2ZRNA

Msreca form iv
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
326
structure length
317
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 81
structure length 317
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrnA01
4LHWA 4WIAA 4RD4A 1W7AA 1ZU5A 2W83A 4AG6A 1EFHA 3RLFA 2QI9C 1W2GA 1SVIA 4OJKA 1OXUA 2GCOB 3F3YA 3A37A 2P6RA 1T3LA 2O8EB 4JVNA 1FX0A 2XNDD 1NF3A 2ZXUA 4Q9IA 1XTKA 4UNSA 1NY5A 4WZAE 1A2KC 2QZ4A 3IDQA 4OI2A 2J5XA 4EJSB 3TR5A 2IXEA 2P0EA 2DFLA 4EPTA 5KDDA 1OJLA 2GJAA 2VF8A 2ZSFA 4DUGA 2QT0A 2EFCB 4TLBA 4PQRA 2RKOA 4LYAA 4U02A 2PCLA 2O8BB 3BK7A 1E94E 1SKYE 2NZJA 4MGYR 3WNCA 4DDTA 1IY0A 4PR0A 2WJVA 4F4CA 3KL4A 1Q22A 1KNXA 2JLZA 1ZNXA 2YZ2A 5KSYA 2FG5A 4M9QA 3GQBA 1XEWX 3AM1A 2Z6VA 3TNFA 3QXXA 1KY2A 3LA6A 4CDGA 4HLCA 1PZNA 3B6EA 4UQOA 3SNHA 5JJIA 3VQTA 3H84A 1XPRA 3OESA 4NYIQ 4X8HA 3V9PA 4A2QA 2ZI5A 3GMTA 3I8SA 2X1VA 5JCPA 2GEDA 2IUSA 5EE0A 2ZUDA 4HDCA 1Z0FA 2MSCB 5SZIA 5BN5A 4J0QA 5L3SA 1FNNA 1SXJC 1Z07A 4XVUA 3GEHA 3CPEA 3GLHA 2VP4A 1FNMA 4LHVA 4D4MA 2OE2A 1JNYA 2MSEB 2JAQA 1JR3E 4PSKA 4JLKA 4PZYA 1SVLA 3E5HA 3WYFA 2KE5A 1PVOA 2BBTA 5GVRA 2XXAB 4QNMA 4BLPA 4CEIB 5SZKB 3K70B 2GILA 4ZO4A 4D0LB 1PLLA 2W0SA 3BFKA 1I4TD 2REXB 1TMKA 3WXMA 2ZE8A 1ZCBA 3GFOA 3KQLA 5DH9A 4RJLA 3QIAA 3DL0A 3MLEA 1FL9A 1OPXA 3ZJYA 1S4QA 1G5PA 3GLGA 3FFBA 3HR8A 4C0BA 4EPRA 3FPAA 2QMHA 3ZZ0A 3QEJA 3TW8B 1G8FA 2IEZA 1G3IA 3UG6A 3TUZC 2BCGY 4ZCLA 4GPTA 2JJ1D 1OFHA 2GKSA 2HT1A 2WTUA 1ZC3A 4DC9A 1W4CA 3A1TA 4ZDWA 2ATVA 3EPHA 2HYIC 1TQ2A 3PCRB 3CBQA 2GXSA 5DYIA 1HV8A 3BORA 3WHKA 3EPKA 3QKTA 1OW3B 4MQBA 3BOSA 2J0UA 5F98A 3WBJA 1KI1A 2QTHA 4KITB 3NHBA 1NKSA 4URWR 5K8LA 2FX3A 3EZ9A 5FR1A 5DI3A 4M1YA 3AF4A 2ANCA 4PPGA 4HLDA 4URZR 1F48A 5KDLA 4QM7A 4DT1A 1EG7A 2FU5C 1F5NA 1ZUIA 3B1WA 1G7SA 4AYXA 6Q21A 1XZPA 1IY2A 1VTKA 2G1KA 2DPXA 3HU1A 4QJ4A 4FMCF 2OG2A 2IYUA 2PEZA 2WAXA 1CKEA 4NYJQ 1XF9A 3BFXA 4Z8YA 4QKQA 2G88A 2V1XA 2H92A 3BH7A 3OFNA 4Q1FA 4BLRA 2YOFA 1JAHA 2NO0A 2HCBA 2DWQA 1W0JA 4B3BA 4M1WA 4TYQA 1P9RA 4JVSB 1IN8A 3AV0B 3KTAA 3NC0C 4JL6A 5G3YA 1U8ZA 2WKQA 2CNWA 1NN3A 3QUSA 1ETUA 521PA 1E3MA 1G4UR 1KSFX 1W1WA 1XFAA 1AS0A 2GA8A 2YV5A 4TL9A 2G3YA 5GJCA 2Q3MA 5CIQA 4MRRA 5JECA 3LXXA 2UKDA 3AP3A 4M53A 4TMWA 3Q5EA 4BZXA 1TQ6A 5EE9A 4Z54A 3K8YA 3MWLA 3QKRB 1G41A 2R44A 3TSOA 4YDHB 4AY2A 2DWPA 2QQEA 2VA8A 3H86A 1FTSA 3B7GA 4B3FX 1U2RA 1SKQA 5FFMA 3QPUA 1J8MF 1YJ5A 2J0VA 4C7OB 1W46A 1J2JA 1V43A 4QFMA 1W4BA 4H1VA 2QL6A 2XAUA 1XB2A 4PAMA 4WXPA 5LB2A 1W0JD 1G9XA 3Q5DA 5EQTA 4Z1MA 1KSGA 4Q9LA 3PIRA 3QNUA 1W44A 3UK6A 3GLIB 3MWYW 2CNWD 1T3SA 2C03A 2C5LA 1OIXA 2D62A 3SC3A 2Q3HA 2A9KA 2DFKB 4QXAA 2J7PA 2PLFA 1YKSA 4GMXA 4CEHB 2CL0X 3ASYA 4R2IA 3VKGA 4K46A 1NBMA 1X8JA 1S0UA 3LW7A 4JLJA 3EAQA 5AJXA 2ZEJA 4FINA 4PC6A 3R7WB 1ZJ6A 1ZW6A 1UPTA 3MGCA 4V0NA 2PT7A 5HZHA 4MITA 4NPHA 4G5GA 4ITRC 3U7HB 4CYMA 4DCSA 1N5JA 4V03A 1XTQA 1QHHA 1E2KA 4LCBA 5HKKA 2W2XA 3DOFA 1YRAA 1E2MA 2ONKA 3C7KA 5SZJA 2DCUA 1ONBA 1ZNZA 4DEXA 4YMUA 2HYDA 2V1UA 4A6XA 4PC7A 3GJ0A 1JPNA 4LV6A 4JLBA 3PITA 1JBKA 1G3UA 4BEJA 3X1DA 4TL8A 1WBBA 5FTMA 5KSZA 1TAGA 4Q4JB 4U5XA 1XZQA 4KVGA 4ACAA 2BMJA 4TN1A 2JJ2D 1GL7A 4CVNA 1WDTA 3UMSA 4A0RA 2QAGA 2QE7D 1TQ4A 4I99A 3THWB 5EXPA 1TEVA 2AWOA 2WVJA 1QHYA 1E2NA 1VG8A 4FWIB 4ZIRA 5HKKD 1E2PA 1G16A 2HUPA 3NEJA 2JA1A 1L8QA 3ZD6A 4B3DA 2QORA 3TBKA 1NL3A 1A82A 1IAQA 1IQPA 2ASEA 2GDJA 2JCSA 1Z22A 2AXNA 3T35A 2G9NA 3REGA 3NWJA 4IEIA 1R0YA 2VBCA 2XEXA 2Q9BA 3CW2A 3CZPA 3U3JA 1VKJA 1GP2A 1QG2A 3LW8A 3L0IB 4PHGA 1XEWY 1W36B 2A3RA 2QM7A 4NYIR 2LWIA 3U4QB 2O8CA 1VCIA 2CXXA 4DVGA 2A5DA 4JKIA 2ZRCA 3MJHA 1JPJA 4KSCA 2NOAA 1CRQA 2ZREA 4RKFA 3OE7A 1H65A 1YR9A 4LJ6A 2R6FA 3GD7A 1QHIA 3IHWA 3PR1A 4A1FA 1M6NA 1Z08A 1XMIA 1KI6B 3ICEA 4JMPA 3W3ZB 2VRWA 1XJ0A 4B73A 4LX0A 2EQBA 1CLUA 2GVDC 3AKDA 4O2LA 3FHCB 2WWGA 1GNRA 4IDOA 1OT3A 3T1TA 2C95A 5EE3A 4PPQA 1XRJA 3CRQA 1W4AA 4ASUD 1XD9A 4X8LA 3QPVA 5JSZA 3SBEA 4D4JA 3BD9A 2B6HA 4CT4B 4WZ6A 4OI1A 2MMCA 4DJTA 3OHMA 3HU3A 4JLOA 2FDCA 2BCJQ 1EFUA 2QU8A 5L3QA 2SHKA 5BYJA 2QGZA 3THYB 2Z4SA 4NKRA 2P6UA 2YOGA 4QJ3A 4BLSA 2DBYA 3SFVA 2IS2A 1TUEA 4Q1CA 2J45A 2CK3A 3BIFA 2NO7A 3FGNA 3LXRA 3AVWA 1E98A 4NDZA 4YMSA 2IWHA 3E1SA 2QENA 1DAMA 4B76A 4TL7A 1A5TA 4P31A 1JECA 4R98A 1I2DA 5EJEA 5CLQA 3SU8A 1KZ7B 1WMSA 3L0OA 4NL4H 1QVAA 1KO1A 2ZSEA 5IHPA 1XTRA 1NIPA 1UBGA 2O0KA 4W5HA 2X77A 3IILA 2R8RA 2A2ZA 4QBIA 2GCOA 3L0PA 3X1ZA 2KB0A 5B64A 3QPWA 3BH0A 2O8EA 1DAGA 1VYVA 1H8HD 4AD8A 3PEWA 1ZVQA 1Z0IA 2GWHA 1S3GA 3GPLA 3DKVA 4MYCA 4C3ZA 4LC0A 4MGKR 4LBWA 1FW6A 3NBFA 3TKLA 1BH2A 1LNZA 1KO8A 1G21E 1XTIA 2CJWA 5FTKA 3MCAA 4KLZA 4RVCA 3V00A 5JBQA 1A1VA 5FTNA 1E2IA 1W5TA 1MRNA 4I1SA 5C4GB 4D25A 5KDOA 1MRSA 2O8BA 1RIFA 1Z2AA 4AWXA 5CB8A 1RYFA 2FN4A 2HJGA 1LVGA 3Q8XB 4QBGB 2FA9A 1ZAKA 5EUMA 4BEBA 5C1BA 2D2EA 2FEOA 1E2QA 4LJYA 4EFLA 3KXKA 3QKSA 3U7GA 4YDSA 5GJVC 3TLXA 1CJUC 3N2EA 5L8VA 2VHTA 1E9FA 1XMJA 2WWFA 3WBKA 1D2MA 3LDAA 4Q7JB 5FL3A 4QHYA 1U90A 2HLDA 2RB4A 2GEUA 2G0NA 3MRSA 3G5UA 4HZUB 4TMVA 1D9ZA 4PSAA 2BHRA 3WRYC 