1UBEA

Msreca-adp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
303
Chain Sequence
b'APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 86
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubeA01
2GZAA 4D80A 1RJ9A 3EPKA 3SHFA 2O8DA 3O8RA 2A5GA 3KFXA 4MKIA 4KFSA 1GL9B 3B9PA 3ASYA 4K8OA 4CEIB 1CKEA 1DAEA 2WM9B 3K0AB 3X1YA 4RD1A 1M6NA 2IYYA 2VL7A 2GK7A 3CPHA 4OBEA 1WA5A 3A36A 3W5IA 4AKHA 4Q03A 1UBEA 2L0XA 3WMEA 2XAUA 2GXSA 5G3ZA 1IONA 1IY0A 4TMTA 1QF9A 5L3QB 1Z3IX 1JPNA 2VHCA 3PR1A 3AUXA 3PUYA 1OH5A 3K9LA 3KXLA 4JT4A 3PUWA 2R6CA 3ADKA 3IUYA 4P4SB 1XZPA 4D4JA 3VX4A 1W0KD 4Q18A 1II8B 4JVLA 1IY1A 5H68A 3GLFB 2KJQA 2ZJBA 3W6PA 1AQUA 1CEEA 2P6UA 4XD7A 4P4TA 4EPRA 4JL8A 1BH2A 3VR4A 3AM1A 3IGFA 4S35A 3ADBA 2OFXA 3M0EA 1KK1A 4LJ5A 1X8JA 2QMUA 4LCBA 1NVVQ 4B2LA 2C9OA 4PAOA 2IYQA 5KHOC 1M1YE 3ZGXA 3CWZA 4BZXA 2NO6A 4Q48A 1XPRA 3NTUA 2ECKA 4ABYA 4JVMA 4GOJA 1IN4A 1NJGA 1XTRA 2A3RA 2QRZA 3QEJA 1EFHA 4RVCA 3S1AA 3UXMA 1I2MA 1I4DD 4HLUC 1NJFA 5AJZA 1WBDA 3K1JA 1EWRA 3FKSA 1UKVY 3QSYA 2JDID 4MRRA 4A4DA 1P60A 3MAAC 1DAMA 3IIJA 4DB4A 3QXSA 4BFWA 2WKRA 1TTTA 2J3EA 1KDRA 2DB3A 2EWVA 3PUZA 4HAWA 3TQFA 1P7CA 4TQAA 2VIIA 4B43A 3CRQA 4A92A 4PR0A 1MH1A 2XTMA 4MKFA 5KSPA 1G1MA 1G3UA 1Q44A 5JJKA 2OCYC 3L8ZA 3A8TA 5F2EA 1GL6A 5FUXA 2YC2C 2WWHA 4D0NA 4PHHA 3WNCA 4V0KA 1DOAA 3SBEA 3CPEA 1AGRA 1MO5A 4PSVA 3KJGA 1UM8A 2P6RA 4O0MA 2CLCX 1KI6A 1RYHA 1XCMA 4DUGD 2F1HA 5KNCA 1UDWA 2HT1A 1Z6TA 2ZRBA 2A5DA 2QQ0A 2KBEA 3FVQA 4TLEA 5H1YA 2EYUA 1J8MF 4K46A 1I2DA 3L43A 3MWYW 2D06A 2IK8A 4PC6A 4HUQB 5AWFC 4EIWA 1XPUA 1G291 1Q22A 2ZU6A 3GLIE 4PPNA 4GPTA 1OH8A 4PC7A 2OT3B 3WNBA 3KUCA 3LDAA 1A2KC 2VF8A 1XD2B 1P61B 2F1IA 2Z0MA 3IHWA 1GDDA 1MO3A 1D2NA 2JJ8A 4MYHA 4PXAA 2CCGA 4BFSA 1WB9A 1N6PA 1ZNXA 2HCBA 2OXCA 2WKPA 3IPXA 4G5SA 3T35A 3GFOA 3LY5A 5AJXA 3HJNA 4KVAA 1G3IA 1KJWA 1U2RA 1IY2A 1L8QA 4KSBA 2XZPA 5J4KA 2ZJAA 1ZP6A 1T3LA 5KSOA 2IYRA 4IFBA 4B3CA 1JALA 1X8LA 5J47A 2FGKA 2WTUA 2ZR9A 2K5UA 1Q3TA 3ZS9A 3NEJA 2OFWA 4OHWA 1S2MA 3U3OA 2FPKA 4DIDA 3A6PC 4QGFA 2FSHA 1YE8A 1OXVA 3WNDA 2F1JA 2ZJ2A 3LD9A 2Q3MA 4Q4HA 2YWHA 1G41A 3KKMA 5LB2A 3R9IA 3TH5A 2QTFA 4CT5A 2CK3D 2NO9A 3QPVA 4LYAA 1VYUA 3T1TA 1NSTA 1RRFA 4LX0A 5KSYA 1OFUX 1E9CA 2D3WA 2QSYA 2H5EA 2VSXA 4DCSA 3X2SA 2XJ4A 1GG2A 1PLJA 1JBKA 4JKYA 1NBMA 1ZD1A 2KB0A 1GAJA 3B60A 1KZ7B 1Z08A 2BKEA 2FF7A 4NHOA 3AF4A 4XVRA 4BLSA 4O2LA 1NN5A 3LQRA 3ZYCA 4KV9A 3PEUA 1XJQA 2IHBA 1IN8A 3SEAA 2QZ4A 4MUBA 5EXXA 3RS4A 4JVSB 5FTMA 3F8TA 3SE0A 4RZXA 4DSUA 4ILEA 3GP8A 4C9BA 3NBFA 3AP3A 3KDSE 2R6GA 1TMKA 4NYIR 2WJIA 4B3BA 3ETLA 2X19A 4GOXA 6Q21A 4FN5A 2MSDB 4NYJQ 2YHSA 3B13B 5FTLA 1G21E 2C99A 5LB4A 4L8GA 1FTSA 4QGGA 3U5ZB 3THWA 4BFTA 2O8EB 5H70A 1P2TA 3LW7A 4JKIA 5JMTA 1G4UR 1IQPA 1I4LD 1HT1E 3HYRA 4GL2A 2FU5C 4BLTA 3U4QB 2EFGA 1NLFA 3FYHA 2IW3A 2LWIA 1AZSC 4FWIB 5FTJA 4FMCF 3THXB 3BORA 5FUYA 3IILA 5JS7A 3Q5DA 2OV2A 1P75A 3TMKA 2O0HA 4CT4B 1AK2A 4G01B 5KOYA 3TK1A 3O8CA 3K53A 1H8ED 1U8AA 2G1KA 1NN0A 1EWQA 2F1RA 3C41J 5GJBA 4HLDA 1D5CA 2ZI9A 3UMFA 2WHXA 2CVFA 3BOSA 1YZNA 2CL0X 4OQMA 1HYQA 2JASA 2ODWA 2OZEA 3QPWA 5DYGA 4OHZA 3QXCA 2OCAA 1EK0A 4KFUA 2FMXA 5BN5A 1WCV1 4LJ9A 1BS1A 5B30A 1ELOA 4TTQA 5CLQA 2ODEA 5DYIA 5FL3A 1LS1A 5IHPA 2QE7A 4ZIRB 1SVIA 1NIJA 4FMBB 2HF8A 3AKYA 3HPQA 4QFMA 4DHEA 2GF9A 2IXEA 2W2XA 2WPDD 2ZIAA 5E7MA 2NMVA 1XTQA 2C98A 4KFTA 3KQUA 2ZE6A 4HLQB 4QHYA 1VCNA 4I1OA 1KKLA 1KDTA 4QJ4A 5KNDA 4Q9IA 3I32A 3KKQA 4HB2A 1ZM7A 3NH6A 4YONB 1W2GA 4C4PA 4QHTA 2R65A 4IOKA 3MFYA 4Q1FA 4OYHA 3T5DA 1E0SA 1QDEA 2CJWB 1G4AE 2PL3A 1KI3A 4C0KA 5KO2A 3IIMA 4PHFA 5BN4A 1T0JB 2ORIA 3QF7A 1GKIA 3JZAA 3RRZA 4RSGA 4TL8A 2CLDX 2VSOA 3ZH9B 1O3YA 1PLLA 4MH0R 5GJVC 3FMOB 1G7RA 4LV8B 2BKUA 2ZJYA 5HKKA 2P0EA 3SFVA 4JL5A 3T34A 1P2SA 2WZQA 1UBGA 4IFEA 1KKMA 3GJ8A 3NIBA 121PA 1KMHA 1E32A 3DHWC 4AYTA 2B7CA 3A1SA 5TY0A 3EC2A 1KTVA 4AG6A 3PFIA 2JLSA 4HYYA 3CB4A 4LV6A 1OJLA 2SHKA 5C2JB 4IJMA 5KDLA 4FINA 1PVOA 1E98A 4XH9B 4KVGA 4IVRA 1M7HA 4X8LA 4HATA 2N1BA 4LBVA 421PA 2ONKA 2BBOA 2PT5A 5EE3A 1XTJA 4NCJA 1YZGA 5F98A 2WJGA 1P62B 3V4RA 1T8TA 4CRWB 3GJ6A 3IEUA 3K8YA 4LBZA 4EPVA 1R6BX 2NIPA 3C4JA 3IBYA 3VMFA 1TL7C 2IS1A 4FW9A 2PX3A 2H17A 2IYVA 4F7WA 4ARZA 2NQ2C 1NI3A 3L0IB 4RD3A 5L3SB 4BRUA 1KAOA 1H8HD 1KDPA 1OH7A 1E2DA 2GESA 1G8GA 5J40A 1N0WA 5CDFE 4B74A 2V4ZA 1JR6A 4B2PA 4DRZA 4AI6A 1VG8A 1G16A 2FV8A 3TRFA 5B58C 2IYZA 4C0SA 1QVRA 2BOVA 2ZYVX 2WSSA 2O8FA 1ZC4A 1G8PA 3P27A 4P32A 1KI6B 3I4LA 3N5CA 2NGRA 2J59A 1KK0A 1GITA 4TMVA 3ONWA 1CXZA 2WIBA 3GLGA 1NY6A 4IVQA 4LDJA 5LD2B 1KO8A 5HE9A 1S4QA 1AGPA 3HU2A 5FFMA 1T4GA 1ESMA 3ASZA 4HAZA 3P4XA 2JIZA 1E2LA 1XF9A 3P20A 2BM1A 4AWXA 1SHZA 2J46A 3UWOA 3KKOA 3D7MA 3HR7A 4JSYA 4JIMA 2H16A 2OHFA 1U9IC 2JAQA 5FOXA 1DPFA 3OE7D 2NO7A 4HI0E 1EX7A 1ZM9A 4LSGA 4ZCIA 2BCJQ 3F0TA 4Q02A 3THOA 1UKEA 2OFOA 1VHTA 2Q0HA 4LJYA 3EPJA 1OIXA 4TQUS 3AF2A 1QHSA 1YZUA 5BQ5A 2FZLA 1F3OA 1Z29A 2AKAB 2BM0A 2CE2X 2N46A 2V1UA 1Y63A 1FUUA 4MKHA 3QI2A 2BDTA 1GUAA 1TX4B 2FSIA 3NVAA 4UNSA 1E2GA 1GL7A 2ATVA 3NBZC 