5FTNA 1EFHA 4TQAA 2XOKA 3O8CA 3ZVLA 3IPXA 4OJKA 2IBMA 2YNMA 3GFTA 3CRQA 2XJ4A 1JXOA 4TSFD 3T1OA 2VBCA 1FPMA 2C96A 4C0KA 4AKHA 1DELA 1QF9A 4ESHA 3W34A 3OF5A 3D31A 2D7CA 5TXGA 1I4LD 3SBEA 2H18A 2G0NA 4GSYA 4PHHA 2DPXA 1G64A 2BCGY 1OH6A 1XDBA 2GCPA 1R0ZA 1CJTC 4F7WA 1YRAA 2J46A 4PR0A 2F9MA 3BFXA 1G291 3CNOA 3QG5A 1BOFA 4B44A 1JI0A 5J47A 4XH9B 1OFUX 4PO1A 2C78A 2EVWX 3PQCA 3UANA 3KQLA 1WBBA 2ERXA 1DE0A 4O2RA 3C16C 2BMEA 2GBLC 1GKUB 3TAHA 4XVRA 4KITB 1XNJA 1ZNWA 5G40A 2JIZD 1C1YA 1DEKA 3A8TA 5FPHA 1US8B 3EX7C 1KI2A 4YDHB 4CIDA 3A1SA 4DLSA 1NVUQ 2VO1A 1YZTA 3B9QA 4AKEA 2H92A 2EFGA 5GJWC 3BAFA 4O25A 4PSAA 3W90A 1N0UA 4EFLA 3QENA 4Q4JB 2QGZA 2ZRDA 3PEWA 4RVCA 1TTTA 3BWDD 4NYJR 3LBIA 4AY2A 4ZKEA 3S1AB 1IJFA 1G17A 2YYZA 1MH1A 4EKDA 2IS2A 4CT4B 5FOSA 4UNNA 4JSYA 1EGAA 2AK2A 5L3QB 3EXAA 1RJ9B 1W48A 1U98A 1U0HC 1W0JA 3AGPA 4TYPA 3LA6A 1VHTA 2QA5A 2QROA 3GLHA 3LAWA 1XRJA 2ZRBA 3B5JA 4PHTA 4CEHA 3FGNA 4A6XA 5EUQB 2WVJA 2YKGA 4IJMA 5H68A 1AA3A 4KV9A 1F2TA 1HH4A 3PG5A 4NBSA 4PZLA 4F93B 2ZRMA 1A82A 3UK6A 2JJ1D 2ONJA 1H8HA 2ZRNA 2BMDA 2IYZA 2FSFA 3OIVA 3RC3A 4ZCLA 1NIJA 3B85A 3SYKA 5HE8A 1KO4A 1P2UA 1JB1A 4AWXA 5JCPA 2C04A 3K53A 4DHEA 3KB2A 5CDFE 2XITA 5CK4A 2ZRGA 2DWQA 3PENA 2JA1A 2QP9X 2ZR0A 3AKEA 4Q66C 1G3RA 3UIEA 3REGA 3A37A 4ZIRB 1XMSA 5EP2A 1QHIA 1IJEA 4KHZA 2VHQA 1SVLA 2QM7A 2IWHA 1SVSA 2AFIE 2XTZA 1S2MA 1M7GA 3RNLA 2QAJA 3H84A 3P32A 4ZO4A 1OV4A 1YRBA 3W5IA 1DPFA 3SU8A 2EFHB 3CWZA 3GMTA 3NTUA 4EDHA 3U44A 1MT0A 5C18A 5JWOA 5A5GA 4OK5A 1N6NA 3GFPA 4I4LA 5FTJA 4ZDWA 5KSOA 3GLIB 3AVOA 4TLEA 1I2MA 3DMDA 4BLTA 4KFTA 4C4PA 3RAPR 2ZSAA 4TTQA 4TL7A 2F55A 4TZ6A 5KSPA 2Q21A 1PUIA 3CB4A 1NG9A 2YC4C 2W2XA 1N0WA 2EFCB 2RGDA 1TAGA 3JZMA 4YMTA 1E94E 5B57C 4DCSA 2QAGC 3MWLA 4LYHA 4BZPA 3SFZA 3Q7QA 4HB4A 1KI6B 2GK6A 2CNWA 5FL7D 3CLVA 1I4DD 1HYQA 4WXPA 4BZXA 4QGFA 2BHRA 2WAYA 4OI4A 2ORIA 2MSDB 3LV8A 1G19A 1VG0B 3QSYA 2ECKA 5IRCD 1WA5A 4D6PA 3M4YA 3CH4B 2ZRLA 3C15C 2IS6A 3HU1A 2PJRA 5G41A 4JYCA 3HU2A 2OAQ1 4LI0A 3K0EA 4E5UA 5CB6A 2VIIA 3T34A 1RYFA 2D3WA 3MWKA 4DUGD 3IIJA 3T12A 2A5JA 2PL3A 1ZM3A 1VECA 2RMKA 4PPNA 1G7CA 4B3DA 5BWMA 4KO8A 4OHWA 1BMFD 4PC3A 4B33A 1XMVA 2XTNA 1P72A 2GF9A 2BM0A 1ZUHA 2DBYA 2YWFA 3DO6A 3FHOA 4A4DA 1VG1A 1FUUA 1XBTA 4EUNA 1OJLA 3DKVA 1C9KA 1RC8A 2FFHA 1DBSA 3K0CC 1SVMA 2WOJA 3LW7A 4MRRA 4Q4JA 3ZQ6A 3KFXA 1LB1B 4AYXA 1KSHA 1KMHB 4GL2A 3S1AA 4B2IA 1G8PA 3W3ZB 1E1RD 4PPQA 1OH8A 4D26A 4DT1B 1T0JB 4B74A 3PEUA 2Y8EA 4OL0A 2B7CA 2JEOA 2BEKA 2VF8A 1RJ9A 2WJJA 2ZS7A 5BN3A 3I61A 4UNRA 2W6IA 1WBDA 4KVAA 4ITRC 2DR3A 4L9SA 4IVPA 3ZH9B 4JKIA 4NYJQ 1S9HA 2AHOA 4HYYA 1IBRA 2J0SA 3BRWD 1OFIA 3SN6A 1JPNA 1Z0JA 1ZC4A 2GILA 2ZI3A 3U7GA 5TARA 1KK0A 1P62B 5EE1A 4B2PA 2VSFA 2OSBA 3SYNA 1R0XA 4BRWA 5JCZA 4DEYA 2XSZA 2J7KA 3NHAA 1N5LA 3QE0A 1VPLA 5KO2A 2V54A 3WMGA 4HLUC 1S96A 3KXLA 1Y63A 1KIMA 4TSFA 2REOA 4QNMA 4M8NE 4ACBA 1DOAA 3KUCA 4BEJA 1NF3A 1LS1A 2FZ4A 3C14C 3TNFA 1E2FA 3ZVNA 5CJPA 4JVLA 2HV8A 1FNMA 4BQSA 1ZU5A 3WNBA 1GRQA 1L2TA 1M6NA 2YOHA 3O8BA 4RD0A 2GEDA 2WJGA 3ZYCA 2VP2A 3VKWA 3V00A 1HV8A 4DCUA 5JLJA 2JJ8A 1XP8A 1IN5A 4ZIRA 3NKVA 5GADl 2FPMA 2J7PD 2PH1A 3HPRA 2GJKA 1UKEA 2JLYA 3GD7A 1W2GA 5FTLA 3BB3A 1QHXA 4Z8YA 3EZ6A 2RGAA 1MABB 3MWYW 3KTAB 2ZRAA 3QKRA 1OT3A 4R98A 1AGRA 4YMUA 1NI3A 4KLNA 1J2JA 2VSOA 3B82A 1UEIA 2CCGA 5DHAA 4Z51A 4DSUA 4PPFA 2WZQA 5J4VA 1D2MA 3CNLA 3GLIA 1MO5A 1KDPA 3A4NA 4O2LA 4IDNA 1AGPA 1E2PA 3L8YA 4Q02A 3DHWC 2WBLC 1Q1BA 1L4YA 2NGRA 2QP4A 4Q4HB 4W5HA 3VR6A 4BFTA 3AEZA 3THWB 3BGWA 5SZIA 4YONB 1U0JA 4Z8XA 2OV2A 3OAAA 5CLLA 3FOZA 4OYHA 3RS2A 4TYQA 3DMNA 2Q0HA 3QEJA 1BYIA 1KI6A 3QNUA 3CX6A 1IQPA 1Q57A 3D8BA 3OE7A 3MGCA 4LBWA 5F2EA 3RSLA 4B47A 2HUPA 1ANKA 3MJHA 4PX9A 