1UBEA

Msreca-adp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords RecA
total genus 86
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubeA01
3LWNA 3HYRA 3K0FA 3LVQE 2J0VA 4YXWD 1WBBA 1MO5A 1P2TA 2XJ4A 3AP1A 3MWYW 4D26A 1SVWA 1G3UA 2EU8A 1E2MA 4HAZA 4G5SA 4Z8XA 2WWGA 1XMSA 3ZS9A 621PA 2Y8EA 3P1JA 3RRZA 1JJ7A 1UKEA 2WWFA 4FCWA 1G4UR 1T5LA 4BEJA 1Z6XA 4JVSB 4DKXA 3Q7QA 4POAA 3AUYA 2RGGA 1QHNA 3WNDA 1YRBA 1RFLA 3OHMA 1FMLA 2ZRBA 1OH5A 4MGYR 4BFTA 4CDGA 1CRPA 1Z2AA 4ZDJA 2B92A 2O8DB 5SZKB 1OPXA 1KI8A 2X19A 1N5KA 5FOXA 1KI7A 4WBSA 2BM1A 4M1KA 4NHOA 4B3BA 4MDFA 2F9LA 2AXNA 4AKIA 3NTUA 4ABYA 3M4YA 1KY3A 2NIPA 1NJGA 1XD2A 4LYJA 4E22A 2NQ2C 2IYVA 4Q1BA 1VCIA 2WZQA 1HEIA 1CJUC 2ZJZA 1ZU4A 1O3YA 3EA5A 3IO5A 3M1IA 4C9BA 1E2LA 1DOAA 3D8BA 4WZAE 4QHTA 4GBMA 3SOPA 4QGGA 3T12A 2VIIA 2O8FA 4D4LA 4LY6A 3CWZA 3SJBA 4NCHA 2HV8A 2R9VA 4CIDA 4DSOA 2PCLA 3TKLA 3DEFA 3AKCA 2GF0A 2GJAA 4B2LA 1NY5A 1LNZA 1AGPA 1E96A 4YDSA 4DSTA 1H65A 4DLZA 2QE7A 5JRJA 2XNSA 4DLTA 1W0KA 2AFHE 3B7GA 2FFAA 3FKSA 3FHOA 1VG8A 1UKZA 2RGEA 2VHJA 5HCNA 2NPFA 2VRWA 3KDSE 4RFSA 1E2PA 4NE2A 4QJ3A 2JEOA 4PZYA 4HSEA 2WJYA 3EIQA 3I8XA 4QHSA 1Q1BA 4B2PA 1G9XA 1PJRA 1S9DA 2W00A 4JZKA 3NKVA 2OFWA 1N6PA 3TR0A 4Q19A 4Q03A 3A1SA 4IVRA 4V03A 3LX5A 1N6HA 3U7EB 1ZD9A 2IUUA 4B73A 4MRSA 5KU1A 3LX8A 4WAUA 4XH9B 1ZMXA 1XU4A 2R6CA 1U81A 1GRRA 2DFTA 3EG5A 2RGBA 2ATVA 2GEUA 2JGNA 3RNLA 3B9QA 3Q5EA 3G5UA 4A0FA 4BRUA 1DAIA 3ZQ6A 5JECA 5KSYA 4OHVA 1XTQA 3PEVA 4US2R 3CH4B 3QEOA 2Q3MA 2MSDB 1XF9A 4OK6A 4BLRA 5JEEA 4A1FA 3K53A 4V0MA 1VYUA 4TT3D 4M1YA 1E99A 1FTNA 1R0YA 1BMFD 4PHFA 5HKKD 1LVGA 4IFEA 3IUYA 2WSSA 4W9MC 1G7SA 2XNDA 4X8OA 2IWHA 2GZHA 4URUR 5FR2A 1DELA 2CEAA 1HQYE 1YZTA 4CEJA 4FINA 1NLYA 2JLYA 4IDQA 3PENA 3AKDA 2DCUA 1E0JA 1KMQA 1CLUA 3KJHA 1NVWQ 2FEOA 3KQKA 4LV5B 4KVGA 1F6BA 4QC2A 4RCYA 3PEWA 4ZIRA 1FPMA 2QN6A 3D31A 2ZEJA 2AK2A 2QRZA 1VG9B 3DZ8A 1LY1A 2JIZA 3W6NA 2F1IA 2VA8A 2PJRA 5FTLA 3U61B 1F2TA 4Q1CA 5EQTA 3F8TA 5DE3A 4UXJA 1M34E 3L0PA 3OEEA 5ELXA 2GAAA 2D2FA 1U98A 2ZI4A 3KKOA 1XD8A 4ON9A 4FMBB 2C95A 4B3FX 3EZ7A 4Q01A 3VR1A 4XWOA 3AVWA 2WKPA 1Z22A 2WAYA 1PZNA 5KDDA 1G5TA 2Z83A 1P2VA 3T61A 2YNMA 4MYCA 2BHRA 2R62A 2ODNA 1A2KC 2YOFA 2ZANA 1RJ9A 4DDWA 2IXEA 1EK0A 2FH5B 3OIUA 1JEEA 5E4FA 1OH8A 4XSGA 3SI7A 5GADl 4K46A 3WP0A 2K5UA 4OHZA 5AJYA 2HJVA 4YONB 1N6NA 5FUWA 1AKYA 3GEHA 1YZNA 1M7BA 2EVWX 1P72A 3BJIC 3W8RA 3SYNA 1E9SA 4DLRA 1XTRA 5FR1A 4GPTA 1GSIA 4LJ7A 2P3SA 4M22A 1U2RA 4B44A 3T06B 1FUKA 4TLAA 1G21E 1N0WA 1SGWA 1Q1EA 1MV5A 1ZD8A 3TVDA 2L0XA 4TMVA 4HB3A 2DY1A 1S1CA 2ZJ2A 4DLUA 2ZE6A 3AGPA 2ZI3A 4PXAA 4B76A 3R9WA 1FQKA 2AKAB 2DWQA 2ZYUX 4LHYA 4Q48A 4FI3C 2OEPA 5DI3B 3UPUA 1RVDA 2ZSEA 4ZO4A 3RRNA 5J4LA 1T3HA 1NJFA 2XEXA 1J8YF 1NSFA 4G3XA 2ORIA 4B47A 4UNSA 1E2QA 2IX3A 1K5GA 3ICQB 5K8UA 1G5PA 3FB4A 3VAAA 4BASA 1P4SA 2XOKA 1Q57A 2IYLD 4OKSA 2Z0MA 1E2JA 3W3AA 4TTRA 1ZM3A 4MA4A 2NO0A 3OAAA 4NCNA 1XRJA 2OLJA 3KTAA 4AKGA 2WWIA 4IOLA 1LFDB 3DVLA 4BLQA 3P32A 4RY2A 4BUJA 2O8DA 1IY1A 2HCBA 2IS6A 4A82A 4MYTA 2Z4SA 2PT7A 3AVXA 4Q4JA 3LVRE 3GP8A 2J45A 1ZNXA 3GLFB 3LDAA 4NYIQ 5DN6D 3T1OA 1J7KA 1J99A 2ZQ5A 1XJQA 1HE1C 4UNRA 2OCPA 1C4OA 3OE7D 2Q9CA 3S1AA 3NBYC 4V0LA 4W5JA 3QPWA 1KTVA 4IEIA 2P2LA 4AWXA 1F60A 1XB2A 2P0EA 1P3JA 4XD7A 4EPXA 1D2NA 1NMYA 2DPXA 2WICA 2YHSA 4S35A 1XPUA 4A2WA 5BYKA 1X86B 3BBPA 2AKYA 3GCGA 2IYTA 2VHCA 5D3MB 3AP2A 3TSWA 4HI0E 1W49A 2XTMA 4Q9IA 2E9SA 2WJJA 4FW9A 4PPFA 3LAWA 3OFNA 2IK8A 3DKPA 4M53A 1RIFA 4MRPA 3UATA 4DLSA 1E2HA 3BD9A 3RWMB 1GFIA 2G1KA 5JFGA 4D82A 4CGZA 2IXGA 1ZAKA 3ASZA 3TW8B 4IXNA 2UZ3A 2GJKA 4JJZA 1KI1A 3I8SA 4WIAA 2PMDA 1FW6A 1CEEA 5FUXA 3ZGXA 1AZTA 4XIGS 1NVVR 3W90A 3A1UA 1W44A 2D74A 4IDPA 1EXMA 1L4UA 4NYJR 3BFVA 3O8RA 2BBSA 1E1RA 4JKYA 4HUTA 1QZXA 1N0VC 5EUMA 3ZVMA 2HLDA 3D7MA 4W5HA 5FOUA 2JATA 5KNCA 4DLWA 4CEIB 1KK0A 1N2CE 2W2VA 2WMNB 3ADDA 3N2IA 4ZKEA 4ZDWA 3GD7A 2ZR7A 4MKHA 5TB5A 3X1WA 1XJ0A 1VTKA 3DMNA 1OH6A 1TX4B 2BVNA 1KK3A 4O0MA 3JZMA 3MFYA 1Z6AA 3WNBA 4GP6A 1R0WA 5KTYA 1KMHB 3KB2A 1E9BA 1P60A 3CR8A 5IK2D 4B71A 5DIFA 4BFVA 5EP4A 1JJVA 3NHBA 1ZM4A 3EX7C 4N0EA 3THXA 1NMXA 2D2EA 3CX7A 1EFHA 2GA8A 2O0KA 4QRHA 3R7WA 1VIYA 1X1SA 3KX2A 2NGRA 2PZFA 5DYGA 5L8VA 2YWHA 1AZSC 2V7QD 2GVZC 5FL7A 1ZIOA 2JLVA 1R6BX 2CK3D 3IKJA 3X2SA 1KI2A 3NDBB 3M6AA 3WHKA 3IQXA 2CL7X 2IC5A 1E32A 4WOPA 5JSZB 1E9EA 4RFVA 1GIAA 1VHLA 2BDTA 3U6KA 2DHRA 3KQHA 3O47A 4KSBA 4Q47A 2J3EA 2W6ID 3FMIA 3RS3A 1XBTA 2ORVA 2C04A 3GLGA 2G9NA 3OEHA 1IBRA 1XFAA 3LRPA 4TMXA 1Q21A 2A5DA 1F5NA 5JEDA 4DIEA 4L16A 1OV4A 1AS0A 4TSFA 1X6VA 4F93B 4XD7D 1GG2A 2ZREA 1RZ3A 5EUQB 1BKDR 1WF3A 5CM9C 3VKGA 1GZSA 5C1BA 5FOTA 2A5GA 3OIYA 2J0QA 3Q8XB 4MRRA 1M6NA 4BECA 1II8A 4DEYA 4LBZA 1G8YA 3PG5A 4R9UC 3ZIAA 2V6IA 1W7AA 4PO8A 1AQYA 3A4LA 1BH2A 4DB2A 2EQBA 1KK1A 5CIQA 1W36C 1JNYA 2YINC 3HU1A 5EXPA 2HT6A 3GJ4A 2O52A 4Q7MB 2BBTA 1UJ2A 4PAQA 5IHPA 3GLIB 2X8AA 3HU2A 3GPLA 1ESMA 2JJ2A 4DZZA 5F2EA 3H4MA 2YOGA 4XTCS 2VSFA 1Y3AA 4QL3A 1KO5A 5BQ5A 1NBMA 2AWNA 4QFMA 5EXTA 4RD0A 