2ZRNA

Msreca form iv
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
326
structure length
317
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 81
structure length 317
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrnA01
2KSQA 3AF3A 4BQSA 1WMSA 2R44A 2C9OA 4LHYA 1JB1A 4AYWA 4MGIR 1MO5A 3R7WB 1UKEA 4C4PA 3HDTA 4LK2A 3AVPA 5KPJA 3WYGA 4LJ5A 1SVMA 4TMXA 4Q9KA 3W6OA 2JDID 3EPJA 1E2KA 1OXVA 2F7SA 4M9SA 1JXMA 5FTMA 5IK2D 2WWXA 3L82B 1HY3A 2Q9AA 1X8JA 4DLZA 4R71A 4LJ8A 4BLOA 1UADA 2OLKA 1CP2A 1HTWA 5DH9A 1EWRA 5FPSA 1OH5A 1PVOA 4F4CA 3CH5A 1KDRA 1U94A 1P7CA 2X19A 1SXJE 4IW3B 3B9PA 4V0OA 1AQUA 4DXAA 1KI8A 4M22A 3IGFA 2LWIA 2JLYA 4FINA 2AWNA 2C04A 4AD8A 3EIHA 2F6RA 1SXJB 2VHUA 3OESA 4XWAA 1CR0A 2RHMA 4OQXA 1KSGA 2G88A 3BFXA 3ETLA 821PA 2VA8A 2FMXA 3THWA 5FUXA 4TMKA 1W4CA 3WXMA 4NYJR 5KUTA 2EFDB 2CL6X 1DG1G 1GIAA 2WSSD 2ZRIA 1G17A 2OFOA 1DAIA 1X3SA 3MJRA 2QQEA 3AVUA 2GVDC 2I3BA 2ZS7A 4CT4B 1KGDA 1DAHA 2BV3A 2ZS8A 2OUKA 3UWOA 5JLJA 4JLNA 3QOFA 1W49A 1Q57A 4D4KA 1NNEA 3ZIAA 3KX2A 2ZJ5A 3CZPA 1N0WA 3QXSA 3NDPA 2ZVQX 3AGPA 3THXA 2ZE6A 1YVDA 1W2HA 2C78A 4FMCF 1FUUA 2VF8A 2YJTD 2O8DA 1G6HA 1WXQA 2CHQA 1WQ1R 4KODA 2H5EA 1P2TA 1RRGA 2FJUA 4MKGA 1HURA 4AURA 2IYYA 3GLHE 4PX9A 3RS3A 3AVTA 1L2TA 4C0KA 4NYMQ 4PC1A 2G3YA 2IK8A 4I1VA 4F7WA 1GNRA 3T34A 5IHPA 3GJ0A 1NSFA 4M0LA 2IS6A 1U9IC 2QSZA 4WOPA 4URYR 1W36D 3GLHB 3WNCA 2IL1A 4Q4HB 2RGCA 4FCWA 4C0HA 3K0AA 2R9VA 1WB9A 3GD7A 2F1RA 5HR5A 3OAAD 4D6PA 3A1SA 1E99A 2QMEA 4FWIB 4Q03A 1GUAA 1XMSA 1IQPA 2GEUA 3RC3A 5E3HA 4L16A 3VX4A 2PBRA 2R6GA 1G19A 2FFQA 3GFTA 2J1LA 3PUVA 2ZRDA 3IIMA 4JLAA 3MCAA 4M1YA 4DUGA 1F2TA 4TZ6A 5J4KA 1HV8A 2V7QD 1ZD8A 1N0VC 4DDTA 1L4UA 2HJVA 2PMKA 2WJYA 3SYNA 5KTYA 5EXTA 4QGAA 4A6XA 2V8OA 4QM7A 221PA 1OIXA 4I1OA 4JSTA 5FOXA 3I61A 1X1RA 3DKVA 2IBMA 4IEEA 4FWTA 2RGBA 2RH5A 5FBQB 4JBXA 2CNWA 1N5JA 4QBHA 3RVBA 3SN6A 4B3DA 4XVUA 2JIZD 2XNSA 4JVMA 1GNQA 2ZI4A 4TL6A 1NIPA 2GK7A 4YMVA 1VYVA 1ODFA 2AL7A 4BPBA 1CKEA 1DG3A 1PLJA 3A1WA 1Z06A 4AIIA 2FZLA 4XH9B 1NVUQ 1H8HA 1KSJA 4JVLA 4A92A 1JEEA 2H1LA 4PTLA 4RKFA 4IDPA 2MSCB 5JCZA 4U7DA 1A2BA 1ZCBA 4TL7A 4A0GA 4DRZA 1S9HA 4B34A 3L0IB 3SJCA 4JS0A 2EQBA 5TMPA 4Y0AA 1EWQA 1S96A 1NVWQ 4WBSA 4P0TA 3FFAA 3IKJA 3EG5A 4PPQA 2OO7A 3EPKA 2AKYA 3K0CA 2JLSA 2GRJA 2AKAB 4TMZA 1G8FA 1YJ5A 3SQWA 3TH5A 5K8TA 2UKDA 1UBFA 3RWOA 3THWB 1E96A 5FBRB 4PC2A 4XIGS 1E1RD 1HEIA 4US2R 4TMVA 3ADBA 3H0KA 2IYXA 2W6IA 1OE0A 4XWKA 3SS8A 3IO5A 4CW7A 4DHEA 1T5LA 1I2MA 2CMKA 1N5KA 1MKYA 3DM5A 3PIRA 3QBTA 3DOEA 4IDHA 4M1SA 3U3RA 4EUNA 2GXAA 4D25A 4NYMR 1ZYUA 2CE2X 3I32A 4BFXA 3W90A 3BORA 4MRRA 2IYTA 4Q1AA 3THXB 3E1SA 3RWMB 1DBSA 2Q9BA 1EGAA 1PUJA 3OIWA 5FPTA 1DAMA 1WBDA 2O8DB 3PUWA 4Q02A 3RRZA 5HZHA 2V1XA 1M7BA 3THOA 4JJZA 3QNUA 1Z47A 1FL9A 2ANCA 3DEFA 3BH7A 1PJRA 2N1BA 3AUXA 3LLMA 4HUTA 4EKDA 5B64A 3U61B 3FHCB 2QL6A 1XRJA 4N1AA 1TEVA 1G7TA 2ERYA 4MRSA 2Q0HA 3SR0A 4GI7A 1Z0FA 2IYLD 2GZHA 1JXOA 2ZE5A 3CR8A 4LYJA 3H1TA 4YXWD 4I1SA 4BLSA 2DWQA 3O8DA 4F92B 3ZD6A 1FQKA 2XZPA 4C2TA 2BM0A 3AH8A 2QENA 2V54A 3K0AB 3WBKA 4Q5IA 1XTIA 5FBVB 1TF7A 1NBMD 4ZPXA 2VL7A 3RNLA 5JSZA 4W7SA 4QXAA 5FR2A 2VO1A 4LY6A 1KI6A 2XB2A 1N6NA 4G0NA 3VU9A 4LGMA 1RYFA 4LBWA 2YNMA 3SFVA 3C16C 1G8YA 1OB2A 1MABA 4GSYA 1RZ3A 2JJ8A 3EXAA 3U7EB 2J7PD 3VR6A 1F2TB 2ATXA 2QSYA 5EXPA 3C14C 5DN6D 3LX5A 5LPNA 1A1VA 4DLTA 5JWRA 3EA0A 5EQTA 2XAUA 4PZLA 3L0SA 5TARA 3SBEA 3OIYA 3UMSA 2ZEJA 2RKOA 1MO6A 1Z8FA 4K46A 2FOLA 2XZOA 3O8BA 2ZJBA 4C7OA 2J45A 3LW7A 2WM9B 1IHUA 1U0JA 2C2HA 2AD1A 4IDOA 1G5RA 1A2KC 2FEMA 1G3RA 3DKPA 3QKUA 2XB4A 3L8ZA 4OJKA 3WMEA 2X1VA 4QOSA 1U8ZA 4PSAA 1E1QD 4US1R 4RCZA 1HT2E 3CRQA 3REGA 1II9A 5ELXA 5CYPA 4DSUA 5B58C 1XEFA 5BXQC 2PCLA 2ZRGA 5JCPA 1XPUA 3I73A 2A5FA 1EK0A 4DT1A 1COWD 4Q4JA 1II8B 4AKEA 4BFTA 4Y0VA 2Z5FA 2ZJZA 3PJRA 5EP4A 4LPKA 2GJ8A 5KSZA 3A37A 4TQ9A 3I8SA 1L4YA 4URUR 1TPZA 4Q19A 3BAFA 3K0EA 2O8CA 3QEOA 1OSNA 1SVKA 2XJ4A 4PANA 3I3SR 2WZQA 3AB3A 2F55A 4JLOA 4CEHB 1E3MA 1IXRC 2BMJA 4E07A 1XNJA 1YZLA 3OHMA 1HYQA 1T3LA 1D6JA 1NI3A 2VP9A 5J4VA 2NO1A 2R8RA 1XFAA 4MRNA 3TAHA 3C7KA 1Z83A 2D74A 2GNOA 3I8XA 4YMTA 5J4LA 3ICEA 4PHTA 1E9SA 3O8CA 4BZPA 4QKQA 2P3SA 3I4LA 4Z8XA 3PITA 1D9ZA 3Q72A 2C9CA 2JDIA 4HAZA 4LC1A 4TT3D 5LB4A 5JHGB 5IK2A 1ZNXA 2GILA 1LFDB 2KE5A 1XWIA 4IDQA 3BC1A 2QP3A 5CM8B 1VECA 2YC2C 1G3QA 4R2HA 1NLYA 5DHFA 5EE9A 3PEWA 2FF7A 1D2MA 2OXCA 4UJ3A 2CHGA 2PLFA 2NO6A 4YQFA 4QGGA 1KDPA 3NKVA 1X6VA 1OHHD 3SFZA 3EW9A 4YMWA 2J7KA 2AK3A 1Z2AA 3IQXA 3TUZC 3DZ8A 4K8OA 1M1YE 4A0RA 4BFUA 1GL6A 1JPJA 3FTQA 2FFBA 2NO0A 3AKDA 3MG9A 4BLTA 3PEYA 1Z0IA 5AUNB 1UPTA 3BH0A 1N6PA 1ZC3A 1KOFA 2CL0X 2WSSA 3GEHA 1CBUA 4PAQA 4U5XA 5FPHA 5JSZB 1KO5A 2FPMA 1KI6B 2B8TA 2Q9CA 1ELOA 3GJ4A 5H1YA 4DB2A 3VU9B 5HPYB 1OW3B 4MGYR 1P62B 1IAQA 1ZMXA 1E9RA 5AUOB 4MUAA 4AC9A 4URWR 2O5VA 4HB0A 3KKQA 4LJAA 1J2JA 4E22A 4GRAA 3I5YA 1NLFA 1XEXA 3HU2A 4G1UC 1GVNB 1LF5A 4DC9A 3FOZA 1HUQA 2P5TB 2UZIR 4N0EA 4Q7JB 4C7OB 2KBFA 1P61B 2NIPA 2ZI5A 4G5RA 3LY5A 2B21A 1Z08A 1KK3A 2NQ2C 1XB2A 2BHRA 