3CM0A 2QP3A 1ZMXA 4M9XA 4TL9A 2WKPA 2D7DA 3WYGA 4QGAA 1XPOA 1CXZA 2XZPA 1GWNA 2RGGA 1QHSA 4JLKA 2B6HA 1OB2A 2ATVA 4FWIB 3WYFA 1WXQA 2HXYA 3DEFA 4MRPA 4IXMA 2Q9CA 1SKYB 4DB2A 2F7SA 1XD8A 1KI1A 3LFUA 4LHVA 2NMVA 3QEOA 4DDTA 1G3QA 5CLQA 2AWOA 1DG3A 3C5HA 3QXHA 5L3SB 2QPAA 1MR3F 4B71A 4LRWA 3LVRE 5EE9A 3KUDA 3T1VA 3N70A 6Q21A 1KMHA 4P0TA 2RHDA 1KI4A 2FE4A 1N6IA 1E0KA 4BECA 1ZW6A 3EIQA 2ATXA 3AVXA 5BXQC 3NC0C 2R9VA 3TQFA 4LJ7A 4HDQB 3KKQA 1RYHA 2IYLD 1L8QA 4Q18A 3GLFE 2RAPA 4V0OA 1ZJ6A 2NO9A 3TQCA 3UG7A 1KJZA 3FDIA 3HP1A 3U3JA 1P9NA 4IDQA 5A0FA 1DAGA 4GT1A 4POAA 3KDSE 1NKTA 3QXXA 4B73A 3ZZTA 3PIRA 2FJUA 2J0VA 1WDTA 3K70D 4Q7KA 1R8SA 4B3FX 5LB2A 2RGEA 5J40A 2ZVQX 1GIAA 1XD9A 2BV3A 2ORVA 2CDNA 3WP1B 3KQNA 2X2FA 4MRNA 3EA5A 4PSKA 4JMPA 2GRJA 3QKSB 5JEDA 2GNOA 2ZRPA 1D5CA 1S0UA 2QY9A 2FGJA 1OKKA 2AKAB 3SJAA 2G83A 3GFOA 4PQFA 4M1MA 2A7QA 4W9MC 4LK2A 3QPWA 3SZRA 1SHZA 2IUSA 3UXMA 4M53A 2WV9A 2V6JA 2LKCA 2AR7A 4BE7B 1IM2A 1G8YA 1JJ7A 4IW3B 1MABA 2Z5FA 4D0LB 3NIBA 3RSOA 2R44A 4JT2A 4YMSA 2BBSA 4G01B 1LV7A 2YWGA 4DLYA 5AK0A 2BJWA 3ZZ0A 4MDFA 4Q4HA 3SR0A 1LFDB 3VX4A 4F92B 2XOKD 2O8DB 2DY1A 2PLRA 3THWA 4JBWA 2EWWA 3FMFA 1EWRA 4CEJB 5EXXA 2VEDA 4JLJA 1GL6A 2KSQA 1GL7A 1OE0A 1TX4B 2IYXA 5JRZA 3U7FB 3ICQB 4DDUA 2CHGA 3U3RA 3GJ5A 4KI0A 3CH5A 4PPGA 2C03A 1RE0A 1IY0A 2CLSA 2ZM5A 1Z22A 5JI2E 2OFOA 2G3YA 2ZIAA 5SZHB 2GETA 1T5IA 2VPPA 2OFXA 4YMVA 2V55B 4B35A 3WMEA 1IONA 2GZHA 2W0SA 2ZAOA 2F1HA 5TVKA 3DDCA 2OBMA 3B2EA 2R8RA 1G8HA 2JLWA 1RVDA 5CDFA 4O3MA 3NHBA 3UMRA 2P0EA 5KSYA 3I73A 2P67A 4ZDIA 5L3SA 3P4XA 3X2SA 3CO5A 2YOGA 1JEDA 1NVWQ 5AUNB 4JLPA 4US0R 3VTKA 2R6GA 4US1R 2QAGB 3P4YA 4FMCF 2CHVA 1OPXA 3W6OA 1SXJC 4LJYA 1W5TA 4U5XA 3WP0A 621PA 5DNYB 2O5VA 2FSIA 2WOOA 3QUSA 5K8TA 2ZYUX 1W0JD 4M9ZA 3DOFA 4XTCS 2FX3A 2GESA 2JLQA 1SVWA 4KLZA 1Q0UA 1XX6A 3KJIA 1ZUIA 3VU9B 721PA 2KBEA 2C9YA 2VHCA 1GNRA 1CR2A 4NYMQ 3IQWA 3AF2A 1D8TA 4EQ6B 2V6IA 3NEJA 1KYIA 1H8HD 3NEYA 3R9IA 2WWYA 3LNCA 3EZ9A 4URVR 2BJVA 4HB2A 1G8FA 1YVDA 2IYRA 3EG5A 1R0YA 2BMFA 5L8VA 1SZPA 1JR6A 4HZIA 5J4HA 1XMJA 2O52A 1U9IA 1CJMA 2P6RA 1ZP6A 4LPKA 4NONA 4UNPA 4FMBB 3TUZC 4B3CA 2BWJA 3I4LA 1FP7A 3QKSA 4TTRA 4G5QA 3PUXA 3LVQE 3NC1C 3HDTA 3ICEA 2WSSA 1JPJA 1GNPA 4JJZA 1OH7A 3LH5A 4TLCA 2OZEA 1UM8A 2I1QA 2JGNA 4H1VA 4JL5A 4NTZA 4Q7LA 3SNHA 2CCKA 2WWFA 2E87A 821PA 4QGGA 5LDDC 4Q1AA 1KJWA 3IHLA 2AN9A 3NBYC 3L43A 2ZRHA 5TDHA 4RZXA 4LJAA 1TEVA 4NPHA 3SQWA 5JWRA 5DI3A 1E2IA 1A1VA 3T1QA 3R9XA 3U61B 3ND8A 2PX0A 1DAKA 1OHHA 3R7WB 4DRZA 2ZR9A 5G3YA 4Y0VA 5FUWA 4F4JA 2O8DA 3ASYA 3MFYA 2MMGA 4A2QA 2ZANA 3UKDA 4CEJA 2QI9C 2XZOA 4LJ8A 1G1MA 5H1YA 2CNWD 4URXR 4M9SA 1EWQA 1NN1A 1KDOA 3CF0A 3C5CA 5P21A 3UATA 2RKOA 1FZQA 3AQ4A 4NU0A 3CR7A 3WRXC 5IT5A 1AKYA 1E69A 2P6UA 3KQKA 5FOVA 2J0QA 2HT1A 3GQBA 1VDZA 3OESA 3GLFB 1PLLA 5C4GB 4HB3A 2QU8A 4JZKA 4Q1BA 4WZ6A 1SXJE 3P26A 3BERA 2NOAA 5DYIA 2ZRFA 1AJEA 4FMDF 4LC1A 3RHFA 1ZD8A 1IXRC 2I4IA 3T61A 2I1VB 3B78A 2P5SA 3F5FA 2ZEJA 3IHWA 3AP2A 1I2DA 3EW9A 4U00A 4A82A 4W5JA 3BORA 1X3SA 5IDVA 1CR0A 1YR9A 3RDPA 1KDRA 3MD0A 4Q21A 1Z6YA 2W00A 2EYQA 4TMWA 4XSGA 3TLXA 1W36B 3DM5A 1ZM2A 1NMZA 2H8KA 1GFIA 3NVAA 1FMLA 2ODEA 3EARA 5AWFC 4LHZA 1DAMA 4LC0A 3RS0A 3QKTA 3L0OA 4LBYA 4QJ5A 1PLKA 3BB1A 3EWAA 1CS4C 1KZGB 1MV5A 1LW7A 1N5JA 2R6FA 2W6JA 1ZUNB 4M1WA 3I5YA 1ZM7A 3A4LA 3BB4A 1Q1EA 2Q9BA 2QAGA 3A1TA 3TVTA 1N6HA 3R9WA 2ZRCA 2ONKA 4WZAE 2J0UB 4TZ0A 1FP6A 5B30A 1PZNA 2W6ID 2OXCA 4GZMA 4IOKA 2ZR7A 3LW8A 1JQLB 4BWYA 2JDIA 1AS2A 4DIEA 1XTSA 2AL7A 4JYBA 3HPQA 1PV4A 1MO3A 2DFTA 2BBOA 2PEYA 3CF6R 4D80A 4DLRA 3SYLA 4Q4AB 3TR5A 1KJYA 4PZZA 3TVDA 2F1IA 3VU9A 3WXMA 5KOYA 2FSHA 4HLDA 4FMCB 4QHYA 4UNSA 2FG5A 1P6XA 3Q9LA 4XWOA 1G6OA 5KNDA 