3W6OA 2GEDA 1Z08A 3TRFA 1BS1A 3SNHA 4M1MA 3CWQA 1G3QA 2VP0A 3Q3JB 2CMKA 4LHZA 1P73A 4LJ4A 4AYTA 3VFDA 4KLNA 2WKRA 4JLPA 1XD9A 3VKHA 2J41A 1TQ6A 3PITA 2OCYC 2NZJA 3G82C 2YZ2A 4I81A 3GFOA 3VR6A 2HDNB 1PLKA 3KQLA 2YKGA 4PSKA 3R8FA 4KYIB 2G6BA 4ZPXA 1U9IA 1MR3F 2QM8A 1GTVA 4JLAA 3D3QA 1WRBA 4W5WA 1JECA 3KJEA 4Q9KA 1G3RA 3TMKA 1MABA 2V4ZA 2G88A 2CXXA 1W4RA 3CX6A 4F4JA 4A8JB 5EE1A 2R6FA 4US1R 1SXJD 5FOVA 5AK0A 3IEUA 3QIAA 2IA5A 4Q7KA 1W47A 5DNYB 2EFEB 2IYWA 4UKDA 1Y63A 3FE2A 4JLJA 1G6HA 4L9WA 3GLFA 3K1JA 4V0KA 2BMJA 2D06A 2QU8A 3IDQA 1I4DD 2QTHA 1E94E 3ZVRA 4B3DA 1OXUA 3TR5A 1DEKA 1I4TD 3K0CA 4HB4A 5DISB 4E5UA 5C46F 1CRQA 1GM5A 3OZXA 1HV8A 2HYIC 3EPHA 1ZCBA 1KI3A 5E7MA 2JAQA 2YC2C 2JIZD 1U8YA 2ZUCA 3RABA 4LZZA 4DHEA 1TQDA 5DH9A 4EFNA 2ZRNA 1ZC3A 1TADA 2QAGA 4NKRA 4KITB 2F55A 1CTQA 1KK2A 3IEVA 2FDCA 1ZD1A 4JT2A 4KJZA 4LYAA 3F5FA 5J4HA 2H92A 4ZI2A 1EFUA 2J46A 1VCOA 2JJ1A 4EFLA 1G3MA 2H17A 1FOEB 3AGQA 5H68A 3U4QA 2GCPA 1K6MA 3B1WA 4JSYA 3VTKA 2QM7A 4KU4A 1SXJB 2VH5R 3K0FB 4Q4HB 2DFLA 2QY9A 1KO4A 1CULC 3JVUA 2IS2A 3ONWA 2GBLA 4ZCIA 1OXXK 2GRJA 4BQSA 1IN8A 1Q3TA 1AA3A 4TTQA 1GKYA 3NBXX 3TH5A 3UG6A 2QT0A 2HEIA 1R0XA 3CPHA 2FPMA 4MGKR 1K5DA 3MG9A 2Q21A 5EE9A 4F4CA 1OKKD 1FX0B 2ZI5A 4YMTA 3K70B 1XNJA 1XMIA 2GVDC 1NBMD 3BH7A 1KAOA 2H1LA 1UPTA 2DYKA 5AR1A 1G8GA 1KAGA 3O8DA 4BLOA 4QGFA 3QBTA 2A30A 3IIKA 1OSNA 5HCIA 1OIVA 3WYAA 4A4DA 5BWMA 4DB4A 2EYUA 3KQNA 1CF4A 4HZUA 1JALA 4FXPA 3FKSD 4HAXA 3WYGA 3THXB 1F3OA 1NNEA 4K81B 2WV9A 2QBYB 4FCVA 3RC3A 3NH9A 1Q1ZA 2N1BA 3NBFA 1T0JB 2Z5FA 4B3XA 1CBUA 1ZM7A 2GCNA 4C0KA 1IN7A 2FZLA 3DZDA 3QEJA 3AF0A 3RS2A 4S2EA 2WPDD 2HYDA 4AK9A 3FPAA 3HJNA 2C9YA 2RGNA 2NO1A 3MLEA 4TYNA 2VF7A 5GJWC 5JSZA 1GVNB 1OIWA 1TF7A 4ASUA 5HPYB 1CR2A 1N5JA 2GF9A 2ZUBA 3SDZA 4BFWA 4Q1EA 3VU9B 5J4YA 3WY9A 5EXXA 2ZR0A 1AQUA 3WRYC 2IYSA 4EUNA 3KXLA 1N6IA 1R5OA 2NOAA 2AK3A 4Z51A 1UDXA 4DDUA 1XZQA 3K09C 5KSOA 1B0UA 5SZHB 3EWAA 1W0JD 1PV4A 3PQCA 2GJ8A 3L8YA 4AIIA 4CZ2A 2XJ9A 2MMGA 4TT3A 1OFUX 2REXB 2VPPA 3DL0A 5FOWA 5IK2A 421PA 5AJWA 4WA7A 2ZRHA 2O8BA 5KPDA 1QVAA 1NKSA 5G3ZA 5KSPA 2AD1A 1II8B 3NC0C 3WHLA 2P65A 1SVSA 1TL7C 1QG2A 2PZEA 4X8MA 5LB4A 2VQSA 3BOSA 4URYR 2XNDD 4LJAA 2LKDA 4N1AA 4V02A 3WRXC 1P7CA 5JS8A 2VHTA 1L7VC 1WDTA 3B1XA 1FUUA 3GLIA 3L2OB 4LBWA 2DWPA 4PZZA 4DVGA 1RPZA 3U5ZB 2JLUA 3D6TB 1UKYA 1AK2A 3U6BA 2YOHA 2ZRPA 1QRAA 4DCSA 4Q9HA 4EPRA 1JR6A 1KDPA 4GSYA 1NLFA 4HLCA 4C0LA 1CXZA 4QM7A 3T34A 3DMDA 1YZQA 3AKEA 3QXSA 1JB1A 4F4IA 3K9NA 1KJYA 4ZKDA 2W6IA 2UZIR 5B30A 4PTLA 1WP9A 4V0OA 1KDRA 4NCIA 1QHXA 1S3GA 5L3SA 1KO8A 4ZDIA 4N0DA 2B21A 1DVRA 4TQ9A 4PPNA 2YC4C 2IYYA 2KI5A 3AB3A 5TARA 1XEXB 2ZJYA 3F0TA 3CX8A 3QI2A 3VR3A 3U60B 1U0JA 3EARA 4YC7A 4Z1MA 1TU3A 3C41J 4FIDA 1EFRD 4HZIA 3B85A 2ZROA 1YZKA 2FZ4A 4RZ2A 3VR4A 2XGJA 1KNQA 1Z0IA 1ZUIA 3C4JA 4KBGA 1S96A 1XEWX 4F92B 1Q12A 2NTYC 2RGDA 3H86A 5J5CA 1PUJA 5AJZA 4JLBA 2VF8A 5HTKA 1MABB 3SYKA 4LHWA 2V3CC 1ZUNB 3UMFA 2IYXA 4P4UA 5FI0B 3VHXA 4PR0A 4D81A 5AUPB 2FF7A 2CCJA 5SZIA 5JBQA 2VP5A 4JL8A 1XTJA 4PFSA 2ZITA 4CEHA 2R6GA 3BB1A 2J7KA 2UKDA 2AWOA 2BJWA 1P2SA 4A15A 1AGRA 3WMGA 1XMJA 1TPZA 4YMWA 4AI6A 2WPDA 2FWRA 1SVOA 5FH9A 3VX3A 2NG1A 1HA3A 3AVYA 4Z8YA 1NN3A 1RJ9B 5EXSA 1S0UA 5F3WB 4MKIA 4IDHA 2J9RA 5AJVB 1E6CA 2O0HA 4E03A 4OHXA 4CYMA 1W0KD 3T5DA 2P67A 2W83A 4CW7A 3MUFA 2ANBA 2ZI7A 3VMFA 2QAGB 4LX0A 3LW8A 4DDVA 5AWFC 1P9WA 1ZBDA 2GZAA 4HEJA 2Q3FA 4U5XA 1PLJA 5CK4A 3R8CA 2R6AA 3QENA 1G6OA 2CCKA 1SKQA 5JWRA 1LS1A 4MUAA 1G64A 4TYWA 2PLRA 4E09A 5UKDA 3ECCA 1IAQA 1T6NA 2ZE5A 3WNCA 3DO6A 4XWKA 4URXR 1SXJA 4JLMA 2Z4RA 4GT1A 4Q4HA 3A1WA 5K8LA 3IPYA 5GJVC 5C4MA 4P32A 2BMFA 1FQJA 2NMVA 1YQTA 3BERA 4I1UA 4HUQA 3ASYA 1W36B 1AIPA 1Z47A 1JPJA 5KO2A 3EZFA 3KJIA 4EJSB 5C2JB 4MITA 3EPLA 2HT1A 3PEYA 1DAFA 5K8TA 2ZIAA 4BFYA 4XVUA 3KTAB 4MKFA 1E69A 4R98A 1FX0A 4TL7A 4TYYA 2C98A 2OV2A 2IUTA 4KFSA 4DC9A 1LW7A 1RRCA 2PBRA 4DUGD 1Z2CA 1FTSA 2RGAA 3AM1A 4D4MA 2OE2A 3QKTA 1GRNA 2OCAA 4JS0A 1Z0AA 4ZV4A 2QTFA 3FGNA 4M9ZA 4AC9A 4O25A 4QG7A 1N3BA 1MO3A 4HZUB 2GJ9A 5KNBA 1D2MA 2AD5A 3S1AB 1NBME 4LPSA 2QBYA 5JMTA 4KFUA 2QA5A 1YR9A 4LYFA 1W46A 4R71A 4JVNA 1E0SA 3TAHA 1R4AA 5CLQA 1VPLA 3BB4A 5DO9A 4X8HA 3FMPB 4PC2A 3BE4A 4JIMA 3OEED 2TMKA 3THYA 1NG9A 5TV2A 3H0KA 1DPFA 2P5TB 3CKLA 3F3YA 4EPWA 4WW0A 4I1OA 5TXGA 1XTSA 4URVR 3DM5A 5F9FA 2IEYA 3PCRB 1T8UA 2B8WA 4OQFA 1SULA 5HE8A 3KFXA 4TLDA 2CVFA 2GCOA 3ZVLA 4AKEA 2GXUA 4QM6A 4DDTA 1DS6A 1RYFA 5BN5A 1N6RA 4M2LA 2YWFA 3I62A 2OFXA 3B78A 4Q5IA 2ECKA 2EFHB 4GOKA 1G4AE 1H8HD 5KDOA 1Q20A 2QUZA 4ERNA 3AUXA 3EAQA 4PC7A 1DE0A 1IXZA 2W2XA 4CEIA 3BXZA 1E1QD 3TSOA 1M7GA 4KBFA 4A2PA 4NYMR 4ZCLA 2O8CB 2QRNA 2KB0A 2OSBA 2V7QA 3IO3A 5FBLB 4LJ8A 2F7SA 3VKWA 5K8IA 3A6PC 1W4CA 2RMKA 2IBMA 2G1JA 5J4VA 2CLDX 3J81k 1N6OA 2JASA 2F3RA 1KMHA 3H2YA 2IXFA 5HZHA 3ZLJA 1AS2A 3I61A 2IF2A 2H7VA 2WOOA 2D4HA 1ESNA 2C2HA 4FN5A 4NZYA 1S9HA 1NIPA 5FUVA 3R7WB 5L3SB 5DI9A 1G7CA 1UEIA 2V55B 1GUAA 1ELOA 1N25A 2PJZA 1KZ7B 2FNAA 2FSIA 1GNPA 3L0SA 4GMDA 4E07A 1AN0A 5KSZA 