1G8YA 1J2JA 2WJJA 1K5GA 3BFXA 3PEYA 2W0SA 3TVTA 2FDCA 1QVAA 4V0NA 1XWIA 1M7GA 3BFVA 2ZRFA 3DMDA 4PO8A 2A2ZA 1W0JD 2J9RA 4Y0VA 3OIVA 3MG9A 2D74A 1E1QA 2QN6A 2WSMA 5FOVA 3BWDD 4A2PA 2J1LA 1S96A 2WWWA 4MQBA 4Q47A 1TQDA 3VAAA 5EZ5A 1ZU4A 1HTWA 4O3MA 4NTZA 2GBLC 1YR8A 4BLOA 1E9SA 3TBKA 1GILA 3W6NA 1IXZA 4YMTA 2J7KA 1CJMA 3FFAA 4E07A 4DSNA 1SGWA 1W47A 1II0A 1KHTA 4KYUA 3VKGA 4XTCS 3CH5A 4DLUA 5K8LA 1CLUA 2C04A 2OAP1 4W7SA 3VX3A 1XMJA 4LRWA 1VHLA 1NKSA 2B8WA 3CW2A 4XSHA 4GRAA 4A0GA 1Z06A 5JZVA 1J70A 1G17A 3ZZUA 3AP1A 3QKRA 5JECA 1B23P 2R62A 4ON9A 4DB2A 1UBFA 4MITA 1AM4D 3THWB 5IK2D 2QA5A 3NDPA 3TGPA 4JBYA 3V4FA 1L2TA 3VR3A 2WOOA 4JLDA 3UANA 1S9HA 4A6PA 1GOTA 4M9QA 4L9WA 5TMPA 3GJ4A 2P3SA 3AGPA 5CYPA 1GFIA 3TVDA 4GBMA 5ELXA 5HZHA 4NH0A 4OQLA 5JCPA 2MMCA 3QIAA 1A5TA 2F6RA 4HLUA 3PV0A 1JJ7A 1IOZA 2NO1A 1GRQA 1SVWA 3EG5A 4D0GA 4J0QA 1OXXK 3QBVA 4TL7A 2I1VB 1Z63A 3GCGA 4B33A 4B6FA 3HPRA 4YC7A 3ZZTA 1GIAA 1Z0FA 1X8KA 2ZRLA 5FPTA 1TQ4A 1P73A 2Z5FA 2ZRHA 3AEZA 2HLDA 2QORA 1QG2A 1Q21A 1X3SA 1SXJE 4YDSA 2G88A 1UDXA 2HYDA 2GTPA 4OQXA 2GK6A 1UKYA 2C2HA 2PLFA 2YWGA 1V5WA 4M1KA 2QNRA 1GSIA 2WAYA 2FFBA 2W6JD 4PX9A 5JI2E 3VR2A 5IT5A 4P3YA 4YMUA 4V02A 1DAGA 4LC0A 3NC1C 4URYR 1OHHD 2ZSFA 3GJ7A 4OK3A 1R8QA 5E4FA 5LPNA 4BECA 4AY2A 3HYTA 5AUPB 2IHYA 2R9VA 4WZAE 1U8ZA 4RKFA 2J0QA 1YHNA 3CONA 2DWOA 3PITA 4US1R 4NCNA 2FPMA 3W8RA 2FFQA 4TT3D 3ZVLA 4ITRC 2PZEA 3ZDQA 4HAYA 3BS4A 4HDQB 5D3QA 4F4IA 4LJ7A 1G9XA 4TLBA 2P2LA 3PEVA 1Z28A 2P5SA 3LFUA 1UBCA 4ZPXA 2O52A 1KMHB 2V7QD 3JVVA 2J41A 4EKDA 2B8TA 1GRRA 1SVSA 2ZRGA 1ZJ6A 5HTKA 4XOIA 4P33A 1CIPA 1VKJA 3SYLA 3PG5A 4RZ3A 2D4HA 2VTKA 4OL0A 4Q4JA 1RRCA 2F3TA 5K8TA 2X2FA 1F2TA 3U6BA 1SKQA 2MMGA 1C4OA 2HUPA 3Q9LA 3EAQA 4QNMA 2GEUA 3BFKA 1QBKC 1F60A 4M0LA 3WMGA 4B47A 4HUTA 4JVNA 3MJHA 3L8YA 1M34E 4B34A 4TYYA 2I1QA 1XD9A 2FPLA 1EFRD 4C0AC 3GEHA 5JRZA 3AGQA 4ARZB 3I5XA 2QP3A 5EE1A 4G0NA 3K0CA 1W4AA 5D3MB 2REBA 1QG4A 5CJ2A 1E2FA 3PVSA 1KOFA 5CDFA 2YINC 3ZD7A 3HP1A 3HU3A 4Q1DA 5E3HA 3EIEA 3DOEA 3FKSD 4Z1MA 3KB1A 4ZCLA 4LJ8A 1ZNYA 3LXRA 3KUDA 5CM9C 3T1VA 1FQKA 4Q1AA 2O8FB 1NN3A 1T6NA 2IYLD 1GZSA 2EFHB 4KJZA 4RKEA 3C5CA 3NEYA 2JJ2A 1OPXA 3CF6R 4R7ZA 2ZRAA 2YZ2A 4CZ2A 2QU8A 5BYKA 3AVOA 4GOKA 2QMEA 4NMMA 2ZRNA 4B75A 4DCTA 4XVUA 1E0AA 3A58B 2RGXA 1VG1A 1Z0AA 2OE2A 3K70B 2WVJA 1FP6A 4BLRA 3ZJYA 2AK3A 3T5GA 1Z5ZA 3OESA 4TYNA 2G77B 5TARA 5BXQC 4IEEA 4URXR 4YLGA 1DO2A 2XSZA 3BC1A 4BEJA 3LV8A 5DGXA 2FX3A 3LBHA 2BBTA 1G5RA 2AL7A 5AR1A 2IX3A 1B0UA 3EZFA 3KJIA 1KJYA 3R20A 3C14C 3FWYA 2B92A 2GJAA 4NPHA 4DLYA 3FPAA 3KTAB 1A1VA 2VH5R 4I81A 3RAPR 1NG9A 1N25A 4RZ2A 3DPUA 4TTRA 3U7HB 4RZUA 1OYWA 4JMPA 4BE7B 3R9XA 2QPAA 3CX6A 3RNLA 5SZKB 2AX4A 3B1WA 4DXAA 2XJ9A 3OIUA 2XB4A 4WVFA 5EXTA 1SVOA 1ZBDA 4JYCA 5CLLA 2JJ1D 2W83A 4YXWA 1XPOA 3CM0A 1MRSA 3MRSA 4JJZA 3C16C 2ZUBA 4MRSA 3J81k 5JWRA 4POAA 1E2NA 1RPZA 2FSGA 1LB1B 4I4LA 4RD6A 3LX8A 1JXOA 4LGMA 1GTVA 2YVUA 4LBWA 4WAUA 4RCYA 2QTHA 2EFCB 1ZIPA 2RGAA 3ZQJA 5AK0A 4TLAA 4D0LB 4IXNA 3GLHE 5DIFA 2QAGC 5FOUA 3KQLA 3TSOA 1KI8A 2PX0A 3ND8A 4URWR 4JYBA 2YOGA 2UVQA 1E2QA 1KI9A 2WWIA 1NBMD 4HZIA 4H9GA 1KDOA 2Q9AA 1E9EA 1WBBA 3E2IA 2NPFA 3L0SA 1FNNA 4MRNA 3MGCA 2GETA 3CX8A 2X77A 1FX0B 1MABA 3FMFA 4FMDB 4URUR 1OXSC 1VG9B 2R8RA 1FL9A 2R2AA 5L8VA 5G41A 2XZLA 2VP0A 4BLQA 4ZV4A 2VP6A 1A2BA 3IO3A 2VHQA 2A7QA 2C95A 3QOFA 2HDNB 2XXAA 5KNBA 3K0FA 1TF5A 2VRWA 5GJWC 1SVKA 4EQ6A 3RS7A 2AN9A 3H4MA 3RWMB 2ZYTX 3RRMA 1VCMA 2H8KA 1ZCAA 4M9ZA 5FOTA 5EUQB 3DM5A 4NONA 1KJZA 2FG5A 3I8SA 5JHGB 1UFQA 3EASA 1XXHA 3BRWD 4C0JA 1BYIA 2IS2A 4OK6A 1FPMA 4LPSA 3GLGE 3PIRA 1O87A 2GJKA 4PFSA 3B85A 4ACAA 2IS6A 2GAOA 1TQ2A 5HR5A 4PQFA 3U60B 5FI0B 1CR4A 1N2CE 2WJHA 1P5ZB 1FW6A 2CEAA 3PXGA 5JJLA 2ZI6A 3QKSA 3KXIA 4TMZA 4PQRA 3MWJA 1CBUA 4PAQA 1N6RA 3A4MA 2X1VA 4XWAA 4A8JA 1SKYE 2OLJA 4ZKDA 5DN6A 5L3VA 1LF0A 3ICQB 1SXJA 1YZTA 2VSFA 2BMDA 2FA9A 4A82A 1E69A 1W5SA 1ZNWA 3SQWA 5FI1B 2PLRA 3SQXA 2ZEJA 4XWKA 4DIEA 4GMXA 4A0HA 2ZITA 1KI4A 2YWEA 3U44B 4BGDA 5DI3A 5DSZA 3CF2A 1KY3A 1UPTA 1YKSA 4IOLA 4G5GA 1QHXA 4QHSA 4Q1CA 1ZUIA 1P9RA 5AUQA 4PSKA 3BK7A 4G3XA 2ZR0A 3FGNA 4UNNA 4BRWA 1E9FA 4IDNA 2HYIC 2RAPA 3WP1B 2ZUDA 1OFTA 1U9IA 1ZYUA 3AVQA 3LAWA 4JJKA 4DLRA 1F2UA 4UNRA 2RGGA 4PO9A 4DZZA 1CU1A 1XMSA 1KMQA 1WRBA 3MWKA 4V03A 3PQCA 3ADCA 3WRYC 1JEEA 2QQEA 2IL1A 2W2VA 4LV5B 2ZRPA 4OI1A 2LKCA 3RVBA 1W49A 2FJUA 4MRPA 3T1QA 2VBCA 3SI7A 2BIFA 1AJEA 4RFSA 1KIMA 1RIFA 4UXJA 2VHJA 3RDPA 3I62A 1KI1A 1JXMA 4C0QC 3G82C 4Q1EA 1XBTA 2WWFA 1WMSA 5FL7D 5JLJA 2YNMA 1IN6A 2IUSA 2WKQA 3DL0A 3D31A 1L4YA 1E2JA 1DS6A 2BC9A 4TL9A 2PJRA 2O8CB 4Q4JB 1W0KA 2OEPA 3H0KA 3I92A 3NHBA 3RC3A 2BJWA 4I1SA 4NKRA 4A2QA 3N70A 2AK2A 1FTNA 1Q1EA 4F92B 1OE0A 3T1OA 4ACBA 5CK5A 4DT1A 1R0ZA 2ERYA 3CBQA 3THYA 4N3NA 4HAXA 2F43A 4RD2A 2IXFA 1RVDA 4OHXA 4OJQA 1TF2A 3RWOA 3SJBA 3U61B 5CM8B 1CR0A 3EIQA 1EESA 5C1BA 2GZDA 3RHFA 1IJFA 5C4MA 1Z0IA 1Z6AA 1E4VA 4F4JA 4M8NE 3TSZA 1AA9A 2DYKA 1VYVA 4TN1A 1YRAA 1ZUHA 3SZRA 4BQSA 3MLEA 3AVTA 2TMKA 2ZSDA 2JDIA 3PUXA 1MR3F 