1UBEA

Msreca-adp complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
326
structure length
303
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGLQARLMSQALRKMTGALNNSGTTAIFINQTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Crystal Structures of Mycobacterium smegmatis RecA and Its Nucleotide Complexes
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 86
structure length 303
sequence length 326
ec nomenclature
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1ubeA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ubeA01
2VRWA 3HP1A 3GJ8A 3JVUA 3SQXA 1G5PA 2FFBA 4OQLA 3GLFB 1NY5A 2J5XA 3QF4B 4RFSB 1C9KA 3F8TA 1GOTA 2IXFA 2GBLC 2ZS8A 2ZI9A 2OV2A 2OCYC 5FUYA 1P5ZB 1DAMA 2C03A 2ODBA 5F3WB 3AF2A 1FUKA 1GVNB 4MGZR 4JYBA 2BMDA 2ZJ2A 1KJYA 3RRNA 3X1YA 4EFLA 1E9BA 3GLFE 1GDDA 2QL6A 2GILA 1RKBA 1SVSA 1LFDB 4IFEA 4FMDF 3VX4A 4AKIA 2VSOA 5JEDA 2CMKA 2IK8A 2Z83A 3BJIC 3EXAA 5TMPA 1IJEA 2IF0A 5JWOA 4PO1A 2CCJA 3SE0A 2G83A 4AKEA 2XNSA 2GAOA 5CM9C 3ZIAA 3CH5A 1VCNA 1H65A 3R9XA 1SKYE 4OI2A 4NTZA 3AVQA 3MUFA 3NEJA 3W8NA 3T5GA 2FFQA 1IXRC 5FPTA 4POAA 1T3SA 4QOSA 3SI7A 2FDCA 1Z6XA 4EIWA 1MV5A 2QEQA 4ASUD 4YMWA 1NJGA 5HKKD 4TL9A 1CJUC 4IDNA 5L3SB 3DKPA 4XIGS 5LB4A 4LYJA 1KMQA 2IEZA 3T5DA 4A2QA 1EESA 1W46A 5KSZA 1XPOA 1E0KA 1IY0A 3LX8A 3QXSA 121PA 4GL2A 4Z8YA 2Q3MA 2VPPA 2JASA 5BW8A 1QHNA 3BH6A 3LFUA 3A8TA 2NGRA 1ZCBA 4JVSB 3RWMB 3GJ0A 3CW2A 2GNOA 1UKEA 3KJEA 2ERXA 4C0JA 1E9EA 2CNWD 1KTVA 5AWFC 2JLVA 5EQTA 4US1R 1CF4A 3TQFA 2IUUA 5E7IA 2NO0A 3THOA 5TV2A 3SYLA 2C5LA 2XZOA 2VHCA 2WWGA 1YRBA 2IYTA 4IOKA 4LOAA 1JQJC 2ATVA 3H1TA 3UG6A 4DUGA 2F43B 1E1QA 1LVGA 1Z0DA 4K8OA 4TLAA 1IN8A 2QY9A 3AF1A 3EA5A 3PCRB 2HEIA 4HEJA 2ZRLA 1ZD9A 2P5SA 1BKDR 2FU5C 3L2OB 3M6AA 1XXHA 2N1BA 2O8CB 3ND8A 5AR1A 4XSHA 4HZIA 1I4TD 2ZTSA 1ZNYA 2HYDA 3IEVA 1AA9A 3KUDA 2B8WA 4MRSA 4N0DA 4A8JB 4MITA 3K0AB 2CBZA 4A2WA 3EIHA 2ZITA 5D3MA 2YZ2A 5EJEA 4JVNA 2CJWB 3I3SR 3L43A 3ADBA 2GVZC 2P67A 4KHZA 4UJ3A 1W36C 4HI0E 4JLBA 5DO9A 4CGZA 1CJTC 1GFIA 4U00A 4B2PA 3EA0A 1VG8A 2OM2A 3PEVA 4JL6A 4X8OA 3C14C 3X1ZA 3U6KA 4PHTA 2WOOA 4HB0A 4D4MA 1G8FA 2BBSA 4G5QA 4OJQA 2BV3A 1KO4A 1QHHA 4EPXA 3L0IB 2WPDA 421PA 4AYWA 1YZUA 4HLCA 1CXZA 1LV7A 3K9GA 1S2MA 2ZSDA 1IAQA 4XTRA 3U4QB 2WAXA 1Q22A 4AKGA 3GJ6A 4GPTA 1Z6YA 1LF0A 1G18A 1CBUA 1GL6A 1E2PA 1GL9B 1S3GA 2BEKA 1KI7A 1NL3A 1P73A 2AK3A 4ZI3A 3EZ9A 1R2QA 5IK2A 1T3HA 2PZEA 4KJZA 4WA7A 4I1OA 3AKEA 1HE8B 1ZU4A 3K09A 5DHFA 4Q9KA 3NKVA 2ZSBA 1BS1A 3BH7A 3BWDD 4BZPA 2BM1A 5B30A 2VBCA 4FN5A 2OBMA 3O8DA 1G8YA 3BGWA 4LJAA 1SXJA 4GT1A 1TF5A 5AUNB 2G6BA 1K5GA 4CT4B 3PR1A 2MSDB 3C16C 4Q21A 1TADA 3VR4A 5L3QB 4CEIA 3VKHA 1N25A 4JLVA 2VYFA 4QRHA 2L0XA 1XPRA 1HTWA 1E9AA 3HR7A 5FOWA 4CZ2A 3VNVA 2GJKA 2RGNA 3AUXA 4S35A 3TIFA 3W3AA 1OXXK 3L82B 1NNEA 3THXA 3DKVA 4L9SA 1OH6A 4FIDA 1E0AA 1WQ1R 3HR8A 4DLVA 3VMFA 2C8VA 4A92A 1XMVA 2TMKA 1TEVA 4FMCF 1P9RA 5JS8A 1CRQA 3IIMA 4NYJR 5KSPA 2YWEA 4AURA 1MO5A 5FH9A 4RVCA 521PA 1S3SA 1QHYA 4NHOA 1CJKC 4N3NA 2R6DA 3EZ6A 4JZKA 3QXXA 3UWOA 3SHWA 2GXAA 1WBBA 5TDHA 5J4HA 1U99A 1OHHA 2GJ8A 3P27A 4ZDWA 4DLWA 2BIFA 1JR3A 2FN4A 3FDIA 5B2ZA 2IX3A 1ZW6A 3GFTA 1KYIA 2E87A 3WXMA 4O0MA 5EXPA 3I4LA 3SU8A 4I1SA 4TLEA 2J0SA 3THWB 1NF3A 1RC8A 2FZ4A 1PLJA 2NIPA 1VKJA 4MKGA 1ZNZA 4Z1MA 3AP2A 5EP3A 1Z0IA 2OE2A 2JDID 2OBLA 4BLRA 3UANA 3MWLA 2OXRA 2Q0HA 3B82A 3QPWA 1M7GA 1ELOA 4YONB 5DI9A 3GEIA 4I1VA 3N2EA 4NYIR 2FNAA 2O5VA 3JZMA 4C3ZA 3IQXA 4C0QC 1XD9A 1ZJ6A 3BC1A 1S9DA 4UNPA 1W2HA 1Z5ZA 4ZKDA 4KO8A 5FR1A 5F9HA 4LJYA 4D26A 1KO7A 5JJKA 1ZC3A 1XPUA 1NP6A 1N3BA 2FMXA 1NIJA 1HT1E 2IEYA 3VNUA 3R8CA 4O3MA 2GETA 2ZI3A 2BM0A 3EW9A 4OHYA 1EK0A 3MJHA 3QVUA 3TKLA 4A0RA 2Q3HA 1Q57A 2AD5A 3CIOA 1E96A 1R0YA 1W0JA 4DXAA 4PO8A 4PANA 3KUCA 1YR9A 5FTJA 5CDFA 2ZUCA 3QEOA 4MYTA 4YDHB 1DOAA 4ON9A 3H84A 2IWHA 1G6HA 5CB6A 1SXJC 2ANCA 3I1FA 4LV8B 1DG3A 4M2LA 1WE2A 1OXVA 3W6OA 1A2KC 3PEWA 4KFUA 4PAMA 2ZI7A 1T4GA 3L0PA 2QGNA 2W2XA 4LJ9A 2R65A 3MD0A 1JNYA 1BYIA 3W90A 4LJ5A 3K0EA 5E95A 1XFAA 4Q9HA 3W3ZB 3GD7A 1U9IA 3TUIC 2NOAA 3PIRA 5H8WA 1VCOA 1XJCA 2QTFA 2NPIA 1K8RA 1XMJA 3IEUA 1Z6AA 1UEIA 3IPYA 3ZZTA 2FEMA 2H92A 2ZI6A 1KI6A 1YZNA 2O8BB 3GCGA 4MGYR 3B7GA 1XBTA 3R7WA 2WVJA 1KK1A 2JIZD 1HY3A 5HPYB 1II8A 4JBYA 3LDAA 2XOKA 4A4DA 1AM4D 2QQ0A 2ZJOA 3QEJA 5BN5A 1JAIA 2IXEA 2WJHA 3LXXA 3KQLA 4IVRA 5CB8A 2ODNA 5HZHA 5KPJA 4QFMA 1IXZA 2F55A 2DWPA 2GK7A 3VKGA 2FZLA 1R6BX 3ZD7A 1RZ3A 5C18A 2QP4A 1KZGB 3PQCA 4DLTA 1G1MA 1AGRA 2O52A 1LTQA 5EUMA 1BH2A 4BFVA 3VU9B 4R71A 2KJQA 3AEZA 1F2UB 1KO8A 2WWYA 1E32A 3UK6A 1OKKA 1XP8A 1DAKA 1ZVQA 2HLDD 1EFTA 3PITA 2V1XA 3R8FA 2OSBA 2DWOA 3CB4A 2REOA 5AUPB 3AQ4A 2VHUA 1T3LA 4E03A 1WXQA 1EWQA 2ZR0A 4HB3A 1VYUA 1QHXA 3KXLA 3OEEA 5C46F 3C41J 2WIBA 1E9CA 1GWNA 1YZQA 1W49A 2AXNA 2IL1A 3PJRA 2QBYA 4IOLA 1GTVA 2WKPA 2DY1A 2B6HA 3UKDA 5ANRB 2WWFA 4OI4A 3HWSA 5J5CA 1S1MA 1UJ2A 5D3QA 1I2DA 2P5TB 1VDZA 2CHVA 2A2ZA 5J40A 2ZE6A 3AGPA 1BOFA 1MRSA 4RKFA 3WYGA 1ZM7A 4YC7A 1R7RA 3B5JA 1AKYA 2AKAB 4GMXA 4C0BA 4ZDIA 2YKGA 2XJ9A 4RZ3A 3I8XA 1P6XA 4V0KA 1ZUNB 