3ZZUA 2ONJA 1UBGA 2I3BA 3A58B 8OHMA 3FKQA 4GRAA 4TL9A 1OB2A 2BCGY 3AVUA 4QHYA 3QY0A 2F43B 3PIRA 3I5YA 3P4YA 2ZYWX 3Q9LA 4IRUB 2DWOA 3QF4B 3PUVA 1YHNA 1QHHB 4EJSC 2X2FA 5FPKA 4PHHA 3MJRA 2PT5A 1U8AA 2ZJ8A 1XP8A 1UBFA 1M1YE 3NHAA 1UDWA 1HTWA 4Y0VA 2D3WA 1L4YA 3A4MA 2CL6X 2JJ2D 4OL0A 1XMVA 2EW1A 4FWTA 2JCSA 4O3MA 2CJWA 2RCNA 4TN1A 1QDEA 3GEEA 4QOSA 3OESA 1J8MF 5CDFA 1FNMA 4B75A 1XCPA 3OFND 3CRMA 3CRRA 4LRWA 2QENA 3W34A 4OJKA 4V0NA 1TF2A 4NPHA 4UXIA 2J0UA 1JXOA 3T1VA 4Q66C 2Z43A 2QSZA 4FMDB 3AF3A 3REGA 3CF2A 4OHYA 1R0ZA 1ZJ6A 3HYTA 2OXRA 4NH0A 2AFIE 3C14C 2XSZA 3H1TA 1WCV1 3IIJA 2YVUA 4R7ZA 5LB2A 2RHMA 1ZC4A 5B2ZA 3BORA 3MD0A 2OZEA 3AF1A 4KXFB 1G17A 1LF0A 5FTJA 1S3SA 2HUPA 4IDOA 2AXPA 4AD8A 1J2JA 3BC1A 1L2TA 1Q22A 1MO6A 2FE4A 1XEWY 2ZYVX 1EESA 2IS1A 1TEVA 4A0HA 2XZOA 1NLZA 2VBCA 3BIFA 2N42A 4DSUA 4AURA 4M1WA 3V4FA 4IJMA 4KCGA 3B6EA 4BWYA 2C96A 3A1VA 3L0IB 4MYUA 3CBQA 4KSCA 2GK6A 4M1TA 4B6EA 3KUDA 2N46A 2V54A 2I1VB 4TTPA 2KSQA 4A2QA 3BGWA 4JVLA 3SQWA 4TWZA 1P75A 3LBHA 5SZJA 5HKKA 1CKEA 2BBOA 5EP1A 2GHIA 3GJ5A 4XJXA 3I32A 1IN6A 1BIFA 4RZXA 4P31A 2A5JA 4RD2A 2XXAA 4L4UA 5CM8B 2LWIA 1X8KA 2C03A 3BWDD 1MRSA 3GFTA 1CU1A 1GOTA 2W6JA 4BFUA 3VNVA 1EGAA 2PL3A 1U90A 4HATA 4OQXA 1E2NA 4Q21A 3SQXA 4NONA 4Z1MD 3ADBA 3VHLB 1EFRA 1ONBA 2QQEA 2G83A 1LTQA 1OHHA 3I1FA 3UK6A 3T15A 5JI2E 2GXAA 4GFDA 1IN4A 4FMDF 1NIJA 2HJGA 2YV5A 4DCVA 2OBMA 3SC3A 1X8LA 1II0A 3V9PA 1KO1A 4LSGA 2E1RA 4TMKA 1GNQA 2G0TA 2IF0A 3ZDQA 4QKQA 1DG3A 4IFBA 1D9XA 3A8TA 1D6JA 3KKMA 4US0R 4EAQA 721PA 5KYKA 3GLIE 3K0AA 4M1SA 2F1JA 1TAGA 2FSHA 1WQ1R 2HXYA 2OO7A 2GCOB 4IXMA 2ZSBA 4MYHA 1KI6A 3RAPR 3TAUA 4PPQA 2ZTSA 3QVVA 3FMOB 1IHUA 1NN0A 3E70C 1AM4D 1OXSC 2OCBA 1CJMA 2ORWA 2ZRGA 1JR3E 1DO2A 4PO9A 3BRWD 4L15A 5FBRB 3X1ZA 4IVQA 1W1WA 2GILA 3B1ZA 4OJQA 3FTQA 2XSZD 4BFXA 5JZVA 4PQYA 3W9YA 1RE0A 5HZKA 1AKEA 3QVUA 5JWOA 4TLBA 2R6DA 1NP6A 4JLDA 1UADA 3EWSA 1PUIA 2NO6A 1GDDA 4A8JC 4WVFA 3VX4A 1TU4A 1KSHA 1U0LA 2B8TA 2CK3A 2GBLC 2CL0X 3N2EA 2XAUA 3LBNA 3QJYA 1G291 4K8OA 4NDZA 1Z8FA 3MGCA 4ASUD 1KNXA 1COWD 1ZRHA 3TK1A 1R8QA 4Q9JA 1RW4A 2ZRCA 1E2GA 3CNNA 1T4GA 4AG6A 1E2EA 4CVNA 1IJFA 1NI3A 3KKPA 1E9AA 2VTKA 4IOMA 2ZRAA 2QMEA 2SHKA 4OYHA 2QL6A 4HAVA 4KFTA 1I4LD 1ZP6A 1UBCA 5FI1B 5BN4A 3CZPA 1HYQA 3DDCA 3O8CA 5F9HA 5L3RA 4Q1DA 1Z0KA 5AJXA 4H9GA 2JLXA 3A37A 1N0UA 1IN5A 3QKSA 4I4LA 1R8SA 2WVJA 4GOXA 4JT4A 4ILEA 1G8PA 1JQJC 1TMKA 3K0EA 4HYYA 2ONKA 3K70D 1RYHA 1V5WA 1CR4A 1A82A 2H57A 3TQCA 4V0ME 3K70C 2ZRKA 3SE0A 4DUGA 2P5SA 4UJ5A 1N5IA 4A6XA 3VU9A 4QXAA 1NVXQ 4G01B 3GFPA 1QHHA 4MKGA 5BN3A 2WM9B 4JKIA 1T9HA 4P33A 1JI0A 4PC3A 3QG5A 3GJ0A 5BYJA 1Q0UA 2D7DA 1E2DA 1FL9A 3UG7A 4B32A 3EPKA 2CNWD 2V9PA 1IXRC 3TIFA 2OUKA 3ADKA 4G1UC 2RGXA 2CJWB 3AV0B 2WJGA 3BB3A 2NZ8A 2QP4A 4WXPA 3RYTC 4XOIA 1OB5A 1HE8B 2ZPTX 2O8BB 1E9RA 3U3OA 2Q9AA 1IOZA 4AG5A 3CRQA 1OHHD 1SZPA 1SHKA 3KB1A 1H8ED 1W5SA 2JDIA 2QPTA 1HT1E 3KXKA 1ZYUA 2ZS8A 3B82A 4B74A 3THWB 3WXMA 5J4KA 4EPTA 3EPJA 4M0LA 3SBDA 2P6NA 2ZU6A 1OXTA 3NEJA 1II9A 1KJZA 4NYJQ 5FBWB 3W5IA 4TL6A 2ZAMA 1E0KA 1GNRA 3CF0A 4Q00A 3QQ5A 1FP7A 5TDHA 2FFQA 5JI3E 3AVOA 4DLYA 4ESVA 4RVCA 3P4XA 1BYIA 4I99A 1ZM9A 1D2EA 3CO5A 4XVQA 4EIWA 5JHGB 3BFXA 3QF7A 5GVSA 1Z0FA 1CR0A 2ERXA 2LKCA 1G3IA 5G40A 2VSXA 3X1YA 5E3HA 4KYUA 2MSEB 3I5XA 5EJEA 3KUCA 3CF6R 2FSFA 4UQOA 3SJZA 1M74A 4YMUA 1GL7A 1XEXA 2GXQA 2FMXA 2J59A 3TNFA 1ZVQA 3CPJB 1HQCA 4RSGA 4P0TA 1F48A 2QPAA 1E3MA 3GLHE 1QHYA 3TVTA 3EZ6A 2FG5A 2FGKA 1YU9A 3ETLA 3SJAA 4ARZB 4WZ6A 2ZJ5A 4JJKA 4ZCMA 4QJ4A 2OFOA 3AF4A 2VP2A 4HLUA 5JJIA 3T35A 3PUXA 1IONA 1K8RA 1N5LA 4MRVA 2WWYA 2HXSA 5P21A 2XTZA 4CEHB 4L5BA 3GJ8A 4IHQA 1W4AA 5KNDA 5FPHA 2QGZA 4Q4AA 3HP1A 2A9KA 1IY0A 1ZU5A 5FL7D 5LD2C 4DCUA 3W5JA 2OBNA 2R44A 2ZI6A 2CCGA 1IQPA 2ZU0C 3R9IA 4G5OA 4DWJA 2IYZA 4Z54A 2C8VA 2V8OA 2VP6A 2GNOA 3FDIA 5EE0A 3R9XA 3AEZA 3CPEA 5FTMA 1XXHB 4II7A 3LH5A 1NSTA 4KHZA 3MJHA 1FNNA 1YZGA 2B7BA 2ZRFA 2VLIA 3NBZC 3MRSA 4DIDA 4Y0AA 4D2IA 1OH7A 3RSOA 4WXRA 1JAIA 2A5FA 4H1UA 4P3YA 2VHUA 1VDZA 1XWIA 2WBLC 2ZR9A 1YJ5A 4FCTA 4RKEA 1TNDA 1DTSA 3SZRA 1KGDA 3L43A 3HR8A 2QMUA 3MWKA 2QQ0A 3QXHA 2GESA 3DOFA 3B60A 3IHLA 1AA9A 3K0AB 4C7OA 3GEIA 4PX9A 1KIMA 5F98A 5KPJA 1OXVA 4DT1B 1KSJA 1NY6A 2JLZA 1DAKA 2PZGA 4I1SA 1D8TA 1NN5A 4LJ9A 1V43A 1QHSA 2AX4A 2OAQ1 3FMFA 2OILA 3LNCA 3TUZC 2F1HA 1M2OB 1KDTA 4HUQB 4LJ6A 4BFZA 1SXJE 1E2FA 4OQNA 4R2IA 4EJSA 3RC8A 1GRQA 5L3VA 2FPLA 5FPTA 1WMSA 2BKUA 1CIPA 2YJTD 1SQ5A 2F9MA 2QPOA 3QG1A 4LI0A 1X8JA 3N5CA 4PPGA 2EWWA 4PZLA 4DJTA 5JCPA 1KY2A 3PJRA 2NO9A 2W0SA 5E95A 4A8JA 1RKBA 3IILA 1L8QA 3WBKA 3W8NA 3GQBA 5DGXA 4DXAA 2IUSA 3WMEA 1A1VA 3K09A 1ZNWA 4CRWB 3NWJA 2QMHA 3BFKA 3CRVA 1D5CA 1UKVY 2IYRA 4LDJA 3RVBA 4AY2A 1ETUA 3EIHA 4MRNA 3IHWA 2FFBA 4IW3B 1Z6TA 1BOFA 3PXGA 2GWHA 5CB6A 3B1YA 4NYMQ 5G41A 5JJLA 2UVQA 1ZUHA 1W36D 2EYQA 3PR1A 4JL6A 4J0QA 4RD3A 3RS5A 5HR5A 2H8KA 3CZQA 3THYB 4D6PA 3LY5A 6Q21A 4LCBA 4Q18A 2BC9A 3ZZTA 2FA9A 2FOLA 5A0FA 2ZSFA 2REOA 1MOZA 3C7KA 3KL4A 4LYHA 3SEAA 1VCMA 4EDHA 4HB0A 