2WOJA 3R9WA 1Z83A 2C9OA 4HDQB 1XEXA 1FUKA 1UBEA 2ZRMA 1OHHD 3CR8A 4JBYA 3K9LA 4BFXA 2H16A 1N5LA 1Q12A 1VHLA 5GVSA 1GSIA 1KDOA 1VYUA 2VH5R 1R4AA 4M2LA 1NLZA 4Q66C 5BYKA 1BMFA 1SGWA 2XXAA 1ZINA 1XTJA 4CEIA 4Y0AA 3ZGXA 5J4LA 1ZIPA 3LY5A 3A4LA 5P21A 5FUVA 4JL5A 4WXRA 4JLAA 1HEIA 3SR0A 1P3JA 4OHXA 1C4OA 1SZPA 1KOFA 2CL6X 1OIWA 2JIZD 3L82B 2ZJ5A 2R6DA 1CRPA 1XXHE 3AVYA 2HLDD 4BFWA 1SXJB 3FMOB 1Z29A 4OK3A 5FBVB 3ZYCA 1IN5A 1AN0A 1U0JA 2V54A 4MDEA 1VPLA 2OBMA 2CL7X 2D74A 3REFA 2J41A 1U99A 3UXMA 1MH1A 2GF9A 3B1VA 5JFGA 4HAVA 1KI3A 2DHRA 3C14C 2AFIE 1P61B 2B92A 3H4MA 4EKDA 1UKYA 3PVSA 1E32A 3K70D 4BE7B 4NE2A 3X1XA 1Z6GA 2FE4A 2QP9X 4MKIA 1NVXQ 4KXFB 1EXMA 1XJCA 2LKCA 2ZE7A 4PC3A 4DEYA 2GVZC 5KU1A 1M8PA 4JLPA 3OAAA 1E9RA 4O3MA 1OB2A 4URYR 4LYHA 3D31A 1L7VC 4BZQA 4BGDA 1FZQA 5FPKA 4KLNA 3WP0A 3QY0A 1Z06A 4Q9KA 3QENA 1R6BX 1S3SA 4P0TA 4HLUC 3THOA 2WM9B 3B85A 4M1MA 2WWIA 4YQFA 2A30A 4QOSA 5D3QA 5J5CA 5E7IA 1KY3A 1D8TA 3K0SA 1M7BA 1YRBA 5D3MB 1VDZA 4QGHA 1O3YA 1RFLA 1EFRA 2D3WA 4TLAA 2ZPTX 1ZBDA 3IPXA 4M22A 5E95A 2FEMA 1KZGB 3AF1A 2LCFA 4M21A 1TX4B 1VIYA 4RCZA 4PQFA 1CU1A 2WMOB 1LF0A 1X1SA 1VECA 5J4HA 1E0KA 3LVQE 4UKDA 4WVFA 5FOUA 3CRMA 2V55B 1VCNA 1YE8A 4G5RA 2OV2A 1G7RA 3BS4A 3CX7A 4XIGS 4S35A 3C8UA 3MD0A 3I8XA 2YKGA 2A78A 621PA 4GMDA 4LGMA 3EA5A 4KYIB 1TF7A 3GJ3A 3RDPA 3LD9A 4C7OA 2J46A 1X1RA 1R5OA 4IOKA 3W90A 3SBDA 3TIFA 4ZDIA 1US8A 4LJ4A 1TNDA 1YU9A 1C9KA 4O2RA 2XOKA 3RS2A 3W8NA 2QMOA 1XPOA 2KWIA 821PA 2AX4A 2P65A 5H1YA 4P32A 2F7SA 4V02A 3GLFE 4URVR 1KJZA 4ZDKA 1I4LD 1E9EA 1IHUA 3FKQA 2QAGB 4IFBA 4PC1A 1ZM2A 2ZRPA 5BN4A 3CPHA 4V0ME 3RC8A 1A7JA 3IO3A 2IUUA 4D4LA 4GRAA 1NIJA 1ZNWA 4ZIRB 5FI0B 3MFYA 4JLNA 4BUJA 1F6BA 4JLDA 1ZM9A 2RGDA 1P2UA 5JEEA 4JKYA 3LBNA 4CEHA 2HEIA 1R5NA 2F55A 2IC5A 4Q03A 1N6LA 2C96A 2QP3A 4L5BA 1X86B 2HXYA 3EPLA 1NN1A 2A5YB 1P60A 1ELOA 3ZZUA 2XZPA 5B57C 2WSSA 2C04A 3KJGA 2ZJ2A 2CLCX 1Y63A 4Q1BA 2GNOA 1VG0B 2ECKA 2PZEA 5AJWA 5DLQC 3W6NA 1GDDA 1D2EA 5EP3A 2BM1A 3AGQA 1WA5A 1IXRC 3AVTA 2B8TA 4L16A 1XJQA 4B2IA 2FZ4A 4EFMA 2HCJB 1IY1A 5JWHA 1EFCA 1KI8A 3DVLA 5AUQA 4LK2A 5EZ6B 2DR3A 3HR7A 1Q1ZA 2X19A 4RZUA 2WBLC 4WW0A 1Z63A 1FP7A 2AFHE 3C4JA 3BB4A 4Q4JA 2XTMA 2A5GA 5JSZB 3W6OA 5TB5A 1IOZA 3LH5A 4G5SA 1KYIA 5IDVA 4N0DA 4TMZA 1KK3A 4LRWA 4WOPA 2RCNA 4IHQA 4ZCIA 3JVUA 3THWA 4PHFA 4PXAA 4EPXA 2VP6A 2ZRAA 1RW4A 1WQ1R 1EWQA 4B32A 1K6MA 3RVBA 4TWZA 2XGJA 2RGXA 3F8TA 4Q21A 4YXWA 2QN6A 2C8VA 2Q9CA 4E5UA 4LJAA 4B34A 4WBSA 3A36A 4UXIA 3D7MA 2R9VA 2ATXA 2IT1A 3KFXA 4QG7A 4A15A 4Q19A 3IQWA 4RFSA 2IYYA 2JDID 2RGNA 3VFDA 4M1TA 3RNLA 3VR2A 2QQ0A 3LO5A 5TV2A 4DLZA 1ZD1A 4HB3A 3SHFA 3U4QA 5DHFA 1JXOA 2ORVA 2H7VA 3K9HA 1XBTA 2ZU0C 4JIMA 4P4UA 4XTRA 4ZV4A 4RFVA 4A4DA 3GJ7A 4NHOA 4UXHA 4A8JC 1UFQA 2CJWB 1KI6A 4XTCS 5KTYA 2YWHA 2BKUA 1E6CA 2XX3A 4E07A 2O8DA 2GBLC 2WKPA 4YXWD 4NCIA 3GP8A 1NG9A 3I4LA 2KBEA 1G19A 2CLDX 5CDFE 3G0HA 1RKBA 1CJVC 4QBHA 1G3RA 1G3MA 4ZKEA 5M04A 2GAOA 1XD2B 1Q21A 3MSXA 721PA 4MRNA 3WHLA 1U8AA 2OXCA 3VKHA 3CNNA 3QKSB 3THYA 1W36D 4BWYA 5IT5A 3HPQA 2DYKA 1BS1A 3M0EA 2ZRLA 1KIMA 2X2FA 4HEJA 5TDHA 3QBVA 4MUAA 3I72A 3O8RA 4HB2A 2OHFA 3NHAA 1MABB 1B0UA 2QNRA 1FOEB 1RJ9A 2GJ9A 3L0SA 4KJZA 1KGDA 5L3RA 1LW7A 3WMFA 1Q1QA 4LV5B 3VMFA 1QHSA 2V7QA 1XEXB 2GZAA 1OB5A 3T1OA 4Y0VA 2GXQA 2P5TB 1E96A 2CE7A 2EWVA 1TPZA 3PQCA 4FMDF 2PMDA 3LLUA 4KI0A 2ONJA 4DUGD 3GLIE 1IN7A 4AKGA 3CB4A 2FFAA 4E22A 3KKPA 3R8CA 2OO7A 5JRZA 1O87A 3QF7A 2IS4A 2BEJA 4PO1A 1UKZA 2NPFA 1XCPA 5DN6A 3PUYA 3X1WA 2ODNA 1XCMA 1OE0A 4GSYA 4FMDB 3ECCA 2WWYA 2VIIA 1JEDA 4HI0E 5GJWC 4O0MA 4JT4A 3IQXA 1KK0A 3V4RA 2R65A 4CW7A 3AP1A 3GFTA 2WPDA 1PUIA 1S9HA 1OH6A 2YOHA 4MYUA 1JJ7A 1G20E 4UNNA 4OQXA 2XJ9A 4DHEA 2IUTA 1NLYA 1G6OA 2VSOA 3AGPA 4B2PA 1FMJA 4AURA 3BC1A 1NMZA 1AJEA 3K1JA 4IVQA 1N6RA 1HT1E 3EWAA 4NU0A 4IVRA 1OV4A 3ZIAA 3U6KA 4XSHA 2ZR0A 4LHZA 5IK2A 4B47A 1Z6YA 1R2QA 1E4YA 3NBZC 2B7BA 2GAAA 2GF0A 2H57A 4JJZA 3GCGA 4KU4A 4OHWA 1RRGA 4HZUA 3OIYA 4EDHA 5J4YA 2BBWA 2CHVA 1NN5A 4G1UC 2CMKA 3PENA 3TUIC 4ON9A 3NTUA 2MMGA 2WPDD 1UJ2A 2P3SA 3IEUA 2V9PA 3UMRA 3KB1A 1QRAA 3LQQA 2ORIA 2ZRNA 4B48A 1M2OB 1T91A 4OL0A 2NTYC 1LY1A 1GL9B 3EXAA 3I92A 1ZM3A 1OF1A 1GL6A 1QHXA 1ZRHA 3LV8A 5JI2E 4JVMA 1E69A 3IIMA 2Z5FA 3U3RA 3ZIAD 4FMCB 3VU9B 2VO1A 5CJPA 1GILA 4CEJB 4JSYA 1GKUB 5H8WA 1NMYA 2D06A 4IRUB 3B1ZA 4NBSA 4DLWA 4AYTA 1T8TA 1SXJA 3ZD7A 4IVPA 4KYUA 2WJYA 4KFRA 2VSFA 3B60A 4R7ZA 4QRHA 1U81A 2XJ4A 3T61A 3O8DA 5HE9A 4JVLA 4LJ8A 3AF0A 2C9YA 2QP4A 3CF2A 4TMTA 1JAIA 4ESVA 2WIBA 1D5CA 3A1WA 2OESA 2O52A 4N3NA 1AQYA 3T15A 1P2TA 2H1LA 4F7WA 4YONB 2J3EA 3TH5A 4F4JA 1US8B 3OFND 2HF9A 2WJHA 1CEEA 1K5GA 3UATA 1SKYB 3IPYA 1U9IC 1YZUA 1Q1BA 1FQKA 4P4TA 5CB6A 1FTNA 1GKYA 2AXPA 3N2IA 5DGXA 4AC9A 1MKYA 4P33A 5IRCD 2BMDA 5FBWB 3NXSA 1MO5A 3CM0A 1CIPA 2GK7A 1NRJB 2HT6A 1VIAA 3P4XA 2JLVA 2ZRGA 5AR1A 5K8IA 5DSZA 4A92A 1NP6A 2GHIA 1TL7C 3LAWA 2J0SA 1ZNYA 3U61B 3QVVA 4XSGA 4XWOA 1Q3TA 2GCPA 1YZNA 3B1YA 2GESA 1EX7A 4B44A 1KDPA 3AEZA 5D3MA 5HCNA 1T4GA 2FGJA 3AF2A 3K9GA 2NQ2C 