1YZLA 1JECA 1S3GA 1GZSA 4RKEA 1E2DA 2UZIR 1LNZA 4EQ6A 3AKCA 1DS6A 3EWSA 4F38A 3BC1A 2V1UA 3LX8A 4DEXA 1G8GA 1TU4A 1DVRA 2YWEA 2XNSA 2CBZA 3PUWA 4A6PA 4JBYA 2ZJOA 4WIAA 5IHPA 2XEXA 1M34E 4E09A 3CIOA 3K0CA 4AIIA 4OQFA 2OO7A 1W49A 1P5ZB 2GCOB 4YC7A 1XEXB 3IGFA 4HSEA 2HXSA 3K9GA 1I4TD 3NBFA 3EZ2A 1XB2A 1U0LA 1DAEA 1FUKA 1N5KA 1NL3A 4C0HA 1NNEA 3H2YA 1XTJA 4LHXA 4F4IA 4U7DA 2QE7A 1UBGA 3NXSA 1A7JA 4JLBA 1B0UA 4F4CA 1E9RA 3MAAC 4EPVA 1MRNA 2EYUA 4KXFB 2C2HA 1TUEA 1ZYUA 4AYWA 1BO6A 4TYYA 1G21E 2BKEA 4ZI3A 3LLMA 2C9OA 2GZDA 1U9IC 3U7HB 2E1RA 3BH6A 3B7GA 1U90A 3BK7A 3ZJYA 4GP7A 4C0LA 3GLGE 1AIPA 2QNRA 3TUJC 2FPKA 4HLUA 4RD2A 4XJXA 5GJVC 3CRW1 1HQCA 3A1VA 3OAAD 3R7WA 1QBKC 3U60B 1XEFA 1PJRA 2VQSA 1A2BA 4A1FA 1NBME 4LYAA 2GA8A 5KNCA 3RWOA 1VCMA 2P3SA 3MWJA 4XTRA 1YZGA 3VKGA 3B13B 1U8YA 3OE7D 3FKQA 4MYTA 1P2SA 2O0KA 2Z4RA 3SQXA 2ZS8A 4PQYA 1F2UB 2GCNA 3PITA 1OSNA 3GLFA 2IS4A 3A36A 2IF2A 2QN6A 2MSEB 4OKSA 2A30A 3REFA 4LZZA 4KU4A 3I92A 5JSZB 1BH2A 2EQBA 5KPDA 2YOFA 1SHKA 2KWIA 2OBNA 2RGNC 1NJFA 3E70C 4FIDA 4JT4A 5CM8B 3X1ZA 2EU8A 2BCJQ 2KE5A 3HYTA 1L4UA 5FPSA 1SKYE 2ZE7A 4XD7A 1Y3AA 2OM2A 2B8WA 2VTKA 4EFNA 1X6VA 2IYUA 2J87A 4OHVA 2VHTA 4GOKA 2GXSA 2I3BA 3H86A 1KTVA 1XTRA 3O47A 3GCGA 2NO1A 1KGDA 4FMDB 1AK2A 2VF7A 2NO7A 1D9ZA 4MQBA 4LJ4A 3IQXA 5C46F 1N6PA 2WIBA 4A0GA 4N3NA 3K0AA 4HAVA 5E7MA 1E2QA 2PMDA 2X1VA 2MMCA 2ZU6A 2J0UA 1KI9A 3ZD7A 2ODBA 2WWGA 5ELXA 1E98A 1F3OA 1OXVA 1YKSA 4Z1MA 3OIYA 5FR1A 2CL0X 1HT1E 4OJQA 3B60A 4B32A 2J3EA 2RCNA 4L5BA 3I5XA 3G82C 4LHWA 3SJBA 2IXFA 3OIUA 1Q3TA 4Q9JA 4IEEA 5E95A 5JJKA 2WWXA 2PT5A 3N2IA 1PLJA 5JECA 2WKQA 4W7SA 4FW9A 3WYAA 3Q7PA 2GJ9A 1P2VA 2PT7A 4A0FA 3ECCA 1M8PA 1NJGA 3B1XA 2ZJBA 1W1WA 3PJRA 1CR1A 5KNBA 4D81A 3AUXA 5LB4A 4GPTA 1T4GA 4DKXA 4AYTA 1E2NA 1OKKD 3AVQA 5FBVB 1SXJB 1XEXA 3L8ZA 3Q3JB 3QF4B 1YZNA 3H1TA 2IUUA 1XF9A 1RPZA 2GZAA 1E2LA 4G5GA 2YJTD 2GJAA 1Q3HA 3M0EA 2QT1A 2BEJA 3THYB 2WPDA 3SFVA 2DWPA 2NPIA 4X8OA 1DTSA 3ADDA 1FQKA 3PVSA 3W5JA 1US8A 4V02A 4MGZR 2A5YB 4EJSB 2ZSBA 5HR5A 5KU1A 4RD1A 2GJ8A 3CR8A 4WZBE 8OHMA 4RZUA 2ZRJA 3QPVA 1ZM4A 4Q48A 4LOAA 1X8KA 3D6TB 1UKZA 1RW4A 4PQRA 1SQ5A 1G4UR 2G6BA 2XZLA 1T5LA 5HTKA 1LF5A 4E03A 5FUYA 3AF0A 1T0HB 2CCJA 2GKSA 4IHQA 4V0NA 3UG6A 1KMQA 1P75A 4R9UC 2LCFA 5FUVA 5L3QA 2QMOA 4WBSA 1T3SA 3A58B 3Q5DA 2OXRA 4K46A 2KJQA 2FGKA 4DDVA 1GOTA 2J9RA 2XAUA 4CEIB 4DLZA 3VHXA 4M1SA 1F6BA 3SHFA 1Z29A 3EIHA 1G3MA 4MYHA 1G9XA 4OQXA 1NN0A 4R2HA 3Q5EA 4ZV4A 4CZ2A 1F2UA 1ONBA 1Z0FA 1KK2A 4A2WA 2C95A 3QY0A 4QJ4A 1JALA 4IOLA 4MGYR 1LVGA 1ZNXA 3MG9A 1IN8A 5JSZA 1RRGA 1IXZA 3MMPA 2WJHA 3I62A 3H0KA 2W0MA 1IAQA 1W0KA 2A5DA 2C77A 3D7MA 2AXPA 4AURA 2BOVA 2CJWB 4IXNA 1OB5A 4D4KA 4QC2A 1OXXK 5KPJA 1OIXA 4PHGA 1FQJA 4NCIA 4XOIA 3NH9A 1HTWA 1OXUA 3LO5A 1E4VA 1E99A 3M6AA 3QVUA 1TUIA 4RD4A 4URUR 1ZRHA 2FN4A 2ZXUA 1CP2A 4QFMA 3I8SA 2FWRA 5EXTA 4LBVA 4HAZA 1CEEA 1UBFA 4UNQA 1T9HA 3CF2A 4IVRA 2ZYWX 2O8CB 3E2IA 4JVNA 4JJKA 4LDJA 1VG8A 4P33A 1IY1A 1HURA 1B23P 2FEMA 2B7BA 2V1XA 5HZKA 2WMOB 5FTMA 5AJZA 1W36C 4LV8B 1W2HA 5K8UA 3GLGB 2HJVA 4KBGA 4KFRA 3OHMA 2ZQ5A 5GJCA 2NG1A 5AJWA 5KSZA 2VLIA 1YJ5A 1G41A 2IX3A 5AUQA 1WB9A 1ZIPA 1FFHA 2ZI5A 2QM8A 1K5GA 1Q1ZA 2ZS9A 4BZQA 1U2RA 1UADA 5CB8A 2G1KA 4B43A 2J5XA 3PEVA 1GKYA 3D3QA 4P4SB 4RZ2A 4HDOB 5JFGA 1NN3A 2H5EA 2PZGA 1G5RA 1KO8A 1CRPA 4JSTA 1UPTA 1SXJA 2QSYA 3QF4A 4NYIR 5C4MA 2WSSD 3U5ZB 3RYTC 1QHGA 3PEYA 2W2VA 1JR3E 3TW8B 1XCGB 4YQFA 4AI6A 1II9A 4DBLC 4XVUA 2D62A 2PCLA 4LX0A 2QG6A 2WAXA 4V0KA 3B9PA 5L3RA 3PUYA 2VL7A 5BW8A 3SJCA 3I3SR 1VG9B 2R6CA 3J81k 2PX3A 3IILA 4TT3D 3ETLA 1GRNA 3DM9B 5SZKB 3RS5A 2JLXA 5DI9A 4EJSA 4JS0A 3WY9A 5FTKA 1SVOA 3U6BA 3KKOA 1Z6GA 3KQUA 1VMAA 2NZJA 4L8GA 3UMFA 