3WNDA 2FU5C 2I1QA 1XZPA 5BYJA 3OAAA 1P6XA 1ZNWA 4MKHA 4BFYA 1XD2A 3ONWA 4RD3A 2XGJA 1OYWA 2FSFA 1R0XA 4DT1B 2IHBA 1S3GA 4HEJA 1YE8A 4BFZA 4DWJA 4HLDA 2QZ4A 1G7SA 1ZBDA 1P3JA 2ORVA 1QBKC 3O47A 2V7QA 2O8CB 3V4FA 3CWQA 3CPJB 1NVXQ 1Z6TA 3QXXA 3P4XA 1SZPA 4PPGA 3E2IA 4WIAA 1IM2A 4LPSA 3QVVA 3MWKA 4D0LB 4M8NE 3KB2A 1DTSA 1NVVR 5CB6A 1UFQA 4LJYA 4LZZA 1W4RA 4RFSA 3SI7A 3B1XA 1E2FA 4KFSA 4NYIR 2IF0A 2OBLA 4JVSB 2QAJA 2ZJ2A 1N5IA 3IIJA 2EU8A 2GCOB 3AKCA 2JIZA 3Q3JB 1Z0DA 4YC7A 2HYIC 1JJ7A 4B3BA 3F8TA 1T5IA 2QEQA 3KTAA 1E9EA 4B2PA 2WBLC 1J7KA 4PHGA 1R5BA 3FDIA 4CVNA 4QFMA 5AJYA 3TVTA 4DDWA 2J0VA 3C5CA 5FBWB 1WDTA 1XCGB 3EZ9A 4W5WA 3RAPR 4HI0E 3VTKA 4CDGA 4KXFB 4OBEA 1KY2A 4HZUB 3DPUA 1KI2A 5FI0B 4QRHA 1OYYA 5IDVA 5KDOA 4LDJA 4M4SA 4FW9A 2OILA 2QI9C 1DE0A 4ITRC 3KUCA 2QMHA 5E4FA 2RGDA 4GZMA 4A15A 1Z6GA 1E1RA 4D26A 3PV0A 1ESMA 4FN5A 2OZEA 1XU4A 1UM8A 2IYRA 1GNPA 4RD4A 1W4AA 1E9AA 5TXGA 1E2EA 2OFXA 2XITA 2P0EA 1YR9A 3HYRA 3U5ZB 1CRPA 2IX3A 2ZJOA 4IXNA 3KFVA 3GP8A 4QGFA 3K0CC 5G3ZA 4ARZA 4B3FX 2DR3A 2AFIE 421PA 5KU1A 4DDUA 3TSOA 1XEXB 3OEED 3IDQA 2NTYC 4I1UA 1ZU4A 4URVR 1DPFA 2E9SA 2XJ9A 3ZD7A 3LA6A 3UXMA 2GAAA 3OFND 1YR6A 1R0YA 2G83A 4KAXA 3QEJA 5DYIA 3WYAA 3NC0C 4YXWA 3B2EA 1KI1A 3PUZA 2DY1A 4Q7MB 3CNNA 1VG0B 1IJEA 1W0JD 2A5DA 3PEUA 4G5SA 4JMPA 4B35A 2ZRBA 5M04A 1XD2B 3M6AA 1G7RA 1AA3A 3GJ7A 3L43A 4GFDA 4LBYA 3QXJA 4QM6A 1J8YF 5E7IA 2JLUA 4IXMA 3BB1A 2ZSAA 5EP3A 3SHWA 4D4JA 4DCSA 2KBEA 2J7PA 5D3MA 1FFHA 4BFVA 1G41A 2NG1A 4IRUB 5SZJA 4B32A 1ZJ6A 5DN6A 4TLEA 1YRBA 2CK3D 4ZCLA 2ODEA 3X1YA 1G4AE 4PO9A 2C77A 3ZZTA 3KKOA 5FI1B 4HAXA 3BH6A 3QPVA 1EXMA 4CEIA 5HTKA 4BUJA 1G4UR 1R4AA 1GZSA 3MSXA 4RFSB 2FFAA 1XMJA 2QROA 2WVJA 2P6UA 3HYTA 2VP6A 4A2QA 4Z51A 2OV2A 2QAGC 4M21A 4TLCA 1CULC 1RVDA 4TZ0A 3A6PC 2D2EA 2VH5R 1TX4B 2WJVA 5KSPA 1WRBA 1G18A 1WF3A 3WRYC 4H1UA 4LSGA 3KTAB 2YWFA 4IKEA 4DEXA 2A3RA 5FUYA 1AZSC 4D0NA 1ZM2A 1AS2A 1COWA 1KDOA 2C03A 1G1MA 4I4LA 4XTCS 2J41A 2QP4A 2NPIA 4JKIA 3PQCA 1OV4A 4NONA 2J5XA 2ZITA 3KXLA 3LBNA 2OG2A 3FMIA 3QQ5A 3TR5A 1D8TA 1U98A 3IHWA 2QU8A 1A7JA 3AEZA 3BWDD 1CS4C 2LKDA 2ASEA 2AXPA 4CYMA 1M6NA 3KKNA 1NJGA 4TWZA 4BEJA 2NZJA 1W5SA 2CLCX 4QJ4A 2BC9A 3T5GA 1AGRA 1IY1A 3VMFA 5FUVA 1P9WA 1M7GA 2Q3MA 2VRWA 1TUEA 2J0UA 2ZIAA 3EARA 3LO5A 3SZRA 1IOZA 1MRSA 2HT1A 2R6DA 3R9WA 3ZQ6A 2QN6A 1YHNA 3ADDA 3ZYCA 521PA 4RSGA 1AM4D 4TT3A 4XOIA 3NBFA 1V43A 4AWXA 5FR1A 2JASA 3CONA 3K0FA 2CCKA 5JS8A 3TR0A 4LUCA 3F0TA 1X8LA 1MO3A 1XEWY 3TK1A 4HB4A 4KO8A 4G5GA 1S4QA 4P3YA 2IHYA 5KO2A 1W7AA 1K5GA 4QHYA 1FPMA 5DIFA 1OHHA 3CRVA 3RRMA 4KFTA 1NP6A 1GRNA 3RRYA 1ZU5A 3PEVA 1E9FA 1QHNA 2G1JA 2V9PA 2VHQA 1XXHA 4YDHB 1QDEA 5JRZA 3B6EA 4IFEA 4MA4A 3EIQA 2BBSA 5KSYA 1N6KA 3IPYA 1YU9A 1KIMA 3RS7A 1E9DA 4YONB 5FOSA 2NO7A 3VR5A 2FH5B 1X86B 1Z22A 1DAGA 4OQMA 2ZM5A 4Q7LA 1AS0A 2OHFA 1KMHA 3HP1A 3AVVA 2BKUA 4IJMA 2IUSA 4NBSA 5DLQC 2UZ3A 2WOJA 1TF5A 4PO1A 1ZVQA 5D3MB 5TY0A 1U8YA 2WIBA 4GPTA 2REBA 4W5JA 3TAUA 5L3QB 4L9SA 3KKMA 3OE7D 1B23P 3B60A 3KJGA 4MYTA 5FTJA 5FH9A 4L15A 3IBYA 3LBIA 2CCJA 4NKRA 1RRCA 2JEOA 2D2FA 3CX6A 3G5UA 2DHRA 1XJQA 2IWHA 1VPLA 3EWAA 2PL3A 1GITA 1I2DA 5J47A 2FG5A 2XZLA 1J8MF 4KVGA 2P6RA 3T1QA 1ZNYA 3ZZUA 5LDDC 4TYPA 1P2SA 4V02A 4XSGA 4OQNA 2F1IA 1KHTA 3FFBA 3L2OB 4O3MA 2P6NA 1QZXA 1E0KA 1YZTA 1RW4A 1J90A 2GK6A 2ZYWX 3NHBA 5FL3A 2DFTA 2C9YA 1G3MA 4DVGA 3K70D 3QXCA 3RYTC 3UPUA 3LFUA 2O8EB 5G40A 4DKXA 3CR7A 4JYCA 3EZFA 2H7VA 4X8OA 4DCUA 1BO6A 5EE3A 1R0WA 3WY9A 1ZM7A 1R8SA 2BBWA 2IXFA 2VPPA 3M4YA 4QC2A 4D4LA 2KWIA 3QIAA 5EE1A 2ATVA 2DFLA 2BKEA 4LHWA 1G20E 3SOPA 1OIVA 4WZAE 1W36C 1JAHA 2PMDA 3TSWA 3K1JA 1EFTA 4Q66C 4FIDA 5JFGA 1GL7A 5CDFE 4V0MA 2QQ0A 4L9WA 2HXSA 1PUIA 1Q3TA 4Q1FA 2J0UB 5C4MA 2O0KA 2WWWA 4FMBB 3GPLA 4JYBA 4NDZA 3U3JA 2XTZA 4B6EA 5IF9A 4CEJB 3IHLA 2XEXA 5J5CA 2W0MA 1IY2A 5SZKB 4KBGA 1T4GA 1OB5A 1NN5A 2YV5A 4JLJA 2FGKA 3NBZC 4TTPA 1P73A 2Z83A 3DMDA 2OLJA 3CF2A 2FFHA 5JEEA 1KTVA 4FCVA 1SGWA 1XJCA 3OEHD 3VKHA 1O3YA 2WWFA 1SVWA 1UF9A 1GL9B 4B48A 1XXHE 4R2IA 4CT5A 5AJZA 3RSOA 4C0JA 2IWRA 5B30A 2GZDA 2PT7A 3OZXA 1P9RA 1XTSA 5KDLA 2HCJB 4QNMA 4AG6A 2FPLA 1XXHB 2EWWA 4E09A 4UKDA 4DSNA 5UKDA 4PSVA 1DELA 1Q1ZA 3HJNA 5CK5A 4V03A 3QKTA 3KXKA 1VHTA 4OK6A 4DIEA 3WP0A 1Z29A 1S3SA 1OFHA 1KKMA 2ZREA 2QBYA 1KK2A 4AK9A 4ILEA 2GKSA 1OH8A 3WHLA 4PHHA 2QTHA 1LV7A 2Z4RA 4ZI2A 1FUKA 1NY5A 1VIYA 1KMHB 1RRPA 3GJXC 2PLRA 2GJKA 1R8QA 3AVWA 1FNMA 2CHVA 4ERNA 1KDTA 3Q8XB 4IFBA 4P33A 4JT2A 1AS3A 1UEJA 3OEEA 4A8JA 2XOKD 3FKSD 3QF7A 2P2LA 5J4HA 1E2DA 4NCIA 1TQ6A 5G53C 3ZGXA 4PQRA 5E7MA 1E98A 4F91B 3OFNA 3TNFA 2D7DA 3CRRA 1BIFA 3K9GA 2CVHA 5FL7D 1TU3A 3W6PA 1R5NA 2N42A 2W6JD 1P2UA 1G21E 2EVWX 1GG2A 5LB2A 3EASA 3TUJC 1TF2A 1VCNA 2QTVB 4QBGB 1KZGB 1U99A 3GJ3A 4P4TA 2GCNA 2R6FA 1WCV1 1P4SA 1W0JA 2AN9A 2I1VB 1L8QA 1RIFA 3DHWC 4WVFA 4DJTA 4GOJA 4XSHA 4ZI3A 2HYDA 3C8UA 5BW8A 2XX3A 1G5TA 2IYZA 3TQCA 3TVDA 1I4TD 5HCIA 1G16A 2BIFA 1RJ9A 4PO8A 3VR3A 4AYTA 4BWYA 2J46A 2GZAA 4LBVA 4XVRA 3CRW1 1JPNA 2B7BA 3L8YA 3NIBA 4B74A 4JBYA 2WMNB 