2IYTA 3GLHE 1KI4A 2N46A 2OXRA 2Z83A 1DAIA 1BYIA 1KI2A 2W58A 3JVVA 4H9GA 2RGAA 4HSEA 1E1QA 3R20A 5DO9A 8OHMA 3KJHA 3B1XA 3OIWA 1AA3A 3SYLA 1KKMA 2VEDA 5EXXA 5FBLB 3IIJA 3NH9A 4M1SA 4KCGA 4Z1MD 2JLQA 4HYYA 2D7DA 3DHWC 2H17A 3NBYC 4JL8A 5FL7A 4LJ7A 1NVWQ 4KVAA 4X8OA 4RZ2A 2I1QA 1JQLB 1TQDA 3IIKA 1E2HA 1EWRA 2ZQ5A 4TYWA 3GLGE 1IXZA 3F0TA 5SZHB 3T5DA 3QOFA 1KHTA 2J7PD 2IYLD 3H0KA 4DLTA 5KNDA 4HATA 1UEIA 3CX6A 4LHYA 4OQLA 3LX8A 4MGZR 1NBMD 1VCOA 2GXUA 2LKDA 5FBRB 1E9DA 3D8BA 4JYCA 5JCZA 1KAGA 1CF4A 2CHGA 4QHTA 1CR4A 3L43A 4MDFA 4C0JA 1NSTA 3FVQA 4KFTA 2XB2A 2ZM5A 5ELXA 1WCV1 3ZZTA 4LUCA 2IYSA 3VHLB 4C0QC 2Q6TA 1E1QD 2PJRA 3A58B 2CDNA 3QEOA 4R9UC 3I61A 2AWNA 2FF7A 3Q7QA 4EPVA 4IEEA 1E1RA 5FL7D 4OBEA 1UAAA 2I1VB 1AK2A 2AN9A 2ZRFA 4TZ0A 2V6IA 2C77A 1G3QA 1KI9A 3I5YA 2EVWX 1HQYE 3UIEA 4IOLA 1Z0DA 4RFSB 3JZMA 3VR3A 1DEKA 1OH8A 2TMKA 3KZ1E 3HP1A 1SULA 3EX7C 2ZRHA 1DVRA 1FFHA 2AHOA 5G41A 4IJMA 4DSTA 4GBMA 1KNQA 3THXB 3RS7A 3WMEA 4EJSC 1J7KA 2X2EA 1SVKA 1DAEA 1AS2A 2YYZA 3SQXA 3X1YA 3UANA 1Z6TA 1WE2A 4DXAA 1NVVQ 2EWWA 4US1R 4B43A 4FCTA 3U5ZB 4C0LA 2D4HA 1E9AA 2O8DB 5AJZA 2ZJZA 3NBXX 1E1RD 4D6PA 1JB1A 4JBXA 1DS6A 1TUIA 3WNBA 4O25A 1G6HA 5FOSA 4DCNA 2FFQA 4DLXA 1E9BA 4V0KA 4TQAA 1GUAA 5KNCA 3Q72A 4MGIR 1AIPA 3ND9A 3AVOA 4NH0A 1QHNA 4PHTA 5DYGA 4D82A 2OFWA 3B82A 4TZ6A 3FWYA 5JLJA 2OFXA 4R71A 3A4NA 2RGBA 2IA5A 1P9WA 2IS1A 5DISB 1RJ9B 2BMFA 2YHSA 2R6CA 3OE7D 4P4SA 4LBVA 2KJQA 1L4UA 2QMEA 4M1KA 2PZGA 2XITA 2GJSA 2DFTA 4NYMQ 2GETA 3GJXC 4U7DA 3KKMA 5JHGB 1UDXA 1DO0A 4QC2A 1S9DA 1M34E 1JR6A 1G291 1X8KA 3K70C 4OQFA 1AGRA 1GIAA 3BXZA 2O0JA 4EAQA 5JWRA 1NNEA 4POAA 3NG1A 3MWJA 4JS0A 1MR3F 4E09A 3M4YA 2JATA 5KSOA 1DAKA 3RSLA 2B8WA 5CITA 5A5GA 4M9SA 5FPSA 1NBME 2ZRKA 4QGAA 4BLOA 4MKHA 1OIVA 4PPFA 2ZJOA 1NG1A 3ZQJA 2CK3D 1QZXA 2FPLA 1II0A 3LLMA 5DE3A 3I3SR 3U3KA 3ZQ6A 4RD2A 1Z6AA 3Q9LA 4TQUS 4W5JA 2FSFA 1CJMA 1AM4D 2J0QA 3FMPB 2IF2A 1E4VA 3FHTA 3RWOA 5J4VA 3K09C 1P6XA 1MO4A 2ZJBA 4Q1DA 4LDJA 1W49A 1F2UB 1XD2A 4LSGA 3NC1C 1D9XA 5A0FA 2IYRA 1ANKA 3SN6A 1QBKC 3KXLA 3CR7A 2ZI4A 1AZTA 5HCIA 2C99A 4H1UA 3S1AB 1T0HB 2VHQA 4C2UA 1E0SA 4DDUA 1DG3A 1II8B 2BIFA 3AKCA 4US0R 1MABA 4K8OA 3RSOA 1FP6A 3ZVLA 1SVWA 1IJEA 1W4RA 4A6PA 3UPUA 1N5KA 4I81A 5FPTA 1I2MA 1TF2A 2WIAA 4BFVA 2CEAA 4B71A 5J4KA 2CLSA 1LTQA 2JASA 3W8RA 3ZLJA 4HZIA 4LPKA 2JEOA 4A2PA 2A7QA 1N0VC 1XX6A 1UEJA 3SDZA 1QDEA 4XOIA 4TT3A 1RC8A 5AWFC 3PXGA 3K0CA 1YQTA 2ZR9A 2ZE5A 4BECA 1TEXA 4RD3A 3M1IA 5AUOB 4HAXA 1J70A 3DM5A 5L3VA 3U44B 5J47A 2IK8A 5EZ5A 2H8KA 1VMAA 2ZJYA 3CNOA 4C2TA 4DLVA 4TQ9A 3PUXA 2KI5A 3H1TA 2BV3A 3L2OB 4RZXA 3PV0A 2OCYC 3Q85A 3U3MA 2K5UA 2FFHA 5JS7A 1EX6A 5CM8B 2VP5A 3SJBA 1COWA 2VHCA 3RRZA 4LWZA 4F38A 4HAUA 3I1FA 3VTKA 2YWEA 4OHVA 1WB9A 4KBFA 3ZS9A 2DFNA 2XTZA 1U0HC 3TMKA 1BMFD 3C41J 3CNLA 3IEVA 3FDIA 1ZIOA 1XMSA 1S96A 3GEEA 3LWNA 1G8PA 2ERXA 3CWZA 2R2AA 2BC9A 4Q7MB 3FYHA 3QKUA 3ICQB 4FW9A 2J9RA 3D6TB 4M1OA 3RANA 1P7CA 1SVSA 3TJZA 1TF5A 1CBUA 4L4UA 4LYFA 2WJIA 2OEPA 1N6OA 1ZM4A 3K0FB 2NIPA 3B2EA 2FPKA 2WJJA 2WWWA 5TY0A 3KQUA 4KAXA 1DBSA 2OCAA 2XTNA 1OLOA 1A4RA 2FSGA 1RRPA 4RKEA 1HUQA 4FCVA 1OXSC 2EFDB 1NLFA 3UKDA 1BKDR 1Q3HA 3OEHA 1UBFA 2F9LA 4KHZA 4WZBE 3L8YA 3PUWA 1COWD 2AD5A 2PZFA 3EW9A 2O0HA 4G01B 2RHMA 4DIDA 4G5OA 2F3TA 4GP7A 2VHUA 1YZQA 3OZXA 4DLUA 4NONA 3VU9A 5C2JB 1XWIA 4NCJA 3NEYA 4RY2A 4CEJA 3CRW1 3CRVA 2EFHB 1ZYUA 1T0JB 4Q01A 1Z28A 3OAAD 2QMUA 3FMIA 5DHAA 4EUNA 4B3CA 4QNRA 2VPPA 3D3QA 4GP6A 4Q00A 1QVRA 1Z0AA 2OZEA 2ZTSA 2FV8A 2NO9A 2GJKA 1R8SA 2RAPA 1BIFA 2PCJA 1R0WA 4HAZA 4TYPA 1YZKA 1BOFA 2WOOA 3BGWA 2ZI6A 1Z2CA 3AH8A 4BRUA 5EUQB 1E2DA 1NSFA 4NTZA 4PAOA 4BLQA 3H2YA 4LY6A 5JJKA 1KKLA 2VSXA 3KQKA 3EPJA 1JEEA 3ZVNA 3FMFA 2CHQA 4XD7A 4QL3A 3SS8A 2WJGA 3LFUA 5LDDC 5BWMA 3K9NA 1S2MA 5J40A 3VNUA 4URUR 3ZS8A 2Q21A 5KNBA 3O8CA 2FOLA 4A82A 2QM8A 1EFRD 1NVVR 4RD1A 4DCUA 2F1IA 3W3AA 3T12A 1KJYA 1LB1B 3R8FA 1P72A 3KXIA 3VAAA 1AKEA 2ODEA 2PT5A 5HZKA 2ZI7A 1M74A 1SHZA 1G7TA 5LB4A 5KYKA 3U6BA 5FUXA 3QSYA 2O8FA 3WMGA 3KUCA 2OBNA 2WZQA 4M8NE 5TARA 1CXZA 2ZETA 3N70A 3IKJA 3RRYA 3RS0A 1YHNA 3BERA 5IF9A 2R6AA 3IBGA 3VX3A 1W36C 4FN5A 1IN4A 1OH7A 2GTPA 1D6JA 4QM6A 1DO2A 5DI9A 1M7GA 2DY1A 5A4JA 1QHGA 5CYOA 4MYHA 4W7SA 1JR3A 2XOKD 3K0AB 2FSHA 3EZ6A 2XSZA 2FH5B 4B3XA 3MG9A 3AVXA 2VP2A 3OIUA 4NYMR 3RRMA 4Q18A 3EIEA 1I4DD 4CT5A 1E9SA 2PL3A 2QTFA 1ZUHA 2FSIA 3NH6A 4HLUA 4AYWA 4MH0R 2V6JA 3PFIA 3OIVA 3WYAA 1A2BA 2F43A 4CZ2A 1GOTA 1XXHB 5HTKA 2PLRA 4HB4A 1G18A 1ZUNB 4L9WA 3O47A 3TGPA 1EESA 3NVAA 4AKEA 3QXCA 3RAPR 2VL7A 1W2HA 1XP8A 2ZE6A 2F1JA 2ZYWX 4PTLA 3NDPA 5FI1B 1LFDB 3GJ5A 1G64A 2QPTA 2IEYA 5CIWA 1CJTC 2RGEA 2WSSD 4RCYA 1N25A 5FTLA 2CVHA 3PG5A 2XZLA 2IHBA 4GZLA 3KJEA 4QBFA 4Z8XA 3FTQA 3T1VA 4DLYA 2QSZA 2ZJAA 2XSZD 1G8HA 3B9PA 4BFUA 3P20A 4UNPA 4V0OA 5KO2A 1BYUA 4P4SB 1NKTA 4QGFA 4BFZA 1GNPA 4EPYA 3O8BA 3VX4A 4C4PA 4GOJA 2IHYA 2NO6A 4UNRA 4IXNA 4DDVA 2QBYB 3FE2A 1VG1A 1SHKA 1OXTA 2XNDA 2E9SA 3GFPA 3QQ5A 5K8UA 4Q4AB 4AKHA 5G40A 2EFEB 3QG1A 4B74A 3B8HA 5BXQC 2QAJA 