2ZRNA

Msreca form iv
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
326
structure length
317
Chain Sequence
b'APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 81
structure length 317
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrnA01
5IK2A 3R8FA 5CDFA 2A5JA 1K5DA 1W46A 4Q21A 4KHZA 3SYNA 2AFHE 2XAUA 4EPRA 1FTSA 1LF5A 1DAKA 2R65A 2JGNA 2FH5B 3B2EA 5EE1A 1N5JA 2BBWA 2CL6X 2IXGA 2XZPA 1ZM3A 1MO5A 4XIGS 3ADBA 4JVLA 2NG1A 4L5BA 1FP7A 2Q3FA 3FYHA 3WYAA 5FTJA 1IJEA 1BOFA 4JLPA 5JSZA 1GKIA 4DLRA 3P4YA 1EFCA 2J5XA 1QZXA 2QUZA 3C41J 3NVAA 4Q4JA 2WWHA 4R2HA 2RGCA 1T0JB 3IPXA 1UBFA 4A9AA 3PEVA 2JCSA 3K53A 2GNOA 4LPSA 1XRJA 4RD6A 4WZAE 2LCFA 4ZPXA 2VH5R 3R8CA 2PLRA 1MH1A 1U2RA 2IYYA 3WNCA 2ZRPA 2NPIA 2QORA 4KFRA 4NONA 4Z8YA 2O8BA 4PQRA 4UXIA 4LHYA 1Q57A 3V00A 4AK9A 2O8CB 3NDBB 3IIJA 4LV5B 2B21A 1XJ0A 1XTJA 5FOSA 4QM7A 4L8GA 2VA8A 1BMFA 4OI1A 3R9XA 1A7JA 2WOOA 5DLQC 3UXMA 3QKSA 4LV6A 4B48A 4KYIB 1UM8A 1JR6A 1UF9A 3BJIC 2DYKA 3DL0A 3QEJA 3SDZA 4C0KA 3ZZUA 3KQKA 1FNMA 4LHVA 4GFDA 5FPHA 4RFSB 3AP2A 4MYTA 1JEEA 1KJZA 3I8XA 2ONKA 2ZI4A 1N6RA 2V9PA 3MLEA 3BFVA 4B3BA 2ZRGA 1P9RA 2FE4A 2DFNA 4BLQA 1Z2AA 2KB0A 4QGFA 1XXHB 1S4QA 4EPYA 2W6IA 2WMOB 1H65A 5F9FA 4JMPA 4LC1A 1COWD 2X8AA 2J0SA 1GL9B 1IAQA 2OZEA 4A15A 4DB4A 3F8TA 1HTWA 3FKQA 5CB8A 1NN0A 5FBRB 3ZVNA 5JWRA 2V54A 5SZIA 1YZGA 1ZUHA 2XNSA 1E69A 2JDID 5DYIA 3U6KA 2ZR0A 1IBRA 1KTVA 4PAOA 4ZKDA 3OFND 2B8TA 1D5CA 2BEJA 5JWHA 2VP4A 4PC3A 5FL7D 2DWQA 2QL6A 3TE6A 3PQCA 4V0KA 1EGAA 2YV5A 4B2IA 1AK2A 5BYJA 4A6PA 1RC8A 3UANA 1SXJC 3OEEA 2ZANA 4NBSA 2N1BA 4QGGA 1CIPA 1KI4A 1NBME 4DSTA 2VHCA 2CCJA 5EUQB 5H68A 4HUQB 1VDZA 4LJ8A 5EE0A 3BXZA 3K0CC 2QGNA 3THYB 3LRPA 3W5JA 3NBZC 3FFAA 5FTLA 4L9WA 1U0JA 1IQPA 4BLTA 2BMJA 4A82A 1EWQA 2PZFA 4IOJA 1E79D 1NVUQ 2QMOA 2GEVA 4OYHA 4M1WA 2IW3A 3RVBA 4QJ4A 2Z83A 2J7PD 2WICA 1S1CA 5J4YA 2FGKA 3B6EA 4CT5A 4CEJA 2C9YA 2C04A 2E1RA 2FX3A 3QVUA 4DKXA 4NYIQ 1J2JA 1R2QA 2CDNA 5AUNB 4FWIB 2J0VA 2EQBA 2WJVA 1P2SA 4BZXA 1RZ3A 3GLHB 4M0LA 1M1YE 3K70D 2HJVA 2WJHA 4CEHB 4KBFA 1VYVA 1Z2CA 2E87A 1FUUA 3DPUA 1N0VC 1AS3A 4A0FA 1OH8A 3AVUA 4JLNA 4LWZA 4MGYR 1ZJ6A 3TUZC 1D8TA 1AA3A 4RCYA 3H86A 4V0NA 1XZQA 4JJKA 2AKAB 4MGIR 2QBYB 1M6NA 2HCJB 2CBZA 2QY9A 2Y8EA 4MGZR 1HT1E 4F4JA 1JR3E 3EXAA 3K0FB 2BJVA 2CE7A 2RGDA 2XX3A 5BQ5A 4OK6A 4KVGA 3M4YA 4Q4AA 3ZD7A 3NC0C 2J7KA 3NC1C 1KZ7B 3AGQA 1LVGA 2ODEA 1KDOA 4TWZA 4C2UA 1XMSA 2BVNA 2RH5A 4NTZA 1YZNA 3Q5DA 1KK2A 1S96A 2PZGA 4TMKA 2CLDX 3B1XA 4B6EA 2ZRBA 2QNRA 5G3YA 3X1XA 2AKYA 2YZ2A 4O0MA 2OCBA 4AG5A 4DCVA 1CU1A 4N0EA 3QXXA 1OJLA 3JZAA 3SNHA 4KLZA 4B33A 3A36A 3HU3A 1G19A 4UJ3A 2RGGA 1E9SA 4IVPA 1RE0A 4F4IA 4ZIRB 3N5CA 4JL8A 3BH0A 3E5HA 3ECCA 4BLRA 2XJ9A 2D06A 3LW8A 4JLOA 4MRVA 4Q4HB 1SXJB 1DPFA 5L3VA 3B13B 5FBLB 4ZI3A 1TUIA 2C9CA 5FR1A 3I61A 2F43B 3H4MA 5EQTA 2W6JA 3DM5A 3OESA 5GADl 3LQRA 4N3NA 2QAGA 2ZJAA 1TAGA 2ZYWX 4MKHA 4RD0A 1ZM7A 4FMBB 2DFKB 2RKOA 1FPMA 4IHQA 2F55A 1U90A 1P60A 2QZ4A 2G1KA 1MABB 3KJIA 2IYTA 2GAOA 3TBKA 2QE7A 3KFXA 3KJHA 1M74A 1W44A 3K09A 3CWZA 1PLKA 1Q1ZA 2BKEA 2IYQA 3BD9A 5CITA 4Z54A 1E99A 2OLKA 1OE0A 2CLCX 2YWGA 3QXHA 4ARZB 2GJKA 1LB1B 1ZD8A 4CT4B 1KMHB 2ZJYA 3LY5A 5HKKD 1IONA 3UMFA 2FPLA 4D0NA 1Z0FA 5JI3E 3J81k 1Z3IX 2ZEJA 4Q18A 1Q1BA 1DG3A 2FEMA 2IHYA 4Q66C 4CGZA 3SS8A 1E1RA 3EIQA 3THXB 3CRW1 3I1FA 1KAOA 4XWAA 1GTVA 2R6FA 1KGDA 1RJ9B 4WA7A 3VAAA 4HAUA 4M1OA 4FCTA 1ZUNB 2BM1A 3IO3A 2PX0A 3LO5A 1OYWA 2NO9A 5CDFE 1S2MA 2F3TA 1NI3A 2ZU6A 4B3GA 4O2LA 4J0QA 3KX2A 5E3HA 1IY2A 2MSCB 3QXCA 1WXQA 1G20E 4WZ6A 3CPEA 5SZKB 2K5UA 2KSQA 1E4YA 1GOTA 1OF1A 2VHQA 4CW7A 1IXRC 1LV7A 2ZXUA 1AA9A 1OB2A 4C0JA 3I62A 1XEXB 4HLUC 4ERNA 2ZI6A 3AQ4A 1ZNXA 2ZQ5A 4HB2A 3U5ZB 1OH5A 1E2LA 2WMNB 3FHCB 4DDTA 1G4UR 1U9IC 1UDWA 2YYZA 2ZR9A 4GP6A 2AHOA 2VP2A 4JT2A 3WHLA 1UJ2A 3RS4A 2CK3D 2IF2A 3TIFA 2VHUA 1P62B 1R0ZA 2IYLD 2HLDD 3FMFA 2ORVA 4C7OB 1KDRA 3FKSD 3P32A 1VCMA 2XGJA 2FU5C 3GLHE 1TU3A 1T5IA 2QTHA 2J0UA 4UQOA 1Z8FA 2QAJA 4JSTA 1KYIA 2VHTA 1TQ4A 3K0SA 1NG9A 4QM6A 3W6PA 3MWKA 3ZJYA 1SQ5A 2IUTA 1QHHB 1KI8A 3CONA 4OHZA 3B9PA 1R6BX 3CRVA 5KDDA 5GJVC 4RD1A 1Z28A 4B76A 2FG5A 2D2EA 5JZVA 2CHGA 5E4FA 3W3ZB 3U44A 3QNUA 3JVUA 3RS3A 2BDTA 3EZ2A 3A6PC 2PL3A 3MD0A 1VCNA 2G83A 5KNBA 1VG1A 1NVVR 1XCGB 1M34E 2AK3A 4C3ZA 4D0GA 1AQYA 1VYUA 3W3AA 1KOFA 4HAVA 3MFYA 3G82C 4FCVA 4Q7LA 2ZSAA 1XD2B 5FOUA 1QG2A 3K70C 1OXTA 1DARA 3NH6A 2ZU0C 2GVDC 2W00A 5ANRB 4KLNA 1CXZA 1FOEB 3OIWA 5L3SA 1GKYA 4G3XA 1TUEA 2RHDA 4DIDA 1A5TA 2XXAA 1CF4A 2JJ2A 2ZI3A 3IQXA 2H7VA 2JIZA 2C99A 3O8RA 4RKEA 5J40A 1G16A 3UMRA 4C0HA 2IYSA 2VSFA 1OFIA 1FP6A 3GEHA 1ZU5A 2QP9X 3KZ1E 5E7MA 3W5IA 1JEDA 4PPGA 3M6AA 2NO6A 3MJHA 4RKFA 1ZM4A 5KYKA 1SXJE 4P33A 2GF0A 1XCPA 3GFOA 3JZMA 1TQDA 1KY3A 5B64A 1N6LA 4Q03A 2JEOA 4HDCA 4BFYA 5JECA 5LD2C 3KL4A 4PXAA 1R7RA 2ZRFA 2AFIE 4NZYA 2XITA 5ELXA 2GVZC 1XPOA 2G0NA 4IDOA 3NHBA 3QKRB 2BCJQ 4URVR 3D7MA 2IS1A 2VL7A 1P9WA 4PO1A 1S3SA 2IWRA 5AJYA 5FI0B 5E7IA 2MSDB 2WOJA 4Q9IA 1E9RA 1O3YA 2HF9A 4R98A 3R7WA 1YR9A 4AKEA 4BFVA 