2PZFA 4IOJA 2W2TA 4P32A 5P21A 3N5CA 2CK3A 1AKYA 2FSIA 3FYHA 3QF4A 1TTTA 1GKYA 1OIWA 1T8TA 1G64A 4D80A 2RHDA 1QHYA 5TDHA 2GESA 2VTKA 3DOFA 2BMFA 3L0PA 1GP2A 4JIMA 2NOAA 4F4JA 1FP7A 2BCGY 2ZUCA 2O0JA 2WIAA 1FMJA 2RGGA 3AVOA 4ZDIA 4Z1MD 3KZ1E 1DAEA 2EFCB 3REFA 3NXSA 1B0UA 3K8YA 3CPHA 1W0KD 1BS1A 1KK1A 1C9KA 1ZNZA 3JVUA 4D2IA 2BOVA 2VEDA 3CIOA 1F2UA 3MAAC 2QAGA 1S0UA 2OAQ1 4CZ2A 4MH0R 3B78A 3V9PA 2PZEA 2IC5A 4KHZA 4ESHA 1G6OA 5DSZA 1E0JA 2CE7A 4LYFA 3X1WA 3P32A 2ECKA 1G3UA 2IYSA 1E4YA 3NC1C 1A5TA 3BJIC 1X8KA 1QG4A 1TU4A 1XZQA 4JSYA 2D7CA 1OT3A 3GEIA 3IPXA 5AJWA 1IXZA 1NKSA 5IRCD 5K8IA 3T15A 1QHGA 2YC4C 3FWYA 5L3RA 3TW8B 2VHTA 4TTRA 5GVSA 2F3TA 4EPRA 1NN1A 3K9NA 4QL3A 1KO8A 3RHFA 2B8WA 2X2FA 2A78A 1Q44A 3T1VA 3PG5A 2O52A 1RRFA 5LD2C 1Q1EA 4BRUA 2QBYB 3T5DA 1JQLB 1PV4A 2BMEA 5CJPA 1MR3F 3AUYA 2ZRNA 1K8RA 1QHHA 2P5SA 3SNHA 1WP9A 3GJ5A 3TRFA 4BASA 3MJHA 2G0TA 2GXQA 4DSOA 2RMKA 2ZSBA 1AQYA 2ZANA 1BMFD 3EX7C 1N6OA 4R7ZA 3U6KA 2CEAA 5JJKA 2A5YB 2P65A 2GEVA 4A8JB 4RZ2A 4P4SA 1Z07A 2J0QA 2TMKA 4C0SA 2J9RA 2DB3A 1P2VA 4EPYA 3ND8A 1G8HA 1H8ED 1XTRA 4ZIRA 5C46F 2VSXA 4HSEA 1OXXK 2EYUA 4JL6A 1RYHA 1UKYA 4E5UA 3DDCA 1KI4A 3AV0B 3QKRA 4HDQB 4KFUA 1VYTA 3KJHA 1MOZA 5IT5A 2ZAMA 5A4JA 2R2AA 1ZIPA 2CXXA 4Q01A 3HU3A 1JR3D 4L8GA 4LV8B 4PQYA 1FQJA 4ACBA 1E79D 4GBMA 4LCBA 3KL4A 3ZS9A 5TV2A 3K53A 4DLWA 5JWHA 1EFUA 1TADA 4HUQA 4TYQA 2QM8A 2ZR9A 4UJ5A 2JJ1D 1RJ9B 2EFGA 4LOAA 2QORA 3LX8A 2YVUA 4ZDJA 3OE7A 4XTRA 1QHXA 2E87A 3NH9A 5HE9A 1ESNA 1LS1A 1QRAA 3PVSA 2ZYUX 1KO1A 1U2RA 3QF4B 2QPTA 3TJZA 4A2PA 2LCFA 1E94E 5CB8A 4TMTA 5KNCA 4XD7D 2D3WA 2VYFA 2Q6TA 4DLSA 4KV9A 3QG5A 2NGRA 1R0ZA 4NCHA 3PUYA 4M2LA 4LJ7A 2IYWA 4BZXA 2ZU0C 4OI4A 4V0KA 4RY2A 3LDAA 3TGPA 2QG6A 4ON9A 5BWMA 3U7HB 2IUTA 4F38A 3HPRA 4OQFA 1IN6A 2WAYA 1QF9A 1VMAA 1MABB 1W44A 4HATA 2D06A 1F2UB 5J40A 2IEYA 2QAGB 4ZKDA 5F9HA 1E2HA 2AR7A 1EX7A 1W2GA 2WWIA 1Z28A 1HA3A 4NCNA 4Q1EA 3UG7A 2CCGA 4GZLA 1K6MA 121PA 5CIQA 3AF0A 3RS4A 1AJEA 1RC8A 3D31A 1SKQA 1E2JA 4OKSA 5CJ2A 1YZNA 4BECA 1P9NA 4TQUS 4NHOA 4PAOA 3Q9LA 1S9DA 1QG2A 5EE5B 4XVQA 3D6TB 4F93B 3THYA 1JJVA 5FOUA 3BRWD 1ZM3A 2JAQA 5K8UA 3QPWA 1CR4A 2HLDD 3AF2A 3QY0A 1XPOA 1F48A 1TEXA 3D7MA 3SYKA 4B2IA 2GJSA 1YRAA 3AKYA 3B1VA 3HU1A 1T3HA 3SU8A 4EQ6A 3AF4A 3BXZA 4MYUA 4Q4JB 1E2QA 4CGZA 5AWFC 4R9UC 3IIKA 1G8PA 1QHHB 1VCMA 1A4RA 3K09C 4NPHA 3FMPB 2IF2A 3QUSA 1E2IA 2ZUDA 4QHSA 1UJ2A 1KMQA 4UQOA 3OEHA 3KJIA 2ONKA 4WW0A 2QP9X 4RJLA 2AWOA 1XMIA 3A4NA 3PXGA 4A6PA 4AG5A 3ECCA 5DISB 1AN0A 2H57A 2NMVA 4B44A 2GCPA 3GLFA 3R9IA 5AR1A 2W00A 1ZIOA 4ZIRB 5FTLA 4TL8A 4JKYA 3W8RA 2B6HA 1AK2A 3A4LA 4KU4A 2QGNA 3BFVA 4MQBA 1P72A 1R5OA 4DCTA 3HR8A 1DARA 4Q47A 3LQRA 4DEYA 2KJQA 4HB2A 4MITA 4TLAA 3IQWA 2W2XA 3RS5A 2FDCA 2UVQA 2VBCA 3B8HA 2OCAA 4Z54A 4Q9JA 1M2OB 1G291 4PPNA 2WKQA 1ZAKA 1VDZA 3VAAA 1SHZA 2EFHB 2QRNA 2QTFA 3LV8A 3KQNA 1W4BA 2WJIA 2F43A 4M9XA 3AVXA 1NLZA 1XF9A 4TSFD 2HUPA 2C5LA 2L0XA 4Q7KA 1PLKA 3RC8A 3GFPA 3OF5A 1KZ7B 2VQSA 3FHOA 2XSZD 5KOYA 4A0FA 3VR4A 2ZI7A 2GTPA 4CRWB 3EAQA 3HWSA 4J0QA 2FX3A 2XOKA 2ZAOA 3FKSA 1EESA 4MGZR 2FV8A 2Z4SA 2F9LA 2WKPA 3P20A 2FN4A 4RZXA 5JI3E 3NTUA 3CF0A 3OIUA 5LBIA 2G0NA 3A58B 3QI2A 3W6NA 3MWLA 1HT1E 3C4JA 4Q00A 3VNUA 3RSLA 4X8LA 1XTKA 1ONBA 2NO9A 2WHXA 5FL7A 4C0QC 2ZSEA 2FA9A 3U4QA 2W6JA 1TAGA 4GOKA 2JGNA 2ZRJA 1NMZA 2R65A 2ZYVX 3BD9A 4PAMA 4JVNA 1R2QA 3KQHA 4PPFA 3KFXA 2OSBA 5D3QA 1F60A 3WBJA 4OHWA 2GXSA 4P4UA 3K70B 5GVRA 4M9QA 2Z0MA 4A8JC 5C18A 3U44A 4IHQA 1KAOA 3A1VA 2XXAA 3CB4A 4LHVA 1CEEA 1XBTA 1L7VC 4A1FA 1GTVA 4M1WA 2W2VA 4MYCA 3UK6A 4GP6A 4OHXA 1DADA 3TUIC 1FTSA 1H8HD 1M34E 2V6IA 3F3YA 4L5BA 5L8VA 3LQQA 4GP7A 3V4RA 4NP6A 2CJWA 1W36B 2VHJA 2ZJYA 2HJGA 1KJYA 1Q20A 3M0EA 4FXPA 1S1CA 3N70A 1U81A 2DCUA 4Q9IA 1NBMA 3KXIA 4PZYA 5AK0A 2HDNB 2HEIA 1KI3A 4Z1MA 3R20A 2OM2A 3SQXA 4EQ6B 2ODBA 1W0KA 3AP2A 1GILA 4NZYA 1D5CA 4DLRA 5F9FA 3DVLA 5CLLA 1Z2CA 5FTKA 5L3SA 2GJAA 2IYVA 1ZINA 1NG1A 3MWYW 3W5IA 2MMCA 3AP3A 3FKQA 1Q21A 4KVAA 2BVNA 4AYXA 1NKTA 5CK4A 3ZJYA 5JECA 2PEYA 2PH1A 3CRMA 3GLFE 3AGQA 2VP5A 4PFSA 2JCSA 1NG9A 2WSMA 1OFIA 1Y3AA 2OBNA 4Z8YA 4BRWA 3ICQB 3TLXA 1CTQA 3EC2A 1IN7A 4Q21A 4PZZA 3ZS8A 2NZ8A 1P60A 1CF4A 4LBZA 4ZDWA 1YZUA 3GLFB 1GDDA 3K9LA 4NCKA 3SE0A 3LW8A 1E69A 1UKZA 1NN3A 1OFTA 1E1QA 2G1KA 3ZVMA 5TVKA 4RKEA 1DAFA 3GCGA 3MUFA 3O8RA 3JVVA 2WJJA 5SZIA 3CNOA 2ZRAA 3QENA 1G8GA 2DBYA 1FNNA 1YZKA 2GWHA 3SC3A 2OCYC 3KKPA 3ZQJA 2H8KA 3NVAA 2YZ2A 3UMFA 1LY1A 5DGXA 4TLDA 3LXXA 4MKIA 2EW1A 1BMFA 1ZUIA 4GDFA 2ZVPX 1Q1QA 1KY3A 2ZJAA 3OIVA 1E32A 1GRQA 5DHAA 5B2ZA 5BYKA 3DZDA 4B75A 3FVQA 5EUQB 1E9CA 2ZTSA 4PC7A 4BLRA 4NYJQ 4JBWA 4GL2A 4PHFA 1H8EA 4G5OA 4JLVA 2QM7A 4OHVA 4C30A 1T0HB 3FMOB 2OEPA 1KAGA 2FGJA 3EZ7A 3U6BA 3E5HA 1SVSA 2DWOA 3M1IA 4KCGA 4C9BA 2K5UA 4B43A 1ZC4A 3BB4A 3ZVLA 1JR3A 2ZRLA 3IO3A 3PCRB 5FUWA 1E79A 4HYYA 3A1UA 3R8CA 1FZQA 1NMXA 4DDVA 1KKLA 1ZD1A 3QE0A 5DI3A 4ARZB 2QUZA 1D2EA 4OI0A 2JJ1A 4RVCA 4QJ5A 3AF1A 1S2MA 1Q12A 1DAKA 5CITA 3AVYA 1MRNA 5JI2E 621PA 3P26A 4WXPA 3T35A 2OFWA 4WXRA 