1TL7C 1T91A 3L0IB 4HATA 1OHHD 2FNAA 1W46A 1QHHB 1XU4A 5FPYA 1UBEA 3QBTA 3QG1A 4QBIA 4DT1A 4B6EA 2BIFA 3BFKA 2Z6VA 3VX3A 3KXKA 2ZUCA 5FL3A 2ODWA 4UXJA 4Q1FA 3CRVA 4RD3A 1QDEA 4CEIA 4TTPA 4TL8A 3GEHA 2WIAA 3W8RA 3I32A 2JLSA 4IVQA 2KB0A 1NLYA 2IC5A 4ON9A 1OYWA 1G7RA 4RFSB 1AQYA 1ZIOA 1U94A 1NSTA 4NHOA 4TMTA 3CBQA 1W44A 4DCTA 1Z3IX 1CJVC 3AKYA 2ZUDA 2ANBA 4HEJA 2ODNA 1ODFA 2IYYA 2FU5C 1W4CA 1DO2A 1OFHA 3EIEA 1NSFA 2DWOA 2CK3A 1Q20A 3K0FB 4GFDA 1CLUA 2QGNA 1G7SA 2Q9AA 1AM4D 5HZHA 2IS1A 1YZQA 2CJWA 2QPOA 3K09C 4UKDA 4LYJA 4TQ9A 1GRRA 1VIAA 3SS8A 2GEUA 3C8UA 4OI1A 4BFVA 1NKSA 2P65A 1ZD1A 2NZ8A 2NIPA 2P5TB 4WA7A 1EFRD 3TAUA 3ND9A 3KFVA 1VYVA 2JJ2A 2QRNA 4JLVA 2W6JD 4NCNA 2BKUA 4ESVA 3LWNA 4DSOA 2PLFA 2BBTA 2CMKA 2ZJ2A 4M4SA 2FMXA 5AUOB 2IXGA 2O8CA 4A9AA
chains in the Genus database with same CATH superfamily
3KTAA 1YULA 2WUFA 4MKIA 3T94A 3LCCA 4C3ZA 2JDID 4NFLA 3U6KA 1IL0A 1KO1A 2C59A 4EO4A 3KPUA 1S1MA 1K5DA 5J1TB 1XAGA 1W85B 2O8VA 4JR0A 5LBIA 5C8ZA 4EGCB 4YALA 1T24A 3UWMA 5EJEA 2O2HA 1I6LA 2A9PA 3S44A 3T7JA 1E18A 1KAOA 5COAA 4A26A 4C06A 5K8IA 4LBZA 4A7PA 5MF6A 2AI2A 3DYIA 4P53A 1ZXLA 3GBSA 3LF1A 2LIPA 2Y6VA 1ZK0A 3O8RA 1HE4A 3CKMA 4ERNA 2ZWIA 3ABRB 4MV7A 4U4AA 2CZQA 3O9MA 1ZRMA 3Q4GA 4Q9LA 4C1BA 4EAQA 1K3FA 3V4VB 5KDOA 4H9GA 1ZONA 3KYJB 4KQIA 3PXGA 4S3MA 2ZVPX 1YIAA 2IYPA 3JSXA 3L4BC 3AIIA 2Y1LA 3HABA 4NSNA 5EE0A 1VJGA 4ZU3A 3HA7A 3DUFA 5KQGA 1YC5A 1K88A 2IYWA 7REQA 3PFCA 4M1TA 3Q7IA 2J32A 1OY1A 4Q19A 4ZOBA 3KAPA 4G4IA 1GNSA 2D4HA 3FPJA 4Z99A 4A2CA 4DWJA 2FPWA 2ABWA 4D3FA 1X2EA 1A5TA 3KTOA 3IP6A 1O9GA 1P1JA 1YZHA 3N2EA 5HOEA 5J1SB 2QE7D 1P60A 3Q1LA 1ZESA 4A16A 1GVNB 4G3XA 2F62A 4I4NA 3C3XA 3KBBA 4DRXA 2QSJA 4EY7A 1D03A 4PO8A 1DARA 3L6DA 5AI5A 3K9NA 4C4TA 3D2BA 1O95D 1JHUA 1HE2A 4ONEA 1N6LA 4NYIQ 4ZQHA 3UGTA 2D59A 4IF4A 3EGCA 4ZARA 3RLFA 3ND6A 2YZMA 2GBFA 2Z3ZA 2H0RA 3RIMA 3FHCB 3JV7A 2JLZA 2YJ4A 2QN3A 2B4AA 2EBFX 3O1IC 3T06B 3BMQA 4F5EA 1O6BA 2CSUA 2WE8A 2C61A 2WM3A 1U0EA 3AH8A 5GONF 2GVZC 1YE5A 2VT3A 3QVLA 1CWUA 3BJMA 3UJAA 2IU6A 2P0AA 1ZQ1A 1SZDA 5CH3A 4E07A 1E96A 3TSOA 3K0KA 4G1MB 2X14A 3KV3O 3ONFA 4RZ3A 4D82A 1X2BA 2KBFA 2X7HA 2PBFA 3QU4A 4QPPA 5AYVA 1NXPA 5CB4A 4RS4A 4DLPA 3N75A 3A6EA 4ZDKA 1BYUA 2ZBUA 3AFMA 4S05A 1GGHA 2HAEA 1SGWA 1Y1TA 4J2TA 5BR7A 5SZJA 5K8LA 4MVJI 4UD2A 1X8JA 3KZ1E 3T8YA 3KKZA 4KK3A 4KBYA 4RFSA 4GI5A 1J09A 2P4UA 5IJ9A 4F84A 2BELA 2FZCA 1E3QA 5A4IS 4KAJA 1XVAA 4EW1A 5AHOA 2G0AA 4ALKA 4E15A 1NP6A 4X3CA 5ALFA 2PD6A 2DSNA 1FMTA 2VXBA 3JQQA 3C8MA 2ZZKA 1LPAB 1SUPA 1P61B 1Y8QB 3PSAA 3RANA 1N34B 3VNVA 1J8YF 1ZVJA 2H9IA 2YKOA 3PC2A 4LK3A 5AUPB 1Y6JA 4QOEA 3V6MA 1Z6XA 1T6XA 2CDCA 2CE7A 3S68A 1KL7A 3H2SA 1WW8A 2CEAA 3K2BA 2IP1A 4RK0A 2BKAA 2HYIC 3FMIA 3I2HA 1V2HE 1E6KA 4F9EA 1Q21A 3T7CA 4FVTA 3FNBA 4YP6A 4DE5A 4D9FA 3KXPA 3WWCA 4KXXA 2B30A 1LZLA 4X24A 2FZLA 2CLIB 3MSCA 3TLEA 4AXXA 2VK8A 3OQOA 2WMDA 4CU5A 4OQZA 1V25A 5K0SA 2XWJI 3M4NA 5K3EA 1RXYA 2PLAA 5BPHA 4C88A 5CU7A 3UMGA 2IHNA 3KLBA 4AMZA 1Y8ZA 3C6XA 4WK4B 1O0BA 1XD2B 3GXOA 5ETJA 1LFAA 2WQ7A 3BEOA 1VM6A 4G8BA 5DTMA 3PNVA 3ZDQA 1E2BA 3UJDA 3TLAA 1DKOA 2PEZA 1NQXA 1L5GB 1ABEA 3RYFB 3WL8A 5JXJA 4U2BA 3HCBA 4WZBA 2F9LA 2DFPA 2EGHA 1R9GA 2BSXA 2OGSA 4OQNA 5DE3A 4IH9A 2ILVA 3IAS1 3ZV5A 3F3KA 3A2KA 1WNTA 2VXCA 2X2PA 1U04A 2WWWA 4LSGA 3M3HA 4PPYA 4F6LA 1JFRA 1VPTA 3FRIA 1ZCAA 1SZJG 3KKNA 3NGMA 4LY9A 5ALGA 1PL7A 4PZCA 2C7VA 1UZAA 2QSUA 1DBQA 2VPIA 2W6QA 4HI0E 3W5DA 1EQUA 1SULA 3C7AA 3L7CA 5ER9A 3W3AH 4D3XA 1FP4A 2FDCA 1C4XA 2A88A 3GU3A 4HDRA 5CCXA 3TUIC 4BKUA 3BTSA 3ZXSA 2X2OA 2ZPUA 4WW0A 2BM1A 1AZLA 3SYTA 1EESA 1L7MA 2JIPA 2VRBA 4R2LA 3ZE9A 5DHFA 1I1OA 4GR4A 1MB0A 2BY4A 3I52A 3S27A 4DSNA 2FPGB 4FN5A 5A3VA 4OQMA 