1NMZA 4IRUB 1E0SA 4M1MA 3CRRA 6Q21A 5JEEA 2O8EA 2OHFA 2Q21A 3QPVA 2GHIA 4NCJA 4E09A 1WDTA 1RW4A 5F2EA 3EIEA 4RJLA 1Q20A 2V7QD 4CYMA 2ZRHA 4RVCA 1EFRA 3ZGXA 4ESVA 3U4QB 3OEHD 1W48A 3ZH9B 1U81A 4QHSA 3AKYA 1DO2A 5KSZA 4GOXA 4BZPA 1OHHA 5EXTA 2FN4A 1VTKA 4JLVA 1ZIPA 2J87A 1NBMA 1IHUA 3SE0A 3K9LA 1JXOA 2GZDA 5KOYA 1R0YA 2OILA 3PV0A 4WW0A 2JLXA 1JJVA 5FPKA 1Q3HA 5FUYA 3P4XA 3P26A 4TMXA 3HYTA 2F9LA 2CJWB 4LBYA 4D4KA 4Z1MA 5AUOB 1HV8A 1KAGA 2WBLC 2IUUA 3I92A 1KSGA 2HEIA 2FFQA 4HB4A 4TLEA 4C9BA 4TL8A 2G3YA 4TT3A 4DXAA 1ZYUA 1E94E 521PA 3C5CA 3T5GA 3K70B 2W58A 5DGXA 4BE7B 1OXXK 2YWFA 3OE7A 2ZYUX 2EFDB 3MSXA 4YMUA 3BIFA 3ADCA 3OF5A 3LBNA 1PUJA 3PEWA 2AR7A 5JJLA 3ZIAD 2QSYA 4FD2A 3ZVLA 2GJAA 2NO1A 3IBYA 2ECKA 2NO7A 3A1TA 3RWOA 4DRZA 1F3OA 1XFAA 4C0LA 4I1VA 4LGMA 1G5RA 2ANBA 5A4JA 4GMDA 2F9MA 5DNYB 2V3CC 1EG7A 1DEKA 4OJQA 3A1UA 3FVQA 2QSZA 2FJUA 3KXLA 1PLLA 5EZ5A 4OJKA 2P6RA 4PPQA 4DJTA 4RD4A 1NKSA 1T91A 1YR6A 4Y0VA 2O0KA 3O47A 4WXRA 5C46F 3OZXA 4DHEA 1B23P 1JR3A 1E2NA 2CNWA 2NOAA 5LD2B 1TNDA 2Z4SA 1ZCAA 1DS6A 5L8VA 1W0KA 2A5YB 4MDEA 3VU9B 3MJRA 1R4AA 3GCGA 4M21A 1G3QA 1OPXA 1D9XA 4B3XA 3A4LA 2D4HA 1XJQA 3KQNA 1RYFA 2KI5A 2OUKA 1KNXA 1W5TA 3CWQA 5BWMA 1W0JA 4TLAA 4GL2A 3ZYCA 2ZSDA 4XSHA 2QROA 2O8DB 4A4DA 1YR8A 4OL0A 5EP1A 1CJMA 3AVWA 5EXPA 4XTRA 2V6JA 4KJZA 4UNPA 1E2MA 2G9NA 4D2IA 1P2TA 1MOZA 1J70A 3U3MA 5FUWA 2IC5A 2DHRA 1G21E 4LBWA 3CX7A 4IEEA 5D3QA 1Q1EA 2VP9A 5G3ZA 5B30A 3KB1A 3LFUA 2OBLA 2TMKA 4ILEA 1ZRHA 5JBQA 1P5ZB 2ZITA 2REXB 4W5JA 4PHGA 3WHKA 4UNSA 1LFDB 2C9OA 2GXSA 5DN6A 2IYUA 2IL1A 421PA 3U7GA 1E2PA 4A2WA 4OHXA 2J3EA 3TH5A 3WY9A 2O8CA 4ACAA 1WF3A 2JAQA 4K8OA 3OEED 4KO8A 4LBVA 1C1YA 2XOKD 4MDFA 4KAXA 3W9YA 3QIAA 4M9QA 1U98A 2F3RA 3CW2A 3R20A 4G0NA 3K0AB 2QPAA 5G40A 4EPVA 4LI0A 2YOHA 3AEZA 1PZNA 4YMVA 3SFZA 4UNRA 3B8HA 4LYJA 4U5XA 5LBIA 1AQUA 2OCYC 1HT2E 4XD7A 2OBNA 5F98A 1W5SA 3X1YA 1RRGA 4RFSA 1KDPA 4V0LA 2RCNA 3EA5A 2WWXA 2WJYA 3MWJA 4TLDA 2Z5FA 4IDPA 1XXHA 2VLIA 3UK6A 4DDWA 3L0SA 1H8HD 2ZROA 1U8ZA 4HAXA 4B43A 1CULC 2GCPA 1XTQA 3ADKA 2C96A 4HATA 3RAPR 2F1HA 4DWJA 4HDQB 1F48A 3I3SR 1IM2A 1VECA 4ZDWA 2I1QA 2V1XA 3PEYA 4XOIA 2XJ4A 2HCBA 4KI0A 1DAIA 5FPTA 3FMOB 3VR4A 4ITRC 3QE0A 2UZIR 3FB4A 3EPHA 5P21A 4YXWD 2H92A 3ICQB 2EYQA 3ND8A 3DDCA 4JYBA 5FBVB 2IYXA 3WP1B 4HB0A 1LW7A 2KE5A 2ZUCA 1GKUB 1O87A 1Z0KA 2N46A 4JSYA 4JVSB 4BEJA 1KKMA 4Q1BA 4DSUA 3O8DA 2OFWA 2D2FA 2GK6A 2OCAA 2RGEA 4PANA 3TMKA 4HUQA 3Q85A 1KSHA 1B0UA 4LHXA 2OLJA 4YMWA 1VG8A 1ELOA 4QFMA 2DFTA 3AF1A 4US0R 1Q0UA 1G8YA 3EA0A 3THYA 1W2HA 3CBQA 4OQXA 4W5WA 4L16A 3U3KA 1FNNA 1R5OA 2H1LA 3ZDQA 1J90A 4D0LB 1FMJA 1LNZA 1TEVA 4PHHA 3Q3JB 3FPAA 2FMXA 3AVQA 3BE4A 4DZZA 2DFLA 1Y63A 3EPKA 4MA4A 5TDHA 1OFTA 5G53C 4CDGA 3EC1A 2XZLA 3DKVA 3TLXA 2C2HA 2DWPA 1G3IA 3QOFA 2LWIA 1FQKA 2QGZA 4DLXA 1UDXA 4A8JC 3PUVA 1X8LA 4HLQB 1MKYA 3GP8A 2BMEA 3GLHA 1KMQA 4CEHA 2ZR7A 2GF9A 2A78A 2BWJA 1R10A 1EX7A 3GMTA 2AWOA 4TZ0A 3EW9A 3NBXX 4B47A 4R71A 5H1YA 3TAUA 1XU4A 2JJ8A 2C95A 3T35A 1H8ED 2GTPA 1YR7A 3AUYA 3KKQA 3Q7QA 2BBTA 4AIIA 4EQ6B 2W6JD 2EWWA 3BRWD 4EPXA 4AKGA 1NVVQ 3RANA 2QBYA 2OBMA 1N6NA 3QBVA 2GAAA 4QRHA 4DIEA 2VP0A 3HPQA 3EX7C 4Q01A 4P4SB 3IEUA 1T8TA 2JJ1D 3K0FA 1AZSC 3QPWA 5EE3A 4POAA 3V4FA 3WRXC 4PO9A 1F2TB 1AS2A 2CMKA 1YZTA 5IHPA 1G291 5AR1A 3SYKA 3SN6A 1OYYA 2NO0A 1X1RA 5GJCA 2P6UA 3BB3A 1ESNA 3IDQA 2CL0X 3SFVA 4PTLA 2IT1A 2ONJA 1UEIA 2R62A 3W6NA 3T5DA 4A36A 3MWLA 2Q3MA 4EAQA 2WWYA 3DHWC 3IILA 3LD9A 4OHVA 5AJWA 1U94A 5E7JA 2IA5A 5HE8A 1TQ6A 2JLWA 2NTYC 5KDOA 4F4CA 1GRQA 5CM8B 5AJZA 1NN5A 2E9SA 1XMJA 2F1RA 1II8B 1MT0A 4B3CA 3ONWA 4ZIRA 1YZUA 121PA 5FTNA 3B1YA 4Q9JA 1K8RA 3SOPA 1X3SA 1JB1A 2VYFA 2ODNA 4NYMR 2JLUA 2MSEB 3TR0A 5FPYA 2IEYA 4H1UA 4PC1A 5L3RA 2ODBA 3PUYA 4GMXA 1SXJA 3OIUA 3BH6A 4Q4HA 1KSFX 1DBSA 3GLGB 1VMAA 1TPZA 1US8B 4URXR 1P75A 4GDFA 1GP2A 2F43A 4AY2A 1XBTA 4PPFA 4OQNA 1BS1A 1VG9B 3WNDA 1XWIA 2RGAA 3D3QA 2ZJ8A 1NIPA 3K0CA 3OHMA 3TQCA 3L0IB 3CLVA 3MMPA 3A37A 3GLIB 2JLVA 2ZYVX 1SKYE 4UJ5A 3GEEA 2BV3A 5KHOC 1BIFA 4CEIB 4JBWA 5FUXA 2AX4A 1YZQA 2HJGA 1KO8A 5TXGA 1MABA 4QGHA 5F9HA 3GJ0A 1GSIA 1NKTA 5JS8A 4WIAA 3T61A 5A0FA 4P31A 4Z8XA 2D7DA 2ZJ5A 3E70C 5JEDA 1FMLA 2B7CA 2MMCA 2YC4C 4A8JB 5BN3A 3T1TA 4AKIA 4Q5IA 4I81A 1YRBA 1RPZA 1AS0A 4WOPA 1E9BA 3KDSE 3QXSA 1KI2A 4ARZA 1CJKC 1G1MA 2WSSA 4DEYA 1KMHA 4QBGB 1NIJA 2YWHA 4CZ2A 3AB3A 5FL3A 4W7SA 3B82A 1CKEA 4IXMA 2PH1A 2RGNA 3OAAA 1XZPA 2CCKA 2FSIA 3AKCA 3THXA 5H8WA 4RSGA 2XZOA 1RJ9A 3NIBA 3KKPA 3CUEF 3CIOA 3K9GA 1YQTA 1Z5ZA 3UIEA 2FFBA 3B9QA 5FOTA 2C8VA 4JL5A 2VEDA 1GRNA 4MYUA 2VO1A 3PCRB 4P3YA 3TAHA 2IYWA 2EFGA 2EYUA 4IOLA 1P7CA 1YJ5A 4MYHA 1P73A 3UG6A 2IS4A 1E32A 1R8QA 2EWVA 3CZQA 4PQFA 3CF2A 1FX0B 1G4AE 1TL7C 2QEQA 3WP0A 1UKZA 1XEXA 5A5GA 2HXYA 2R8RA 4GPTA 4A2PA 3WMGA 1OFUX 1U8YA 5FFMA 5CM9C 4H1VA 3RRNA 2O8FB 1CJTC 3F0TA 4OBEA 2NZ8A 3I32A 4O25A 4I99A 3GFPA 1Z06A 4LJ4A 1ANKA 2JIZD 4ZCIA 4C7OA 3SJCA 2RGBA 2HUPA 1OLOA 1WA5A 4D6PA 1Q3TA 4WXPA 1ZD9A 2ZRCA 1KHTA 2ZE5A 4HUTA 2OCPA 1NVWQ 3C14C 1IXZA 