2ZRNA

Msreca form iv
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
326
structure length
317
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 81
structure length 317
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrnA01
3JVUA 2GZAA 3K70D 2WKRA 2C9YA 2WJVA 1G6OA 4GZMA 3B1YA 2BMEA 3UWOA 1E9FA 1KOFA 1FNNA 3EIHA 4JT2A 2YWEA 2P5TB 2F1HA 1KSGA 3CRQA 3KJGA 1XU4A 4Z8YA 2CMKA 4LYHA 3SEAA 1I2MA 3KZ1E 1OHHD 2Q9AA 3BORA 4EQ6B 2ORWA 3FKQA 3LY5A 3NWJA 4BRUA 4UQOA 3Q5DA 2XXAB 5DLQC 4DDUA 4BFUA 1F2TA 1XRJA 5H1YA 1ZNXA 3E1SA 2O52A 3QJYA 3GLGA 1FMJA 1FP6A 1XF9A 2F9MA 2O8EA 2PLFA 2R65A 4EFLA 4XSGA 5JHHB 4YC7A 1Z6TA 4Q5IA 3IBYA 4URYR 2X2FA 4KHZA 2B7CA 1GKUB 3I61A 3EPHA 4LC0A 3DOEA 4CEJA 1X1SA 4HI0E 1MABB 1OJLA 4BE7B 1MOZA 1Z0KA 4KLZA 3QPWA 1XEWX 4A82A 4IDQA 4O0MA 4MRRA 1H8ED 1TQ4A 1RJ9A 3NDPA 4FMDF 3KB2A 2CBZA 5E95A 1E2EA 2XGJA 5EUMA 2G0TA 3QKTA 4QM6A 1E2HA 3LDAA 4GNKA 4XD7D 1JAHA 4KU4A 3U6KA 4EKDA 3RABA 2W6ID 5HZKA 2YOHA 2BC9A 4OK5A 4PAOA 3I3SR 4MGIR 2YYZA 5GJVC 3U3MA 2H16A 2ZYTX 4D81A 1FW6A 3V4FA 2FPKA 3IQXA 3MRSA 4BFWA 1XCPA 1G7SA 1TAGA 2BEJA 4KI0A 4L4UA 4V0LA 1N6RA 1W0JD 2W6JA 4JLKA 4KITB 3VNUA 2EFHB 2F1JA 1Y3AA 2ZSAA 2QMOA 2JDID 3QI2A 1NF3A 5FOWA 2PEYA 4KCGA 3AKYA 5SZKB 2CCJA 1B23P 3QKRB 1OLOA 3HR8A 2ODEA 1SHZA 1NY5A 1E99A 3QF4B 1US8B 4NYIR 4HLUC 2OAQ1 4TSFD 5TARA 1II8B 1OFUX 3SJAA 5J4HA 1FMLA 1Q1ZA 1W5SA 4DLRA 1M7BA 1UBFA 1Y63A 4JLVA 2IF2A 3FHOA 2J0VA 2W58A 2UZIR 1Q1EA 1IN6A 3AV0B 3TBKA 3NHBA 3O47A 2Z0MA 4NCHA 1UADA 2QMUA 1F2UB 4Q21A 1W1WA 3CX7A 2XJ4A 5JEDA 4ZCIA 2HF8A 4NHOA 4LV8B 3QBVA 2RH5A 1PLLA 1W47A 3BFXA 3GJ8A 3ND9A 1ANKA 1VIAA 1XFAA 1KZ7B 1G9XA 2WIAA 4BZPA 1AKYA 2OZEA 1OPXA 2AXPA 2A5YB 4EPTA 2GJAA 2B7BA 5HZHA 1FUUA 3L0PA 1Q1BA 3DOFA 5KOYA 4MUBA 4EAQA 621PA 3SU8A 2BM0A 2WSSD 5J4YA 1E0SA 3VAAA 4D0GA 3Q7QA 1K5GA 2V55B 1HY3A 4M1TA 1WCV1 4Z1MA 4NL4H 2SHKA 4DEXA 1HEIA 2YNMA 1TU4A 4MRPA 4RJLA 3EASA 4YXWD 1JR3E 1NRJB 3AVOA 3FMFA 1TX4B 1Z08A 3GLIB 4CT4B 1OB5A 5DYGA 1E9CA 1U8YA 4WVFA 5FFMA 5KSPA 2ZU0C 1KY2A 1E2JA 1OW3B 5HKKD 1M74A 1E2NA 4P33A 1JEEA 3B7GA 2HXSA 1Z0IA 3FB4A 1IAQA 2H5EA 5ANRB 1CR2A 1G19A 3KTAB 4YMTA 2AX4A 2RGEA 1P6XA 3OFNA 3PUZA 4QC2A 1S3GA 3K0EA 1YRAA 3VHXA 1HTWA 3LD9A 4LJ5A 5KSZA 4HLUA 1MH1A 4MUAA 4JLBA 1U9IA 2KWIA 3OEHA 1D2NA 2IYWA 3BH7A 2F3TA 2PMDA 1KI7A 3MJRA 2HDNB 4GFDA 4JLOA 2P5SA 3SYNA 5L3SA 3LX8A 5AJZA 1E1QD 1TPZA 1HYQA 4Q4JA 5E4FA 5JJKA 1EFTA 4LJ9A 3GJXC 4GI7A 1KI8A 1WMSA 4RZUA 2V4ZA 1OXSC 1D2MA 1KTVA 2P2LA 2VP6A 3LO5A 3RS0A 3AGPA 4TYWA 3L0OA 5FTKA 5CDFE 1SVWA 1ZBDA 3PUVA 3GJ5A 2QM7A 3TSWA 3TK1A 1YR7A 4NP6A 2CCGA 2GAOA 4TLCA 3GJ6A 1VYUA 5D3MB 1G1MA 3NKVA 1NNEA 4TL9A 1E6CA 1NG1A 1QHHB 2J45A 2IYRA 3KTAA 2GJKA 4GSYA 1CEEA 1UBCA 1DELA 4D2IA 4JL6A 4MKHA 1VHTA 3T06B 3THXB 2RB4A 3CZPA 3MCAA 1Q1QA 4L16A 1F60A 3RS3A 1OIWA 1E2MA 