2ZRNA

Msreca form iv
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
326
structure length
317
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 81
structure length 317
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrnA01
1G3RA 4NCNA 2FX3A 1G3QA 4R98A 4C30A 1FNMA 5B57C 4MKHA 3QSYA 3WNBA 1XEXA 3FHCB 2UKDA 4QRHA 1TL7C 2JJ2D 3W6NA 1E2EA 4NMMA 4P33A 1WP9A 4HEJA 3K0CC 1L4UA 2ZUCA 1DPFA 3GFTA 3TSOA 1LNZA 5EE1A 2HXSA 4TZ6A 3C4JA 4ZV4A 4RD0A 2REOA 2RGCA 1II8B 4UJ5A 3P20A 5EP3A 3VFDA 5B58C 2F43B 3TR5A 1VCIA 4B73A 2PEYA 1DADA 1EXMA 2ONJA 2GEVA 3NKVA 3U2QA 1MO3A 5AJZA 5K8TA 1EX7A 2A5DA 2BBSA 1OIVA 4RZ2A 3SEAA 1COWA 1Z6YA 3U3MA 1RYFA 2ONKA 1GFIA 4IVPA 4TSFD 3DKPA 4W5JA 5J5CA 2IS2A 3BK7A 3W6PA 2CNWA 2R62A 3PG5A 3OIYA 2WPDA 4LK2A 2QU8A 3P32A 2H7VA 4RFSB 1Q3TA 3KX2A 2IS1A 1EFRD 1S8FA 3PV0A 2FGJA 1HUQA 5DO9A 1Z28A 2ECKA 721PA 1VPLA 3ZVLA 1U2RA 3FFAA 1ESMA 4PHHA 5EZ6B 3VKWA 1LFDB 1E79D 3HYRA 3WHLA 1P72A 4OK3A 2BC9A 3R8CA 3Q9LA 2BV3A 3GLGE 3LLMA 3DM9B 3REFA 5BYKA 4AKGA 3QY0A 1Q3HA 4MDEA 1ANKA 1NMXA 4D81A 1KTVA 4KU4A 1JI0A 4AKHA 3X1DA 1E9EA 4M1OA 5FBLB 3BE4A 3CPEA 1SVWA 1U90A 1QF9A 1ZUNB 2P6UA 3DHWC 2G83A 2VP4A 1NY6A 4XTRA 2IHBA 3H0KA 2ZYTX 5JHGB 1I4TD 4URWR 4QGHA 1WQ1R 2QE7A 1XTIA 2BHRA 1KK0A 3I5YA 4F4JA 3X1WA 3Q5DA 1X1SA 2GCNA 3DMNA 1E1QD 4OKSA 3AVXA 1WRBA 2VBCA 1ZBDA 1SXJB 3IEUA 3SJZA 5FBVB 2XZLA 3C7KA 4TMKA 3IIMA 1IXZA 1N6LA 3B60A 4MYHA 1W48A 2IF0A 2XSZA 1EFUA 2JATA 3RNLA 2QAJA 1ESNA 3FVQA 4D0GA 1HURA 2B7BA 2OFXA 3EIEA 3QI2A 1V43A 4LDJA 1W5SA 1Z06A 4EJSC 4N0EA 4OQXA 1WBBA 1L4YA 2RGEA 4OHWA 3CRW1 4JS0A 1KMQA 2GNOA 4DVGA 3R7WB 3JZMA 4HSEA 5DYGA 3AKEA 2GESA 4HDOB 2HYIC 1SGWA 2YWHA 1J70A 1GDDA 4MQBA 2VTKA 3EG5A 2KI5A 4XH9B 2Q9BA 1A4RA 2GXAA 5J4LA 3W9YA 5FBWB 4A0GA 4CGZA 1H8HD 1JEEA 2R6CA 1YHNA 3R20A 4AD8A 4DRZA 5K8IA 1UF9A 1W47A 4DLSA 4DLVA 2KBEA 4MA4A 4V0ME 2AKYA 1Q1BA 4Q4HB 3U3OA 1I2DA 3UG6A 3ZVRA 3AKCA 1MT0A 5LB4A 2ZAMA 5GVSA 1OIWA 2ZS9A 3W3AA 4M21A 4A1FA 2GZDA 4HLCA 2CLCX 3U61B 2BEJA 2F1RA 1JJVA 1IN4A 2PMKA 4AIIA 4D4JA 3B1VA 5FI0B 4KXFB 3TH5A 1HEIA 4TL8A 1II0A 5CITA 4YXWD 3ICQB 4DB4A 4BEJA 2NPIA 1YR7A 1CULC 2R2AA 5E3HA 4HDQB 3WNCA 1UAAA 2JA1A 2VHTA 3WYFA 2PLRA 4YLGA 1OIXA 5FTNA 3UK6A 3KKQA 4Q7JB 2QN6A 2D7DA 3FMIA 1EESA 3M6AA 4E07A 3KJGA 3I61A 1X8JA 2IW3A 1NLZA 3O8RA 4QOSA 4CEHA 3CONA 1RYHA 1SHZA 5AWFC 2P5SA 1E2KA 3KJIA 5G53C 1L7VC 1XTQA 4KAXA 5E4FA 3FPAA 1A7JA 4GP7A 4R7ZA 5FOSA 5KU1A 3LW7A 5TV2A 3I4LA 4Q9IA 4YC7A 3SJBA 2PCJA 1AQYA 4HUQA 2YWFA 2X77A 3ZZUA 4A2PA 1YRAA 1XD9A 5C4GB 1LV7A 2NIPA 3AV0B 1NN0A 5J4VA 1XZQA 2ZE6A 3I5XA 1E6CA 2ZJAA 1TU3A 1MH1A 1M7GA 4DLTA 3PUZA 1NBME 3SN6A 5IHPA 2IYTA 2AX4A 4ERNA 5SZIA 4KFUA 3UPUA 3V4RA 1FMJA 2G0TA 2JLZA 5AJVB 5P21A 4Z54A 3NIBA 4GFDA 4KBGA 4M4SA 4PAOA 2O8CB 1D2NA 2QAGB 4HAYA 4TYNA 2KJQA 2J5XA 4Q7MB 1TQ6A 2NPFA 3VX4A 3N5CA 2O8BB 4URYR 1M2OB 1CRPA 2NO7A 1Q1EA 4HB3A 2QORA 1G5PA 5SZKB 1II8A 1PV4A 2F43A 1KSHA 4RVCA 4BFUA 4TMVA 2F9LA 4Q4JB 1OYWA 1DO0A 3LBIA 1DG1G 1NRJB 1X8LA 4BLPA 1KKMA 2OZEA 4OJKA 2R6DA 1UKEA 2RGGA 2GJ9A 2WWWA 1XTRA 2QQ0A 3HR8A 2AK2A 2KWIA 4FWTA 2HCBA 2I3BA 3IHWA 4OK6A 2JJ1D 4RD2A 4C0BA 1PLKA 3RRNA 4RFSA 2V6IA 1VHTA 1WBDA 3BGWA 1KDPA 2F55A 5L3RA 4QM7A 1IBRA 1QHHB 2W6IA 5FOTA 5FPKA 4KITB 1Z0KA 1OF1A 4TMTA 1KI4A 4B3CA 4B2IA 1YVDA 2FZ4A 2J0SA 1XEWY 4E09A 1Z83A 2QA5A 2HF9A 2ZRNA 4JLBA 4ZDKA 1GITA 4PSVA 3KZ1E 1UKZA 4WZBE 2V8OA 3JZAA 4G01B 4LSGA 3PEWA 1XXHE 3B1WA 5HCNA 1KGDA 2OM2A 4HZIA 4BE7B 1GNQA 1GOTA 5DLQC 2R8RA 3QKRB 4WW0A 1GL6A 4DDTA 3FHTA 4U5XA 4A82A 4TTPA 4P4TA 3U3JA 5J4HA 2GWHA 3R9IA 2ZI6A 3LXRA 3JVVA 4BZQA 2CL6X 4Z8YA 3FYHA 5M04A 1E2QA 5KSOA 3IKJA 1BO6A 1FPMA 2AL7A 2BJVA 2OCBA 1LS1A 2XB4A 4LJ9A 5KPDA 1SXJA 1J2JA 2QMOA 2H8KA 1S3GA 1P2VA 1F5NA 5IK2A 1AIPA 3K0SA 3TK1A 4QFMA 2ZYUX 3IDQA 3L8YA 2ZVPX 1AA9A 2EU8A 1HQYE 1KMHA 2ZS7A 2CHQA 1E9BA 1Q20A 4URUR 4M1YA 4M9QA 2A30A 3W34A 2IYRA 4II7A 3KKPA 4FIDA 4RD6A 1L8QA 2Z43A 1AA3A 1VG9B 4RCYA 1G5RA 2CVHA 1G7CA 1Z0IA 4B43A 3WRXC 3B9PA 3ZIAA 1XTJA 4C0LA 3R7WA 4A2WA 3VTKA 1LS6A 4PHGA 2QMEA 3K0FB 1N5IA 4PZLA 3U3RA 4C4PA 3A4MA 3V9PA 1IY2A 2CCGA 2O52A 4L16A 4M0LA 1FUUA 2IBMA 1Q1QA 2QTVB 1NIJA 4TLBA 4G3XA 1Z3IX 1FTSA 3DZDA 2ZRBA 3EX7C 4DHEA 1ZC3A 3K0AA 4R2IA 4V03A 4WXRA 3G0HA 2W6JA 4LYJA 4Q4HA 3BFXA 4FD2A 1N2CE 2WMOB 1F48A 2GBLA 3LNCA 1E2IA 4LOAA 2FEMA 3OIWA 2ZXUA 3AEZA 4ZCLA 5FR2A 5KYKA 4DCVA 3H4MA 3PIRA 4NDZA 3HJNA 5FL7A 3IBYA 3NEYA 2BMFA 3PEUA 3TUJC 4OI0A 2ZRIA 1DVRA 5HE9A 4IW3B 4JSTA 4A36A 1G17A 1TEXA 3CB4A 2YINC 4O0MA 2G9NA 4I4LA 4CZ2A 3I62A 2IS6A 2ZVQX 1KO7A 4FW9A 1IY1A 3EXAA 4D80A 2DFKB 5FTKA 4M9SA 2VYFA 3ASZA 3ZDQA 5DNYB 2P5TB 1YKSA 4PQFA 3KJEA 2QPOA 1FL9A 1ZM9A 4FINA 1CR1A 5SZJA 2BMJA 5JEDA 5KOYA 1ZAKA 4NYJQ 3BFKA 4JSYA 1N5LA 3AQ4A 5DN6A 4AY2A 2JJ8A 2GBLC 4DDVA 1KK3A 1Z6AA 1ZW6A 5FBQB 1BYUA 5CDFA 1YR6A 1D2MA 4PO8A 4LHZA 4RKEA 4LPKA 2QPAA 2YKGA 2XNDA 4DEXA 4DLRA 1FX0B 3K9HA 4HAZA 4TTQA 1NNEA 1FQJA 3ASYA 1AN0A 3GFOA 5B30A 1HY3A 2GF0A 4URVR 5EP2A 1WB9A 3D8BA 1AK2A 3HP1A 3SBEA 3EPHA 3Q7PA 1CJMA 3FKQA 