2EFEB 2G0TA 3LBHA 1QHHA 1GL6A 2QPTA 4BEBA 4TQ9A 1NF3A 3ADDA 2QT0A 3DM9B 4B74A 1GDDA 1N5KA 4JIMA 2N42A 2ZAMA 3LA6A 1L8QA 2XB4A 4KXFB 4RY2A 2OAP1 4G5GA 3DKPA 1BYIA 4HLDA 4LYHA 2HV8A 3ZLJA 4FW9A 3HJNA 4M9XA 4IDHA 1GNQA 2OT3B 3B85A 4TSFD 2BIFA 4LOAA 4BUJA 5JCZA 3S1AB 3THWB 1N25A 1E2QA 3TK1A 1P4SA 4F38A 4Z51A 4URYR 1G8GA 4DC9A 2QP4A 4U02A 1XMVA 2Z0MA 2OXRA 1Z83A 2ZAOA 1Q21A 2WWFA 3WNBA 1W4CA 1NSTA 1XD2A 4NL4H 2F7SA 2HF8A 2FSGA 3OIYA 1ZBDA 1WP9A 1LTQA 1XXHE 3BS4A 4EKDA 1EFRD 3AH8A 3AM1A 3HWSA 2NZJA 2ZS7A 4Q7KA 2QP3A 2VIIA 3LAWA 1KI7A 1UKVY 2WPDA 4KFTA 3WYFA 1FFHA 4E07A 1OHHD 2CVHA 4MRPA 1G7RA 4URZR 1MO6A 2FSFA 1ZIOA 3IPYA 4QJ5A 1SULA 4IXNA 5B58C 2REBA 4LBZA 4Q7MB 2WHXA 3FMPB 2ZE8A 4PFSA 4HAWA 4LPKA 1OIXA 1VCOA 4Z1MD 1OB5A 3L0PA 1KO4A 2WVJA 2GCOB 3LXRA 2WAYA 1GAJA 1RRFA 2J45A 2CCGA 1IN4A 4X8LA 1GL7A 3LLUA 4KU4A 2WWGA 4HB3A 3K09C 4MKIA 3QKRA 1ZNWA 4D82A 1UAAA 4CIDA 1V43A 1G9XA 3N2EA 4TT3D 4BLPA 5KSPA 1UBCA 3KTAB 2JDIA 3V9PA 1TF5A 2FPMA 3VFDA 3OFNA 3LXXA 3QKTA 3LX5A 4B2PA 4M4SA 3LV8A 4BQSA 3ZS9A 2AL7A 1U9IA 4M8NE 4NU0A 4ZKEA 1Q12A 5IF9A 3NEYA 3GLFB 4TMTA 3WXMA 3IHLA 1G8PA 1KJWA 4F92B 2ERXA 4L4UA 5C1BA 2FDCA 4HDOB 4PQYA 3CM0A 2A30A 3T12A 4M1YA 3B1VA 5EE5B 1R5BA 1D2NA 2J0QA 1RKBA 3KUDA 3NBFA 4DVGA 3U4QA 1TQ2A 4QG7A 5DHAA 4MYCA 2D62A 5IRCD 1YKSA 1JNYA 1Z07A 4QGAA 3DOFA 4EJSC 4URUR 3EWSA 2REOA 4HSEA 1JR3D 2CNWD 1G41A 4TTRA 1TF2A 2WKRA 4DCNA 3KKOA 1E79A 4IFEA 821PA 1D2EA 1QVRA 1L4YA 3AP1A 1IN6A 3TVDA 1E9FA 1SVKA 4JL6A 4LX0A 1UKYA 2IYZA 1M7BA 1E2HA 1QBKC 2CJWA 2ORIA 4LY6A 4M2LA 1JJ7A 1LS6A 3PXGA 4IEIA 3C4JA 2KBEA 4DSNA 1G18A 3FHOA 3EZ6A 1I4LD 1HUQA 3QUSA 4KV9A 4NCKA 3W8NA 4D25A 3B78A 3RHFA 3SHFA 1KK3A 1QHSA 3M1IA 4B35A 1QDEA 4QBHA 1JAHA 2G88A 3RDPA 4FMDF 1NN1A 3EC2A 2YWEA 5JFGA 4NH0A 1Q1QA 1YE8A 3LX8A 3GJ7A 2G1JA 2GA8A 3KKMA 1YZKA 621PA 4IDQA 1XTIA 2VSXA 4KSCA 5CLQA 5DN6D 1E1QD 2FFAA 2PJRA 2P3SA 5FOXA 1CEEA 1DTSA 2Q3HA 4V02A 3T06B 1G7CA 1EX6A 1S3GA 4MUAA 1A4RA 1GFIA 4MRSA 4OHWA 4QOSA 3QPUA 4GRAA 1S8FA 1T4GA 1YVDA 3DZDA 5DH9A 1C9KA 4GNKA 5G41A 1E2KA 4Q1EA 2YJTD 4FN5A 5D3MB 3MGCA 1OKKD 3O8BA 1GNPA 2DY1A 2DPXA 1M7HA 1Z6YA 2Q6TA 3VU9A 4R2IA 2GZAA 2ZYTX 3F5FA 4JLDA 4JVNA 3VKGA 1JPNA 4C30A 4PPNA 4PC6A 2BBOA 1HE8B 2ATVA 3KJEA 3DOEA 4D80A 2BMDA 1ZINA 2O8DA 3NWJA 4A92A 2JLYA 2C78A 4NPHA 1G5PA 1MRNA 3GD7A 3AVTA 3HPRA 2XNDA 4UKDA 4KYUA 2DCUA 2VSOA 2ZI7A 3TSWA 2Q9CA 1GM5A 4DUGD 3UG7A 3VX4A 1SHZA 1XEWX 1P3JA 2WWWA 3TW8B 3MRSA 3CNNA 4NYMQ 5CYOA 2FWRA 2VHJA 3U3OA 1CR2A 4TZ6A 3U2QA 4OK3A 1E0KA 2ASEA 4P4UA 4GI7A 4EJSB 4YDHB 5JRJA 1T3LA 2QI9C 3NBYC 4G5OA 3VNUA 3LVQE 3PIRA 4PC7A 1W1WA 3W6OA 3IEVA 1OFHA 5DISB 221PA 2ZJBA 3K0AA 1ZP6A 5FH9A 4QBIA 1WMSA 3FOZA 5IK2D 5E95A 1N3BA 2QN6A 1BO6A 2OEPA 3H0KA 4EPTA 1T9HA 2ZI5A 4Q9KA 3UWKA 4E5UA 4TYPA 1YRAA 3A58B 4UXJA 1AN0A 3B1WA 4HAZA 2QM8A 2AXNA 3TKLA 2PMDA 4H9GA 2H16A 3EIHA 2JLQA 2IF0A 3ZS8A 2P2LA 1NJFA 2XB2A 5CYPA 3T1QA 3UKDA 3TUIC 3SBEA 3CPJB 8OHMA 1CS4C 1E6CA 1UEJA 1CRQA 2GWHA 3QKUA 4RZ2A 2FPKA 4IJMA 4M9SA 5FBQB 1Z0IA 4FMCF 3RS5A 5CJPA 2NPFA 3GLFE 3T34A 5FI1B 4B73A 1LF0A 2GILA 3U3RA 5JJKA 3BB1A 2QM7A 4NKRA 3R9IA 1HYQA 5DI3B 4MGKR 1JXMA 3D8BA 3JVVA 3L0OA 2RMKA 2GEDA 1ZVQA 3GJXC 2QENA 3B60A 3K0EA 3ND9A 4LHZA 4ON9A 3X1ZA 4B34A 4IW3B 2JLZA 1NNEA 4BRWA 3RC3A 2VBCA 5KPJA 2QTVB 3IHWA 2G6BA 1BMFD 1G3RA 1Q44A 2X2FA 3RABA 1E98A 2NQ2C 2GBLC 4KBGA 2AK2A 5TB5A 4NYJQ 1E4VA 3A4MA 4AKHA 4K81B 3AP3A 3Q72A 1DG1G 1T3SA 3N70A 1IXSB 2RAPA 2R6AA 3U3JA 2Z43A 4XH9B 2A5FA 3PITA 3EASA 2X19A 3OIVA 1J8MF 2CK3A 3CB4A 1XDBA 1MR3F 1T8UA 2W6ID 5SZJA 3TUJC 4DCSA 4RZUA 2B7BA 3IUYA 1ZAKA 3C16C 4URWR 3FKSA 3VKWA 3SQWA 3BC1A 1PLJA 4HZIA 3H2YA 4MRNA 3RS0A 1G3MA 2ZI9A 4DT1B 4ABYA 5EUMA 1G6OA 2WM9B 3BWDD 3A1VA 4HZUB 4KODA 4GOKA 1ZC3A 2BC9A 4PZLA 4S2EA 1GNRA 3NH9A 3LQQA 5UKDA 4D81A 3VX3A 5SZHB 1DOAA 5JWOA 3TR5A 2P67A 1SXJD 1GILA 1HURA 4LV8B 3VTKA 1NMXA 2QMEA 2A2ZA 2FNAA 2WAXA 1F2UB 1KSJA 4EQ6A 1E2JA 5DO9A 2WSMA 5L3QB 5DIFA 1G64A 2IXFA 2V55B 3ASYA 4TQUS 4P4SA 4U00A 1XTKA 1D2MA 2Q0HA 4I1SA 4IVQA 4PAQA 2V8OA 1PUIA 3RYTC 1F2TA 4JZKA 4XTCS 4LC0A 1N6OA 1E96A 3PEUA 2FEOA 4A0GA 2PZEA 3PR1A 2QRNA 4YMSA 2FGJA 5FTKA 2W0MA 2C77A 4AC9A 3I8SA 1DAEA 2JATA 1EESA 1OSNA 1E9CA 2YOFA 5FR2A 4KFUA 5EP4A 5BN4A 3T15A 2KJQA 3C15C 3WYGA 4MUBA 3AF0A 5EZ6B 5FPSA 4O3MA 1II8A 2PCJA 2IEZA 4BLSA 1FZQA 4DLWA 1A1VA 4D4JA 3BB4A 3HR8A 1JBKA 2V1UA 4G1UC 3OAAD 3NEJA 4LCBA 1NN3A 1TADA 2WIAA 1VIAA 2OE2A 3W90A 1TX4B 2QA5A 4XVQA 1KK1A 5B57C 3ZD6A 1JECA 4JYCA 3GLGA 1US8A 1OV4A 2WKQA 2GRJA 2GESA 3EARA 3KUCA 1KO7A 1OXUA 4GP7A 4ZDIA 1W2GA 1E2IA 1KO5A 4R9UC 3U61B 1TEXA 4NMMA 3GLIA 3K9HA 1TF7A 1SHKA 4Q4LA 2OV2A 4NHOA 1XD9A 2WZQA 4NCIA 1DELA 3BH7A 4CEIA 2J9RA 4KITB 2QT1A 1E3MA 3EZ9A 4TYWA 4Q9HA 3ETLA 5HZHA 3SYLA 3FDIA 3ZQJA 4LJ6A 2PEZA 1RIFA 4LYAA 3ZZTA 4ZCMA 1VPLA 3OEHA 2OESA 4BECA 2AD1A 3SHWA 2CE2X 3BAFA 4C4PA 2OFOA 1W47A 1TU4A 1I4TD 1T3HA 2FFHA 4A8JA 5FOWA 4JVMA 3P1JA 3ZVRA 2ZTSA 2BM0A 2XSZA 4DBLC 5FBWB 3NKVA 1OIWA 1P72A 2QTFA 3W34A 1OXVA 1KKLA 3VR1A 1Z6AA 1WBDA 3PUZA 