3LLMA 5EJEA 3CPHA 3A1TA 1Q21A 5JJLA 2GJ8A 1VHLA 2XAUA 2EFGA 2ZE7A 2BJWA 2FFBA 4IEIA 4PHGA 1RRFA 2CVFA 3MWLA 2JJ2D 4TMTA 2NPFA 4DLXA 1K6MA 4RZXA 3SJZA 5J4VA 3U3KA 5E3HA 1JXOA 1L4UA 2XOKA 3GLGE 4CEJB 3B60A 1P75A 1ETUA 1G20E 3TH5A 5JRJA 4G5OA 1Z06A 1IN4A 4G5SA 2PT5A 4NCIA 5EXTA 1Z0JA 3WMFA 3MUFA 4XVRA 5B30A 4C0KA 1RC8A 3NXSA 1YVDA 2GZHA 2Q3HA 2ZR9A 1W0KA 4Q1AA 1DO2A 5KSOA 1P60A 4F38A 4XTCS 5AUQA 5TXGA 4QKQA 1G16A 1EWQA 4DJTA 3L2OB 4Q9LA 2FSIA 3ZH9B 4FMCB 5FUXA 4RFSA 3LXXA 4D4MA 4EPYA 4LGMA 4F4CA 4C0QC 2VPPA 2P67A 1JR6A 2BMJA 2DWQA 2YOFA 1DG1G 2IHYA 1HQYE 2R6AA 5JHGB 2ZM5A 4II7A 3QE0A 1HA3A 2IXFA 3LA6A 2EFDB 2X19A 4JBXA 2NGRA 4BLSA 5B57C 4BGDA 1ZC4A 2HCJB 3CNOA 3VKGA 4CEHA 4C0SA 3T1TA 2W0MA 3TVTA 4FN5A 4RY2A 3TR0A 3CBQA 3FPAA 3K9LA 1D9XA 3P26A 1QHIA 2IA5A 3RSLA 1HQCA 2AKAB 4FMBB 5ELXA 3CF2A 1MO4A 5CK5A 1ZYUA 1T3HA 4G5QA 4M1MA 3CW2A 3D7MA 2Z5FA 5E7MA 2VH5R 3B9QA 1W0KD 3BBPA 3NBZC 4I1OA 5HE8A 4PPNA 1JJVA 1KI6A 3LVRE 3W3ZB 821PA 5IF9A 5LPNA 4QBGB 1JAIA 1U8ZA 3UMSA 1FTSA 2O0JA 2RCNA 2ASEA 1KI4A 2YC4C 3MWYW 3PUXA 4KFUA 5KTYA 3W5IA 4DUGA 2QQEA 3WYAA 4DIEA 2ZRLA 2NO0A 2J0UB 2XJ9A 1KDTA 1ZNWA 3LBHA 4FCVA 5EE9A 4D4JA 4PPQA 2C9OA 2QL6A 2VP0A 1Z5ZA 4NYMR 1TQ2A 3UXMA 1GRNA 2AWOA 5FOUA 2F7SA 1ZM4A 1OHHA 1M6NA 2JAQA 1LF0A 2JJ2A 4C30A 4MGKR 4XWKA 2GJSA 4ARZA 1G21E 3TNFA 5C46F 2EFCB 4EQ6A 4GP6A 2O8EB 3GEIA 5IRCD 3H2YA 1CKEA 4LOAA 3ADDA 3T35A 3AVPA 5CIWA 2ANCA 2JIZD 4FCTA 3E2IA 1VCIA 1UM8A 3SJBA 2ZS8A 3KJIA 4IJMA 1N6KA 1T0HB 3F5FA 5JRZA 2WOOA 1TL7C 4CF7A 5JSZA 4AD8A 1L2TA 1VG8A 1RFLA 5J47A 3KKPA 3P4YA 5BW8A 1G8HA 3QBTA 1G291 3I8XA 4W5JA 1KDOA 4TTRA 4HAXA 4B35A 1XJCA 1E4VA 5HR5A 1DPFA 4V0OA 3NH6A 2DBYA 2Z43A 2QGZA 3ADCA 3AGQA 2J1LA 5G3YA 1LY1A 5HCIA 3RLFA 1RVDA 2QPAA 3NTUA 1W48A 1F48A 1YHNA 2C98A 2P3SA 3K1JA 2R6GA 1W7AA 4QXAA 1FP7A 3BWDD 2QU8A 4Q1BA 1JNYA 3AVVA 4M9XA 4DC9A 3B2EA 2G0NA 3ND8A 4TLEA 4Y0AA 4TYPA 4MYTA 5CITA 1D2EA 5FUYA 5J5CA 4O25A 4B3GA 4DT1A 1RW4A 1S2MA 3V4RA 3ZJYA 4JL8A 3PCRB 1VDZA 2QENA 3NIBA 3O8RA 2OT3B 2FJUA 2R8RA 2XEXA 1CLUA 3L8ZA 4PPGA 2QEQA 1AGPA 3GJ7A 4C2UA 1XCGB 1GSIA 1U2RA 4YDSA 2C77A 2ONJA 3U60B 1QHSA 3W6NA 3OAAA 1VYTA 2IC5A 5AR1A 2MSEB 1NI3A 4MQBA 4TT3D 4I1SA 3QG5A 3SI7A 2G9NA 4JJZA 4JLJA 1Z29A 3TKLA 4B6FA 2O0HA 2OEPA 2REOA 3K8YA 4XJXA 5JZVA 4DKXA 1OSNA 1D8TA 3DM9B 1FZQA 1VIYA 1XTIA 4JJKA 1QF9A 4WZ6A 2NG1A 4PSAA 2RGAA 4OQFA 4NE2A 2JLQA 4QBFA 5JEEA 3CRRA 4B3XA 5DN6A 4B34A 2QBYB 4IHQA 4XSHA 4B2LA 2LCFA 3KDSE 1H8HD 1VCMA 4Q9HA 4A2PA 1Z6XA 1NMXA 2D4HA 3OF5A 1GKIA 2XB2A 2QPOA 3IIJA 4HDOB 3RS4A 1ZRHA 4JVLA 2WSMA 4OBEA 1XXHA 4FWTA 4G3XA 2PJZA 2VHJA 4UNNA 1UFQA 4US0R 1ZU5A 1SXJE 3NDBB 4F93B 4DT1B 2J59A 1KIMA 1GL9B 4ZIRB 1Z28A 2MMCA 1R5NA 1XB2A 1TU3A 1GL7A 2JA1A 1DAMA 3CF0A 4WZBE 4R2IA 1K8RA 1X86B 2WM9B 1U8AA 1ZINA 1XTSA 5KUTA 1XMIA 3S1AA 2NO7A 