4ON9A 4W9MC 4D25A 1RRGA 4B48A 2D06A 3IO3A 1F6BA 4PC3A 3FKSD 1KSGA 5AJYA 5DISB 1VKJA 4PPGA 2PMDA 2QAGA 3AP1A 5HE8A 4XOIA 4CEJB 1H8ED 2O8BA 3QPVA 3O8DA 1E0AA 3GLHE 2AK3A 2C96A 2ATXA 5DE3A 4XIGS 3NBZC 2VHCA 2FPMA 5D3MB 4IXMA 4JJZA 4B6EA 5J47A 4MUBA 2V7QA 1QHYA 4DUGD 3CRRA 1E2JA 5KNDA 1G8PA 2OG2A 2OO7A 2QMHA 1CRQA 4LHVA 2AXPA 4Q66C 2J59A 4NPHA 1OHHA 1OFUX 1IOZA 4Q7KA 4TYPA 2EYQA 4BEBA 4PZZA 4Q4AB 3NDBB 3WRYC 5ELXA 1OFHA 4DWJA 1QHHA 3LXXA 4CYMA 3BS4A 1D2EA 1U9IC 2FV8A 4Q00A 1UKVY 2W0SA 4GI7A 4CF7A 2ANCA 3SYLA 1X3SA 1R5NA 4Q9LA 4B44A 2JLSA 2HCJB 3T1VA 2ODBA 2CCJA 3D6TB 1JPNA 5FUVA 4DKXA 4FMCF 2ZJ8A 1XD2B 1SHKA 2ERXA 1E98A 4U00A 5KNCA 4LY6A 4B32A 1OH7A 1NSTA 2WWFA 4TSFA 3A58B 2QG6A 3DPUA 4KVGA 4GBMA 2WIAA 4TWZA 4IHQA 1AKYA 3QKRA 4LCBA 4KHZA 1UPTA 1ZNWA 3L0IB 4ACBA 4DLZA 1W2GA 4JL8A 3LVQE 3TQFA 1SKYB 3AKYA 5KDOA 1HYQA 2R6GA 2EFGA 4ZCMA 3EC1A 1JXOA 3P4YA 4QL3A 3AF3A 4XSHA 5DSZA 3UANA 3ZH9B 4EJSB 5C1BA 1SVIA 2VRWA 3ADCA 3CPHA 1EGAA 1KAOA 1KNXA 4YONB 1GSIA 4EIWA 1J90A 5JRZA 3RC8A 3GJXC 4MRPA 4RZ3A 2HJGA 1UBEA 5LBIA 2CLDX 5TXGA 4TLAA 2DFLA 3I32A 1YZUA 3B8HA 5FPSA 1YR9A 1OFIA 4UNRA 4LRWA 4V0KA 1G4UR 3LRPA 2Q9CA 2ZUBA 4MH0R 4DLUA 2FFQA 2WMNB 1OJLA 4B2LA 4WBSA 2WWIA 3KFVA 4AC9A 2MMCA 1OXSC 1UFQA 4AYTA 2MSCB 3CW2A 2GF9A 3QG5A 5E7MA 2GXUA 4Z1MA 4N3NA 4S35A 1BMFD 4PPNA 3NTUA 5H70A 3A4NA 1E2PA 1P7CA 2BVNA 821PA 1JAIA 2GK7A 5CM8B 3K0FA 3QVUA 3TQCA 4BFWA 1E1QA 1EWRA 2V9PA 3F0TA 3RVBA 1JAHA 4BLSA 3AVTA 1W0JD 4C9BA 5JEEA 2ORVA 2JDIA 3EA5A 4EPWA 1MABB 1T91A 2C04A 3LLUA 1KO4A 3KFXA 4IDPA 2NG1A 4ZKEA 1KI8A 2WV9A 1WE2A 1ELOA 2FFHA 2ZSEA 2IYXA 2B7CA 5BXQC 2RGBA 3KKOA 1NBMD 1II9A 4TL6A 3T5GA 1KI9A 3KTAB 4HZUB 3MMPA 1TQ2A 2QT0A 4EPTA 1S9DA 4IEEA 1E9RA 3B5JA 2DY1A 4MITA 3L8ZA 3ADKA 2WHXA 3HYTA 1ZIOA 2CK3D 2J7PD 4H9GA 1P3JA 3K8YA 2WOOA 4MYTA 4Q1EA 4KFSA 4PPFA 4PTLA 1QHXA 2GXSA 4L15A 3T1TA 1Z6GA 3M4YA 4NCHA 1E9FA 4HI0E 2Q3HA 3TRFA 2D2EA 3QENA 2UVQA 3SU8A 3NC1C 1DELA 3LDAA 2WM9B 2QENA 2QY9A 1Z29A 4QKQA 1OLOA 3M0EA 1JXMA 2WAYA 1DAGA 4Q19A 5FUXA 4G5QA 1RPZA 4PANA 2JLWA 5FUYA 4K81B 1JQLB 2NO1A 4Q01A 1M8PA 2AXNA 4EDHA 1TMKA 2CMKA 4Q1AA 1TU4A 4NL4H 4XSGA 3ND8A 1NSFA 3VR4A 1KK2A 1LY1A 2YYZA 4P4SA 4DSTA 4JLDA 5EXXA 2NMVA 1QRAA 5FL3A 1FX0A 1TEVA 4TLEA 3U7EB 3EW9A 2NO6A 4A92A 1UKYA 2X19A 3A1VA 2YOGA 3MSXA 621PA 2WOJA 1GVNB 1AS3A 2JCSA 4M22A 1E2FA 3CF0A 4XWAA 2D7CA 4HDCA 2QQEA 1KI2A 1BKDR 2F3TA 2P6RA 4HUTA 1NP6A 1NVVQ 3WNDA 1NI3A 3SJCA 4D4MA 2ZRJA 3IIKA 2ZAOA 1H65A 4PAQA 1OKKD 4YMTA 2GA8A 1WA5A 2ZSBA 3KQUA 4CEJA 2GJAA 1K5DA 1E4YA 1E1RD 1KYIA 1PLJA 4FCWA 3LV8A 1XU4A 2GRJA 1NKTA 2WJHA 1SVSA 3UIEA 2QM8A 4TMZA 5GJVC 5C2JB 5D3MA 2NZ8A 2ORIA 4Q03A 1P5ZB 2IYLD 3WHKA 4ARZA 3GCGA 1IN5A 1AM4D 1US8B 1N0UA 1NL3A 2IYWA 4JT4A 4N1AA 4ASUD 4JYCA 3NEJA 2VP0A 3ZGXA 3U7FB 1XCPA 2GCPA 1HQCA 4PZYA 1N6RA 4OHVA 4Q4AA 1KNQA 3EWAA 4O3MA 2J41A 4Q1BA 2FSFA 4Q47A 1XFAA 4JVMA 4MRRA 2CLSA 3GLIB 3PQCA 2VP2A 1IXSB 3QXXA 2OBLA 4CW7A 1Z5ZA 3BB3A 1WF3A 1YQTA 4U7DA 2YWEA 3NHAA 2ZI4A 3TVDA 4AI6A 2R6FA 3AUXA 3LAWA 1P2UA 2NO0A 4QHYA 4AWXA 1T9HA 4F93B 1XD2A 2ZITA 4LV5B 4D4KA 1N0VC 3EAQA 3GJ3A 1U8ZA 4IJMA 1A2KC 1RE0A 4R9UC 3LBHA 4Q1DA 5DI3B 3X2SA 2C77A 1UEIA 3OFND 3VX3A 4LHWA 1XX6A 2DR3A 1C9KA 1HTWA 2JJ1A 4IOJA 2VSOA 3A1UA 2H17A 2QEQA 1TAGA 1OT3A 4A15A 1OXVA 2JIZD 5HPYB 4EJSA 1R0XA 4P32A 3RANA 3AF4A 5FOXA 2REXB 5AUPB 2ZS8A 4ZIRB 2LWIA 3MWLA 1T6NA 2AHOA 3H1TA 1R0ZA 4WOPA 2RCNA 2AFHE 3BB1A 1SULA 3TIFA 2LKDA 2F1JA 1ZVQA 3UMSA 2G1JA 3MUFA 3FHOA 2PX0A 1RJ9A 1WCV1 1XP8A 1KHTA 2B21A 2BDTA 2XTZA 4MRNA 1DS6A 1KI3A 4Q48A 3I73A 5B2ZA 1N5KA 3B13B 2ZI7A 4I1VA 3DDCA 1D6JA 5JJIA 1F2TB 3FOZA 1ZC4A 2ZRKA 3OEHD 2N42A 4GP6A 4AG5A 2HLDD 3ICEA 4Z51A 3LH5A 2ZU6A 2HEIA 2J3EA 2ZE8A 4BFVA 2OFOA 4YDHB 2ZR9A 1JQJC 5EE3A 3QVVA 2FWRA 1S4QA 1NN1A 4QC2A 4BECA 2GTPA 4ZDWA 5JWHA 2EQBA 1CEEA 1ZD8A 4JBYA 1OFTA 1UJ2A 3NBXX 5JECA 2I1VB 2A78A 3AVQA 1MABA 1DAHA 2XEXA 4G5GA 2QUZA 4US2R 5JCZA 3E2IA 1PLLA 1FW6A 3RSOA 3B9QA 5L3SB 3CR8A 1AQUA 3TJZA 3J81k 3KDSE 3REGA 2GK6A 2CL7X 3H84A 1KDRA 3GLFB 2Q9AA 2Z0MA 3TGPA 4QHTA 2PBRA 1DOAA 3KTAA 4HZUA 3S1AB 3B2EA 3I8XA 5LB2A 3SYKA 1E0SA 3TVTA 1E3MA 1JBKA 5A0FA 2WSSD 3AGPA 1GP2A 2ZRFA 1FNNA 3EA0A 3PUXA 5GJWC 3TNFA 3I8SA 1SXJE 2BIFA 3TW8B 4V0OA 4BLQA 3KQNA 4JJKA 2RAPA 1TF5A 1X1RA 2C78A 3U5ZB 1GL9B 1G16A 1ZNYA 1G41A 1KJZA 2VQSA 5C4MA 4PFSA 1G3IA 4C7OB 1Q1ZA 3NXSA 3QPUA 4LBWA 3F8TA 3K0EA 2IUSA 1XDBA 3FB4A 2P0EA 4TN1A 5JHHB 3CM0A 2ZRCA 2CHGA 3MWKA 2V55B 2JLQA 2D62A 2QTHA 4Q1FA 3ECCA 4M53A 3KXKA 4OJQA 4F4IA 2IEYA 2GHIA 3Q5EA 1KY3A 2XZOA 4KBFA 3C41J 4JL6A 4EUNA 4XD7D 1U81A 2WKRA 2QMUA 4GZMA 1Z2AA 1Z22A 4QBHA 1HE8B 3P1JA 2ZE5A 1OH8A 1FP7A 1YJ5A 2X2FA 2YV5A 1DAMA 5H8WA 2FPLA 2FSGA 4DCNA 3TUZC 2BWJA 4LV8B 3X1YA 4V0LA 2A7QA 2FZLA 3RS5A 3SQXA 3CWQA 3GJ6A 1XJ0A 1Z47A 1KAGA 2AD5A 5G40A 3PEVA 5AUQA 3LY5A 3WP0A 3VHXA 1IHUA 5EXSA 3DEFA 3JVUA 2ODNA 2I1QA 4KCGA 2MSEB 4FI3C 3ZLJA 2IYUA 3V00A 4NYIR 3A1SA 5JS8A 2PL3A 1NN5A 1ZD1A 4GOKA 4LBZA 2B8WA 1ZMXA 4TMXA 1PZNA 3PUVA 1IXRC 1GRNA 2GCOB 4NHOA 