2B7CA 4IOKA 1AZTA 3LH5A 3NHAA 4Q9HA 4O2RA 3TIFA 3U60B 1Z0JA 1AIPA 1W1WA 2WJHA 1NIJA 1M8PA 4M1OA 1OXUA 4B71A 3B5JA 1JECA 1NBME 1TQ2A 2IT1A 3C5HA 3Q5DA 1NSTA 3UG6A 2ZRMA 1XDBA 1F5NA 3QBVA 5J4YA 4XD7A 2AXNA 4CF7A 2FZ4A 2QPAA 4ZKEA 2ZRPA 1T6NA 1FX0A 5H8WA 1G9XA 1U8AA 2XNDD 2WJGA 4WZ6A 1Z6XA 5FPYA 4XWOA 5DNYB 4MDEA 1XD9A 4RD6A 3G0HA 1U0HC 5L3SB 3WYFA 3X2SA 1RE0A 4FI3C 4X8MA 2DFNA 4B33A 2X77A 2WWHA 3MWJA 4HZIA 1UEIA 2HCBA 1NRJB 2ZYTX 4D81A 3CM0A 2DYKA 2DPXA 4Q9LA 1VG1A 5GJVC 3PENA 4UNPA 5G41A 1E2LA 5TB5A 4UXHA 3W9YA 3BE4A 3FE2A 4KLNA 4UNSA 4CEIB 5DI9A 3UMRA 4X8HA 4D0GA 3EC1A 1I4DD 1OPXA 3B1WA 2W0SA 2MSDB 3UKDA 1CJMA 1ZM4A 4P31A 3ZVRA 3K70C 4TN1A 4DCNA 3CX8A 3ZLJA 1Z5ZA 2HLDA 5F3WB 1SVLA 4OI1A 3T1OA 5GJWC 5C4GB 3ADCA 2BWJA 1I4LD 4Q1BA 4ZCMA 3SHFA 2EYQA 3F5FA 3UATA 2OAP1 3KUDA 3A1TA 1FP6A 1O87A 1YZQA 1H65A 1VKJA 2GA8A 5LD2B 2RGNA 4JLDA 5GJCA 4ESVA 1Z6YA 1V5WA 1VIAA 3K09A 2WTUA 1G7CA 1JR6A 5FBLB 1F3OA 4FD2A 3ZVNA 2JLWA 1YKSA 4IOLA 1QHIA 2GBLA 4JLKA 3X1ZA 4GOXA 2BEJA 3W3AA 3LNCA 1ZUHA 4B76A 1MO4A 5JJLA 3U7GA 2FSGA 3E70C 3EZ6A 3ZDQA 1ZM9A 2YWGA 2ZUBA 4UXIA 3U3KA 1KI9A 3AQ4A 2ODNA 1G5PA 1JR3E 2ZI9A 2ZU6A 3TBKA 3NBXX 2O8FA 1KK0A 4ACAA 721PA 4B47A 1TQDA 4N0DA 2JJ2D 4LI0A 3W5JA 3JZMA 2VP0A 3C41J 3K0FB 2AFHE 2GAOA 3WNBA 3GMTA 4B6FA 1ZW6A 4W5HA 4FMDB 2OXRA 3B1YA 2C8VA 5DI3B 2RB4A 2IUUA 3EWSA 3EIEA 1VG9B 2IEZA 4TSFA 5ANRB 3BFKA 3W3ZB 2C96A 3U3OA 3ZZ0A 3IUYA 4LV5B 2XSZA 3BGWA 3SBDA 4AI6A 3EPHA 1Q22A 2REOA 1DO2A 1SKYE 2PCJA 5CYOA 3I72A 3TW4A 1CXZA 4GMXA 3B82A 3R9XA 4BFSA 3VR2A 1GRRA 4YMUA 2FSHA 4C0AC 3AP1A 3CBQA 4L4UA 4QNRA 2EWVA 2G6BA 2GF9A 1SKYB 4HLUA 4DB4A 2F1JA 1IN8A 3VR1A 2ZETA 5JHHB 1FX0B 2ZQ5A 1Q3HA 2IXGA 4TMWA 1E2MA 1N3BA 1YR8A 1UBGA 1T3SA 1ZD9A 1KYIA 1T9HA 1Y63A 2HF9A 3WP1B 1WE2A 5C2JB 2DWPA 2IXEA 5E7JA 4JL8A 3VKGA 3TKLA 3HR7A 1SULA 1Q0UA 1BYIA 3B13B 2KI5A 3GEEA 3H86A 5FOTA 6Q21A 3FHTA 3SJAA 1LTQA 3WMGA 4DBLC 1NL3A 4DCVA 3MD0A 4PR0A 2J3EA 2Q21A 5KNDA 2AK2A 1FW6A 1VG8A 4KBFA 3PFIA 4TYWA 1WBBA 4MDFA 1II8A 2WICA 2G9NA 3A8TA 2PJZA 4M1TA 4EFLA 2F9MA 1IONA 4IDNA 4U00A 3I5XA 1XEWX 2OT3B 1N0UA 4CEHA 5FTNA 1YQTA 5HCNA 5EXXA 4S2EA 3L0OA 4JJKA 1AA9A 4KSBA 2H92A 4DLXA 1C4OA 2RGAA 4DLVA 3QG1A 3BBPA 4PSKA 3LBHA 3QPUA 2ZS9A 2O8BA 4B73A 4I99A 2VP4A 1BH2A 2ZSFA 4V0ME 1VCOA 3VHLB 2Y8EA 4OHZA 3K9HA 4LV6A 3BIFA 5F98A 1LF0A 1U0LA 1GKUB 1YZGA 4URZR 1ANKA 3W34A 4FMDF 4G5QA 5KYKA 3WHKA 4G3XA 2V55B 2W83A 2PT5A 4HDCA 2O8FB 1NMYA 2JLZA 3MMPA 4NCJA 2AD5A 4WZBE 2H17A 1OH7A 3H4MA 4H1VA 2BBTA 2C95A 3MFYA 1LB1B 3PUXA 3VX3A 3K0SA 2ZRHA 2YHSA 5CIWA 4Q1DA 1CRQA 4UNNA 2BEKA 4OJQA 2F3RA 5CM9C 5EJEA 4OL0A 3DM9B 1HH4A 4RFVA 3R8FA 1XPRA 2OCPA 2R62A 4US0R 3RANA 2WPDD 3QVUA 4MUBA 4DSTA 3SEAA 1CJKC 2YWHA 4NE2A 2OESA 2R6AA 4M1MA 3SDZA 2QPOA 3AKEA 3D3QA 3LD9A 3RABA 1CJTC 3T06B 4B3GA 2FNAA 2BM1A 2JLXA 1OKKD 3NH6A 3QXHA 5JEDA 2VSFA 3P1JA 2ZR7A 2GF0A 1SXJC 1GFIA 2ERXA 3G82C 3QKSA 1N6LA 4KYUA 2V3CC 3VHXA 1EFRD 8OHMA 4KYIB 1E2GA 4KI0A 3Q7PA 3CO5A 2IYUA 4TTQA 3BERA 3VQTA 1SXJD 2OCBA 5EXSA 3NDBB 4OYHA 1NY6A 5L3VA 5BN5A 1S1MA 1CIPA 4A2WA 2CDNA 1LS6A 4ASUD 1G3IA 3RS0A 4WAUA 2IA5A 2VP2A 1PZNA 2NPFA 1IXSB 2BBOA 2BMDA 2GHIA 4NMMA 4TLBA 5EP1A 4LRWA 4D82A 4RZ3A 4BE7B 4EPXA 4C0LA 1XX6A 2ZRFA 2ZXUA 1N2CE 5H68A 3VNVA 1C1YA 1JQJC 1UAAA 2GXUA 4EPVA 4LC0A 5FOWA 2ZRCA 5SZHB 2MMGA 2REXB 1R6BX 2CLSA 1T0JB 2E1RA 5HKKD 4HAWA 2WOOA 1KSFX 5EUMA 1TQ4A 1W5TA 4LJ6A 5JJIA 1JI0A 1X1SA 1Z6AA 3LLUA 2IS1A 2O0HA 4DIDA 4EPTA 1IN4A 5EP2A 4W9MC 4ZCIA 4II7A 3ASZA 3LXRA 3CNLA 3LRPA 3MGCA 4DLYA 1WA5A 1CR2A 2XNDA 2HF8A 1E6CA 1Z63A 2QE7D 2QY9A 4RD1A 5BQ5A 4EJSA 1FOEB 1M74A 4QG7A 5JZVA 2QT1A 2QRZA 3B9QA 4C2UA 2JA1A 3PR1A 4NL4H 3IBGA 4JLBA 4GNKA 2GCOA 2OBMA 2O8BB 2B92A 1GKIA 1XMVA 3FMFA 2BCJQ 5DE3A 4B3XA 1SQ5A 2Z43A 4HDOB 4K81B 5BN4A 5JMTA 4YDSA 4IVPA 5EZ6B 1NVVQ 2RGXA 3H2YA 1UBEA 2FE4A 1R10A 4LJ4A 2IW3A 1Q1BA 2HT6A 1JBKA 2XTNA 4NYIQ 3S1AA 2CLDX 1N6IA 1XD8A 5K8LA 4HZUA 4HLQB 4RZUA 1DVRA 4LYAA 4O2LA 4OI2A 1UDWA 1EX6A 3MRSA 3NG1A 1ETUA 2KB0A 2ODWA 2CVFA 3RLFA 3A4MA 5E95A 2YWEA 3RRNA 5AJXA 2ONJA 4NH0A 4KLZA 3T61A 5FPKA 2J59A 3KQUA 2JLQA 3BB3A 3LVQE 3QSYA 4OQLA 4EIWA 1P5ZB 1J99A 1RKBA 2IS2A 4HB3A 2PX0A 1XP8A 4QBIA 4V0LA 4OHYA 3BK7A 4C0BA 1TL7C 4HAYA 3CW2A 3U2QA 3LWNA 3I62A 5GADl 1CLUA 4OK3A 2ZROA 3QKSB 5KNBA 4IVRA 2X8AA 4RD0A 1R7RA 3IILA 1E9BA 1S8FA 4I81A 4QBFA 4O0MA 1LW7A 2ANBA 4UXJA 2AHOA 2H18A 2JLRA 1FTNA 2SHKA 2ORIA 4Q4AA 2VLIA 2CBZA 2H16A 2JJ2A 2RGNC 4Q4LA 3FB4A 2YOGA 5A0FA 1NJFA 3X1XA 4D4MA 2RGEA 3CF6R 1KJZA 2QMOA 2N46A 2GBLC 2ZI6A 1GWNA 2GEDA 4M1KA 1ZCAA 5HE8A 3T12A 3ZH9B 4G01B 4A82A 3C15C 5AUPB 1ZP6A 3UIEA 1U9IA 2ZJ8A 4BZQA 1J70A 4M9ZA 3ZIAD 4P4SB 4YMSA 1XTQA 4GMDA 2ZE8A 3HPQA 3BOSA 4BFWA 2A2ZA 1E2PA 4S35A 4Q18A 1P75A 3RDPA 1YR7A 4H9GA 1F6BA 2A5JA 1IY0A 4DLUA 3SYLA 2VF7A 3GJ8A 1GAJA 2A5GA 4C3ZA 2HXYA 4AKGA 3QKRB 2C99A 2WAXA 2FEOA 1XCMA 4A36A 1N6RA 4QHTA 4JZKA 4LX0A 1UBCA 1BKDR 4KITB 3P4YA 1US8A 1BOFA 1CJUC 1EG7A 1OJLA 3V00A 4EJSB 3CKLA 4HUQB 4QJ3A 3H84A 1A82A 3IEUA 2GETA 3KQKA 1JAIA 