1TADA 2YOHA 3TAHA 4BWYA 3CF0A 1XEXA 4D2IA 1FFHA 1OKKA 4Q7JB 4EJSC 2QSZA 4URZR 3L0OA 5FUVA 1OXTA 3QXHA 3A37A 5FOWA 1Z22A 4FWTA 2HV8A 1W46A 3F3YA 5K8UA 1E6CA 3QF4A 4F38A 2RHMA 2F55A 2HCJB 4F4CA 2O8BA 3VKHA 1JR3A 2D2FA 4JL6A 4TYWA 4DC9A 1T5IA 2ZI7A 1NLZA 3SYNA 2ZS9A 1W5TA 1N6OA 4M1YA 3JZMA 4ASUA 4OQNA 2XOKA 3UG6A 2QGZA 3GD7A 5CYOA 4NL4H 1EFCA 3Q7PA 5CIQA 3A1VA 3AB3A 1E1RA 2WSSD 4LK2A 3PENA 3SJCA 4HB3A 4I1VA 3WXMA 2ZI4A 2QROA 4U7DA 2J7PA 1ONBA 2O5VA 3FHTA 2ZQ5A 1YU9A 2YWFA 3AVPA 3BBPA 3BB3A 3WMFA 5EP4A 3REFA 4B6EA 2C9YA 3EZ7A 4O2RA 1ZAKA 5TV2A 2V9PA 1N0UA 4DCUA 2IEZA 3K70D 2ORWA 2QM8A 5E7JA 3SYKA 1WF3A 4RD0A 4IXMA 5C4GB 2W2TA 4Q9HA 2I3BA 4BEBA 2IF0A 2F7SA 4IDHA 4OK5A 3TAUA 3R8CA 1W4CA 1Q3HA 3RS0A 1RJ9B 1Q12A 1T5LA 2O8DB 3L0PA 1P72A 2JEOA 3VFDA 4B73A 2VYFA 3Q7QA 3U7EB 1G64A 2BCGY 3W8NA 2JLXA 3OZXA 5SZJA 2AWNA 1TAGA 3LNCA 2GAAA 4NBSA 3KQHA 1JQJC 4WA7A 3K0SA 2F9MA 3FB4A 5ANRB 1VMAA 1WE2A 2W58A 3ZIAA 721PA 1XD8A 1FMLA 5JHHB 3SNHA 2EFEB 3VKWA 2MSEB 3G5UA 2AFIE 4Q00A 4Q4LA 1XZQA 5H8WA 3OEED 4D4LA 1SHKA 2OILA 4ZKEA 4DDTA 3QPUA 1KI7A 2AD5A 1E1QD 3GLHA 4XWOA 3NHAA 2XNSA 3IIKA 1XDBA 1NMXA 3QENA 1U94A 3UK6A 4DEXA 1JI0A 1YR7A 821PA 2IWHA 1E9DA 2ZXUA 1COWA 3LH5A 2BWJA 3S1AB 2VPPA 5A4JA 1HQCA 1OH6A 4R71A 5BN3A 2GF0A 3V00A 1G20E 1LFDB 3A1TA 1CJTC 2QY9A 4NDZA 4QGHA 3DOFA 2NO0A 3T61A 5FBQB 2OM2A 5CIWA 4LHWA 4PSAA 1N3BA 2D62A 5FPHA 1OIVA 1BOFA 3BAFA 2GRJA 2FE4A 4B2IA 2XXAB 2OUKA 3NBXX 3B9QA 4R2HA 4EQ6B 3RLFA 4BUJA 2JATA 3WY9A 1KY2A 4JBWA 1N6KA 3ADDA 2VP4A 2D7CA 1AS3A 1OW3B 1XB2A 2QGNA 3H84A 3N2IA 1GKUB 521PA 1XXHB 2FN4A 5LD2C 1ZM3A 4BFUA 4I1UA 2ZANA 4LHVA 2BBWA 3RABA 3D8BA 1ANKA 3FE2A 1TEXA 3KQNA 4HZUA 3TUIC 5KU1A 4QKQA 3GJ5A 3QKSB 1G7CA 4BLPA 3P26A 1P9WA 1R0WA 2PEZA 1NF3A 4A8JB 1YQTA 3RS3A 2IEYA 3BH7A 1CR1A 1SXJB 2V55B 3KX2A 5F3WB 2A5FA 1C9KA 2PMKA 4FXPA 2RGNA 4KO8A 4O25A 4DWJA 2WMOB 2WPDA 4CEJA 4QG7A 3OEHD 4US0R 2HLDD 3TQCA 2LKDA 5BYJA 5DI3B 1US8A 3RRNA 1VCOA 5FPKA 1P3JA 4NU0A 4IVPA 4XIGS 4XTRA 5FUWA 4PPFA 3NKVA 3T06B 4F93B 1VIYA 1RYFA 2E9SA 1ZM2A 1WDTA 2E87A 4B35A 2FSFA 4NYIQ 4V0OA 4AKGA 2A9KA 3A1UA 2ZVQX 4KXFB 4ZDKA 1F2UB 1L4UA 4Q4HB 3ZZ0A 2GA8A 1DO0A 1YVDA 2JGNA 1A82A 2BMEA 2OCBA 1JECA 4KBFA 4W5HA 1AA3A 1YZKA 2FOLA 1Z0KA 2PBRA 2ZE5A 4QGAA 1VG0B 1AQYA 1QZXA 4G5RA 4ZO4A 2XNDA 1LY1A 3BB1A 4MGYR 1G18A 2ASEA 3DVLA 1KYIA 1XEFA 1KGDA 1SULA 1Z07A 2WMNB 3ZVNA 1J8YF 3I61A 4CEIA 2O0KA 2Z4SA 5FBVB 4D6PA 4MGZR 4BFYA 2BMJA 4MRVA 3GJ3A 4UJ5A 1Z0JA 3THYB 2QMOA 2F43B 3IKJA 3B82A 2AHOA 3LBNA 1G3RA 1RW4A 1RRPA 3GLFA 3KQKA 3P32A 2ZYWX 2YYZA 2OCPA 4TQ9A 1EX6A 4QJ3A 4ZCMA 4CGZA 2DBYA 1AKEA 1GVNB 2A78A 1KO1A 2OBLA 3B8HA 2GCOA 1G6OA 3KL4A 3O47A 4YMVA 5FR1A 2JCSA 4DLXA 4A6XA 2RCNA 2W6IA 2W0MA 1XEXB 4JLJA 3TSWA 3FDIA 5KPJA 3W3ZB 5SZIA 2GNOA 2QAGA 1MO4A 5A5GA 3AUYA 1KI2A 3M4YA 4MDEA 1T9HA 3QF4B 3HDTA 5TB5A 4MDFA 1GRNA 4KBGA 2ZYUX 2IUUA 2O8BB 1JJVA 4C3ZA 1ZIOA 1SZPA 1XXHE 4XVQA 2C96A 2NG1A 2YKGA 1Q1BA 5G53C 3A4LA 3EC1A 3KJEA 2GEDA 4Z1MD 2X8AA 1JQLB 2P67A 1LW7A 1LVGA 3U3JA 3UMRA 4GT1A 5JRJA 2RMKA 4HAUA 4W5WA 4X8MA 5G3YA 4CDGA 2WWYA 1HY3A 4FI3C 2JJ2D 4LZZA 3SR0A 3PJRA 2V6JA 1MO6A 3D3QA 3LVQE 2G3YA 4DSTA 4P4UA 3R8FA 4JZKA 4AIIA 4DLVA 4JLMA 5P21A 2PCJA 3PEWA 5DE3A 2DHRA 1M8PA 3SFZA 4LUCA 5JEDA 1OLOA 1E4YA 4U5XA 1W36B 2UZIR 3AV0B 2CVHA 2J0UA 2CNWA 4B3XA 2Q21A 4V0MA 2JLQA 2XSZD 4PC1A 4C0BA 1PV4A 1XCPA 3QQ5A 4C0LA 4PQYA 1TNDA 3CWQA 1YZLA 2J5XA 4KLZA 2XITA 2V3CC 2FFAA 1XCGB 3NH9A 3RS2A 3DDCA 2ZRMA 2D2EA 1W1WA 2IXGA 3QJYA 5FPSA 1BMFD 2BBSA 3HR8A 2RGEA 1E2KA 1GP2A 1ETUA 2VEDA 4NZYA 3G0HA 2OAQ1 1TUIA 4JS0A 1E79A 2ZUCA 3UPUA 4YMSA 1ZD9A 1IN5A 3UATA 5FPYA 2GVDC 1CP2A 4Q21A 3FHCB 1T3HA 1D8TA 3WBKA 2XEXA 1DBSA 3RANA 1U0LA 2Q3FA 3A1WA 3OIWA 3WYGA 4WXPA 5J4YA 1D2MA 2ZS7A 5CITA 1PJRA 2Z83A 5G40A 5EUMA 1NNEA 2ZROA 1UF9A 2OO7A 3ECCA 3MCAA 4IRUB 1EFUA 3GLHB 4Q9KA 3SJZA 3GFTA 2DWPA 1Q1ZA 4L4UA 4F91B 5TDHA 1S1CA 2VF7A 1KSFX 4WBSA 1FUKA 1CRQA 1M2OB 1DAKA 4LHYA 2A5JA 5DI9A 4XD7D 2QT1A 1K6MA 2RHDA 4Q1BA 5GVRA 2DFLA 3TJZA 4AKIA 1KSGA 1FQJA 3ICEA 1GNQA 3TNFA 2QT0A 2RGDA 4FMDF 2WICA 3U2QA 2H18A 2QENA 2QL6A 3B7GA 4P0TA 3LBIA 4TYQA 2EQBA 3QKUA 3VU9A 5JEEA 3BD9A 5FH9A 4IDPA 5J4HA 2QUZA 1CRPA 5FTNA 2J0SA 4WW0A 4MYCA 4AD8A 3U7GA 3MMPA 3FTQA 1D2EA 2IYSA 1JR3E 3FHOA 2IBMA 4UJ3A 4TSFA 3AVUA 1U8YA 5FBWB 4FCWA 5EQTA 2XTNA 4HB0A 4NCIA 4Z51A 3OAAA 3K09C 1HA3A 5J5CA 4D4KA 1OIWA 3GLGB 4WIAA 4LBYA 1XRJA 3K70C 4I99A 2KI5A 2QPTA 3AVYA 3FFBA 3R9WA 621PA 4HZUB 1D9XA 3W9YA 4HSEA 4EJSA 1T8UA 3EW9A 3QG1A 1EXMA 4EUNA 2HEIA 2ZS8A 4PZZA 3EA5A 3MD0A 1S1MA 1SKYB 5EE5B 1GKYA 3LVRE 1U0JA 2ZRJA 3K9HA 1LF5A 1XP8A 2EW1A 2IC5A 4R2IA 3X1ZA 4CEJB 1U98A 4UXHA 4MA4A 4Q9JA 1E99A 3DKPA 3NDBB 1PLKA 2Y8EA 1JNYA 2W6JA 1YR6A 5JWOA 3TIFA 2P5TB 4ESHA 1SXJD 1KNQA 2B21A 3K9GA 4B3GA 2W00A 1PUJA 3Q5EA 2H1LA 2CXXA 1RRGA 5FBRB 1G19A 2JLVA 4M53A 4UXIA 1E94E 2GKSA 4GI7A 4UKDA 4BFXA 2GHIA 2QMHA 4TT3A 2O0JA 4IKEA 2DR3A 2R44A 4QBIA 5GJCA 4W5JA 2HXYA 5AJYA 3NXSA 1R0XA 1NMZA 2CJWA 2RH5A 5EXSA 1AIPA 2V7QA 3IHLA 4DEYA 