4JS0A 3GJ8A 4TL9A 2O0HA 3IIMA 5AUQA 2GJSA 3I5YA 2CEAA 2QMHA 3Q7PA 5TMPA 3RWMB 4AYXA 1VKJA 2ZJOA 2GZHA 2BCGY 2R44A 3KXIA 1DAMA 4LHWA 5BYKA 5JJIA 2H8KA 1LY1A 1YZLA 2FA9A 1N6IA 4KVAA 3QQ5A 3HU2A 1IJFA 1EFUA 2ZUBA 3CF0A 1OXSC 4RZ3A 3VKHA 4DLZA 4NCHA 4DLYA 4FCWA 2ZJ2A 3TSZA 2QMUA 3DMNA 4PSAA 3K1JA 4NE2A 1FUKA 1WE2A 3QY0A 2QRZA 4GZLA 2ZRLA 2ZSEA 1D9ZA 1LS1A 4Y0AA 3RC8A 3NG1A 4KSBA 3TSOA 5JRZA 1T0HB 2HYDA 2OO7A 3ZIAA 2EW1A 3CNLA 4PZYA 4QBFA 3AVYA 1NY5A 1FX0A 2W2XA 1P9NA 1VG0B 2X77A 3I5XA 1U8AA 1SVOA 3GEIA 2QE7D 4P0TA 4M1KA 4AI6A 4RFVA 4IDNA 2O8FA 3Q9LA 4NDZA 2PT7A 3TQFA 4OHYA 1WRBA 2VTKA 4GBMA 4HI0E 1DAGA 2WPDD 4Q02A 4AYTA 1P61B 1Z0AA 2VP6A 1S1MA 5KSOA 4ASUA 3AV0B 2KWIA 3I72A 2JLSA 3SJBA 1XX6A 2DWOA 1UADA 2GXAA 2ZSBA 2ZRJA 1X86B 1MRSA 1DO0A 1G3UA 1FL9A 1KNQA 4YDSA 5K8TA 1PVOA 1ZCBA 4ZDJA 1XF9A 4XSGA 5EXSA 4D4MA 1E1RD 4UNQA 4F91B 4E03A 3ZZ0A 2CL7X 1KY2A 5DE3A 3LH5A 3TW4A 2AWNA 1U99A 1XCMA 1KI9A 3P27A 4TQAA 1P2UA 4OQFA 1QHIA 2P5TB 2HDNB 1ETUA 4BWYA 5K8UA 3LNCA 3HP1A 2ZPTX 5CK5A 5J4HA 1XP8A 3S1AA 5J4VA 3THWA 1EFTA 1G6HA 3LDAA 4U7DA 1F6BA 3RRZA 4EFLA 1GWNA 3VQTA 2ZRMA 1G17A 3SC3A 4XVUA 2XTZA 1Z29A 3MUFA 1G7TA 4S35A 2PJZA 1KI6B 2YHSA 4OKSA 4Q00A 1SVIA 4US1R 4X8HA 1JPJA 2CXXA 1ZW6A 3BGWA 4K46A 2GKSA 3RRYA 2J41A 1W4AA 2AN9A 2PX3A 3U7EB 3SU8A 2AD5A 2NGRA 2PMKA 5TVKA 1YHNA 3VR2A 4EFMA 4ZDKA 4MRRA 3VHLB 1UBGA 2XOKA 2W2TA 4X8OA 4O2RA 4PR0A 4A0RA 3CH4B 1NLZA 4YLGA 5LPNA 3CKLA 3R9WA 3UWOA 3Q8XB 4TTQA 1HH4A 3EWAA 2LKCA 2HT1A 1S0UA 1U0LA 2XTMA 3C8UA 2BMFA 3BBPA 4A1FA 2IBMA 1XMIA 2ZRAA 5DHFA 1ONBA 2I1VB 2H18A 3VR5A 3QG5A 5LB4A 2QQ0A 5HPYB 5FTMA 1ZUIA 2MMGA 2ZUDA 3QF7A 1R8SA 5JSZB 1H8HA 3CO5A 5B2ZA 2GCOA 4QNRA 1W36D 2EVWX 2W0SA 4DCTA 4Q4JB 3PUXA 1SKQA 1QG4A 1VIYA 3SJZA 5C18A 4LRWA 4TYYA 1JQLB 3LVRE 4WZBE 1HQYE 1ZM9A 3KTAA 1WBBA 4D4LA 2ZS8A 2YKGA 1GRRA 3AF4A 1XD8A 4NYJR 2ODWA 1RRCA 2J59A 4HAYA 4YXWA 1I2DA 1TMKA 2O8BB 4UXHA 5KNDA 3GLFA 2YINC 5GJBA 1E2DA 3NXSA 1DADA 2ZE7A 4ZO4A 2RGNC 4HLCA 1L4UA 1KZGB 3T1VA 3TJZA 3U6BA 3LBIA 4ESHA 5LB2A 4LZZA 5TY0A 1GVNB 3V4RA 4JLKA 1S9DA 2DBYA 3VMFA 3L43A 3UATA 3QKSB 4EFNA 2JJ2D 5HCIA 4NP6A 1W49A 1P6XA 5J5CA 4TN1A 4XJXA 2IX3A 3U7HB 4PZZA 3CF6R 4DLVA 4LJ9A 5CLLA 4A6XA 1NLYA 2D74A 4B2LA 5CB6A 4GOJA 4HEJA 2FF7A 4DLUA 4YQFA 4P4TA 4I1UA 4C2TA 2XEXA 5EP2A 1UFQA 4G5RA 4IOKA 4MKGA 4DLSA 2OXCA 5TARA 1L2TA 4GT1A 3NTUA 4B32A 4B3DA 2QG6A 2FZLA 1F60A 4PSKA 1I4DD 5DI9A 1E2FA 2J1LA 2XNDD 4M9ZA 1XTRA 1DAHA 2UVQA 2PBRA 4RCZA 1NRJB 2VF7A 1KI1A 3CZPA 3QENA 3RLFA 2BKUA 3QEOA 4RD3A 4IVRA 1H8EA 3TNFA 4QC2A 1GG2A 3IBGA 1PV4A 4OQLA 1WCV1 3IIKA 1NJGA 3MAAC 2EU8A 5AWFC 2D7CA 1X8KA 2VQSA 2O52A 5CIWA 4DDVA 2OFXA 2P0EA 3LWNA 1NP6A 4DDUA 4JBXA 5HE9A 2FV8A 5K8IA 2JJ1A 3RNLA 1E0AA 2W2VA 4MQBA 2VRWA 2UZ3A 721PA 4QNMA 1HA3A 2I4IA 5D3MA 4QHYA 4WAUA 2QAGC 4MH0R 5J47A 5KTYA 4YONB 1EWRA 1SVWA 1NBMD 3CH5A 5GVRA 2C98A 2HT6A 3WMFA 4XWOA 3SQXA 5HCNA 1D6JA 3X1DA 2OSBA 1YU9A 2NMVA 3RS2A 3GLGE 3KB2A 3TRFA 3MWYW 5HR5A 1G7SA 1COWA 4II7A 5H70A 2FZ4A 1MO4A 4CEJB 2GDJA 3A1SA 2BOVA 1N5LA 1SVMA 1Z0DA 4M53A 2P5SA 1N6PA 4Q48A 3GLIE 4FWTA 2ZE6A 3RS7A 2O0JA 3KQUA 4V0ME 4JKYA 3VHXA 1KO1A 3SEAA 1FW6A 1CJVC 1E2EA 1E9AA 4HYYA 2WJJA 3B5JA 1X1SA 4IFBA 2IYRA 4HLUA 5EP3A 2IUSA 2RB4A 3OE7D 1CBUA 4LJ7A 3EPJA 4G5QA 5FL7A 1XPUA 4OQMA 3KQLA 2QU8A 3MG9A 4OI2A 3G0HA 1IN5A 2J46A 1M8PA 2AXPA 2FOLA 3RSOA 3H84A 1EXMA 2VPPA 3AVPA 1VCIA 1Z63A 1WQ1R 2SHKA 4Q47A 3KFVA 4EJSA 2ZETA 2YOGA 4TL7A 2IS2A 1Z6XA 5KPDA 5KDLA 2ERYA 4QHTA 5JLJA 1SVSA 5CK4A 2B92A 2YNMA 3F3YA 2Z6VA 4US2R 1CR0A 3FGNA 3WBKA 5BW8A 3MCAA 3BFXA 3U60B 1RFLA 2A3RA 3BORA 1Z6TA 4Q4AB 4BFXA 3QSYA 2IYVA 4N1AA 4TYNA 4LDJA 4LSGA 2B6HA 5BXQC 3Q5EA 1QHGA 1ESMA 1W0KD 1RYHA 4FI3C 1E2GA 4BFZA 1N2CE 1CP2A 3H1TA 4PO8A 3E2IA 4JLMA 2KBFA 4LJ5A 2J7PA 1DVRA 1AM4D 4EIWA 3NDPA 2VP5A 3QG1A 1TTTA 1W0JD 5AK0A 3ICEA 3CRMA 4Q9LA 3BFKA 4G01B 1AZTA 3PUWA 4LYFA 4YC7A 1A82A 4B75A 4BFUA 1Z0JA 1IN8A 1JQJC 1FQJA 2PCLA 4EDHA 3AF2A 2ZRNA 4A2QA 5JI2E 4B71A 1KJYA 1XNJA 4LK2A 1ZC4A 1X8JA 2A5GA 4ZI2A 1T6NA 2ZVQX 4BLOA 3SBDA 2ATXA 4I4LA 2A7QA 5DI3A 3KKNA 1MO3A 3AKEA 4V03A 4Q7JB 3WRYC 2WTUA 5F3WB 5IT5A 2H5EA 3O8CA 3THOA 1OH6A 3DMDA 4JLBA 2Q9AA 2QAGB 3ZVMA 3EPLA 1CR4A 3PJRA 3FHTA 3QBTA 5KNCA 5TV2A 1W36C 4BFSA 4JT4A 4AD8A 3NHAA 2WWIA 3PG5A 3X2SA 4EUNA 4Q1CA 3CR7A 4TLBA 2UKDA 3P20A 1II0A 4M22A 1NY6A 3HU1A 3I73A 2GXUA 4JKIA 3WBJA 2BEKA 3B1ZA 2CHQA 4XD7D 1W4BA 5HZKA 4TMZA 1E9DA 1V5WA 1XEFA 1GIAA 1J8YF 2NIPA 3D6TB 3HR7A 5AJVB 1CJUC 1XJCA 3CPHA 3FWYA 4DEXA 4F93B 4B6FA 4GZMA 3CNOA 3PFIA 4P32A 2IHBA 3AGPA 1ZD1A 2X2EA 2VF8A 3SZRA 1OT3A 5M04A 2P65A 4OK5A 1HEIA 2A5DA 4C0AC 1CTQA 2GJ9A 3GQBA 4DT1A 1GITA 2WJGA 1XTSA 2R2AA 4HZUA 3CR8A 1Z6GA 3B7GA 4BGDA 1II9A 2ORWA 3UPUA 4ACBA 1NLFA 1QHNA 2ZM5A 4CVNA 1CRPA 3PENA 2V4ZA 3BERA 2XTNA 3PVSA 1KK0A 1SGWA 1Y3AA 4PAMA 1F2UA 4TMVA 4TSFA 3LW7A 4PC2A 1T5LA 1EFHA 2DB3A 2F1JA 4PHFA 1E0JA 3EZ7A 1K5GA 4M1TA 2ZS9A 4NCNA 2CLSA 5L3QA 1KI3A 4KCGA 4L15A 5EXXA 2ZREA 1N6KA 2ZSFA 2A9KA 4M1SA 2OAQ1 5KUTA 3AVVA 1AIPA 1JI0A 1NMYA 