4R2IA 2W83A 5HTKA 1GSIA 3ICEA 3IQWA 2CHGA 1SHKA 1Q1BA 1X8KA 3DEFA 5DH9A 5JRZA 1YZLA 1N2CE 4IDOA 4JL5A 2G9NA 2RGDA 4A0GA 4B3FX 3I5XA 3FMOB 2PEYA 4ZI2A 2XGJA 3FHCB 2C77A 3SFVA 3WMFA 2NPFA 4YMVA 1Z08A 4PAOA 1R10A 5HCIA 2XXAA 5DE3A 2BCJQ 4DJTA 3K0CA 1OFHA 3LWNA 3NDPA 4TYQA 2Q9CA 1MO6A 3FKQA 1E9DA 2ZJ5A 1SQ5A 5EP4A 1TTTA 2FG5A 3SFZA 2NMVA 4LHZA 2HJVA 1KZ7B 3MCAA 3HYTA 5FOVA 3PFIA 1E9SA 3BH0A 2EU8A 3ND9A 3OEHD 3CPEA 2I3BA 4L4UA 1T6NA 2Z5FA 3CPJB 3AF0A 2ODEA 1YKSA 3TVTA 2QN6A 4BFSA 4Q7MB 4C7OA 5KNDA 1G20E 5UKDA 1W44A 2XTZA 3WP1B 2O8EB 4FCTA 3REGA 2J0UB 4TLCA 1S4QA 2RGGA 4QGFA 2RAPA 2O8DB 4Y0AA 3ZQ6A 3SYKA 1G8GA 4Q1BA 1R8QA 2FGJA 3KXKA 1RPZA 1VHLA 4LBVA 3SN6A 4JKYA 3CRRA 1SKQA 1DVRA 3AVXA 3FWYA 4L8GA 1JJ7A 4PC6A 3SR0A 3NHBA 3WBJA 5L8VA 1RRFA 1T0HB 4TYNA 3CZPA 1A2BA 3RRZA 1T5IA 2QROA 4ZDJA 1GG2A 4PQRA 3A1VA 4B48A 1OF1A 1G9XA 1L8QA 4HAYA 3AUYA 3F5FA 1NY6A 4HUQA 4HUTA 1KK0A 1CJMA 4BWYA 1LS6A 1D8TA 1CULC 2XTNA 1GRRA 2CK3D 4LHYA 1NVVR 2ZRNA 4KITB 1UBEA 4TSFD 2FSIA 3I73A 4R2HA 2QA5A 2IUSA 1OH7A 3QXCA 4YMSA 5DLQC 1N6RA 4BFUA 1L4YA 3LLUA 4YMTA 3CX7A 3Q85A 1M34E 2VP6A 2ZRFA 4BZQA 4DCTA 2QE7D 4AC9A 4KBFA 2IYXA 2QU8A 1GZSA 2BKEA 3RS4A 4B3GA 1AJEA 4UNSA 2ZRAA 3KTAB 1UBCA 1P2VA 2SHKA 5EUQB 2D2EA 4XSGA 2JJ1D 4A36A 3QIAA 4JJZA 1VECA 3RWOA 2NZJA 2V54A 8OHMA 3UPUA 1II9A 2RHMA 3B78A 3G82C 2EFCB 1H8EA 3KKMA 3W34A 1TL7C 2H16A 2GAAA 2C9OA 1Q44A 3F0TA 4KODA 4Q4JA 3NH9A 4O2RA 2C04A 1CR1A 1I4DD 4DCSA 2MSEB 1FW6A 3I61A 3VTKA 1JPJA 1QG2A 1X6VA 3K0FA 4B73A 2OZEA 3VKWA 2CVFA 2ZJYA 1G3MA 1KNXA 2OG2A 3KX2A 5E7JA 2CDNA 4ZCLA 4JL8A 4QBFA 3QBTA 4KVAA 2BWJA 3DMDA 1R4AA 4CW7A 1XRJA 5JJLA 1OB5A 1Q3HA 4MKIA 4PC7A 2QAJA 1B23P 1UBFA 5KO2A 2G0NA 2W6JD 1ZM3A 1AS3A 3H4MA 1W7AA 1YR6A 3FKSA 4LHXA 2REXB 3BB4A 1DARA 1T91A 4OKSA 4C30A 4B33A 3EWAA 5SZIA 5JZVA 1G4UR 4LJ4A 3T12A 2GBLA 5DHAA 2QENA 3B1WA 2W00A 4QG7A 2WKRA 3CO5A 5B64A 1PUIA 2WSSD 4JJKA 1JR6A 3UMFA 3NTUA 2FFHA 2P2LA 1E2FA 1NJFA 2UZIR 4WZ6A 4OK3A 3TUZC 1E1RD 3KL4A 3ZYCA 3AKYA 4DSTA 4ZCIA 2P6RA 3ZLJA 2V7QA 4PXAA 3FTQA 4CEJB 4P4SA 4U02A 1OFTA 1VYVA 1M2OB 1DG1G 2VL7A 3A4MA 5KYKA 2PL3A 1Q21A 1GNPA 2QZ4A 3DO6A 2GVDC 3LAWA 4TLDA 1EXMA 3DM5A 4A6XA 1MABA 1G21E 1NRJB 2ZUBA 5FPYA 4D4LA 1JR3D 2VP2A 2ZPTX 4ARZB 1GITA 2WJVA 3GFOA 4X8HA 5C4GB 4U7DA 3THYA 4Q5IA 2W0SA 4HDOB 1G8PA 4I99A 3U60B 1WF3A 1E2MA 3T1TA 2CEAA 1KI3A 1Z6TA 3TW8B 3LY5A 4FCVA 1JECA 4RD1A 1CLUA 4WXPA 1S8FA 2I4IA 3PUXA 3CPHA 1V43A 1MO4A 1IOZA 1OFUX 1TF2A 4FINA 2ZAOA 4M9SA 3ZVLA 3GLHA 1G3RA 4DIDA 3O47A 4WAUA 2F1HA 3CNNA 5AUQA 4ZIRB 3RYTC 3OF5A 4DLXA 2ZI4A 2QMHA 4IJMA 1Q3TA 3ZJYA 4BFZA 4DEXA 2CE2X 4V0OA 3GLIB 4CEHB 2JAQA 1COWA 1ZMXA 2OAQ1 2DHRA 4Q4AA 2J46A 4TT3A 3OIYA 4OK6A 4RFVA 2FSHA 1XEWX 1OIXA 4TMZA 5G53C 1ZAKA 1W0JD 1N6IA 2VHTA 3FMFA 5DN6A 5SZJA 5HR5A 5B58C 3OE7A 3QKSB 5FI1B 5KNCA 3K9HA 3NEYA 2EWWA 2EVWX 3W6NA 1AK2A 1ESMA 3GLIE 4NCHA 2HYIC 2JLRA 2EFHB 1ZNXA 4HAVA 1P75A 2G77B 2VSFA 4YXWA 3CX6A 4A6PA 1DBSA 4FMCB 1HQCA 2IHYA 3AVUA 3N2IA 3GLGB 1ZM4A 1EFRA 1NSFA 1G17A 2OXCA 3ZZUA 4O25A 3C4JA 4DT1B 1TQ4A 3H2YA 4DEYA 3GLFA 1W0KA 3QF4A 1GKYA 4RFSA 4L15A 2XX3A 3WMGA 1O3YA 4BLTA 1WP9A 1AQYA 1US8B 2F6RA 1Q1EA 1SKYB 3E5HA 3O8BA 2C9CA 4KLZA 4LV5B 5KSOA 5CIWA 3GLGE 4NDZA 3EWSA 4B47A 1O87A 3B1VA 1KSGA 1Z6GA 4RZXA 4URZR 3OZXA 4TL8A 4ERNA 1UAAA 2XNDD 2IS6A 5GJBA 4AIIA 5BN3A 2J7KA 3C5CA 2OCBA 3WYAA 3CR7A 2FJUA 1RVDA 4NBSA 4UXJA 4D0LB 4MDEA 5G3ZA 2J87A 2KBFA 1E2EA 4DWJA 5AJVB 1N6OA 2EQBA 2PH1A 2Z4SA 1W4AA 3NBXX 4URWR 2OCAA 2HF9A 1G5RA 2WBLC 3GQBA 1U0HC 3QBVA 2Q9AA 3B8HA 4LJ6A 4RZ2A 1OSNA 1UDWA 3NXSA 5L3SA 4US0R 2PMDA 1E94E 2WIAA 4B71A 3FPAA 4QL3A 4U5XA 5K8IA 4D4KA 5FBVB 3IO3A 3RC8A 1NN1A 2XSZD 4Q1DA 4M21A 5IDVA 1FUUA 1NIPA 4HLUA 2V9PA 3IPXA 5BXQC 1U8YA 4XVQA 4MKFA 2DFNA 2Q6TA 3SJAA 1E2LA 1E99A 4B2LA 1QHSA 1KMHA 2Q21A 4MYUA 4OHZA 5FL7D 3ZZ0A 4DC9A 1IJFA 4NONA 3C5HA 4LYFA 1M74A 4EFNA 2WOJA 1OT3A 4XD7D 2WZQA 1P2SA 2QM7A 1TX4B 1XZQA 4L9WA 1W48A 4BEJA 4PC2A 2JJ2A 1FMJA 3RSOA 3X2SA 2QRNA 4DLYA 1TU3A 2D7CA 2KSQA 2GZDA 5DSZA 4Q47A 5BN4A 5DNYB 1HEIA 4JSTA 2F43A 2AR7A 5FFMA 3GJ7A 1WB9A 3SOPA 1VCIA 1OB2A 3TNFA 3EZ7A 3ECCA 1Y3AA 1GAJA 3LQRA 4D82A 3BBPA 1ZINA 2O8CA 3QKRB 2CL0X 5LD2B 4EAQA 1G7SA 1NMZA 1N5KA 2ZREA 3CONA 3AKCA 4CDGA 4ACBA 1UBGA 3LD9A 1JB1A 4A8JA 4GP7A 4V0NA 3K0AA 1DADA 3HU2A 4DLSA 1SULA 1W47A 5FTMA 1YQTA 3B1YA 2YC2C 3TAUA 4NMMA 1NLYA 4MRPA 1CR0A 3D7MA 1XXHE 4QHTA 2CJWA 2J7PA 4TYWA 1FNMA 2FX3A 3SBDA 1E69A 1P2UA 5C1BA 2BJWA 1ZNWA 2R6FA 2GZHA 4ILEA 2V3CC 3FE2A 2ZROA 4ITRC 4GOKA 4OL0A 2WKQA 1DPFA 1YZGA 2A3RA 4QM6A 1F2TB 1XCPA 3IO5A 1NBMA 2A5JA 1E2IA 3QI2A 4PHHA 4PQFA 4DCVA 3AP1A 2EFGA 3LBHA 5FPSA 3TAHA 3OIVA 5A4JA 3AM1A 2GK6A 2D3WA 5JECA 3SYNA 3U4QA 1ZM2A 2WM9B 1CEEA 1FPMA 1WA5A 2G1JA 2NO1A 1XD8A 3LO5A 3TH5A 4JLKA 1WCV1 3RRMA 4PAQA 3CH4B 3CRMA 4BECA 2YWGA 2R8RA 3NBFA 2WMNB 2NZ8A 4ZDKA 2XJ4A 2JLSA 1ZYUA 4F91B 5DYIA 3J81k 4IXNA 3QJYA 3KQKA 5FBWB 4PSAA 5JCPA 2AK2A 2AKYA 4M1YA 5AJWA 4MH0R 2ATXA 3EPLA 3H86A 1KIMA 4HLUC 3ASZA 4QNMA 1XJ0A 2V1UA 4KI0A 3QPUA 1XU4A 1CTQA 2OILA 4MYCA 4E22A 1G16A 1SVIA 