1J90A 2CMKA 1HQYE 1R2QA 3EZ2A 1JAIA 1MKYA 2ODNA 1YR9A 4EPWA 2ZRCA 2BMFA 3RS5A 1N6LA 4A1FA 5EE9A 1X1RA 2CLSA 2ODBA 1DELA 5EE0A 4S2EA 4CIDA 4A36A 1ZW6A 4D25A 1E3MA 2ZAMA 3EPHA 5CK4A 2WBLC 3LLUA 2QEQA 5LBIA 3OHMA 3FMIA 3EXAA 3TR5A 4DKXA 5HZKA 2KSQA 2FWRA 2RGBA 3QKRB 4E5UA 1KSJA 1ZC3A 2ZE7A 1EFRA 1NG1A 3C8UA 3KKNA 1HH4A 3W90A 2GCOB 1IAQA 2CCKA 2YC4C 1QHHA 3AP2A 3KJHA 2G9NA 2C8VA 3E5HA 4FIDA 1S3SA 1NRJB 2IT1A 1UJ2A 4EFNA 4B48A 2QAGB 1OT3A 2NZ8A 4NYMR 2ZR7A 1Q20A 3U3MA 5DO9A 2ZVPX 1N6HA 4KLNA 1U90A 4LYFA 4HB4A 2V54A 2ZJ5A 4IOMA 2JA1A 2FNAA 4U02A 4M2LA 1CR2A 4DBLC 4E09A 2WIAA 1W4BA 2ERXA 5L3SA 1S8FA 1Z2CA 4A9AA 3X1XA 3CX7A 3QKTA 1OKKD 3GJ0A 1XTSA 4Q7KA 2FEOA 3B1VA 1E2PA 4M1OA 1AZTA 2QPOA 4TMKA 4QOSA 5B64A 5KUTA 3Q85A 3AKCA 1GNRA 2CE7A 2NOAA 4A2WA 1LTQA 1JR3D 1DE0A 2FFHA 4EPTA 4CEHA 2GXQA 1FOEB 4Q9LA 3SU8A 1KAGA 1NL3A 4QM7A 3RC8A 1E96A 1AN0A 1Q1QA 1G8FA 1E9RA 4MGKR 2X2EA 1G8HA 1OF1A 1WP9A 2VO1A 2IUTA 3MUFA 4ASUD 2QAJA 2XOKD 5CB6A 1GM5A 4OI2A 4CF7A 1NVXQ 3EWSA 5E95A 4Y0AA 2D7DA 1E1RD 2XGJA 3H2YA 5SZHB 2GXAA 2J0UB 4BZPA 2XZOA 4LJ4A 3OFNA 4JT2A 2J7PD 2QE7D 4KITB 2P65A 3SS8A 1R7RA 1HEIA 4BFZA 3BE4A 4AKEA 3FKQA 3TUZC 4IEIA 1NIPA 2AXNA 3GQBA 2NPIA 1W36D 3BIFA 1QHIA 1PZNA 3ZQ6A 4ZI3A 4M21A 4GFDA 1JEDA 3VTKA 2QTVB 1FNMA 1I4TD 1NVWQ 1W48A 2H57A 2JJ1A 1UKZA 1OFIA 5KPDA 2ZSEA 5TVKA 2IYUA 2REOA 1KO7A 3VQTA 3ZLJA 5JSZA 5GADl 4DDUA 3DKVA 4DJTA 1RZ3A 1XX6A 3M6AA 3Q3JB 4LY6A 4Z54A 4YDHB 2DPXA 3WRXC 4D26A 1P6XA 5HKKD 3DMNA 5KYKA 4YMWA 1F2TB 4QRHA 1GNPA 3NBYC 3SJAA 2CDNA 1F6BA 3ZIAD 3U3KA 1DG3A 1AS0A 1K5DA 4IW3B 3B6EA 5AUOB 4TZ6A 5JFGA 4KU4A 4P31A 2IA5A 3EPLA 4BASA 4KFRA 3C7KA 1G7SA 1E9BA 1XJ0A 1TPZA 2IF2A 4N1AA 4HDOB 1DAFA 1CULC 3NC0C 3Q8XB 3I72A 2DWQA 4Q7MB 2AD1A 1ZD8A 3GLFE 2BJVA 1HURA 4GNKA 2GJ9A 1JB1A 3LRPA 3K0CC 4OJKA 4DLTA 1LS6A 4RCZA 4B44A 1UEIA 2GBLA 2OBMA 4B76A 1A7JA 1SVMA 3CR7A 3IQWA 1COWD 2AFHE 5JWHA 1LNZA 3VNVA 5IF9A 3VU9B 1XMVA 1FMJA 1N5KA 1DADA 4L15A 2KBFA 1N6IA 4C0HA 2V1XA 2Z43A 2JLZA 2QBYA 4XSGA 1E9AA 4RFVA 5M04A 4KAXA 5B2ZA 2ZE8A 1CJUC 8OHMA 1ZCBA 1OXUA 4M9SA 4UNPA 4TZ0A 4RY2A 2HJVA 4DUGA 1IBRA 4Q7LA 1BKDR 4GP7A 2WWXA 5EZ6B 2CHQA 4AG5A 2ZREA 3I3SR 1G7TA 1X86B 4M22A 3LXXA 4EJSB 2ATXA 1CTQA 3QG5A 3L82B 4JLNA 4PTLA 4Q01A 4ESVA 2G0TA 4DLZA 1H65A 1GWNA 2OLKA 3AF1A 2CBZA 1S3GA 5DHAA 4MYTA 3DM9B 2ZJ8A 3BGWA 3RSLA 1IHUA 2JIZD 3RYTC 1W2HA 1P2UA 2GDJA 3CRRA 5C18A 1U0HC 1QRAA 2HJGA 3NG1A 4DCVA 3K9NA 4V0ME 4C2TA 2DFTA 2IYTA 5EP2A 5DLQC 2C9CA 2WJYA 4QBFA 1DVRA 2GILA 1VTKA 2R6AA 1G3QA 1IXSB 4M1SA 1NSFA 3WP0A 3VR1A 2ZETA 1OB5A 1MV5A 2UKDA 1ZUNB 5JS8A 4JLVA 1E0KA 1CJVC 3SN6A 4R98A 3AKEA 4U00A 3CUEF 2DCUA 2IWRA 3H86A 2Z4RA 2I4IA 5FOSA 1T91A 3I73A 2VLIA 1CS4C 2CK3A 3MJRA 3VHLB 3ZVRA 1Z83A 2OSBA 1R5OA 2WJVA 2XX3A 3LX5A 2H92A 3BERA 4LI0A 1ESNA 4NYMQ 2CL6X 2C78A 2MSCB 3GEEA 3C5HA 3CH4B 1G6HA 4N0DA 4TYPA 1W44A 3OIYA 4TLDA 5E7IA 4ERNA 3BH0A 5FL7A 4HAVA 1YZQA 1XNJA 4FD2A 4QBGB 2OESA 2GCNA 5L3RA 4OQFA 1IJEA 5JCZA 2A5YB 2DFNA 2VQSA 3R7WA 4PANA 4IDOA 2XNDD 4Q66C 1G5PA 1JPJA 4EDHA 1XFAA 4QL3A 3IPYA 1NMYA 1KZGB 1XEWX 3SOPA 3PUVA 4JSTA 4US2R 3CLVA 4JLKA 4GZLA 4AURA 4A15A 5EXPA 4BZQA 5F9FA 3TW4A 4KSCA 1R4AA 1NP6A 3DZDA 1MABB 2QP4A 4WOPA 4QM6A 5LDDC 3QBTA 2H7VA 2REXB 1P4SA 1QHHB 4RD4A 2B6HA 2BEKA 2HT6A 2ZPTX 4EFLA 1DEKA 2JLUA 1W7AA 2EWWA 3U7FB 3K0FB 1AS2A 4MUAA 1E0JA 4NCHA 2ZRIA 3VR5A 3LQQA 4DDVA 1X6VA 1OB2A 4C7OA 3IQXA 2QM7A 2PZGA 1R8SA 3WBJA 1EGAA 3M1IA 5HCIA 3B1ZA 4OI0A 3LLMA 3CZPA 2W6ID 5BWMA 3HU1A 1Z6GA 2C5LA 2Q3HA 3I1FA 1KSHA 2XTZA 5D3MA 1H8EA 2F3RA 3SC3A 3B1YA 1JAHA 2NZJA 4KYIB 3UWKA 1S9DA 3B1XA 4FMCB 3N2EA 2JLWA 1TU4A 4H1VA 5JJIA 1QHGA 4A8JC 3QEOA 4CEHB 2IYXA 2QP9X 2ZI5A 1FP7A 3KKPA 3CIOA 4ZDIA 1SXJC 2YV5A 3AVXA 4E03A 2P6NA 3X1DA 3LO5A 5TXGA 4Q4AA 2DFKB 4QXAA 3TUJC 4B32A 4EPXA 2AXPA 2PJZA 1ZU5A 2RGCA 4Z8XA 4PC3A 4GDFA 2IYWA 1NKTA 3K09A 4ZI2A 2ORVA 4NP6A 3SDZA 3LA6A 1XTKA 4GMDA 2PH1A 4JLBA 4EFMA 4R9UC 2QG6A 3QNUA 3B5JA 4IHQA 5IRCD 3GLIA 3D6TB 4MKGA 3GMTA 2Q9CA 1XMIA 4KI0A 3UIEA 1ZMXA 1XTIA 4GZMA 2PMDA 4L16A 3DEFA 1HT2E 4M1MA 1IXRC 5BW8A 3AVVA 3DZ8A 5AJWA 5CJPA 4C2UA 3CR8A 5EP1A 2O8EA 4BPBA 4GSYA 2N42A 1UAAA 1RE0A 2CNWD 3W6OA 3KTAA 3AKDA 3QXXA 4KODA 3V9PA 2GWHA 3QVVA 3QVUA 2FZ4A 3AH8A 3UMSA 4PHGA 4Z8YA 5JSZB 1UADA 4RFSB 1UEJA 5KSZA 5DHFA 4K81B 1MT0A 1MRNA 2ZU0C 4M9XA 3UKDA 2HXSA 1E79D 2CCJA 2G83A 1OYYA 2JLRA 3U6KA 2GCPA 3K0AA 3QUSA 1TUEA 3KXKA 4CVNA 3UG7A 1XEWY 1II9A 3OEEA 1Z47A 2PEYA 3CRMA 5KTYA 1WXQA 4DT1B 5L3QA 1VECA 1PUIA 1J7KA 1KK2A 2GXUA 2BHRA 4HLCA 1RKBA 3SHWA 3CZQA 2FGJA 3O8BA 2ZJOA 4G5QA 4P4SA 4UQOA 5K8IA 3CNNA 2BV3A 5J4LA 1BYUA 1D9ZA 2ZI3A 4TTPA 1ZVQA 1II8A 5KDDA 3MWLA 3BXZA 4DLSA 1XU4A 5JBQA 1Q57A 4V0LA 1KNXA 4PO1A 1HE8B 1E2IA 4ZDWA 2A30A 5B57C 1G5TA 1H8HA 1NLYA 4TL6A 2E1RA 5FTKA 4JLOA 4LJAA 1U81A 4TWZA 4D81A 2R6FA 1R5BA 3BJIC 4M1WA 1N5IA 3TE6A 3TR0A 3FOZA 5F9HA 5KDOA 1N5LA 4DVGA 1OV4A 4L9SA 5AJVB 3W5JA 1OSNA 2FEMA 3VR6A 2QBYB 5DNYB 2AR7A 1DTSA 2QI9C 1FX0A 1HV8A 1Z2AA 1BO6A 1T3SA 2EU8A 4G1UC 2AWOA 2VHUA 