2WV9A 2HV8A 2D62A 2PEZA 2ZRKA 4CIDA 4A9AA 4LYHA 1KO4A 1Z3IX 3ND9A 4FCTA 3ASYA 4HLUC 1TNDA 3GLGA 1DOAA 1XJ0A 4DUGD 3FGNA 4MGKR 1ZUNB 2ZI3A 3S1AB 1OLOA 1QVAA 4LJ9A 1KNXA 1CJVC 5AUQA 3EA5A 3N2IA 4OK5A 4NTZA 4EAQA 3I92A 5C1BA 3T1TA 4AY2A 2RCNA 3EZ2A 2WWYA 4LWZA 3KQLA 1JEDA 3GJ6A 3MLEA 4Q48A 4E03A 1EFCA 3CZQA 3TSZA 1DS6A 3Q7QA 1LVGA 2F1HA 2WWGA 4RD2A 1N5LA 4PXAA 3CLVA 2CNWD 2Q3HA 3ADKA 4EFNA 5KPDA 2IS4A 1VYUA 5KHOC 2YYZA 4URXR 4MYHA 4AKIA 4IVQA 4PQFA 2PJRA 3B85A 3CX7A 4V0NA 3I1FA 2IYQA 3TQFA 2QGZA 1QVRA 3VFDA 3N2EA 1KI7A 2DFKB 2ORWA 2YOFA 5HZKA 4B2LA 3THYB 2GVZC 2X2EA 1JNYA 4BEBA 1W46A 3AM1A 5DO9A 1KJWA 3SJBA 1N25A 1GSIA 4IEIA 3GLIA 2FWRA 4HAVA 2C98A 4B3CA 4EFMA 3LAWA 2FPKA 1GOTA 1E0AA 2WKRA 4Q4AB 5JRJA 4BGDA 4ZO4A 4MRPA 4PC6A 2Q3FA 1OXSC 1NF3A 2D4HA 1W48A 1VCIA 4EPWA 1HE8B 1UDXA 3R7WA 3SJZA 1NN0A 5KSOA 4EDHA 2W6ID 4XJXA 3TMKA 5JS7A 2JLVA 4KFRA 4F4IA 1HE1C 1VHLA 1K5DA 4UNQA 5CLQA 3UANA 3KB1A 1E2NA 2WPDA 4IOMA 4TYYA 5AJVB 3U3MA 1VTKA 5A5GA 3X1DA 1JALA 2V1UA 4JL5A 2BJWA 4UNRA 1EFHA 4TYNA 3CH4B 1BYUA 1QHSA 2QT0A 3D8BA 1KSHA 1OKKA 4GT1A 4MKFA 1DO0A 2QA5A 1AGPA 2QMUA 3P27A 1E0SA 3QJYA 5EZ5A 2BJVA 1T91A 1RFLA 3Q85A 3Q5EA 4O25A 5L3QA 1EFRA 3BS4A 2JATA 3GFOA 1M7HA 4PC3A 4POAA 2QNRA 1OF1A 4MRVA 3UWKA 1IBRA 3W8NA 3U7FB 5KDDA 2YKGA 1SXJA 1GM5A 3NEJA 1II0A 5FOVA 4LHXA 2VIIA 1US8B 3RS2A 2XTMA 1UKVY 5G3YA 3WMFA 1KNQA 4ASUA 3TE6A 2G77B 1T8UA 3J81k 2BDTA 1TMKA 1MH1A 2F43B 4KSCA 5F2EA 1IJFA 1SVIA 3GLGE 1CU1A 1MV5A 4JLPA 3CUEF 2YINC 4Q1CA 4BLPA 1D9XA 2WMOB 1U90A 1DEKA 1HQYE 1OXTA 2Z6VA 3DMNA 3B1ZA 2ZPTX 1HQCA 1FMLA 4LHZA 3GQBA 1ZRHA 2O8EA 1N6HA 3CWZA 2V6JA 3GLGB 2MSEB 4RCYA 5BN3A 4KJZA 4HLCA 2GJ9A 1SHKA 3A36A 2V4ZA 4ZV4A 5HKKA 1MT0A 4M53A 3AVQA 2OE2A 3U4QB 4TL9A 2W58A 2PX3A 2RAPA 1E4VA 2A30A 3B7GA 2ZSDA 3KJEA 1LNZA 5DYGA 3NBYC 2CL7X 2VSOA 2R6CA 4WA7A 3IEVA 4NU0A 2ZE7A 1Z0KA 4U02A 2AX4A 2ZR0A 4QGHA 4BLQA 2QE7A 3U44B 3GLHA 4FMCB 4N3NA 1XTJA 4Q4HA 5JWOA 2PZGA 4YLGA 2XXAB 1Z0AA 2I4IA 4AKHA 2EFEB 1IN5A 4DZZA 5CDFA 3FPAA 2VHCA 1KO7A 4CEJA 1W47A 2J87A 5H70A 3NEYA 2A7QA 4HAUA 4R98A 1RPZA 3EPLA 5B57C 1OH6A 1AKEA 3DO6A 1XCPA 1D2NA 3VKWA 1CR1A 3GLIE 5JBQA 3NWJA 4JT4A 2CJWB 4ABYA 4TQAA 3WRXC 1SVOA 3LVRE 2J0SA 4EJSC 4JLMA 4ZDKA 1TUIA 1PLLA 3JZAA 3GLIB 2GDJA 3DL0A 4A4DA 3CPEA 5EE0A 2P67A 1OFUX 3KDSE 2A9KA 5FFMA 5GJBA 2YOHA 4A0HA 2LKCA
chains in the Genus database with same CATH superfamily
5F78A 2C9OA 2H2IA 2I2BA 4LHYA 1CPYA 4ZJYA 4AYWA 3D0RA 3I01M 2EKDA 3NYRA 2G09A 2PPLA 5CHEA 5KPJA 3SIRA 1RXVA 5IMSA 2DH6A 4L4RA 2H2WA 1PDOA 2HHAA 1ADYA 1L1RA 4YRMA 5J2UA 1E2KA 1T1GA 1UZLA 1RWMA 3UAXA 3ZNPA 3V2UA 1X8JA 2W2KB 5ITSA 4LJ8A 4MQ5A 2FZ5A 4BLOA 5JXJA 2OLKA 5DH9A 1CDEA 3K20A 2CUKA 1FLVA 3H04A 3H6HA 4DPLA 4F4CA 1LK5A 1L3BA 1S01A 3RJMA 2B5WA 1P7CA 2X19A 3LCJA 3QVGA 3IQFA 1DEXA 3CISA 5PGMA 1RHRA 1WCIB 3B9PA 3HUUA 3LIIA 4QZVA 2PKQO 2DTXA 1DBRA 4M0DA 1EPUA 4M22A 4QE3A 1VMDA 3K2EA 5JAIA 2WPNA 5K4HA 4KLCA 1NXWA 4QVKA 5D3KA 1F17A 2F6RA 2VHUA 3QLTA 1XOIA 4OQYA 4ER3A 4DANA 4ALNA 4MZXA 4R7TA 2H29A 3DXFA 3ROXA 2VA8A 4Q3KA 3WLQA 1Y3BE 5FUXA 3WXMA 4NYJR 4JQOA 3L8HA 1P45A 5DKFA 1DG1G 1ZFNA 2PPVA 5JNSA 2J9GA 3WWOA 5IH7A 4EHIA 1X3SA 2Q1XA 2AF3C 4LDPA 1KEWA 2VHVA 2ZS7A 4N5IX 3AVUA 1UANA 4RM2A 4WINA 1U5BA 2ZS8A 2OV3A 1KQGA 2FN8A 1AHNA 2CFTA 5DGCA 2IEGA 1QV9A 1Q57A 2J9ZB 2OZKA 2YUTA 3QOFA 3PFCA 4D4KA 4BBAA 3GLVA 2VJQA 1N0WA 2Q2WA 3QXSA 2FPUA 3NDPA 3AGPA 3D8HA 3MWGA 4R6WA 2GM9A 2ZWMA 4KN5A 3WL3A 2QKYA 4FMCF 4ETMA 3II6X 1CQZA 2CVPA 2CV0A 2GUGA 5JNTA 4F5WA 2CHQA 3CC8A 2UAGA 1U8UA 5JY6A 2LCQA 4AURA 4KODA 2VTBB 1RRGA 1OROA 2FJUA 2WNHA 2IYYA 4UM7A 1LKZA 4EKIA 4N3AA 1SBCA 4D99A 2W43A 5LNK6 4P36A 2VWQA 3AVTA 3DLCA 5ECGC 1NJ1A 2G3YA 4F7WA 4JUAA 1W96A 3UXEA 3IKMB 1GNRA 2EARA 5K6TA 5ED4A 3GJ0A 3RRJA 5ALTA 4I8IA 4TUYF 3KLOA 4B09A 1TVMA 4WOPA 3OP1A 1W36D 2R1VA 3GLHB 1ZX1A 4LXIA 2IL1A 4B6RA 4Q4HB 1XUOA 2F2TA 3ESCA 2TYSB 4FCWA 3ZY3A 3K0AA 2NW6A 1ZJZA 1WB5A 2X23A 3QLJA 3VU8A 1AUOA 2F1RA 4RL4A 3OAAD 1N5RA 2R00C 4LMAA 5AJHA 3MM4A 5LMUB 1OASA 1Q1NA 3EDOA 4A8PA 1C7IA 2I67A 3P19A 1IQPA 4H6WA 4L16A 1C5KA 4PONA 3PUVA 2ZRDA 1WCWA 3FAKA 4KMSA 1YNOA 5J4KA 1Z0UA 2ZSKA 2PUVA 1A8UA 1N0VC 3VVLA 2ZJ1A 1V16B 3HEAA 4G8JA 4DIFA 1HBJA 3LPAA 1W34A 1L4EA 1Z12A 5D86A 4XDHA 1E3QA 3C48A 5EQFA 4FBGA 4O2BB 3WV4A 4FZJA 1OIXA 3EF0A 4L85A 1Q91A 1QIEA 4O0LA 3JD3A 2AOUA 3KSRA 3Q2IA 5U4QA 3O4GA 3I34X 1ZMRA 3P71T 3H2ZA 4ZEXA 5TGZA 2IHZA 4FWTA 3T41A 1EK2A 3RFVA 4KB5A 2RH5A 4ZRNA 3IT0A 4QBHA 4XVUA 2D3TA 2X42A 4PYMA 2JIZD 1DIRA 3CUKA 2QJWA 2IEIA 4HADA 1TVKA 4JVMA 4TL6A 5DEIA 1HXHA 5A5EA 5KVCA 3ZNOA 2MJLA 3DCYA 3NHZA 1Z06A 1ZRMA 1EXVA 1KRHA 3GEGA 1Y5MA 3D4LA 3ETJA 3VO1A 5KC9A 1HDYA 1HO3A 1X19A 3LOPA 4OQPA 4JVLA 3WIOA 2VF5X 4R1PA 2I76A 1OOEA 2F8LA 2IU3A 3DR3A 2IHTA 5M34A 1QDLB 1A2BA 5KVSA 2EQ5A 1PKXA 2Y77A 1DJOA 1P77A 1PU2A 4YNBA 1KE1A 3WB0A 2J5RA 5AVVA 1RQPA 1EFAA 1AHIA 4B34A 4R40A 3L0IB 3SJCA 3GGJA 4JS0A 1X42A 3QKIA 5F4ZA 1S96A 4IVNA 1CQIB 4WBSA 1ES9A 1S3IA 1YOBA 3IKJA 5T4FA 3EG5A 4K05A 2NT4A 3TM4A 4RMNA 