1CU1A 1NJGA 4TMWA 1JECA 5J4KA 3L82B 2ZYVX 4KLNA 1UADA 1NKSA 2BOVA 1US8A 1RVDA 4LGMA 4O2LA 1G3UA 2MSDB 3TBKA 4DT1B 5FI1B 1G18A 1I4DD 5L3QB 4WIAA 1R5BA 2V4ZA 2XJ9A 3QOFA 1HE1C 4NYMQ 1ZM4A 3W8NA 1IAQA 5CJPA 1XXHB 3A6PC 2C99A 3QQ5A 4A8JC 1ZU4A 3QF4B 4B33A 1F3OA 2YNMA 3GLIA 1KOFA 2CHVA 3BFVA 1NG9A 2ODWA 2C9OA 4BFXA 4AURA 1R2QA 2VP6A 4TYQA 2BCGY 1NVWQ 4IRUB 4K8OA 4H1UA 1GL7A 4HB4A 1M1YE 4TLDA 3WYGA 4BFYA 4H1VA 5DI3A 4DEYA 4DUGA 3DOEA 1Y3AA 5AUNB 4L8GA 3C14C 1E2NA 4US0R 4IDQA 3L0SA 2WJYA 3RWMB 3Q8XB 5FOVA 1R0YA 2GAAA 1M34E 1RFLA 3RS7A 1OH6A 2ZUDA 2EYUA 3SR0A 1VIYA 1Z0AA 4B3DA 2FJUA 4M8NE 4MUAA 3Q7QA 4RJLA 1G19A 4ZDJA 1NMZA 4JMPA 2BBOA 5KTYA 2OUKA 4ZIRA 1NMYA 1CLUA 2WWYA 4B3GA 1JEDA 4WXPA 4MRVA 3LW8A 2J0QA 5AJXA 4LX0A 2QBYB 1C1YA 1GWNA 4NCJA 5CK5A 2D74A 4UQOA 1G6OA 1GKUB 1QG4A 2CCKA 2FMXA 4DLXA 4BRWA 4EFMA 4GZLA 1XPRA 3OESA 4PO1A 4IDNA 5JSZB 2HJVA 3MFYA 4NCIA 1F2TA 4Q9HA 2FF7A 3VNUA 3KKNA 4PHTA 3AVYA 2I4IA 2IT1A 2FN4A 3NHBA 5HKKA 2ZPTX 2WJIA 1VIAA 5KSYA 4DB2A 3UXMA 3T06B 1CJTC 1U0LA 3TE6A 4YMUA 2ZR7A 1N6HA 4B34A 3X1XA 4PHFA 4B6FA 3B78A 4DXAA 4M1WA 3RWOA 1AZSC 2DYKA 3AF2A 1ZINA 3K9LA 5UKDA 4F91B 4NP6A 5C46F 1FQKA 4POAA 4M1KA 1E69A 3GPLA 2O8DB 2BMDA 3TLXA 4ILEA 2NQ2C 2UZ3A 4LYHA 1SKQA 2GJKA 4TL9A 2WVJA 3IPYA 4BQSA 5EUMA 3ZQJA 4HLQB 1KI6B 4D2IA 3FGNA 3GLFA 1K5GA 1RIFA 3IPXA 1O3YA 3S1AA 2DWOA 2ZJBA 3CRMA 1XBTA 4JBXA 2AWOA 2QSZA 3PITA 2A5YB 3CNNA 1G20E 3B82A 4RSGA 3PVSA 5IF9A 1CR2A 2IXFA 3IO5A 1W0JA 4JLJA 2GVDC 3CZPA 2IXEA 3VKGA 1KO1A 2EW1A 3L2OB 3K70D 3C15C 2FA9A 4Q21A 4C7OA 2DPXA 4DCTA 2FEOA 1RZ3A 4Y0VA 4PC7A 3QKSB 1T8UA 3GMTA 5G3YA 4A0FA 4NU0A 4JLAA 3EWSA 4DCSA 1CBUA 3BJIC 2ZREA 3AH8A 4MDFA 4PC2A 3HU1A 2OT3B 1JR3A 2VIIA 1DTSA 3BD9A 2Z6VA 4ZKDA 2OLKA 2LKCA 3KXLA 3QEOA 1VG1A 4EPYA 5CK4A 1R7RA 3K1JA 5JWOA 2DFTA 3GEEA 3CIOA 4OQLA 1GUAA 1G7RA 2CJWB 4JVSB 1G4AE 4B2PA 4A4DA 4JVLA 1U99A 1XF9A 4G5RA 2G88A 3HPRA 1XCMA 1XCGB 2VPPA 2Z5FA 2QNRA 4LV6A 1Q21A 5D3QA 2N46A 2H18A 3HPQA 5BYJA 3GP8A 1TTTA 2B92A 3GLHB 5J4YA 1B23P 1JNYA 1KIMA 4HLDA 2VSXA 4C0JA 5DHFA 1ZUIA 4NTZA 4BFSA 1AJEA 1GILA 4QG7A 1M6NA 1FMLA 3CH4B 4Q5IA 4QXAA 4UNPA 3OF5A 3AP2A 4IFEA 2REBA 1PVOA 1XMSA 2IXGA 2F3RA 2W0MA 3WY9A 4LI0A 3CWZA 4MKIA 3WBJA 2W00A 2XZPA 5EE0A 2FNAA 1HA3A 2O8CA 4DSOA 1U9IA 3LA6A 2YHSA 1IY0A 2ZYWX 3OE7A 1RC8A 3BBPA 1GKIA 4CVNA 4IOKA 2KBFA 2GCOA 2YOFA 2IUUA 3RAPR 4BGDA 3C5HA 1SQ5A 4M2LA 1WDTA 2WBLC 2PJZA 4XVRA 5JI2E 4DT1A 1XTSA 2KB0A 2RH5A 3ND9A 4FN5A 2VA8A 1UBGA 4Q4JA 5L3VA 2DBYA 2F9MA 5L3QA 4KVAA 3WMEA 4W5HA 2VHQA 4G0NA 4D6PA 4JLPA 1VECA 1XXHA 2UZIR 3B7GA 5E7IA 2O0JA 1X86B 4TQUS 3QF4A 2DWPA 1R8QA 4GRAA 2IYQA 2J87A 1XTKA 2WAXA 4NZYA 1YZNA 4MKGA 2WJVA 1E1RA 2HF8A 4CDGA 4M1SA 1ZM3A 2JJ2A 2XJ4A 4V02A 3D31A 1AGRA 2VO1A 5E7JA 3G5UA 3GJ0A 2GKSA 3B6EA 1XEWX 4M1MA 3CLVA 2VHJA 3CUEF 2DCUA 2RGXA 3AUYA 1GIAA 3OIVA 2H92A 4FCVA 4QJ5A 4ASUA 4LZZA 4EFLA 5KDDA 3E5HA 4W5WA 2A2ZA 1U0JA 1DE0A 4HLUC 2IWHA 4F92B 1VG0B 1W4AA 3SHWA 1X6VA 5A4JA 1KI7A 2WJJA 4D0NA 1CXZA 1N6OA 3PUYA 4UKDA 2XTMA 3AF1A 3LQRA 2VF8A 2C8VA 2O0KA 4AKEA 1EFRA 3PENA 4CEIB 3CH5A 3E70C 3VAAA 3VR2A 2JASA 2ZRGA 3FMOB 3GFPA 2QBYA 1Q0UA 3CNOA 5TVKA 1XEFA 2O0HA 1E79A 2AKAB 4CRWB 4NE2A 5HZKA 5KHOC 2QP4A 3EPJA 4JIMA 5JI3E 4AKIA 4Z8XA 4Q9JA 2K5UA 2NGRA 4D4LA 5JSZA 3SFVA 3OFNA 1SXJD 2X1VA 1FFHA 1W2HA 5IK2D 1GTVA 4FXPA 2JLUA 1G21E 2EFDB 1E9SA 2E1RA 3CZQA 4OI2A 5GJCA 3UG7A 3SS8A 1F2UB 5CLLA 2JIZA 1PUIA 2QRZA 3MWJA 4TT3D 3ZD7A 1A82A 3R8FA 3B1XA 3F5FA 3NH6A 5EUQB 1LVGA 1S3SA 4F7WA 5KSPA 1W44A 2DHRA 3AF0A 4Q4LA 4RD4A 2CE7A 3K9GA 3WXMA 2ZRHA 2OBNA 3AVWA 2KE5A 3AVVA 2ZE7A 4IEIA 4F38A 4XTCS 1KZGB 4LC1A 3ZZTA 3QKUA 1GNPA 4AYXA 1YZQA 2QI9C 1NN3A 1T0HB 2J46A 4F4CA 1IN7A 1X8KA 3WP1B 3VR1A 5CIQA 5JBQA 2OXRA 2G1KA 1SKYE 4LUCA 2BCJQ 1KI6A 2YC2C 1MKYA 3IQWA 1T3SA 2HXYA 1E94E 2ZJ5A 3THOA 2H1LA 1G1MA 2W6JD 3LQQA 4HATA 2JEOA 8OHMA 1KI1A 4A9AA 3T15A 3SI7A 1BS1A 2ZTSA 1QVRA 4UNNA 4O25A 5ANRB 3TAHA 2YOHA 2OLJA 1J7KA 1TX4B 4OI1A 3U7HB 3DL0A 5H68A 1OPXA 4NONA 1K8RA 2AFIE 3SFZA 3VR5A 4JLMA 4EPXA 4YDSA 4C2UA 3LD9A 4US1R 2F7SA 3IHLA 1NJFA 3QKSA 2OFWA 1RKBA 4G5OA 1H8HA 3N2IA 1CR4A 4MGKR 4TL7A 3THWB 3NBYC 3NG1A 4WZ6A 3ZS8A 4NYIQ 4PQRA 1U98A 4BLOA 3CF2A 2NZJA 4A6PA 1ZRHA 4I1SA 4OHXA 2ZJYA 3IGFA 2ANBA 1Z6TA 1VYVA 1CKEA 2GILA 1XZPA 4GMDA 4QGGA 3QBVA 1IJFA 2WSMA 4CIDA 5IDVA 4M9ZA 2EWWA 2FE4A 2ZQ5A 3T35A 2RGAA 2ODEA 2CJWA 4LBVA 4B74A 1ZCBA 1E2GA 1VCMA 2QPTA 4RZXA 4OI4A 4KODA 4NH0A 4MRSA 4IVQA 1CP2A 2QGNA 4C0HA 2OILA 3PR1A 4JYBA 3K70B 2G0NA 3WBKA 4YXWA 3MG9A 4IOMA 4LC0A 3TUIC 1S96A 2XNDD 3D3QA 4MKFA 1YZKA 4EKDA 2ZJOA 5K8LA 5TMPA 3GEHA 2WWXA 4OBEA 4QM6A 1PUJA 1F60A 3BXZA 2ORWA 3VQTA 2GAOA 1OXUA 4QBGB 5EJEA 4XVQA 3CRQA 2WKPA 4XD7A 3QPWA 4A2QA 4E5UA 2B8TA 4ABYA 2C98A 4A8JB 1JALA 1AS2A 5EP1A 1EWQA 2ERYA 2XITA 2VHUA 1VDZA 3AVPA 1KKLA 1AKEA 2VF7A 4RFVA 4WA7A 4O2RA 4B47A 3DKVA 4L4UA 4LJYA 1XMVA 4Q02A 3R9WA 3OEED 2ZANA 2P6NA 3DVLA 4HUQB 3K9NA 1ODFA 1WMSA 2XOKD 3SE0A 2OXCA 5CIWA 2LCFA 2MMGA 5CYOA 1XPUA 4ZCIA 3QXSA 4V0NA 1R10A 3MRSA 