1E98A 3NH6A 4RZ3A 4WZBE 4UXHA 5AUOB 4LV6A 2P6RA 1SHZA 1DAEA 3EW9A 3RANA 221PA 4RZUA 3U3MA 4BLSA 1VKJA 3ZJYA 1GL9B 2G77B 2QORA 3SR0A 3UKDA 5CYPA 3ZD6A 1E9FA 1XCGB 1NG1A 3T1TA 3U3RA 2W6JD 121PA 1E4VA 2ZE7A 4Q1AA 1ANKA 1OF1A 2ZSDA 1G41A 5GJCA 3UMRA 1VHTA 3GJ6A 3TBKA 2ZRJA 1IY2A 3CB4A 4HAUA 2PEYA 2ZAOA 3SU8A 1W48A 2R8RA 3EIEA 1N6KA 4F7WA 1EFCA 1NF3A 5BW8A 3IQWA 3BH0A 4JLOA 2GKSA 2RGNC 1DG1G 1XXHE 4GMXA 1GWNA 3UXMA 2WKQA 4PQRA 1YE8A 2F3TA 1KI9A 1W4BA 2FEMA 4EKDA 2O8CA 4BEBA 1TUEA 1EFTA 3VR2A 3GLGE 4L8GA 3KQUA 1U99A 4B43A 4N3NA 5GVRA 1P6XA 3WYFA 1XPRA 3QOFA 1SVKA 2QP3A 4OK3A 1HUQA 2GEVA 2I4IA 2CLCX 1ZCAA 4TYQA 4EQ6A 4C0HA 4YQFA 1ZINA 1BMFA 3NG1A 5GJBA 2ZVQX 2YYZA 2G0NA 2XITA 1LF5A 2WSSD 3K0CC 1UBEA 1T8TA 3HR7A 4JLKA 4U00A 2BMEA 3GLHB 1WE2A 4Q02A 4QJ5A 1KKMA 1MRNA 2QSYA 2VSOA 1KZGB 2MMCA 5EE3A 3QPVA 2RAPA 1DADA 2XZLA 3VR5A 3ZS8A 5H8WA 3KKNA 2ZRLA 3MMPA 5KUTA 4ZDKA 5H1YA 2DFNA 2PLFA 3PEUA 3TE6A 1DAGA 4M8NE 2AR7A 4QGAA 4GNKA 1MT0A 1R2QA 2WTUA 3AVTA 2F43A 3GJ7A 3JZAA 4YMVA 2EFCB 3OIWA 4O2RA 1VECA 1JXMA 4XSHA 3SHWA 5EP3A 2BV3A 3QF4A 4IOJA 4URZR 2AN9A 1OYWA 2FU5C 3B13B 4G5RA 5FL3A 4B35A 2GETA 2KWIA 5JS7A 3W6PA 1X1RA 3LLMA 3BAFA 1YZUA 4DCTA 1JPNA 2Q6TA 3IBYA 4A92A 5L3QA 3U7FB 4PANA 3HPRA 1OT3A 2WJIA 4LGMA 2CE2X 1DAHA 3LLUA 3QE0A 2DB3A 1NMZA 4RD4A 2CBZA 3RWOA 3FOZA 3UMSA 1XPOA 3QNUA 4Q4AB 1QG4A 4TLEA 5FPSA 4EPVA 3ZZ0A 3U44A 3QKRB 4UNQA 3Q5DA 2KE5A 2QEQA 2O0JA 4GDFA 5BXQC 4HDOB 2J7PD 1KYIA 2JA1A 1W2GA 3P27A 3PV0A 4LHVA 3TLXA 3TUIC 1U9IC 1A4RA 3QXJA 1U94A 1YR8A 1XXHA 1E79A 2J0UB 1PLLA 1EX6A 4FWIB 4PSAA 1F2UA 1VYTA 1VIAA 4U02A 1KSGA 2J0SA 3GMTA 1QHGA 2CHVA 3U2QA 4L9SA 3I72A 4C0AC 3T5GA 3LW7A 5A5GA 2DFKB 1Z06A 3FVQA 3C16C 4KODA 2WJVA 2F1RA 5AUQA 5IF9A 5FBQB 2WWXA 4DBLC 1UAAA 1E2KA 1XEFA 2NPIA 3EZ9A 4PHGA 4UNPA 4PSVA 2JLSA 3A36A 4HDCA 4M9XA 1R10A 1P9RA 1IJEA 5J47A 1Q44A 1ODFA 2IYQA 4D0GA 1G20E 4LBYA 2ZRMA 2H5EA 3MWJA 3SHFA 1XD2B 3UANA 3B2EA 5A4JA 3U7GA 4JL5A 1OYYA 2XOKD 3UIEA 1BYUA 4Q7LA 4BFSA 3ZD7A 3PUWA 2REBA 1J70A 4C2TA 2JLWA 3U3JA 4M9QA 2QT1A 4TSFD 1JBKA 3THOA 1EX7A 1Z83A 1E0AA 4RKFA 2WMOB 4IEEA 2O8FB 1HY3A 2ZI9A 4BLTA 4QNRA 2WOJA 4JVMA 1WXQA 2BEJA 1Z3IX 4TQAA 2O5VA 2VO1A 3SYLA 3O8BA 4XWAA 2ZJAA 4C0JA 4KVAA 3L0OA 4TL8A 3FFAA 2J87A 4P4SB 3RS4A 1FMJA 5DHAA 2XXAB 3B9PA 3HDTA 1J90A 4BRWA 4LWZA 3CLVA 4A36A 5M04A 1G19A 3AVVA 4C0SA 1O87A 2G3YA 3FWYA 1CS4C 3C8UA 2DR3A 3K0SA 2XB2A 4NYIR 1KSFX 4RD6A 4LC1A 3VQTA 5EZ6B 2BBWA 1MH1A 4G5GA 2QMOA 3LXRA 3NDPA 1QBKC 4C0QC 2E87A 2HF9A 1JR3A 1G1MA 2H18A 4QBIA 1Z0JA 4OK5A 4ACAA 1Z07A 5G53C 2DBYA 3X1DA 1VG0B 3MCAA 3RLFA 4OHWA 2VP9A 1GL6A 2OBLA 3ZVNA 2OM2A 3Q85A 4PHTA 1A7JA 3LV8A 1C9KA 2F6RA 4I1VA 5C18A 2FV8A 1XTKA 1P2UA 2A5YB 3DM9B 2EFGA 3Q7PA 3HPQA 1G8FA 1KI6B 4PAMA 1T0HB 4ZI3A 4B3GA 3QXCA 2GTPA 2W58A 2QNRA 3IBGA 5JWHA 4R2HA 1Z6GA 2R2AA 3LQQA 2JLQA 2IEZA 5TMPA 1G7RA 2CVHA 4DCNA 3MWLA 5E7JA 3FYHA 4UNNA 5CB8A 2W0MA 4LHXA 2R65A 1VMAA 2WIAA 3EA0A 3MSXA 5AUNB 1RC8A 5LBIA 1P5ZB 1Z28A 2PMKA 1MO4A 3CIOA 2CDNA 2X1VA 3B8HA 1B23P 1TQ4A 2OLKA 3CNLA 4B48A 4MH0R 4NMMA 4BZXA 3NIBA 2V1XA 1EG7A 2A3RA 4PC6A 2BIFA 3ZQJA 2V1UA 1S4QA 3EZ2A 3N70A 4B3CA 4ZIRB 4CF7A 1TTTA 1NKTA 1XDBA 4HDQB 4TMWA 3EC1A 4EQ6B 5IRCD 2ODEA 3I92A 4C0BA 1Z0DA 3DHWC 3PUYA 1G7TA 1F2TB 2O8EA 4BE7B 4QNMA 2VP4A 1US8A 1NVVQ 1PVOA 4LPKA 4TZ0A 5JRZA 4MQBA 1ZNYA 5JLJA 5FTNA 4QBHA 4C2UA 3SFZA 2JJ1D 4GZLA 3RS0A 4CT4B 1LB1B 4RJLA 4X8LA 3SS8A 2FSGA 1WA5A 4ESHA 4OI0A 1P62B 3QKSB 5H70A 2YWEA 3UWOA 1SXJC 1UM8A 3ZH9B 4NBSA 2Q9BA 3ZYCA 4JYBA 3BK7A 1KJWA 2A7QA 2JLRA 5CIWA 4KFRA 4TYPA 1H8EA 2JDID 3R20A 2WAXA 2LCFA 2OHFA 2C78A 1DO0A 3LBIA 3QBVA 2GAOA 1XCMA 3E2IA 2J1LA 3OEHD 4D25A 2XX3A 1R5BA 3JVVA 3LO5A 3ADCA 1KO7A 2ODWA 4B33A 2JJ8A 3LXXA 3RRYA 1KHTA 2RGCA 2KBEA 2D62A 2VHQA 4LC0A 2BKEA 3V4RA 4HLDA 2ZS7A 2ERYA 1D9ZA 1IM2A 4HAYA 4NTZA 2ZETA 3U3KA 3A1TA 1UFQA 3QKRA 2ZVPX 3K8YA 3WP1B 1VCNA 4MUBA 1CJTC 1NVUQ 1U8ZA 3CUEF 4XTRA 2RKOA 1BO6A 3P20A 4TQUS 5DI3A 521PA 3SN6A 3THWA 1Q3HA 1W2HA 2WJHA 2QGNA 821PA 2B7CA 2BEKA 3RHFA 3CRW1 1F2UB 1HT2E 2C5LA 4B34A 2QAGC 4LOAA 4IKEA 3L82B 4KAXA 4DRZA 3FFBA 2WHXA 1XX6A 4M4SA 2ZRDA 1R7RA 4A9AA 3SFVA 2P6UA 2RB4A 3EASA 4AYXA 1GITA 5E7IA 1M7HA 4BZQA 5B64A 2ZXUA 4PAOA 5EZ5A 3U7HB 2A78A 4HLUC 1DAMA 2ASEA 2D7CA 5DSZA 4FMCB 1KOFA 4LJ5A 4NU0A 1KI4A 3CH5A 3WBJA 3LQRA 3WMFA 1OFTA 2OAP1 4QGHA 5CJ2A 3E1SA 3OIVA 3LD9A 4YMSA 1OLOA 2VL7A 1P9NA 4RCZA 2QP9X 3PVSA 2FJUA 5FOSA 4BPBA 1QF9A 2FGJA 2GXSA 4JBXA 2FX3A 5DHFA 2QTVB 1OW3B 2ZYTX 4Q4JB 1FP6A 4YXWA 1RRGA 1FZQA 1KDOA 2CHGA 4GOJA 4JMPA 1YKSA 4OI1A 2I1QA 1YR7A 2PCJA 2FFHA 2OG2A 3AVQA 1QVRA 2BMDA 4U7DA 3UWKA 1S2MA 2Q3HA 3AKYA 2HF8A 1G16A 3KJGA 4DEXA 1EWRA 5DYIA 3FHCB 5CLLA 2IS4A 4HAWA 4ARZA 4F38A 5DLQC 4D4JA 1A2BA 5C4GB 2PX0A 2ZJBA 1HH4A 2QI9C 2BJVA 5D3MA 5B57C 2B6HA 3CNOA 3ND9A 4JYCA 2A2ZA 3L8ZA 4P4SA 3ZIAD 2PH1A 3BS4A 5LD2B 4G5QA 4M9SA 4QBGB 1LV7A 4HB2A 3KZ1E 2ATXA 5ANRB 3B1VA 1DARA 2AHOA 3OE7A 4D80A 1GKIA 2C99A 3HU3A 3G0HA 3IGFA 3NVAA 2GZDA 3QSYA 1RRPA 2WWHA 4C30A 2FN4A 