3ADKA 2GDJA 2B21A 4G5OA 4N1AA 1E2DA 4B6FA 5L3QA 4DLRA 2VO1A 2AX4A 2NQ2C 4CEIB 1DS6A 4IFBA 4Z8XA 4JBXA 1G7CA 1WRBA 1XTSA 2ZVQX 4BLPA 3RS2A 4DCNA 1KI8A 3QY0A 2PJZA 1XJQA 3WNDA 2B7CA 2HDNB 1J8YF 1NN5A 1GILA 4HDCA 1TQ6A 3SQWA 5CK4A 1H8ED 3LV8A 5CYPA 3RABA 2O0JA 5KDDA 4Q7KA 2OO7A 4MRNA 3T1VA 2P65A 1CRPA 4BLQA 1S1CA 5FTNA 4NYJQ 3D6TB 1NLZA 1H8HA 2OFXA 4A8JC 5LD2C 3TSOA 2OT3B 3RANA 1E79A 4BFXA 2BBOA 2IUTA 2X8AA 2IYZA 3CUEF 1BO6A 2ZSFA 3B9PA 1XDBA 3BOSA 1L2TA 4M1MA 5JLJA 5F2EA 3THWA 1ZIOA 621PA 3CF2A 1N0VC 2FE4A 3U3OA 3LA6A 2ZRPA 4ESHA 2D4HA 1N0WA 2UZ3A 4IOJA 4P4TA 5JWHA 3HYRA 1JR3E 4M4SA 1MRNA 4BPBA 3CZQA 4KLNA 2FF7A 5KNBA 3MSXA 3S1AB 3LXRA 4Q9LA 2Z6VA 3U61B 1OW3B 5DISB 3OFNA 5H68A 3ZD6A 4JYCA 1JEDA 1E2QA 2W6IA 3ZVMA 2GA8A 3OESA 4BE7B 1Q0UA 1GL7A 1SVWA 3BS4A 1A82A 1RJ9B 2ODWA 1XB2A 1QVAA 1WDTA 1TQDA 3GPLA 3SJCA 2HT1A 2ZSAA 3I72A 5DI3B 4IEEA 4OQNA 3UIEA 2CXXA 2GCOB 1W4BA 2DPXA 2Q3FA 1J2JA 2IYQA 1DTSA 4WXRA 2A9KA 4JSYA 2C99A 3AB3A 3PVSA 4JMPA 1OXUA 4MUAA 1BMFD 1QG4A 2ORIA 2HXYA 1F60A 4OQMA 3TJZA 2K5UA 2CCGA 2HV8A 3TW4A 1RIFA 2DR3A 2OCPA 3P32A 1F48A 2CL6X 2B8TA 2PX3A 4GRAA 2F9MA 1KO1A 3TQCA 2ZJBA 4KV9A 4C2TA 2WWIA 2R62A 1D6JA 3B60A 3NHAA 5LDDC 1SVKA 1Z83A 3PUZA 4NYMR 4TQ9A 4TQAA 5GVSA 1I4LD 2VA8A 4FW9A 2F7SA 2FEOA 1UKVY 3ONWA 4UJ5A 4HB4A 4D25A 1T0JB 2F1IA 3T15A 1PUJA 1XMIA 1UF9A 2VP4A 3DZDA 5GJCA 3UMRA 1FMLA 3MWJA 2A5FA 2VSXA 4LI0A 4HZUB 1VPLA 4LUCA 1X3SA 3KJIA 4M9ZA 3IBYA 2YVUA 1QDEA 3IIKA 4URYR 3B9QA 1OIWA 1HQYE 2OHFA 4LX0A 1XEWY 2O8BA 2V8OA 5L3VA 2FFAA 3IHWA 3GMTA 5EE9A 3W5IA 1XEXB 5G41A 2J45A 2DWQA 3CF6R 3SBEA 2WWHA 1MO3A 3AV0B 3KJGA 4UQOA 4ACAA 2XZPA 1J8MF 5F9FA 2RH5A 1ODFA 2JATA 2R6CA 2JLUA 1GRQA 1ZM9A 4D0GA 1G291 3NVAA 4PO9A 3Q5EA 3CNOA 4TT3D 4G5SA 3VU9A 1A1VA 1Z07A 4G01B 2ZRIA 1F2UA 3VR5A 3AVWA 3D3QA 2YOHA 4PZZA 4ASUA 4CYMA 1E9FA 1R0XA 1K5DA 5HKKA 1P2TA 4N0EA 4FWTA 2NG1A 1FP7A 2BMEA 4NKRA 3LBIA 1N6LA 1D2EA 1SGWA 3FYHA 1OFIA 4C0KA 1EWRA 4E5UA 1Z2AA 5A0FA 3RS5A 2J3EA 4UNNA 1UADA 5JS7A 1E2HA 3P4YA 4V03A 5E3HA 1W4CA 1R0WA 1FQJA 1G3UA 2ZQ5A 3CRW1 4R7ZA 3HJNA 2GESA 3M1IA 2G88A 1DAHA 1IN6A 5BWMA 1PVOA 2RHDA 2QTVB 3AF4A 3EZFA 3T35A 1W36D 1DELA 2G3YA 4LBYA 3SZRA 2AWNA 2VTKA 2CNWA 3U2QA 4PZYA 4ESVA 1W1WA 2GEVA 4DDUA 4DSUA 4EDHA 2VLIA 4DLZA 2ZE7A 2QUZA 1KKMA 3QQ5A 1NI3A 1P62B 1FP6A 1ZD1A 1TEXA 3ZIAD 2ANBA 4ABYA 2RGEA 4B34A 4MGIR 2YWFA 4IDHA 5JRJA 3Q5DA 5J4KA 1FFHA 1D2NA 1U98A 2WTUA 4TN1A 4TMVA 4BUJA 1D2MA 1OH5A 1S0UA 4DKXA 5GADl 1U94A 2ASEA 1HYQA 3RAPR 1S96A 2WV9A 3A1UA 4F4IA 5FTLA 4M9QA 3SJZA 2AWOA 4TL7A 2C96A 1YVDA 1G7TA 721PA 2ZRMA 2Q9BA 3K53A 1GNRA 3WNCA 2GRJA 2E9SA 1NVXQ 3KKPA 1FX0A 4XTCS 1KAGA 2RMKA 2WHXA 1ZP6A 2R6GA 4LPKA 4TMWA 3GJXC 4EPYA 1KGDA 1JPNA 4G5GA 2H8KA 2ZUDA 1J70A 1F6BA 3FFBA 1MOZA 1YU9A 3X1XA 2IW3A 5AUOB 5FUXA 3IUYA 2O8FB 3LVRE 4HATA 2BMJA 2W0MA 4I1UA 2XB4A 3CKLA 3UG7A 1AS2A 2O8EA 3RVBA 2J0UA 1T9HA 3U6BA 1PV4A 4IRUB 3CRQA 1GIAA 4HDQB 2O8DA 2ZRGA 2QMOA 3FFAA 1PLKA 1UDXA 4IDPA 4DUGD 2WSMA 1E1QD 3VHXA 4Q9IA 2BVNA 1TUIA 1FL9A 1OV4A 1AZSC 2FPKA 2KE5A 3BFVA 3ZS8A 1N6PA 1CJVC 3KDSE 4MRVA 5KSYA 3EPHA 5G40A 3U7EB 1D9ZA 5FR2A 2CLDX 1HE1C 3P1JA 5HCNA 3FGNA 2GJ9A 1A4RA 4JT2A 4B43A 2AL7A 3R20A 3HPQA 1HURA 3CWZA 4G5RA 1U8AA 2ZJ8A 3B85A 1KI4A 3BAFA 4LC1A 1EFUA 2X77A 5FTKA 1UM8A 3U44B 3D8BA 4C0SA 4Q4LA 1P9NA 2MMGA 1P9WA 4EPTA 4DDTA 2GTPA 2IF2A 1CP2A 2V6JA 1GKIA 1VHTA 3M4YA 1NVVQ 3TVDA 1YJ5A 5JEEA 4W5JA 2QTHA 1IM2A 2R44A 4NL4H 4WW0A 1P7CA 1YHNA 4FMBB 1TNDA 4URUR 1Q12A 2WPDD 1F3OA 4B74A 3WYFA 1CS4C 3KTAA 4RKEA 4D0NA 221PA 1JXOA 3SS8A 1QBKC 2MSCB 3A1SA 1J7KA 2BMFA 2OBNA 4MUBA 4KSCA 4XWAA 3WHKA 4YQFA 3T1OA 3U3JA 4PC1A 1ANKA 3AVVA 1NBMD 3QUSA 2JLQA 4LWZA 4B32A 4Q4HB 4CVNA 4PC3A 3ZS9A 3RRYA 1KJWA 2BEJA 1OXSC 4A1FA 2P3SA 1U90A 3EC2A 4FXPA 3CM0A 2IYVA 5IK2D 4QKQA 2CVHA 3A1WA 2HCJB 3DM9B 3OAAA 2IS1A 4HLDA 4BGDA 2Z0MA 2W2VA 1KKLA 2F9LA 4G1UC 2AN9A 4MQBA 3UATA 2JCSA 4AY2A 4WBSA 2Z43A 4M8NE 1W5TA 1NLFA 3TSZA 3NH6A 2OEPA 2ZRBA 1U2RA 4NE2A 1SXJD 1QVRA 4NZYA 2J41A 2V55B 1ZUIA 3EIQA 4OK5A 4V0MA 2BDTA 5LBIA 4AG6A 2IYYA 5CIQA 1TF7A 2JDIA 1P4SA 4EQ6B 4JLDA 4GBMA 2OESA 4LPSA 2A78A 5FL3A 3R9IA 3DL0A 3DDCA 3B13B 4GP6A 5FOSA 4WOPA 6Q21A 5AJYA 5FBRB 2HF8A 4RD3A 2JLWA 1KOFA 1KK3A 4MRRA 2NO6A 1KDRA 3BFKA 3Q3JB 2YJTD 1ZU5A 1E2GA 2CL7X 2WICA 4Q1FA 4W7SA 4QHSA 1KDOA 2WJJA 2IHBA 4RD0A 1G5TA 1ZIPA 2W2TA 3GJ5A 4LGMA 5HE8A 4C4PA 2FPMA 1W4RA 1Z2CA 1OE0A 5TVKA 1G3IA 4M1KA 2ZAMA 4CEJA 2PLRA 2QAGB 3IDQA 1EX6A 2QRZA 1T8UA 4I4LA 1A5TA 4PPQA 1OHHD 5LPNA 3O8CA 2VHQA 4LCBA 4URXR 4EJSB 4M1TA 2ZYVX 4O2LA 3U3MA 3VR1A 2VF7A 3G5UA 2ZANA 4F93B 2EFEB 2VHJA 3U7FB 1EFHA 5CJPA 2KWIA 5JBQA 3ADCA 1RRCA 1ZD8A 4F38A 1TMKA 2JEOA 3QG5A 3ZH9B 1U0LA 1K6MA 2UKDA 4CF7A 3PUWA 5FBQB 4QJ3A 1VG0B 4ARZA 2GCNA 4Z1MD 4TZ6A 4PZLA 4UNQA 2QT1A 1ESNA 2H5EA 1XD2B 2A5DA 2ZSEA 1LNZA 2C2HA 3C7KA 1ZUHA 5GJVC 3U7GA 1YZTA 3H0KA 4QBIA 2DBYA 2PCJA 4QGGA 5JSZB 1RRPA 1MKYA 1XCMA 4II7A 4P31A 1CR2A 5DYGA 3NG1A 3BORA 4WIAA 1KNQA 4GOXA 1TQ2A 4A2PA 1GUAA 3QNUA 2F1RA 3U3KA 1DE0A 4ZIRA 2ZVPX 1N5JA 1CR4A 4XH9B 4QNRA 2JLZA 4PHFA 