2KBFA 2Q3FA 4HUQB 2IL1A 3MJRA 1U98A 3X2SA 5HPYB 1GITA 3TW4A 2R6GA 1PV4A 3QXJA 1W5SA 3THXA 4KFSA 3C15C 4C9BA 1MV5A 1N3BA 3IHLA 4DIEA 1YR8A 5AJYA 2VP0A 5EXTA 5DNYB 1TADA 4MKFA 4PHHA 2P6NA 4PQYA 1VYTA 4PX9A 4TLCA 3ZDQA 2IXGA 3EZ2A 1E2LA 3U7EB 5C46F 4ARZB 4BQSA 4ZI2A 3QI2A 3DEFA 2ZRBA 3CH5A 5KOYA 1P62B 5CM9C 1TU4A 1CP2A 4G5QA 4RZ3A 4HAWA 2FNAA 4P3YA 5KPJA 4C0KA 2F6RA 1KO7A 4CF7A 1Z5ZA 421PA 5JMTA 3AVQA 4Q7LA 4OQNA 1UF9A 1X8LA 1WF3A 3BJIC 4AK9A 1IONA 3TSWA 3ADBA 2ZJ8A 1GVNB 1JXMA 2QEQA 2QPOA 4DLRA 1DAHA 3IGFA 4N0EA 3RHFA 2PJZA 1IXSB 1P5ZB 2RMKA 1AQUA 2X8AA 3EC2A 3JZAA 2GXAA 3GLFB 1G8GA 2E87A 1UKVY 2Z0MA 3SHWA 4TTRA 4ERNA 5KSPA 1N0WA 1G17A 3UWKA 1XU4A 4US2R 1IM2A 3SE0A 3DMDA 2VLIA 1GG2A 2A5JA 3QF4B 4C0HA 2EU8A 1U8YA 4MKGA 1XMVA 2ZSAA 2OCBA 3TQFA 4PSVA 4B75A 1CR2A 3GJ8A 4PPNA 2QGNA 5EE5B 4LOAA 4LHXA 4JBWA 2JJ1A 2OAQ1 4A9AA 1HTWA 4HAYA 1Z3IX 2ZUCA 4U00A 2P5SA 5EP1A 1N6KA 3I73A 3RC3A 2ZRDA 4XVRA 2C78A 3L8ZA 4UJ5A 3QXSA 1W47A 4ACBA 1ZD9A 4OJQA 3WRXC 1DPFA 1M1YE 5EP4A 2ZVQX 3KQNA 1S8FA 2QTVB 3SZRA 4URXR 2V7QD 4FWTA 1T5IA 4I1UA 5C18A 2PX0A 1F2UA 3VR1A 4PANA 4RD6A 2G83A 3J81k 5CJ2A 3SJAA 4PO8A 1ODFA 2ZUBA 2O5VA 3S1AA 1QG4A 2IW3A 1II8A 5DN6D 4A8JA 3PUZA 5H68A 4DZZA 1AZSC 4G3XA 4OK5A 3EIHA 4TYNA 2PBRA 2UZIR 1II9A 3T34A 3ADCA 1U94A 2GBLA 1OYWA 4UXJA 5FOTA 3WYGA 2OM2A 2G6BA 1TU3A 5KUTA 3A4MA 3P4YA 2JLWA 1RPZA 4Q9JA 1JQJC 2QRNA 3P1JA 4A2WA 3PUVA 4BFYA 2WICA 3A1SA 4PZLA 1YVDA 4B6FA 5FUYA 2MSDB 4RSGA 4DLSA 4FIDA 5GJBA 3CIOA 5B58C 2OT3B 1D2NA 1Q0UA 4ZI3A 3VR6A 3LBIA 2BM0A 2EYUA 2ZRJA 1GRNA 3A8TA 3KDSE 1R0XA 2ZITA 1R0ZA 2FGKA 1Z47A 1YZGA 3MUFA 4LJ9A 4EPWA 5IK2D 3U44A 1KO5A 1E9CA 3B13B 4DB4A 3NIBA 3ND8A 2EYQA 1GRQA 3GEIA 5CK5A 1HYQA 1PLJA 1YZTA 2UZ3A 2ZANA 4FD2A 4IDNA 4ESHA 2GZDA 4A0HA 3BH6A 4DDWA 2VYFA 3MWKA 3RABA 4Q9HA 2AD1A 3A1VA 3SOPA 4GZMA 5BQ5A 2J7KA 1N6PA 2N1BA 2FMXA 2ZAOA 4NCNA 2ODWA 4Q48A 3ZVMA 2W6JA 3KFVA 2IYWA 4EIWA 4S2EA 2WHXA 1UKEA 4F4IA 2AK3A 2WMNB 1FUUA 3EG5A 3FKSA 1P2VA 5LD2C 2HDNB 4HLQB 2E1RA 1DOAA 3ONWA 2ZRIA 2QAGC 1F2TA 4A0FA 2ANBA 3DM9B 2ZS9A 1KO4A 1X3SA 5KPDA 1N6NA 2KSQA 2JLYA 3K0FA 4A36A 2EW1A 3QJYA 5FOXA 3AVVA 1ZCAA 4G0NA 1SXJD 3TR0A 1P2SA 3ASZA 1DARA 1FMLA 1KK1A 3DZDA 3LX5A 1XEFA 1SVMA 3SJZA 3M6AA 3T1QA 1PJRA 4Q5IA 2O8FB 1DTSA 3CKLA 4EQ6A 3IO5A 4DBLC 4TL6A 4YMWA 5F3WB 1OYYA 3PEVA 2IYXA 2R62A 4B33A 4BZPA 2ZSDA 1G7CA 2J59A 3ZH9B 2W6JD 1ZP6A 1GNQA 2WV9A 2RGGA 4GT1A 4MRVA 1KMHA 2UVQA 1Q57A 3RS4A 5FOVA 3UWOA 4ZDJA 3AP2A 1HY3A 1DE0A 3FKSD 4Q47A 2A5FA 4YMTA 3EIQA 1ZC4A 4JSTA 2F1HA 2ZIAA 4PFSA 4C30A 5JHHB 1TTTA 1IN6A 2BVNA 2YVUA 3CZQA 1HURA 4XWAA 2W6IA 3I62A 2Z4RA 5EP2A 1LS1A 1OFIA 1UDWA 3EA0A 4OQMA 4LZZA 1AKYA 1R8QA 5FR2A 5FTJA 2JJ2A 4M0LA 1W48A 4Q1EA 3QXHA 5HR5A 4I1OA 2RH5A 1KK2A 2F43B 2QUZA 4OHYA 3LVRE 2QE7A 2IYVA 2ZYVX 4AKIA 5E7JA 1LF5A 4UNQA 4ZCMA 2ZI9A 3KUDA 1XNJA 3ADKA 1J90A 2YNMA 4LBYA 4LJ5A 3C5CA 3TAHA 1DADA 2AKYA 1P73A 2JLRA 2JLXA 1MOZA 3KKQA 2VF7A 3CLVA 3IBYA 3T5GA 4IW3B 2ZYTX 5CK4A 4KO8A 3N5CA 4TLDA 5FOWA 5LPNA 5CYPA 4JLVA 2OCPA 4GOKA 5AUPB 3VHXA 3KKNA 5KHOC 2OLJA 2OFOA 3AF3A 2W6ID 1G4AE 2RGCA 2ZU6A 2H18A 3RRNA 5AJVB 4B35A 2BJWA 1AGPA 5LBIA 5HE8A 1NMXA 5UKDA 3TSZA 3MAAC 3VR5A 3RYTC 1FPMA 2C2HA 2OBLA 4PC2A 4OI0A 1U9IA 3DDCA 2BBOA 3TE6A 2ODBA 4MRSA 1DG1G 1NVUQ 1YR7A 3EARA 4DCTA 1N2CE 3K0AA 3TUJC 3WNDA 2IX3A 1NJGA 1GFIA 1HE8B 2Z43A 1CULC 5JS8A 1S1CA 4ASUA 4KODA 2HV8A 1X6VA 4IDHA 1R7RA 4JYBA 3SQWA 4D26A 2FWRA 5E4FA 3EZ7A 4MYTA 4NP6A 1R5BA 4MRPA 2CBZA 1BO6A 1XXHA 2ORWA 1F3OA 2NPIA 3QVUA 2RHDA 5FUWA 1SXJE 3PJRA 2CVFA 2D2FA 1EK0A 2BBSA 3TRFA 2V4ZA 3K53A 3FHOA 1U0LA 1HH4A 1FX0B 3FOZA 1Q44A 4QJ5A 2I4IA 4KBGA 1JJVA 1IBRA 1N0UA 1OFTA 1GAJA 3DOEA 1NY6A 3KX2A 1OSNA 1T8UA 4D4KA 5JRJA 2OLKA 3B5JA 3G82C 4XJXA 1KDRA 1NI3A 5FPHA 1Z0KA 3KQHA 1CS4C 1KJWA 2G0TA 1XCGB 2WSMA 1M7HA 4JLMA 1MT0A 2WKRA 4F91B 1N5IA 2REOA 2AKAB 2IYZA 2ZYUX 2ZI3A 2VTKA 3R9IA 1E2GA 3CH4B 1H8HA 1S1MA 2QBYA 2DB3A 3PEYA 5FH9A 2BEKA 3FFAA 1KTVA 2ZAMA 1RYHA 2W0MA 2YC4C 4Q4AA 4X8MA 4F93B 2JLUA 4DB2A 2PEYA 3TAUA 4KSBA 2V3CC 3E2IA 3SYKA 3K0CC 4AIIA 4HUQA 4DWJA 5TMPA 3HDTA 3B78A 3RS3A 2GZHA 5BN3A 4WAUA 1PLKA 1N6HA 1Z8FA 4Q4HA 3B9QA 2OUKA 2ZVPX 4FMBB 3VR4A 221PA 1GZSA 5L3SB 1KSJA 4L8GA 3DPUA 3GLHB 4HUTA 1OKKA 1P75A 4M9ZA 3LQRA 4N1AA 2F3RA 5G3ZA 1T6NA 2AL7A 3W5JA 1GKIA 3QBTA 4OI4A 4K81B 4W5WA 4ARZA 5FPYA 4Z51A 2PX3A 2QG6A 3CUEF 3A1UA 4GI7A 2FFBA 3RWMB 1G5RA 3UG7A 3VKWA 1CJKC 1RRFA 1ZMXA 4Q7KA 1NN0A 5C4MA 1ZU4A 3CX8A 5DIFA 4IDQA 5AUNB 3ADDA 4ZKDA 4TTQA 3ZVRA 4EJSA 5B30A 1ESMA 1OHHA 5H70A 3GLGB 1WBDA 4CIDA 2I3BA 2NG1A 4A8JB 3AUYA 4NYJR 3SI7A 4LYJA 3T06B 2DWOA 2Q9AA 4B3GA 2OSBA 4PAQA 4DSUA 2GJ8A 1FQJA 4HDOB 3GLFA 3HYTA 4QGGA 2V8OA 5K8TA 4C0AC 1OKKD 1E79A 2XZOA 3QG5A 4FXPA 2W2VA 4V0MA 3QE0A 2BJVA 2IBMA 1F60A 1E2JA 4D0GA 3AUXA 1C1YA 5GADl 1GM5A 2JIZA 3AQ4A 2XB4A 4OYHA 2J0UB 3QF4A 4GNKA 2P2LA 5F9FA 1KDTA 1RE0A 1AA9A 2CCGA 3CRRA 3W6PA 1HT2E 3FB4A 5AK0A 3BB1A 1P4SA 4MA4A 3P26A 5DI3B 1GWNA 1Q20A 5G53C 4B6EA 3U7FB 1K5DA 3BB3A 3CWQA 1WXQA 4DT1B 2IYQA 