4QDKA 4DB4A 4JLDA 3NOOA 4JVSB 2A2ZA 1GUDA 4K87A 4MA4A 1NW9B 1H2HA 4RXUA 5D5QA 1Y98A 3EULA 5JSYA 1E2JA 2QWXA 4CNBA 2F3QA 3BWXA 4B3BA 3TLYA 5DNUA 1SBNE 1VCHA 2CNBA 1ECBA 1VJ5A 3T5GA 4BRSA 4HLQB 3SBDA 4DV7B 2BPOA 3JQCA 5F78A 1OLOA 1J4AA 3PXBA 4NH0A 4A0HA 3PFWO 3D5QA 2Q07A 4QHSA 3O0DA 3FCOA 3ML1A 5FXMA 1WDWB 4LXYA 4URYR 3F97A 1FW6A 4PSUA 1XDUA 1CB0A 1X8LA 4BQSA 2QUIA 1DRJA 2WF8A 3BYZA 1BDHA 5F98A 3VHLB 2ZJ4A 4PX5A 3BHJA 4ZI5A 3IP3A 1U6IA 3RS7A 3DOHA 2JLRA 3AVYA 5F1PA 4MJ3A 4NG4A 4R31A 1CIPA 3QXJA 1X86B 3M3PA 2PBLA 2QTGA 1JJVA 1GZ5A 4KYVA 3T1NA 5CFZA 3B1VA 3DBRB 5I9IA 2JLVA 3PJGA 2GX6A 2PCJA 2J9FB 3Q0IA 5B7GA 2G77B 5JH7A 4RFLA 5TGTA 4NCHA 5C32A 5CLHA 2Q7OE 4WASA 4DTCA 2BTQB 3LDHA 3FWPA 3VTZA 2WWTA 4N1AA 4B80A 4XB2A 1U0BB 4OUDA 3A1WA 4K81B 3TRHA 1VBKA 1GAXA 2QK4A 2M32A 1I2CA 2GRAA 4GR9A 1VJCA 3HFJA 1KDZA 2NU8A 4UOEA 1PT5A 3IRVA 1Z63A 3KHSA 2GBGA 2TMGA 1E5TA 2G88A 1H3NA 1XDDA 5ALNA 5SICE 3PWKA 4P80A 1YDGA 5GP1A 2ZSJA 2W8ZA 2O8BB 3T9CA 4FCCA 4X92A 1UBHS 4TMVA 1N8SA 2ZTUA 3SLRA 3W5SA 1SAYA 2GAOA 2VJYA 1QP4A 4BV8A 5KYXB 1H66A 2NSHA 4XCVA 3SR3A 4ODIA 5K0TA 4S1OA 4EKYA 2REBA 3ROXA 3SEAA 3QKUA 1UOEA 1YONA 4UFOA 3PDJA 4ASUA 4NE9A 4BO0A 3DWEX 1RPAA 1YOVA 2ADOA 3E9YA 4MQFA 5IM4F 3FFBA 4KW7A 5K01A 3AERA 2W2QA 2I7DA 4FEGA 3B6MA 1N2ZA 1ODTC 2VA8A 3EVFA 1V11B 4C7VA 3OPNA 1ZG3A 1WXWA 4CKEB 4DSTA 3IB6A 2ONZA 4O63O 1UK9A 2YJ3A 3HN2A 5JE8A 4MDHA 3VM6A 1DJNA 4PIPA 1Q0PA 4AT1A 4Y9UA 4EI9A 1XYGA 2O6HA 3KD3A 1C0KA 2R1TA 2HU8A 4HT3B 1UMCA 2GZ2A 3B6EA 4RCZA 2VUIB 1QOPB 2YDXA 5J59A 2IBSA 5JXGA 2QD2A 5DP1A 4CF6A 1VHLA 1OAKA 2BFCB 1O89A 3DEZA 4YJ3B 5C37A 3G2KA 2RB5A 4RPHA 1K3UB 3SQNA 5LD2B 3EZFA 4HEQA 4UUPA 4C0WA 1T8UA 3CONA 4DCGA 2DR2A 4YRJA 1OJ7A 2XCLA 3IELA 1L5YA 4MV0A 5AKXA 3H97A 1Q77A 1QIDA 4JK3A 5L4LA 3DZCA 4UFNA 3CVUA 1TM1E 2ZJYA 2PZBA 5HF9A 4CV3A 5L51A 5IN4A 3O3NB 2O3RA 3VPSA 3N28A 4E88A 1P4HA 3N5KA 2YIDA 4YAWA 2VJMB 5DGIA 4YAJA 3V55A 3UWOA 4P6VF 1RIFA 3PX3A 2VYFA 2PU5A 1UFVA 2H57A 1G18A 1FNNA 2ZFUA 4DMKA 5JNWA 1WMFA 4OHKA 5EOVA 1NVXQ 3NTXA 3RUIA 3ZWKA 5M2QA 1IBLB 4WV3A 1JLRA 1WDMA 3EE6A 4HY3A 4H1UA 4ZD6A 4HWGA 3REOA 1S5PA 5KTOA 3SSMA 5SY6A 5DW3A 3NX4A 4WOPA 2QUZA 4BQRA 3KSMA 3TEMA 4JL6A 4QJ3A 4DNPA 1J1UA 4GG1A 5CD9A 5PNTA 3IOEA 3EIUA 4JUIA 1CYEA 4YRRA 1FTQA 1E1KA 1QCZA 5H3CA 3W2TA 2RJNA 1N5RA 1SCUB 4G23A 4PNPA 4AU1A 3OH8A 4DR7B 3OPXA 2RGXA 4QBGB 2Y4OA 1DOZA 2GEJA 4Z86A 5FI5A 3PFIA 4YQZA 2ZYTX 6ADHA 2BRUC 2NYUA 5EXPA 4BGDA 1F51E 2VOJA 4NZYA 5HYVA 5K0FA 2Q0SA 4A1OA 2RHMA 3K9LA 4U6QA 3L7AA 1X1RA 1HYEA 4GOXA 3GYGA 4BFZA 2HJSA 4PAQA 2BISA 5DIFA 5F3WB 3HL0A 4FEEA 3BK2A 4L4XA 4LEIA 5J58A 2RHWA 3STHA 1E9DA 4Z3OA 4C3OB 3VC3A 3SIWA 4YV2A 3BD9A 3LA8A 1WD5A 1E2GA 3UV6A 3WSTA 3G49A 2BP7A 2QL6A 2YVQA 2XXAB 3LD9A 3I4FA 1TCUA 2VP3A 1R27A 4I99A 3MC1A 3D6MA 4BZPA 4O2BB 1N33B 1G0NA 1V5EA 2IELA 2YYYA 4N7BA 4UBJA 5K3FA 2WWVD 1ZD9A 3M5PA 1E1MA 5BPFA 1U9YA 5CP8A 2NPFA 2WSLA 1TTHA 2YFKA 3I34X 5FOXA 5E7IA 1U5BA 1FZTA 5AW1A 4XSHA 1R9MA 1VLMA 4Y2GA 5C8YB 1QK4A 3BJRA 3QA9A 4RIGA 3RFCA 5A04A 5GZ3A 2FP3A 2OMKA 3PKIA 5GONA 3RRBA 3TLGA 3T52A 3WISA 2E21A 5IWCA 3PD0A 5IH3A 3ZE6A 3QMVA 5A7FA 1WZNA 3A05A 1N36B 4L95C 2DT5A 5GM2A 2V3VA 4XFJA 3CBGA 1J99A 2FSVA 2P3OA 3X1WA 5IXJA 1FTWA 1UT8A 3C8ZA 3WL4A 2TMDA 1P73A 3TOXA 1M76A 1DEOA 1K2WA 3IO3A 5FWYB 3U3XA 2X1LA 4HXGA 2XNDA 2ZI4A 3E6AA 4MS1B 4P3KA 3SHQA 4BCCA 3RAEC 4K3UA 3N2NA 4L3OA 3ESZA 3V32A 3RSZA 1VZ3A 5JHHB 3I04A 1BX3A 2D7JA 2OM6A 2XA9A 2JFPA 1RRCA 1V2GA 2J4FA 121PA 3TL2A 2H1IA 3T1YB 4DIMA 1FXUA 1A27A 1AS0A 1GR0A 2J6CA 1XLUA 4NOLA 4Q7MB 3ZHQA 4XWOA 1G9SA 1ZGZA 2DCMA 4B3RB 3BE6A 5L3VA 3RFVA 1T8PA 4EYOA 4QFBA 1V45E 4IIYA 1F60A 1EX1A 3PFKA 1R18A 3HRHA 2I4MA 1BS1A 3IP9A 3H83A 