3GQBA 4QJ4A 1ZJ6A 4BLRA 1P72A 3QIAA 2ZREA 3THOA 4H9GA 2PX3A 1NBMA 4C0BA 3GEHA 2ZRJA 1Q57A 4IXNA 3DDCA 1G7CA 4OI1A 2QE7D 2E87A 4HZUA 3RHFA 2VSOA 4NTZA 2HT6A 4BEJA 3A36A 4LBZA 2FFAA 2X77A 5CB6A 3J81k 3UG6A 4BFSA 1U98A 4M9ZA 4PO1A 1KY3A 5F98A 2CL6X 4A1FA 2Q9CA 4BFXA 2DPXA 4QNMA 1E2FA 1CXZA 5DI3A 2LKDA 4QGGA 2UVQA 1UKYA 3KKOA 4PHHA 1A2KC 4ACAA 4RVCA 2W2VA 4TYNA 4D0LB 4US2R 1YZLA 5C1BA 2R44A 4U00A 3C5HA 3SBEA 3OEHD 1MO5A 4LY6A 4N0EA 1SKYE 5DHAA 1DOAA 2NO1A 4QHTA 2GZDA 3BD9A 3ZD7A 4B43A 1COWD 3K70C 4PTLA 2XNDD 2OXCA 2IUTA 2XITA 3LV8A 4V03A 1AKEA 1TQDA 5BN5A 4Q03A 4XH9B 1E9DA 2CL7X 2FEOA 4ARZB 2HEIA 1I2DA 5C4GB 1OYWA 2QP4A 2RHDA 2EYUA 4M2LA 4P0TA 3P1JA 1KI6B 1CIPA 1ZUHA 4PC1A 1GRQA 4D25A 4TZ6A 5C2JB 4LJ8A 3RC3A 3GMTA 3TJZA 1E79D 4ZCLA 4BLTA 1GVNB 2WJGA 3KFVA 2PCLA 4GT1A 1XPOA 1X8JA 1XNJA 3U7HB 1M1YE 5DISB 1LF5A 3CNNA 3R9XA 3QXSA 4NONA 1YR9A 2ZANA 3C16C 3UK6A 5LDDC 4C4PA 1L8QA 1N6HA 4OYHA 3AF4A 2QM8A 3PEYA 3B9PA 1XEWY 1T9HA 3TLXA 2IWHA 3U7FB 5KNCA 2C99A 1L4YA 1NP6A 3HU2A 5FOTA 2P6RA 2GXQA 3OE7A 2C04A 1XD9A 1GZSA 3MJHA 2PT7A 3DHWC 1NVVR 1R8QA 1AGRA 2BKEA 2DFTA 4M8NE 3X1WA 2HJGA 3QVUA 3CLVA 3FMPB 4FINA 3R8FA 2IYXA 1JXMA 1LFDB 4HAWA 1Z0AA 3EX7C 2BMFA 3GJ3A 4LWZA 3LW8A 3ZYCA 4PPFA 4DRZA 5J4LA 2GVDC 1JPNA 2IF0A 3GEEA 5JI2E 1W2HA 4S35A 1MR3F 2OBLA 4JLNA 2OUKA 1OE0A 3EWAA 4JT4A 1WRBA 3LLUA 2QTVB 1TEXA 3L0SA 3IPXA 3LW7A 1YZUA 2B6HA 2GXUA 1X1RA 3K09A 1ZM9A 3ICQB 5CM9C 2RMKA 1GTVA 3BIFA 2V6JA 4RFSB 2RKOA 1KSHA 2A5JA 4MA4A 3AF3A 4V0NA 4Q48A 1IM2A 4KYIB 2OFOA 2JASA 2IK8A 4D4LA 2OCAA 2AL7A 1N5KA 3DZDA 5SZIA 3K53A 2WMNB 1N6IA 4C3ZA 2H7VA 3OIUA 5DNYB 2R6DA 1MRNA 2PH1A 2ZRMA 4OKSA 3SYLA 4OJQA 2ZITA 3AKCA 2AN9A 1S9HA 4EPXA 4Q4LA 2BVNA 4OL0A 2GHIA 2Z4RA 2WJYA 2HUPA 1OB2A 3FVQA 1IXZA 4Z54A 2YZ2A 4OQNA 1M8PA 2GTPA 4FMCF 4Q4AB 5HTKA 4PX9A 4FW9A 2WWFA 3MFYA 4DSTA 1N6LA 3FFAA 2CE7A 3KFXA 3WY9A 4HAVA 1UDXA 4NCNA 2VYFA 3I4LA 4MDFA 2PCJA 2X8AA 5JSZB 3WP1B 3ZQ6A 2CXXA 1T3LA 3FKSD 3BH0A 4URUR 3AVWA 1J2JA 3TW8B 4EUNA 4A4DA 1E0AA 3Q5EA 4TWZA 4Z1MD 2FF7A 2CVHA 3ZLJA 1OYYA 1ZM7A 5GJCA 2J0UA 5CJ2A 1EFUA 1OFTA 4C0JA 4GOXA 1PZNA 221PA 2RHMA 2AKYA 1GKYA 3SR0A 2PLRA 3K0FB 4QRHA 1RYFA 4DCVA 1N6NA 1YRBA 1M7GA 4D80A 1E1RA 3CNLA 4BFTA 4QGHA 3FOZA 5B58C 4IRUB 1CULC 4KODA 2O8DA 4KFTA 3TAHA 1E94E 4FMDB 1SVSA 5F9FA 2BKUA 1OXTA 3LXRA 4R2HA 2ZRBA 3UPUA 1W49A 2OILA 1P9NA 3P20A 1KJYA 1NLZA 4RCZA 4KFSA 3WRYC 4PSVA 1PLJA 3TUJC 4HLQB 3CUEF 2JLXA 4PC7A 121PA 3K09C 5M04A 1W4RA 2DB3A 3P4XA 4IFBA 2O8CA 4Q7KA 4HB2A 5JLJA 4IXMA 1JBKA 4KFRA 2RGNC 1YR8A 2ERYA 5BQ5A 1E9RA 2QG6A 4AI6A 2BHRA 1G8PA 1S0UA 1YZGA 1NVVQ 1P4SA 3PEUA 3KXKA 2P6UA 1KYIA 1NKTA 4Q9IA 4LI0A 4YMWA 4W5WA 5LB2A 1W36C 4EPVA 2ZROA 3K70B 3KXIA 2R2AA 3L43A 3EZ7A 1Z2AA 1ZD9A 3HDTA 4LHZA 4XD7A 3LNCA 4YMSA 3AF1A 3ICEA 5HE9A 1VCNA 3RVBA 4EFMA 1IJFA 