3X1WA 3E2IA 2JIZA 4QM7A 4JKIA 1W2GA 5JHGB 1LW7A 2PCLA 4JLAA 4D81A 4CEHA 2OFOA 4JLNA 3TMKA 5K8UA 3GLHE 2C78A 3KQHA 4LHWA 2VP9A 4Q7LA 3GP8A 3VAAA 4KSBA 1Q20A 2NO7A 2D74A 3Q7PA 4XWOA 3QKSA 5F98A 1E0SA 2ZEJA 2R6AA 5CYOA 1AN0A 2HUPA 4DDWA 2KI5A 1AIPA 3CBQA 1SVLA 1XNJA 2HLDA 4RD4A 1AA3A 1JJVA 3ASYA 2ZR7A 4B3DA 4G0NA 3GLGA 2XZLA 4DCUA 4XOIA 1XZPA 4M22A 1KI2A 4DB4A 4BASA 3MFYA 3LVQE 3W9YA 1A7JA 3VX3A 3LNCA 4DT1A 2RB4A 3CNLA 3IBGA 4JBWA 4KFRA 2AHOA 3FVQA 4QGAA 3TR0A 2ZU6A 2JLXA 2DB3A 2WWWA 1NKSA 1W5SA 4PX9A 2PT5A 1US8A 5KU1A 4Q01A 1AKEA 1SHZA 1R5OA 4FWIB 4LYAA 3VR6A 1E98A 3EIEA 1W36B 4H1VA 2XOKD 2IYSA 3RHFA 2ZE5A 5C2JB 4ZKEA 4B3BA 1XMSA 4XVRA 1IY2A 1GRNA 1G19A 5H70A 3OIWA 2IS4A 3TBKA 1X86B 4AKHA 2X1VA 1KI1A 1X1SA 2QAGC 3LQQA 4NCKA 5AK0A 2IXGA 5L3RA 1XWIA 1KO5A 2R9VA 4JLPA 1RW4A 5FUWA 3AGQA 4EJSC 1R8SA 2X2FA 4RY2A 3BB3A 2ZRJA 1OKKD 1LB1B 4UXIA 2IWRA 2ZXUA 4B35A 3KQUA 1G4AE 3O8RA 2BC9A 5E4FA 5JI3E 1Z0KA 2XB2A 3PG5A 4H9GA 4HSEA 3VR3A 3BE4A 4Q02A 4R9UC 3MMPA 2WJYA 2D2FA 1D9XA 4QBGB 3W6PA 1KY3A 3KFXA 1E2JA 1YZKA 3OEED 5P21A 3PEYA 4BFTA 3MWKA 2LKDA 3AP3A 2RGXA 1F5NA 1RE0A 2D7DA 5FBLB 2QPOA 5EP1A 3WRXC 1OYYA 1GNQA 1B0UA 1DO2A 3OEHA 4IEIA 4K81B 3SHFA 2G0TA 4RCZA 5EP2A 1JI0A 1Z29A 4K46A 2JGNA 3EARA 3QXHA 4X8LA 1P61B 2EWVA 1L7VC 1OLOA 1QF9A 4XJXA 3KB2A 4Y0VA 2UVQA 2OLKA 3RDPA 1KMHB 4NCIA 4IVQA 2FWRA 1II0A 2GF0A 2A7QA 3KKOA 5CLQA 4FD2A 2ZRHA 4D2IA 1KSJA 2D62A 2IA5A 4LBWA 3I32A 4Q00A 1HH4A 2LKCA 5CJ2A 1R5BA 4CRWB 4XWKA 3HU3A 3RNLA 4TTRA 1C4OA 1KJZA 3PENA 2A5YB 3L0OA 5K8LA 2PZFA 5HZKA 1RFLA 4MA4A 1XXHB 3ICQB 3NWJA 4MDFA 4C0LA 1XTIA 4CT5A 1UPTA 4JS0A 4ZV4A 1MH1A 3K1JA 4IKEA 3QKRA 4LJ7A 3QXJA 4AYTA 2O0KA 1UFQA 2CK3A 1IN7A 3K8YA 5D3MB 1VIYA 3K70D 4TSFA 3MRSA 3N70A 1KDPA 2QM8A 2QPAA 3LW8A 2Y8EA 4PPGA 2DYKA 3KB1A 2WWXA 3U3RA 1CU1A 4NH0A 1JXMA 2QE7A 1NMYA 2A30A 3DMNA 1U81A 2AD1A 4QHYA 1G41A 1QHHB 3DPUA 4KXFB 5A5GA 5EXTA 4RD6A 3D31A 1IBRA 3HPRA 4M1WA 1VCMA 2JJ1A 1F2TA 1KHTA 1Z47A 2IS2A 1G64A 2H17A 2XITA 2ZRCA 3X1DA 4MKHA 1Z06A 2CE7A 2F3TA 2VP5A 3QSYA 5IRCD 2QMUA 1SVOA 2YWHA 4TMXA 2GHIA 4EPWA 3ZVNA 4S2EA 4Z54A 4KU4A 4L5BA 1NKTA 4FI3C 3T1QA 4LYHA 1T8TA 4NU0A 1Y63A 3Q9LA 1VG1A 5JI2E 5FOTA 3W8RA 2AXPA 2V6IA 1NBME 4D6PA 2F1JA 2GXSA 2QSYA 3EG5A 3IILA 4B2IA 3ETLA 4DZZA 3KZ1E 3HU1A 4Q48A 1SXJB 3B1XA 1CIPA 4F4CA 1UEJA 4OHVA 2FV8A 5GJWC 2WJIA 1E2KA 2W6JA 2JA1A 2ZJAA 2GEUA 3A1TA 2IYLD 4BLSA 2FGKA 2ZYWX 3WNBA 1BYUA 2GF9A 1Z28A 1I2MA 4NPHA 3SEAA 3RS3A 1Z3IX 3K9NA 1GKUB 4OJKA 1SXJE 3I5YA 5KPDA 3UMSA 3THXB 2WSSA 1U8ZA 4RD2A 3WHLA 5FUVA 1OH8A 1UKYA 1XEFA 1Z0FA 5IT5A 1GP2A 4PR0A 5CM8B 1EGAA 2YOFA 2FPLA 1E1RA 2HXSA 4P0TA 3EPJA 2GKSA 2A5GA 5EXXA 4BQSA 4OYHA 2RGBA 3AVOA 4UXHA 3KQNA 1OYWA 1XCGB 2JLYA 4GZLA 3VQTA 1E2NA 4X8MA 4OI0A 3QG1A 3P4XA 1NN3A 3PV0A 5EZ6B 1LY1A 3LLMA 4GMDA 2ZS7A 4EKDA 1YR8A 2QGZA 3FOZA 1OJLA 4I81A 4PSVA 2ZR9A 2YV5A 1E6CA 2OUKA 4NP6A 4B6EA 4C9BA 3OAAD 2AFIE 4RJLA 1EX7A 5KOYA 2QMEA 4A9AA 2V4ZA 4LSGA 3QENA 4AI6A 4C0HA 3ZGXA 3KFVA 3FKSD 4QJ5A 1M8PA 3V4RA 3AVYA 1R0ZA 1U0JA 3TLXA 3T61A 4URVR 2FSFA 4B3XA 821PA 5BYKA 1BIFA 5FI0B 1G6OA 4MGKR 4QC2A 4H1UA 3KXIA 1NMXA 2ONKA 1FNNA 2PEZA 3BRWD 2NTYC 5EZ5A 4L16A 1AQUA 3S1AA 3N5CA 4NYIQ 3CWQA 5AJXA 3SC3A 4NCJA 4B76A 1E0JA 3CLVA 3LH5A 4M1OA 1Z0JA 2DCUA 4BEBA 4YMUA 3NC1C 4Z51A 1RJ9A 2RCNA 4KFSA 2V7QD 3G0HA 1Q1QA 2GWHA 3AF3A 4GZMA 3TGPA 1ZBDA 3SNHA 3ZQJA 5DI3A 4A82A 2XTMA 4LV6A 2ZS9A 4P33A 4LC0A 4F4JA 5J47A 1NVWQ 1JEEA 1N6HA 2GCOA 3AKDA 3C8UA 4B75A 3FMPB 5TARA 3WP0A 4BRWA 1KI9A 4LDJA 3AVPA 1KAOA 4D80A 2ZIAA 4PQYA 2B92A 1FQKA 3T06B 1VTKA 3LW7A 1E4YA 4F7WA 3K09C 4M9XA 4W5WA 3LX5A 4OI1A 3GJ3A 3KJHA 3BFXA 1P60A 4GNKA 2PBRA 2ZETA 4RSGA 5C4MA 5KUTA 4FCWA 2J0QA 1N6KA 2LCFA 1KY2A 3GFPA 4OHXA 5CDFE 3RSLA 2BKUA 5CLLA 5J4YA 2H18A 5FPKA 4LBZA 3RLFA 3RC3A 2CLCX 2VP0A 5JCZA 1ETUA 2RKOA 2H7VA 4QBHA 3EC1A 1HA3A 3BIFA 2EYQA 2YYZA 4J0QA 1XTJA 3TRFA 2RGNC 2RGCA 2VF8A 4NYMQ 4PFSA 1G8HA 4HZUA 4E09A 1KI6B 2YINC 1DEKA 2PMKA 3MJRA 5KTYA 2VIIA 3M0EA 1HT2E 3R7WB 4DHEA 1IXSB 1YE8A 2EW1A 1II8B 3EPKA 5EE0A 5JMTA 3NC0C 2E1RA 5IF9A 4GI7A 1M6NA 1YR7A 2J9RA 1XEXA 2XNDA 4V02A 1COWD 2OAP1 4HLQB 1LS1A 4OHWA 4Q03A 2X2EA 4TWZA 3HDTA 2IT1A 4B3CA 5DN6D 3TK1A 3JZAA 3OE7D 2REBA 1E9RA 2QP9X 4KCGA 4DRZA 4US2R 2BCGY 2GCPA 2H57A 3QOFA 2VH5R 1Z8FA 1XTRA 2G1KA 3VR2A 1JALA 5J4LA 4YXWD 2WMOB 2WJGA 2HT6A 2P0EA 2ZYTX 4DIEA 4DDVA 1EFRD 4BZXA 4JIMA 3QE0A 2QT0A 2PJRA 3A4LA 2DFKB 1VYTA 4ZPXA 2XAUA 1W0KD 5CITA 2DFLA 4PPNA 4C0AC 1PLLA 4JLMA 1OPXA 3U7HB 4A0HA 5LB2A 2ORWA 3B2EA 4W5HA 5JFGA 2QBYB 2XSZA 3QVVA 2P6UA 4E07A 5H1YA 4TQUS 1TUEA 1QHGA 1KDTA 3OHMA 2C95A 3QKTA 3TE6A 4M0LA 5B57C 4Q9JA 1HV8A 1DAEA 5SZHB 4TTQA 5FL7A 3IKJA 5HE9A 2QI9C 3VFDA 1ZC4A 2BOVA 2I1QA 2I1VB 4XD7A 1JBKA 3OIUA 2FH5B 2P6NA 1QRAA 1OIVA 3A4NA 3B6EA 4C2UA 3A37A 4EUNA 3LRPA 4DSNA 1WBDA 2FSGA 2OLJA 3F3YA 4HYYA 4ZCMA 4HB2A 3V4FA 2Z4RA 4LRWA 4PHGA 2XXAB 2QSZA 1Q1ZA 2XEXA 3FMIA 2ONJA 4UNRA 3Q8XB 2NO9A 2QPTA 4Q18A 2D06A 1XTKA 1D5CA 4XVUA 1U9IC 3B1ZA 4LK2A 3QF7A 5DIFA 1JQLB 2FOLA 3K70B 3EAQA 1LF5A 3I62A 2GXUA 1N5IA 2ZJZA 