4GL2A 2PH1A 3CO5A 4Q02A 1VG9B 2G1JA 1GTVA 2ZS8A 1Z0JA 4ZPXA 4I1VA 3W5IA 3WP1B 2YINC 5F2EA 2NZ8A 3U2QA 4BFTA 2GEVA 3GJ6A 4BFSA 2VQSA 2QSYA 1E79D 3EZFA 4Q4LA 4D80A 4D81A 1UBCA 2CCKA 3EASA 5EE1A 3AB3A 2VHJA 4CGZA 4TYYA 3KTAB 4IXMA 4LV8B 3TK1A 1GRRA 2JGNA 2F9MA 2G77B 5BW8A 1R10A 4TT3D 4KFUA 2ERYA 1E0JA 3SEAA 1F2TB 2GK6A 1MO6A 1J8YF 4E03A 3DKPA 2YWGA 2YC2C 1V5WA 2BKEA 2OILA 1LS6A 3P27A 3K0EA 1Z6XA 3DO6A 3EWSA 4XVQA 3AVUA 2W2TA 3AKEA 4QHSA 2F1RA 3K09A 4D2IA 4GOXA 2IS6A 4TMXA 5CLLA 3HYRA 4R2HA 1OFUX 5E3HA 3UMFA 4JZKA 5TXGA 4I4LA 4D0NA 2C9CA 3R9XA 2ZROA 1H8EA 1JALA 1L4YA 3CPJB 4FCWA 4EQ6B 2CCJA 4JJKA 1B23P 3OF5A 4OK6A 1HA3A 2JLSA 3LNCA 1Y3AA 3I5XA 2IF0A 1E99A 3BWDD 3LBHA 1KMHB 1VCMA 5EXSA 2FPMA 3MMPA 4DKXA 5JEDA 1MO3A 1PUJA 3Q7PA 4LBZA 5JZVA 3BBPA 4NZYA 4EFNA 4NCKA 3TVTA 2Y8EA 2JJ8A 4GDFA 3DMNA 3W9YA 1E0AA 3CF6R 1E2FA 2BMEA 4TTPA 3SFZA 4AI6A 2QA5A 1KSHA 3Q3JB 4A0GA 2J87A 1WRBA 1QF9A 4LC1A 2IWRA 2QY9A 5ANRB 2AR7A 1CR1A 1H8ED 4NMMA 1XD8A 3OEHD 2W00A 1Q1EA 3BE4A 1UM8A 1XPUA 5JJLA 2N42A 1QHHB 1CTQA 5CDFA 4IKEA 4OHZA 1CR0A 4RD0A 3V4FA 3TQCA 4W9MC 3F5FA 4B2LA 1T3HA 1IJFA 4TMKA 3QKRA 4F92B 4WA7A 3SJCA 3U60B 1K8RA 1DELA 5E7MA 4DCVA 4IFEA 3LRPA 4MUBA 1HQCA 4BLTA 3HJNA 5F9HA 2P67A 1ZM7A 4V0LA 1KI7A 3PEUA 1EFTA 2WWXA 4HB0A 4KV9A 4TSFA 5B2ZA 2NGRA 1VHTA 3AVPA 4OKSA 4PO9A 4BASA 4XH9B 3EC1A 1DAFA 1W0KA 4CRWB 4AG5A 4M9XA 2L0XA 4IOMA 5TVKA 2RGNC 3P32A 3IUYA 5LD2B 2QRZA 3BFVA 2J1LA 2GCNA 2ZS7A 1JI0A 5JWOA 4LI0A 4BRWA 3GLIA 4XD7D 3SYNA 3CONA 3HU2A 1XTSA 3CF0A 3ETLA 3A6PC 1SQ5A 2PMKA 2FJUA 4FI3C 2YJTD 2EFGA 2CE2X 2GRJA 2BWJA 1J99A 2C98A 2B21A 3I32A 1ESNA 1LV7A 3C5HA 4XWKA 4NCHA 3WY9A 3KJIA 3NKVA 2OAP1 3BAFA 3R7WA 4TSFD 1SVOA 3DZ8A 4Q1AA 1AS3A 2O8CB 4UJ3A 4YLGA 2QT1A 3C16C 2ZSBA 1HE1C 1W0KD 4IOJA 1T9HA 3RS5A 3TVDA 2NMVA 2QPAA 4LPSA 4ILEA 4L9SA 1G8YA 3E70C 121PA 2B7CA 4II7A 1KMQA 1RZ3A 1OH5A 4YC7A 4JT2A 1E2EA 1JR3D 2IXFA 3OEEA 1G5TA 2D7CA 4TLEA 3U3OA 3GJ4A 2HF8A 4DRZA 1NJFA 4BPBA 3HWSA 2BOVA 1P9NA 1RRCA 2JDIA 4YMVA 3HPRA 2YWFA 2FZLA 2ZR7A 2Q0HA 3AKYA 2NO1A 2HJVA 2QROA 2REBA 2WWHA 5FBQB 5JI3E 1KAOA 1RVDA 5L3QB 2AK2A 1L2TA 3KB2A 2HXSA 1OXXK 1XDBA 4C0SA 3W34A 4DSNA 3VNVA 1ZD8A 2H5EA 1G1MA 1YZLA 1OXVA 1YR6A 2BDTA 4IDPA 3NDBB 1T5LA 4M4SA 1N6IA 4PZZA 4L15A 4Q4HB 4GFDA 1EGAA 1WP9A 4ABYA 2WAYA 3BRWD 1UADA 3KKOA 4DSOA 2XNSA 3OEED 2VP9A
chains in the Genus database with same CATH superfamily
4F12A 4W5OA 3IE0A 4WIAA 4KBYA 1K6JA 4HQRA 7REQA 2W83A 5GIPE 1EFHA 5T3UA 3OE4A 4OGKA 4UE6A 4ONEA 1OXUA 1R8YA 3LU1A 1ONOA 3A37A 3WDMA 5IH3A 2ZIXA 4H0CA 3WHPA 3BWMA 2O8EB 5C8YF 5HNKA 1XCOA 1ABEA 3PCXA 4JVNA 4YJ3F 1FX0A 5HIAA 2QR2A 1ZW1A 4DL9A 4EY3A 4Q9IA 4K9PA 1FDRA 3AEKA 3GNQA 1AKQA 4YV7A 2JW5A 4QEZA 4WZAE 4IWYA 3D8RA 4FVTA 4PZ9A 5KYWB 3GHHA 1Z3CA 3TR5A 1EVEA 2XUPA 3FXAA 2P78A 3OX2A 1WZNA 2C2BA 4JGBA 4OXIA 4BYMA 5JNUA 3U4MA 1I36A 4BDSA 3AFOA 3HB5X 1V5GA 2NV2B 2EFCB 4U02A 1I1QB 4LYAA 2PCLA 2D3TA 3BK7A 3II6X 3V4LA 4INAA 3WNCA 4DR7B 1IY0A 2N3ZA 3FNEA 4A8TA 4YAIA 1NQOA 3IFSA 3WL7A 3P7MA 1KNXA 4KXWA 2JLZA 2HLPA 3P52A 1NNUA 4YCAA 2YZ2A 1E8NA 1IDOA 2E18A 3VNSA 3T5TA 4ZEMA 2FG5A 3W5AA 1P17A 1ITZA 1T4MA 3A9WA 4LA4A 5FWYA 1USWA 4S0XA 4EHLA 2RCYA 2X9GA 3TNFA 4LRYA 5A1JA 1HDXA 3DPSA 2FFJA 2SKCA 4XIJA 4FGLA 4HLCA 4TX1A 2VCHA 3W9BA 3GLSA 3C1AA 3HFJA 4IG4A 3PRHA 1YD7A 3H84A 3L79A 3SNHA 4B8ZA 5FYDA 4BRZA 1G0OA 1XPRA 3OESA 3KQVA 4X8HA 5CH8A 3V9PA 1U7XA 4C2BA 1I3MA 4GQIA 1AOXA 3I8SA 4YIKA 1L3IA 5HFAA 5JCPA 3MK31 1NBEA 5DPMA 3X2FA 2JD1A 2ZUDA 1U7UA 1GAXA 1Z0FA 2XNJA 2I78A 2Q4DA 1DIHA 4FYJA 1SXJC 2QF7A 1K75A 1ENYA 1U04A 1V1MA 3CPEA 3EG9A 3HZZA 3NHFA 3GLHA 5FAXA 1CYEA 4FN4A 1UK8A 4D8WA 3COSA 1JNYA 1ULTA 3ES9A 3KXDA 5IW8A 3FLMA 1UH5A 1JR3E 3KWJA 5G02A 5CFZA 5MDHA 2XMBA 1JEOA 4PNEA 1GSAA 1JKFA 2KE5A 2NTJA 3T7KA 3WYFA 3IIEA 2OP0A 5DASA 3ZNOA 4C03A 4MV4A 2HQ1A 3PFKA 4D0LB 2W0SA 3IYLW 1XE3A 3BFKA 3PXAA 1I4TD 2REXB 2TYSB 3GZTB 4PLGA 2ZTLA 1VOTA 3GFOA 2R0QC 1RPAA 4AB1A 3PD7A 3N2GA 5E6UA 2HPAA 1L5HB 3NTVA 3QUQA 2XGMA 3H04A 3MLEA 3NHZA 3GEBA 3HVRA 3MXOA 1S4QA 2H3EA 3FFBA 4WKOA 1JKJB 1FDIA 2O3QA 3FPAA 2QMHA 3H16A 3QEJA 2XBUA 1G8FA 2IEZA 1C30A 1G3IA 3UG6A 4CR7A 2HO4A 1H69A 1LBTA 2GKSA 2PX2A 4OH7A 4CKXA 1EZ4A 1ZC3A 1OT5A 1U5CA 2AZDA 3Q87B 3V8QA 4C7VA 3QUAA 2GAIA 1P1IA 3SKXA 1Y9JA 4GU5A 2O7VA 4EX6A 5LQDA 4U2CA 4ZDWA 3S4YA 1MQSA 2TMGA 2HYIC 5CFPA 1C4XA 1FSPA 3CBQA 4E11A 1JXAA 3MT7A 1VE1A 3ABQB 4HDSA 5DYYA 1U2GA 3EPKA 1RWKA 4BAUA 3VM6A 1S2GA 3JYLA 2J0UA 3P2MA 3ER9A 1IHOA 3WGOA 1CK4A 3BD6A 5F98A 3FTDA 5L3ZA 4ZEOA 2INGX 1KI1A 1YA4A 4K6FA 2QTHA 3QVXA 3WBJA 1NKSA 4L5YA 2XNKA 4URWR 5K8LA 2CLIB 1OC4A 2CGEA 5J2TA 3P94A 3EZ9A 2YKQA 4R8LA 2ISSD 2XB6A 2PAAA 4WY2A 1I4EB 4PZUA 5DI3A 5THXA 5C3MA 7GPBA 3GVPA 4J16C 1RAAA 1F48A 3DDUA 1PK7A 3FIUA 4R54A 4URZR 3RUHA 1AHPA 2H31A 2FU5C 1V2HE 1UFRA 1B8NA 4NNOA 5KWJA 1HT0A 3HHEA 5B3JA 2AH5A 2H1IA 2Q1TA 3A9CA 1IY2A 1FDOA 1VTKA 2G1KA 2YXNA 4DJAA 2R8YA 5JAIA 1DSSG 5AICA 2FZGA 1FUEA 4RMJA 5HMMA 1Z2EA 2WAXA 1NVBA 4Y6GB 1Z0UA 4Z8YA 5F21A 2VBGA 4MUNA 3OFNA 