2A2ZA 3VU9B 1KK2A 4DSUA 4YMVA 2ZI4A 5F9HA 2ZRAA 2IEZA 1Z6YA 2OESA 1NJFA 4UKDA 4RKFA 2OLJA 3PQCA 2JATA 721PA 3DMDA 4FIDA 2VIIA 3CPJB 3T61A 3SE0A 1ZIOA 3AP1A 4KVGA 2WIBA 4BASA 4ZI3A 4ZCMA 4AG6A 2ZRPA 2DFNA 2C03A 2RGDA 2ZSBA 3O8DA 3CM0A 4M1YA 4RCYA 5AWFC 3BB3A 3SFZA 2VL7A 4OI0A 2XTZA 1I4TD 4OHYA 2EU8A 4G01B 4MKGA 3TQCA 4B74A 4ESHA 3GFOA 4DZZA 4AURA 2J5XA 4Q00A 5AJYA 3UATA 1DBSA 1DEKA 1JI0A 4BFZA 4TQAA 3U2QA 2IYVA 2FWRA 4D0NA 2J9RA 3ZDQA 1YE8A 2KJQA 4P31A 1Z63A 2IUSA 1OH6A 3EXAA 5JMTA 4DLYA 3UMFA 2IWRA 4LJAA 1YZNA 2QRNA 3I72A 3QXXA 1QHHA 1U0LA 3OESA 1GITA 4Q18A 2PEZA 4Q02A 4P3YA 3VQTA 4LHVA 4DLSA 2QT1A 1I4LD 1TMKA 1WXQA 3L82B 2G88A 4A8JC 1A2BA 2YVUA 2I3BA 4PAQA 4XWOA 2GKSA 2IT1A 3M0EA 3WMEA 4UNPA 1G5RA 3K0AA 3QPUA 4QHSA 4HUTA 4XOIA 4IOJA 2Q9BA 1S1CA 4JMPA 1Z8FA 4YDHB 3T5GA 5JWRA 2ZYUX 2P6NA 2KI5A 3I73A 1NBMD 4KYUA 3IUYA 1AQUA 1X6VA 4B32A 2L0XA 1G64A 2FFQA 4DB2A 2GXAA 3BH6A 4DLVA 4TLBA 4ZPXA 4MDEA 5DH9A 4BLPA 1EX7A 1OIXA 3RDPA 2VA8A 4Q1FA 4A2QA 4DSOA 1W2GA 4IOLA 2QSZA 3W8RA 4ZI2A 2P65A 3CR7A 5EQTA 4EFNA 1BIFA 5FTNA 1E98A 1XCMA 4FXPA 1G3UA 1SVOA 2VBCA 2EWVA 1FUKA 2FZ4A 2WWWA 4UJ5A 1RRPA 4L9SA 4C0AC 4JLDA 1HT2E 4XTRA 2XXAA 4OQLA 3GFTA 4MKIA 3NH9A 4LYJA 2FE4A 3ZVLA 2IS2A 4JL5A 5LD2B 1KMHB 2Q3FA 4DUGD 4EJSC 2VO1A 1WBBA 3SNHA 5KNBA 2CHGA 3BB1A 4DDWA 1SXJD 4LCBA 2CL0X 3EZ2A 4NYJQ 3T5DA 2ZRIA 3GLIA 3FYHA 5E7JA 1E2LA 4A8JA 2ODBA 4GL2A 2H57A 4HB3A 3AH8A 1VG0B 2J7PA 1JR3A 4QOSA 1G41A 2NQ2C 3O8CA 4DIDA 2ZVPX 2QORA 3RRZA 1YZKA 2YV5A 4GMDA 3A1VA 4MRNA 2F55A 1J7KA 1N2CE 2YWHA 2NO9A 1WP9A 4TMKA 4JVNA 4HUQB 4QM7A 1CP2A 1US8A 1W44A 3IBGA 2O8DB 3AKDA 2OLKA 2CE2X 4LUCA 4R9UC 3Q3JB 5FL7A 2VHCA 4QHYA 1N3BA 1P3JA 2DWOA 2IL1A 4B3BA 3R9WA 3ZVMA 1XXHE 2W2TA 3F0TA 4P4TA 2A5DA 1C4OA 2V7QA 2WAXA 3RYTC 4Q01A 5DO9A 4PQRA 3CZQA 2ZRNA 2QAGB 2ZJ8A 2RGBA 2ONKA 1F2UA 1IY2A 1G7RA 2ZS9A 3R7WB 3KQHA 4P32A 1VMAA 4WZAE 1W36D 2WHXA 4WXRA 4L5BA 3QKRA 4R98A 5TDHA 2V54A 2RAPA 5DE3A 4NYJR 1SHKA 2GCNA 3QG1A 2ATXA 4KBFA 5FBRB 1ZIPA 4EIWA 4RD1A 1ZM3A 5K8TA 3BS4A 2JLYA 2GK6A 2BIFA 3ETLA 4EJSA 1T4GA 4A0GA 4LDJA 1AJEA 4EPWA 1DS6A 1CS4C 3AVXA 1AZSC 1G8YA 1NVUQ 4V02A 3N2IA 1IN8A 3OEEA 3QKSB 1GOTA 1R10A 4QBHA 1T8UA 1P2TA 3UWKA 3RC8A 5G41A 1J8MF 1YR6A 4WXPA 3DMNA 4Q7MB 1HUQA 2CDNA 3BC1A 2CEAA 4HLCA 4LV5B 3UG7A 3AVQA 1VECA 2FSGA 4V0ME 4K46A 6Q21A 1SQ5A 1H8HA 4TMZA 1P73A 1UPTA 3OZXA 2XSZD 1T5LA 5TY0A 1JQJC 1ELOA 2A78A 5FTMA 3B1ZA 3TE6A 2VHQA 1NMYA 4NMMA 4C2TA 1N0VC 3SHFA 2ZJBA 4DCSA 5K8IA 2QE7A 1ZAKA 3Q72A 2QNRA 3FFBA 4CW7A 4GP7A 2JCSA 5A0FA 5CYPA 3RAPR 2ZETA 1XJ0A 1RIFA 2FA9A 1R0XA 4G0NA 1Q22A 4NPHA 3U5ZB 2OO7A 1UAAA 1J8YF 1Z07A 3DL0A 2QPTA 2VTKA 5GVRA 4LHWA 3WNCA 2BM1A 2OG2A 1F6BA 1OFIA 2WAYA 3SJCA 3CH5A 3KQUA 1KGDA 3K0FA 4JKYA 2JEOA 2EQBA 5JCZA 1Z2CA 4W9MC 2V7QD 1DVRA 2A30A 3KXLA 4TZ0A 5SZJA 3CX8A 