1AJEA 2RGXA 3A1WA 4BASA 1CLUA 2B8WA 3WMEA 4BZQA 1IOZA 4BFWA 3TGPA 5GVSA 3UMSA 3IGFA 3QXJA 4V0OA 5DSZA 4QJ3A 5JMTA 1XEWY 3KQHA 1ZM2A 4TLCA 1N5IA 1N6HA 1X6VA 1QVAA 1QHXA 2F1IA 4XWKA 4MITA 4IOMA 4NYIR 5HTKA 2W83A 4LJYA 2XSZD 2J0UB 3FFBA 4CF7A 5HKKA 1XPRA 4JLAA 4DB2A 1N0WA 1ZNZA 3CX6A 4AWXA 3C7KA 4LJAA 2PLFA 3T1OA 4OI4A 3DZ8A 4TTPA 4B3FX 3E1SA 3SR0A 1RVDA 2R9VA 2RHMA 4FINA 1VHLA 3QF4A 1KIMA 1Z22A 2JA1A 1W7AA 1UPTA 4C0BA 3LLMA 5BN5A 3M0EA 3U44B 1P2VA 1W36B 5JHGB 2R6DA 4PHTA 4ZCLA 1SVLA 1BKDR 4LUCA 1CR1A 2GBLA 2OG2A 1NG1A 2FSHA 2I3BA 2LKDA 4WBSA 4TYQA 5AUPB 1AGPA 3A8TA 1F5NA 2IXEA 2YVUA 3IKJA 3QVVA 2DR3A 1HQCA 2F6RA 5J4LA 1ZMXA 4FMDB 3FE2A 2R6CA 5KSYA 3L82B 4C0SA 1R0XA 2QQEA 1DE0A 3VR3A 3DVLA 1E9EA 1QF9A 1XB2A 4G5SA 5CJ2A 4L9SA 1HE1C 5J4KA 4FIDA 5L3SB 3IQWA 3C5HA 4Q1FA 1M2OB 3FTQA 4AURA 2BBSA 2H17A 1GZSA 2XXAB 3BOSA 4Q1DA 1FTNA 4TL6A 3D31A 4RZXA 2IWHA 1OW3B 4C0QC 2HLDA 4QXAA 1AKYA 2Q9BA 1J99A 3DEFA 2D3WA 4KFSA 3RSLA 4XVRA 3N2IA 4TMWA 4B44A 1UBEA 5FOVA 1UKEA 2GCNA 3L8YA 4BRUA 2P6NA 4ASUD 1G8HA 5AJXA 4BPBA 1JAIA 3AKDA 3FMIA 4QKQA 4D26A 1EK0A 1W4RA 5EJEA 1BH2A 1NVXQ 2V6IA 2ZVPX 2EFHB 2X1VA 4FXPA 2ANCA 1SZPA 1U0HC 3K9NA 2OM2A 2HXSA 2QPOA 3BK7A 1IY1A 1BYUA 4DSOA 2C5LA 2GEUA 2ZRDA 3W8RA 3KJGA 4OI0A 3HDTA 4AG6A 3L2OB 1A2KC 5DYGA 2O5VA 1R0WA 5GJWC 2ZIAA 1MV5A 3AVOA 4W9MC 1VYTA 3R7WB 4JJZA 4X8MA 2GK7A 3AF3A 3GJ5A 2G77B 2WIBA 3EG5A 1A2BA 5JS7A 1AGRA 4Q1AA 2O8EB 1R5NA 3GPLA 3RRMA 3EZFA 1G5TA 4W5HA 5KO2A 2WKPA 1E1QA 3SJAA 4RD2A 1ZNYA 1JALA 3KXKA 4ZV4A 4F7WA 4AYWA 1DAFA 2WJIA 1Z47A 5JHHB 3GJ6A 4YMTA 2JASA 3GJ4A 1KDTA 2C03A 3GFTA 2IK8A 2GXQA 1L7VC 1OKKA 1AKEA 1J7KA 4WVFA 5C4GB 2L0XA 4EPWA 2PEYA 1RRPA 2WSSD 3SI7A 1SKYB 4CRWB 2Z4RA 3U7FB 1IN7A 3QJYA 2YC2C 1K6MA 3REGA 2CHVA 3QI2A 3HYRA 4PX9A 4PSVA 1Q22A 3X1WA 5LDDC 3QF4B 4DLTA 5KU1A 3VR6A 3L8ZA 2JLRA 1HY3A 3CRQA 5IDVA 4I1OA 1ODFA 3VNVA 4IKEA 1NSFA 2ZRIA 4A0HA 1M7GA 1S9HA 3AVXA 1OIVA 5C4MA 5C2JB 1ZU4A 3ZQ6A 4DUGA 2GETA 3K8YA 1PJRA 4DCUA 1GUAA 1NL3A 3A4NA 3EAQA 4V0MA 1C4OA 1N0UA 1QRAA 3I4LA 3GJ3A 3G5UA 1WB9A 4FMCB 4GSYA 3TVTA 2HYIC 4BFTA 4E22A 2PT5A 2R6GA 4JLJA 4Q19A 1G8FA 1KI6A 3REFA 3DO6A 2ZJZA 3AUXA 3IO5A 5JCPA 1IY0A 3CX8A 1Z08A 2GJ8A 2BHRA 2V7QA 3ASZA 2CVFA 2H57A 2IS6A 4MKFA 1QHYA 5K8LA 1I2MA 2BJWA 5EE9A 4R7ZA 4JBYA 1OH7A 2ZRKA 2WV9A 4N0DA 4UNNA 5FUVA 1VHTA 5CIQA 4QL3A 2EFCB
chains in the Genus database with same CATH superfamily
1ZX1A 1WXGA 4LXUA 3KYBA 4G2NA 4CODB 1W46A 3CV3A 4B1FA 1WHTB 4OXKA 3WV4A 2AFHE 5LQAA 2XAUA 3AHHA 4ZOBA 1ZZGA 1DAKA 3RSSA 1V9CA 2FH5B 3RW9A 2NTVA 2BBWA 1ZL0A 4RA9A 2QRGA 1YC5A 2VOEA 5CPBA 3OLVA 4MUKA 1UWVA 2QTGA 1OFVA 4F3RA 2IJGX 3LOUA 2GEFA 3AV3A 3L4BA 3PFHA 4L5BA 1EXWA 4MS4A 3T7SA 2BGRA 5AI9A 5JSZA 2FFRA 4EABA 1KP2A 1O0SA 1Z2DA 1GKIA 3EVAA 4GBGA 3BWEA 3FRJA 1WMDA 4IJ5A 2IV7A 3F9IA 3SXUB 4EHLA 4PTYA 1XWFA 3ZHOA 2Y1OA 5BRNA 3ANSA 4C4TA 3OZDA 3VKVA 2R68A 2WWHA 3AM4A 3UT0A 1EFAA 3KU4A 3ROGA 1W1UA 2YX1A 5LBUA 4WFJA 2BI4A 4JUCA 3PEVA 3K53A 2GNOA 1XR3A 3DUWA 4L78A 4WZAE 2LCFA 5CU7A 4ZPXA 3I6IA 4RHTA 4F71A 1MORA 4HPWA 2Z3WA 2OQRA 2D5LA 2VBFA 1L5KA 1X7YB 2PLRA 1E3LA 1UXJA 2I1LA 5CVEA 1U2RA 2IYYA 1F0KA 3FVTA 4D3XA 4RKRA 2NPIA 3J7AC 1PG5A 2QORA 3BDAA 4GSLA 2QB5A 4Z8YA 5AVJA 2HA2A 4C05A 4PQRA 3PGXA 3CNQS 5BNZA 3WJAA 1Z3CA 1RHUA 3D8UA 2D1TA 1P1JA 4KFCA 3WKCA 3IIJA 4Y9TA 4LV5B 3DAGA 1ECCA 1BXGB 5FOSA 1XTJA 4QAJA 4QM7A 3K0KA 1GADO 3OCCA 3GXBA 3EG9B 4L8GA 4F2DA 4OI1A 3R9XA 1FFYA 2ZT5A 3RUCA 3D3NA 4EEZA 1LDBA 3EGIA 1M34A 4KYIB 1CYEA 3I6ZA 2GHQA 1UM8A 2C7VA 1IHOA 2M6LA 4BV2A 3C1AA 5B3LA 1UF9A 4C0KA 3KQKA 3D64A 2HRBA 3QEJA 4OAPA 5KMGB 1FNMA 3BMNA 4DJFC 1WXDA 4LHVA 4YS6A 1JHOA 3WLFA 5FPHA 3I8XA 1V1MA 2ONKA 1N6RA 1JIUA 3O31A 4IL5A 3WKAA 4DHWA 4B3BA 2DFNA 3IR7A 1NKVA 2FMUA 2J4DA 2JEZA 1XXHB 2I76A 2D00A 2KB0A 3HKBA 1R4MB 3N0RA 1T29A 4QGFA 5CLJA 3Q8MA 1BROA 3ETCA 2RJ3A 5F9FA 2J85A 1COWD 4AP9A 1ZEJA 1Z5VA 2J0SA 1IAQA 3II6X 1UQUA 4GHWA 4CN9A 3BL8A 5FBRB 3ZVNA 4L8VA 3NTQA 4QOHA 2V54A 3W8EA 5SZIA 5K2MA 1YZGA 5JMOA 4BV9A 3LJKA 1E69A 2J9YB 1ILEA 2RAFA 4EP1A 1CZKA 1NYTA 2QPLA 3MYYA 4L75A 1ZGAA 2B8TA 4NEGA 4R16A 2BEJA 4OQEA 3U7IA 5BT8A 5I4KA 1L7NA 2B0CA 2BFCA 2NQ8A 1PL8A 3HEAA 2PH5A 2ZUUA 4D9KA 4M88A 2E4AA 2RK3A 4FEAA 3WB1A 4RTNA 2JBHA 1SEPA 3N2KB 3EODA 5JAQA 2EG9A 4WZZA 1TFRA 1L5RA 4YLEA 2Z5GA 3ITEA 1SHTX 3OEEA 3TFWA 3NXKA 3UMJA 3A6HA 4FKMA 4JB3A 4QGGA 3N59A 3FYCA 4A0SA 3IMEA 4DSTA 1OFGA 2VHCA 3HY4A 3ORRA 2VI5A 2PS3A 5EUQB 5B4TA 4LJ8A 3I52A 4KN9S 1DPGA 4IMJB 5EE0A 3BXZA 3K0CC 2PUWA 2XMZA 2W98A 4J7CA 4P0QB 1QF7A 3I4CA 4EF5A 4L74A 2NP7A 5FTLA 3FFAA 4L9WA 3HI6A 1UP7A 2BMJA 4JA2A 1RAIA 2JPDA 2Q0QA 4BMNA 2IW3A 2YYYA 3FJYA 1A4UA 4AJPA 3TSCA 2Z83A 3E6AA 4YRSA 4ZOLB 3SFTA 1P1IA 3KR2A 4LHSA 4CTNA 1ORVA 3OQVA 4CEJA 3OQIA 1RWMA 4X7MA 2C9YA 2C04A 3QVUA 4YAFA 5K6TA 4NYIQ 1A5AB 2D3TA 4WKCA 2HU7A 2F67A 3VSAA 5AUNB 1GY8A 4FWIB 5B1YA 3F73A 3FGOA 4IUBS 3GCWA 4OSOA 5T5QA 1P2SA 3GFFA 1GV1A 3GLHB 4M0LA 1M1YE 4MCIA 2BDEA 2HJVA 3ZU5A 3EGEA 4AY3A 3GDGA 4EL5A 4CEHB 1RU3A 4HNAB 3SWWA 1VE3A 