2RB4A 5A0FA 1Q0UA 3W34A 1Y3AA 4PZLA 1ZINA 2WV9A 4KCGA 3AF3A 1VYTA 4II7A 3VHXA 1P9NA 4H1UA 1N5JA 4D4MA 3CNOA 2Z6VA 1Z8FA 3F5FA 4LWZA 4DCNA 3RSOA 1J99A 1CF4A 3TLXA 4X8OA 4B3DA 1TF7A 4FCTA 4TSFD 1K8RA 3H1TA 4PPQA 2ONJA 3EIHA 1NVUQ 3ND9A 4EPYA 3EA0A 1ZRHA 5UKDA 3X1WA 2C77A 3OAAD 1DARA 2GVZC 3W3AA 3EWAA 4LHZA 1W36C 1R0YA 4PZYA 4WXRA 4LOAA 2PZFA 3GEIA 3TKLA 1NVVR 2V6IA 3OE7A 3P1JA 4M1TA 4C30A 3AVWA 3A4NA 2WAXA 4E22A 4L5BA 3ZVMA 5HE8A 2B7BA 4A0RA 5C46F 1DAHA 1M74A 4HEJA 3ZS8A 4OHYA 5HCNA 4OI4A 2C03A 1KK3A 1T0HB 4AYXA 4DDWA 4HUQA 4TLCA 4M4SA 2PCLA 2VA8A 5CB8A 3OEHA 2VP5A 4DLWA 1WQ1R 3B78A 2J0VA 4IDQA 1SVLA 3BH6A 2BEJA 1QHNA 2J45A 1XD2A 3CRW1 1IM2A 1TQ6A 3CPJB 3I5YA 4CYMA 2G1JA 4EAQA 2GEVA 3EZ6A 4AC9A 1YRBA 5AUNB 4LPKA 3ZD6A 1VDZA 2BVNA 3CNLA 3KFVA 5EJEA 2Q6TA 2KE5A 3U44A 1EFTA 4MYUA 4YQFA 2DY1A 3QXJA 1W0JA 4LC1A 1AKYA 1QHYA 3EZ9A 3QE0A 4NCKA 4B3FX 2ZRDA 1MOZA 1ODFA 4PAMA 5FBLB 4ZDJA 1KO5A 4QJ5A 4YXWD 4PPGA 1D6JA 3QY0A 1G3MA 2VP9A 4DSOA 4PC2A 5FR2A 3JVUA 2Q9BA 5JI3E 2ZAOA 5DISB 1Z6YA 1R10A 1FZQA 1R5NA 3R7WB 2AKYA 4A0FA 3FMPB 2GZHA 4PHTA 3REGA 1ZM4A 2ZSBA 4XJXA 4MGIR 3CKLA 2ZJZA 3Q72A 1XJCA 3LWNA 4G5OA 5IDVA 4QC2A 1A4RA 1SQ5A 2EVWX 1NBME 2PT7A 5EP3A 2LCFA 2NTYC 2UZ3A 1E2HA 3RRYA 4TMXA 4LJ6A 1C1YA 4UNQA 1BIFA 1VIAA 4LHXA 2O8CA 3I8XA 1NN1A 3AF0A 4OHVA 1X1SA 4W9MC 2IS4A 3WHKA 2OXRA 2CHGA 3AQ4A 1S0UA 4LYJA 5IK2A 2WOJA 2F9LA 3DO6A 5DH9A 3WHLA 2CL7X 3IEVA 2GJ8A 2ANBA 3KB2A 4RJLA 1Z0DA 4NE2A 4C7OB 2R6DA 1N0VC 4BFVA 2HF9A 4GP6A 1ZNZA 4N0EA 4KHZA 3LW8A 3WYAA 3O8DA 4HDCA 3T15A 2EYQA 4AK9A 2JLYA 3E70C 1U99A 5HPYB 2QRNA 1E2EA 3OF5A 4B71A 2CHVA 3CRVA 3GFPA 4JLAA 3EARA 1RFLA 3T12A 1M7BA 3U4QA 2RKOA 4URVR 2OG2A 3GPLA 3THXA 4LYHA 3VNUA 4Q19A 5GVSA 1CJKC 3NWJA 4TMWA 3C15C 1TEVA 221PA 4OKSA 2ZTSA 3IDQA 2GJSA 4QBHA 2ANCA 2RGNC 3BB4A 4Q4AB 2YJTD 1HUQA 4QNRA 2V8OA 3K0EA 1LV7A 1EG7A 2VP2A 4IOJA 1Z6XA 3MSXA 1VCIA 2EFDB 4AYWA 2KWIA 3IO5A 2WWGA 1N6NA 1E2MA 3EX7C 3E1SA 1DAIA 1US8B 3PCRB 1L7VC 5DN6D 2G0NA 1V43A 1VPLA 2G6BA 1OHHA 3CO5A 1OFHA 4NYJR 4JLPA 4WZBE 3HWSA 3GLIB 4ZIRA 4X8HA 5J4VA 3SBDA 3KZ1E 1F5NA 1P2VA 3L2OB 3TW8B 1KO4A 2YOFA 1HE1C 3GJXC 3IBGA 4FCVA 1NY5A 3P4YA 2OBNA 2ZRKA 1IN7A 1DG1G 2J87A 3OFND 3U3RA 2XB2A 1BMFA 4D82A 1RC8A 1TU3A 3B2EA 4JBXA 1YJ5A 2VHTA 4CW7A 1W4RA 4Q5IA 2ZM5A 1F48A 2ZSAA 2FH5B 4WZ6A 3WYFA
chains in the Genus database with same CATH superfamily
5EQJB 1PDWA 2HQOA 2NQTA 1RJ9A 3K0BA 3UK2A 4C4XA 2JIRA 3NO4A 3KFXA 4LS3A 5C37A 1M6WA 1O54A 1ZK4A 4CLOA 3ASYA 3A4VA 4DW8A 1ULZA 1DAEA 3K0AB 4ESHA 3M2PA 4RD1A 2IYYA 4RE6A 4H6XA 1UBEA 2L0XA 5PGMA 2QHXA 2W22A 4NZPA 2JBWA 3JAKA 4MROA 2ECPA 2DAPA 1EXWA 2WINI 3DXYA 3UH1A 3K9LA 3PNPA 3NP7A 3PUWA 2R6CA 3ADKA 4MA0A 5E1DA 1OAOC 4P4SB 4KX5A 3QOWA 4NI5A 1XZPA 1WW3A 5BV2P 1P31A 2B35A 4Q18A 2FX2A 1BDMA 1IY1A 5I8PA 2X76A 1AQUA 4UZSA 2GK4A 4P4TA 4XD7A 4WBNB 5HILA 3AUFA 1C30B 3JW8A 4R6WA 5EERA 4LNHA 3IGFA 4S35A 2WF8A 4L02A 1POXA 2JAUA 1W19A 2IYQA 2ZFUA 1M1YE 3GI1A 4NV0A 3CWZA 2YJZA 1NDQA 2II6A 4DMRA 2OO3A 3HWX1 3NTUA 1YJCA 3FPLA 3P9NA 2ACWA 4YFYA 3FMGA 4RNDB 5IF3A 1XTRA 2A3RA 2QRZA 4G67A 2WSIA 1XYGA 3S1AA 4HLUC 1NJFA 3QLVC 3VPFA 1WBDA 3T9EA 5FFFA 3U9SA 1Z73A 1QNLA 3QSYA 3VNAA 4TSRA 1ZJYA 4H7FA 1N2XA 4A4DA 1TTTA 3FROA 3LCCA 3OCVA 4HYEA 3UYLA 4LN1A 3O75A 5F77A 3MT7A 1TYBE 3PUZA 4HAWA 3QKIA 4JI6B 1MEEA 4L8FA 4TZ6A 4TQAA 3DP7A 2PGIA 4LDAA 1D04A 2GZMA 4B43A 1DGQA 4UUOA 1X3LA 3I2HA 4PR0A 1ZRNA 3PFCA 4QPDA 1UMBA 1Q44A 4NHEA 5HQ3B 1DC8A 3A8TA 4M1ZA 5BP7A 2J33A 3TDNA 3ZHRA 2WWHA 3R3HA 1DOAA 1RI3A 3BXOA 3CPEA 3JAWA 4FW8A 2NNLD 2OL4A 5I3CA 1YONA 2JARA 2QRHA 3KJGA 3NGLA 3KAPA 1E63A 1UZNA 4DA4A 4O0MA 2P6RA 2X9GA 2XBUA 1RYHA 3QLUC 1UCFA 1XCMA 2P9EA 3HJGA 4GMGA 4DARA 2LBPA 4CCYB 2RHGB 1F06A 2PSDA 1O4WA 2WZCA 3R7BA 2ZRBA 2QQ0A 3A7DA 5DPMA 3TD9A 2PUTA 1M83A 2AF3C 5AVOA 1T29A 4JMLA 3TQIA 3Q9SA 5DWQA 1HEUA 1CY2A 3DL4A 1PFGA 4B31A 2W71A 1T36A 4EIWA 2VOEA 2RFLA 3PVZA 4CIBA 1EGQA 3OQIB 3HXOA 4NIMA 4HFNA 3RTCA 5HRUA 3Q3GE 3TCKA 1XZEA 2Z0MA 1Q2XA 1BE6A 1CEXA 4PLZA 2QR2A 3AM4A 4PXAA 2JJ8A 4MYHA 4N5HX 1YS1X 2CCGA 3AR7A 4KGVA 1N6PA 2HCBA 2WKPA 3BAZA 4G5SA 3NP9A 1BCRB 4NDNE 2YZGA 1NVFA 1CY0A 4YT5A 4KVAA 5AKGA 3WB2A 1BS2A 2XZPA 5J4KA 3WA7A 3D2LA 2G0AA 4RGYA 4IFBA 3IEMA 5SYNA 4LSMA 3D8NA 1JALA 4ND2A 3MD9A 3V33A 1W35A 1XF1A 4CLHA 1M0SA 2PTHA 1X8LA 4JHXA 5EKXA 2FGKA 3UAGA 1HZZC 4OQ4A 2ZR9A 3JWJA 2IFTA 4DMKA 3NEJA 4YHHB 3BRSA 4R16A 1WHTB 4LKOA 3CSDA 4KVFA 5I5GA 3UXYA 1DKOA 5CB0A 1YE8A 3KSRA 2CZQA 2CVZA 3G17A 3AEYA 4WZAA 1TEZA 4DLPA 1E3JA 1Q0PA 2AXQA 3B36A 3T54A 1M6VB 2Q3MA 2WDZA 2H5IA 2YWHA 1CUHA 2R8XA 3P5BA 3A0UA 1W6UA 4WY2A 3TH5A 1E6EA 3BF8A 4XUCA 3T3EA 1L8LA 4C7BA 1VYUA 1H9BA 1Q7EA 4ENQA 1Y6ZA 1OX6A 1RRFA 2NAFA 5AQEA 3WLAA 1WTCA 5KSYA 1B0AA 1W96A 3LPNA 1E9CA 2QSYA 2ZJ0A 1L5ZA 1D6SA 4DCSA 4F9FA 4MICA 8ADHA 1GG2A 4N03A 2MSKA 1JBKA 4H1WA 3M6WA 4JKYA 2VJDA 5AK4A 5ALHA 3VR6H 4IKOA 5IWAB 2E5FA 4E7PA 3CFYA 2W2PA 3CU5A 1IAVA 1JV2B 3M3DA 3KAQA 4NHOA 3AF4A 5IMSA 3B8EA 3FGOA 1Q7RA 4DR2B 1K5PA 4ME6A 2E4AA 4A8PA 1BN7A 