3TSZA 5BN4A 1IN6A 3EPLA 2QTFA 5AK0A 3TMKA 2ZIAA 1R5OA 1SVOA 1NIPA 1OHHD 3RRYA 3GLGB 2GJ8A 1OW3B 3ZVMA 1CIPA 4FWIB 4Q18A 1N3BA 5HR5A 1UDXA 2FU5C 3GEIA 1SVKA 1G3MA 2EFEB 4QNMA 1IM2A 3UWOA 1VTKA 1SVLA 2YJTD 3HR7A 3Q85A 1KSFX 4NYJR 2CL0X 4YMSA 4AG6A 1L2TA 5HTKA 1GRQA 1VMAA 3IQXA 4PPQA 1OXTA 1S0UA 1CJVC 1MRSA 2JLRA 1W49A 3T61A 4EAQA 2FG5A 2GETA 5JLJA 2O8EB 2ZI3A 1HH4A 4I1OA 2VL7A 2YZ2A 3OAAD 1FOEB 3BORA 1A1VA 2OHFA 3EZ2A 5AJWA 1R8SA 2A5GA 4YQFA 3MJHA 2R65A 1AZTA 4DSNA 2FSIA 1P2SA 1TQ4A 2AWNA 2PEZA 2RHMA 1KO8A 1Q12A 3TW4A 1GKYA 3BH7A 3T1QA 2A5JA 3RC3A 1P6XA 4TYYA 4CEIA 3BB4A 3X1ZA 4DJTA 2P3SA 4E22A 5IT5A 2NO9A 2FSHA 4D26A 2XX3A 1CJKC 5BWMA 2OEPA 3O8CA 5FTLA 2IYSA 2W58A 1E99A 3MJRA 4PC1A 5LD2B 1ZM2A 3NBFA 3AKDA 4BWYA 4JZKA 3IILA 2QRNA 3HU2A 3AM1A 1MO6A 4I99A 4OQMA 5G3ZA 2P67A 2YWGA 2WJGA 4LJAA 1F2UA 1GRRA 3LBNA 1ETUA 1UM8A 1YRBA 1E2HA 3QUSA 3GLIE 4P4UA 3FDIA 3QXJA 3RABA 3N2EA 1U0HC 3BH0A 3TR0A 5TDHA 2D3WA 2E9SA 4KV9A 4MGIR 5JJLA 2PX3A 5A5GA 1QBKC 3GJ5A 2IEZA 2W2TA 1J8MF 5EXPA 1QHIA 4Z1MD 1W7AA 2IUTA 3KB2A 5JWRA 3QXCA 2IC5A 2XNSA 2WTUA 4LJ7A 4D82A 3C16C 2VLIA 1G9XA 1W4BA 1W36D 5GVRA 3CX6A 2ZJ2A 1W0KD 1P60A 2PJRA 5F3WB 2SHKA 2VP5A 2ATVA 4DLYA 3KXIA 2JDID 4IXNA 2BKUA 3T34A 3PXGA 4GNKA 3Q3JB 3TAUA 4WAUA 5CB6A 2AD1A 4LBYA 1KMHB 2HT1A 3SYNA 4LJ6A 3THXB 5KSZA 5JMTA 4W7SA 3I72A 2YC4C 1AS0A 3RRZA 3AVUA 4LHXA 4A6XA 1T3HA 1J8YF 2GXQA 1SZPA 2Q0HA 1V5WA 5EE5B 3KB1A 2WWHA 2IS4A 1OB2A 4RD1A 3O8BA 1W46A 3VU9B 2BJWA 2JGNA 3ZYCA 2PT7A 4QGAA 1Y63A 4OQFA 1NG1A 2P2LA 3SHFA 5DYIA 5BQ5A 2W2XA 4IDHA 1XJCA 2ZSFA 5TY0A 3THWA 1G8HA 2HDNB 1S2MA 2GDJA 3CPJB 1VYUA 4L9WA 3KQHA 5DH9A 4CT4B 3BC1A 3K0AB 3GJ4A 4Y0AA 1IJEA 5CLQA 3QE0A 1ZNXA 3RLFA 4DLWA 1M7HA 2FH5B 2CE2X 4FMDB 3T12A 1UBFA 2ZRAA 3SZRA 3CO5A 3EZ6A 2PCLA 1TF2A 2Z4SA 4I1UA 1VHLA 1BYIA 3A1TA 1QG2A 2H57A 3NC0C 1RRFA 4LHYA 5FPYA 3K09A 3ZD6A 2RGDA 1Z0FA 2V3CC 3CNLA 3T1OA 4AYWA 1G5TA 2GVZC 4OHZA 1QZXA 3ONWA 4JL5A 4URZR 1TQDA 2IWRA 5F9FA 1G6HA 4WVFA 4LJ5A 3NWJA 3THYB 2FOLA 3FWYA 4ESHA 1FP6A 2QP9X 4BFZA 3GLFE 2OCAA 2OCYC 2HYDA 5HCIA 1VG8A 1VYTA 1G8YA 1TF7A 5BN3A 3ETLA 3CX7A 4TTRA 1DAFA 2RGNA 2JLYA 3AGQA 3LX5A 3PCRB 4I81A 2GZHA 1EG7A 1IONA 1UEJA 2QGZA 3CF6R 4A8JA 4DZZA 5KPJA 5FBRB 3PFIA 1JJ7A 3ZJYA 2ZRDA 4WZAE 5GADl 1G8GA 4EPRA 4A0HA 221PA 3K09C 1R6BX 2BEKA 1T5LA 5KUTA 1MO5A 3BOSA 3A37A 1G291 3K70C 3FFBA 4E03A 3RRMA 2W2VA 1Z07A 2G3YA 3B85A 1P4SA 3BIFA 3ADDA 1JR3E 4X8LA 3OZXA 5IRCD 1KZ7B 3U44B 2Z4RA 4KYIB 3I3SR 4KO8A 1G7SA 5F98A 3RS0A 2EFCB 1QHGA 3GLGA 3C8UA 1C4OA 3FKSA 4QBFA 4ZO4A 2RGNC 2XXAB 1COWD 4LWZA 4RKFA 4X8HA 1LW7A 2CNWD 3FMFA 5CDFE 2RKOA 2WPDD 5FUWA 3FMPB 1H8EA 4JBWA 5SZHB 2IX3A 3WYAA 2ZJZA 5JZVA 4C2TA 1UDWA 1VCOA 4B35A 2RMKA 1KY2A 1A2BA 1OB5A 2ZI9A 2O8EA 1Z0JA 2XGJA 5TARA 4EQ6B 5EZ5A 1GNRA 3V4FA 5F9HA 5CB8A 4LYFA 4HAXA 1OE0A 1IQPA 4BUJA 1DAKA 1S1CA 3DMDA 1E0JA 1T5IA 4PX9A 1E2MA 4UNSA 4AK9A 3PJRA 3RS2A 1TUIA 2YVUA 1TUEA 5L8VA 4L5BA 2XB2A 2GJSA 1YR8A 1D9ZA 3LWNA 1XMJA 3Q72A 4KJZA 1CTQA 3H86A 4DIDA 3KQKA 1Q57A 2GZAA 2CEAA 1P75A 3UWKA 4DDUA 5CJ2A 4B3XA 4DCUA 2V54A 2Q21A 4NBSA 1EFTA 3RYTC 1NVVR 3SC3A 1NLFA 2IYZA 4QJ4A 2FGKA 2H16A 2HUPA 1OYYA 1JPJA 2BM0A 1LTQA 1P9RA 3VNVA 2QE7D 3KJHA 2EWVA 1G8FA 4HAWA 4ZPXA 3ZVNA 4RD3A 4ZI2A 3T5DA 4FMCB 4EFNA 3VR6A 521PA 4C3ZA 2P65A 2F1HA 1E9DA 3L43A 4UXIA 4PO9A 1CR0A 3GQBA 2B6HA 1RW4A 5CYPA 3W8RA 2C5LA 4D0LB 5JS7A 5JRJA 2XSZD 3I1FA 1DEKA 2DWQA 2W83A 3UKDA 1R0WA 5KNBA 1LB1B 2R44A 3H2YA 3ADBA 2IL1A 3RHFA 1S9HA 2ZR0A 3U4QB 2HT6A 4V0MA 1ZM7A 1B0UA 1E9CA 2ZRPA 1ZD9A 2N1BA 2Y8EA 2VEDA 4QHSA 5FH9A 5LPNA 4PXAA 1XPOA 2XTNA 5BW8A 5LD2C 2V1UA 3L0OA 3TSWA 4PR0A 2QROA 4Q9KA 3HU3A 4L9SA 3CRVA 3THXA 1XNJA 2WKQA 4IDOA 4TT3A 4B3BA 5L3SA 4B3FX 4KFTA 4BZPA 2IYYA 1D8TA 1XMIA 4BFTA 3D7MA 1KO5A 3AP3A 3QG1A 2WICA 2R6AA 4U02A 1BMFA 3W5IA 1K6MA 3FE2A 2ZRLA 2QM7A 3VU9A 2J0UB 2PT5A 4JLNA 4GOXA 3MWYW 1W36B 3I92A 3ZS9A 4C0SA 3MAAC 3R9XA 3QKTA 2X8AA 1SXJC 4RY2A 3EZ9A 3KUDA 1ZCAA 1A5TA 3BWDD 2VP9A 2GEUA 5TB5A 1UBCA 4HAUA 1OH5A 3OHMA 4FMDF 3EZ7A 3L0PA 4PSAA 1AGPA 3KQLA 3W3ZB 4YMWA 2Q3MA 1TADA 2BBTA 4BZXA 1QHSA 1KJWA 4HAVA 3EPKA 5J40A 3KL4A 4M1TA 3SOPA 4JLOA 4LYAA 2WWGA 1N25A 1NBMA 1I4LD 2CDNA 3B1YA 4C0KA 4ESVA 2JLXA 5FTJA 4K46A 3VMFA 4EPVA 3SNHA 1T0JB 5JCPA 2VSFA 3A36A 2QP3A 2CK3A 2J7PA 1RRPA 1GM5A 3QNUA 2PZFA 4OYHA 3HDTA 2BKEA 1Z0DA 3THYA 3CR7A 3ZQ6A 2OBMA 2EVWX 1HV8A 1W4RA 2NOAA 4QBIA 5C18A 3CKLA 1N0WA 3MCAA 5AR1A 4KI0A 3SBDA 3RSLA 3AB3A 3EASA 4BPBA 2OCPA 3QEJA 4M9XA 1ZUHA 2X2EA 4LPSA 2O8FB 3UMFA 1ZP6A 5DI9A 1CS4C 1N6PA 1NVXQ 2J7KA 4TLCA 2A3RA 4XWKA 3HWSA 1S1MA 3IIJA 2PLFA 3BAFA 3MGCA 3QXHA 1OSNA 5DIFA 1KDOA 5AUOB 2IF2A 1XD8A 3DZ8A 4JT2A 1G64A 4TZ0A 3EIQA 2ZROA 2CXXA 4GSYA 3KKMA 5E95A 1DAEA 2ZRMA 2ZSAA 4IOLA 4C0AC 4OHYA 3OIUA 2FFBA 2IHYA 4NKRA 1D5CA 4P4SB 3DM5A 4JLVA 1IN8A 1XWIA 4QNRA 2J45A 3M1IA 2OSBA 1PJRA 1N5JA 4GMXA 1XJQA 4BASA 1DO2A 4P31A 3MD0A 4RZUA 5JJKA 1T8TA 1E0KA 1XRJA 1NLYA 2IYVA 2G77B 3U44A 3RS3A 1E9AA 4JVNA 1T3LA 4HLUA 1YZLA 4GL2A 4J0QA 3QJYA 1ZYUA 5LDDC 