3N3BC 3O3NB 4DG9A 2CEKA 3Q7SA 4CQLB 3WWEA 3HQ4O 4EENA 1CLEA 1B93A 3MB8A 4GZ6A 3C97A 3V42A 1IOWA 3A4TA 4YUZA 2WF7A 3N76A 1H3EA 1QQTA 4MLCA 2XOEA 5DM60 1OAOC 3CISA 4X1IA 1GZUA 2AOVA 1C29B 3FSEA 3O90A 3BSSA 2QBYB 1CY7A 1A9OA 4RY9A 4FGJA 2EKBA 1ZRSA 3WBBA 2QY9A 2Y8EA 2MJLA 3D5QA 3NHJA 1JR3E 1W59A 4AF8A 2VUTA 1AKWA 2RGDA 2WM2A 3A4VA 3LS2A 4N7JA 4UOQA 5FV7A 3RYCB 2VTEA 1GA6A 4GPAA 2ENUA 1NW5A 3NBQA 1GPBA 3IJ5A 1TCVA 4IFTA 4KVGA 4DMHA 3M4YA 3SP1A 1PFYA 2UYHA 2J7KA 1XA4A 2GMWA 2GZ1A 3S1LA 2ODEA 1X1EA 2QYTA 4RXUA 4TWZA 2GSWA 4YRRA 2VDLB 4AZVA 1CSEE 4QD3A 1IATA 2IFTA 3ROZA 3P52A 3Q5DA 2H1CA 3ZLBA 4EHJA 1FFWA 1JHAA 2XADA 4M1EA 4TMKA 3B1XA 3X1MA 4G4IA 3PD7A 1ST3A 2QNRA 3CBGA 3HCNA 3NUGA 3UFBA 3IVAA 1O94A 4ND8A 2VH1A 3W1EA 1OJLA 1IMOA 4KLZA 1ZI8A 3N0TA 3OOEA 7YASA 4UJ3A 1ODLA 3GMDA 3F1LA 4MIOA 2OQVA 2BP7A 4G81A 4I1YA 4ML3A 2BGKA 2JLAA 3KPWA 2W42A 3BH0A 3VC3A 4BLRA 1ZJWA 3GUYA 1RYBA 3GNTA 1XV5A 2XJ9A 2YXPX 4BL5A 3WGKA 1KFCB 4P5PA 4UEWA 3J80A 1YH3A 4MRVA 3TAXA 4AU1A 4Q4HB 4TT8A 2ICAA 3PHHA 4MYDA 4N5LA 5L3VA 1T2UA 4JUAA 1ZCFA 2C9CA 3HKEA 1JRLA 4JAVC 2F43B 5EQTA 4IO1A 1JKJB 2CC2A 3HBLA 3LL4A 3RD5A 5L7WA 2AFIB 4N3NA 2HJWA 2QAGA 1FFSA 4C6HA 1HMPA 1FXWA 1MTZA 4D9MA 3INRA 1OVGA 5JNRA 5JTUA 4YIHA 5EPUA 3KQVA 4IWXA 4UNIA 4B7UA 4TKMA 4KPYA 3RU9A 1A8UA 2AJ8A 3Q6MA 4P7KA 3L46A 3RREA 3V1YA 3SF8B 1U02A 2XQFA 2E5LB 1A69A 1U90A 1I2CA 3KJIA 4FFVA 2GAOA 3EQ6A 4AMGA 3TBKA 2FPXA 4L2IA 4OG2A 4PSDA 1Q92A 4PZAA 1IIRA 4CDRA 1WSBA 3KJHA 4RIIA 1ZD5A 4BIMA 4DLPA 3H0EA 5BN3B 1CDDA 1LSJA 1Z25A 2BKEA 3MCVA 3QFCA 2F8MA 5TPWA 2C4HA 4JI0B 4KPUA 5KAPA 5EHGA 3HY3A 4C0WA 1OE0A 3QXHA 4CT4B 1ZD8A 5J43A 1XMPA 1HPLA 2JFUA 4YCSA 1KMHB 2ZJYA 2HFJA 3HVKA 1YE5A 3QW4B 3QRWA 3PA6A 3RTCA 3UMFA 2AN3A 1XCBA 3UKOA 1TA9A 1L3BA 3K5IA 4Q18A 5G4KB 4BATA 3OZEA 1QGUB 2FEMA 1EGMB 2P40A 3PPYA 3CG0A 2X0EA 4CGZA 2ZTVA 2UXBB 3SS8A 1FRZA 4QU8A 4DMLA 4WNAB 1USVA 5JVDB 3VH3A 3EIQA 3P0RA 4F1KA 1T1EA 2PMCA 2AW5A 3I1FA 4IWYA 4EJ2A 4Q05A 5I51A 1W85A 5CYGA 4JI3B 1SHUX 4WA7A 2FCAA 3LGAA 3VAAA 4IDCA 3KLPX 1O6BA 2FN7A 4RA6A 1CDOA 3LY8A 3OZIA 2XMDA 5H59A 1L5HA 1MB0A 1PR6A 2BM1A 5K8CA 3HBNA 5HYVA 1DO8A 2NUPA 2PX0A 2Q29A 6ABPA 5JPCA 4PZPA 2QJWA 1ZRNA 3G5AA 5KZMB 1OYWA 2WHPB 3ZI7A 2I4LA 5CDFE 1KWGA 4ND7A 2P6PA 4S24A 4B3GA 3EDQA 4GZ5A 4LNUA 2OCKA 4YJ2B 1AMUA 1WXQA 1CZHA 3CPEA 2KSQA 1E4YA 1JXAA 1Y1RA 2ZG6A 3G2NA 5AVTA 1FFCA 5C3MA 1FBTA 3RAEC 1YIOA 2YZGA 2ZI6A 4HB2A 1ZNXA 4HLUC 4BN4A 3AL0C 2WMNB 5EWMA 3LI2A 1G4UR 3N87A 4GP6A 2ZR9A 5AVSA 1NTOA 5DBIA 2AHOA 2BRUA 1UJ2A 1CQPA 3RS4A 1ZI9A 4NBLA 4MQMA 3SC6A 4PXYA 2J48A 4DABA 1KWKA 1R0ZA 2IYLD 2ZYGA 3FMFA 5K0FA 4B3MB 1Z68A 1VRCA 5HK8A 5AHKA 5LIPA 2QTHA 3S55A 4GMGA 1IK4A 2YWXA 2QAJA 3GRCA 1SU6A 4TWBA 2JIPA 1YCHA 3DTNA 3OKFA 1KARA 1WUHS 4L72A 1YA4A 5DEOA 3JARA 3W6PA 4NC9A 4KTTE 3ZJYA 1VPEA 2XNHA 1RWXA 2IUTA 1MAHA 3N8GA 1KI8A 3CONA 4RIGA 4PLYA 4U7GA 4OHZA 2LDBA 3TRKA 5KDDA 5JNUA 1CHNA 1QOPB 4OFZA 5GM1A 5JZVA 1LH0A 1VLMA 1XMQB 5BVGB 2MOKA 2X0KA 1POWA 3FF1A 3Q10A 3H9QA 3QNUA 2BDTA 4G1CA 1SVNA 2NN3C 5DRYA 3MD0A 2V7WA 3RS3A 1VCNA 1QK3A 4D8TA 4RKQA 5LP6F 1W9HA 5F78A 1QE5A 4D0GA 2NW6A 4RL6A 5BRAA 1L7BA 3AESB 1RSZA 5FF9A 2NLOA 4J4TA 2NX2A 2REQA 5ABPA 2HWUA 1PJTA 3JZFA 1MXFA 4KMMA 2JF0A 4Q15A 3VNSA 3MFYA 4FCVA 4H7FA 4Q7LA 1G21B 2ZSAA 3ASVA 2CNNA 2VXCA 5T41A 3PXCX 1QPGA 3WHPA 5KYWB 5LZ2A 4RVSA 4PLFA 4WXEA 3NGLA 3NH6A 5JDCA 2ZU0C 3Q5GA 2W00A 3T7AA 1WCIB 4OSEA 4B87A 5ANRB 2GAFA 4H7IA 1LC3A 1CXZA 1O8CA 3RTGA 1A9YA 1X2BA 4KYVA 5L3SA 2QY6A 4DMMA 3MJEA 4TWIA 1CY6A 3C5EA 4TS1A 2DY0A 3ZDZB 1PO7A 1U8FO 2Z58A 2XXAA 4ARIA 1CF4A 2V9CA 2WR8A 3LQFA 4HGOA 4ZDIA 1FFGA 4YRGA 3H1EA 1GZ4A 5EQFA 2OAGA 4ARBA 4GP9A 1TZMA 2PS9A 4OBWA 5CX1B 3IAM6 4C0HA 3IKTA 3A31A 4XJVA 3DXZA 2I7DA 1OFIA 3ABRB 2JW5A 3FZNA 4Y30A 2UUPA 2EZ9A 3M6AA 5KYKA 2YKOA 2JFBA 4Z2YA 1XCPA 3GD5A 1ZDMA 2R8PA 2PKYX 3JZMA 4UHHA 3JAWB 2R4TA 3OTHA 2YIVX 2DBRA 3P2KA 2QI9F 3RC7A 4Q03A 4D3SA 2JEOA 4NMLA 2R79A 4BFYA 3CEJA 3LQ1A 1D5WA 4V0LA 5LC1A 4D9JA 3NTRA 2GFHA 3V5NA 3VXKA 1R7RA 2KQUA 1AX9A 4NZYA 1I51A 1J5XA 2XITA 4P36A 1M1XB 3PQ5A 3Q7TA 3VPSA 1KS2A 4EH1A 2G0NA 4IDOA 4YP0A 5I7AA 1Z2EA 2PWPA 1LDMA 4P83A 2WIGA 3QKRB 5GONB 2A14A 4BMYA 3D7MA 4D9EA 4URVR 2IS1A 2VL7A 1ZXXA 2HJ9A 4C22A 3STXA 1L4KA 2CVQA 3QYAA 1AKRA 1H1LA 4K3UA 4DA7A 1DXOA 4C0XA 3H99A 1K8QA 2WOJA 2YXNA 4MAFA 4Q9IA 2V6BA 3DBOB 5SY6A 1DWOA 1RBZA 4RYDA 1U11A 4PCLA 3LDFA 4R98A 1QUFA 2PMFA 2ZTHA 4AKEA 5IT4A 2P2DA 2H1VA 4F3TA 4GMFA 4HFRA 4HK4A 2BLLA 5LQUA 4IRUB 4JBGA 4J3NA 1E61A 3BMXA 2OHVA 1SPXA 2OHFA 3PJDA 4FOLA 4OHUA 3QPVA 4TZTA 2O8EA 4E09A 3H05A 4M89A 1EZ1A 3QUTA 3WKBA 5IBCA 1RW4A 1C30A 3O0DA 5DXFA 3H7IA 3PJGA 1PZXA 4FYYA 5CG1A 4QZVA 1P0IA 2V7QD 4ESVA 4YRLA 1GTJ1 1IJKA 1EFRA 1W34A 1WB6A 2ADOA 1W48A 1LI4A 3OEHD 5FWDA 4MMZB 3ROTA 3ZH9B 1RPAA 1C0LA 1NXTA 4R1PA 3T1HB 3ZHSA 4D41A 4KO1S 5JPDA 1BDHA 1GFWA 4PF1A 8MHTA 2RI1A 1W96A 1BN6A 5LQCA 2QRLA 3UENA 4HDNB 1VTKA 4JLVA 1NBMA 3ZU2A 2OXIA 2O6LA 3SE0A 3PXXA 3K9LA 3BILA 1SQGA 4M0KA 4I3HA 3IKMB 1M2FA 1R6UA 1VGVA 3PI7A 