1RPZA 5DGXA 1DAFA 1EXMA 1KDPA 1VTKA 1GDDA 2J87A 2WPDA 4RD6A 3HWSA 4RD4A 1WA5A 4B75A 3KQKA 2ZU6A 4ZIRA 1D5CA 3I8SA 3M1IA 3FMIA 2O8BA 3KJEA 4F91B 2Q21A 1NG9A 2ZIAA 4IVPA 2WJIA 1W0JA 2XNSA 4C0LA 1M34E 2WOJA 5L3SB 2PZEA 3KUDA 4KSBA 5FI1B 1KAOA 3PFIA 3IGFA 4LK2A 4W7SA 1GNQA 3W34A 2D3WA 3V9PA 1OXUA 1COWA 1X8LA 4IVQA 1QVRA 2QSYA 4IVRA 4M0LA 3VHLB 1SZPA 3ZIAA 2OSBA 3C4JA 4HYYA 3H4MA 4A0RA 2XZLA 3CB4A 2J0SA 3P27A 521PA 1E2PA 3B13B 5HPYB 1TF2A 3FWYA 2Z6VA 2IS1A 1CJTC 1DTSA 1II8A 2QP3A 2VF7A 3RNLA 3B1WA 1ZCBA 4V0MA 2WWYA 3OE7D 4IFEA 3U7GA 3R20A 1CRPA 3B85A 2BV3A 2IYZA 5BXQC 2KBEA 3A1WA 3VU9A 2E1RA 5FUWA 1E79A 4Q9JA 4DLZA 4GDFA 1IONA 1QZXA 1OV4A 4LJ7A 3U3JA 3CRW1 2O8FA 1IN5A 2ZRHA 1CTQA 5HKKA 1IN7A 3QVVA 4LHXA 4BFVA 4ZV4A 3U6BA 1P2VA 3IIKA 3QQ5A 1XTJA 5L3QB 3HPRA 1FQJA 4QGAA 4US1R 3U44A 2YINC 3LQRA 4FCWA 4TMWA 2ZJ2A 4A6XA 1SXJB 3DEFA 2W2XA 3C8UA 1E0KA 3CWQA 5AJXA 2BBWA 2RGCA 1NIPA 4MRVA 4PXAA 1RKBA 2BWJA 4ITRC 3CWZA 4MYHA 2NPIA 4K81B 1XD2B 4YXWA 4MYCA 4RZ3A 2CHQA 4GOJA 4PAMA 1BS1A 3I92A 2C8VA 4HUQA 4X8MA 4WW0A 2FG5A 4B33A 2BBOA 3ADBA 1WBDA 3AKEA 1F3OA 4NZYA 1FPMA 4PO8A 4UJ3A 2ZXUA 2BJVA 2I1QA 3AP2A 4TL6A 3BB4A 5DN6D 3H1TA 3ADKA 3JZMA 1YU9A 3MMPA 4HB0A 4YQFA 3QENA 4M9QA 3SC3A 3ZD6A 2NZJA 3HPQA 3WP0A 2D7CA 3MGCA 4CVNA 1SVLA 2X1VA 3KQNA 1DE0A 2RGXA 5C4MA 4NU0A 2OV2A 1V5WA 2R6CA 3SQXA 3B8HA 3L0IB 5G40A 1UKEA 4DCNA 1ZVQA 5DYIA 4B2PA 2ZUCA 5AUNB 2G1KA 3BFKA 4JBWA 5AJVB 2IEYA 2WJJA 5H70A 3ZQJA 1ZNYA 2KE5A 4B2IA 2R9VA 3VR2A 1WF3A 3ZS8A 5GVSA 3VKHA 1PV4A 1N6PA 4JSTA 4ILEA 3AEZA 1E2IA 3B5JA 2D06A 2FFHA 2QAGC 4Q1EA 3GLIE 4BRWA 2IYTA 1E9EA 1ZM2A 4LBWA 4TYYA 4HEJA 3BK7A 2C95A 3S1AB 3VR6A 421PA 1S9DA 2H8KA 2Z4SA 4CZ2A 4AKHA 2OBMA 2VQSA 3ZGXA 5FI0B 4U02A 4KSCA 3C14C 4KLNA 4IW3B 3VTKA 1EFCA 2G6BA 2GCPA 2ANBA 4B44A 2QZ4A 5EE1A 3SQWA 5FOXA 1H65A 3IDQA 1QHXA 2FPMA 1GFIA 2W6JD 3WXMA 3M4YA 2REBA 3PG5A 5LD2C 1UKZA 3FHTA 4UNQA 4BFYA 5FBWB 4JS0A 3GPLA 2Y8EA 4LYAA 2TMKA 3K0CA 2ZJZA 4Q1CA 1Q44A 1OKKD 3TR5A 5KDLA 1WB9A 2FDCA 2JDIA 1P62B 3IHLA 8OHMA 1GUAA 4QFMA 4QNRA 2WWIA 1M7HA 3Q8XB 1IY0A 3KB1A 1N0WA 3CONA 4Q4HA 4E09A 3EIEA 2H17A 1DAHA 5K8LA 1F5NA 3FGNA 2ERXA 4W5HA 1FTNA 2VP4A 4Q47A 3LBNA 4L8GA 2ZSDA 3HP1A 4NDZA 5EE0A 1A5TA 4URXR 3THWA 4JIMA 2V3CC 2A9KA 1P9RA 3CPEA 3PENA 1G6HA 1XMSA 3O8BA 3PJRA 2JJ1A 1XDBA 2BMDA 1G8GA 4TTPA 1KO7A 4TQ9A 1P5ZB 5FPYA 5L8VA 4TL8A 4TMVA 3MD0A 4GOKA 3EPKA 3BRWD 1CR4A 2IYLD 4E07A 4LZZA 5UKDA 4B71A 1SVMA 4HAUA 2D74A 2IXGA 2ZE5A 1HH4A 4TL7A 2HXYA 2O8FB 4PFSA 2HYDA 2WSSA 3LBIA 2GCOA 4QJ5A 5CJPA 5JCPA 5EUQB 1TF5A 1II0A 4ZKDA 1WE2A 5DSZA 3GP8A 4MRSA 2EYQA 4AKEA 3Q85A 4RKEA 5IDVA 2AFIE 1E2QA 2QQ0A 4DWJA 2ZSFA 3DKVA 1E2KA 3RWOA 4DLUA 4F7WA 5J40A 2FOLA 2F43A 2NTYC 3BOSA 4EDHA 2GNOA 2QAJA 1HT1E 3GJ0A 3VMFA 2GK7A 3GCGA 2JIZA 2FH5B 5FPKA 1XD2A 4ZDWA 3OIYA 1RE0A 3AUXA 