4TLBA 3MAAC 2B7BA 4IXMA 4BFWA 4A15A 1FX0B 4C7OB 2GZAA 4BRUA 2R2AA 2QORA 1IY1A 4IDQA 4Q1CA 1PZNA 1X1RA 1J90A 2VQSA 3IIJA 4HAWA 2PZGA 2O8FA 5TY0A 4B44A 4IHQA 3BB1A 4LY6A 5EE5B 2JJ8A 4UKDA 3FB4A 4TTPA 2RGAA 3WMEA 2JJ2D 3DHWC 3RS0A 4HAUA 4WVFA 3L8ZA 3REFA 3BXZA 4YLGA 4KYUA 5GVRA 5TXGA 4JVLA 4CIDA 4KFTA 5FPHA 2FA9A 4KBGA 4G3XA 4OQFA 4IVPA 4KVGA 4QXAA 4BLOA 4TL6A 4LZZA 4TYPA 5EE1A 5SZKB 3Q7QA 1TU4A 4PSKA 4Q19A 1TPZA 3K9LA 4HUQB 1M7HA 5BQ5A 1IQPA 3LBNA 1AGPA 5IHPA 5J4VA 3W5JA 2CCKA 1VMAA 3NBZC 2F3RA 2QG6A 4M1SA 1G3QA 2ZYUX 1OXTA 1XX6A 4DLUA 3DVLA 4GDFA 1Z22A 4Q1AA 2IYUA 2KB0A 3U44A 1IHUA 3AH8A 4KYIB 4F92B 2QQEA 2GJSA 3MLEA 4FMDB 3FHTA 1IN4A 1N5LA 2OFWA 2PT7A 1AZTA 3GEHA 1SZPA 3PUVA 2J7PD 2HCBA 3DOEA 3A6PC 2IBMA 3NBYC 4GOJA 4Q66C 3GEEA 3WY9A 3EX7C 1Z0AA 4JLJA 5KDLA 2YHSA 1QHIA 5TB5A 2PLFA 1YRAA 1ZRHA 3K0SA 1C1YA 1MT0A 3PXGA 4DB2A 3EASA 3QKUA 4Q4HA 4LHVA 4Q4JB 4PPFA 2CLSA 2DFTA 2ERYA 1DAGA 2GXQA 4A0FA 3I92A 1EG7A 3FHOA 3K0FB 1TAGA 1NG1A 3MWYW 4QGHA 1XTQA 4M53A 2KBEA 4P4UA 3DZ8A 3CR8A 2X19A 3A36A 3E1SA 2EFDB 2BJVA 5AJZA 1AS0A 2ZU0C 3BD9A 1SVMA 3K0CC 5BYJA 2N46A 2HJGA 3P26A 2ECKA 4EFMA 1R5NA 4TZ0A 2BHRA 4EPRA 1MR3F 1VIAA 3UXMA 1T5LA 4GSYA 3L8YA 1DAIA 3K70C 1FTSA 3T34A 1G7RA 1NN0A 1HUQA 4DVGA 1X8JA 4EPVA 4EQ6A 3E70C 4AG5A 2CHQA 3MGCA 1RYHA 2PX0A 3CF0A 1FZQA 5M04A 2H1LA 1FTNA 3KKNA 3I8SA 4P32A 1IN5A 2C9YA 4JVMA 1DO0A 2BBWA 2O0HA 5FOUA 5K8TA 3AVTA 4V0ME 1UKZA 2WAYA 4QJ4A 1J99A 3PEUA 4R98A 4ZO4A 4P4SB 4KAXA 1QZXA 3CX8A 3TUJC 2IYRA 3ZDQA 2IC5A 3V00A 4JT4A 5E7MA 4AWXA 1E3MA 1KK2A 2QP3A 2LWIA 2QAGA 3IHLA 3BERA 4TYYA 4DSOA 3RS7A 3QPVA 1ONBA 2YNMA 4HAZA 3VHLB 4PTLA 2GJAA 1EFCA 1VG9B 1KSFX 1MABB 1H8HD 1NSTA 4EJSA 5JHHB 4YDSA 3R9WA 1E79D 2QNRA 1NG9A 1IONA 1BMFA 4LJ8A 4DBLC 4WZBE 4JLOA 2VEDA 3THYB 1FOEB 2ZE8A 2YOGA 4HAXA 5G3YA 4MYHA 3NIBA 3U5ZB 1PJRA 2ZM5A 4RCYA 1M1YE 4V0LA 2ZI5A 2J1LA 4BFYA 4AK9A 3C15C 3SJBA 1XD2A 2N42A 3TSWA 1N0UA 4Q1EA 4AD8A 4WZAE 2W58A 5JWRA 1M7BA 1V5WA 2ORVA 3OFND 2YC4C 2ZRKA 1P72A 3GLHB 2ZRDA 2W6ID 3BK7A 1XF9A 3L0SA 1KSHA 5JSZA 2C98A 2J59A 1L4UA 3Q72A 3ADDA 5KDOA 5EXSA 4IOMA 3IGFA 3PUYA 3P20A 3SDZA 4IW3B 4TMKA 2AFHE 3GLIA 2IYWA 1RRGA 4OQXA 3V9PA 1DAFA 5CK5A 3WBKA 1WMSA 5JJIA 3KKQA 2EYUA 1ZCAA 4Q7JB 4NCNA 2MMCA 4OBEA 4Q4AB 4GFDA 2GEDA 4D4JA 3A58B 2J0VA 3ZVRA 4P3YA 5FOXA 3JVVA 5KHOC 1CKEA 4W9MC 3NDBB 5DGXA 3CRVA 5ELXA 3GJ4A 1P3JA 1JAHA 4TMTA 1X8LA 1S9HA 3UWKA 3TR5A 3DOFA 4AYXA 1Z63A 1E4VA 3MG9A 2BBTA 4RZUA 1NVUQ 1GM5A 5EE3A 3WRYC 3EZ2A 1N6NA 1RYFA
chains in the Genus database with same CATH superfamily
1OGJA 1GRVA 2ID9A 2VRWA 3D54D 1OQAA 2CGEA 3FTPA 3I6MA 3N2ZB 3QU5A 2SBTA 4QU8A 3T99A 4EF6A 4FQ7A 2FFBA 1POXA 4OQLA 5AMXA 3UHPA 1X9HA 5KU7A 4RFSB 1GOTA 2IXFA 1P0IA 2GBLC 3RQSA 4UTZA 1P5ZB 1HEYA 4KEAA 4J91A 4MWBA 4AQ7A 2C03A 2ODBA 1COZA 4O33A 5KX5A 1QOQB 1FUKA 2EGHA 3NLLA 4MSUA 4PLFA 1SBCA 1P5RA 2ZJ2A 5DBHX 4BO6A 1E9BA 1DBVO 4UDYX 4HQFA 3CKMA 1T36A 3GLFE 1GDDA 2QL6A 3HWRA 2JGMA 1SVSA 3P5SA 1JJAA 5KJ6A 1MQ8B 1VJTA 2WPNA 3WRVA 5JEDA 4ICIA 3BJIC 2IK8A 4R1UA 4PLYA 4TKUB 4CMCA 4C4YA 3SX4A 5BVHB 4UHFA 2LDBA 1L7QA 5JWOA 4XD2A 1QGDA 2G83A 3ENKA 3IDOA 4PM4A 1F8YA 4XKJA 5CM9C 3ZIAA 4D0SA 3CH5A 1VCNA 3W6UA 3WWOA 1SKYE 1CE8B 3H3XA 1L7OA 3AVQA 5EJ8A 1WJGA 1V8ZA 4YMIA 1YB6A 3T5GA 3CS3A 3VR5D 1FXWA 1LJUA 2XGOA 3SI7A 3ZWAA 4EIWA 4KTTE 2G1AA 4IIJF 1ZVMA 1ZICA 2PZMA 3DE7X 4YMWA 3M49A 5AW3A 1WG8A 1A5ZA 4LX8A 3KD3A 3ND5A 5E0KB 4E3WA 3E2PA 1EFVA 2H1IA 5C3MA 2GK4A 1P8JA 1Z18A 3Q6IA 3RAEC 1QUFA 2ZIWB 1ZIXA 1D8AA 3N58A 1TYZA 4HGQA 1UXHA 3SMQA 1IY0A 4RETA 3LX8A 1XPOA 2HU7A 3GAMA 2UUAB 4ROSA 3TVYA 1P2DA 2BKAA 1UPAA 1ST3A 4YFVA 4Z8YA 2D0IA 4H3SA 4GR5A 2Q46A 4JBLA 4AW9A 1D6SA 4QSHA 2FP3A 3C5WP 4FNMA 5EKDA 5JYCA 1ILEA 4PRZA 4CIVA 1RTKA 2PXHA 3RAGA 3G2NA 1Y6FA 2GHQA 1ZCBA 3LHFA 4IUDS 3R44A 2QL9A 2XBLA 1DIHA 3JCZA 4LYDA 5F5LA 4HK4A 3KJEA 1CUEA 2ERXA 2OZVA 3CSSA 2CNWD 1FTGA 1KTVA 3EGCA 4HDNA 4PR3A 3R5KA 2O7RA 5HK8A 2ORED 3SXUA 4A27A 1Z5UA 1C9JA 3VC1A 5E7IA 1UQRA 1IHYA 2JRLA 5A5FA 2EX1A 2C94A 3MINA 2XZOA 2GARA 1OI2A 1YRBA 4FTWA 4GUDA 3T4XA 4X65B 2VS1A 3W5AA 1JQJC 2BFNA 3N0RA 3L4JA 1QH0A 2XNCA 3TFWA 3UG6A 3DWEX 1QMGA 4Q93A 1NUTA 1LVGA 4UW9A 3C3BA 3BWVA 3WGGA 3AF1A 4HTFB 3JQ9A 3OEYA 2CJFA 5L40A 2CYAA 3E7WA 2OC9A 1YRLA 1B8OA 4HEJA 1ZD9A 3LZCA 2P5SA 1ZCJA 3FLEA 5JDIA 5F1KA 1XXHA 2AEJA 2ETVA 3LZ6A 9LDBA 4YMLA 5AW2A 4HZIA 2Q8NA 5D8DA 1JU3A 3ZGVA 1I4TD 2Y1EA 3FMVA 2HYDA 3B3QA 1ZD5A 5HUJA 4AS1A 2B8WA 3C1AA 2QX8A 4RK5A 5I7AA 4MRSA 3S2ZA 4E1VA 1B73A 2V4UA 4QBKA 5B4VA 2CLEB 4TRNA 2CBZA 1PNVA 2DBRA 2HSZA 4A2WA 3PXBA 2AV6A 3FDJA 5K01A 4QO7A 3FOFC 4Z4FA 4FLEA 3IKTA 4JVNA 3KHKA 3CEPB 3KCNA 5CM2Z 3ADBA 2GVZC 1IEQA 4UJ3A 4PG4A 4Z3DA 3C87A 1ULZA 4HI0E 4R5MA 3S7ZA 1FTWA 1W36C 1VG8A 3NW9A 4JL6A 3G13A 4Y9RA 1SQ0A 5AM5A 3X1ZA 4MWSA 4PHTA 1UBTS 4D4MA 4G5QA 3CA8A 2WDZA 1XVAA 3H8SA 5AK4A 421PA 3H2HA 4TTSA 2UXDB 4DFDA 4DNFA 3T4PA 1U9YA 4LDRA 2ZSDA 1IAQA 3HJFA 2BF7A 2NAFA 4XTRA 3IVGA 3MAJA 2WAXA 1T8WA 2GRUA 3HB9A 4RM2A 3F9CA 1V5EA 1JAZA 2C5EA 4GPTA 2WUWE 1V3VA 3QLVC 4NFHA 4BLWA 4C0XA 4D8TA 4IJQA 