5FUYA 3P4XA 4YP6A 5FPKA 3P26A 4TMXA 3DBRB 5EL0A 4E31A 1JLLB 2F9LA 3AJ9A 5AMXA 1WNFA 1V11B 3L07A 4GWKA 2QTMA 4MROA 1D2AA 1ML4A 4WUVA 3SHQA 2DQYA 5BNIA 4HB4A 2BF4A 3BTOA 4O5OA 3P9QA 3RVJA 3ELWA 3M1LA 4M8KA 3CLTD 5KTOA 4L28A 2CVZA 4TL8A 4JI8B 3BWCA 3K9WA 4KWIA 1YJCA 4XUEA 5M34A 3T5GA 1BHSA 2W58A 5DGXA 3T9AA 4BE7B 5EZQA 3GF4A 4AZ3B 2BZ0A 2E37A 3OE7A 2ZYUX 4E21A 3BIFA 2DHQA 3IPCA 4F2WA 3LT4A 4HJRA 1PUJA 1WSDA 3ZIAD 5K3OA 1U2TA 2GJAA 5HIJA 4KX5A 5BVHA 3TTWA 1WOMA 3RWOA 5DV9A 1NVMB 1PS9A 1F3OA 1E63A 3I9V6 1U9YA 2Y1DA 2FXIA 4WACA 3KQQA 4QRDA 5CT4A 5TJHA 3W4KA 4C0LA 5BYAA 1CUUA 1W88A 2Q3DA 5A4JA 1F6DA 1V39A 2A1TR 2F9MA 3R24A 3WLEA 4YO7A 3ODGA 4G2TA 5LLSA 4U2CA 1DEKA 4KOEC 2BI8A 2DFDA 4OJQA 3FVQA 3KXLA 3TUJC 5K4GA 5T3YA 1I7SB 4ENVA 1YAJA 2GJ4A 3ZZ1A 4RD4A 2BFAA 1NKSA 3FYUC 3OOWA 4M7PA 5E4YA 4WXRA 2AJLI 3DWFA 4PPYA 4CMHA 5B4VA 2CNWA 3PXAA 4HPJB 2NOAA 1B23P 4MR9B 5IPFA 2Z4SA 3MERA 4MMXB 5DYNA 3ZUPA 3L6CA 1VHQA 1QFSA 4UE6A 3EIWA 5DM2A 2RD2A 2JANA 1HOTA 4C21A 1R4AA 3GCGA 3FAZA 1LV8A 1KMMA 1CUIA 1EBUA 1EYZA 4JJGA 4JGIA 5DX0A 2OUKA 1KNXA 2PLAA 1L7EA 5BWMA 4KW7A 3ZYCA 2QROA 1JDNA 1P3Y1 3F5MA 4Y6RA 1GQQA 2B5WA 3OCJA 1CJMA 3OC6A 5FA6A 3PHJA 1G6Q1 3X43A 1XQXA 1VLQA 3UJHA 4YPOA 4X94A 4U7TB 7REQA 2HA7A 4ZYLA 2HREA 3FBTA 4IEEA 1QGZA 2NZXA 4MW1A 4X7BA 5KAMA 1WU7A 5F4ZA 3LFUA 3RPEA 1ZAYA 2C83A 1UMCA 2ZQYA 4PHGA 1L4EA 4W5NA 1VL6A 1IC6A 2Y0BA 3ZOKA 1Y4DE 2NNWB 5DN6A 3MIIA 4NR0A 3BL5A 3AUFA 4MW9A 1DC8A 5T64A 4P3XA 1LQUA 3C5WP 4A2WA 1GGJA 4OHXA 4BNMA 4EKEA 2IZ1A 3AY0A 4QT4A 4MP8A 5DTEA 2JAQA 1EEHA 1DB3A 1W5EA 3OEED 4EI9A 1GUFA 1C1YA 4LBVA 3IT2A 3W9YA 1ZJJA 1ZOPA 4MDFA 4M9QA 3R20A 4Q16A 4G0NA 2QPAA 5G40A 1RABA 2GNPA 3AEZA 1HK7A 4GPEA 4UBJA 4DV7B 1XC7A 1I3MA 1KIFA 2VXYA 4W5TA 3B8HA 3V1UA 3C70A 4HRAA 3RWBA 2D5AA 1HT2E 1I1NA 5B5SA 2YXLA 3ASUA 4ETIA 5HNKA 4YYEA 2OORA 2VUSA 4Z0TA 2HM7A 3D4PA 4RFSA 3T38A 1VB3A 3BMOA 3EA5A 1NJ1A 4J8PA 3TLCA 4JQYA 1DQYA 4KE7A 4AO8A 3HHPA 2EP8A 4TLDA 2Z5FA 4DR1B 3KUXA 1BJTA 1ZXBA 3WQHA 3FZEA 4FS8A 3G2PA 3D0QA 2ZROA 1HT3A 4R0VA 4B43A 3R6LA 3OVMA 3OO1A 2GCPA 1XTQA 4LQ4A 2O7NA 1Q0PA 3D3WB 3FAKA 5IKXA 2FPGB 1M5RA 5CNJA 4XUCA 5IEBA 1F48A 2WFLA 3I3SR 1THTA 1EUZA 2I1QA 2V1XA 3CWCA 3DLCA 1WMFA 3LT5A 1X8XA 1M8KA 3DFIA 3FOFC 1J2RA 1QIGA 5KYXA 1THGA 4K6CA 2Y2VA 2UZIR 3FB4A 4WUTA 1Z4JA 5CGQB 2VTBB 2EYQA 1C8KA 3P9IA 1B3RA 2OFPA 5IABA 2HHCA 2J33A 5CBPA 3ZBTA 2IYXA 2NV2B 2W2PA 3FYUB 1DC4A 2KE5A 2X2PA 4HB0A 2YICA 4DIUA 5DIZA 1WLSA 2PSEA 5LA6F 3LKZA 4KGZA 4JVSB 4BEJA 5TGZA 1KKMA 3U26A 2IX9A 4DQDA 2ZZKA 4DSUA 2XB6A 3AJAA 4I3FA 3QYFA 1A9TA 1TA4A 1KY4A 2OCAA 2RGEA 3A3OA 4HUQA 1KSHA 3G3EA 3C1OA 4R3NA 2OLJA 1J21A 2PTHA 2DFTA 3B48A 4US0R 5C8ZA 1Q0UA 1Z0SA 3VYRB 3SGLA 2D4AA 4OQXA 4ZREA 4FONA 4BMOB 2HSDA 1X87A 1AQLA 2JCGA 4HYQA 5CVTA 4XB2A 5K09A 4YT4A 2DUJA 1LNZA 3T0IA 4H7EA 3K6RA 1K6IA 4RESA 1VL8A 2GH1A 1HSZA 1Y63A 3R3SA 3DLIA 1GTL1 4MA4A 1JT9A 1LK7A 4DIFA 1MG0A 1Y4UA 3H6GA 2J9FA 1U63A 4KQ1A 3J7TA 4KE6A 1D0VA 5IXYA 1PW5A 1WDKA 5D6OA 1A8IA 1AH2A 2A9JA 5EKSA 2DTEA 2JI4A 4R6WA 4FR5A 4CNQA 1DJNA 1Q2XA 1TI7A 2C2HA 3TLGB 3QOFA 2LWIA 1NHWA 2O1EA 2OZVA 4BNDA 4MLZA 3H3JA 3O4HA 3D4IA 2G36A 3ZHXA 2G40A 2LD4A 2XYRA 1DKOA 4O1IA 2AWOA 4TKLA 3NBXX 1QCDA 4XDYA 2W90A 3WMXA 4R71A 2M32A 1IBMB 1DIGA 2RJNA 1JDVA 3PUHA 4HL6A 4NJEB 2BFDB 2YMQA 1LWOA 2BBTA 4W9NA 4X62B 1E3IA 3PWTA 3VC2A 4MAMA 4FFDA 2EWWA 1RYNA 1ADGA 2OV6A 3LNTA 4IDFA 3VZPA 1NVVQ 2OO3A 3RANA 3U37A 4AKGA 1N3IA 3FRIA 3R0VA 3L9WA 4ZVSA 5B3KA 3KWJA 3HPQA 3OWHA 4NF2A 4P4SB 3CLTC 4QA9A 3LWDA 3K0FA 1AZSC 3NAQA 3SIWA 3V4FA 1DRJA 4WT7A 1CUVA 1QR2A 3NZEA 4B3FX 3T7IA 1A4IA 1JIKA 2GQ0A 6PFKA 5KSWB 1JDJA 1YONA 4JLUA 4F8JA 4RTKA 5AVXA 3L40A 5BR7A 2NO0A 2QX4A 2WUFA 3FNIA 1VA5A 3HFRA 4XCXA 1MMFB 4MJ3A 3IDQA 4MUGA 5TGTA 4CM8A 5TQ0A 2QQ5A 4EGSA 1UJ5A 3IEKA 1BVUA 1PJ2A 1DDOA 1UEIA 2R62A 4RXTA 3ZTYA 3OZGA 1JBQA 2QL5A 3ISTA 4L7QA 5K0BA 4KLRA 2HPAA 2ZJ1A 1SC3A 3QFFA 4S12A 2B30A 4F4CA 5CM8B 1JDZA 2F1RA 5BWNA 2JHPA 2P5UA 1CUHA 1Y9EA 4DZRA 3ONWA 1J56A 1KOLA 121PA 2D2IA 2BKAA 2GZMA 4GX5A 1K0FA 1M2HA 2P9YA 1K8RA 3C8DA 4BKRA 4D9BA 4H1UA 4V1CA 3M83A 3QOYA 2JGLA 1E1CA 4AKTA 3PUYA 4GMXA 1OR8A 1SXJA 3IUEA 1RQRA 3LQYA 2D0OB 3EGCA 3IAM1 1ZFNA 4EB6A 1PFKA 1US8B 4URXR 4IM7A 2XUZA 2D0DA 4CIWA 3WGZA 1ISGA 5IVKA 4PPFA 1RBYA 4LDQA 3OLZA 2ES4A 1XWIA 3JSAA 3PR2B 3PQ4A 3EXHC 1SC6A 1Y80A 3GLSA 3BWMA 4M55A 1AZLA 2O2YA 2WY2D 3TQCA 3TEJA 4WSOA 3MMPA 4BU0A 3A37A 1S7CA 3T3EA 4ENUA 1NBOA 2ZYVX 4KQEA 1KRXA 1SKYE 4H3SA 3GEEA 3UK2A 3DL4A 1YF3A 3WLLA 3CLHA 2ONYA 4U7HA 4BNGA 4ZZ2A 2AX4A 2AUNA 2P41A 3KWFA 1TJYA 3G1UA 3GELA 1BE6A 4PYOA 1QDUA 4J49A 1IQRA 3DFZA 1BGWA 5TXGA 4PZ9A 2X0FA 5L4LA 4MUEA 2V0CA 2KMLA 4MVJI 4K1LA 1KVQA 3OE4A 4M60A 4FFBB 2VJNA 1NKTA 4FVTA 5ALPA 4B7CA 3HFSA 3K5PA 5JS8A 5A0FA 2YXEA 2W2OA 3E70C 5DKFA 5JEDA 2YC4C 4MGHA 3T1TA 2YUIA 4OFWA 3AOEA 1M1NB 4HAIA 3Q9SA 4WOPA 1E9BA 3QXSA 1V4BA 2QE6A 4PYRA 2WZBA 1YS6A 3OUZA 2UZ0A 4AT1A 3E9NA 1K66A 2AE1A 3VHRA 3UM9A 4QBGB 2FPSA 4F2PA 3C2QA 4UBOA 1EGQA 4M0MA 4X6LA 1EPUA 3RRXA 