2OO7A 4B8ZA 3ANSA 3SMQA 3EPKA 4GBJA 2AKYA 2IDZA 1KDZA 2J3QA 3UW3A 1KP9A 3JD1A 2Q45A 2GRJA 4L5IA 1WDWB 4N40A 1YJ5A 1E4EB 1FU4A 2ZAGA 3TZKA 5EHXA 4PO3X 1OC2A 2OVBA 4P7BA 2P77A 4PC2A 1IBMB 1E1RD 3ADBA 4US2R 1YDFA 2ZOSA 1DHTA 3CS3A 3H0KA 4R8SA 1OE0A 4XWKA 3X3HA 3SS8A 4CW7A 1J2TA 3A4VA 3N6XA 4MW6A 2GBPA 2FUG6 2ZM6B 1EXWA 4K0RA 3HE3A 1TUGA 4K9QA 1XZMA 5DGTA 3EMBA 2XKAA 4M1SA 4CQMD 1L4FA 3GGCA 2QVGA 1M6VA 2GK4A 2ZIWB 3I32A 1N2SA 2EHJA 3BORA 5ERGB 3E1SA 4I1IA 4R16A 4WNYA 4ZXPA 3ZEAA 4L6IA 1S7CA 1FRFS 3LVFO 3CZRA 3G1WA 1DAMA 2O8DB 3NBAA 4RW0A 3SVZA 3RB8A 1GAXA 3RRZA 5AW6A 3P9SA 5D6OA 2V1XA 1Y42X 5E0KB 4JJZA 3FTPA 2VATA 1FL9A 5K51A 3BH7A 1PJRA 3AUXA 3PUKA 4KXNA 4AO8A 2LNDA 2QR3A 5EJ2A 2PX4A 1GKLA 3G2QA 4POOA 1G7TA 1MVLA 1U3WA 3S28A 2IU4A 1LDEA 3GUYA 4U8GA 2HC9A 4L0CA 1Z0FA 2DH5A 4F9EA 1MT3A 2ZIXB 1EAYA 1JXOA 3CR8A 1ECJA 4RS3A 5FAXA 3H1TA 4PY2A 4B84A 4YXWD 4I1SA 4JB3A 4XJVA 3R74A 2DWQA 2H1VA 4F92B 2XZPA 4JJAA 5F7XA 3WDLA 5DWVA 3A2MA 2PRJA 2GD1O 2VAXA 4KVFA 1Y81A 1UQUA 1SWVA 3WNVA 3X2FA 1EFLA 2NYRA 2P9YA 5FR2A 2HIHA 3HO1A 4PGFA 1FS4A 1OILA 4K87A 4O2BF 3H5NA 4LGMA 2GO7A 2YNMA 1OB2A 3EMKA 4N7BA 5TS2A 3AHCA 4X65B 3EXAA 5HOEA 3OE1A 2I1LA 1VJ5A 2PLWA 3VR6A 4B3MB 3DT9A 1WMBA 2QSYA 3JYLA 3PHBE 3C14C 3D6NB 5EXPA 3USCS 3WGGA 5DM60 4DLTA 4E31A 4KR9A 4BGVA 1DMRA 1FDVA 2P9CA 4PFKA 5EN4A 2IH4A 2I65A 3OIYA 5IBQA 5IVDA 1R0CA 4LOLA 4JA0A 3F3MA 2XZOA 5ALRA 2O7SA 5NLLA 4LOIA 2Q6KA 4KGDA 3LW7A 1IHUA 1M8GA 1U0JA 1WSBA 3AFHA 3QKUA 3WMEA 3OJOA 2XB4A 2X1VA 2I8AA 4DV4B 4FZVA 4N7MA 3JYOA 5NULA 1KJ9A 1E1QD 3M6IA 1Z16A 3B36A 3ZDXB 3QVSA 1CVIA 5G1PA 4ENTA 2IH2A 1HT2E 4YJGA 3KYDA 1X7WA 3DEYX 4FW8A 4P34A 3REGA 5ELXA 4E5SA 1T10A 2QR5A 1XEFA 1HZZC 2ZRGA 1Z2OX 1DIAA 1R00A 3I73A 4Y9DA 1LSSA 2C9DA 1IC6A 4RULA 4DT1A 1K68A 2P7HA 3FX2A 1K4YA 4LF6B 3DUFB 4BFTA 3SAJA 1UBNA 2FPPA 4Y0VA 1E9VA 3PJRA 1B1CA 4WMLA 1WMEA 3M70A 1WXEA 4TWJA 4UTPA 4TQ9A 3I8SA 3IBFA 1L4YA 1KGSA 4FKMA 5DNVA 4GX1A 2EBHX 3QBDA 3K0EA 2O8CA 3AB3A 3JQ6A 4W99A 4JLOA 2A59A 2Q5OA 2Y0BA 2BMJA 3BE6A 1XNJA 4BP3A 4II2A 4IM7A 3GARA 1DJMA 1JA9A 4D02A 3ILHA 2VP9A 5ICGA 4MRNA 1VKHA 3AL3A 3IURA 2CUZA 1QH9A 1Z83A 1BW9A 1X1CA 2GNOA 1VP3A 2BFWA 3ECAA 1UAYA 3I8XA 3PNOA 1CNMA 1TUBA 1EUDB 1YDEA 1SC4A 4MW5A 4G1MB 2REQB 3PFKA 4QLOA 1IZZA 4QKQA 3SVTA 2GEKA 5BPFA 1D9ZA 2C9CA 1DL5A 1HE4A 1PO7A 2I03A 4HAZA 4BNVA 5EXDA 2VT6A 2Y2VA 4ITVA 4YAIA 1M2OA 4R1TA 1LFDB 1XWIA 2BR4A 2HGSA 4Z9YA 2IUYA 1QZUA 4IDQA 1U7WA 4X66B 4ALLA 3GGGA 1N9GA 4BEVA 1H5QA 1T2EA 1ZG3A 2NZVG 2Y1LA 5CM8B 4ZQEA 3GNQA 3BCHA 3TMYA 5I3ZA 5DHFA 4J1TC 2NM0A 2QE6A 2KHZA 1D2MA 4I8DA 2AS0A 2ZATA 1G8JA 4UJ3A 5FA5A 4J49A 1FDTA 2NO6A 4KMRA 5F1OA 4YQFA 4GQBA 1OHHD 4PYOA 1E1LA 4F2DA 1XDDA 3SFZA 4JOBA 2AK3A 4J0IA 3QYFA 2NYVA 1NMQA 1Z0SA 3DAPA 3IQXA 5GPBA 2WYWA 4ESOA 5K0BA 2VXYA 3IUMA 4HFMA 4MVJF 4R1MA 4A0RA 2OG1A 1JPJA 4KL8S 4RABA 1T5SA 2GRUA 2R7KA 3AKDA 3GELA 1SOWA 1CY7A 3C0KA 2PZ8A 1Z7GA 5I7VA 1JJIA 2G4VA 1D6MA 1WJGA 3INRA 1E3IA 4J29A 3D0KA 1N6PA 4I55A 1KOFA 4V0QA 4AMVA 4YCSA 1CBUA 1MJHA 4FX2A 5KKCA 4RZIA 3CKKA 3H2IA 3ZW7A 5JSZB 4XUEA 4QPJC 4KXLA 1VQ1A 4UEWA 1GPDG 1HE2A 3BQMB 2HRQA 3GJ4A 4RZSA 3PFFA 4HGRA 5FFNA 1QGDA 4R1OA 1XCBA 1Z8NA 1P62B 1IAQA 5D3ZA 5B3KA 3L93A 5DEOA 3HCDA 4AC9A 3DMTA 2XHZA 3FNQA 1GPJA 2DC1A 4S1WA 3R0JA 1IVYA 3UAVA 4DR1B 1J2JA 3R3SA 4GRAA 4E22A 2G67A 1NLFA 1SQ6A 1XEXA 3F47A 4LF5B 5EFOA 1H1LA 3NHRA 5A4AA 2XE6A 1CUZA 1GVNB 5KX5B 3HVKA 5BN5B 2CF5A 4WBNA 1QS0B 1SD2A 4ZCPA 5DHPA 2ZRQA 2QIOA 4RTJA 2C0PA 3SR4A 4MDFA 2FMIA 5TLSA 5CH8A 2B21A 3P9YA 5K3EA 2BGWA 5J3JA 4Z5XA 4L50A 2PSSA 4L2IB 1XB2A 4O8CA 2BHRA 1Y5LA 1MORA 2IZ0A 3PUHA 1H0RA 1ZKMA 2JHPA 3GLRA 3OAAA 4WD3A 4E7PA 1H22A 4QJIA 1XD2A 1M6YA 3NZEA 4NOLA 2FSFA 3V97A 2IZZA 1E7QA 5J1SB 1BFUA 1E59A 1QGAA 1S3GA 2IHBA 5KAPA 5J63A 1NT4A 4G0OA 3QWAA 1R6XA 1C0PA 4UD6A 1LLFA 4JD5A 5DNCA 2ZYGA 3RBXA 2DVMA 1DIOB 1P3JA 1S7GA 4XI9A 1QBKC 1BMTA 3IPCA 3GZ4A 2VAMA 2AMFA 3V4FA 3BREA 4EYOA 1A96A 4P7FA 2G4LA 3W6ZA 5CFNA 2I91A 1UXOA 4WIAA 4WV3A 4KRYA 5EYPB 1T4CB 4KVZA 4M8NE 1PEDA 4ND7A 3TOCA 5DBIA 1HEUA 1RHJA 1CVLA 3ZHXA 5FXMA 4LZZA 2V6MA 4NABA 5E4TA 4YFVA 4F9TA 2OXFA 3F5QA 3VH2A 1N5IA 1V7CA 5L95A 1SNYA 1MAVA 3IIJA 1NJ8A 2EU8A 2FW0A 1JEQB 1XQVA 2JARA 2JIZA 3OZRA 4LEIA 2QN3A 4B3BA 3F8TA 2C7OA 3SF8A 3CJTA 4UCQA 1F4PA 3BHJA 3KTAA 5IAAA 3NUZA 4A0SA 2Q27A 4B2PA 2AJTA 5IJAA 3GX1A 3OF2A 3RBAA 4CVNA 2N75A 3L4EA 4QFMA 2EP7A 2DBZA 2P68A 4DDWA 2XCIA 1PN3A 1ZLYA 3C5CA 3EH1A 4EF5A 4N5NA 1A27A 5FBWB 2J6CA 3OWOA 1GGVA 1YB6A 2Y1WA 3ICWA 5T8KC 4KXFB 4OBEA 4IKPA 5B2EA 1WW3A 4YRZA 3VH4A 3T0FA 4Y98A 5FI0B 4YRPA 4QRHA 3H5TA 4BNWA 5IDVA 1QIDA 2NU9B 3SF0A 3THRA 3T54A 3A6KA 1FDOA 4M4SA 2HJWA 4E32A 5IZ4A 4J4BA 5JBIA 1M2EA 5LP6B 4OHCA 1LSUA 2Z95A 2GZMA 3DFUA 4ITRC 2P9TA 2QMHA 3RYFB 1JEJA 3TO5A 2EJCA 3G3EA 3MEQA 4CKCA 3GPDG 1I13A 4EB6B 2W6PA 2V6BA 1Y1LA 2OY0A 3DF7A 4XDGA 5AVQA 4A15A 3QQPA 4E6EA 3RTEA 3TTSA 1KOJA 3GVXA 1E1RA 1TU0A 4I50B 3GR6A 4CMCA 4EKYA 3OUZA 1H6BA 2OZEA 3RUIA 2QV0A 3H3XA 3ULKA 6GPBA 2R68A 4G0PA 5KX5F 3F49S 