2IA5A 4DSUA 4XJXA 4R71A 3K53A 2XXAA 2D4HA 1HT2E 1E4VA 4OQNA 1HT1E 3WMFA 4UXJA 4B75A 2FDCA 2OAQ1 2ZM5A 2OESA 4KFRA 1NY5A 1OKKA 2F1IA 2RHDA 3RDPA 1Z08A 3U6BA 2H5EA 2TMKA 2PZEA 3OEEA 1XEXB 4IVRA 4Q1CA 4IFBA 4RCZA 5EQTA 3G82C 3CX8A 4DBLC 1NVUQ 2W6ID 1Q44A 2XOKA 2ZI5A 4IKEA 4QGFA 2ZEJA 3SJAA 6Q21A 3PEYA 4MGYR 1M74A 1WXQA 4EQ6A 4MGZR 5CM9C 4ARZB 2CVFA 1W4CA 1G7TA 4R2HA 1P2TA 3W90A 1TPZA 3NVAA 1QDEA 5FFMA 4KLZA 1Z2CA 2BM1A 2OV2A 1ZNZA 2ASEA 4FMBB 3VKHA 2Z83A 2C9YA 4KSBA 4G5SA 3BH6A 1FTNA 1FUKA 3F3YA 1ZIPA 2QAGC 1N6IA 3DO6A 1XB2A 1I2MA 5BN5A 1FZQA 4ACAA 3P4XA 1P62B 4S2EA 3SDZA 4B71A 3IEVA 4FCTA 5G41A 3OAAA 1DBSA 1KJYA 3RS4A 421PA 4PQYA 1N6KA 2C95A 1YZTA 2FPKA 1ONBA 4ZDIA 3A8TA 3W6OA 1BOFA 3A1WA 1MOZA 3LFUA 3FTQA 1DG3A 5FPTA 1BIFA 5KO2A 3NH9A 3TKLA 5HKKD 5FOUA 2BBWA 2OAP1 3GJ7A 3LVRE 3PUWA 3SQWA 1P9WA 4XWOA 1JB1A 4NCKA 1YE8A 4DC9A 5FR1A 2V6JA 4QJ3A 3U4QA 4B76A 3B1ZA 1JR6A 1KK1A 1KSJA 4X8MA 3U3KA 4NYMR 1BH2A 4GOJA 1ZJ6A 2HV8A 4XVUA 1U8AA 2E87A 3VHLB 1E2DA 2ZSDA 3ZIAD 2NTYC 2QZ4A 3A4LA 1DARA 4JLKA 4UXHA 1N6NA 1RJ9B 1CJUC 1Q22A 3U6KA 3EC2A 4P0TA 3KUCA 2ZETA 3E1SA 4MYUA 4LJ4A 2O8DA 3IUYA 3ZZ0A 2ZU0C 5FOWA 4KYUA 5FPHA 4DIEA 1P9NA 2R9VA 2QT1A 3OEHA 2HLDA 2C2HA 1W1WA 4GDFA 1EFHA 4JKIA 1TNDA 4Q7LA 2QL6A 3BERA 3P27A 4X8OA 1MV5A 1EFCA 4P3YA 3WMGA 1E96A 5H1YA 4CT5A 1E32A 1Z6XA 2J0UA 2L0XA 4TYWA 2XAUA 4GPTA 1DAIA 3LO5A 4UJ3A 3AVOA 2C03A 1CF4A 4ITRC 4BLRA 1W0KA 5DGXA 2JAQA 1Z8FA 1LF5A 5FL7D 3GD7A 4LJ8A 3CBQA 2CBZA 1GG2A 2JLVA 2WZQA 1SVMA 1MR3F 5K8UA 2AN9A 4BRUA 2C9CA 1GAJA 2Q3FA 5KDLA 2IK8A 1YZGA 2J0VA 1P73A 2BMEA 5F2EA 1E2LA 1O87A 2O5VA 3VR3A 4TQAA 4BLTA 4ZI3A 4OL0A 1R4AA 3UMRA 121PA 5GJBA 1EK0A 1NF3A 3W5JA 1JR3D 3UATA 4PSKA 4C0QC 2WSSA 2DFNA 2RB4A 3EZFA 2DB3A 1D9XA 3EARA 5DN6D 1VCNA 1MRNA 2GEDA 1YU9A 1GZSA 1QHNA 3NDPA 4DDWA 1RRCA 1W36C 1P61B 1M7BA 5DHAA 4TQ9A 4HB2A 2V1XA 1LF0A 4G1UC 4HYYA 2EFHB 5HZHA 1KDTA 2F6RA 3BRWD 3LX8A 1Z63A 3N70A 5EE9A 3GLHA 4UNQA 2O8FA 1J99A 1U8YA 3QF7A 2Q6TA 2J9RA 4N0DA 4JKYA 4PAMA 4A0RA 3GJ8A 2QSYA 3U7GA 4OK5A 2PH1A 1OV4A 2J1LA 2OE2A 1T4GA 1EX6A 4PC6A 4GT1A 3O47A 4CEHB 1W5TA 5FTMA 3DOFA 5B64A 4YMVA 1QVAA 3OE7D 3K0CA 2WIBA 2G6BA 3EIHA 5JFGA 2VH5R 4KSCA 4MYCA 2KSQA 5EXTA 3MLEA 1MO4A 4HB0A 3IBGA 3QIAA 2D2FA 3P26A 1U94A 2A9KA 1OXXK 5EP4A 4URXR 1ZU5A 2AR7A 2A5FA 2V7QD 2PZGA 3U60B 3QBTA 2FFAA 3C5CA
chains in the Genus database with same CATH superfamily
3EVZA 2AYYA 1G3RA 1ONOA 4DYDA 3NATA 4NCNA 2XDWA 3JQQA 1G3QA 3LBYA 1YVRA 3M8KA 4R98A 5ALFA 5I7EA 3FRHA 4S04A 3UGJA 4HFNA 2QR5A 1KQFA 1DB3A 4WKBA 2YBEA 4NZNA 1JHXA 3ZDBA 3O38A 3CA8A 3BQNB 3CEPB 2YS7A 5LSAA 1LDMA 2DJIA 1WP9A 3OFKA 1WHTA 4INJA 3A14A 4RESA 5EHIA 2BHSA 4I6EA 3PC8C 1MW8X 5B58C 2EX0A 2E6UX 4HNSA 5BWCA 1BQ4A 3GRVA 2ZCUA 3OHPA 3TR5A 2YHIA 4RV9A 3VR6H 4L3WA 3U2QA 1CZUA 3UJCA 4C89A 5AJZA 4KR3A 4YUYA 1I94B 1FFAA 1Z6YA 1QIGA 2JGIA 4HNRA 4MVJG 5EL0A 1GFIA 4GUDA 5AM4A 1P81A 4I55A 5FV4A 3ANMA 2R62A 3PG5A 3CMCO 2KM1A 4L5JA 4MRMA 2QU8A 1TVEA 4HDRB 3U19A 1SRQA 1HR0B 1G8MA 1QFXA 2D3TA 1QVVA 2Q5QA 3K73O 3KTOA 3O2NA 4G56A 2GKOA 4R3WA 4R54A 3O4RA 1BQ3A 5EWJB 1JIKA 1X7XA 3KALA 3BTOA 4BX3A 5DTMA 3NM6B 4FFWA 1BX0A 1N1DA 5CU7A 3GCXA 5KAPA 1SEVA 3RIHA 2PU5A 1R12A 1XZJA 1U2RA 3GUCA 2W5UA 1ESMA 4PHHA 2JL1A 4E32A 4IG9A 2WE7A 1XU9A 5EEHA 1CHNA 1E79D 2IV7A 3HYRA 3HG7A 3R2JA 2FYTA 3WHLA 1P72A 3C6QA 3F46A 2BC9A 2PTHA 1AMUA 1PJ4A 3MQFA 4JLUA 1D0SA 4DMCA 4G26A 5AVYA 1XROA 5CB0A 1JF8A 2VZ9A 3LLMA 4AJLA 4EATA 2GCEA 3EBPA 2OBBA 1ZO8A 2Y77A 3RBXA 3REFA 3WGKA 4W5RA 2XMQA 1IUPA 3D3JA 1ZRNA 3OQIA 3LDFA 3D7KA 4PWYA 1JI0A 3AT1A 3ONVA 5LUBA 2VXCA 1W94A 3ZWQA 1A8PA 2MTBA 3FRIA 4EZIA 3UOAB 1ZUNB 2P6UA 4TS1A 4HDSB 4YHHB 4Z5XA 2XXBA 1MEEA 2IHBA 3OCXA 3H0KA 4KYVA 2PFSA 4XTRA 3BHIA 4URWR 4QGHA 1K7CA 3TL2A 1QC5A 2R8YA 5A9RA 1Z5PA 4DDMA 2BHRA 2GZ2A 3BE6A 4QO8A 3WGUA 3RUDA 4ZOEA 3I5YA 1I6LA 2HLPA 4LRYA 3EXG1 4GU5A 3AVXA 2RH9B 4CMIB 2XZLA 3Q4GA 1A3CA 3E1KA 3F8WA 1N6LA 2NUPB 2Z08A 1OV6A 3I5UA 1BE6A 2CVZA 1GZ3A 2XSZA 4DRXB 1MA3A 4NARA 2QAJA 1ESNA 2FEKA 3KYBA 4WT7A 4S05A 3TDNA 1ZXBA 2Z6QA 5CURA 5CFNA 2OFXA 4D9JA 4BMCA 2HPZA 4WINA 2NT3A 3ILYA 2JD2A 1Z06A 4EJSC 1OR8A 4ZRMA 1C7IA 2NXEA 1F38A 5G2OA 3ZS9A 4RMGA 2RGEA 2C0QA 1OQAA 2EX4A 4OHWA 4JS0A 3UJHA 1XZFA 2ZWVA 3OTIA 2GNOA 4UHDA 4V0RA 4JGGA 4TS3A 3JZMA 4RQBA 1UBOS 4RXTA 2GESA 3LUAA 3B6JA 4EA9A 4TRNA 3E3MA 5LU9A 1J70A 1KP9A 2WF9A 4PW0A 2V7WA 2KI5A 4D9KA 5C8YF 5ES3A 3NDRA 3W4KA 2R751 1K1EA 1A8IA 2EJVA 2JGLA 4GIBA 2UXDB 5J4LA 3IVGA 3W9YA 4MYDA 4NMHA 1GU0A 1TE2A 4ZTZB 4AD8A 2JFBA 3JVDA 5K8IA 1UF9A 3DUFB 4CTNA 3MTQA 4QDJA 3TBFA 4ZEMA 5LQMA 3CBGA 4BX8A 1Q1BA 2FUEA 3AKCA 5A0TA 1TTPB 2XVZA 4GXNA 3RRFA 5GVSA 1D1PA 1OIWA 2ZTUA 2ZS9A 3PSAA 2WTUA 3ADPA 5CVUA 2XKJE 5HS4A 5ESXA 4B6GA 5JYEA 1L9KA 1EP1B 4UHEA 3BMOB 3O31A 4D4JA 3RKUA 3NRCA 3ONEA 4IUBS 6REQB 2EARA 4CM1A 1NX9A 3HBJA 4BEJA 5K0EA 1GGHA 4G24A 2XA2A 3UMMA 1CULC 5E3HA 5IBPA 1J7JA 4MEJA 1BN6A 2QTZA 4Z9FA 3WNCA 1UAAA 1FUIA 3WYFA 4YLGA 4P98A 4JI1B 4EHFA 4TVKA 4HR7A 3BIOA 4WQMA 1UEXC 3TZCA 2D7DA 