5HIJA 3E4DA 5JIBA 1CZUA 5EIBD 5KI6A 2EGGA 1Y6RA 1N25A 2OCDA 3LT2A 2DRIA 2LNDA 4FKBA 3W6PA 4DVGA 3I6MA 5JUWA 4Y2JA 2H59A 4N0EA 5AQEA 3J7AC 1VL0A 3ZGZA 1RD4A 3L0PA 4FFPA 1WY7A 4J16A 1L3CA 2AC2A 4MUIA 1EQAA 3TBKA 1DIGA 4LC9A 2IV3A 1OFVA 3A1NA 4B09A 1SIUA 3ZU5A 2YNMC 3GFRA 1UF9A 5FHRA 2XA1A 1C3OB 2QZ4A 4GWKA 5L95A 1S4QA 2HPZA 4IINA 4P82A 3EDCA 4DAOA 2MCFA 1P3DA 5JCOC 4X1IB 1J7KA 2X40A 1JQAA 2WTXA 1ZO8A 3E1GA 2HMTA 4X7RA 5A5DA 3K09A 2R4UA 4IRUB 3SX4A 1BCRB 1SU7A 3AF3A 3QFSA 1AQUA 4YMLA 4ETIA 4Y18A 1OIVA 4IEIA 1U3CA 5HS6A 4C5BA 2C4HA 1P17A 1NI4B 2QMYA 1A9QA 3PUZA 4N3AA 5LM3A 2GDJA 4DDKA 5JAZA 3ZK9A 2Q3HA 1QIJA 3MW8A 2IPAB 2ZBDA 4RORA 5UKDA 3NAGA 1WHTB 3WBJA 4ARZB 3SHVA 1E2HA 3OF3A 5CNKA 3DDSA 5JAQA 3VGPA 4CM1A 1A2KC 4HXYA 3S99A 3GRKA 1UJMA 5IBRA 1QO9A 2UUOA 3HSYA 2EARA 1S9DA 4BQIA 4OREX 3TL6A 3AM1A 3AM4A 4O2AA 1C7RA 1U2GC 4MW9A 5BN5B 4M8SA 4R9VA 2A1TR 4P31A 2IYAA 3FF4A 2CWDA 5JAOA 1RXUA 2HYDA 4RYDA 4W5WA 4PZDA 4OHXA 3W9YA 2WP0A 1XL1A 4EO9A 3AKDA 1J0EA 1TF5A 2IEZA 5DN6A 2ZUWA 2EZ9A 2ZSKA 4YVFA 1D2AA 4FOLA 1E6MA 2AFHB 1NMXA 4NXMB 1OLSA 2WU3A 1B42A 1J39A 2CF5A 3BXZA 2EJUA 3JWHA 1L7VC 4IXWA 4UTXA 3LIPA 4AJ2A 4DS3A 1I10A 1FYXA 1QYDA 2YHIB 2ZRKA 1EK6A 4PC6A 5IUKC 3SVZA 1AUOA 2H0AA 3C3EA 2NUAB 4F3YA 1MAUA 4ZOEA 1XCPA 4WFKA 2UUAB 2HWXA 5IYZA 2IUTA 1BE1A 2F43B 5H82A 4ZI7A 5ICMA 3MTBA 3STXA 2ZSHA 4B79A 3FGZA 1OW3B 4CM5A 4D8YA 1UQUA 1Z06A 3U2QA 1KZ1A 2Z43A 3H7AA 3RSFA 1M2NA 2JZOA 4C7OB 1T2NA 5BNFA 1T8RA 4Q4DA 1U4OA 2O4CA 4CM4A 2ERYA 3WB2A 5K9ZA 2OCPA 2PN1A 5F1OA 2WF9A 3DLHA 2C4NA 3KCQA 3UH0A 3D4LA 3LUHA 3NETA 1XTQA 1X80B 4Q1EA 4CMEA 5EJ5A 3LL7A 4LRQA 4Z3KA 2YXBA 3IVAA 3D6NB 4BAZA 1QZXA 1R15A 2YDYA 3AI2A 1VC2A 1D4AA 1YDWA 3M2PA 4UXIA 4F3RA 5K0GA 5KX5A 2JGMA 3BZBA 4IHJF 5AK5A 2DUMA 2FKAA 5BVHB 1LLFA 3OOYA 3QMPA 3U4QA 2ZSEA 2ZSDA 4DCMA 3NDBB 2O3JA 1Q7BA 3ENZA 5CVUA 2FV8A 5EZ6B 5D87A 2X8AA 3EPHA 1G6HA 4IWYA 1Z28A 3FZNA 4Q1CA 5JVDF 1E0SA 2E49A 2JW5A 5BRJA 3VAAA 1WABA 2YRWA 5EJGA 1R5BA 3BULA 3OFKA 2X9QA 5LYJB 1YI1A 5BQXA 1EJ6A 1MLDA 2HU2A 1JZTA 3KKEA 4R5MA 4DCNA 4F2DA 1CQJB 3AJRA 2Y1XA 3ECAA 4OHUA 5ESXA 4Q39A 3R75A 2CY0A 2LBPA 3V1LA 5IM4A 3LMKA 4Y3UA 2IW3A 1Y4AE 3RRFA 7ADHA 5MGNA 4FINA 1FW8A 4OMCA 5EZYF 3E9CA 1K8RA 3IXQA 3DBVO 2G4CA 3N2KA 1SOVA 2V4MA 3PYMA 4X9XA 1AGNA 3B1ZA 3BN3A 1GPBA 3DL4A 3FWYA 3PQ7A 4GRDA 4UQPA 2LGJA 5FADA 5FI0B 1WD7A 2H17A 3AEUA 1Q0RA 1VPDA 3KUXA 4F12A 2FWPA 3TRDA 3ZPXA 2AE1A 4U7WA 5BSFA 1R6VA 1Z6TA 3R0ZA 4P83A 4DJTA 6AT1A 1K4YA 3MOSA 3RVPA 1BEEA 1KEZA 2ACKA 2B4QA 4LOHA 1XELA 3L7MA 1UBMS 4LXXA 1COWD 1FU8A 5TVGA 5ITZB 3HUDA 1O0CA 2AWNA 4EMUA 4AJPA 4YWHA 4HN2A 4QL3A 3RTBA 1IVSA 3DB1A 3DDOA 1SKUA 2PMBA 2W71A 4KP7A 3QX9A 3T3OA 3EEYA 2IEYA 3L1JA 3R5XA 1GPAA 3T3EA 3ZY5A 2BMJA 1ECGA 4YPOA 1QV9A 1WNFA 2PSSA 4QDXA 1HYHA 2QXUA 3NOQA 1O6ZA 2HIGA 3EVCA 2ZJ5A 3L02A 5K51A 4I5FA 3FUXA 4LN1A 3TM4A 1YQTA 2YVAA 1PZMA 4GC5A 2ZULA 1GUBA 5EJAA 2XVZA 5FHQA 4E22A 1X8XA 4MARA 2W43A 3NWOA 4LTMA 1RKBA 1WZCA 3N2YA 4H60A 3WGVA 5E1DA 4GOND 1Y42X 1Z3CA 4R2KA 1JTEA 4YBZA 1ZR2A 1MZVA 3GHYA 4PHCA 1DIBA 5J5VA 3S2IA 3PU6A 2YICA 4P3YA 3BJZA 4FM9A 2ZGVA 1GGMA 4WLUA 1VIDA 2E4YA 5L7YA 2OXTA 2W2PA 2HJWA 3DZDA 4XYGA 5I7SA 4G07A 3ZHYA 4XEUA 5F73A 5CA0F 2R7AA 3PX7A 3OM9A 1C3LA 3HWX1 2FPSA 3FZYA 2O7RA 3K2QA 4BMVA 4S2EA 1YFZA 4UUBA 1Z0KA 1HDZA 1X38A 2RHOA 2DPGA 3Q8XB 2FR8C 5FL7A 3FYUA 1ZEMA 4JEIA 5GIPE 3WZMA 3DZ8A 2RCYA 4C9BA 3BOSA 1NVVQ 4GZ6A 2WIKA 1J70A 1SUSA 3FYTA 3W7VA 2CF6A 1XVVA 3LVBA 1SVIA 4G4SO 2EG9A 3ZZUA 1GXSB 1XTKA 4I55F 2XLBA 4DV1B 1DIOB 2QRHA 2FEAA 3IMFA 4IJKA 1K8QA 4KE8A 1KQOA 1P2BA 2WLTA 2ZKLA 3A3NA 3HZHA 4LY3A 2VQ6A 3WBKA 1C8KA 4NMMA 4PLYA 4IM7A 1C7QA 3NP9A 3GH3A 2V6MA 3ON5A 1ULBA 2ZB3A 1B0ZA 