1KR5A 4ZGWA 3F78A 3KV3O 4AP5A 1E2EA 3NPMA 4GS5A 1TK2A 3CT4A 3SM9A 3UYKA 4A5SA 4BKMA 3PC6A 2IHNA 2OORC 3A7EA 2FMHA 1JP7A 3D7RA 4IJ5A 4IXNA 3DJFA 2XYVA 1V1RA 3K0CC 4JI5B 1GPKA 3KPWA 1KEEA 4B3FX 4LXYA 4LZLA 3M83A 3IVRA 1I7QB 2HQ1A 4X1YB 4DDUA 1SVUA 3QOWA 3IT2A 1ZU4A 4FHDA 4B7UA 5AKYA 4NMLA 3ZH2A 4I5FA 2XJ9A 4FFRA 5E3IA 3L6UA 1U4OA 3E7XA 3STXA 1BEZA 3TZBA 5IVPA 3ZD7A 3LA6A 5JDIC 3UXMA 2XUZA 4KAXA 2E7ZA 1I01A 2G83A 1UK7A 5FNVA 3C3EA 5KYXA 1POXA 5DYIA 3WYAA 3GJRA 1ZOSA 4JXKA 4YXWA 5A62A 1XDWA 3W5DA 1U2TA 2D13A 3F67A 3BGSA 5KTSA 2ZT6A 3PUZA 4YP1A 1FRQA 3BULA 2QVCA 2H07A 3CNNA 1QKIA 3ZVKA 1RLOA 4NV3A 5DYWA 1IJEA 3PEUA 1K08A 4B4KA 4Q34A 3S8EA 2J3KA 3D2CA 3PFWO 4H7EA 1ZXLA 2A9QA 3WDSA 4B35A 2OL4A 3SY8A 4BFLA 2BGUA 4YQZA 3M1AA 5F1YA 4LBYA 1SQGA 4M99A 4W6ZA 4ZO9A 1T8YA 4DAOA 2G17A 5IH3A 1U7XA 3VR3D 4DCSA 4P53A 1BHJA 1WL8A 4J43A 4BAGA 5BSKA 3H9UA 1VA5A 4M98A 1IQ0A 3CKMA 1ZJ6A 4TLEA 2B6NA 4ZCLA 5JYCA 3RYCB 2CNOA 4IIBA 3TCXB 3PQ3A 3ZZTA 3F6SA 3N2GA 4QG3A 1FLDA 5D5QA 3UAYA 1X13A 3ZXIA 3CVYA 1BDJA 1SBYA 1SCIA 3ZWXA 2UYHA 3BH6A 3AR7A 1O97C 1R4AA 1GZSA 1ZMTA 5CHYA 1D4FA 1PJ2A 3MSXA 2RAFA 4IZOA 4L1KA 5T4BA 3DA8A 1Q15A 3GV0A 1SK9A 3HMKA 4YWHA 1QRTA 3CNHA 1UMCB 2A14A 3T3EA 3WGOA 4F5ZA 4M21A 2YY6A 1BJTA 1PJZA 3GFVA 4H77A 2OXTA 5J43A 4HRVA 3W79A 5KSPA 3K92A 5CNIA 5F35A 4H1UA 3SC6A 2Q49A 1GTG1 1SB8A 5C8ZA 4DEXA 4JJEA 1AZSC 2QD3A 1ZM2A 1WY5A 5FUYA 1N92A 1AS2A 4C07A 5LP6F 3A2LA 3LX6A 3SZLA 3WGIA 3WYDA 1E8NA 4EUHA 3E2MA 2JCBA 2NPIA 3PNBA 1K8YB 3FDJA 2ZITA 4Y9SA 2JK1A 1KYXA 4I50F 2GT1A 4OFZA 1D8TA 1EVQA 4ZQGA 3TR5A 1U2GA 1VL5A 3EOAI 4YJHB 1FC0A 3I3OA 1A7JA 3AEZA 1DBQA 3THSA 4E14A 1A5SB 4C0WA 4GI3A 4XWGA 5LYYA 1EJ6A 3IFSA 5I4CA 4UHFA 2G76A 2NZJA 3AUJB 5T6BA 3WB1A 5G1NA 4EKGA 4Q05A 4UBLA 2BC9A 3LCUA 1Y5NA 4WZAA 5AM1A 3CBGA 5JQWA 1VJGA 1B73A 3KYCB 3LSYA 1M7GA 2A33A 1E3DA 2HLPA 2J0UA 2Q3MA 1QFZA 2Q4DA 3LO5A 4HXYA 3HUEA 1MX9A 5ALHA 1MB4A 2ORYA 3SLGA 3R9WA 4LSWA 1ZJWA 4IIVA 3D7KA 4N6GA 2QN6A 1YHNA 2QYSA 4X7RA 4XW2A 2ZYHA 4S24A 1UC5B 3ACDA 5LQMA 521PA 3DZFA 3UCXA 5CGZA 4KHPB 3Q3CA 1AM4D 3SP1A 1X7YB 2XMRA 3HB7A 1GCGA 3LUKA 3NBFA 4HDKB 4XOIA 4P35A 5FR1A 2JAPA 3CONA 3GXBA 3I05A 4EG7A 1LLCA 1P6QA 2K87A 2JAUA 3CZMA 3BXGA 5CVCA 4ZVKA 3SYRA 1B0PA 1W5EA 4MWCA 3I0NA 1RM4A 1M2VA 4RHUA 5FBZA 4WFKA 4AZ3A 2WVHA 3DXYA 2Q6LA 2O2XA 4OSOA 3LLVA 3OP4A 2NNLD 2DG2A 4P3YA 4AQ7A 2Z04A 3AUTA 3EDQA 1GQQA 1PBTA 4NS1A 3OBIA 3CLHA 4BKPA 1YA8A 1OBOA 5DIFA 1AKRA 1OHHA 3CRVA 4YRIA 2C92A 3RRMA 4KFTA 1RBMA 4FHGA 1GRNA 1L8LA 4AZ0A 4CKWB 1B8VA 1KAEA 5A1JA 4II3A 4MIKA 4YO8A 5IWCA 4RLHA 3VVBA 1EJ0A 3W7AA 3F4KA 2JIDA 2OOKA 3ZUPA 1F2VA 5B7PA 3HJGA 4FB4A 3EN0A 2G72A 2LDYA 4ND8A 5HRAA 1SH7A 3GOHA 1ORVA 2YCBA 2IFTA 3JQFC 1KIMA 3TX6A 4COKA 1U2DA 4EB8A 1JH9A 2RIRA 1RDFA 1E9DA 1X2EA 2DECA 4C7BA 1U3GA 2NXEA 5FOSA 2P9ZA 2G9QA 5BURA 4YA6A 4DFDA 5CFZA 5IBPA 2R48A 1BFKA 4DAEA 2NVUB 4OQMA 4HGQA 2XOXA 1XU9A 4KACA 1KMHA 2ST1A 2BKUA 4GR5A 4NBSA 2PRSA 5DLQC 2DOKA 2UZ3A 2WOJA 3ZIUA 1MTZA 4Y6RA 5D3MB 4GPTA 4W5JA 2REBA 3Q8MA 3KKMA 1CS0B 3OE7D 1AKQA 3B60A 3IVGA 1JHRA 4L15A 3KSMA 1T5BA 1Q2UA 2R84A 2WHPA 3N2KB 4BVGA 3LBIA 1RRCA 2FZGA 4NKRA 4Y2YA 1AXGA 1JUDA 2IPOA 2D2FA 3G5UA 5B4VA 2IWHA 1KE2A 4M1QA 2YXPX 1JLMA 3G02A 5CVUA 3LC1O 2KMLA 4QASA 5J47A 3OT1B 2IOYA 2YMQA 5FA8A 2XZLA 2G40A 2V7WA 1U9YA 2RH9B 3T1QA 4XE5A 2CVOA 2ODTX 4LQDA 2H85A 4LFAB 5DRTA 5BT9A 4Z4HA 3DLAA 3BZBA 4OQNA 2QTVA 1KHTA 2P6NA 1E0KA 3KB8A 4K6MA 1XDZA 4C87A 2DFTA 2TMGA 4BOYA 5HIJA 1B93A 1G3MA 3K70D 3GQBB 5BN3B 3LFUA 4F8YA 4UHKA 1DWOA 2O8EB 4NXNB 4DKXA 1E77A 2PS0A 1V37A 4CLDA 1K7FB 3DC2A 4UU0A 2BYTA 3OUTA 2X76A 3QVOA 1L5HA 3WK9A 1UBMS 3A32A 1ZM7A 2GI4A 2PKQP 4IGFA 4MEAA 3QZUA 3O3NB 3T4PA 4LWQA 2W2PA 5AVXA 2IXFA 3ITEA 2VEOA 1XAGA 5TEWA 2KWIA 4JKOA 1EH5A 5EE1A 5C52B 3HGTA 5CD1A 4ENVA 1OIVA 1WSWA 3QYJA 1NZDA 3GO4A 4FHZA 4QBKA 1RPNA 2B3TA 2PMDA 1J06A 3DMHA 5FUBA 3WNQA 1D1SA 3TD2A 1P9OA 2I6GA 4Q3BA 1YTLA 4RLSA 4DMLA 4AN4A 5CX1A 2FX2A 4JUCA 2FZKA 2SCUB 1GL7A 4XGIA 5KYGA 1OGIA 4L6AA 3EE6A 1R16A 1AK1A 3PQFA 4KIJA 2JLVA 1R0KA 3S2SA 1ONPA 3ISJA 2I3ZA 3DP9A 4KTVE 5JUWA 3PYLA 3KNZA 1GZ3A 3BWBA 4ZI7B 5JXHA 4FMBB 1WLYA 2GM3A 3Q2OA 1SCUB 3CLSD 3V8EA 3P2IA 2H4ZA 2I9KA 1W85A 2OBBA 1NN5A 2YV5A 1I5EA 4ZPJA 1HFKA 1P73A 3S1SA 2FMKA 4RMHA 2CMHA 5FO1A 4C4SA 4K3UA 2PO5A 1G42A 1NU6A 1RKVA 4XGNA 3IC5A 4Y0NA 1XQWA 1EE2A 1YI1A 4YRKA 5K3OA 1TKBA 4OGLA 3D81A 3AJRA 1ODJA 2D59A 2Z2KA 2R7NA 3T3IA 4BV9A 3N0TA 1E3EA 4B48A 3LOUA 1I80A 4R0VA 3W5BA 1Z62A 3DOHA 3NX4A 5AW5A 3OCXA 5KS2A 1XPJA 2GTHA 1T8RA 1GPMA 2HCJB 4J7UA 5KDLA 821PA 3I12A 3GT4A 3M4XA 5AD1A 4JB8A 1Y82A 2VUTA 3BPSA 2PKXA 1IMOA 3LHSA 4DSNA 3QUQA 3TINA 1UMDA 1PHPA 3UHOA 3KXKA 5J2UB 1PJAA 5G4KB 1I6LA 1A9PA 1PT6A 1S3SA 1YDWA 3BCRA 5JD3A 5HILA 1SC1A 4D41A 2QBYA 2WF9A 3KT3A 1PFYA 3F6BX 4AK9A 1REQA 4LRXA 1CHNA 2QTHA 1LV7A 2Z4RA 3RG8A 4BO4A 4D4HA 2WIFA 2XA2A 1U7UA 2GJKA 3QVGB 4RTQA 1JDPA 2C42A 1DKOA 2QX8A 2X0RA 1Y7LA 3DD5A 4XYEA 1OAOA 3AVWA 1E1CB 1Y9ZA 3PEFA 3U7JA 1GU7A 3HHPA 2IGTA 1AS3A 5IM5A 3ZUGA 3WK8A 