2ZYVX 4N0DA 4OJKA 1W36B 3EPJA 1XX6A 4QBIA 1IBRA 3OFND 4LHYA 1II9A 2VP5A 1QG4A 1RYHA 4RZ2A 1XD8A 4ZKEA 2VEDA 3H0KA 3G5UA 1DAKA 1KI9A 1OKKA 2OBNA 2XTMA 2IS4A 4HZUB 2GF9A 1KNQA 1XMVA 1J99A 1W4CA 2QGNA 2QP9X 4IDHA 4LJYA 1Z6GA 2C5LA 3U44B 5KHOC 3HU1A 1ZMXA 4YMUA 3TUZC 2V8OA 4PC6A 1DAEA 1ZD8A 3QOFA 3KKNA 5KYKA 2NMVA 1T5IA 1EFRD 4JLAA 4M22A 4PZZA 1G5TA 1P61B 4LRWA 4DSNA 1AS3A 4PHFA 4TMXA 2FPLA 1KO5A 3EC1A 2VP2A 2JJ1D 4I81A 3LH5A 3MSXA 4ZDKA 1GM5A 1FOEB 3OHMA 4DCUA 1AM4D 2CLCX 5FTLA 3IPYA 4QL3A 5EXXA 2B8TA 4GPTA 1JALA 4N3NA 3NEYA 3X1YA 4AYWA 5J4KA 2NOAA 1F2TB 1LB1B 2AR7A 4Q7LA 2HYIC 1A1VA 1QHYA 3E5HA 3QY0A 4KXFB 1X3SA 5DI3B 1XTKA 2JLZA 2IW3A 3JVVA 3OAAD 4OK6A 4QGFA 4DLWA 1ODFA 4LJ4A 3MWJA 1IOZA 4X8LA 4G1UC 3KX2A 2JJ8A 2QROA 4A6PA 1YZTA 2ZRKA 2F1RA 1PUJA 1Z83A 2CCKA 1U81A 1U99A 1NSFA 4M1SA 3TMKA 4M4SA 3VR5A 1KHTA 3CIOA 2H18A 1WQ1R 1XPRA 4LC1A 2LKCA 2AXNA 4A0HA 4WOPA 2XOKD 2ZE6A 5EE3A 3U4QA 2D2FA 1O3YA 3TAUA 3X1ZA 5FBVB 2K5UA 4MGZR 3RS2A 2ORVA 3KKMA 1IY1A 3TIFA 2ZRFA 3SDZA 3SZRA 2GILA 4PANA 4NCJA 3U61B 3TRFA 1R7RA 5CYOA 1IHUA 1D6JA 1FQKA 1JB1A 4HDCA 4RFVA 4E22A 3A1SA 2GVZC 3ZIAD 1WDTA 3W6OA 3PV0A 4LBVA 5L3QA 3SYKA 1ZP6A 3EZ9A 5FBQB 2HLDA 1DARA 3WHLA 1LS6A 3BXZA 2VSXA 4B3CA 1G4AE 3KUCA 4M1KA 1BYIA 4BQSA 2JLUA 2ORIA 5EP1A 3P32A 1H8EA 2ZR0A 1LTQA 1ESNA 1AQYA 1KO1A 2J0QA 2WKPA 1RJ9B 1S8FA 5FPSA 3T1QA 3X1XA 1G18A 2QRZA 4YONB 5EXPA 3ZZTA 1AS2A 2W6IA 2FGJA 1OFHA 3DKPA 3MWKA 2ZUBA 1OXVA 2A5GA 2YKGA 1NBME 4JKIA 5KNDA 3SHWA 2RGNA 3PXGA 1E32A 5EXSA 2D2EA 4AYXA 3EAQA 3U4QB 1BYUA 3MG9A 5EP4A 1MRSA 4A0FA 4G5RA 2CLSA 1ZUNB 2FX3A 3CF6R 2B92A 4LSGA 2B21A 4A36A 1TF7A 1U0JA 4POAA 3W6PA 2EWWA 2ZI6A 1R0ZA 2B8WA 3KJHA 1EGAA 4IOKA 4OHVA 2BCGY 3EARA 4R71A 4JSYA 2ZRDA 1MO6A 2XNDA 3L8YA 5CLQA 5BYJA 3T15A 3K0CC 1JJ7A 2W83A 2WTUA 1QDEA 2MSCB 4L9WA 2HLDD 5FOVA 2E9SA 5IK2D 5CIQA 1QHNA 2XZPA 2LWIA 2OCPA 2WJHA 4OI4A 4Q4AA 4CEIB 3K9NA 4ASUA 5KU1A 4ON9A 1T8TA 4Q7JB 4AG5A 1CJMA 4OHXA 4OQMA 3U3OA 3A6PC 1P2SA 2X2EA 1E9BA 4ZDJA 5K8UA 3R9IA 1NVXQ 1JQLB 2CK3D 2UZ3A 3T1VA 4HSEA 1TTTA 2OCYC 2MMGA 1ZNZA 2FN4A 4KVAA 4UNSA 3SOPA 1CF4A 1BH2A 1SVKA 1CJKC 2V1XA 2DFLA 3LVQE 1EWRA 3A4MA 3CRVA 2WICA 3RRNA 1KSFX 2OE2A 3DZ8A 4V0KA 3VX3A 4E5UA 1LV7A 3DO6A 3W3AA 2WWGA 1ESMA 3THYB 1KAGA 4KBGA 1L7VC 2UKDA 3AF2A 3QXCA 3ZVNA 4C0HA 5JS7A 3HYRA 3GLGB 4IDPA 1HURA 4Q1DA 1R8SA 1UKVY 1QG2A 3ZZUA 1A4RA 4ZDIA 1BKDR 3W9YA 2IX3A 4A92A 3LQQA 3VFDA 3C7KA 4FI3C 2AK2A 1KI2A 3K0SA 2WWHA 1CJVC 2FGKA 5EZ6B 4AKGA 3EZ6A 3TW4A 2QBYA 1CR0A 1VPLA 3LAWA 1RRCA 2WBLC 2G3YA 1LNZA 3LFUA 5TMPA 2AD5A 2I4IA 1N0UA 3IEVA 2QY9A 3QSYA 2WMOB 2YHSA 1G3IA 4B73A 2ZI3A 1U9IC 3EPLA 5H8WA 3EA0A 4BZQA 2DWPA 3C15C 2J41A 3REFA 2OAP1 4H1VA 1KKLA 5FR1A 2ZQ5A 2WWXA 4CT5A 4C7OB 1Z0DA 1SXJC 2KBFA 1R6BX 4XIGS 4TT3A 5L3VA 4U7DA 3TSOA 1Z22A 2QN6A 2ZUDA 3TVDA 