1ZISA 4Q1FA 4BLRA 4EYQA 3LF2A 2YOFA 4WK4B 2QTAA 5C4IA 1KEKA 3GAAA 1TO6A 2AB0A 1W0JA 2F4NA 2EKBA 1L8XA 4ZHQB 1T36B 3ZQ4A 3PDIA 5A6VA 1U3TA 4M0FA 3GZ4A 3AV0B 2BLNA 5ALXA 4ZRNA 3A3NA 3TM5A 3MWFA 4GYYA 3U4AA 1U8ZA 4C0WA 5C52B 2Z1MA 3S8EA 4J03A 4PIVA 2EC5A 1KSFX 1DXHA 2I9PA 1W1WA 1XFAA 3IQZA 4TL9A 3QA9A 4QZVA 2G3YA 5DT9A 5IVPA 5JECA 2RI1A 1EFPA 3LXXA 4MRRA 4W5TA 4M53A 5D87A 3FZNA 4IIJB 1IJBA 1SK9A 2HSZA 2DBQA 2C8KA 5EE9A 3K8YA 4Z54A 2CNOA 4N7RA 2Z98A 4QXQA 1TZ2A 2R44A 3AC0A 2Z2KA 4AZ3B 2VA8A 3UY4A 1FTSA 2C4HA 3KVYA 2ZIEA 3B7GA 4BJHB 5TJ9A 4AULA 2MT9A 1YJ5A 3ESDA 3LBYA 1W46A 1JEYB 2A67A 1XCLA 2BI8A 3OQIB 4I5FA 4QFMA 2EGGA 4E5YA 4DSZA 1J1UA 2UZAA 2AJTA 3IURA 2W93A 3E81A 2FLVA 1D8AA 3EDMA 3R0QA 1C9MA 2P9CA 3JRXA 4I5DA 4O6VA 1JDTA 4Z9AA 4WJLA 3Q5DA 3RK0A 1SCQA 2WUGA 1M33A 4Q9LA 1D3AA 2YN0A 4KREA 1VC2A 2RI6A 2UUPA 4Z9FA 3FYUC 3UK6A 1UC9A 3IR7A 1Y1LA 4DCMA 3L6DA 4JJAA 3JQ8B 1QMGA 2Z04A 4JFRA 4KXLA 1F1JA 4PSUA 4E3ZA 4R16A 4KHPB 3QWAA 3I6QA 2Q1UA 3OE1A 3H1PA 2DFKB 1RM4A 3ETNA 1X1DA 3M6MD 2ABWA 1XZDA 2J7PA 2NU7B 4J1TC 4L27A 3RKUA 1YKSA 4CEHB 3WX0A 3PQ5A 5HOEA 1RZUA 1V1RB 3AT1A 1T5OA 3ORQA 1P33A 1Y81A 3DS8A 3EAQA 2RGRA 1F8UA 3NASA 2CDRA 4FINA 5CCXA 4PC6A 1JH8A 1I2BA 1YJXA 1T35A 1FE8A 1ZMRA 4EO4A 5BSHA 3QY9A 4G5YA 4NPHA 4CL0A 4Y9DA 1ACLA 4DCSA 1F4LA 1UJ6A 1XTQA 3LQKA 3HH8A 3W1EA 5KVSA 5EIXA 2EDCA 1KQNA 5BUSA 5ILGA 1PKXA 1IXKA 2ONKA 4YMUA 4MINA 2VXBA 2DT5A 4L3VA 1U8UA 2BFCB 1E3TA 2C07A 4A6XA 4G63A 4J7UA 5D51S 4DIFA 5AOCA 1LLDA 3BPSA 2HGSA 3PITA 4JLBA 3PGJA 4MR8B 3X1DA 3DT9A 5KSZA 4MCIA 2CLOB 2GKOA 3BMNB 2IOYA 2G76A 4Q4JB 2BKXA 4RTJA 3HO1A 3R0JA 4JI5B 1UQUA 4UCWA 2C42A 2BEWB 5IABA 1J5XA 4FBLA 4F4DA 3R7FA 1JDNA 1MEOA 3HWX1 3WV4A 2HMWA 3WDKA 5JS6A 4D9BA 2B61A 5A5FA 1WDTA 2EHJA 2N0SA 4QOEA 1JDPA 4JP2A 1CETA 1NNSA 2PKXA 4EZIA 3N0RA 4GZ5A 4L75A 3NR2A 4C7KA 1QH9A 3DQZA 5D3ZA 3ET5A 3OKFA 3B53X 2Y93A 3HRIA 1E2NA 2PMWB 3TS1A 3IUMA 5AXDA 3O73A 1PSZA 4RA9A 2DSTA 4XDGA 2H51A 2FJPA 1E2PA 1EXNA 4GWGA 4BVFA 4ZIRA 5HKKD 3URMA 4AS2A 4BTLA 5I7SA 4RULA 5E0KB 1Y6FA 1P1KA 2O8NA 3TBKA 4N5LA 1A82A 3HLTA 3TTWA 2GDJA 1JG2A 1JQDA 1P0MA 2ASEA 2JCSA 1K4KA 1RCTE 2JGDB 1J2YA 4EHFA 2VNJA 4MHSA 3WJ1A 4IQ0A 3DYVA 4FNGA 4WL0A 3O93A 2G9NA 3NWJA 4FI3F 1R0YA 2VBCA 3L49A 3SIWA 3CW2A 1MMFB 4C6TB 5FNVB 6GPBA 2VJPA 9ABPA 2A3RA 1ZK1A 1H2AS 1ZGBA 2ZRCA 4D99A 1UBJS 4PXSA 1JPJA 1PS9A 1DHTA 3QFTA 4L6CA 3P0FA 4J2OA 2LW7A 2WE7A 4KMSA 2ZREA 5FEMA 4KGVA 1GUFA 3AEKB 1F4VA 2NACA 3GD7A 3IHWA 2HAEA 3PR1A 3V1TC 5A5EA 1VP9A 2POCA 4RJJA 3S28A 4HUJA 5JCJA 1KI6B 2B82A 2QX9A 1VGQA 4FDVA 5DBGA 3W3ZB 1L5YA 3WWDA 4LX0A 3BTSA 1UMDB 1YJAA 3JASA 2ZTMA 1SWWA 4MAMA 2JHFA 1GN9A 3ESAA 2WTBA 3A6DA 3IP5A 4O2LA 3HY4A 4IDOA 1DLIA 1OT3A 3TL6A 3EHDA 3O8LA 1W4AA 4YXFA 1P1HA 4OX9B 3DDWA 4P9NA 1BDMA 2YXEA 1ZMBA 2HU2A 2B6HA 4E5DA 1ZJ4A 2QTTA 3OTHA 1W6UA 3CBGA 5HZMA 4JLOA 1TM3E 4O4IB 4BRSA 4C08A 4ID3A 1EFUA 4OXYA 3OU6A 2SHKA 5BYJA 2QGZA 3V4SA 3VPHA 4NKRA 2VPYA 3S8MA 4BLSA 2IS2A 4LE0A 4Y6QA 2I4MA 4U7JA 4BDTA 4GC5A 2FZKA 1FXWA 2OWEA 4JX9A 2CK3A 1P31A 5D86A 3AVWA 2A9OA 3OX1A 3GBSA 4NDZA 1CB7A 4WZBA 4YMSA 5DB4A 3O03A 1N34B 3MJSA 1V1JA 4DG9A 3NTXA 4V0RA 3F9RA 2VDRB 3L1IA 1T9GS 5EJEA 4OJYA 5ICEA 2H1FA 3SU8A 1KZ7B 1WMSA 2GAJA 3L6BA 2ZSEA 3PUHA 4ND5A 3TZ6A 4EY4A 5BWNA 3DVSX 4NI5A 1H3FA 1XVVA 5BNFA 3VYTB 1E3EA 3FKJA 1PYDA 2LIVA 4I4IA 4PG8A 5LUAA 3L0PA 1FTQA 2KB0A 1FYFA 4JSRA 3BH0A 1V8PA 4UVDA 2W98A 1JYEA 1RP7A 1IHXA 1R0BA 2NZUG 5D8DA 5JASA 2BUCA 3DKVA 3V97A 3ZE6A 1J1IA 2JKZA 4W1PA 4BN5A 4WKGA 4DEVA 5F1YA 1UBHS 3TKLA 4MAAA 4YV0A 4JP5A 2FUG6 3ICWA 1NBIA 3N2GB 2FF5A 4J4BA 2CJWA 4PVDA 5E6UB 5FTKA 3V00A 1A1VA 5FTNA 2NVOA 2TS1A 1ORWA 1JLHA 2FEAA 3IBSA 4I1SA 5EIFA 5EWJA 5C8YA 3RUEA 2PUCA 1H4TA 1PDOA 1MRSA 4RENA 4YJ3A 4DPKA 5K05A 5K3EA 2R5WA 4MPRA 1JBEA 4PG6A 3VR4D 5C5EA 5CB8A 3SKYA 1LVGA 3Q8XB 2FCRA 1DZ3A 4GEKA 4QBGB 4Z0PA 3O4JA 1ZAKA 1XZHA 1D0SA 2FEOA 3R7AA 1FUIA 1XRMA 1GPAA 5U4XA 1QV9A 1BJTA 1EA5A 2Q5LA 4R1PA 2A94A 3RJTA 2Y6UA 4EFLA 3QKSA 4HDSB 3U7GA 4HSGA 3ZXYA 5DYTA 3TLXA 1CUJA 4JB2A 2WWFA 1G55A 3HDGA 3PI6A 3QYAA 3WBKA 2PBLA 5IC4A 4B3RB 1MGPA 1TVKB 2I55A 1GAQA 1CF9A 2ODTX 1UQTA 4QHYA 1OUMA 1BCSA 3OO0A 2VCYA 2VP3A 4P7KA 2PGDA 4UCXA 3WWYA 5A62A 3S81A 4HZUB 4TMVA 2BHRA 2PA0A 3DH0A 1NFQA 3OCYA 1Z83A 3K7EA 4NBNA 1ISGA 4OHBA 1WABA 5A4IS 5LQKA 1F17A 1FUKA 2FN7A 4IJ6A 1P2DA 3DQPA 4KIGA 4QG3A 4BFXA 3K9LA 4G0UA 2BR5A 2NU8B 4W9NA 3OZGA 2HRRA 3VPCA 2VRCA 2P9EA 5GVSA 4RTMA 3KVNA 3Q8MA 1CEXA 4M2LA 2WF8A 2ZYRA 3PYXA 1ZINA 4PZ0A 1CQZA 4Y0AA 2EOAA 1FFXA 2IHJA 4D9KA 4F3KA 3AEUA 3LY5A 2DH5A 3U81A 4AICA 1VJCA 1DC3A 1J56A 1LU9A 1UJ4A 2AOXA 5FUVA 3TRIA 3WGUA 5IKXA 1M2JA 3MTBA 3HUEA 2VN8A 2HWYA 2JHAA 3G2PA 3TLKA 2UVPA 1SZPA 1KOFA 2CL6X 3I0MA 1TAHA 2FI1A 2GM5A 2AQ8A 2JIZD 3C3MA 2F67A 1D7AA 4NVRA 4RM3A 1CRPA 1NNI1 3QJGA 1XROA 4L2IA 1MDFA 3AVYA 3JW8A 3QH4A 4UZEA 4BFWA 4YNBA 3H9JA 2Z30A 2VDNB 2O2SA 5AJUA 4CCYB 1LNSA 4UARA 3KOZA 3R0IA 2DAPA 3UUWA 2GBCA 2PS0A 2QE6A 1IB0A 1QFMA 1U0JA 2V6BA 3H5OA 5IBPA 3LUJA 2OBMA 2D74A 4GXQA 