3HKCA 3SAJA 3UW3A 1BXZA 1GQ2A 1DDOA 3SVZA 1UT6A 4UBLA 4PBTA 3JWJA 3NWBA 4FHDA 1V0JA 2G4VA 1AX9A 1KMMA 3EIXA 1RYHA 4LZNA 1FP4A 1OU4A 5CX1B 5E2AA 5T3UA 4TN5A 4BCBA 1E2KA 2MOKA 1JA9A 1WVGA 3KJIA 3I2JA 1N33B 5G53C 1L7VC 1XTQA 2UZ1B 3FPAA 4P36A 1RHJA 4YASA 1XWWA 1DXHA 1ZSYA 2YWBA 4BNYA 9ATCA 1BGXT 1CYEA 2CVQA 4C6SA 5IYZB 2BUAA 4J29A 4HUQA 3DDUA 5CCBA 3ZZUA 1GLNA 1CWUA 5C4GB 2YRFA 3EXHA 1QK3A 4L75A 3EGVA 4BLVA 1Z2DA 3OICA 3BZUA 3OLQA 4ISBA 4P4NA 1NR5A 1L5VA 1WSDA 5EJ2A 1M7GA 3FA2A 1G2IA 1XN1A 1GGEA 5INTA 2Z56A 3GVHA 1H3FA 2IYTA 4B31A 3HVJA 1YZ3A 2ZB2A 3V4RA 1FMJA 2G0TA 1SA0B 1U6KA 4WERA 5BORA 4F5EA 3NIBA 4I8DA 3KQTA 4KBGA 4GXQA 1CUJA 1PNRA 4PAOA 1X42A 3SD7A 5K01A 5LA6B 5ALOA 1CY0A 1E7MA 1PSDA 2C59A 2QAGB 3M3HA 3P0FA 3EWIA 4HAYA 2KJQA 2J5XA 2JGKA 3I9V1 3L6CA 4LXXA 4Q7MB 4YRJA 2NPFA 2PWZA 3A04A 2QTBA 3K1ZA 5F9MA 3WC4A 4FHGA 2ENWA 2NO7A 4GM0A 1Q1EA 4M6WB 3FNGA 1G5PA 5DLDA 3HB7A 1PV4A 1KSHA 5BT9A 3F3MA 2F9LA 2HCFA 2XA1A 4GOOD 4Q4JB 4DA0A 1YBMA 1ORRA 2XHEA 1X8LA 2AA3A 1F8XA 4D43A 4FOSA 2RGGA 5E2BA 3LT1A 5CXUA 2QQ0A 1KY4A 1VMEA 4K2AA 4FWTA 4I9UA 4KEAA 2I3BA 3GRAA 3IHWA 4OK6A 2JJ1D 4FZRA 1K7SN 1L4KA 2FQQA 4RD2A 5KQPA 4XGQA 1RQLA 3I83A 4P7KA 4Q0MA 4F4DA 5EWJA 1PGNA 2G36A 3KQYA 4LIPD 4EEXA 1WBDA 3LQ4A 4NF2A 4QM7A 1IBRA 3FIUA 2VWQA 5FOTA 2C2XA 5A4AA 5F7OA 1QTQA 1USWA 4CM9A 5JNSA 1IBCA 2XV1A 4II2A 5B12A 4BKQA 1KI4A 2J48A 2NYUA 4FJ1A 2FZ4A 4E09A 4O4JF 2JC3A 3KWFA 5GZ3A 4JLBA 2ZRNA 1ABFA 1PWHA 3W9SA 1VJ1A 1LQ2A 1XXLA 1YCHA 3LMKA 1PVVA 3QIVA 4PSVA 4MAAA 4U39A 4WZBE 1TIBA 2V8OA 4O4JA 4LSGA 1IZ0A 4RQTA 1I3LA 3N2ZB 2GK4A 3UXHA 3PEWA 1CB7A 1KGDA 1P2DA 5EI5A 4BMNA 2GO1A 5DFAA 2VAMA 1G9TA 4RHTA 3RTGA 3PUKA 4H4EA 5DLQC 4QLOA 4Q9DA 2R68A 3TEMA 5FQOA 4D96A 5F7XA 1THGA 1GL6A 3GY0A 3Q7TA 3LSYA 4DDTA 1ZUNA 1TZ2A 2CVOA 3KDAA 3PYLA 5E9WA 4HDSA 1EP2B 2K7FA 4AQ7A 3KQSA 4KXVA 2ZI6A 3R9IA 3LXRA 2VF5X 3KPWA 4FYWA 3WLKX 4BZQA 3V7UA 1WLSA 1JQDA 2BZ0A 1DCTA 1V1JA 3MTBA 3IKJA 1BO6A 2JCGA 2OHIA 5LNK6 3K94A 4D99A 2OCBA 1LS1A 2JFWA 1V8FA 1UZUA 2O07A 4LJ9A 5AYVA 2OV4A 3FCSB 4OXQA 3ZWKA 2H07A 1LQTA 3LTEA 1FNCA 1AIPA 1KEVA 2X7JA 2CMHA 2NUPA 4M0DA 1LLQA 4UUOA 3K0SA 2K4MA 4FGKA 1J42A 4QFMA 4RIEA 4DRXA 2WHYA 3ZKWB 5KTSA 1TIKA 2OAGA 4IUDS 3OPYB 4C05A 2HWYA 3DFFA 4YP7A 1NI4B 3A25A 3KPYA 4YAIA 5EJ8A 2HHJA 3KKPA 1RM4A 2VZ8A 4P6VF 1AA3A 3NR2A 4KQXA 1RWBA 1L5MA 4RCYA 4YT5A 4XIFA 2PUAA 1G5RA 1HDIA 1KERA 1Z26A 2P0YA 5D5HA 1HRKA 1Y0BA 3M2PA 4HGZA 2M32A 4WY2A 3JPYA 4KIWA 4OAOA 5SICE 4C0LA 2VRBA 2WTXA 2EWMA 3V7NA 2FPGB 3O5AA 4PHGA 2VJKA 4DCOA 5HRUA 5K45A 4TWBA 1TLTA 3NANA 1UOPA 3ANLA 1V39A 3K0FB 2UYOA 2WEKA 3ZXYA 4CDMA 3KE9A 4Y2QA 1IVYA 3EQ2A 3F4BA 4FILA 4C4PA 1PL7A 2AZTA 2CXNA 3QY9A 3LP8A 5JZOA 1FUUA 3H5WA 4JGIA 3Q15C 3DZDA 3R6WA 4F2GA 3BWXA 1SQ0A 3G9ZA 5CUQA 1R0RE 1ZC3A 1CC1S 2WFZA 2YS6A 1YCDA 3H99A 3QYJA 4IIFA 4V03A 4L4SA 1WZIA 4N3CA 5LR6A 1F4VA 3G0HA 4YRZA 2ZPUA 1JH9A 1D2GA 4RV5A 1X70A 3AJ9A 3IUMA 3A1NA 1RMTA 1FJXA 3IVMA 4LOAA 4ZCLA 1ONNA 4EF6A 5KYKA 3JQ7A 3LGSA 3X44A 4DCVA 5FL7A 4OUKX 3WNZA 3BMOA 4OI0A 1RYBA 1T6YA 2ZRIA 1DVRA 3MK31 4KVZA 3OIDA 5HE9A 4ATNA 4A36A 1CRLA 2JIRA 6REQA 4IMJB 3UUEA 1MPXA 1RYYA 2RHRA 4GYJA 2ZVQX 1Y7TA 2VYNA 2FRXA 2W4IA 3U4AA 3VBEA 4FW9A 2X5KO 1JQBA 3ROXA 1QTIA 3EXAA 3KG2A 2JKZA 2RHGB 1OA1A 2FUG1 4GVXA 5FTKA 2ZGVA 4C4RA 2VYFA 2GBIA 4R01A 4TZKA 3H18A 1M0WA 4PQFA 1X1BA 3F6BX 1FL9A 1YUNA 5SZJA 4JI0B 2DWCA 1ZAKA 4NYJQ 3TLYA 3W9BA 3WNVA 2H06A 2JAWA 3BFKA 5CX1A 1MV8A 3IFSA 1U3FA 2OCXA 4ZOAA 3PXUA 4F45A 1RHKA 1Z6AA 1ZPDA 2UZ1A 1LRLA 3P4UA 5EUBA 5CDFA 3VU8A 3CZRA 1D2MA 1I6KA 2QPAA 1A9ZA 2AH5A 2B83A 4DLRA 4HAZA 1HETA 2C2ZA 1FQJA 2AR0A 1DRJA 5C3MA 3GFOA 1X7YA 4Z7NB 5B30A 3N0RA 3RG2A 1VPVA 4BMPB 4JBIA 3VSDA 1WB9A 4ZOQI 4ZJUA 1S4MA 2VK8A 3SBEA 3WGIA 2P1ZA 2PGOA 3Q7PA 3EPHA 2AE1A 4RO0A 4F4UA 1SA0A 3D4PA 3MGGA 4B48A 2F8TA 1QIIA 2F3SA 2GX6A 5H02A 3VC3A 1YV9A 4KQWA 1NBWB 5IJ9B 5DISB 5LA6A 4ADSG 3HCPA 2QAGA 3COWA 5DMHA 2R8XA 2JNWA 3IQHX 1Z68A 3R0XA 4IO0A 1V37A 2TSYB 4E11A 3BILA 1MBZA 3QPDA 5HE8A 3IMFA 3ECSA 3FMGA 2AZ4A 4RKWA 3TFWA 3LKBA 3N3AC 5F33A 2ODAA 1QUEA 1Y1LA 4M6WA 3FMVA 1P6UA 4LDPA 4FNMA 2NUTB 1CDOA 4H1WA 4UUAA 3FPFA 1IB6A 3H9GA 5DGCA 4IXMA 3K3PA 3ONNA 3GRUA 4UVGA 4NI5A 3U62A 3DC2A 4DUGD 3ZDZB 1L7NA 1E3DA 1HL3A 1L7RA 3CSSA 2CF6A 1B15A 4ZC8A 1FFDA 2M1XA 4CI0B 3OCYA 4LRUA 1CRQA 2O14A 1UM9A 2RSLA 3DB1A 3O90A 4AZ0A 3WYEA 2J59A 1OHHA 1WMEA 5LU8A 4UUBA 1OFUX 4Z4GA 4Q7KA 3BMCB 2ZYGA 1ZKMA 2XUZA 3FBGA 3GLTA 3LC7O 4NCXA 4PZ9A 4YDQA 4Q4AB 4JQZA 3WRYC 3H9EO 3D2AA 9LDTA 4BVFA 2WB2A 4Z0PA 1AF7A 1Z7EA 3BS4A 1QTRA 1Y6JA 4UMDA 4CYMA 3WICA 2B1IA 1OBFO 4ZYXA 3MS7A 1X3SA 2DKOA 2I3DA 2ZYIA 3AO0B 4Q9LA 2CLMB 4OGFA 2COUA 3ELBA 3KZNA 4NBUA 2JLSA 2HU5A 3EULA 2CCJA 1MMFB 1RPNA 7YASA 1HBJA 4RENA 4JC8A 1VKOA 3ILSA 3NAZA 2QGFA 1SELA 3K6SB 1S2NA 1SBYA 3ABSB 3SIPA 1P5JA 2FTKE 1N3YA 1Z4PX 4IHQA 2Q46A 4LCBA 4Q3CA 4KHZA 3LUBA 4DLZA 1W2GA 1ZSVA 3QFSA 2D1SA 3BULA 4UZEA 3GWZA 4YJ3B 5DT2A 3AKYA 1U2EA 1L7QA 2XPCA 5KNBD 2R6GA 3EZLA 1TJPB 1QIKA 3UANA 2FZEA 2YJGA 3AF3A 