1X1BA 2LZ0A 4PWZA 4CZ2A 3K32A 5FL3A 3SIPA 1JKMA 1SRQA 2AG1A 4ER0A 3B82A 3GJYA 3SF0A 1JHUA 2CXHA 5FWYA 5KNCH 2FSIA 3AKCA 4REOA 4DAEA 2XZOA 2O2IA 5K6RA 1AKUA 2PANA 2QYHA 1WCWA 1RJ9A 2X9VA 2FMHA 2ZYIA 3CIOA 2TYSB 4PSUA 1J20A 2POQX 1YQTA 3RG8A 4IF4A 1LNSA 2QLBA 5A4DA 2F8TA 5AVUA 1BMDA 1ITZA 1XT6A 1QVVA 1SOVA 2C8VA 1GRNA 2H9YA 4FSXA 5DGHA 4U8HA 3P94A 2JBAA 2IYWA 4P4NA 4IOLA 4NZ9A 4DNPA 1SELA 4B8YA 4WDQA 4JJFA 1P73A 1PQPA 4GPIB 3QV2A 5EJ4A 3NT2A 4U0JA 4EMTA 3DKIA 3CZQA 1RS0A 3MB5A 1CR6A 2P3LA 1QQBA 1JR4A 1G4AE 4GVPA 1IYZA 3EXEA 1M1ZA 3REQB 2OV8A 3H8SA 2OBXA 4B4VA 2VDWB 3IIIA 3QWFA 5FFMA 1CJTC 1E18A 1QE0A 5FD8A 4AUNA 3INYA 4R8MA 3ZXUB 3RGWS 2DKNA 2NZ8A 2NZVG 3REOA 1U7UA 1G6KA 1YQEA 5ITZA 4I99A 5AI0A 5BMOA 3IEPA 4DV5B 2VHVA 1ODCA 2YJNA 1Z06A 5D01A 1L5QA 5CB4F 3VU8A 5DCLA 1DQSA 4DY4A 5DW3A 4C7OA 5ICFA 4RPJA 4S0ZA 3SJCA 3B53X 2RGBA 1EK6A 3BIXA 3KQTA 1PJZA 1UP6A 3R5KA 1EE9A 1ZIDA 2FKNA 1UBTS 2OWDA 3KC2A 4JK3A 1P4RA 1KHTA 1UT8A 4S1VA 2OCPA 4ECAA 1BQ4A 3EXHB 2Q62A 3LBHA 3T3MB 3CVOA 2QPTA 1GL6A 3FF4A 1A72A 1L4HA 4N9QA 4TQ9A 1NF3A 1TZCA 3ADDA 4ZK2A 1GDDA 3OOSA 2FPIB 2VK4A 4KXFB 1RQGA 4YP9A 4DV2B 3IP3A 1Z5GA 4ZAVA 2PUVA 3JPWA 4FW9A 2BFEA 4IAOA 4IDHA 4M9XA 4MVWA 5DDIP 4NMHA 4LOAA 5JCZA 3THWB 1ZESA 4KDEA 4YQZA 2NUTA 4B81A 4KQWA 4F38A 5JSQA 4U02A 5HX7A 3ISVA 2GN8A 4YMLA 1TXGA 5IM5A 2VAPA 1Z83A 1R6DA 2WSBA 4IXDA 4HMQA 4MIYA 3W5BA 2WWFA 3EQZA 1L1QA 3WNBA 4OIFA 3FM9A 1U8TA 1ULTA 5BQ3A 2F7SA 5IJ0B 3OBIA 1EFDN 4RZHA 2PGIA 4WDRA 1K1EA 1XXHE 4AP6A 2G80A 2RC5A 1JHMA 3TTVA 3UV3A 3HDVA 3V6MA 1HZZA 4AS1A 5LOVB 3Q7IA 5T4FA 2Y1GA 1P2GA 3URMA 2IZOA 1YQ9A 1EFRD 5DEIA 3AM1A 1ZN2A 2CD7A 2PSJA 4RLHA 3TSAA 1HDEA 4R5HA 4YV0A 3G0OA 3OEWA 1UKVY 2ZCVA 4KFTA 1XRRA 4EEKA 1ZGGA 4HDMB 1E1LA 3GZNB 1TM1E 1FFHA 4H0NA 4MRPA 2CVHA 2RIRA 3Q8LA 4ZTZB 2IV2X 1SXQA 2FSFA 1ZIOA 4C4ZA 4QJ5A 1DIOB 4FZ5A 1CB7A 1SBQA 4LBZA 2FWJA 3R40A 4YAGA 1JFVA 5EIBD 2WHXA 1ST2A 3ZY2A 1U9ZA 4B7AA 3KEOA 3L0CA 2O1XA 3HCOA 3R1IA 2B6NA 5GWXA 3QWIA 5JZBA 1VB5A 2R1TA 4OXQA 4ZRDA 1HORA 2B7LA 2QD1A 1XTBA 4RH3A 3L0PA 4BNZA 3VUEA 2ZTUA 2W22A 2GCOB 2VAVA 3A6KA 3LXRA 4MJ7A 4HXGA 2CCGA 1IN4A 5C35A 2QR3A 1GL7A 1JZQA 2Q1SA 2CUKA 2IDZA 3RJZA 3AI2A 3IP9A 2H2GA 1WZEA 2W2QA 4G1MB 4GUDA 4E5YA 1KE2A 4NJMB 4XQ9A 3AU9A 2FYTA 5TF4A 3I9NA 1JHQA 2ZPUA 3KTAB 4Q3CA 3IAAA 1K89A 5A5EA 2ZP1A 4QASA 3VFDA 1I24A 1YZFA 3OFNA 3QKTA 1UIRA 4NU6A 3LV8A 4EKIA 5IXJA 1EUDB 1Z4OA 1PTJA 2AL7A 2UDPA 2PBZA 3EB9A 3EQ7A 1Q12A 1A27A 3GUVA 1TGVA 3COYA 4EATA 3NEYA 4TPKA 2WFMA 1M72A 3HKCA 1PFVA 1KJWA 4F92B 2XCOA 4EUFA 1OLSB 4HDOB 2FW0A 1QPBA 2A30A 3ESQA 4M1YA 5EE5B 4GI1A 2VDOB 1CT9A 5JU6A 1PQ4A 4EY5A 4EA8A 1QGDA 3KUDA 4JP5A 4MWGA 4LC9A 4D9CA 1YKSA 1VI2A 1T35A 1P4GA 2WKWA 4PFQA 4QGAA 5AK3A 5CA0F 4OUDA 3C3KA 2HA3A 2PUGA 2NU6A 3COPA 3EWSA 1P8JA 1DC5A 3ZGNA 2CNWD 2QUBA 2K7FA 5DHUA 3UBMA 4DREA 1YFJA 1K68A 4EA6A 2X1MA 5AVZA 2QLLA 2I1WA 4DNFA 5I3ZA 1E79A 3K4PA 1Y8RB 2WVHA 1L4YA 4RX1A 2IEIA 3OJOA 1IN6A 1ZXLA 1MDFA 4KPGA 3TZEA 5H9WA 1JJAA 1AF7A 1E4EB 4LY6A 2ORIA 1WV0A 4RIHA 1ADFA 2XMCA 4R9VA 4AJNA 1TJ3A 1ENYA 1UCFA 1NPDA 3HDGA 1G18A 1U0EA 3MTAA 3QVMA 3FHOA 2WUEA 1QSGA 4KV9A 1M76A 1C1DA 4D25A 3KZOA 5D87A 1I1QB 1NJ6A 1E3WA 1W73A 3OBBA 2ZB8A 5BSHA 2JCBA 1VBKA 2FFJA 1JAHA 5HMLA 4P3NA 3NLLA 1ZK1A 2FSVC 2I54A 2X15A 1UBRS 3ZDDA 3C3MA 1M2WA 2XZDA 5EEGA 2DU8A 1D04A 1E89A 3KXPA 3MM4A 4B6GA 4FFNA 4P58A 3GJ7A 3R5SA 3AHDA 4AO7A 1U5BB 4KXNA 4PEVA 5CLQA 2JIOA 5DN6D 2RARA 3RH0A 2C7RA 1XDDA 4EA7A 2C97A 3FA2A 5D84A 3DOCA 4W7HA 3T06B 1DV2A 4E08A 2XUAA 4R9SA 2X0DA 5DVZA 4O33A 2OPBA 2Y9MB 2QW1A 5JADA 1HF3A 4GRAA 1S8FA 4R0NA 5DH9A 4MNTA 2R84A 3ZW8A 4OLJA 2X13A 3LA8A 2PYDA 4FN5A 4JGGA 4FP9A 3MQ4A 3VDNB 3TLZA 1NHGA 1J5PA 1M7HA 4PFJA 4NCBA 3RIMA 4CT0A 1KEEA 2Q6TA 3VU9A 3UK1A 3OFSA 1JTVA 2ZYTX 2KYRA 2XCQA 4JVNA 4R2IA 4WJKB 1JPNA 2BH2A 1B76A 4PPNA 1PJSA 2X76A 4PC6A 4BX9A 3ZD8A 3HEBA 2MYPA 2P35A 2PK3A 3D6HA 3EAGA 4D80A 5TJ9A 1JQDA 4YECA 1WSAA 2WJWA 3NWJA 3ROQA 2EX4A 1X94A 3FCAA 2C78A 2BZGA 2I29A 4N12A 1JFFB 1HE5A 1N0HA 3UNXA 1BNCA 4X1KB 4DMKA 3AVTA 3DXXA 1Y5LA 1NUTA 1MBZA 4JUBA 2DCUA 5FLXA 3PE3A 2JHAA 4UW9A 1VA4A 5CVVA 1XVAA 3VX4A 1SHZA 3MGGA 5DK6A 1OTYA 4TXJA 2WWWA 3QEKA 2ONZA 5A3RA 1FYXA 4IDDA 2VHJA 4XVHA 1M0WA 3AR9A 4K2HA 3PF8A 3T3NA 1CR2A 1I9CA 2BFNA 5ITSA 2HI0A 1M6VB 3U2QA 2G4LA 1HEYA 2EP5A 4X92A 4YDHB 1BU8A 2D1RA 5JRJA 2YN4A 3P0EA 1T3LA 3QKIA 3NBYC 5DT2A 1AC5A 1Z39A 2J3MA 2PGAA 3MF4A 1UDAA 4EG7A 1ZONA 4OFBA 2H4YA 5F51A 3H5IA 3E18A 5IDQA 4PC7A 3I09A 3K20A 4FHGA 4F9EA 1OFHA 1TVEA 3W9BA 2FCRA 1SOWA 4LDNA 5DISB 3IT3A 4FOTA 3KCNA 1LI7A 2C1EA 3W05A 2B69A 1Y82A 5IK2D 1B8OA 1P5FA 5GGXA 2FQQA 1Y1TA 2QN6A 2N75A 3LK6A 5C1IA 1PEYA 4M86A 1ZISA 3D4LA 4HQRA 4ZJZA 5A03A 1XKXA 4QELA 1KBQA 5KOHB 4Z0HO 4K6OA 4Q9KA 3OIDA 1U65A 2XYPA 4UXJA 2VBIA 3QYPA 1O8BA 1KMNA 3KOUA 3B1WA 3UQYS 2JFGA 3CIFA 2TRSB 2PMDA 2H16A 3OPYA 4XW2A 3L8GA 2JLQA 3A6ZA 4O4HB 1D8AA 3H75A 5CYPA 3JALA 1OWLA 3OU6A 1JWAB 1TIKA 3HMKA 4U7FA 1TT7A 3M9XA 3SBEA 3B2NA 1VBMA 8OHMA 1CRQA 5FBQB 1OI2A 4IJMA 4M9SA