4LY9A 3STYA 4ALIA 4X54A 1KZYC 1IB6A 5JS6A 3C6QA 1V8ZA 4RZXA 4ILEA 2GD0A 2ZG6A 3AP3A 3KDSE 5LDGA 3OQNA 4NYIR 4B3BA 3ETLA 3DVAA 2O1XA 4AS1A 2P41A 3T0IA 1AN9A 1CHNA 1KZ6A 2MTBA 3GZNB 3IP9A 1ACLA 1JAXA 4MINA 3BZBA 3BN3A 3AHGA 4XQ9A 5AW6A 4R8LA 3CQ9A 4FYWA 4QGGA 2ZT7A 2XCRB 1D4OA 3ETEA 5CEFA 1Y8CA 2A9PA 4KQIA 3WLEA 1G4UR 4KMSA 1I4LD 2OK7A 2PM8A 2FU5C 4BLTA 3M1YA 4ZCPA 3U4QB 2IW3A 1AKVA 1V6SA 2LWIA 5FPQA 4JROA 3L06A 1IWOA 2VTDA 2Z2KA 4FMCF 4F0JA 1VKOA 4CGYA 3TI7A 1N36B 1JZSA 2NTJA 4QG3A 1GQYA 2WIDA 2Z2IA 3CNEA 4LXQA 3UJCA 1P75A 3TMKA 5I9NA 2J4DA 1SCIA 3SM9A 4CT4B 4GOND 1AK2A 2P6OA 5AJHA 5CFQA 3ROFA 2C1ZA 3QHPA 3TK1A 1L1QA 3UBMA 3O8CA 1W34A 3ENWA 4C21A 1H8ED 3NDJA 3MGAA 1RYEA 2C5HA 4DBLE 4NV3A 3UGJA 1YNSA 1LBHA 2OAGA 2ZI9A 2BMAA 5BSUA 2I6FA 2CVFA 4R9VA 3FDJA 4JJEA 4OQMA 3RC9A 4HQ0A 2JASA 4D8XA 3H2JA 9LDBA 2OHGA 3S44A 2OCAA 4KFUA 4MQEA 4HWKA 4IHJA 4XEHA 5JCOA 4ZC1A 4LJ9A 5B30A 3T3MB 3HVHA 1PIWA 4B5KA 4MVJG 2ODEA 5DYIA 3QVGB 1P0QA 3B89A 4BN0A 2QRMA 4ZIRB 2EFJA 2ETVA 3O3NB 1UP7A 4RNCA 5JZBA 5KC9A 4DHEA 4QFMA 1YGPA 3DPSA 4AIRA 5KJ1A 3S70A 3ZWNA 3H1PA 2A1TR 1VIMA 2C7VA 2YWJA 5KI6A 4I1OA 5LWHA 4C6TA 3I64A 1PR4A 3B12A 3V1UA 3D4NA 3PC8C 2NZVG 3W9SA 2NT3A 4WXYB 4MW2A 4E5PA 4R8MA 1WKBA 1YQQA 4MPRA 4BL5A 1SA0A 1CUJA 5EIBD 1ZM7A 1L4HA 2IRWA 2X3YA 4KPUB 5E9AA 2R65A 4Q1FA 2DKFA 1M1XB 3PPXA 4DR4B 1J4AA 3IMCA 2GWRA 4A16A 1KI3A 2NXNA 2M6RA 2VHZA 3I3OA 5FWDA 4C0KA 3T7TA 5BY2A 1BE0A 3DBRA 3IKMB 2W5UA 1M0WA 5DYTA 4FDVA 3QF7A 1HDRA 2WUDA 3CT4A 2P7HA 4EVQA 1O3YA 1WZUA 3FPBA 4BFCA 4PIMA 1YFLA 3GAZA 3M4ZA 4TWAA 3SFVA 3CS3A 1RWXA 4FSXA 1HKUA 2WZQA 5A02A 4WN9A 2W2KA 4RMHA 2QNIA 2XZDA 3ONFA 4RDHA 3L92A 1LBTA 4BAGA 1ZUD1 1I4OA 3FNHA 5JY6A 3A1SA 3EISA 4Y2HA 4AG6A 4LMRA 4LV6A 2JLSA 1C3OA 3CB4A 3L01A 3AHHA 4MVWA 4OIMA 3RKRA 5AKIA 4FINA 1BNCA 1E98A 2ZOSA 3EBLA 1PVOA 2GA9A 3HJUA 3OA0A 3CTMA 2H1FA 2Z30A 2ZIVB 4IVRA 2HHLA 1C7EA 1L6RA 2ONYA 2PWAA 1K7CA 1BC5A 3PX3A 2N1BA 1UBMS 3LY9A 4GAEA 3NGXA 4TS3A 3RW9A 1GGVA 3RYIA 3KXDA 1PFVA 3MGBA 2O2SA 3NYQA 4Y9TA 3V3KA 4XI9A 4V1CI 4NCJA 5LQUA 1A1SA 2GAJA 3DULA 1EVZA 2PGLA 1X1EA 1X9GA 1UMDB 2DFDA 1O9HA 1JIKA 3MGGA 5AICA 1OLSA 3FPKA 2P77A 4TZKA 4FFLA 4MWTA 1H0SA 4EPVA 1SD1A 1TL7C 2AGVA 2AX3A 2PX3A 2IYVA 4F7WA 2NQ8A 4BX2A 1QIFA 3L0IB 5ALQA 1MNAA 4TRNA 5L3SB 1J23A 2PPVA 5DM2A 1KAOA 3NI2A 5TS2A 1KDPA 1TIKA 3KLBA 3QVWA 5KQPA 4YQYA 5J40A 3QX3A 1W75A 3F6RA 1KYYA 2F8TA 4BV2A 5BWCA 3EXFB 4XYEA 1XQ1A 3I76A 3E4DA 5JDIC 4AI6A 2BP7A 3AHFA 2FV8A 4PYNA 1JHRA 2D5IA 4G0MA 1L7BA 2ON6A 5FCDA 4IUBS 4K6KA 3OF2A 2IDMA 3RIEA 4D98A 1NWHA 5B58C 2ID4A 1FMCA 2DBRA 2WLSA 2BOVA 4KXXA 3GRPA 4OX9B 5MFPA 1ZC4A 2QTWB 4COKA 5J43A 3AUAA 3I4LA 2NGRA 5B58T 1IIRA 2J59A 2P35A 4P3PA 4F2WA 4FYYA 5KYYB 1DCMA 2DPHA 4L4YA 1CXZA 3JSXA 3W5DA 1APBA 3USCS 4U2CA 3G9XA 1SIBE 3NT4A 1R4NB 3WGIA 5HF6A 2WU0A 1O0BA 4LDJA 3L9XA 4P7KA 1L7MA 4JK3A 5IM4A 4GX5A 3AUKA 5FLYA 1HQKA 4F5DA 4FWTA 4AWXA 1E1NA 2R7KA 3OO0A 3P20A 1TM4E 4MUFA 3WE7A 1JEOA 2EJTA 2J46A 2JPDA 1XQYA 1OROA 4JJAA 1VP3A 4WY5A 1GPNA 4RK5A 4JBNA 4M0FA 1YK1A 5KJFA 5FOXA 1BCSB 1DPFA 1MJGA 1V6AA 3EG9B 3EVGA 4DNOA 4G0PA 3AJ9A 2NO7A 3KB6A 3ZK8A 5IXYA 4FI3F 2DQYA 4K6FA 1EX7A 1O7JA 1ZM9A 1A8IA 1YL7A 2C7GA 2G17A 3F0TA 5BSEA 1J42A 1UKEA 2XNCA 4Y2TA 3RT9A 4ARCA 2XKAA 4GLOA 3EPJA 5JD5A 1YWGO 5IT0A 4KQHA 1KQPA 5LP6B 2SNIE 2XODA 4IIHA 1QHSA 2WHEA 2AFVA 5BQ5A 4EWLA 4F5EA 1EJBA 1HFKA 1Z45A 2B82A 3N87A 3TIXB 4F3YA 1F3OA 2ZBEA 3JQ7B 3WJ2A 3R2JA 4XOUA 3ONDA 4NZ9A 4YRIA 2W70A 1U0OC 3CEHA 3ROXA 1D8AA 2BDTA 2J0EA 2QN1A 3D8HA 4J16C 2FSIA 3NVAA 4TKVA 1QFSA 3FKJA 1GL7A 1GZ5A 1SWWA 4EMTA 2XHZA 1BD3A 2WJJA 3GU3A 5LMZA 4CM5A 4N3BA 3JWEA 2EDAA 4ZAVA 2C7RA 2RHCA 1ZJ5A 3VR4H 3DWGA 1S8NA 2DHQA 2EKDA 1ZR4A 4MMZB 2QE6A 4K9DA 2BISA 4Y0VA 5KNLA 2IQ5A 4DIKA 1R8YA 3MG9A 4E15A 3UHPA 3OJFA 2FG6C 4D45A 1WXHA 2IUYA 1MNQA 4YUAA 4MQBA 2IZ5A 4Q47A 4RXTA 1RKUA 3PHIA 2IEBA 3EOBI 3VAAA 2OSVA 4LNUA 5EZ5A 1ZU4A 1R0KA 1HTWA 1SKUA 3EUAA 3OWHA 4IL5A 1ZH8A 5U4QA 2I6UA 3H5IA 1MH9A 4E5DA 1XDSA 1GILA 4Y6PA 1CR6A 4Y6RA 3VHRA 1U2GA 4YMTA 5HEKA 1FY2A 4A6DA 1A88A 1TDJA 5IVPA 1GU1A 4CKEB 2TRSB 1C0LA 2YQ5A 1HLFA 4O4JA 4BQPA 4CLDA 5K8LA 5G1PA 1OVGA 1RBQA 3AHDA 3ZYZA 5IXSA 4B4OA 3VX3A 3F9RA 3NBKA 3CW2A 1HK7A 2XMQA 4WT7A 4A0GA 1RHJA 1Z06A 3DV0A 2P75A 3I2KA 4CKCB 2YQ4A 5JECA 4KXNA 3DA8A 1QLWA 2V7XA 3NHLA 4D5GA 2P62A 5C8YF 5CVJA 2C3YA 3IEKA 1PEDA 3Q5GA 4LJKA 1SCDA 4LF8B 2NV6A 1Z37A 2QA5A 1BXRA 3BILA 3L7NA 5IK2D 5KNCH 4LHSA 3TGPA 2BZ1A 2O2XA 2OP1A 1CK4A 2ODAA 2LE0A 4UARA 1GOTA 3MMXA 5IAOA 4ALLA 1XJ5A 2OFPA 2Z8ZA 3GJ4A 1NR7A 4DPLA 4U0JA 3TNYA 1SU8A 2QSUA 4Q3AA 2JG3A 1H3EA 4BE9A 1TKBA 4NH0A 1K4YA 4MVJM 4MWOA 1BDJA 1VB3A 2IYNA 3HVKA 3LZDA 3MF4A 3RFXA 1P0PA 1F4LA 2QTNA 4Y2SA 3PV0A 4IO0A 2QRQA 1JJ7A 4KIWA 4QPZA 5ICCA 4YBZA 1Q74A 3RSGA 3GFGA 2AB0A 5ARDA 4BKRA 4ZALA 1F0YA 5LYJA 1SVWA 4X3PA 4J0QA 1I9CA 3EGEA 2C97A 5HQ3A 5AVKA 4FOTA 3VPCA 4XSVA 4BIMA 1WO8A 2PFGA 4YC7A 1I1NA 2QNBA 1ODKA 1RKXA 1X8KA 3FPFA 5B37A 3S5UA 3QP9A 4NE7A 1FJGB 3NTQA 2Z5FA 1V16B 3DLTA 1E6MA 