3G8YA 3JWEA 3ZH9B 4EJSB 1ZHOA 5TGDA 1RRMA 5KYUB 5L6MB 5FOQA 1TZCA 3ADCA 3OZSA 3CPHA 3WLMA 4N3GA 1KNXA 2RG7A 4Q16A 5DCUA 1T36A 1SCUA 4B87A 3WOVA 5ESRA 4JEUA 3SG0A 1KYWA 4LMPA 5J1TB 2Q5LA 1P3Y1 3OTWA 1WO8A 2YUTA 2ZWMA 3OPYA 1NE7A 4CCAA 1T0UA 3BQ9A 1JFVA 4R1NA 1NI4A 2PD3A 3X3HA 4LE0A 2QNBA 1XRQA 4UBIA 1G4UR 5F1OA 2ZUBA 2EAUA 4FFRA 3UGKA 4JV5B 2H48A 4I36A 5EAIA 2WWIA 1E5TA 4E13A 4C5CA 3KFVA 3BKXA 3EDYA 3QLVC 4MCHA 5CGQB 5DDIP 1CUXA 1Z17A 3QG5A 5WRFA 4N7RA 4C3VA 4CNQA 3QBDA 3S8YA 2OCIA 4Z4EA 1QNLA 2EBFX 3GNQA 4N3NA 1SRRA 5EWLB 4BP8A 4PPNA 1E2PA 2FPGA 3MRTA 1PAUA 1P8JA 3F4LA 4O4IB 4IICA 1P2GA 1QO0D 1I10A 1SBHA 2J08A 2H1VA 4N6OA 1GARA 3K0FA 3MT8A 1ENYA 1E1QA 3DO8A 4MR9B 1N36B 4UEKA 5JDCA 1EVYA 3HY3A 4X65B 4PYKA 4J1NA 3Q3HA 3TNDA 3AVTA 1H5QA 2WFMA 4JITA 1PJBA 3G85A 4M0CA 4LF6B 2QN9A 2JDIA 4U6QA 4BNUA 5HIKA 3L0YA 3H2JA 4PVCA 4M54A 1Q7CA 1KO4A 2Z5VA 3DAYA 1A7KA 2VPZA 3DKIA 4Q3DA 4QFDA 3UW1A 4BV8A 4ZKEA 2BZGA 2JHAA 3IDZA 4PM4A 4RJIA 4TM8A 2Y1FA 5DM2A 5BWBA 1W96A 2AXQA 3G0CA 4DNPA 4KN5A 2WPNA 1CZHA 2PKWA 5BXQC 5FUBA 2CNKA 4EG8A 4PLCA 2WM3A 3IOMA 3HCOA 3N2NA 5AI9A 3T5GA 4QDTA 5JMPA 1QIMA 5BRNA 2JJYA 3SS7X 3N2GB 1GQSA 1TKRA 2QT0A 3QVMA 1E9RA 3E5MA 1ZOLA 5COQA 2DY1A 3DOJA 4PGFA 1M5RA 1ZIOA 2CK3D 5FBKA 5B2EA 1K66A 4OHUA 2WOOA 4ROSA 1QGOA 3DH0A 3STVA 3T1TA 1RCFA 4HRYA 2QRHA 3GK3A 3PR3A 4NCHA 4IMRA 1KEUA 3IAS1 5HIMA 3WGHA 1QRDA 5CDTA 1E0DA 4OXIA 2AOVA 5K4HA 2A4KA 3HVIA 5JJ5A 5KYYB 1U28C 1P5HA 4EYKA 2WM9B 1QE0A 1H6BA 2CB0A 3KB6A 2QY9A 2YVQA 2MR5A 1U0RA 2HA6A 4OL9A 1IBSA 1JXMA 2WAYA 4WLUA 1CNMA 5AP9A 4JYMA 3MA0A 4Q19A 4C6RA 1O0SA 3O92A 3OM8A 3HUTA 2GN4A 2P11A 3KPJA 4LY9A 5F64A 5FUYA 2R86A 1VLLA 3T4EA 5C7IO 3KETA 3TTUA 1PSZA 2QSJA 2NO1A 2PDAA 1EMDA 2AR9A 3WLQA 4ZVOA 3ND8A 4D56A 1OC4A 4A8PA 1LY1A 5B7PA 3UAXA 4JLDA 2Q5IA 3O0TA 3UAVA 4ETMA 3DNPA 3DDZX 3PDCA 3PC8A 2JVKA 3P8ZA 1XQWA 1IM5A 2BFMA 3DXZA 2X19A 3TQRA 4BNLA 3ID6C 2YOGA 621PA 3RH0A 5ICEA 2DETA 3LF2A 3MBOA 1AS3A 2JCSA 5DYNA 1VOTA 3STHA 7ADHA 1N2ZA 1U0OC 1E2FA 2C2OA 4XWAA 5BN3B 4DFDA 3N3BC 1L1QA 2QQEA 4FYPA 1KI2A 4AJ9A 2P6RA 1SIWA 5IJ9A 3FNHA 4ZT3A 5EKTA 1NVVQ 2Q9UA 1NI3A 1H4TA 1MNQA 3E9DA 4L8LA 2XB9A 1V11B 1GCAA 4MIYA 4EKNB 4E70A 1FK8A 3BWYA 5ETJA 3FZYA 2PNFA 3FFWA 1E4YA 1E1RD 3I2YX 3GHHA 2PM8A 4FCWA 3HB5X 2NUTA 2ZUFA 1OFGA 3UIEA 2QM8A 4TMZA 4CIBA 2J8ZA 5C2JB 2X8BA 4UAGA 5K8CA 4IP0A 4HF7A 4NECA 1JFFB 4B3IA 5A02A 1IN5A 1A8SA 4O29A 2NU6B 4HQOA 4OHFA 1J0XO 1IULA 5HJEA 4JT4A 4N1AA 2R25B 4UUPA 3HV2A 3ZD9A 4DZTA 3JZFA 4BO0A 4WCDA 4DLTA 4CTJA 4O4HF 1HQCA 1E3WB 3BMCA 5CVDA 3G5LA 1Z5VA 3CFYA 1N6RA 3IAAA 4I5GA 1UXOA 3QI7A 2O3TA 4M49A 4Q4AA 5COBA 4WFKA 3I58A 3DWIA 4X41A 5DEIA 1G6Q1 1VKHA 4JVMA 4N03A 1IFXA 1F8UA 1U7DA 4QGBA 1YIDA 1S7GA 5IKOA 2VP2A 3QXXA 2OBLA 1ZITA 1WF3A 1YQTA 2L42A 4JD5A 3ZGVA 3ZWOA 3TOZA 3S1SA 3TVDA 4AI6A 4QASA 3AUXA 3LAWA 4I4TB 5DNDA 2ASVA 2VNKA 2VSNA 3DBVO 1E89A 4LV5B 4LF8B 3NOXA 1QH8B 3GJ3A 4NABA 4ENVA 3D1LA 1GUFA 3GFBA 2QLTA 3LHKA 4BC1A 4QO7A 3K6SA 1UJBA 3PYMA 4IS3A 3VX3A 3HGQA 5A1JA 2IHTA 5B7QA 2IU4A 1E6MA 3ZY2A 3ECAA 4I50F 2VSOA 3A1UA 2H17A 1DJOA 1KR5A 4DQLA 2TMGA 3ELYA 2XT9A 1G38A 4Y6LA 5ALZA 1TAGA 4I50A 1NTOA 1OT3A 2G9RA 4MW9A 3USZA 9GPBA 2JIZD 4ZFNA 1DRWA 4EJSA 1KORA 1R0XA 5KYUA 3AF4A 4R16A 3AINA 3RF6A 4XKJA 1IOLA 1K4YA 2Y0DA 4RVSA 3MWEB 3BBLA 1T9GS 3DE2X 1G63A 3FOWA 3QU4A 4H2DA 1V6SA 2FMKA 1WMFA 1JLHA 1FTWA 2JRLA 1SULA 3F6EX 4KNVA 2F1JA 3UMSA 2YDYA 1XZDA 4EVRA 1X80B 1I1NA 4AAYA 2AUNA 1WCV1 2BDTA 2B21A 4FR0A 5B2ZA 4Q48A 1DS6A 3AR8A 4QRDA 3I73A 1TB4A 3I6ZA 3WAJA 3JAMA 1L5OA 4WKPA 5LKAA 2YXPX 1SCIA 1D6JA 2R7AA 1NE2A 3OEHD 3PHLA 4I14A 1DC6A 5SYAA 3I05A 2FLWA 3RAGA 5FXMA 1LKZA 3Q6NA 4Z51A 3LH5A 1M2VB 5C5EA 3G5AA 1L7PA 4O4IF 3IUSA 2J3EA 2ZE8A 5EVCA 3B5EA 4MV7A 3MCUA 3HJGA 1JQJC 2PLWA 5EWLA 2G8LA 4O4IA 5EE3A 3AW8A 2I7DA 3DA8A 2CMDA 4KE7A 5I7FA 4QPNA 4JDUA 4MR9A 4D46A 5BR8B 4FZ5A 4JBYA 4P8RA 4OKNA 3WIDA 1WSWA 2WIFA 1Q7EA 3JY6A 1I4OA 4WUVA 1R6VA 4K1XA 2P5YA 2PR2A 1IM8A 3IE2A 3SKVA 2C58A 5FORA 1Q0RA 1PLLA 1Y3IA 3ROQA 1FW6A 1TIPA 2DERA 3UCEA 2Y1GA 3DL2A 2GEFA 1WTAA 1CZOA 3JW8A 5JG7A 4GQAA 1U0NA 3TJZA 1QF6A 1TJ5A 1VKNA 2XCRB 1HDEA 1ZESA 1X1AA 3FB1A 5JO9A 2DHCA 2G5TA 3H42B 3L4BC 4O08A 2HUNA 1MC5A 4TKVB 1E0SA 4JT9A 3SYKA 4BNNA 3OO1A 4DANA 1I51A 2NQ8A 3I42A 4FDAA 3D4LA 1UFOA 2Z1NA 4QRIA 4WLVA 2GM9A 3EA0A 5GJWC 3QMMA 1F4LA 1ECGA 3TNFA 5COAA 2BIFA 2P5UA 4M1QA 4BLQA 1DXYA 2UDPA 2ZIWB 4JJKA 4QSMA 3STYA 1TF5A 3DQPA 5IH7A 4J2TA 1Q92A 2BAGA 4Q3LA 4RMHA 3LUJA 1KJZA 3CPSA 3EG9B 3GG2A 2PS0A 2WVAA 1DC8A 3OJOA 3T3NA 2PKEA 3U7JA 5KYYA 2Q07A 4FBLA 4LBWA 2IEGA 1L8LA 3OLWA 2IUSA 3DR3A 1AH2A 4X3PA 4TN1A 1E5LA 1OI4A 4AXBA 4E1BA 2ZRCA 5IFLA 4DR6B 2D62A 3NTOA 4Q1FA 3ECCA 4M53A 4MOWA 3W4JA 4P58A 3X43A 1ISMA 5KC8A 4OJQA 5CCEA 2IEYA 2Q5EA 1LX7A 3O83A 1PP4A 3Q5EA 4GRDA 5A5VA 2XZOA 1ULHA 3OC0A 4CUKA 4XD7D 1U81A 4GZMA 5DLEA 1Z2AA 1LV8A 4YY3B 1HE8B 2NZUG 2VUTA 4N5DA 2C0PA 1KJIA 1FP7A 3FBTA 2JI6A 4UTRA 3HUFA 4YGXB 1RKQA 2P1DA 1JQ5A 2FSGA 3K6KA 2BWJA 2Q4TA 5DBOA 5LQCA 2J9ZB 4RVHA 4WLNA 