4MGZR 1NRJB 1YR6A 3CONA 1WB9A 1Z5ZA 4DLVA 2ODBA 4TMTA 3SJCA 1SKYB 4GZMA 3CR7A 4M1OA 1UEJA 4Q1FA 4W7SA 2BCJQ 1TQ2A 4A0GA 3I73A 2C77A 1Z63A 1OJLA 3CW2A 3TUJC 1GKUB 4A0RA 1E4YA 2QE7D 2Z6VA 5KDLA 2CNWA 4LV8B 5CDFE 3HWSA 5CJPA 2GDJA 1CJVC 1M8PA 2IHYA 4C7OB 2IWRA 1FFHA 4LK2A 2QZ4A 4FMCF 3AH8A 4DT1A 3FHTA 1E9CA 2IW3A 3OF5A 3QKUA 3BH6A 2BWJA 1S8FA 5TVKA 3LA6A 2H16A 2J7PA 3IPXA 2HCJB 1ZIPA 4IVPA 5KHOC 1COWA 2HLDD 3KKQA 1XJCA 4DLXA 4QBFA 4JBYA 1AJEA 1SVLA 2BOVA 1E79D 1TUIA 2QROA 2ANCA 4OQMA 4BZPA 1VYVA 4A6PA 3Q72A 1OKKA 4LUCA 3RRMA 5IT5A 4PO1A 1TEXA 1P61B 1AS3A 4D4KA 1OFHA 1S1MA 4H1VA 2RHDA 4TLCA 5CK5A 1G18A 5D3QA 1G5RA 2CE7A 3ICEA 2BM0A 3QXXA 1RRFA 1SKYE 1IXSB 3TSZA 4DSNA 1W5TA 1JR3D 1YRAA 2CLSA 3B5JA 3M0EA 3RDPA 5G3YA 4P4TA 1E9DA 2WWWA 1N6LA 2ZSAA 2XZPA 3PFIA 1NL3A 2O8EB 4IDNA 1VG1A 1US8B 4KLZA 4GI7A 2QAJA 2CHQA 2GJSA 2ZUDA 3EC2A 2XTNA 4B2IA 3GLGB 4RFSB 3KXIA 4YLGA 3W3ZB 2AL7A 4OQLA 1CR1A 2GK7A 3RS7A 1ZM2A 1I2MA 1X3SA 3MAAC 2NO7A 3ND8A 4IOKA 5JCZA 1Q1QA 4LBVA 5JHHB 4NL4H 4NCJA 3QUSA 2PEZA 3P26A 1T5IA 1C1YA 3DPUA 4MDEA 3T1QA 2ZJOA 4TMZA 4KO8A 2EWVA 2IYUA 4NP6A 5FPYA 4PC1A 3C5CA 1W0JA 1UF9A 4JLVA 1CJKC 4D0LB 3LFUA 5LPNA 4EFMA 2ZS9A 3KFVA 3E5HA 3C15C 3K9HA 3NXSA 4GP7A 4MGIR 4C3ZA 5CYOA 4D0NA 4OI2A 5HE9A 1JAHA 5CITA 2XB4A 3RSLA 3VNUA 3AF2A 1KKLA 1GP2A 2OXCA 2VEDA 3K9LA 5EP2A 2W2TA 4B6FA 4C4PA 4G0NA 5DN6A 1T91A 2MSCB 4CEJB 3I4LA 4ITRC 5EE5B 2KJQA 5FBVB 3DOEA 1U0HC 1R5NA 3CM0A 2VYFA 3V00A 4M21A 3AVPA 1YVDA 2X2EA 4JLNA 1E2IA 1LS6A 5FFMA 2PX3A 1Z29A 3QPUA 3I3SR 4BLPA 1A5TA 4XVRA 2IHBA 4Q4LA 2Q0HA 1GAJA 4OI4A 3TQFA 5IDVA 1TF5A 4F91B 1MKYA 1ZNZA 1DBSA 3GLHA 3PUZA 3X1XA 2IL1A 1OIXA 1T3SA 2ZM5A 4O2LA 1I2DA 3NEYA 4BGDA 5J40A 3GJ3A 2EFDB 3GJXC 1Z6YA 4Q9LA 4GL2A 1OFIA 2ZRIA 4RD1A 3K9GA 3AQ4A 4URWR 5FTKA 2WIBA 1HURA 4HLQB 1SVIA 4CT5A 2KBFA 2OT3B 3NC1C 5B58C 1EWQA 2YWGA 3TJZA 4ACBA 3OAAD 2OESA 3REFA 2QG6A 2RH5A 3TGPA 1ZW6A 1H8HA 4AKHA 1E1RD 1XZPA 3EXAA 4UJ3A 2WSMA 4OBEA 1NN1A 4YDHB 1CP2A 5L3QB 3TW4A 1YZLA 4LJYA 5TY0A 1E1QA 1JQLB 2V6JA 4PQFA 1XTIA 2J5XA 3DKVA 4FD2A 4KV9A 5KOYA 1SVMA 4NCKA 1GILA 4JSTA 2IT1A 3AP3A 5LDDC 4AYWA 2C9OA 3H84A 1OE0A 3GLFE 4EPYA 4JBWA 3U44B 5FUYA 1G8HA 2X77A 2FPKA 1T3LA 5JJKA 3U4QB 4Q7JB 3C5HA 1WBDA 4KI0A 3A4NA 2ZE8A 2C9CA 3IIMA 1JEDA 4TZ6A 1QHIA 3SBEA
chains in the Genus database with same CATH superfamily
1GYQA 2WJAA 2IRWA 3K0FA 2NT4A 2ON6A 1G2IA 2PPLA 1P2TA 4EECA 1ONOA 5CBKA 1Q0TA 1HETA 2EU8A 1Q7RA 3AHDA 4G5SA 3TB6A 1XMSA 1QQ7A 1ZSNA 2YUTA 4GHWA 2VJDA 4HQNA 1OD6A 2R751 1QCDA 2WWFA 3I9JA 4TWAA 4ZICA 5CTAA 1F5SA 1DL5A 4HXEB 1P0QA 2DTEA 1QHNA 5JSHA 3BGIA 2R8EA 4R3UC 4MV7A 3LT0A 4Z0PA 5LFAA 1Y1KE 1NXOA 3PJFA 1Y8QB 2O8DB 2QOEA 2C83A 4CMJA 1PU2A 4YQEA 4B3BA 4HH3C 4WBSA 2BGIA 3NTUA 3M4YA 4E22A 4B46A 1Z5PA 3ECSA 3OMWA 1LRLA 4OQEA 3MT8A 4R4JA 5HM8A 2QUBA 2WZQA 5KVSA 3BL6A 3QUQA 4V38A 3K6SA 4MJ7A 4YJHA 3VH3A 4ZYZA 5B6PA 1MOSA 4H6WA 2WJPA 3RVRA 3D8BA 4PW0A 1VLMA 1AC5A 3TKYA 4MVJG 1L8XA 4AFNA 3IP3A 1FS5A 2HMUA 5HYVA 2NLOA 4QGGA 1B6SA 3KJNA 1U65A 1UXJA 1H2XA 3T7EA 3TJMA 4MR7A 2XMCA 1PQWA 1D2HA 2E4UA 2O0LA 1E1CB 1N9ZA 2H0RA 3EGWA 3SG0A 3AKCA 2R7KA 4ZT5A 3OLYA 5AVXA 1JLLB 1UZAA 4DTCA 2CXHA 2PH3A 2IZ5A 2VWGA 3W5SA 1EM8B 1PJ3A 3QWBA 3BIJA 4GLFA 5DT2A 4DLZA 2AC7A 4MIYA 3PXCX 4Y9TA 4O4IA 5BRNA 4LDRA 1C3OB 2XNSA 4DLTA 3V6MA 3R74A 3ZLBA 1ZI6A 3HA5A 1VJCA 1W0KA 2R1UA 1E3DA 3C5WP 1H3FA 3AEKA 4H77A 2FFAA 3FKSA 4BN5A 3RVKA 4YUAA 1RVV1 5F4BA 1YDHA 2G7ZA 1NRXA 1VG8A 4G1MB 2W6QA 3S70A 5F76A 1S5PA 1MPTA 1YB2A 3GRYA 4QATA 2ZYSA 3QE3A 3TDMA 2VFAA 1I30A 2DR0A 4NE2A 3RROA 5J2UF 4QJ3A 2JEOA 4PZYA 3ZUGA 2WJYA 3K0BA 4QHSA 3LX6A 1G9XA 4EARA 3OOSA 1HFWA 4JSRA 1CY2A 4LRTB 4KFCA 2QD5A 4IQGA 2JFBA 4YREA 1DC5A 1XDZA 2HGSA 2HL6A 1IUNA 3A1SA 3COVA 3LX5A 2J07A 3B12A 5ENVA 3U7EB 2Z1MA 5TEWA 5KQMA 5C52B 1U0BB 1QNFA 1BHSA 2BZGA 1GAEO 2BZSA 4WAUA 4XH9B 1ZMXA 1ISFA 1TIPA 2R6CA 4FGUA 1GRRA 2DFTA 4W8GA 2RGBA 4DIOA 1JKJB 3OVMA 4AG3A 2EQAA 5KSYA 3WLJA 2QVGA 3HN7A 4Q82A 4HTFA 4DLNA 1NFFA 2CUNA 1XCOA 1KMMA 3VYRB 3LC0A 4BNNA 2YL2A 1PF7E 4V0MA 2EJWA 4YT4A 2C00A 3HADA 4WJZA 1GNVA 1JEYA 1E99A 3OWXA 3SIPA 2R7AA 4D42A 2IIVA 1R0YA 1BMFD 3KOYA 4PHFA 2Q3JA 3DOUA 3N2GB 1RYEA 4KLCA 4Q4CA 5A6SA 2G80A 2POQX 2ZB8A 1YFLA 3CUTA 4W9MC 2Q5OA 5JSUA 4YCMA 1NVAA 4Q3KA 4X8OA 2R68A 4URUR 4G41A 1LV8A 3W1EA 1UOOA 2FFRA 5DYNA 3I30X 4Q39A 2JLYA 1XKTA 4G8DA 4GIBA 4LXHA 4B79A 4BMPB 3AY3A 4F2DA 2OV1A 4RIEA 3KYDB 4XM0A 2BZ1A 3KJHA 1GQQA 3V8VA 1RI3A 4KO4S 3WRYA 4ZYTA 3MWFA 5A3SA 1F6BA 4TWRA 2G09A 3QEMA 4RCYA 3V97A 3GGJA 3INTA 3D31A 1OA1A 3NOOA 2Q6LA 1J2YA 1IPEA 1EVLA 1JQKA 2F1IA 1A72A 1SFRA 2YVKA 3DMPA 3G9XA 1BFKA 4S12A 3U61B 1F2TA 4Q1CA 3UT5A 5JOQA 4RY0A 1ACJA 1T9ZA 2FETA 3NDIA 5DE3A 3W1WA 5C37A 1JTVA 3R8XA 3OEEA 4EG3A 2P77A 3D3EA 4LDNA 4LMPA 4S2UA 4ZVLA 1U98A 3NIFB 2ZI4A 1XD8A 4DMCA 2EAUA 4HRVA 4MROA 4O4LA 1XROA 5EXEA 4DNXA 4E5NA 3LM8A 4Q01A 3KSZO 2QHXA 2EZ4A 2A8YA 1D5WA 3E1GA 2GFHA 3OOWA 4Z9XA 3VR1A 2H1OA 5IPFA 5A5VA 2WAYA 2FG7C 3L8HA 1UK9A 1PZNA 5KDDA 2JG3A 2HNKA 