3UAYA 4BCDA 3N53A 1NF8A 1U99A 3UXMA 5L4NA 1MH1A 2GF9A 3B1VA 1KR2A 4WADA 5SYMA 1KI3A 2DHRA 4UU1A 2JH8A 1T43A 2AFIE 2XXBA 5IF3A 2B92A 3H4MA 2AUNA 2ZIVB 1TAQA 3JVIA 1E32A 1J9ZA 3S2IA 1TVMA 1JQ3A 1MTOA 3MERA 2D1QA 3OMWA 1HETA 2Y92A 1TQ8A 5I5EA 4RELA 4LFCB 5EKSA 1C4WA 3OF3A 3QBDA 3STTA 4L0CA 4QVGA 2AEEA 1JIJA 2PIDA 2W48A 2IE0A 3IOCA 3KYCB 3M1AA 1ZIXA 1HLGA 3P9IA 2GN1A 4BZQA 4BGDA 2WHQA 3WGQA 5FBHA 4IXTA 1RQ2A 3U3DA 2QYTA 3WP0A 1N4DA 1Z06A 3K2IA 1D0VA 2X8LA 3NIDB 2V74B 1DJMA 4QYXA 1QDUA 1UR5A 2GLTA 4YJFB 2HA5A 2ZB2A 3L7NA 4M1MA 4ZQCB 2I99A 2NTEA 5I9LA 3LOPA 3L7YA 3E7PA 3TQIA 4X64B 1WDMA 2ZJFA 2GM9A 1JLLA 1M7BA 4UPVA 3I5AA 3FTFA 1BXZA 3OFKA 2GOYA 4QGHA 3RHTA 3BQ9A 1EFRA 3NAQA 2ZPTX 1ZBDA 1L7BA 3IPXA 3W2HA 3W6ZA 1TX4B 3RRJA 4TWRA 4BNUA 4BQRA 5C8ZA 4PQFA 4OA5A 1CU1A 4YVFA 3Q3CA 3KM0A 1VECA 3NP9A 4N9WA 1I33A 5I7VA 1EQ2A 3H2ZA 1DUVG 2GYWA 3AJEA 5BRAA 3RBZA 1VCNA 3BS4A 4UUBA 4S35A 5F76A 5CDGA 3FVVA 1YL7A 1MW9X 3I8XA 1OX4A 4O08A 5LJIA 3U62A 3TN7A 4KRFA 4J49A 1L0BA 1BSVA 1YB1A 2COUA 2IEGA 4C7OA 1V11B 1PS0A 4K8RB 1ILEA 5AKZA 3WLAA 2IU0A 1VL0A 3G7NA 5LQNA 3OZBA 5JPIA 1ZH4A 3V34A 4F5WA 1TNDA 4O2RA 2XVMA 3FIJA 3Q6IA 5I9IA 4I5GA 2KWIA 3ANLA 2HA0A 1GADO 3LUCA 3KZCA 4EFKA 3GLFE 2F7SA 3C85A 2IVZA 2OYSA 4H7PA 4ZDKA 3ISTA 3MJ4A 1X1TA 4R6WA 4D9JA 1JJIA 3LQYA 4ILKA 3CPHA 4V0ME 4FLFA 4IX9A 2OCLA 5C1DA 1QRSA 2XW6A 2ECPA 3H97A 4IRXA 4AN1A 3WADA 1KVUA 4ZIRB 1E2UA 1F6BA 1XFDA 5B6JA 2XOEA 3DMGA 1HWYA 3RJMA 3P97A 4MQLA 3M6FA 4DW8A 5JEEA 4A91A 3P4UA 5DHSA 5LC1A 3NBAA 1A9RA 3CH7A 2Q8PA 2ZTUA 4L5BA 2I4OA 2VNKA 5F7JA 2P2YA 4ZAFA 2Y2VA 4WKCA 2B36A 5EPOA 4BMSA 5ITVA 3EPLA 1B2RA 4KWEA 1NFFA 2VUIB 1M72A 3QMWA 3JPYA 2CLCX 4Q1BA 3FTEA 5EQJB 2WSLA 3UXEA 1D2EA 3W79A 3QEBZ 3L4EA 4IMIB 3B3AA 4UATA 1XJQA 4YBRA 5BQXA 3OT1B 1S3IA 3HJBA 2AF4C 5JNLA 4F9GA 2FZ4A 2H48A 1W88B 2DJIA 1DTWA 4XPZA 1LKZA 1IY1A 2XQFA 1EFCA 4HYEA 1JMVA 1RYDA 2WJWA 2EJUA 4OU4A 5AUQA 1OZGA 5IJ9B 2XD4A 2I1WA 3HR7A 1ZMTA 3A32A 3BXXA 2WBLC 3NQ41 1Z63A 3AU9A 3T7AA 4EUHA 4J75A 2QG4A 5BQFA 1MQ8B 4PN7A 3UT0A 4DV1B 5B3LA 3W6OA 1H1LA 4L7VA 4WD3A 5ALJA 2HEGA 5TB5A 4MEAA 4G5SA 1KYIA 1VRCA 5JY1A 2ORED 2MOKA 3CMCO 2AIRA 3R24A 2EWMA 4L4YA 3QFSA 3G2KA 5KNCH 4WOPA 4JI6B 3LLCA 4ZOLB 4IHQA 3K6SB 3LDFA 3SXJA 2ERCA 3JVUA 3RYHA 4OEHA 1F2DA 1K6MA 3RVBA 2J5KA 3DOHA 3PNSA 2D8MA 1FQOA 2RGXA 1DGQA 3MMXA 3KZXA 3PX2A 2Y1CA 2A6PA 3R3JA 2N9UA 3F5QA 2AQHA 2QN6A 1C3OA 3F9CA 4OHUA 4C3OB 3D6JA 1DV1A 4QX6A 1LPMA 4NC9A 3SZUA 1QPZA 1XELA 1EDZA 3D7MA 2O3RA 2AEMA 2R9VA 3IMCA 2IPNA 3KAJA 3EPPA 3KQSA 3P9RA 5BW6B 4NBKA 3VJRA 4QG7A 1P3DA 3BRQA 4JOBA 3IQWA 4Q19A 4R9SA 4UPDA 3WRWA 1J00A 2JDID 2RGNA 3KOYA 3ZU3A 4KMOA 1BXGB 5TV2A 1CCWA 3VA7A 3S3TA 3UJBA 4JJ7A 2HHCA 2JGAA 1BWQA 2ORVA 3BE6A 3BD8A 3NWPA 5DHFA 4AWBA 3KSBC 1SZCA 1XBTA 2C2XA 2AR9A 3ZKAA 4P4UA 1XQYA 4DQ0A 5I9SA 4L4XA 4PYMA 3IA7A 4CG1A 4NHOA 3Q8KA 2NNWB 2CJWB 2E4ZA 3CW9A 1YULA 1FS6A 2JFYA 3LWBA 3QWIA 5ALMA 1ZJ5A 1ZD4A 3MGGA 4IV0A 5EWJB 4NBVA 1E6CA 2ZT8A 2QQGA 1EUCA 1SBHA 2GBLC 2WKPA 3RC2A 3SDSA 4NCIA 3N8HA 4MUFA 1YS1X 4P38A 1G19A 1P9LA 4YFYA 3ZHZA 2XT9A 1RAIA 4QBHA 4HJXA 3FVRA 1KAMA 1PSWA 2MCFA 2JIMA 2ZSJA 1G59A 3OU7A 2H59A 1U8AA 1QX3A 2IEAA 3IPAA 3QKSB 2DFPA 5KJFA 2IKQA 3ZNNA 2IPOA 2CXPA 2ZRLA 2X2FA 4MP6A 4HEJA 1Q74A 3QBVA 5AP9A 5TDHA 4EG4A 2D0PB 3Q6NA 1BCSB 2OHFA 4XLLA 1IOVA 1KZYC 3NHAA 5F12A 3ROPA 3L0SA 5A2GA 1M1NB 1J8DA 4LWPA 4E88A 1EM6A 3WMFA 1ORTA 1ZJZA 3OJLA 4LV5B 1X7XB 4ZVMA 4FHGA 4CIBA 1OB5A 3EGDB 3O2SB 2C1EA 4AG3A 5DW0A 4WVLA 2ZBFA 1UJCA 2CE7A 3PQCA 2EWVA 1TPZA 5L9AA 3ONVA 4FXOA 2FPIA 2HK7A 1TMGE 3K9BA 2PZKA 1GT6A 2JRBA 3UCXA 4NJEA 4DV7B 3RAJA 1GD1O 3A1DA 4R3WA 1ZOLA 2FFAA 2QVBA 3KKPA 3PNBA 3LUFA 4R1LA 4HNHA 3AJDA 4YN3A 3QF7A 5JRZA 4TMYA 5LBTA 1CS0A 4RH0A 4PO1A 5BR1A 1JHQA 3ZQ6A 2Y1DA 1YGPA 5FDFA 1DI0A 1FFXB 2P1DA 4BX2A 2FR8A 2HBZA 4QATA 2QRPA 3OOWA 1XCMA 1OE0A 4N8DA 2AN1A 3TKYA 1J39A 4GOLD 1EP3B 1SG6A 4UZSA 4BMXA 1R8XA 1I3NA 4B0PA 2EJBA 4HI0E 3WB1A 5GJWC 4O0MA 1VJGA 4NF2A 4EA6A 5AHKA 4P35A 1MT3A 5HK9A 1FDVA 1ABFA 5GGYA 2JH3A 2ROQA 3FGOA 1Q2XA 1JMKC 2QPLA 3OJFA 4TS3A 3NLLA 5AXAA 4NQRA 2H2GA 3EVTA 2DX7A 3P19A 2Q6LA 3IAM6 4UNNA 1OCEA 2XJ9A 2J9FA 4JLWA 2PD4A 4DHEA 2C3PA 2IUTA 2VSOA 2W2KB 1WSBA 2QJFA 3HCDA 4OQDA 4TV8F 1AUOA 1UANA 5FT9A 4CKBA 4YLEA 5LNK6 3K1JA 3HYNA 1JZTA 1W8DA 4DIBA 3OHSX 4TTSA 1CUWA 4IVRA 1IJKA 5EMNA 1FCJA 3U6KA 1E4YA 3KYBA 1JEQB 5BVGA 3QLJA 1ODKA 1XK6A 4J0IA 1QLHA 4LWOA 4TXMA 2CUTA 2B7BA 2GAAA 4JJZA 2H57A 5LP6C 3GCGA 4KU4A 4NU5A 3RCBA 3OIYA 1B3RA 3HSSA 4LF7B 3IDFA 3HJUA 4W4TA 1C4KA 3T9DA 1NN5A 4ZMBA 1CUZA 2VRNA 3MYYA 5EERA 4HWOA 4XUCA 3TUIC 2IZ6A 2VRBA 4NBUA 3NWBA 1TK9A 4F86A 1ONNA 4PICA 4YDQA 5JFTA 2PANA 2VCEA 3HCOA 3IEUA 2V9PA 3T4UA 2JI8A 1N2CA 2CF5A 4OQEA 1QRAA 1GRVA 2YWCA 2ORIA 3QITA 2B4YA 1KH1A 3EXG2 3KHTA 4WESA 3OECA 3EXAA 3LVBA 5CURA 1N5OX 5TLSA 4ZVKA 1QHXA 1ZRHA 1G4HA 1FPQA 1X7ZA 2O4CA 4IMPA 1JLLB 1XZGA 3BJZA 4JVMA 5IG2A 5JI2E 2COKA 1RXIA 3IP1A 4KTTE 2Y68A 3DMYA 3ZIAD 4CI9A 2GYVA 2J9XB 1P74A 3PFCA 5JSFA 1AQJA 4E4YA 3LLVA 1P6UA 