3WYGA 2HJVA 2F9LA 1NY6A 1XEXA 3NEJA 4XVUA 4MITA 4NYMQ 5IK2A 2O8CB 3F8TA 3I32A 4TYQA 3FHCB 3GLHE 5F3WB 2FZLA 4A2WA 1XEFA 1KK3A 4C9BA 1LS1A 5DHFA 1RZ3A 1QRAA 3IILA 2ZPTX 5CB8A 2CK3A 1OH5A 4P4SB 3BGWA 1S1MA 2HF9A 3MLEA 1NVWQ 2IYQA 4DBLC 5TB5A 4RSGA 2XX3A 2IXEA 5CLLA 1G3QA 3EA5A 3Q9LA 1NN1A 2G77B 1C9KA 3OIWA 3VNVA 5LBIA 4K8OA 1E0JA 4BLQA 1J90A 3A37A 4HB4A 1G17A 2EW1A 3A4NA 4KV9A 3A58B 4B48A 5JWHA 5D3MA 2CHVA 3KL4A 4DHEA 2BOVA 2Q6TA 3AVYA 2P0EA 1NKSA 3EIQA 2VRWA 2ZSEA 3IEUA 3IO3A 3THXA 3WRXC 1E69A 2KSQA 3CH4B 1OH8A 1KI1A 4RD3A 1R5OA 4OK3A 5FL7D 1NJGA 5IHPA 4AY2A 2C78A 2BDTA 3W90A 3GLHA 3UANA 4FWIB 4UNRA 5FL3A 2F1IA 4HAZA 4BECA 5HCNA 2ZAOA 1NLYA 1SKQA 4M53A 3RANA 1XJQA 3VR3A 2ODWA 1MO3A 4TSFA 4HZIA 5AK0A 2GXSA 2JLSA 5JBQA 2VP9A 4RD2A 1E1RD 2QTFA 4JZKA 3UKDA 5P21A 3GLFE 1JPJA 1B0UA 4R7ZA 3E70C 4I99A 1KK1A 2YWFA 3BFVA 2ZAMA 3HYTA 3QXHA 2ZJOA 3QXJA 4JYBA 1QBKC 3BJIC 5BN3A 3D8BA 5D3QA 2ECKA 1KO4A 4JVSB 3W8NA 2YJTD 3QF7A 1TEVA 1O87A 4CDGA 3D6TB 1IXRC 1T0JB 1E3MA 3I5YA 3IHWA 1Q0UA 4CEIA 4IDOA 3FMOB 2AFHE 3N2EA 1I4DD 3UIEA 1W46A 5BN4A 1BOFA 3WBKA 4OI2A 5DI9A 3CX6A 5DIFA 2JLWA 1T6NA 1EFRA 1Z0FA 1AA3A 3D3QA 4B6EA 3RRYA 4CEHB 2FSFA 3VR4A 2IYYA 4WA7A 4XVQA 1KKMA 1KDRA 2CJWB 2H1LA 4IDNA 3AUYA 5L3RA 2J7KA 1KZGB 1V43A 3RRMA 3PEVA 2NIPA 4Q9KA 1U90A 1J70A 1YJ5A 1OXXK 4L15A 4ZO4A 5KO2A 1M2OB 1W5TA 4P4UA 1YKSA 2XB4A 2QT0A 5FPTA 1GP2A 2D7DA 4Z51A 1FX0A 1EESA 2BEKA 4A9AA 1W4AA 2QA5A 4UXHA 4HATA 4I4LA 4IEEA 1HV8A 4J0QA 2A5FA 1G7TA 3F3YA 1G3MA 1HE1C 2OXRA 1A7JA 3I1FA 3M6AA 2DR3A 3RS7A 1DAGA 3IIMA 3QKUA 1ZC3A 4Q19A 3TQFA 4DEYA 2GWHA 4URWR 1AN0A 3FDIA 1KO8A 3ZVRA 1MT0A 3NG1A 4PZYA 2N46A 2XZOA 1IJEA 5BWMA 3N70A 1RRGA 5JECA 3H86A 3AB3A 1EG7A 2WV9A 3GFPA 3QNUA 3ASZA 4KAXA 3CO5A 4D6PA 2FMXA 1UEJA 4DDTA 3THYA 3SBDA 4PC3A 5AJWA 3LWNA 4CGZA 3PITA 3ECCA 1N5JA 2G1JA 2PJRA 4C7OA 5FTJA 1KMHA 1U0HC 3REGA 2O8BB 1AS0A 5A5GA 4AYTA 2V1UA 4GZLA 4A8JB 4PQYA 1G3RA 2ZJAA 1PUIA 2FV8A 5H68A 4AK9A 5LB4A 4MGYR 3DPUA 3WHKA 1NL3A 1XEXB 1DADA 1SKYB 2MSDB 5EE5B 3NVAA 2EVWX 1UEIA 2J46A 1TQ6A 3BERA 1KNXA 4ESVA 2GEVA 2DHRA 2QI9C 4MH0R 5FBLB 3A8TA 1P2UA 1JECA 2ZEJA 4TQUS 1Z6AA 4XWAA 4F4JA 4LPKA 4BZXA 3R7WA 5C18A 3AVUA 3NC1C 3IKJA 2ZR7A 2FNAA 1XTRA 4DVGA 2XTNA 3GLFB 2ZS7A 3QEOA 4TN1A 2D62A 1MKYA 1ONBA 1YQTA 2PMKA 3TUIC 1IQPA 3G82C 1UBGA 1ZUIA 1R0YA 1ZCAA 3D31A 1E4YA 1R4AA 3RWMB 4QG7A 4H1UA 3NBFA 1AA9A 1EK0A 3WYFA 2JLVA 1T91A 1GRRA 1T3SA 2YWGA 3PR1A 1FL9A 2GRJA 4CRWB 4F4IA 2ZI7A 1LW7A 1KI3A 5SZHB 3WNBA 4BPBA 3SFVA 2C9CA 2HCBA 2DY1A 3TSZA 5JWOA 1PVOA 1Z3IX 3QKSA 2VHTA 1AK2A 3B6EA 2HV8A 1K5DA 3HR7A 5IT5A 2VLIA 2YC2C 4GBMA 4OHWA 1G8FA 2AHOA 1VYVA 1C1YA 4LX0A 3K0AB 3ZZ0A 1ZU4A 1OH7A 4PR0A 4TLAA 4Q66C 4UXIA 3T12A 4HAYA 3X2SA 1QHGA 3B78A 4TLDA 4EJSB 5AUPB 1XWIA 4LYFA 4JLMA 4MYUA 3FKSA 4ABYA 4CIDA 1SULA 2GAAA 