4ES6A 5LKAA 1G18A 1UJ4A 4KN8A 1LQTA 1E2PA 1KIFA 1S3GA 2BEKA 3BEDA 1NL3A 1P73A 2AK3A 4KDRA 5JDCC 5T4HA 3ELBA 5I3CA 4ZI3A 2CXSA 3EZ9A 3UY4A 3G85A 2XQJA 5BYAA 1FF9A 4IKPA 1N5MA 4WA7A 3V8EA 3VKVA 2RC6A 3EODA 3TIVA 4R9NA 1ENOA 3O3OB 1GZUA 5DHFA 3NKVA 1BS1A 1GAXA 2XMQA 3N05A 4COOA 4KQHA 2YRWA 2OBMA 4REQA 2TYSB 1JWBB 3PQ5A 2PYIA 5DYNA 4WK0B 1LDEA 1ORHA 2BZGA 2I6FA 5F21A 2VOJA 2G6BA 5ALEA 1GUFA 3PGKA 2R97A 3PR1A 4M83A 3KSMA 4TQGA 2FPOA 4G0UA 1WU8A 3VKHA 5IHXA 1A4XA 2OV6A 5TSDA 4HNVA 5DT9A 3JV7A 2I62A 4QULA 2IEIA 1FFXA 4YJGB 1PR1A 1XP5A 3CO0S 1XT6A 1S2LA 2BN4A 3IOEA 3PFNA 4IJWA 3OP1A 4Q9AA 2L0XA 4MEJA 1XZEA 1LI5A 3DDUA 5CNMA 2GJKA 2RGNA 2V03A 5JMWA 1TFRA 2JVJA 1OXXK 3H9CA 3C4QA 4RF5A 3PRHA 4RZHA 4DMRA 1CUFA 1WLYA 5CBPA 1EQUA 3HR8A 4KLRA 3FPKA 3GLQA 3RD5A 5LNK1 3F6YA 3WLTA 4HR7A 1U0BB 2C8LA 5JS8A 2C4MA 5AVRA 1BQ4A 3ND7A 3B3FA 2PFSA 3PQ8A 4YWJA 2YWEA 5HF5A 5KSPA 3GOQA 1PR4A 3HACA 4RVCA 4EKNB 4XZ3A 1S3SA 2AB0A 4X9XA 4PLGA 4RGQA 1YZ3A 1CJKC 2NT4A 3I45A 2R6DA 2NUPB 4N3NA 4NNOA 4PNPA 4Q3EA 4JZKA 5TJHA 2F8TA 3L4KA 2GXAA 5COQA 5FFFA 4UE6A 3LRTA 4AUMA 1OHHA 2A0UA 1L6IA 3HO6A 5EN4A 4ZDWA 3UM9A 5AKIA 1QNFA 2H59A 1RE1A 4G24A 1A9YA 2QF7A 5I4IA 2LDYA 2BGIA 2E87A 3F7MA 4G9GA 3WXMA 1ZOSA 2GFIA 4UMVA 1BGXT 4TLEA 4JNKA 4DM4A 4EY6A 3RTCA 1N8TA 2FZ4A 1H4VB 3PPXA 2NIPA 1EA7A 3IXMA 3CZ9A 3P0HA 1ZNZA 4U9HS 3DA8A 4O8CA 1T0PA 1Z0IA 2JDID 4EGSA 1RMYA 1P3DA 3EHEA 1HDCA 2ZBGA 2IP1A 3B82A 3HKBA 3IERA 1IQ0A 1E3TA 1A9XB 1QJ4A 1M7GA 1Y8CA 1ELOA 1F5SA 2J5RA 4LRUA 2I87A 4OSOA 3VDRA 3DLAA 4ZAXA 1HTTA 3HM2A 1A4UA 3LF2A 4LHSA 2PUVA 4NYIR 5K4AA 5DM70 2Q49A 3EDCA 1KEKA 1WEHA 5KIAA 4JI7B 3CIFA 4HDMB 2VFAA 4C0QC 2ENWA 3BC1A 3RJZA 2ZIFA 2RHOA 1S9DA 4PQGA 3F78A 4UNPA 1Z5ZA 5IZCC 1D0VA 5GAJA 3LT4A 4D26A 3ZEAA 3VYSB 1BDHA 3NHSA 3IIEA 3R7NA 2O5CA 5BSVA 4JYPA 1HT1E 4FE7A 1PRYA 5D5HA 1BW9B 2WF6A 4O3MA 4GQIA 3F9IA 1RS0A 2GETA 3VV3A 2P9EA 3E5MA 3EW9A 4FDAA 2G8LA 4CUJA 1C41A 1EK0A 4F4DA 2FK7A 1HLFA 5BO5A 1JU9A 4FDMA 2WP0A 2M1ZA 5A06A 1T4BA 4N4AA 1KYQA 1R0YA 1W0JA 4V24A 4PO8A 1T9BA 2IKQA 5CA1F 6LDHA 4WJKB 4DV4B 1O8BA 1HPLA 1BFKA 3QEOA 4YDHB 4EZIA 1N78A 1DOAA 3LLCA 3H84A 4RV5A 4V3CA 3NUGA 2IWHA 1G6HA 3JW8A 4JWTA 1E8MA 2LGJA 2X0NA 4LOIA 1QVVA 4GRIA 3W5UA 4FIZA 4XEUA 1SXJC 2F4NA 2ZULA 4AMZA 3Q88A 1RP1A 2C1XA 4L57A 4M2LA 4YFYA 1WE2A 3WX0A 2EDAA 3EEOA 1T1SA 4ZODA 4F2PA 4UVIA 3FI0A 3L0PA 1T4GA 3DFZA 4JC0A 3WWPA 2QGNA 3FH0A 5F7OA 2R65A 3K05A 3DEJA 2HX1A 3K0EA 1XFAA 2C4HA 4TMYA 1IXKA 2LVBA 5E1OA 4ANFA 5A3JA 1NBWB 1U63A 3DL2A 1XJCA 4FR0A 4U9UA 2P5YA 3L5KA 4MV0A 2NPIA 2QOEA 2QTAA 4RH1A 1KU6A 1VSVA 2X3YA 1XMJA 5NLLA 4XGKA 4C6RA 1IULA 3EEFA 3H9JA 1XO1A 4ZEWA 1RFGE 2DFDA 2ZI6A 4BGIA 4KG7A 1BN7A 1YZNA 3G6KA 4XQEA 3B7GA 1KWKA 2O2ZA 1GQYA 1XYGA 2P78A 3HGMA 2WVJA 3R7WA 5HPYB 3SJUA 3DEKA 3R6DA 3V3TA 4WKNA 1VL1A 2NO5A 2VF4X 2XOKA 4WCDA 5JXJA 4XFJA 5T4BA 2WG0A 2H8GA 1JAIA 2IXEA 3LXXA 1OR8A 2QK4A 5TS2A 3OQ1A 2CMGA 5CB8A 3KQLA 2NZYA 4LF9B 4ZAWA 5A7HA 4XPZA 1Q95A 6AT1A 1NULA 2YH2A 4LWPA 4RKRA 4PG5A 1QQ5A 4G0YA 3WNQA 5KQGA 4K9RA 1RZ3A 5C18A 1YI8A 1KZGB 3L41A 3PQCA 1JWLA 3UT6A 1AGRA 4QTXA 3JQ6A 3C24A 4B09A 3SZOA 4DMKA 1U0TA 3AEZA 1KDVA 3CKKA 3DAPA 2PXAA 4L3WA 4DR5B 1PN3A 2F17A 4YIKA 1YJ8A 1RWMA 1DAKA 3MWGA 1ZVQA 2ID8A 3O3MB 4HDSB 3R8FA 2PV0A 5BSRA 5LA6F 3CLUC 2C29D 1PT7A 2LW7A 4FYKA 4H4EA 4XVCA 3DW1X 4KMOA 2VHUA 3G7NA 1T3LA 4GOOD 4E03A 3K9FC 3GI1A 5TMDA 1YQQA 1EWQA 4HB3A 4P83A 3ELUA 1UQTA 5DP1A 3NWPA 2VQ3A 1VYUA 4G9BA 4V38A 5C46F 1P18A 2WIBA 1E9CA 3A4TA 2Q3BA 1GWNA 1YZQA 1W49A 2AXNA 3PBKA 2WYOA 2QBYA 5HJEA 1GTVA 3B6ZA 2DY1A 2F1OA 3UKDA 1R50A 2WWFA 5JCOC 4F46A 3HWSA 3STHA 3VR6D 2GO1A 4KLCA 3BF7A 4AJ1A 4D3XA 1NXQA 2OXFA 2C7VA 2P5TB 3SOZA 1BOFA 1MRSA 2ZAIA 1XLTA 1TC1A 3GL9A 4JVOA 1G55A 4YC7A 2YKGA 1AKYA 2AKAB 4URFA 2VK4A 3EYAA 4RZ3A 3I8XA 3PEFA 1P6XA 3SK0A 1ZUNB 2GAJA 2W83A 4KRXA 1GSIA 2DH5A 3QVTA 3ZNOA 4OBXA 1IE3A 5ALIA 1HRDA 2HZ7A 2NVUA 3WBFA 5JRZA 2Y76A 1YZLA 1N2CE 4A0GA 1L5SA 1S2DA 3PPYA 1EDEA 1Z5WA 4Z7OB 1GQRA 1BCRB 4IJ6A 2C77A 2NVWA 3O21A 4M49A 1FFEA 3E3NA 3U0VA 3B5IA 4YMVA 1RI5A 1C1XA 2BM9A 3QOYA 5EJGA 1KIAA 1J5XA 4R6XA 3QFFA 4J1SA 5G0VA 3PDJA 3DQQA 3KE9A 4EHKA 3FNEA 4Y2YA 3TTWA 5H82A 3ZLTA 3DUWA 4ZYWA 4HQ0A 2R751 2Q9CA 2R4TA 1BFUA 2B4AA 1E9DA 2HMVA 2X0JA 3UT0A 1BEUB 2FVYA 5EP4A 1GGKA 1G20B 3IPLA 5I5GA 2NMVA 3EXHC 1TJPB 3HYTA 3PFIA 1NQOA 2AOWA 2EU8A 3KEMA 1DKUA 5A6VA 4EEZA 1ZGJA 4AY6A 1DFHA 2CYCA 2Z5FA 3ZLBA 3RVQA 4CLDA 4YRGA 5INTA 3CPJB 4JXKA 3J80A 2ODEA 3G89A 1YKSA 2P4SA 4C7OA 4Q7MB 3HEMA 4IIDA 2AFRA 2QR2A 5GTDA 2O8EB 3REGA 1KU0A 4DZTA 4MWOA 1X70A 2HWWA 2JIOA 4HGZA 4QGFA 3WKAA 2RAPA 2O8DB 3ZQ6A 2GHTA 2WHQA 2Q4OA 3HJGA 3HCOA 2FGJA 3QVXA 3QX8A 3DMTC 4DABA 2MOKA 2DG2A 1SKQA 2RJOA 1L4HA 1U0NA 1JJ7A 5H4GA 1IPFA 3A3OA 3A7EA 3NHBA 3SR0A 1PL0A 1KFCB 4EGQA 2CKMA 3VPAA 3U09A 1A2BA 4OLBA 3RRZA 4K26A 4CIXA 2VJQA 5I5EA 4G23A 4ZREA 3A1VA 3AESB 1OF1A 1G9XA 4LI3X 1I1HA 3EUAA 1V5IA 4Z9YA 3UNXA 3DCJA 1VYHA 3F5FA 1ZCFA 2J4DA 3HJAA 3HUEA 1F8GA 4WN3A 1WAMA 1KK0A 4C7VA 3WGLA 2B2NA 2HV9A 2P9FA 2X8BA 1LS6A 4J6EA 4HYTA 1MX5A 2FCAA 