4GPEA 3IP3A 1A4IA 1WLYA 2UVPB 1GUZA 3SC4A 4EMUA 5BWBA 1FDOA 2QD2A 2JW5A 1RYBA 4XVHA 5J2TB 2Z1DA 3MMNA 4D4IA 1Q21A 1X3SA 2XW6A 3PA6A 4GYWA 4WZBB 3MJVA 1ZPDA 5EY5B 1UDXA 5EMLA 3VGJA 2R47A 2HYDA 1E7QA 2D7JA 2WHPB 1M72A 4ZOAA 3TGWA 3GPCA 4PX9A 1CY8A 1GSIA 3OZAA 4TWBA 2A9VA 5IT5A 3HWWA 2IHUA 4P3YA 5AVTA 1T5DX 5D3ZA 5G0VA 4J8PA 4C4OA 3FNEA 3NC1C 5EJ6A 1QWSA 1ODLA 4OPMA 4RYLA 4U2GA 3ZPXA 3ZLUA 1X7ZB 1J9GA 4OK3A 3NHFA 4LDPA 4BMSA 5GTDA 1VKZA 1IQRA 2XB6A 5HGXA 3OVMA 4IQ8A 1ISGA 2IHYA 5H4HA 3VKWA 3OLCX 2BGUA 4J07A 2O3RA 4Q9AA 1OR8A 1OA0A 4ZVNA 3PIIA 4QRIA 5H59A 4GMKA 3SAJA 1YHNA 2DWOA 1NX6A 2GD6A 4FZJA 2FPMA 2FFQA 2X3FA 2J3QA 4ENUA 1SOMA 2ZIUB 4NJEA 5EPEA 4HDQB 3KB8A 4FFBB 3I4FA 3K2BA 1ZMRA 2LDBA 4GP9A 1QTNA 2P5SA 3PEVA 4MS4B 3QFFA 5BYBA 1SVUA 2H1OA 3JVVA 4BMYA 4QYIB 2B8TA 4EKDA 1XT6A 3H2ZA 1OXMA 1AC5A 4R1LA 4XJVA 4Y2YA 3GN2A 4W9NC 5K6AC 1U3WA 2DC1A 4Q3OA 1QRSA 2PRKA 3SYLA 3PG5A 3EMDA 2PU5A 3NAQA 3PNBA 4OL0A 4Q4JA 4RZ3A 1T9GR 4WEOA 1I94B 1IPEA 5LXTB 3U6BA 1SKQA 3PXXA 2QB5A 2MMGA 1LPPA 4R9SA 2RI6A 3Q9LA 5HMLA 4O59O 3ABZA 2GEUA 3BFKA 3EVNA 3HRHA 3L8GA 1EVEA 4DJ5X 1XZKA 1F60A 3WMGA 1SRRA 5CMLA 2PH5A 3MJHA 4O4JF 2W2OA 3HH8A 5DP2A 7ABPA 2YY7A 3GGJA 3L1KA 1XD9A 1BW9A 4HNAB 2XF8A 3ORQA 3GEHA 4XGNA 4ZI7B 3NTOA 1PW5A 1UWVA 3TKAA 2Y3IA 5J59A 4BCDA 1J2RA 2QLFA 2VPXA 4JVOA 2FRVA 1JAYA 2R66A 3K0CA 4Y6LA 1RWVA 2REBA 4UFPA 1SBCA 3NTXA 3PVSA 4I50A 3ZDAA 2H48A 2HH9A 1QP0A 2L69A 4FYJA 1JR2A 3ZCRA 2FW0A 5CDFA 4DILA 1K8ZB 3DOEA 4DWWA 2JFWA 4PYKA 1EUZA 5I9IA 1ZNYA 3B38A 1KAEA 1CUCA 1SR8A 2B3TA 4NATA 5CM9C 3RIHA 4JYZA 1DT5A 1FQKA 4K9MA 4RVOA 4D6XA 2O8FB 3TJRA 2Z9DA 2IYPA 4LQCA 3WL6A 4R51A 1KC3A 1EJ2A 2HMYB 2IH4A 5CGQB 3LT2A 1ULSA 2QMEA 3KHTA 4H4EA 2ZRNA 4XVUA 3KCQA 2YVLA 3C7TA 4HBZA 2O3UA 1Z4LA 2CJXA 1JLLB 3S7TA 4KREA 1CIVA 2ZT5A 4RK0A 5KNDH 1LFAA 3ILSA 4P1ZA 1VG1A 1Z0AA 2OE2A 2WVJA 3WWCA 1FP6A 5FI3A 3NCTA 1E3DA 1YQ9A 5MF6A 1DCTA 5AM3A 1FTQA 3ML1A 1W1UA 4MDHA 3U09A 1JT2A 3CXRA 4URXR 2ZVJA 2ZDHA 2P9ZA 4FTWA 3ET4A 1MDBA 4BEJA 2FX3A 3LBHA 3PNKA 4PYMA 3V2HA 4CIVA 5AR1A 4FDTA 2BE7A 3BWMA 1Z4IA 1UBSB 1JKFA 3B70A 2IHJA 4Z0NA 4DLYA 5I6DA 4AROA 2GT1A 3RAPR 1UINA 3TTUA 3WLLA 2FUG6 5KX5A 2QUAA 1NG9A 2VYVA 1JW9B 3KZOA 5DCWA 4RZ2A 4TTRA 3U7HB 1FZTA 1ISPA 2ZJFA 3TWOA 1JB9A 3ANNA 4WUTA 2VZ9A 5SZKB 2OENG 4HDRA 5U9CA 3ZTTA 1ADFA 4BMOB 5T8KC 2WF5A 4ZHQB 4JDUA 3D4IA 1XMOB 2F90A 3IV7A 1IHPA 3MUNA 1ZHFA 2XJ9A 2XB4A 1YBHA 1PDOA 3PI6A 4Q3DA 1JFRA 5EXTA 1Y1KE 2MSWA 2VT6A 2W83A 1XPOA 4IQGA 2LDYA 1Q0HA 3GPIA 4AXBA 5GOTA 1RLJA 3MRSA 4JJZA 4OYYA 2PX2A 2REQB 4GW3A 2BPOA 2BGTA 3IXMA 1E2NA 4UTVA 1L5RA 3CXUA 4X1YB 1FPQA 3IJPA 3NWOA 5EC8A 4QU0A 1EXDA 3MTEA 1QBGA 4PE5B 2OC4A 1K3TA 3ZDDA 1RRKA 3T8YA 3D2AA 7MDHA 2X8WA 3R41A 3UAZA 1T9CA 2O50A 4D3XA 3ITDA 4PVCA 5DXAA 5C4IA 1XDZA 2F8LA 4X1OA 5BVHB 2QAGC 3EUWA 4AY4A 13PKA 1W6RA 2Y67A 3KLPX 1NM5C 2BGRA 5JD6A 3ABQB 2DHCA 4JBHA 1G8KA 4FHZA 4CNBA 4JYBA 4OHUA 2NU7A 1I0ZA 2EKBA 2JGJA 2Y68A 3LSTA 1T9KA 5C1IA 2WWIA 4EY8A 1JJIA 2H7XA 4HZIA 4H9GA 1E9EA 1XDWA 1RZVA 5TEVA 1EFVA 1XAJA 2ZIXB 1FNNA 4K28A 3CX8A 4D74A 1EP3B 1Y3HA 3FCYA 4AZVA 4CN8A 4OQZA 3FMFA 4UTXA 3EDYA 3O1HB 2O1EA 1VG9B 3OJ0A 4TVKA 2R8RA 2R2AA 5G41A 4O0LA 3HLKA 5AP9A 1QH1B 1K7FB 1YJ8A 2VHQA 2E37A 5JYDA 2QRJA 4FFOA 5BQ3A 1ZI6A 3QOFA 5K1ZA 4EI8A 5KYNA 2Y2VA 3R5FA 4GU5A 5ER6A 4JI8B 2XXAA 1DX9A 1TCAA 3KZVA 3U3XA 4JC5A 3SHVA 4MS3A 1FLVA 3OF3A 3GEBA 3H4MA 3M3HA 4HF7A 3RWMB 3RRMA 1VCMA 2JRLA 2H8KA 1ZCAA 3AFIA 4RF4A 3K1TA 1WXIA 2QW1A 2I03A 4NONA 4K9KA 1KJZA 1M6HA 2SCUB 5AOBA 5JHGB 1IHYA 1CEYA 5EINA 2DFPA 3BRWD 5BYAA 5E3IA 4C0JA 4YJDA 2JHCA 4YLEA 1O87A 2GJKA 2UDPA 4GOLD 2IS6A 5WRFA 3LECA 5GV8A 3A6DA 1B8OA 3ESBA 2F1OA 4RFLA 3RYFA 3OOSA 4RV5A 3M81A 2HMVA 1L5OA 2CEAA 4H77A 4R2WA 4AUNA 1O9GA 2CHFA 3BSWA 3TZKA 4TMZA 4J4HA 1J07A 4EG1A 2HRBA 3NPAA 4IIEA 1SKYE 2ODQA 2OKGA 2IZ0A 1K06A 5DN6A 3T6KA 1PG2A 2JH9A 4IP0A 2P6MA 4U3JB 3UOAB 5JZMA 1JEYB 4GX0A 1UDCA 2WV7A 2FA9A 2A84A 1E6WA 5FT9A 5A7HA 4EI2A 4CV3A 3QYJA 1C9EA 4WE3A 5JE8A 4H18A 4XW2A 4X20A 3ZOZA 3JQRA 2ZITA 3W2EA 3Q87B 2V74B 5FUMA 1EGMB 5D2CA 3V32A 4WCFC 1VE3A 5DSZA 4F8EA 2BFFA 2O7RA 3ADOA 1N9GB 3HCPA 1YKSA 4IIJF 4PRYA 4Q6BA 5JASA 2I9KA 3HB9A 3IE0A 2O2ZA 2ZAGA 3A9TA 4QHSA 2DLDA 1WHSA 5AUQA 2P78A 3BK7A 2NNWB 4FIZA 2R1ZA 4ZJPA 2X58A 5CCEA 3GXBA 4IDNA 1ZXBA 3WKAA 1ENYA 2RAPA 3HN6A 3JR7A 1TM7E 3LAWA 4BLUA 5HUJA 5A1TA 4RY9A 4LYGA 2RGGA 4PO9A 3I0MA 1CU1A 1KMQA 1Q0SA 1WRBA 2QR3A 4IV0A 3WRYC 3AERA 1MJNA 1JEEA 5FBZA 2QQEA 5G4KB 3ZDZB 1KBZA 2N0SA 2XQJA 1M2FA 2ENUA 2CF5A 3RVBA 3LY8A 1I6WA 3T1QA 4WKOA 3SI7A 2BIFA 1E7WA 5ENZA 4RFSA 1KIMA 1FS5A 1UXHA 5P8WA 1TVKB 3GGPA 4DLNA 1P17A 4Q15A 1FRFS 4C0QC 1JXMA 4HXGA 1TQ8A 2WT9A 1XBTA 2WWFA 6NULA 2Z9BA 1EXVA 1OTYA 3WC4A 2IUSA 1RD4A 3FYSA 4ICIA 1DS6A 5HKBA 4R1QA 2Y1FA 2O8CB 1QR2A 4MGEA 3RC3A 1R0RE 3TSCA 4A2QA 3N70A 1FTNA 1Z5GA 2R48A 4P4GA 3T1OA 3LBYA 3PICA 2B5OA 5CK5A 1R0ZA 4DG5A 4N3NA 5IC4A 2QUHA 3W05A 2J4CA 3B5EA 4OJQA 1JUDA 2Q5EA 5T57A 4UFNA 2X0KA 3M8KA 4KW7A 3EIQA 1MUUA 1UBKS 2WUEA 3JS5A 