3FCYA 3L07A 2PH3A 3ZEAA 4RTRA 4MTLA 3ZZMA 1EWKA 1GCAA 4IRUB 4F8EA 4XFKA 2P4QA 3M4ZA 2FQWA 1T8TA 3DSRA 1SXJA 3ZD7A 4X3CA 3WL4A 1KVQA 1A7UA 4MWCA 4KFRA 4EARA 4FHZA 4ERXA 3K94A 2VSFA 3PKJA 1L7DA 5IKOA 1Z35A 1NR5A 1AZWA 4YDRA 3O8DA 3T61A 3TTVA 3E1KA 1RSZA 3GCWA 4RY0A 2IUYA 1ESEA 1EM8A 2C9YA 2XD9A 3AF0A 3CF2A 1JAIA 4MQ4A 2HLNA 1D5CA 4EF4A 1Y8ZA 2J3DA 1N8KA 1AQYA 2J67A 1PW7A 4OO3A 3KD2A 5A9RA 2AVNA 1UWVA 4YRFA 1Q0ZA 4F4JA 2FB9A 4S24A 3OFND 3BEDA 2B99A 4TZTA 5AHWA 5HOQA 4UM9B 3UCFA 3IPYA 1L5FA 1U9JA 2P2ZA 1JTEA 5H3HA 5KNBH 1U9IC 3JTEA 5E4JA 5M7EA 1Q1BA 1FQKA 3SLKA 5CB6A 1GKYA 3N2IA 1EWYA 1MKYA 4X1IA 3CM0A 1VE9A 2IZ0A 4OB7A 3E58A 1UINA 1VIAA 1ODTC 4JK3A 2JLVA 2PUVA 4A92A 1CERA 5BORA 1VKNA 2H7YA 3DBOB 3UUFA 1WHSA 4GPAA 3U61B 2KHZA 5HCUA 1AQ6A 2VDJA 3WKAA 3SFTA 1APBA 1Q3TA 2YUTA 4NV3A 4D5EA 1B6RA 1PT6A 2A9FA 2GESA 2WIGA 3ZUPA 4S1PA 5I7FA 2YJ6A 4DMFA 1QGZA 1P0FA 1YJQA 3AEZA 4PF1A 1T4GA 5D3MA 3AF2A 2E3JA 4HWTA 1V9LA 2NQ2C 2YKOA 2IYTA 2VZ0A 3GLHE 3MJFA 4U7TB 2XUOA 3SZGA 2N46A 4X41A 3ZW8A 4C04A 5BSWA 5CT6A 3NYIA 1BYIA 2CMDA 1KI2A 2IIVA 1UAGA 2HJRA 4J16A 2WYVA 3PHHA 1E1QA 5DO9A 4ENRA 4BNYA 8OHMA 2PVCA 1COZA 3EY9A 1AA3A 1GG5A 3SYLA 4IH1A 1MJHA 1PNOA 1PHPA 2V58A 1IG0A 3FWKA 1RHKA 3VKVA 3ZNPA 1ZESA 2WZCA 3O1JC 3OCXA 4OFXA 2H17A 3IQIX 4JL8A 4LJ7A 1NVWQ 1MBZA 3UUEA 5AXCA 5T4HA 1LSSA 9LDBA 1T6XA 4UEJA 4RZ2A 2O2JA 1JQLB 1TQDA 3JALA 1EWRA 1LPOA 3NBUA 4IICA 3GJSA 5DWVA 2ZQ5A 1XZCA 5CB0A 4TYWA 1UDCA 5JZ9A 1EAMA 1KORA 2E0IA 2GH1A 2J7PD 2IYLD 3C1OA 2V7GA 3EXHC 4NY1A 5JAQA 3ZH2A 3SJ7A 1RZRA 1WDWB 1YASA 1W25A 3K73O 3DOOA 1H1LB 4LJKA 2YZKA 4PHCA 1XT6A 2O0LA 1ABBA 1DIOB 1VCOA 2GXUA 4UTRA 1M5UA 1YNOA 2NP7A 1CWUA 1QM5A 4UHKA 4ZQBA 3C8ZA 1KAGA 3F46A 3MTQA 4XJSA 3TI7A 2WT9A 2POQX 2XGSA 1CF4A 2XUHA 1FS4A 4C0JA 3KJZA 3IKMB 5CT5A 3ZZTA 1DL5A 1K7CA 2HU8A 1E59A 2AEJA 3CFYA 2Q6TA 2GBGA 3AY6A 3HADA 2RAUA 3PFWO 3IOEA 4C0QC 4RTLA 4OBBA 1IUPA 2CDNA 1OMOA 3UO8B 1FW6A 1X74A 3UOGA 2AWNA 1FYXA 2H2IA 2QVYX 2WUEA 3R4CA 2WFMA 3R5TA 3V33A 3WOVA 4C88A 5FOQA 1T2FA 3G0DA 5IMBA 2YBEA 3BWYA 2XH8A 5CAEA 2AN9A 2ZRFA 1G8AA 1MCZA 3LSYA 1G3QA 3KG2A 4RLFA 5AKLA 2A5LA 3IR5A 1RWWA 1HQYE 3HL0A 3AUJB 2IZOA 1Z0DA 2DPHA 2RH4A 1T4CB 2W2MA 3F6YA 3IAAA 3JZMA 2RBEA 5TQ0B 1DEKA 3C43A 1E58A 1ZS9A 4WH0A 3V8EA 3EX7C 2ZRHA 1QCDA 3PQ3A 1IAVA 1IFXA 1BGWA 3FYUA 4GBMA 4U1RA 1KNQA 3E3NA 2BDEA 2J32A 3WMEA 1J23A 4AECA 4EJSC 1L4NA 1A2OA 2W4QA 2XE4A 1OA1A 3A1CA 2W6OA 4J9VA 3U13A 3WAGA 1DTEA 3QVJA 2E4XA 4J1TA 1NUHA 3SAJA 1Z6TA 2ZJ3A 4DXAA 2VBFA 3AESB 1YB7A 1MB3A 1Z9BA 2XYGA 4GUDA 1IG3A 4QOJA 4US1R 3U5ZB 4FDUA 4L22A 2ZJZA 1XA4A 2EFJA 2B9VA 2CBGA 2HHLA 5LWQA 4ESEA 3CU5A 4P36A 2V5AA 1ZNQO 4ZVTA 2GD6A 1DKRA 1P7YA 2XUZA 1KBQA 2FFQA 3QTBA 1HTTA 1RYNA 2XMPA 4V0KA 1N7JA 4UBOA 5AK3A 5I4KA 4HTFB 2ZUTA 3AVOA 4KE7A 4NH0A 2GNPA 5AVQA 3B82A 3GUVA 4R1MA 3FWYA 3LPCA 1ADGA 4FJ1A 3KQPA 3O91A 5HHTA 2RGBA 2PBFA 3RUFA 3RPEA 4P4SA 2GX6A 2YHSA 2HBYA 1AY0A 3F78A 4FYKA 5DOZA 5U9CA 1ENPA 4LBVA 2ATCA 5D5QA 2QMEA 1DRUA 4H4DA 1HQKA 4OPMA 5JCJD 1MOPA 2F1KA 3GUZA 5K01A 2GJSA 3A31A 3AR9A 1PG0A 3IEMA 2VK8A 1N2SA 3GJXC 3KKMA 1DO0A 1E20A 1ODLA 3G79A 2OY0A 1QVWA 3WB9A 1VJDA 1AHIA 4BNVA 5C5IA 1X8KA 2Y4NA 2AZXA 1AGRA 3BXZA 2O0JA 1NNEA 5JWRA 4UU7A 1IQRA 3C7DB 5I9TA 4NZZA 4F3YA 3NG1A 1DKPA 2OECA 2YFHA 2QD5A 4JJ6A 4K7JA 1E8DA 1FVFA 3AQIA 3EEBA 2JATA 3K5PA 1RI2A 1ZKMA 1C7FA 1DAKA 2E5FA 4M9SA 5FPSA 4LY0A 5IC6A 2BMWA 3SCZA 2D0DA 1ICEA 3CWCA 3H1BA 4MKHA 4CFSA 3BDVA 3ZJ5A 3NGMA 2XMDA 2CYAA 3CTPA 3MOGA 3OPYA 1FVHA 4GL4A 4AXBA 3B6MA 4G1MB 2CK3D 3ZQJA 4B84A 3AX6A 1II0A 5KQLA 3X1KA 2Y1FA 4RD2A 2AN4A 3N6XA 5L95A 3AF5A 4CKCA 2WJ3A 3PWZA 5AI6A 1KEVA 1VBFA 3FMPB 3W4JA 2RG7A 3E23A 3BHIA 5FWDA 1EIZA 1K3FA 1QFXA 2PL5A 5KQRA 5LQCA 4HNSA 4Q1DA 2G80A 1SD2A 1W49A 1X7YB 3MMZA 3RV4A 1QYIA 3KHKA 4CKBB 5FWAA 1NYRA 2G1AA 1Z33A 1V8OA 4QELA 1PI3A 1GL3A 1MGOA 3CR7A 1UZAA 4AQYB 2XADA 3JATA 4CLRB 1WQ4A 1IM8A 2JFZA 2ZT7A 3V7YA 1BMQA 4H1UA 5D00A 2VHQA 1KOGA 1E0SA 2BIFA 1WAMA 2OBBA 1Z36A 4MUHA 3Q7RA 4Q3DA 2JCYA 3VZCA 4US0R 2HDOA 2I80A 3N3AC 3ZG6A 3KEGA 4K1XA 4CCWA 4IGFA 1DOZA 1FP6A 4DTCA 1DCTA 3ZY2A 1F6DA 1AQLA 1W4RA 4A6PA 3UPUA 2PM8A 2EKZA 3MHPA 5IULC 4TMFA 2NP6A 1VSBA 3W2IA 1PR1A 2ISCA 2CLSA 1FFBA 4R40A 2JASA 4G8BA 3KE9A 3TG8A 3ZLJA 1L5ZA 3PXBA 4M7WA 2GHRA 1ISRA 2A7QA 1XX6A 1UEJA 3MB8A 4AZTA 4Q34A 3WGLA 4EA8A 4ZJZA 1AO0A 1OY1A 2FSUA 2J4DA 4L07A 5AWFC 3VR6H 4ZOEA 3RKSA 3WK4A 2ZE5A 1KOJA 3C6KA 3MCWA 2WR8A 1GAWA 3V2GA 1Q6ZA 3GLQA 4F72A 2G4CA 2ZBQA 4FR2A 4J3FA 2XUDA 1S89A 2RARA 1WZUA 4G56A 1ZXBA 3A6KA 4J29A 4UBLA 5J47A 5BMVB 1UXJA 1R74A 1YS9A 3WNVA 1DX9A 3GV0A 7YASA 3ZY6A 3L7BA 1Z4MA 1WXHA 1U3WA 1ULSA 1JNXX 4MW7A 2VP5A 3WK8A 2O07A 3UJ8A 4R1OA 2XCQA 4LXXA 2CFCA 4MV5A 4IP0A 3UTDA 1COWA 1DBWA 2EG9A 2VHCA 5IKMA 5IT0A 1WS6A 2VRCD 3UTCA 4F38A 3KWFA 1WMAA 2YWEA 1H6BA 1RI3A 3M9LA 4OHVA 3MTAA 1N2ZA 2XTZA 1ZVKA 2QYOA 3HR4A 3C41J 3LY9A 4IQ4A 4L0MA 3TMKA 3CNLA 4YT4A 3IEVA 2FN9A 4BE9A 4GI5A 4D8VA 1RKVA 4C2AA 1G8PA 4WNYA 4TV8A 1XYVA 3R3WA 4K0KB 1LUAA 2IBSA 3D6TB