4O4JF 1CULC 3TQQA 4IY1A 2TMDA 3MAGA 2X5KO 1B1AA 1XLWA 3IHTA 1HSZA 4TS9A 3TTXA 3GLKA 3MELA 3PFHA 3KKEA 3B6IA 4TSFD 5SY4A 2XE6A 4MMYB 4F1JA 5AOAA 4H16A 3QXCA 4ZQIA 1QO0A 2IDMA 2R1ZA 3B6KA 4BFUA 2OO3A 1NE2A 1PWYE 3OTIA 3M6WA 3ZHZA 1RSZA 1O77A 3CX7A 3Q85A 4O2AF 1E3SA 1M34E 1JHPA 3NALA 2ZRFA 2C2BA 4G5XA 1JIVA 4BZQA 4DCTA 4C3UA 1E60A 4KBFA 1WB6A 1MVLA 1GR0A 1ZOOA 3JVEA 3K9BA 1IOWA 5K03A 3BMOA 1AJEA 1JSXA 2J33A 2UZAA 3NEPX 2WHRA 1EXWA 3KTAB 4M98A 5EUQB 2D2EA 3I12A 2JJ1D 1NONA 5ENZA 1EUCB 1JHUA 1C4KA 3QIAA 5BSKA 5LP1A 8OHMA 5ALSA 1BS9A 1XFDA 2V54A 2PUHA 3TLMA 1II9A 1SCNE 2RHMA 4DQLA 1ZR4A 2LZ0A 1ITZA 1GA1A 3G82C 3IMEA 4PXSA 4C6SA 3LOUA 5FKJA 3KKMA 4ZTZB 4R1SA 4ZQCB 1DNPA 1TL7C 1EU1A 3JWGA 3ZJ5A 3FPFA 3O38A 2X1LA 3ZCXA 4Q4JA 1JEQB 3F1LA 3RK1A 4E33A 5BURA 1GPAA 1FW6A 5DNVA 1JVSA 1ZY2A 1MB0A 3DDOA 3QW4B 4IEFB 4WFQA 2OWEA 4B73A 2CVFA 4I5DA 1Z8NA 2ZJYA 1WCIB 2IFTA 3CEHA 3KX2A 4GP9A 1TA0A 4P7FA 4P35A 1RXWA 4QBFA 3V7WA 2ZIXA 5EIEA 2YS6A 4MKIA 1NBHA 3ERCA 3PTLA 1UMDA 1K5HA 1VIVA 2QAJA 5HBGA 4ND2A 2G0NA 5K8VA 3L1IA 4HX2A 2JRCA 3FKSA 3B6MA 5D7BA 3ZU4A 1T9KA 2JAUA 3WOHA 2G70A 5AW9A 5DM0A 1CEQA 4B33A 2H4HA 5F33A 4LJ4A 5BMOA 3I2JA 4MULA 3KOMA 5DHAA 2QENA 4MLCA 5JSUA 2M32A 3K16A 2Z5VA 5FPPA 1LZKA 4F6LA 1RZRD 2QRQA 2FFHA 4L9AA 2FB9A 1GQ2A 1SPXA 1NJFA 1JILA 5F9MA 1DQYA 5CA0B 4Q3BA 4IIVA 2I65A 5EGNA 4NXMB 4TMFA 2GEJA 1T1GA 1U2PA 3ZLJA 2C07A 2V7QA 3OKCA 1G21B 3RT7A 2AUTA 3L6CA 3TF5A 4U02A 1BAPA 1TVMA 2OAGA 4G0ZA 2O7QA 4NAHA 3A4MA 1Z17A 1MTZA 2YJ3A 4RELA 2OGUA 2NXNA 4BNMA 1GNPA 2QZ4A 3DO6A 2CZCA 3A32A 2NV6A 2A57A 3N2NA 4AJ4A 4BVFA 3A4IA 1UBHS 3KQWA 3DM5A 2QQFA 3KTFA 4Z53A 2OKCA 3DWIA 3UJ6A 2ZUBA 5EPUA 4AQDA 4D4LA 1JR3D 2VP2A 3PGA1 5JAOA 3ZE9A 5C4GB 1B0ZA 4U7DA 3ZK7A 5C37A 2CYBA 3K8QA 1KEEA 1X7GA 1XDWA 2CV2A 2H08A 1MG5A 3A9UA 3DPIA 3W78A 4I99A 3SICE 3U60B 3AONB 1Z2OX 1URPA 3H19A 1O89A 1ORRA 1RZVA 2HU5A 3HN7A 3DKKA 1PKEA 2CEAA 3K3PA 3MJDA 4TWAA 2BPOA 2P4QA 3TW8B 5E6UA 3CWCA 4K6FA 1JHVA 1JECA 1JKJB 1NUAA 1A9SA 2Q7XA 1SUIA 2X0IA 1CLUA 2YWJA 1S8FA 3PUXA 4LMBA 4Q37A 4RD1A 1JV2B 2XQFA 1IOZA 1CG6A 4FGZA 4NNJA 5AI0A 4YMGA 1TF2A 2HGZA 1KQFA 2BEUB 3RBVA 2FW6A 4DIDA 3SVZA 2F1HA 2IEBA 2Q2OA 1V71A 3JASB 1DC4A 3FLAA 3LUAA 3W2GA 4ZIRB 1O0SA 5C5IA 1RHKA 3OF5A 4F2WA 2BZSA 2ZI4A 3NIFB 4JODA 4AZ3A 4F8YA 4AUEA 5FUBA 4UARA 4BP8A 1TKRA 1EFDN 1Q3TA 4MAMA 4UM8B 4UUAA 2W6CX 4B0OA 2XWPA 1H1TA 4MV5A 3MOSA 4PBTA 4DEXA 3OSZA 5KS2A 4V0OA 3KS9A 5ENDA 2MSNA 3IJEB 2PO5A 1ZMXA 2V7TA 2XDQA 1R4ZA 1NXXA 3HG7A 1QS0A 4D3ZA 2J46A 1WV1A 2BGKA 1M6VA 2VDOB 1W9HA 3IURA 3VVBA 2FSHA 4P0QB 3ICOA 2ABWA 2NYRA 3I9OA 5G53C 1HOXA 3AHHA 5CVVA 5SZJA 4ETIA 5HR5A 5B58C 2AVNA 5KNCA 4E13A 3K9HA 2ZWMA 3NEYA 1YZFA 3GLIE 1LPAB 1KQGA 2JLRA 4HAVA 3BG5A 3ROFA 2BR5A 3MT8A 2NZWA 1SY7A 3AFNA 3CX6A 4I55F 1U8TA 4L1KA 4MQEA 2C0CA 3AZPA 4CHTA 2IHYA 2R8BA 3RVJA 3SKXA 4E1AA 1RQPA 3JQGB 3GLGB 1NSFA 4XR9A 3U7QA 1YONA 5DPMA 4N5HX 1V6CA 3RFVA 3ZZUA 1V16B 1FLDA 2D1TA 2ZZNA 1JQDA 3ISTA 3ZKWB 3DVSX 5JBNA 4EAQA 3KBBA 2PSJA 3UHOA 3H2YA 3CNBA 4ZAGA 1W0KA 3QF4A 3WMGA 4YP0A 4RVDA 3GAAA 1PYGA 4FYPA 1IB0A 2MHCA 4JP1A 4ZV7A 4CKCB 1P19A 2EL7A 4BLTA 1AD2A 1RKQA 2X8JA 4TWRA 3TJMA 3HEBA 3LYAA 4RA6A 4LV5B 3A2KA 1JR2A 2QRVB 4PRYA 5HFNA 1KSGA 4TUYB 4WOBA 4W1PA 3UV3A 4F3NA 3QPDA 3K1ZA 1CZLA 2QU7A 3N59A 2HKIA 1XI2A 5AP9A 2BHLA 4JI3B 5GJBA 2JJQA 2OYSA 3DL7A 3QU2A 4UAVA 4AIIA 5BN3A 4Q3NA 2E4AA 3VAZA 1I80A 1PS9A 2O4CA 4O08A 4D99A 3EK2A 4E7PA 5G3ZA 2J87A 2W43A 2WWVD 4NBKA 3C6ZA 2IHUA 3QUBA 1QQAA 1TTHA 3K1AB 2KBFA 3R4CA 4EVIA 1E2EA 1QYDA 2YIVX 4G1EB 5AI8A 1N6OA 4OFBA 2EQBA 2Z4SA 1MIOB 2XUDA 5F64A 3ZV3A 3CC8A 3VNAA 2WBLC 3GQBA 1NJ1A 2VF5X 3K5PA 1O6CA 4P3XA 5DXFA 1VJDA 2X4IA 1N1GA 2O3TA 2Q9AA 2XKJE 4LJ6A 1Q77A 4URHA 3TEMA 4GOMD 2Z95A 1OSNA 2PNJA 3NXSA 1AXGA 5L3SA 3H8VA 1MPTA 4X20B 3TS1A 2WIAA 1LDNA 1PD1A 1ENZA 4QL3A 3UT5A 5L7TA 1N34B 3T52A 1WPXA 3WGUA 5MHTA 4ZHQB 1QZ3A 2HSEA 1MX9A 5HG0A 1YVUA 1SC4A 2GNPA 3JD3A 3PKIA 2XCTB 1O94D 3K15A 5ELLA 5BR1A 5K3OA 4W5TA 5K0EA 4A91A 1YA4A 3IPXA 3PWTA 2FQXA 2DFNA 3SJAA 1A3CA 1E2LA 2WZBA 5HHTA 4OY3A 4GGOA 1KE2A 3Q8LA 4UM9B 1XQ1A 5C8YF 5IASA 2PUGA 3GT7A 3QXGA 4LEIA 2OGTA 3UUGA 5LOVB 5I7OA 3N76A 5JALA 2WOJA 5HM6A 5DCWA 3DKRA 2AYXA 4MUJA 4INZA 4ARBA 2Y71A 2JGKA 1SO8A 3QTTA 3OQ6A 4L9WA 2I3AA 1W48A 2WYWA 4PC2A 4WDQA 2JJ2A 1GG5A 3OFKA 4UEJA 3O73A 5B3AA 4B80A 4BZWA 2QRNA 1FFSA 4QPJC 4R1LA 3U40A 4AZ0B 1M6EX 1Q7GA 5AKYA 3EYWA 1YMVA 5FOQA 2ID7A 1WB9A 1QB7A 2I3DA 2GUWA 3EZ7A 1E8DA 3W5CA 3AHGA 3VBEA 2WJZB 5KVAA 4HQ6A 1ULSA 2PGJA 3FCSB 4FX5A 3OZBA 4KE6A 5ALZA 4D82A 4Z4QA 2CL0X 5LD2B 4YAOA 1Z39A 2ZKLA 4P3PA 1WXDA 2YY6A 3UV6A 1OLXA 4B84A 4AKSA 5BV2P 1X7WA 3N2KA 3WQBA 1Z4MA 5AW4A 1ACJA 3CV3A 5EESA 1KJNA 4JITA 3RBXA 2NTEA 4CDGA 4OU5A 5JFTA 3WGMA 5F3RA 5FEUA 3SPXA 4A8JA 4UAJA 4V0NA 1Y3BE 2YV2A 2UVDA 3BA1A 4UUBA 3K0AA 1DADA 4K9NA 4MARA 4RVOA 3H3JA 2YC2C 1AGXA 3BL6A 2R11A 2P8JA 3TAUA 4DC0A 1GG8A 1CR0A 3D4NA 1DJNA 1FNMA 4OHKA 1E69A 1P2UA 2P9JA 4OQ4A 3TQIA 4GG1A 2BJWA 2ZJFA 3K6SB 1XPJA 1NP7A 2RFLA 1ZNWA 3U4DA 1VLQA 3FE2A 1JDNA 1YUNA 1GQFA 2WKQA 