3PJDA 1P2VA 2OCDA 3RARA 1OI4A 3T61A 4E4RA 1U5BA 4WRRA 3VNBA 1Q84A 3PHGA 2A9JA 3CX3A 2R62A 3AILA 3DZHA 2ZANA 3JQDA 3ZTYA 3A3KA 2FMFA 3OIUA 3FKJA 1OH8A 4EH1A 4I5DA 2E5WA 5GADl 2GM4A 4HQOA 1W1UA 4FKMA 4KXUA 2K5UA 4WX2B 4OHZA 2ZUFA 5AJYA 3W5AA 4Y1GA 1E0AA 3ZGNA 1S4MA 1VE6A 1NVMB 3GEHA 4A8HA 4EVQA 4OLAA 1M7BA 2EVWX 2YW9A 1P72A 1QKJA 1WXXA 2FP3A 3EB9A 3P0JA 3QUAA 2NYAA 4UARA 3STHA 3SYNA 1GL3A 5DP1A 3V1YA 5FR1A 4E4TA 1GSIA 4LJ7A 4M22A 5F64A 5AKHA 1C5KA 3RB8A 5ALNA 3T06B 1Z74A 3JQFA 3USCS 2X4DA 1FRVA 1G42A 3FNGA 1B4DA 4MEBA 2DY1A 4DLUA 2ZE6A 4CMKA 4IX9A 5DKFA 2FSVA 4HFNA 2AKAB 3NBQA 4YY3B 4FI3C 2EF1A 8ATCA 1KQNA 1P7WA 3R3HA 4YX9A 4GXNA 4ZO4A 5K3AA 4FYYA 2PD4A 3I6MA 1NSFA 3PHCA 1U9ZA 4UNSA 4ALIA 2DH5A 1QK3A 2WD7B 4ZK6A 1C4WA 3UAYA 1G5PA 3Q0EA 1EB9A 4TVSA 1AQNA 2X3YA 5DTIA 3NWOA 2GPAA 3AC0A 4NS4A 2CLLB 1MZPA 1AXRA 2ZJ3A 3C45A 2DQYA 1OI3A 5C34B 1XTZA 1ZM3A 2CVPA 1TM4E 2G4VA 3QHQA 4MA4A 4O4JA 5I9SA 3TTYA 4R5HA 2IODA 2OMEA 1Z37A 3NRJA 2WA1A 1LFDB 3DVLA 4BLQA 4RY2A 3UAVA 1FRZA 3OIDA 4MPRA 1IY1A 3MINB 3VPGA 5IVPA 3F7OA 1ZI9A 2Z98A 3WGLA 1IEVA 3A6HA 4G97A 1Y9EA 4JELA 3AM4A 4MYTA 5FYDA 4DRYA 3AVXA 1XQ1A 2UZAA 4C7JA 1PV1A 2QXTA 5IHXA 4OHKA 2J45A 3BILA 3UTCA 1WOMA 1OVGA 2PGOA 3E3MA 2EKLA 3GLFB 2Z9CA 1U2ZA 4EG4A 1L7MA 3A9RA 1J99A 3E8XA 3IEKA 2I4OA 1H4VB 3LUPA 3N05A 3QU5A 5J2UA 1X7WA 1UMDA 2NV0A 1I9CA 2Q9CA 4UAUA 2DUUA 1T34A 3A1EA 3L7JA 5AM3A 1KTVA 2GWRA 4AWXA 1TKRA 2VNJA 3C1TA 1ZLYA 4LHSA 5BT9A 1P3JA 2IEGA 3FGPA 3FPBA 4FGWA 4XD7A 2NU9A 1D2NA 4S35A 2Q4TA 2YHSA 3DAPA 1K1EA 3LYHA 5B7PA 3UJ9A 2AKYA 3B3QA 4IUBS 4MV9A 2C0PA 4JYPA 4PFQA 2VHCA 2QT9A 1FP1D 1NM5A 1TVKA 5D3MB 4UOEA 4FVTA 4J3FA 5CNMA 3DR3A 1OLSB 3VDMA 4FW9A 2IZOA 2R7MA 3LAWA 3OFNA 3SNKA 2IK8A 4MRPA 1UXHA 5F3RA 4EYOA 3T7AA 1CUYA 1JG3A 3RWMB 3F6YA 4D82A 4CGZA 4XE5A 1K7YA 5GPBA 2E0IA 2L18A 2IZ0A 4NQZA 4G6ZA 3SM9A 2FW8A 2QDKA 4IJUA 5IVHA 2J08A 2GJKA 3UGTA 3L1KA 4P34A 3RODA 1FRQA 2PMDA 3A4TA 2VHEA 3A6DA 3T1NA 3N7TA 1I4EB 1EFVA 1AZTA 3P9NA 7YASA 3B6MA 3W90A 3ZW7A 2XRYA 5ALZA 1W44A 1PRYA 3B6IA 3L06A 3OSZA 4QBKA 4RQTA 1RWQA 3BJEA 2B4QA 2VI5A 2Y6UA 3MC1A 4AMZA 2DFDA 3ETCA 5L9AA 1SBZA 4KQIA 1S2NA 4HUTA 1QZXA 1N0VC 1C50A 2F3SA 1F06A 3D7MA 3M5WA 4MKXA 4AZ0A 5KNCA 1SCBA 1KK0A 2OORC 1N2EA 3L5OA 3JAWA 2OGSA 4O29A 2NUBA 2E82A 1JKJA 1QRRA 3N2IA 2ZUVA 2WD8A 3NWBA 4MWSA 2X7XA 3MLBA 3E7XA 4ZDWA 3B52X 3GD7A 2ZR7A 3ZUPA 1SPXA 3H5AA 5AHOA 1VTKA 2AEFA 1TX4B 2BVNA 1A2QA 1ONNA 4CF4A 2YQ4A 2BFOA 3MFYA 2PFKA 4LYYA 3GRUA 1RWWA 1R0WA 1NW4A 1NYRA 1U1GA 1P60A 2HJHA 4CQLA 4U0JA 3A0UA 4B71A 1WP4A 3OCZA 1QCYA 3C3BA 5A6SB 3HNRA 3PF8A 1JJVA 3NHBA 4O33A 5EP4A 4D3FA 3MOGA 4K5QA 1N8NA 3UHJA 3EX7C 4IUCS 4N0EA 1RHUA 1NJ1A 2JAHA 2NZYA 4BFLA 2PUCA 2GA8A 3R7WA 1R50A 3IQHX 3L46A 4M8SA 5K3CA 1Y1PA 2EIHA 2SCUA 4DY4A 2PZFA 3FPEA 3UUEA 1VXRA 5D84A 2YWHA 1AZSC 3LDGA 5FL7A 2ORYA 3WYNA 2JLVA 3DTNA 5AICA 5E9JA 1YI0A 3PNLA 2CK3D 2Y77A 2Q6IA 2ZSUA 1GTRA 2C9ZA 4FR2A 1R64A 1S8NA 2LRHA 3KSMA 4IIUA 2COEA 1E32A 2D0IA 2IC5A 4NDNE 1I0IA 4V2IA 3UAGA 3UHFA 5JSZB 3N8KA 4M6WB 4YASA 3F98A 5IT0A 4L0CA 2CUKA 4J1TC 4EYKA 3UW1A 3IIEA 1EFKA 2P68A 1Y7LA 4I2NA 3UT5B 2W6ID 3I42A 2PTGA 2QX9A 3Q8LA 4RTQA 1T2FA 1L3CA 1IBRA 5KHLB 1XFAA 3TTTA 2IUYA 4MVJH 4TVOA 3STXA 3WJAA 1PNVA 3RSSA 5JEDA 2NUPB 4KQWA 4Z4GA 4ZT4A 1T26A 4JUAA 4N5HX 4DL9A 4B7AA 5CUQA 2VDNB 1RZ3A 1OBHA 1L7QA 4HX9A 5EUQB 5IC5A 3TLZA 3KYCB 3OY2A 1GZSA 2HJRA 3VPHA 5C1BA 3H2KA 1PS0A 2DLCX 4QFCA 1UJMA 4NJEB 4EM6A 2GD6A 1II8A 4H1HA 3SKYA 2FLVA 2JFGA 3A2MA 3N07A 2A4KA 1Z5WA 5A6VA 3PNYA 3D2LA 3BBLA 4PO8A 1E1DA 1AQYA 1PE0A 3F97A 1KK1A 5CIQA 5TSDA 1W36C 1K7FB 3KHSA 2YINC 5EXPA 2BFDB 2O5EA 2R00A 4PAQA 3GLIB 3V8RA 5B2EA 2X8AA 1T9GR 3HU2A 1CVRA 4DA7A 2E1PA 3KVYA 4QFBA 3RTDA 1I9GA 5G0UA 3H4MA 2Q7OE 2QJOA 1QPGA 2VSFA 4ALNA 3HCOA 2P78A 2TYSB 2Z3VA 2C2KA 2IQ5A 3G8DA 2AWNA 4OU4A 1JG6A 1E58A 2J5BA 3AYZB 4OGFA 3DTVD 3CUUA 3OZFA 3VZRA 1E3TA 1SXPA 2I66A 2IZZA 1WM1A 4UUOA 1HE4A 1Z12A 1GUYA 1ZAYA 3CWQA 3ANXA 1J0CA 3IAS6 2VP0A 3QVJA 2CMKA 4HQKA 3I5UA 4LJ4A 1C41A 1M6YA 4YCAA 3OY7A 1RAFA 2Y0PA 3VZQA 2PNJA 5JCOC 3GMSA 4JLPA 3U7IA 1XVVA 1XD9A 2WUWE 1YS1X 2Z2KA 5ADHA 1B76A 4LDPA 2B1QA 3A05A 4F7DA 3LTNC 3D6NB 4J2OA 4AWAA 1PLKA 1YDWA 3IP5A 4ZPXA 2G6BA 4YYEA 2QM8A 2RG7A 2ODPA 4JLAA 1PT7A 4G1CA 3V8PA 3B2QA 3KJEA 4ARIA 1GUDA 5EIBC 2WE7A 5MHTA 4ISBA 4QTTB 3E9MA 1IATA 2V4ZA 4INAA 4LG1A 4MRMB 5CFPA 4C88A 4N03A 1ZVJA 4KR3A 4LXXA 1RRKA 4H7DA 4C7VA 1P7YA 3MRVA 3OTIA 2V7VA 3QIAA 2IA5A 2ZQZA 3U81A 1K7EB 3GRFA 2EFEB 4QJBA 2IYWA 4PAWA 3AR7A 4UKDA 3W2TA 3UYKA 1WKVA 1N2HA 1IHPA 5DWQA 2CWDA 3K1JA 2BMJA 2AG8A 2D06A 1AKQA 1I4DD 2QTHA 3FZGA 4MUMA 3V80A 1HDGO 1IHYA 2VG8A 4OAOA 4RA9B 5E9AA 3ZTTA 3TR5A 5LQAA 1DEKA 3K0CA 4TXLA 1M1ZA 5DISB 5G0VA 1M2HA 3RI3A 1CRQA 4BO8A 4EY7A 4DPKA 1HV8A 1NI5A 3ISTA 4HG2A 3GGCA 4L5IA 3BDIA 1AZLA 3FTNA 3U26A 1KI3A 1TOAA 2JAQA 3LPCA 2JIZD 1U8YA 2ZUCA 1TVKB 2RH9B 3TLKA 4EFNA 4P5PA 1J0DA 1MT3A 3UMJA 4Z4CA 3KWJA 5KYGA 5AVZA 5LU8A 2A1UA 1TFUA 3W5VA 4KJZA 4DV7B 2GZ3A 4TRRA 1GDHA 5AJHA 