1ZRSA 2A94A 1QP8A 3M33A 4IPTA 4UPVA 3WG9A 5MFPA 4G9BA 1YXMA 4XLLA 3CWQA 2F1KA 2QOEA 3GJ6A 1KAGA 3O82A 4AN4A 4JI7B 4D8WA 3LY5A 2HA2A 2H8GA 3PA8A 4BB0A 4M7OA 3K1AB 2EZTA 3K31A 1SU6A 3ROZA 3GLSA 1VI6A 5C1PA 2IEIA 3VHQA 3GDHA 4CODB 4WKGA 1DJQA 1EJ2A 1JQAA 3IP7A 4MEBA 2MSEB 5E6UB 5CHEA 2ZYSA 3ND7A 4NU5A 2IYUA 1DFIA 5KX5B 3BMQB 1VJ0A 1TCCA 2I71A 4RHYA 4P4GA 1XE3A 2C5EA 3PE3A 4C2AA 4GOKA 3PRYA 4LBZA 4AWBA 1J0EA 1NWHA 2B8WA 4BGUA 2GCGA 3WLOA 3CVWA 1Q50A 3LPAA 3O26A 2F00A 1ZZGA 1G5IA 2GCOB 4KWHA 1C7JA 1JFFA 1RHUA 3IUNA 4PLTA 4YS6A 1JECA 4UZFA 2ISQA 3DJYA 2G63A 1NKSA 1BFDA 2NU6A 1QFSA 4LGMA 1PQ4A 4GEKA 2XRMA 3S2EA 1I33A 2R4UA 2ZTMA 4LXIA 5FI1B 5KNCH 1KS2A 3DLCA 2QYOA 3DULA 2XIQA 3GA7A 1T2DA 3O7MA 1P31A 1R5BA 4JI5B 2GLXA 2XJ9A 1E3WA 4NESA 1HE1C 3W8NA 3UFXB 3RW9A 1IAQA 4K9MA 1XXHB 1JKIA 3CH7A 1DTWB 5H0IA 3T54A 1V9LA 4BAUA 4GQBA 5HRAA 1ZU4A 2Q6OA 3HABA 3MWDB 2B3TA 1CNFA 1QRRA 1YKGA 3LI2A 4MYRA 4NBLA 4RY9A 2ODWA 4HEA6 3RB8A 3B6MA 4BFXA 2JCBA 1NMQA 4Z7QB 2O2XA 3FX2A 1BRMA 3Q87B 4YR9A 3RYCB 1MOSA 2DECA 4I4TA 1DEXA 2YZ7A 1JBEA 2YH2A 4B83A 4K8OA 2IHVA 4KOAA 1QH8A 3GOQA 3WYGA 2COKA 2SCUB 3IESA 4L6CA 4TLDA 1FDOA 3H9QA 4JUBA 4X64B 4CIAA 4PBRA 1XYYA 4E21A 5A6SB 1FYFA 4EB0A 5K2OA 4K6HA 4X3OA 5C32A 3O74A 4KO3S 3L0SA 1N9GB 4US0R 2BFFA 3Q8XB 1R0YA 2C8JA 2FWMX 3ABIA 3KOMA 3I6QA 2NU7B 1V8OA 3WYAA 1PFWA 4I9FA 4L72A 2EYUA 4PLGA 2EKBA 4RIHA 4HQKA 1NVDA 4M8NE 3DNFA 4MUAA 1TTQB 3GEBA 3F2IA 4ZDJA 5L9AA 4MI3A 4HGPA 2BBOA 3KELA 4KH1A 1T4BA 2E4WA 4YYZA 5I7OA 3MWEA 4B3GA 1MN6A 1XKXA 3CH6A 4LXHA 4EG0A 1N7HA 1YB1A 5I3CA 2J0QA 1MB4A 4DV1B 2WM2A 1D6SA 1X80A 1T2FA 1GWNA 3NX4A 3WAKA 1ZG3A 4UQOA 5LXTF 1RCTE 2XXAA 1G6OA 2FMXA 3HGMA 4ZYYA 5FUQA 2V3VA 1P44A 5JSZB 2QU7A 1RPAA 4H7EA 3UO8B 4NOLA 3UT0A 3MFYA 3CN7A 1TW3A 5IKMA 4NCIA 3FHLA 4CL0A 5JROA 5HG0A 2FE1A 4ND6A 3DSRA 5A9TA 3AVYA 1PG2A 1QIJA 2DBVO 2IT1A 2Q28A 2B35A 3NHBA 4UOQA 3P0EA 4DMRA 1YGYA 2FMUA 2P1RA 5DKFA 1M2VA 4DB2A 1XJ5A 4ER6A 2P9CA 4RYLA 3TE6A 2ZR7A 2DUNA 1AT1A 5CG2A 1TW2A 1SCDA 4IGIA 1N8NA 1BJKA 2Z9BA 4PHFA 2VK1A 3GRZA 4MA5A 4UD6A 4JVOA 4R6WA 1Z4KA 5B2FA 3D7LA 2AQ8A 1WSBA 3B53X 4DXAA 3YASA 4W7HA 4X90A 1C3OB 1Z45A 1AZSC 3I9V6 1ZINA 5C46F 1PT8A 2NPOA 4ME6A 4POAA 1MAAA 1DC5A 3HKEB 4MPTA 3GPLA 4Q1VA 2BMDA 2PGLA 1L5QA 2NQ2C 2UZ3A 2WYUA 2GJKA 4LYHA 4TL9A 1JTFA 3T7EA 3VC7A 2QVXX 1ZIDA 1QFZA 3D6FA 1GNTA 5HF5A 3WK5A 1F0KA 3DE1X 5U1PA 4D2IA 4FEEA 1RIFA 5MN4A 2C7QA 3G3EA 1T8SA 4CFZA 1QV7A 1UWCA 2DWOA 3PWKA 2IIVA 2DWUA 1VLQA 4JJ8A 5JZSA 5CFRA 3FKJA 3JX9A 3E7WA 4DG5A 4P7BA 1V5FA 1W1UA 3PITA 3W3AD 1AKWA 4AW9A 1CRWG 3ADOA 5KQMA 2HDWA 3B82A 2WTEA 5IF9A 2FOIA 3VR4H 1CDEA 1L7MA 2AQKA 2IXFA 3ZWWA 5F5LA 3QX3A 1TA0A 2HPVA 4WZAA 3WA6A 2GVDC 3EG9A 4DA7A 4NEGA 3L2OB 3DG9A 1Z5GA 4H0FA 4NZ9A 3C15C 1FP1D 4MP8A 4ZHSA 5I45A 4KDFA 4FYKA 2DPXA 4DCTA 1E5DA 5DGIA 3PF8A 3ZNOA 2QZPA 1RWKA 2ZUSA 3AI7A 3FGZA 3GMTA 5AK6A 3ZDEA 4KR7A 1K88A 4MPPA 1JWLA 1DP4A 1PJQA 4CR6A 1U0TA 3C5VA 1Z7YA 2V7VA 4K8RB 3O4GA 4PC2A 5F3WB 5IU6A 3IJEB 2OT3B 4HNHA 4HDAA 4I6JA 5I8PA 4IZIA 4DUPA 1YDWA 2VIIA 2VKTA 3J7AC 3PKJA 1B3BA 1V5GA 1DKUA 4KX3A 1LBEA 4CF5A 3FGPA 2H6EA 2XAAA 3K1JA 3LUGA 2GNPA 1Q7TA 3C3XA 4JNCA 3HY4A 3RAJA 4CMHA 5DX8A 1EIWA 3RVJA 4EEZA 2PGJA 2ST1A 2V4MA 1G4AE 3CGGA 4IGKA 5AXCA 3MCVA 1OOEA 1U99A 2YJ3A 3N9IA 1RBMA 1Y4AE 2LDXA 3HPRA 5KMGB 1J2UA 3G2OA 4LV6A 2FQ1A 1IIRA 2QNRA 3AFOA 1Y1SA 1KH3A 2C3OA 2N46A 2C7BA 3KOOA 3DOUA 4MW7A 3HPQA 5BYJA 3GP8A 4J8PA 4XYGA 1G6KA 2B92A 2ZUUA 1JNYA 2DQ4A 3DQZA 4HLDA 5DHFA 5CFPA 3U3XA 1AJEA 3LPCA 3ON5A 4X00A 5KX5F 5E6UA 4Q5IA 3EVBA 3IULA 3OF5A 3UV3A 1DTEA 2REBA 2CW5A 2WNHA 1H3NA 2X41A 5LDGA 1DXOA 2ID7A 4FFSA 5KX5A 2YQZA 3BMQA 3WY9A 8OHMA 2UUCB 3CWZA 1EHCA 3WRYA 3PXAA 5KYGA 2O8CA 2QQGA 2XUJA 2I62A 2P6OA 2YHSA 4CHTA 2YRWA 2W4QA 4IOKA 3D0KA 5ITZB 1PL8A 2GCOA 3AEUB 3TIGA 3C5HA 1SQ5A 4UAUA 3RVRA 1WDTA 4BC0A 1XALA 5KKCA 1Y3CE 2IX9A 2YXDA 1HYGA 1O97C 2OFFA 4J2OA 3AIKA 1V3VA 1TJ3A 1XTSA 2KB0A 2NTJA 4B6QA 1P18A 4MICA 4F60A 1V71A 3KE8A 4QYTA 2DBYA 1Y9AA 3IKVA 3PGJA 1NW4A 4KVAA 1N75A 4WFJA 4A8HA 4ZI7F 1GG9A 4NFLA 4YAOA 1QNFA 3UA3A 3G68A 3M6MD 2VHQA 2ZJ3A 4G0NA 3UFXA 2FP4B 5CA0F 1RKVA 4ZI7A 1XXHA 1DV2A 2UZIR 3UXEA 1DTWA 1IZ9A 3K2EA 2VDKB 3ZZ1A 3MWDA 5CA0A 1A4XA 4ZQGA 4GRAA 3R5FA 5EPUA 2J87A 1GSOA 1XTKA 5KJCA 3A6DA 4G89A 4MKGA 4O02B 1T0PA 3I2KA 3GRCA 4TVOA 2DXIA 3RYCA 4M1SA 5LFAA 2NZXA 2XJ4A 1P4HA 3BCUA 3IMKA 3AHDA 3V3TA 2OHJA 2UZ0A 4TL6A 2CLOB 1AGRA 2SCUA 3RODA 2Z6AA 3RT7A 5DNUA 1VP9A 1KXZA 2OGUA 2BDEA 3R4CA 5A6SA 5KU7A 1PFQA 1PDVA 1HRDA 2VHJA 4I3FA 3O8OB 5A9SB 2DCUA 4ASUA 1N9GA 1GIAA 2AMJA 3OIVA 1N2BA 2GOYA 4FCVA 4IIBA 4KKXB 1MJGM 2NU7A 4LZZA 3UQYS 4W5WA 4EYSA 4PE5B 1U0JA 1J33A 1DE0A 1KAEA 2G67A 4YROA 1VG0B 3GLRA 3U5TA 1EBFA 1WUKS 1YMUA 5FQNA 3UV7A 5JSHA 5LJLA 5A4JA 3KXPA 5B53A 2BLLA 2Y76A 3FPKA 3PJDA 2FUG6 1CXZA 1N6OA 2Z5LA 3WOHA 3QLVA 1UXHA 2XTMA 3GXBA 2JHGA 2V5UA 2VF8A 2C8VA 5CT5A 3I9LA 4CEIB 2FPOA 3E70C 2AFVA 4LVUA 4PGHA 3VR2A 5BPHA 1U7TA 2I66A 2ZRGA 3FMOB 2R0QC 5LBUA 2OPBA 2B78A 2Q1TA 1Q0UA 3CNOA