4BTLA 3VR4D 3U49A 1EBUA 4ECAA 4A8JA 3LNTA 3TSYA 2XOKD 1JG2A 1NVDA 1MN6A 1SHLA 4FZRA 3U0BA 4NCIA 3TGWA 4DN6A 4XX0A 3RIGA 4CMKA 1LLUA 4IYRA 3NLLA 3ER9A 4NOJA 4F91B 4Y1RA 1BU5A 3HDHA 1TLTA 3R44A 3KRTA 4FNOA 5EWLB 3ZWWA 2D7DA 3K9GA 1IIBA 4GMKA 2JFQA 3W6PA 2QUJA 5LLTA 1P2UA 2EVWX 1XTBA 4J2HA 1U5BB 3ANMA 3PQ2A 4RESA 2VZ8A 5LB2A 5C32A 4CV2A 2RDMA 4OU5A 4P4TA 3BCSA 2GCNA 5K8JB 1WCV1 4KZPA 4WLEA 1NVMB 1RIFA 4DJTA 4ZI3A 1TZ2A 3B6IA 5HKAA 1SCBA 2HADA 1XMXA 2Y1CA 5BW8A 4E30A 4S12A 3TVDA 5HCIA 3Q3GE 1QH1A 4DLKA 3H16A 5HS6A 2RG7A 2Z6UA 1RJ9A 1HEYA 3NR2A 3VR3A 4AYTA 2P1RA 3K7EA 3R2JA 1J09A 4HEHA 4R3UC 1PNOA 2J46A 4CPDA 5HJ7A 3CRW1 1JPNA 4U3JA 4ZI7F 2B7BA 4BNMA 3B20A 4JBYA 4FS3A 4BMVA 1CP3A 1XRMA 1SO8A 1AKYA 1I1HA 1T8TA 2HRRA 4Y18A 5GMOA 1FP4B 1L9KA 5CTJA 3RC7A 5BORA 3W78A 4JB2A 1JEOA 2IHUA 3RVLA 3RYHA 5IYZA 4CL0A 2HSWA 2B4YA 3KWFA 5IKPA 1GP2A 1QJ4A 2NQ8A 1D4OA 1TVEA 5TQ0A 4PTZA 1IHDA 1V71A 2ZUCA 3UCEA 4A73A 5LXTB 1FMJA 3AVOA 5BOVA 2WB4A 1MQSA 4BO3A 4Z1MD 1DAEA 2E2WA 3REFA 1I3MA 5EUBA 4MJ7A 4ZVMA 1KK1A 1TMGE 4WY2A 2XTJA 4FGWA 4N3CA 4EY3A 3NP7A 3CIOA 1JA1A 1F0PA 4KK4A 1HORA 4LSZA 1F2UA 2O20A 4NBLA 4IH9A 3B6ZA 1UOOA 4EH1A 3Q9NA 3B78A 1F8GA 3VU0A 1Z26A 3L7DA 3PNMA 4PRZA 1M0EA 1JB9A 2YVLA 3AW9A 1CK4A 1E0JA 1MX3A 2OYRA 2H6EA 4J8PA 1G3UA 3LC0A 3URMA 4BCBA 4TTJA 1JHAA 4DMFA 5J2UF 3OQIA 5JMPA 5L4SA 3G59A 2ATEA 1A5TA 1X8KA 3E81A 1PRYA 1IHXA 1TCAA 4R83A 4R81A 1XQXA 1D0SA 3JQCA 3WJAA 4CG2A 5AI6A 1NFFA 1QG4A 4JSYA 2D7CA 5DGDA 1TCBA 3FLAA 1H2YA 1OT3A 2GEFA 3O4FA 5ALNA 3IAEA 5F76A 3OCWA 3H5LA 4LZOA 1JAYA 1IXZA 4H0FA 2XF2A 4G25A 4ESEA 4MW4A 5K8IA 3TEMA 3EDMA 4RF5A 3U3DA 5JDCC 4Y6SA 1KAQA 4EPRA 4P3OA 4DR5B 4PYKA 1J1IA 1OYVA 1Z4MA 2PH3A 1LPBB 2MSLA 2QRMA 3HV0A 3T1VA 3V4ZA 1W1UA 1FDWA 1RRFA 1R9MA 1RTTA 1UJBA 4INAA 4BC0A 4EHLA 3T5DA 1WWKA 5KQMA 4QUBA 1HDCA 3AUYA 2IDJA 1K8RA 2OO5C 2P5SA 2PZKA 1WP9A 2G6TA 4Y2QA 3TRFA 3UMGA 4BASA 1WTCA 2J33A 2O0LA 2IOFK 5IU6A 4MARA 4C4RA 3OFSA 5T57A 5BV1A 3EX7C 1RLJA 4DV1B 4YX9A 3WA7A 3DAFA 3AUAA 3R3ZA 5A06A 5LIPA 2WD8A 4P5EA 4KBYA 2HK8A 5ALJA 4TV9B 4PX3A 1MPXA 2NSJA 4FGLA 4UCXA 2H8GA 4P4SA 3N75A 1D7AA 1JA0A 1Z07A 4BBJA 1ZEMA 4IAOA 1OJ7A 1W75A 2VA9A 1FUIA 5KMGA 4YPOA 2ETVA 4KO3S 3HKDB 1OXXK 4B4UA 2EYUA 1NRIA 3CZAA 1C0KA 4YHHB 5KYVA 4P4GA 1T6YA 2JFYA 3W1VA 1KI4A 3AV0B 1VLQA 3PXAA 4JC0A 4KFUA 4YJDA 1Z4LA 4JDPA 5SY4A 4OHUA 3LECA 2ZAMA 3A6HA 5T6MA 3OFKA 4W5RA 2Y71A 2Z57A 3CURA 4R8LA 3STTA 3UMBA 4AUMA 4L51A 4BQQA 5C80A 2D8MA 3AUSA 4ACBA 4B82A 3ZS9A 2J3LA 2EW8A 5TV2A 4GXRA 4QGBA 4CKZA 1XVUA 2QM8A 1N5DA 2I99A 3OJFA 4LOAA 3PQ5A 5EKXA 3HJUA 3LX8A 5GP1A 1EWYA 2KYRA 2XY4A 3EVCA 3JYPA 5LXTF 3ZZMA 4C06A 4CIXA 2Z3ZA 4PYLA 3OE7A 4NAUA 4U2FA 4XTRA 1EEXB 1AV7A 2E87A 3NGXA 1ESNA 3B9RA 5C7OO 1XHFA 2RGYA 1VL8A 1MIOB 4HH1A 1ENZA 4G37A 5DLEA 4F60A 1KO1A 4DHWA 3QF4B 3P5BA 1R12A 1O0BA 2V58A 1T9GS 3N1UA 5FBKA 4B4DA 2D1TA 2DUNA 4JBIA 4Y2PA 1BROA 3I2IA 4KXUA 4IH4A 5H83A 4JNKA 2B1IA 4XD7D 4ZT5A 3QX9A 2PNJA 3GMDA 2GO1A 4RO0A 2X0DA 1LX6A 3QG5A 3SD7A 2NGRA 1FXWA 1O4VA 4ADSG 1R0ZA 5CAEA 2Q8NA 1XZDA 2IYWA 2ENUA 2WI8A 4P81A 4BZXA 4E7OA 4RY2A 3RADC 4LKRA 5JS6A 4Z53A 1KR2A 5CURA 1IN6A 1NA5A 1K0UA 4HATA 4UTOA 5CGQB 5J40A 2EJBA 3DL4A 3OX2A 4KH1A 3BD6A 1EUCB 4KE7A 3OWHA 4YT8A 3EW7A 1W2GA 2BTQA 2HL6A 3GRPA 4NBWA 2R25B 2NN3C 2CCGA 3BJMA 1U28C 4UM5A 1RP1A 2BHSA 2ACKA 4OATA 5CIQA 3OTQA 3AF0A 5DN9A 2CUNA 3RS4A 4NBTA 1RC8A 3LCMA 3M6XA 2ZBUA 1Y7IA 3ABQB 4W1SA 3RT1A 4HX2A 2EGGA 4Q24A 1Y1QA 4BECA 4C03A 4CN8A 1P91A 3Q9LA 2FOIA 4MVJI 4OMCA 1QX4A 1CE8B 4R3NA 4AS3A 5FYQA 4E5MA 2HZBA 5KWSA 3D6TB 3I52A 2BKAA 3ZLBA 2VDOB 1XYVA 3B2QA 3EQZA 4G6ZA 4LNUA 3A1FA 2JAQA 3NHYA 4LRUA 4M8KA 4W8GA 5EZYA 5KYWA 5K8UA 3GRZA 1YF3A 3E3AA 4UHCA 1CR4A 2Q4TA 3ED1A 2Z1DA 4PG4A 3UH0A 4AROA 4EFKA 5IX8A 3DTVD 5IXJA 3KYDB 1F48A 1P1IA 1RBQA 3VRHA 4DV7B 1YQGA 2V8BA 4TV9F 1MQAA 3AKYA 3DH0A 1T3HA 2DWCA 3RS9A 3SU8A 4EQ6A 5C8VA 1E2QA 4ZI5A 2NZYA 5AWFC 2ID8A 2FPPB 2BUBA 3EXG2 1G8PA 1VCMA 2HMWA 2IU0A 1Z4NA 4FGKA 2CKMA 4ZEWA 2C4WA 3FYCA 4XLZA 5AK5A 2YQ4A 2ZUDA 1QBGA 1UJ2A 2BTOA 3KOWA 1TC1A 2E4XA 1KMQA 3GVPA 4PLGA 1JHYA 1Y6QA 4UQOA 4WLNA 3KJIA 4ZAWA 4O4IB 4WW0A 2QP9X 1TFUA 1WMFA 4RJLA 1YRHA 3MW8A 5CLIA 3VC2A 1XP5A 3KV1A 2EZ4A 3QVJA 4QA9A 4AG5A 3IOBA 3ABOB 2W6CX 3ECCA 5DISB 4CIVA 2M98A 5K6RA 1GUBA 3RIXA 3UUFA 2NMVA 1GUFA 1JBEA 4R1UA 2ZJFA 4R2XA 2VCHA 2W00A 3IAM1 1K4KA 1ZIOA 2JZOA 1C9NA 3HJBA 2OK8A 4JKYA 1TUBB 3HBNA 5BRJA 4G67A 4JVOA 3DNFA 4MQBA 4H4CA 4MW1A 2KJQA 3M33A 3MUOA 3IQWA 5DHTA 1PJQA 2VBCA 2Q3JA 2OCAA 3EZGA 4Z54A 1M2OB 2YR0A 3KZCA 1L5NA 5KWEA 1UINA 2H1RA 3D8TA 4DXHA 5C53B 2P75A 5E8RA 1SY7A 1VDZA 2HU7A 4GLJA 1PZHA 1N9GB 1VE7A 2EFHB 2JH9A 2YKOA 3K1TA 3OCJA 3KQNA 4JGBA 1Y1PA 3U9SA 5A3RA 2ID7A 4PRLA 1JBQA 4KXVA 4TKUA 3QM1A 2PR7A 1CUGA 2AI3A 3E9ZA 3HM2A 4PIPA 4TSFD 4WXHA 1PLKA 3DONA 2OBXA 2EG5A 4RPCA 2Z56A 2ZWPA 1YBAA 5AKEA 3FLEA 1FXUA 3VR4A 1QYXA 2YX1A 3S2GA 1A7KA 3EAQA 1D4AA 4GXQA 3PL5A 4J0QA 3I2KA 2XOKA 3MMNA 4J16A 1FP1D 5ALQA 3SJ7A 1DX4A 4RZXA 2WKPA 1KU6A 2LV8A 2VHEA 3OIUA