4KO2S 1Q11A 3S29A 5C1BA 1Z18A 2GZDA 3FXAA 4Q4CA 1P80A 4GF5A 1Z6AA 1E4VA 2DPMA 4QA9A 5I9SA 4F4JA 3DLCA 1NJ5A 3O73A 4GLLA 5D87A 1JQ3A 1YRAA 1ZUHA 2BLNA 3IE2A 4FHGA 1CHDA 4C3OB 2JCXA 5MFZA 2QZJA 3UMMA 2JDIA 3PUXA 4P3NA 3J81A 2F8SA 4BWYA 2I78A 2F9FA 3OX3A 2QSZA 2OGZA 3AU9A 1ZISA 3T38A 1FNDA 1OXTA 2G1UA 1C1XB 1LX7A 2FEKA 2LVBA 1MC5A 3A37A 2HV8A 3G49A 3DLIA 4WLFA 5F3DA 1L5HA 5K8UA 1Z12A 4R2JA 1UDBA 2AN4A 2RHMA 3MNFA 3QFSA 3RREA 1O96A 4YGXB 4MJ7A 2O8BA 3VKHA 2D2FA 2WDPA 3ULKA 5CT4A 1IOWA 4GO1A 5E2AA 4L72A 1ZMOA 4RKRA 4RVSA 5J63A 7GPBA 5JSHA 1K8QA 3OTGA 4UHDA 1OX4A 1W5TA 4REQB 1Z2EA 2R25B 3GFVA 4KGXA 3GJSA 3I05A 3KZMA 4ASUA 5D51S 1QQ6A 3UG6A 4CMEA 2QGZA 2BGKA 3GD7A 2FUG1 1A5BB 4NL4H 1EK6A 1SXPA 1EFCA 2Q4TA 1T2FA 1M8FA 3M1AA 1S3IA 5FTWA 4NAVA 4EYGA 1FBNA 3Q10A 4HB3A 4JUFA 4YO7A 4Q3CA 3M7IA 3ZY4A 3CR3C 5CXQA 4HMQA 2C9ZA 2QMYA 1QPGA 3QVJA 5F5XA 3TX6A 1JQAA 2RKBA 2V5UA 3AVPA 2YWFA 3BB3A 5EP4A 1VL8A 1MLDA 2NU8A 2GUGA 3OM8A 3H65A 4P38A 3K70D 2IEZA 5HSGA 3RKSA 4BQRA 4KE7A 4KN9S 5BSRA 3GGOA 2C2YA 2W2TA 1YB5A 2WY2D 4XGQA 2FEWB 1T9ZA 2IF0A 3H4TA 4G1FA 2QV7A 4IDHA 3HBMA 3PPIA 3TAUA 4ZQCB 1RYZA 3R8CA 4KB5A 4J0IA 4D8UA 3FPCA 1Q12A 3E0XA 3PD0A 5D5PA 4ETMA 3FOEC 3F3KA 2FCAA 1P72A 2JEOA 4H7DA 4B6JA 3PCTA 5KC8A 3ZEIA 3ACCA 1G64A 4WCVA 2BCGY 4OQYA 2RARA 3ANXA 1W2WB 3GUUA 2FQXA 3NKLA 4UMEA 4FN4A 3W8NA 5SZJA 2AWNA 1TAGA 2OK8A 2QL9A 3KEOA 1XDDA 4X41A 3UJ9A 5GZ1A 1B8PA 1U1IA 1MORA 1JQJC 2GDZA 4HWOA 4IDCA 5AYVA 5B2FA 3QFCA 4AP9A 1VCHA 1K6XA 1ZOLA 1O03A 1VMAA 1WE2A 3L41A 3ZIAA 3R24A 721PA 5MN5A 4BX0A 2I87A 1CNFA 3ZQ4A 4ZOLA 4ILKA 4F9TA 3P2MA 2FFJA 3FCEA 4NK4A 2EFEB 4HWGA 2MSEB 3GN1A 1VXRA 3G5UA 3LU1A 1G6KA 4JA2A 4W6ZA 4Z0TA 4RQTA 5AI6A 4EVIA 4PYQA 2ZJ7A 4WNCA 5A03A 2FZVA 1SU4A 4M89A 5LQDA 1GN9A 1Z38A 2OILA 1PL0A 2O7QA 5FEMA 1Q7CA 4DDTA 1KI7A 4RLFA 1E1QD 2IPNA 3N58A 4XWOA 5HOEA 3NHAA 2XNSA 4F4HA 4ZEOA 3RFCA 1XDBA 5KREA 4AZ0B 3ROGA 1QAMA 1QTRA 1CF2O 4QO8A 1JI0A 4DEXA 1YR7A 5CFMA 4GWGA 1E9DA 2IWHA 1COWA 3LH5A 3JQFC 3LUFA 2EP5A 5K4AA 1J97A 4PZAA 3WNDA 3ZHBA 1IY8A 1Z25A 1E7MA 4QLBA 3FYUA 4YRTA 1A4UA 4LFBB 1LCIA 5CBPB 1MQAA 3RK0A 3H4IA 3V00A 2VJNA 1G20E 3ZE2B 2OD2A 2OG1A 3WIDA 1PQYA 1U4SA 4HXFB 2G25A 1EP1B 1B74A 1RLUA 3T61A 4INOA 1FYXA 1N3BA 5B6PA 2GRJA 2C94A 4YNBA 4F45A 5AW2A 1P1KA 4I4TA 2X6QA 2BEVA 2OUKA 2VJMA 5DCYA 4F84A 3MQFA 3RLFA 1JKJB 1ND6A 1M1NB 3JVIA 5THXA 5B1YA 2XQIA 5AW1A 4MWEA 1I2AA 3ZIDA 1PJBA 2MYTA 3OT1B 5ALOA 2DPGA 1QE3A 2IYOA 4JBWA 5JNRA 1H5NA 1N6KA 3E81A 4PNHA 4TV8B 3VDRA 4DMFA 5BSWA 1P33A 4ARBA 1W5EA 2WD9A 2OHVA 4AZ3A 3HR4A 1XZFA 2QGNA 4KBYA 2VK4A 3H84A 3N2IA 1XXHB 1N7HA 2HRCA 2FN4A 1E18A 3O26A 1ZM3A 4A2CA 2EGGA 2PPLA 4NARA 1ZCZA 2BBWA 1XEAA 5BRAA 3FSGA 1SBNE 2R86A 4P98A 1TEXA 4PG7A 1N9KA 1IZ0A 3Q6NA 4G0VA 4AY3A 4YJHA 1I32A 2XYVA 4MSUA 4QKQA 4ENTA 3R7FA 1W581 3RSZA 3IVXA 5CDTA 3IQHX 1NF3A 4A8JB 1YQTA 4OQEA 4BWVA 1O57A 3WWOA 2HK9A 2IEYA 5JIBA 5F3WB 3IESA 3NBQA 2IVZA 1C9KA 3I6BA 2V7EA 5EJIA 4O25A 3FY4A 3T5TA 4DWJA 4L8LA 4OCZA 2WPDA 1FVOA 1FDTA 2PLNA 4E4YA 5DDIP 3T52A 2HLDD 5KTSA 3I01M 1GGHA 5DI3B 2FMUA 1YR1A 3LIPA 3T0GA 1VCOA 2YVQA 5FPKA 4NU0A 4KIFA 4XIGS 5H82A 3OOWA 4PPFA 3CKYA 1FYVA 5FUWA 5HQTA 3PHHA 1RYFA 1T5SA 1PJCA 3PU6A 1HG1A 2W8ZA 4TUYA 4B35A 1TCUA 2HA5A 3DEHA 2IHKA 1FU4A 3L84A 4ML3A 5BNIA 5HW0A 1Y4DE 1B2LA 3CF4A 5F3RA 3AYXB 3ICOA 4ZDKA 1F2UB 4Q4HB 3TLGA 3WLSA 1L4BA 1JMYA 2I6XA 3IVAA 4G8JA 2OCBA 3CEAA 4RGVA 4Q3NA 4C88A 1RXCA 4QU8A 4W5HA 1P1RA 1YZKA 2PBRA 3F46A 3P0RA 4QGAA 3ST7A 4BC0A 5A4KA 4WH0A 2XUFA 1QJCA 1MAHA 3EMKA 1ADGA 2AOUA 5CLJA 2EARA 3KOXA 3L7OA 1LY1A 3CURA 3IOYA 1G18A 1Y7HA 2ASEA 3IAXA 5JC8A 1OWOA 2E4XA 3CLKA 2FUKA 1GTMA 1C0EA 2V7UA 3HFGA 4QDTA 4I9NA 5KYUA 1S8OA 5HIAA 4NBRA 1PJAA 4RGQA 1XEFA 1KGDA 1Z07A 2O48X 2WMNB 3I61A 3ZVNA 2O0KA 2Z4SA 3USES 2VN8A 5M3BA 4DVJA 4Q05A 1NAHA 3FIJA 1JU3A 5DYWA 4BFYA 1RHKA 3O2NA 4HZGA 3R1IA 2DVMA 2VC2B 3BFJA 2QL5A 3GJ3A 3QUQA 4TSKA 4ER5A 5DHUA 1BE8A 4YX9A 5FYDA 3HDVA 1EKXA 4X7PA 2JCBA 5CT5A 4ALJA 4AP5A 5BOSA 2IBTA 2GCGA 5LZ7A 1TZJA 3C7CB 4QATA 5CFOA 1NPYA 1M34B 3BMQA 4V2UA 3NONA 1NWCA 2WTUA 4YUYA 3KQKA 3L7DA 3LX4A 1KJNA 3IAEA 5B3LA 4LRTB 3WYNA 4TQ9A 1X74A 2ZJ3A 3ZBTA 1NVTA 1GZHB 1C30A 3B8HA 4M0CA 4TTAA 5J5AA 5IVKA 4OJTA 4QOIA 2P30A 4EHAA 2IEDA 1OYOA 3HL4A 4DLXA 3C3WA 3H5VA 4YV0A 2W0MA 1XEXB 3TSWA 1U2TA 2FN3A 2OFFA 3ZW7A 1EP2B 2C61A 2GNOA 3PD1A 2HGZA 4IX1A 4Y3UA 1PFWA 4ZVRA 4I4TF 4K8RB 3C0KA 5EQFA 4DCOA 1KI2A 5A5GA 4PF1A 5DF1A 1ZOIA 4C3UA 5CG2A 3QF4B 2PRSA 4MVJP 3WMRA 2ZYUX 5FUQA 2ZBGA 1Z7WA 2XZOA 4KUHA 3ZWMA 3OPNA 3MWEA 1HF3A 2JGAA 1XXHE 4EZBA 2NG1A 3C4QA 4RHYA 5TIIA 2VJLA 3AZPA 2QLJA 4HVTA 4FJ0A 5G53C 1G9TA 2QQGA 3SZUA 2AN1A 2FVYA 2XE7A 1QU3A 4Z1MD 3JZDA 2FKAA 4HWPA 5A6SB 3DMRA 3JWIA 4X9XA 5U1PA 1JQLB 1LW7A 3UMRA 2VDMB 4G2NA 4QZVA 2RMKA 4HAUA 5JW6A 4WKBA 2WWYA 3U3DA 2P2SA 4RVHA 2IOFK 3O9VA 4ZT3A 1WOYA 2ZB4A 3LVQE 3DFMA 5AVRA 3R8FA 3ZWBA 3DFIA 3LUBA 2DY0A 3ORYA 4R0NA 3TZCA 4NOJA 4DLVA 3TD2A 2RB5A 3FJ1A 4D42A 2DHRA 1QP4A 1X9HA 4LUCA 4RVGA 3TL3A 3VJMA 1XHEA 1A1VA