3P9YA 1IN7A 4NMXB 5EIFA 5EWLA 2K5UA 1V16B 5JWHA 2X0FA 3UB2A 421PA 4KWIA 5K3OA 3QOYA 1T9ZA 1EVKA 2YH2A 3DFUA 2WUDA 1MQAA 3NHSA 4V0QA 4ZJUA 7MHTA 3GPIA 1W1IA 2BL4A 1II8A 3TE7A 1EGHA 4UTOA 5DBFA 3IVCA 4U7TB 4UUAA 3VH2A 3R0IA 1SKQA 2BF7A 1LQ2A 3AY0A 4CIWA 2HCJB 3AM5A 4MVJH 4N12A 3FPEA 4NCXA 3WLOA 4KAXA 5FPKA 1YD7A 5AI0A 4CG0A 1S6YA 3HCPA 5FFFA 1WKCA 3S5UA 1LBQA 4IFBA 1Y34E 4Y2TA 3TNDA 3R0VA 1DADA 4P38A 4W6ZA 1YA8A 3HJRA 1Q91A 1DXOA 3FIJA 4LGCA 2IH4A 3L1HA 1QS0A 2PYZA 5G4KA 3QFCA 4QQ8A 1TD9A 2VYQA 4GRIA 1DQYA 1FRFS 3V4FA 4C01A 5C2JB 3GFFA 3MYYA 4DMCA 3B3FA 4LAFA 5TF4A 3V4OA 3P0EA 4DJJA 4Z6KA 4JT9A 2V6GA 3K94A 3QWAA 4I08A 4RDIA 1H22A 2JI6A 4RIFA 4TXNA 4YCAA 3FHTA 2SCUA 4H15A 1GCAA 5B58T 5E7QA 4BFUA 3ZE2B 4DLVA 1F6WA 5DCLA 3WQSB 1TMYA 3JW8A 3OFND 1JLLB 3BRWA 1IEWA 3PDCA 1T3LA 5ECDA 3T4EA 1HI9A 5T64A 4PG8A 4HGYA 5AKKA 4JGIA 1OV6A 5I6DA 1AKWA 1JMYA 3UV3A 3FYHA 5LU8A 1XZQA 4YMWA 4X6XA 4C5AA 3WL7A 3ZI0A 4IICA 4O4HF 4XWKA 2BTEA 4O4LB 4J0KA 3JQAB 2P2GA 2I2AA 2ZYRA 1AU9A 1XROA 4XEHA 5IT4A 3TRFA 3HBFA 5F9HA 3NORA 3GN1A 4GS5A 5EP1A 1JXMA 3RYIA 5HFNA 1IVYA 3AX6A 1Z2DA 3GEMA 4GKVA 2QUBA 2NU6B 2VRWA 1CD5A 4HOYA 5JCJA 3U7QA 3VAYA 1LZKA 2QIPA 3L6OO 3S1LA 1EWTA 2CVQA 3PV0A 2D2VA 1ZJYA 2FTKE 2A59A 3IBYA 3H1EA 4NCJA 3BRQA 1LF0A 2DQKA 3HVRA 4IQFA 1YE8A 2I76A 1XDGA 3EIFA 4X64B 3GLUA 2PGXA 2GO7A 1RQPA 3LSYA 2E9SA 4DCVA 1JE0A 2RAUA 3LI2A 4TKZA 4MGEA 1PGPA 3AFGA 4ZC8A 1TYDE 3TW0A 1KO5A 1L4FA 1BFUA 1EJ2A 4RO0A 3TZ6A 1C9EA 1SBTA 4OK6A 5LBUA 2EW1A 2V97A 2WA2A 4HVAA 4ZOLA 1HG1A 4U2EA 3V3TA 1B1AA 3HUEA 5T5QA 3D54D 1RCFA 1QONA 1B15A 4ZT6A 3S2EA 5A1TA 3RK4A 4D4JA 1TJ3A 1RAHA 2I71A 4RTSA 1ADBA 5EYPB 2O0HA 5EMMA 3ZXIA 5LOVB 3QIAA 4GKKB 3F1KA 3SJZA 1DMSA 4NE7A 5H9VA 3LFHA 4QU0A 3D7LA 2P9HA 4Q93A 4FYXA 3G7SA 2PZAA 1BEUB 5CIQA 3HG7A 4U5QA 3GRAA 2WMNB 3FTCA 5EUMA 4G0VA 4PW0A 1Z88A 1Z6AA 2OCIA 4P5PA 4M9CA 3CZQA 4F5WA 5KWSA 2A3RA 2P2LA 2OLKA 3ABQB 1ECLA 2PU7A 4YRDA 1XK7A 2HLDD 1QAQA 3BIFA 3PHJA 2OYCA 2Q5EA 1RM0A 1Z38A 4OP1A 5CHYA 5CTAA 4DIFA 1ZPDA 4V03A 5AW0A 2BD0A 3TPFA 2ISQA 1Q44A 3N2LA 2ON6A 4E5NA 1IZZA 1FYDA 3OWOA 2PQ0A 3OQNA 4C4ZA 2PT6A 3BSFA 4EG3A 1P4GA 4PYMA 5TNXA 4EMSA 3B6IA 2WAOA 1KAGA 4UEWA 4E12A 4FLMA 4B3GA 1SXIA 1CEYA 1DAIA 2PS0A 5FO1A 3E22B 5BMVB 1PFUA 2IWRA 1TQ2A 3MLEA 1V43A 1GTL1 1R5NA 2N1MA 3PSHA 4DPMA 1V7PC 3NH6A 1U8TA 4HTFA 1KERA 1CY6A 1RYZA 2ZJ6A 3GPCA 5DCYA 2W2OA 4BLVA 1V3VA 3HJGA 4EB6B 4B4VA 1A5BB 2ZYGA 4ZCMA 1JYEA 1DC5A 1E3JA 1M2FA 3BS4A 1YDHA 5IAEA 1NYLA 3CZ4A 4UVGA 2HEIA 3R7FA 3GBPA 5THQA 5JNUA 2Q46A 1J00A 2JGLA 2V6BA 1CUGA 4BQQA 5EJ7A 5AKIA 2B4KA 4CCAA 3GUHA 4EPTA 1RWMA 2XCIA 3OTOB 1NU8A 4BN4A 3JQFC 4EF6A 4HH4A 5FOQA 4LGMA 5L3ZA 2IEGA 1P9RA 2X19A 1M1NB 1AB6A 3CEAA 3HM2A 3OLWA 1M1UA 3LXXA 1CUAA 2VP4A 3EOBI 4GZ5A 4LSZA 1KOFA 1T15A 1UEJA 1E0JA 3PVCA 4DV3B 3L8MA 3QQPA 4R8VA 4BB0A 3S1SA 2IOFA 4E08A 3EJWA 2UZ1B 3I9JA 2AN5A 2XVAA 2VP5A 4YDRA 2ETXA 3EC2A 1IOLA 5C5DA 3PUVA 5G02A 3P94A 2MSKA 4IHJA 1LPMA 3F2IA 1MIOA 4XAQA 4RNCA 5KVQA 4NXNB 1P7PA 2WAMA 4B3XA 2JARA 4TXMA 4J1TC 1YZYA 1SM4A 2J07A 2YFYA 5GVRA 2G1JA 1YL5A 4C43A 2Z6QA 1ZIDA 3GD5A 1J2YA 3BDAA 1QO7A 1V39A 3QF7A 4MINA 4WGGA 3FM9A 5LCXA 3VDQA 5J4LA 3KAKA 3VR2D 3KM0A 3LY5A 3WRWA 5KQRA 2J3HA 4E5YA 2YV5A 4FOPA 3DG9A 2C54A 1XCJA 3WFIA 1JLHA 2Q5FA 3SE0A 2CXUA 2X6RA 5KKCA 1KEEA 4MYUA 4RTPA 1P1CA 2IA5A 5I7FA 2O0JA 2CNLA 2ZIZA 3MUOA 2PGOA 5KNDH 1JTFA 5BNIA 5AVTA 1JI3A 1P77A 4Y2UA 4X66B 1L5FA 4HV4A 2XKJE 2BM8A 4JR1A 3DKKA 2DQZA 2Q5OA 4V1CA 4I2VA 2BMWA 5BYAA 4A0SA 4RD6A 3NHZA 1L5RA 3FUCA 5EZYA 3TINA 4HAXA 3RS3A 1FU7A 1THTA 1X15A 1QFZA 4O4JF 4ZVPA 3VMMA 1OFTA 4Z7OB 4CR7A 3RF7A 3TB6A 4KYTA 5ALVA 2BI8A 5HJ7A 1TM2A 5IABA 2D5IA 3O9VA 4KYUA 2Z3WA 1FSGA 