2W37A 3I0NA 4HZGA 4Y2GA 2A3RA 1LSOA 4WT7A 4EGCB 3ZWXA 1C0IA 3IO5A 5JRDS 4LYGA 4DCVA 1KC3A 1PK7A 3UAVA 2QD4A 3OIVA 3B2NA 2PV7A 5A4JA 3AM1A 1KMCA 5JECA 2W7TA 1VHDA 4UCFA 1MENA 2R7KA 3CU5A 5K0BA 4KYVA 4KIFA 2IUYA 5JUWA 2H48A 2V97A 2PX4A 3DP7A 2VJDA 1TO2E 1EVQA 4JJGA 3TCKA 3CRMA 4ZVSA 4BECA 4A6EA 2WMNB 1CUXA 2NZ8A 4RXUA 2FN3A 1TVEA 3H1BA 1ZYUA 2JZOA 4CKWB 3RU2A 1E1YA 2NN3C 3BAZA 3D0OA 5F2NA 2CDRA 3HCDA 4JP8A 2XB9A 1N1EA 4RHCA 4BQNA 4DMCA 1N75A 2AK2A 4F96A 3FOEC 2A9OA 1L3BA 4NJEB 1SXGA 2HK6A 1KIMA 4MUMA 4B4VA 5I7RA 1YQWA 2JIMA 4CQNA 3FRJA 1XJ0A 1UWCA 1ONPA 5HS6A 1C2TA 1UPCA 2BKVA 2BZ1A 2VRBA 4OHBA 3RUEA 3ADKA 1IPEA 4G5OA 4LYEA 3AUTA 5GMOA 1E2DA 5L3QA 1EDDA 4D5GA 3DBOB 1KVQA 1M33A 5SYAA 1I13A 3M5DA 2P4HX 4R2LA 1D1QA 4E2ZA 3RS2A 3CLRD 4PLVA 5IC4A 1MJHA 3IEMA 4DLNA 5DU2A 3ZW9A 2PJZA 2BT4A 1NXOA 3MC1A 1XNGA 3WNDA 1O95D 2O1XA 2XF2A 1M5RA 1NN5A 3NHMA 1ZOLA 3JQAA 1FJ2A 1H8ED 5HZMA 3LV8A 4ER3A 3RABA 1JXAA 3UHFA 3WJ7A 3INNA 3BGSA 2IV2X 2Z1NA 4MUIA 2OO7A 4K1XA 1W5BA 2P65A 4BGVA 1EFLA 1ESEA 4NYJQ 3D6TB 2X3FA 4BMXA 1PVVA 3PJGA 1H8HA 2O2IA 3B7PA 1L9KA 3BL8A 4FFMA 4KJXA 4CG3A 3IE1A 1N4DA 3TSOA 3RANA 1UJMA 2V65A 3MWFA 3DZJA 1RWXA 1TM1E 3EMKA 3KR9A 3UWSA 3WISA 5BUQA 4M1MA 5JLJA 4HWRA 5F2EA 1QJCA 5IWAB 3THWA 1QWOA 3AM5A 5H9VA 1TD1A 1EMDA 1KR5A 2GPWA 4P4GA 1AKNA 4ECEA 3CF2A 3DE1X 1Q19A 4RY8A 4LRSB 1R37A 2I5PO 4XPIB 3U3OA 3LCJA 4NVRA 5JC1A 5LQUA 3KV3O 4IOJA 3MRTA 4YK7A 4CCYA 1RXVA 5LQAA 3GPBA 3HYRA 1JR3E 2Z9CA 1MRNA 3K8OE 4QODA 2QLTA 4KLNA 3UMVA 5KNBA 3F97A 4RORA 2ONCA 4G8JA 5CNKA 3WLFA 1MFPA 4Q9LA 2Z6VA 3TSCA 3LE8A 2I2XB 2GCIA 2INGX 3AFIA 2G7ZA 4UPVA 2VWPA 2W6IA 2AF3C 2GA8A 3GJYA 3OESA 4YR9A 3I9JA 2JK1A 3BS4A 1YOBA 3O8OA 2W42A 1PR2A 1HZJA 4GR4A 1K27A 1TQDA 4MHOA 4TTIA 4UC0A 4QFBA 1AY0A 2H2DA 3DQZA 3G0IA 2YFQA 2JGDB 1H2BA 2WG1A 3E22B 3I72A 4IEEA 4TV9B 5DI3B 3V7UA 3ZWVA 1M2VB 1B8PA 2VATA 4Y2JA 4NV1A 4BB9A 3PT9A 4WY5A 3P9IA 1W4BA 4YASA 3ZHVA 2JBHA 2MYPA 1OBVA 3A1DA 4WXRA 3TDKA 3RUDA 2XUIA 2ZUSA 2CXOA 3V4PB 4NNPA 3ZC3A 4UCXA 3CHYA 4F5EA 5BRAA 2EKZA 1VQ1A 1OZGA 3AOGA 1QV7A 4MQ4A 1QIGA 5A3RA 1EDBA 3TLGA 5TF4A 3U4CA 1X2BA 3EUEA 2ORIA 2CDBA 2HXYA 3ZWNA 3Q3CA 4EB8A 4EMBA 1F60A 2QHXA 4OQMA 2LUOA 3TJZA 3H13A 2D0DA 4WN9A 1NFRA 2DR3A 2PSEA 3P32A 5KHAA 3OE4A 3LX4A 5ILOA 2HTFA 3QWHA 3ZXXA 1KO1A 2XXAB 4H18A 5D5QA 4ZT5A 4C2TA 2R62A 5LDDC 3NHAA 3QHQA 4CNBA 4E6EA 1SVKA 1NI5A 1Z83A 3PUZA 1FY2A 1U8UA 4TQ9A 2H4FA 2KS6A 4FYJA 2F7SA 1UKVY 4FW9A 3GGJA 2GHRA 4HWPA 2AOVA 3M6VA 1T0JB 1V4BA 3TNDA 3WJ2A 3TNJA 5B36A 3NANA 2B8JA 4OF4A 3O74A 4NK5A 1S7GA 3OQHA 1ECPA 2E55A 2QRPA 3UMRA 3VDQA 3D6VA 4M9ZA 4RKYA 2A7XA 4K86A 4P2BA 2ZT5A 1XA0A 2B36A 2YVUA 1RM5A 1HNWB 1QDEA 3CN9A 3AJ9A 3I28A 3O95A 4QLOA 3B9QA 4ZMRA 1IHXA 2ZT6A 3U3DA 4OA8A 2E5LB 2DJ5A 4GPD1 5TPWB 3V1MA 3CMMA 5AW0A 1ML4A 4KC0A 2FFAA 4HH4A 2BGUA 5EE9A 1WKVA 1EWKA 1Y1SA 3UCEA 2C58A 1PDWA 5KJCA 2H2FA 3MYYA 1CRWG 5IVPA 1PZGA 4AXXA 5BMVB 2Z30A 3KJGA 2CNKA 4M86A 3U4AA 2XZPA 3AT1A 3VKUA 5F9FA 1QNLA 4GL4A 2R6CA 5AKHA 4F5WA 1GRQA 3O90A 5TPZA 4PO9A 3Q5EA 3L7KA 4D9JA 1TLFA 4JP3A 1A96A 1PJ2A 2EKBA 2GPSA 4KX3A 4ZCPA 4LZWA 4NU5A 1QP0A 4G5SA 2I6QA 1A1VA 5KTKA 5E6SB 5JXGA 1F2UA 5DULA 1FRZA 3D3QA 2EFYA 2YOHA 3H9EO 5JVDB 3OKPA 5H59A 2ATCA 1PG2A 2PGXA 4UM7A 3VNQA 4ASUA 4RTMA 4D4IA 2VT2A 4QOEA 4U0KA 2X1MA 3N0WA 3KEGA 4AG3A 4FWTA 4M88A 1FEZA 4YI3A 3ROZA 1HEUA 1UR5A 3ZWBA 1N6LA 1SGWA 3N6RA 4DV2B 3D43A 1DUIA 4BV9A 1FMTA 4LJLA 5HNKA 2OB2A 5A0FA 2J3EA 4GF5A 2ZUUA 3KZOA 4CL0A 3P4YA 4V03A 1Q74A 1R0WA 1SVUA 1CT9A 2HRZA 1U6IA 2X4LA 3E9NA 3A9RA 1FSSA 3IPCA 5DTEA 4B4DA 4B0PA 4EBBA 2N75A 5BWMA 2RHDA 3T35A 3LL4A 1U2ZA 4L74A 1RWBA 2AWNA 2RI6A 2VJLA 4PZYA 3SZRA 3VNBA 4DDUA 3KQPA 2JCXA 3R77A 5U1PA 3A2NA 4JYMA 3ZHUA 3E53A 4DLZA 3AIOA 3EY9A 4U2FA 5H02A 3ZIAD 1FP6A 3RIHA 1TEXA 5ED0A 3UFBA 4B34A 2RGEA 2EIHA 4RLSA 2ADMA 3EBLA 4MGIR 3U4HA 2YWFA 4MQLA 4MLDA 2EZUA 4XIYA 3C6MA 3F3MA 4ZI7B 4IUCS 2XCRB 3E03A 1I8TA 1I1OA 1PGQA 4BO5A 3RTAA 1D2NA 3ZZNA 3SXPA 2FVXA 1J24A 4X3OA 2FRDC 1YDEA 2MINB 4DKXA 3ANTA 3OJ0A 2ASEA 3P9PA 2VT7A 1HYQA 3GA0A 5KYUA 4NOMA 1LNQA 2ZG6A 3VUFA 5IAJA 3AY0A 3UWPA 5FTLA 5AM1A 2ACWA 4DG5A 2AWOA 2DWUA 5P8WA 1CD5A 2VT6A 1OYOA 3H8JA 4TL7A 3WFZA 3A26A 1GPWB 1T2UA 1YZVA 4LQLA 4U9IS 1NAHA 1E7MA 5B1YA 2BZ0A 5GINE 1OX4B 1FX0A 4HL6A 1KAGA 2DJIA 4N9QA 4FZRA 4BP3A 1U2GC 3JQ8B 4CMEC 3EJ6A 1NSYA 4F3KA 2EXXA 5L45A 4YQZA 4RGYA 5EXDA 2BTOA 1FP1D 1J70A 5GZ6A 3GJZA 4U2KA 1Z4NA 3KUUA 4YUWA 4J43A 2ET6A 1R0KA 2RBEA 5FUXA 3B51X 3GLSA 1U8CB 3M34A 1RD4A 5BQPA 3ZVKA 1DINA 4LXUA 4B7UA 3U6BA 2IP4A 1GIAA 3ASVA 3NTXA 4B17A 1RDFA 3FFAA 1PLKA 1P1KA 2ZUEA 3IUQA 4IDPA 1LI7A 2W6OA 3GEPA 1VL2A 1TM7E 1G9TA 3MSCA 4G4SP 1KYVA 3HO8A 4NSNA 4Q9IA 4YA6A 1S8NA 4YV1A 2RD2A 2WUFA 1G0NA 1G4HA 1TUIA 4A73A 2RKBA 1MIHA 3STTA 1OV4A 4ENRA 3O7MA 2GZ3A 4IGEA 4AN0A 1N6PA 1XDZA 1MX3A 4MRVA 2G4VA 3OF2A 4CCWA 5CLJA 3EPHA 2GKOA 4KVZA 2O5EA 1TTPB 4J1QA 5J2TA 2OZLB 1F06A 5FR2A 3C3DA 1HE1C 1WHTA 3WJAA 3X43A 2GJ9A 1A4RA 2VWGA 2WR8A 4JT2A 4B43A 3WQQA 4AIRA 4PSCA 3W77A 2AL7A 4UMEA 1YZHA 1HURA 4PNZA 1O9HA 4G5RA 5B3JC