4LYAA 5J4HA 4NCXA 4KR9A 4ZI2A 2J46A 1VCOA 2VPYA 1J56A 3O21A 4ZC8A 4DY6A 3N2LA 2ZXEA 5BMVF 1E4EB 2H17A 1Q7CA 1N92A 4DQXA 3Q5GA 1MG5A 1NW6A 2P1RA 1ZOSA 1W5AA 1VI5A 1YB1A 3G89A 1NRIA 1DJOA 5EIEA 3MTDA 1LC3A 4OIMA 5AM1A 3WWOA 4KU4A 4FYPA 6REQA 2H51A 2DFLA 1BMQA 2QY9A 4OHPA 4RJ2A 1KO4A 2A7XA 4X92A 5C0OE 3RUPA 1YIDA 1XO1A 1JKIA 1SXGA 1Z4NA 2B8JA 3EVAA 3OTQA 3EYAA 1P1KA 1I2AA 4KBYA 4PONA 4LKOA 1Z56C 5LL6P 4Y3UA 4OX9Y 3QVKA 1IN8A 3D1VA 5G4KB 3PDHA 4LKRA 4TTQA 5EFZA 3TH5A 1XXLA 3VC1A 1P8JA 2XNHA 3PT5A 1IVNA 4PV7A 2IZ7A 3PUJA 4EBFA 4RTLA 2ATEA 3LSTA 4D9KA 1VLHA 4MGKR 3BTOA 3W2EA 1ZN8A 1QQ6A 3FPSA 4MQ5A 1FX0B 2ZI5A 3X2FA 5BNIA 4FPXA 2GVDC 3WKBA 1HDRA 1NBMD 5KYXA 3D5QA 1M3SA 3K6KA 1H6DA 1U2EA 3BMXA 4XAQA 3U16A 1P4HA 1ODKA 1X9HA 4NECA 1HLPA 1YC5A 2RJOA 3IIKA 2EL7A 1PJ8A 5HCIA 3WYAA 1EWTA 3FDZA 4DB4A 4TZTA 5FWDA 1BA3A 2EYUA 4X9XA 2AG0A 4AZWA 3DTYA 3GT7A 1PFUA 3MJTA 1WBJB 3IP9A 1FMFA 3FKSD 3WYGA 2PM8A 3THXB 1F3OA 3NPAA 4K81B 2LR0A 3HACA 5ELLA 3B9BA 2EBUA 1Q1ZA 2D13A 4OQQA 1W6RA 4UBIA 3RC3A 3TO5A 3QPCA 4NNJA 1U28A 5DTQA 2SCUB 1CBUA 2H31A 4B3XA 4TXMA 2GCNA 3Q2KA 1V71A 2HBYA 5KKCA 3GMIA 4YJ2A 1T9BA 1E63A 3DZDA 3KQSA 3QEJA 2QD2A 2FRDC 4ALJA 4EAAA 2WPDD 4RLFA 4AMUA 4W9NA 2C9YA 2RGNA 3MLEA 3AUFA 3OC6A 3G0IA 2HMSA 2H1IA 3DWGA 1WW3A 5JSZA 1TF7A 1U7WA 3W5UA 3F6SA 4O4IB 5ERXA 1AHNA 3D3NA 1RYBA 3I1IA 3O7MA 3SDZA 2FW6A 4TVKA 2C4NA 1P2GA 1L5WA 4N5LA 3JD0A 5E3JA 3T99A 3VU9B 4B6OA 4GPBA 1DIOB 2V58A 4WFKA 1RXWA 3EVEA 1SQ0A 3TLEA 4WPGA 2WUGA 1UDXA 3GBVA 4RNCA 1UBOS 1XZQA 2ZUWA 3W8DA 4E46A 1B0UA 3NEPX 1CS0A 2BL4A 3AHGA 1PDWA 1W0JD 2NUPA 4HN9A 3BGOS 4JWTA 1PV4A 3RJ9A 3PQCA 2GJ8A 3COJA 1ZONA 1YBAA 1FW8A 3DE0X 4FM9A 2MMGA 2GX6A 4TT3A 3IBSA 4GLBA 1OFUX 2Q3BA 2REXB 4MLDA 3I1YA 5IK2A 4WCVA 3IT2A 2PSSA 4I7EA 4WA7A 2ZRHA 4EBBA 1I7NA 2YIDA 2Z09A 1PZMA 1UCFA 1ZVKA 4H1TA 1II8B 4NBRA 1EVIA 5KSPA 4KQCA 3TCKA 3MW8A 3AJEA 1SVSA 4X20B 5TS2A 3W04A 1J06A 5LB4A 1QFMA 3KIPA 4DILA 3DMGA 2FXVA 2R6HA 3BOSA 1GPAA 4URYR 4DM7A 4RGVA 2XNDD 1E6WA 4V02A 5AQEA 4GYKA 3WRXC 2Z04A 3GLIA 1CCWA 4G4JA 4J16A 4PZZA 2DWPA 3RFUA 1CVIA 1DIGA 3O4FA 4HTFB 4F12A 2RHRA 3WKAA 1AK2A 2CT8A 2QTCA 1WPXA 5B53A 4ZRMA 1JR6A 3WK6A 4UHCA 5JFTA 1NLFA 1YQQA 2HRBA 4FP9A 3OPNA 3NR2A 3CZ9A 4YP9A 3T34A 1LWOA 1JEYB 3AKEA 4CIYA 1HNZB 1U3VA 1JEQB 2W2LA 5IF3A 4IZIA 2PYDA 3GCXA 2WIKA 3GW8A 5ICCA 4RTKA 1KJYA 4DCVA 3ZVKA 1O96A 2UZIR 3BQ9A 4Q9NA 4PTLA 3A9WA 1WP9A 3FWZA 2YMQA 4OXRA 1KDRA 3HVHA 5B30A 2R8PA 1D4ZA 4OG2A 3ZU6A 3T41A 1UZLA 5L3SA 3C7AA 3P2YA 2FE1A 3CE9A 3OO1A 2B83A 5DM60 5HOQA 4KNWA 1B7GO 1FYVA 1LPMA 2X2OA 3KYDA 5LQCA 1EDEA 1XEXB 2JHGA 3D81A 3CX8A 4KWEA 3CG4A 3GBPA 4ED9A 5EHQA 4GYYA 3CUWA 1P9OA 1ISSA 1J07A 1UKBA 4GM4A 1IXKA 3RG2A 1M10A 1SA0B 1YB6A 2FZ4A 3DDOA 4G4IA 2YIMA 5DHTA 1Q19A 3FUTA 1Z0IA 3KQMA 1T43A 1O95D 3C4JA 4KBGA 4L0MA 4F92B 2RONA 5KX5F 1Q12A 2NTYC 1K2VN 1O8BA 2QRPA 2V6MA 3EFBA 4L95C 4UAVA 4AN4A 1EZ4A 1ESCA 2O6HA 4HF7A 4YLYA 2V3CC 1QB7A 4YALA 3ROPA 5FI0B 3H13A 3HUEA 1KWGA 1JDBB 2ACKA 1X2BA 5CPBA 2FF7A 5SZIA 5JBQA 4JBIA 3KETA 1OJ7A 1QV7A 4PFSA 3UFXA 4GR5A 5LNK1 3M6FA 3FIUA 4JOCA 5LQMA 4AX4A 2AWOA 3FYSA 3L8GA 2BJWA 2XCSB 4KC0A 4FUTA 1AGRA 1TD9A 1XMJA 1YO6A 4OMFG 3NHUA 5K0LA 1Z68A 2BMVA 4I4IA 1L4EA 1S7CA 3IQIX 2OP1A 1YE5A 4FYIA 5I9NA 3AVYA 3VX3A 3IMFA 4HNUA 4YVFA 1NN3A 5EXSA 3TIIA 4CLOB 3K9CA 2XD9A 1Q77A 4IDHA 3P52A 3MWGA 2OSVA 1O6CA 3EE6A 5FX2A 2AR0A 1DEXA 3T5DA 3UA3A 2YFKA 1L7DA 1AQLA 2FKAA 2ZI7A 3B5EA 4KPGA 3B48A 4BGIA 3ZEAA 4KE9A 4HNVA 5F21A 4CL8A 3SXJA 4IIJB 4DDVA 5EZQA 2MCFA 1P9WA 3FNBA 1ZBDA 2GZAA 1JU3A 1RWMA 4B7CA 4QU8A 3KOOA 1BWQA 1Z2NX 3JWEA 3DQZA 3ND6A 4YRRA 5B1HA 4YMLA 3WOHA 1G6OA 5JWRA 2CHFA 1FE8A 2FVXA 4PVCA 3ZK9A 2AOXA 2GRAA 1J97A 1EIZA 3SZOA 2PLRA 2HLPA 3DG9A 5UKDA 1D2AA 3ECCA 1IAQA 1P8AA 3FVVA 3HDHA 4ERXA 2ZE5A 3DO6A 4URXR 1ZISA 1FDTA 2PQ6A 2X0IA 4Q4HA 2ZR8A 3A1WA 3IPAA 5IZCC 1EVJA 1HDOA 1QR2A 2FVYA 1IHXA 2DQKA 3EOAI 4G1BA 3KT0A 1E1LA 1GADO 5GJVC 3LT1A 3HMQA 4F11A 1FQJA 1VSBA 1KOLA 3N76A 4I1UA 1N0HA 1EDBA 3ANYB 1Q0QA 3GGGA 3KJIA 4H35A 4K6OA 1W5BA 3EA4A 2HT1A 4GX2A 4XWTA 1M1UA 2ARKA 4Y2UA 4DRXB 1NM5C 3BTUA 3VJMA 1PL7A 1GSAA 1FX0A 4MWEA 5A4IS 4DM4A 3U31A 3A6JA 1RM5A 4HYEA 2BEUA 1RRCA 2HBRA 2ZSKA 4B45A 4HVCA 3LLVA 4ZRNA 4B3RB 4KIFA 1NT2A 3VA7A 2CGEA 2YN4A 3F6BX 1NNUA 2E6UX 1R6AA 1ECLA 2WZCA 3P0EA 3HHEA 3QKTA 3WC4A 1SHTX 2Z6UA 2XRFA 2K7FA 4KE7A 4K9OA 3VV2A 4UHKA 1QVWA 1ZMOA 3FGNA 5HRUA 4AC9A 2FB9A 1X77A 3O8OB 5J2UB 4PYKA 3S1AB 1QVVA 3LLCA 4PX5A 3BRQA 5LKRA 2QBYA 3T4PA 5JMTA 2H48A 1QIFA 2QA5A 1CY4A 1K92A 2WTMA 4I9FA 5AM4A 4BO9A 2C2ZA 4BMVA 2ZOSA 1W46A 3V46A 1FNBA 1NR7A 2RIRA 4MMZB 4HEA6 2YKQA 3TZQA 4N82A 3W06A 4F71A 1HDYA 1Z8NA 4LNHA 2Q1WA 2ZTUA 3BSWA 3QTTA 5IDXA 1E89A 3KG2A 3UAZA 5AKLA 4PC2A 1UDCA 4J0EA 2NXWA 1OLSA 4QPCA 1BJRE 3D8UA 3I04M 3HBNA 4OEHA 5TV2A 1F8YA 3D4NA 3FYDA 1J22A 3O74A 3H0KA 4UM8B 2FZKA 5GOTA 3CKLA 4MW4A 4AS3A 4L08A 2C1ZA 1EVEA 1JEJA 2P4QA 1QLWA 1TVEA 4JXKA 4I1OA 4WEQA 4JAVC 3OX1A 4AJ1A 2VTBB 4IZOA 1XTSA 1BMTA 3K5HA 1OY1A 2GDZA 3KU1A 