3D0OA 1KHTA 2BFFB 3GV0A 1GD1O 1NQOA 4OHZA 3LDUA 4R3WA 1FEZA 1BW9B 5TPZA 1V71A 3CIFA 3IAHA 4HPJB 5EQJB 5DGTA 4EEKA 4F9FA 1OWLA 3EN0A 2EFJA 4KUEA 5EHZA 3KXIA 3EZLA 1ETUA 2GEVA 4QO7A 2DX7A 5LZ2A 1V1JA 1E1CB 1M1YE 1UDCA 3A6ZA 2F4VB 4RKWA 4Z2YA 2BDUA 3O2QB 4QRHA 1YU9A 4IIJF 5F35A 1QP7A 4TQAA 1ZHHA 4XDGA 3ZGOA 2XOKA 5FEMA 5IU6A 1UINA 3ZVLA 1DINA 5AKEA 4WNAB 2RI1A 1JXOA 2XJ4A 4JUBA 2QRVB 9ABPA 2IHZA 4C08A 1QRDA 1ADJA 2ORYA 3FZGA 5B36A 2DFDA 3D31A 4TRRA 2WYVA 3L0ZA 3R3XA 1UPFA 5DM0A 5A05A 1I4LD 3SBEA 2G0NA 2H18A 4PHHA 2PUHA 4QICA 3GZJA 1OH6A 1RRMA 2POQX 1XDSA 3AFOA 4IMIB 1YRAA 3CJTA 4RDCA 5K8JB 1GO2A 2EDCA 3QG5A 4U3JB 1WXDA 4WLNA 4B44A 3KPJA 4XH9B 2C78A 1TJ5A 2WJPA 1L5MA 2WYHA 2ZYDA 5ALUA 2DVMA 1BFKA 4JP1A 3TBHA 2OFFA 1WBBA 3SBXA 1H3FA 3C16C 3DWIA 3KVRA 4L51A 2PA0A 3VKFA 4EHDA 4XVRA 4KITB 5IG2A 1REQA 1PK8A 2WVGA 4FR5A 1UM9B 2X7JA 2XXJA 4BU1A 2PRSA 3ULKA 4NZ9A 2H29A 4PXSA 1T2EA 1P5HA 3IUQA 4QATA 2CXSA 1PAUA 3UOWA 2LIVA 2JFYA 1GPDG 2PJUA 3A1SA 3ANNA 2VO1A 3CN9A 3DLIA 4P5EA 3B9QA 4DLSA 3EGVA 4FQ7A 4ZOQI 2OHJA 4YRBA 5LVAA 3EC7A 4MTCA 1ZOPA 4RABA 3VU9B 1YQXA 3W90A 5B3LA 3WGKA 1GGEA 1YVRA 4QEDA 5LN1A 3LBYA 2NLOA 3V48A 4QU9A 3PQ3A 4NYJR 1DXHA 1A77A 4X6LA 1UAGA 2W2NA 1L7DA 2AYYA 2ZR8A 3IL2A 1J7JA 5FOSA 3UQYS 1UEXC 4BYGA 1B1CA 3V42A 1LRJA 2NU9A 3EXAA 1TIBA 1L5SA 3WYCA 3U19A 3L7IA 5A9SA 5KEIA 3BGSA 2BMVA 1NQWA 3CCBA 3CHYA 4LQ4A 5CW1A 1XRJA 2ZRBA 2NUPB 3I76A 3UC9A 3VR3D 4GYYA 4ER5A 3CA8A 3TGLA 1QK3A 2Q1TA 4BB6A 1PI3A 2Q2VA 1P0QA 3N39C 5LYJF 2DEUA 2YKGA 4ESEA 3T5MA 1HLGA 3GUUA 4KQJA 4KV9A 1CF9A 1HH4A 4B3IA 5EIEA 4PZLA 1V95A 2G36A 3FLMA 1TJNA 2ZK7A 3DO5A 5LLSA 4R2WA 1EVZA 4FB4A 1C0EA 3WV5A 4LFBB 1RWPA 2IYZA 2ZRNA 2BMDA 2Q4OA 2SKEA 3OIVA 3CVOA 3O8LA 1TXGA 1WSBA 4OOEA 8AT1A 1POXA 3LBFA 1P2UA 1PK7A 3U4HA 1JB1A 4DM3A 2PL9A 1U9ZA 4PIMA 4DMUB 5CDYA 5IJWA 3T38A 4DHEA 3N2GB 5FDFA 2DWQA 3DH0A 3PENA 5ALHA 1QGED 1U0GA 2NT4A 4BZZA 1LDMA 3HKDB 4KQHA 1DMRA 2FJ0A 2O9JA 4WESB 3WQHA 3ABIA 1L5KA 5KHLB 4A8PA 3SQDA 3MGBA 1S8OA 3R3WA 5GINE 1SVLA 1RQRA 3CLSC 3TIIA 3F47A 2AFIE 2QL7A 1S2MA 1PSWA 4JB0A 2HMAA 1TAUA 3WGMA 4DA6A 5KNBH 2OV1A 3Q0TA 1ODSA 3WZ2A 1BE8A 4OAQA 4M60A 4XUGB 2XTJA 1YL7A 2G80A 4ND7A 1WMDA 3NTUA 3V4PB 1SJ9A 4QT4A 2H2HA 1EFVA 2G9RA 3CT6A 3KAJA 3O4RA 4G1FA 3S2UA 4BAGA 4B83A 5JWOA 1VSVA 2C29D 4TVSA 4DARA 1NUHA 2AR0A 4QQFA 5BOSA 3SLKA 2PS9A 3DA8A 2QGFA 1M6YA 3W5AA 2VRNA 1SURA 4GZ3A 2B83A 2YJ6A 3KPWA 3IEXA 3CB4A 5TJHA 3VYUB 2PA3A 2W2XA 1NG9A 1ID8A 1N0WA 4NG5A 1BNCA 1ZH6A 2XEDA 1ODIA 5E9QA 3EDOA 3PZRA 3JZMA 4F21A 1V11A 2G4LA 3GLKA 4EG1A 3OZVA 4JP3A 2CW5A 1GSHA 3JWJA 3DP9A 1GPNA 2QN1A 5DHQA 4LYHA 4BVKA 4ZQBA 4HB4A 1KI6B 4I8XA 4OP3A 2VUUA 5H7XA 4WXPA 4BZXA 3MS7A 1Q0LA 3LU1A 4FMPA 4BJ1A 2ORIA 3ESYA 3QSYA 5IRCD 3M4YA 1NSYA 1ML4A 1NA5A 2ZRLA 2IS6A 2BFCA 3F1LA 3GDWA 5I7UA 1OBHA 3HU2A 1NJ2A 3ZLVA 1CZOA 1UC4B 2GD1O 2ZDQA 4LI0A 1XTBA 1V7CA 2PX6A 3BRSA 6NULA 4G56A 4KIWA 2VIIA 2NTEA 3EMDA 4HGPA 4UMVA 3T34A 3JR7A 3GNLA 3IIJA 1TLFA 4EY4A 1DKPA 3C1UA 3G2PA 3BE5A 1HNWB 1BMFD 1L8OA 1LRKA 3EUAA 3OOSA 2BM0A 1ZUHA 3HI6A 2Z8YA 1KR5A 2Q41A 1EP1B 1ENYA 1XBTA 3IUEA 3L7NA 1DRKA 1IDN1 3HEBA 4C04A 3EBOA 4MW4A 3JSAA 4PQEA 4BBZA 2IKSA 1RC8A 1QRTA 3DW1X 4TWJA 1N7HA 1ZSYA 3LW7A 4MRRA 4QDTA 3KFXA 2RHLA 3BJEA 1ZK4A 5LDGA 2I8LA 2Y1GA 3EBPA 4AYXA 1Z8HA 3QP9A 2WTAA 4UZEA 4GL2A 3ENKA 3D7RA 3OQMA 5NULA 4HWSA 4B81A 2GFQA 1E1RD 2E0IA 3GK3A 5AM4A 4E4TA 3UCFA 5EESA 4B74A 1M2EA 4OL0A 3AL0C 2B7CA 2VF8A 3GI1A 3I61A 5FF9A 1SCUA 1EBUA 2DR3A 2G70A 1MN6A 3PC8A 1BVUA 1EA7A 4MVXA 5LP6C 1VHJA 3ZH9B 2OGUA 1S9HA 1JAZA 3R3JA 3HBJA 1UC5B 4HYYA 3HBLA 2B4YA 1Z0JA 4Y2XA 1QYXA 2VHYA 1U31A 3PE6A 1U1GA 5TARA 4OHFA 3SG0A 3GFVA 4PS0A 5EE1A 2JHCA 4RSRA 2VSFA