3C5VA 3DM5A 2EP8A 5JCOA 3MJCA 4MS4B 3TRKA 3G85A 1BTOA 2IEYA 3KE8A 4H2DA 1T8UA 2F1KA 2EJUA 2Q2OA 3C1OA 5HE8A 9MHTA 3KFXA 5CA1B 1N9GA 2GXUA 2REQB 3OOHA 5DM70 3FRJA 1QNLA 1Q74A 1RYFA 5BN5A 1N6RA 3VPAA 4M99A 1XA0A 2Z08A 2L82A 4NV1A 5EWMA 3ZTWA 3I62A 3JWPA 4Q5IA 4NE9A 3FBGA 1RWKA 3T9FA 4GOKA 2QR2A 2V97A 1M34A 5KDOA 1Q20A 1H1LA 2QUZA 4R5MA 4DLAA 4Z9BA 5K6AA 3R40A 1YQGA 3EAQA 3QKWA 1DE0A 1Y33E 3CYFA 1F6DA 2BKLA 2OMKA 4FLMA 4X20A 1E1QD 3UPDA 1WZCA 3NUZA 1V16A 1WSAA 4C08A 2FY8A 2M6SA 3NUGA 4NYMR 2I4NA 1GD1O 4LQLA 1D7OA 1B6TA 1GQRA 2A0KA 3PE4A 5DPMA 4CIVA 3VKWA 5K8IA 3A6PC 1Y4DE 4A2CA 1JHUA 4BVLA 3I6YA 1Z26A 2IBMA 4C4AA 4Z4IA 3MM4A 3NGXA 5J4VA 2CLDX 3CNHA 3KVNA 1LSUA 3ENWA 3SC6A 1MO2A 2F3RA 5FO1A 3H2YA 4MAAA 4EF5A 5F77A 5HZHA 1AS2A 3J80A 1TEHA 4YLEA 4QXOA 1FQOA 3DO5A 1V9SA 1GUBA 2DQ4A 2VS1A 3DC7A 3O9MA 5L51A 1P4RA 2I34A 3CMMA 3ZPXA 3ZCVA 4Q3EA 2XVZA 2PVPA 3R7WB 3WJ7A 5DI9A 1EP9A 1TM7E 1RYMA 2WTNA 2P9ZA 4JT9A 3ACDA 2QK4A 2V55B 1ELOA 5HMLA 2J9FA 2FNAA 2FSIA 3HZOA 1GNPA 4RABA 4E07A 1P18A 1UP7A 4OXQA 2ADFA 1EUCB 2AXQA 3ZZUA 1Y7HA 4JGIA 3PUKA 4D9JA 3A1NA 2Q4DA 3AR5A 4DMUB 8OHMA 1MHTA 3AVUA 4QHYA 3DULA 1Z4LA 3JQ6A 4AMGA 4FDMA 4LWPA 3Q9LA 3OZEA 3EJ6A 4CQMD 4IRUB 1J0EA 2DWOA 2KLBA 4MW1A 1JIKA 1I3CA 4OXNA 4ZEVA 4QVGA 2AW3A 2WDZA 4RK0A 4RFLA 2B2CA 4HSGA 4CM3A 4NOLA 5LJIA 4L3VA 1MC5A 3NHAA 1UDWA 3C6QA 4Z6KA 1HTWA 4KH1A 4KPYA 2YMMA 5DASA 2AR9A 1BEZA 1NTRA 1KWKA 1I2CA 1XMVA 2C1XA 4JX9A 2JCSA 3QM1A 4ZZ3A 2PZ8A 4RQAA 3KL2A 1Y7IA 1PEAA 2RCNA 1MENA 5CPFA 1QDEA 4C0WA 3LY8A 3GEEA 3IVRA 4QOSA 3OESA 5IBCA 1TI7A 2BSAA 2CVOA 1JFLA 1NUUA 3MERA 2Y4NA 3G8AA 1VHJA 4MQ4A 5AT1A 3CRMA 4IIJF 3CRRA 3WB9A 2QENA 1T5TA 3EQ9A 3NM4A 1DKMA 1QG0A 4OJKA 3T4UA 1BSVA 3OMLA 1KZ9A 1Z8HA 4CIAA 1V6CA 1RAIA 2J0UA 2BFDA 5C5DA 4IDAA 2YMLA 4RC9A 2AFIE 4D99A 1W5EA 2C3OA 1RHMA 4P3OA 3H1TA 1XZFA 4R9SA 1O94C 2Z6QA 3ZR4B 1T0IA 3D6AA 2VT2A 3ETGA 4EHJA 1VKHA 4R7ZA 1A9RA 3L4JA 1ENYA 2H59A 2QLNA 1T1IA 1W87A 2OC4A 5C7YA 2G1AA 2OZEA 3OX4A 4MK4A 4CLEA 2E49A 2HFJA 2C07A 3DL2A 4YAEA 1ORTA 3L9WA 2XH8A 1C7IA 4I3HA 3ELBA 4LFAB 1NE7A 3HGQA 4UHEA 1Z3CA 1NV8A 1Q22A 3PFHA 2QN8A 1BN7A 1CFZA 1BS9A 2PZAA 1V1MB 3RSHA 1XEWY 4POOA 2ZTVA 5JZMA 2LXNA 2X0RA 4GXTA 2VQEB 5K0EA 2GLUA 3FWHA 4LXIA 2XZOA 1PJCA 3NOQA 3KVRA 1XTTA 1OYOA 2WM8A 3F3SA 3V4FA 5THKA 4KCGA 1JHPA 1RXIA 3MSCA 4PLWA 1QE5A 3FF4A 4QUKA 3F96A 2Y2UA 4EKIA 3CBQA 4W1RA 4UQPA 1I51A 2E4ZA 2GK6A 2WDPA 3H4TA 4ZWNA 4B6EA 5BYAA 4E6EA 3IAHA 1XI2A 1X7HA 4OAPA 4RMJA 3DDSA 2R87A 2HSZA 4TWZA 1NC1A 3LBHA 4XX1A 4RY8A 4I1YA 3F5MA 1CQPA 3GMDA 3S55A 7AT1A 3MN1A 3I9LA 4XJXA 5IM5A 1P39A 3I32A 1BEEA 1TCCA 3GPBA 1GUZA 1JQ3A 2HM7A 4IGEA 1AE1A 5DGIA 4QUJA 2XB9A 3TF5A 3DZJA 4L4UA 4DJ5X 1A8PA 2A0XA 3AUUA 2LWIA 4E32A 4F8EA 1WAMA 1PNQA 2J0EA 3DLTA 3QPDA 3T7JA 4YN3A 4R01A 2FZVA 2W6JA 4EMUA 1UBRS 3NHJA 1TT7A 3H04A 3E3OA 3K4PA 4NK5A 4Z49A 4HATA 4DCCA 4YR9A 5K3EA 1NDHA 2VXBA 4TTJA 5G1PA 1WR8A 4EKGA 3SQXA 4QULA 3OZGA 4ETNA 4OATA 4YT2A 3ADBA 4M7OA 3EY4A 2C9BA 1FLNA 1FYEA 2NQTA 4Y6GB 4HDMB 1F4LA 2YXNA 3T15A 3DE6X 2GXAA 3WL3A 3HY4A 4RSHA 5NULA 2HJGA 5K6RA 1KJQA 1DIHA 3ZE8A 4BV3A 1IEXA 3C2QA 3OJ0A 2E1RA 3TMAA 3A8TA 721PA 4US0R 1XL1A 3SICE 1O5TA 3GLIE 5TC4A 4QVIA 1RXSA 1LC0A 2NW6A 3IOYA 2ZAYA 1EJ0A 3ADOA 3P9SA 3EDRA 4MYHA 2NTNA 3RAPR 1RZRD 4HPWA 1EP2B 3JRNA 3V1MA 6REQB 5I7VA 2ZTSA 2JK1A 3QVVA 3TTSA 4RYLA 1IIBA 1IHUA 1NN0A 4ZRDA 3E70C 5ALJA 3SQMA 1QIGA 1Z88A 3CRZA 3DZIA 1EUDB 3M1AA 2OCBA 3GLSA 1E4OA 4J4HA 4WERA 1JR3E 3X1ZA 4PO9A 4L15A 4Y1FA 1MAVA 4UTXA 5CB4F 4RH3A 2GO7A 4FGLA 4GYJA 4D7AA 4BKOA 3PSHA 3B1ZA 3B6ZA 1J2RA 3ZLVA 3PCTA 2YQZA 4FYHA 1FDVA 5DX8A 2J3HA 5DNDA 3TLJA 3QVUA 1M66A 1LPPA 1PGJA 3HZZA 1U3TA 4G9BA 1XL0A 1EYZA 2NO6A 5CW2A 4B17A 4ENSA 4WKCA 3OCUA 4AS2A 1J4AA 5I7WA 2HU2A 1TU4A 3GRRA 1U0LA 3PKIA 4GKBA 1WTCA 3ABRB 1Y80A 4OUKX 2PYIA 4OYYA 4A8JB 2CXUA 4WXYB 3FTCA 3MGCA 3GBSA 4DN6A 1QYIA 5K4AA 1COWD 5DMXA 1X0XA 3LP5A 1R8QA 4Q9JA 4LVCA 2ZRCA 1E2GA 3CNNA 3LCUA 3K05A 3TLBA 1B0PA 2C1EA 4AROA 3C8HA 4HL6A 4HNQA 4DQ0A 2Q1UA 4GZ3A 1LH0A 1TVCA 3IFSA 4I55F 4YJ2F 1NI3A 3AI3A 4L2IA 1AOXA 1UPCA 1Q3KA 4Q3CA 5TS3A 2AFIB 5HS6A 4BB6A 1T0PA 1L7EA 2EZTA 4HAVA 3M4JA 1F0NA 4QODA 3VRHA 4ER7A 1PNRA 5JVDA 4QTXA 3CZPA 3G1UA 4PVDA 3ZCSA 3C85A 2DETA 1Y1RA 2J9FB 4UHBA 2BTQA 3H5IA 4Q1DA 5L3RA 1Z0KA 3HJAA 5AJXA 5ENZA 2ZWIA 3A37A 4D6YA 4D79A 1N0UA 3HNOA 2V6GA 4I4LA 2WVJA 4EW1A 3MPOA 4ILEA 1G8PA 4WY5A 1KRHA 2ONKA 1RYHA 2PO7A 2J3IA 2ZB3A 3KQVA 4MVJI 4DUGA 4MULA 1ZMBA 3TZBA 1N5IA 3ELYA 1NVKA 1N33B 4G01B 1HI9A 4IS2A 5HZGA 5E2BA 2WM9B 3MCWA 2X14A 3FJOA 1DWQA 1M73E 4JKIA 1T9HA 3OOEA 1JI0A 3OPXA 3IMCA 3PUIA 3GLKA 1M83A 3QFFA 4YMGA 5BYJA 1Q0UA 2D7DA 3D4OA 1FL9A 3QU7A 1XDSA 5IDQA 1ZESA 1IN1A 3TNJA 3KQPA 1IXRC 4KN8A 3RH0A 3RYTC 4YHHB 3CLUC 4ND7A 4W99A 4UEKA 5DHQA 1KEPA 1QO0A 1K6JA 1MU0A 4DLKA 3GX1A 4PWYA 1U6JA 1AA6A 3U09A 1KBZA 2NO4A 6ADHA 1E9RA 3D1JA 2K6GA 4PIVA 1H8ED 3NFYA 2C5FA 2QN2A 1ZYUA 4DLPA 4WN9A 5JSQA 3CCFA 3QOXA 3RRBA 1LQTA 3BUSA 5EG5A 4GKAA 3FD8A 4U2BA 2A84A 3M1YA 3MJ4A