1Z47A 1Q12A 4FD2A 1GILA 5CM8B 2GJ9A 4QJ3A 4ERNA 1G5PA 3K9GA 2N42A 1N5LA 1OT3A 2Z83A 1GL6A 5KSYA 3GLFA 2CLDX 4ASUD 1DO0A 4O2RA 1N5IA 4M1OA 1NN3A 1BMFA 4URVR 1IXSB 3LRPA 1XXHB 4B76A 1XZPA 1TADA 3H84A 1NLFA 3KQLA 4LBYA 4Y0VA 1JR3D 1E2GA 1CRQA 3ASYA 3QUSA 2JGNA 1NMZA 3B1XA 2CNWD 4BUJA 5GJBA 4G5GA 1XTQA 4N1AA 2FEMA 1N25A 1FFHA 3CRMA 1R2QA 4PSKA 2IYUA 4MKFA 1Q3TA 2YOGA 3ZS9A 1SGWA 2F6RA 1NIJA 3TGPA 3EZFA 4JBYA 2OM2A 4D26A 1TUIA 2BBSA 4NYIQ 3MAAC 4AC9A 4NH0A 3BAFA 3FTQA 4DCTA 4ACBA 3U7EB 2QTHA 3PUWA 1BO6A 1GNRA 2CJWA 1E2DA 1QVAA 2IS6A 1XMJA 2GESA 2IHBA 4S2EA 1GNPA 2QMHA 3EG5A 2OFWA 4HLDA 3PEWA 4HDQB 5FH9A 1KMQA 3QPVA 1GIAA 1CBUA 1FX0B 4E03A 2DYKA 5B2ZA 2R62A 2VSFA 3KKQA 3EW9A 3Q7PA 1N6OA 2A7QA 2QMEA 3R8CA 4KO8A 3I62A 3RS5A 5TV2A 2F3RA 5F2EA 2W0SA 2DFKB 4Z8XA 2NO6A 2VF8A 1CJUC 3T34A 1TNDA 2FU5C 4OQXA 5GADl 1PLKA 3G0HA 2WKQA 4NCKA 3A4LA 2ZI9A 2C96A 3GD7A 2CNWA 2REXB 2ZE8A 3HJNA 1R5BA 3W5JA 3I5XA 3NHAA 3OEED 5A4JA 2ZYWX 1XBTA 2J3EA 2RGGA 2FSHA 2DCUA 2R6FA 3NBXX 4DLTA 3B82A 4URZR 2QAGA 1VG9B 1XZQA 2JLRA 1LVGA 1XP8A 5FR2A 3C5CA 1BMFD 4RD0A 4U5XA 3HU3A 3GLHB 2C2HA 5G53C 3EC2A 2XSZA 4AIIA 1R0WA 5KPDA 1E1QA 1MABA 4IOMA 1Q3HA 4B47A 2BCJQ 4GMXA 2GEUA 5KPJA 3PUYA 3C41J 2O0KA 5TVKA 2GBLC 4O3MA 1UJ2A 1UBEA 1E9SA 1TUEA 4AWXA 2PBRA 2Q3MA 2W00A 4M9SA 4B3DA 5EZ5A 5CK4A 3EWSA 4PC2A 2OHFA 2AD1A 3LX5A 1X8KA 3V00A 4JVMA 5EP3A 3NC0C 3ONWA 2WVJA 4NKRA 2WZQA 4A15A 4PQFA 1PJRA 4X8OA 3WMGA 4AKIA 2BBTA 4B3FX 1Q20A 1S3SA 4I1UA 4PZLA 1KJWA 5BYKA 3B1VA 3OIVA 2HT1A 2KB0A 4WIAA 3AF0A 1D9ZA 1MV5A 1DAIA 1UF9A 3DVLA 2Q0HA 2IUUA 3UMRA 2V9PA 3AM1A 4Q4JB 1OIVA 5FPHA 4WAUA 1DG3A 3U3RA 3GJ4A 2ZVQX 5E7IA 4BEBA 5JI3E 3AQ4A 2V6IA 1VCOA 1YZQA 2GDJA 3THWB 5EP2A 2ZI5A 4M21A 2ATVA 3SS8A 3X1DA 3AVTA 4KJZA 2PL3A 1S96A 2ODNA 1G4UR 3NBYC 4BLOA 5CDFA 1FNMA 1KK0A 2H92A 1EFHA 1SXJA 2PZFA 1CR1A 4JYCA 2GEDA 2VHUA 2EFEB 3BE4A 1NSTA 5JJIA 4GRAA 3AP3A 5KDDA 1SVIA 3T1OA 2QUZA 2F43B 4O2LA 2O5VA 2GF0A 1U94A 3PIRA 2IYSA 2ZTSA 4LJ6A 2ZRCA 3QF4A 3SN6A 2ZJ5A 2GBLA 1XPUA 1P7CA 4NBSA 2ZJYA 1E96A 1A82A 2AK3A 4OHZA 1KJZA 4PHTA 2NZ8A 4DB4A 1ZD1A 4F92B 2OFXA 3QEJA 4CYMA 2GCOB 1KSJA 1AIPA 1ZW6A 3N5CA 5KDOA 2WPDD 3JZAA 3PVSA 4YLGA 1P9WA 2GETA 2IBMA 3WNDA 4IKEA 2ZRGA 4JLPA 5JFGA 4EPRA 3DM5A 4BWYA 2N1BA 1CU1A 1GWNA 4PO9A 1S4QA 3FE2A 4LPSA 2GA8A 4LV6A 2J7PD 4M1WA 3RSOA 4UXJA 4DXAA 1VKJA 4DDVA 5JS8A 1HE8B 1AZTA 1GG2A 3IO5A 5FUVA 3WBJA 3CR8A 4TTQA 1JEDA 2PX0A 3VX4A 3K9HA 4WBSA 2AWNA 5G3ZA 2OCBA 1GAJA 1VG1A 3A1UA 1UDWA 5B64A 1W4BA 1OF1A 4P4SA 4D4KA 2I1VB 2PZGA 3IQWA 4Q4HB 4X8HA 1NN5A 4I1VA 3VKWA 3VR1A 2A3RA 1NN0A 1E9AA 5FOSA 2G83A 5GJWC 1EX6A 5AUOB 4D82A 3CKLA
chains in the Genus database with same CATH superfamily
4NIMA 4WH0A 3JVUA 1H6DA 2LPMA 3L0CA 3SHTA 1OTYA 2UU9B 3RH0A 3H9BA 3B1YA 4ZOCA 3R7BA 5HEKA 5K0BA 3HBJA 1SUAA 1QCYA 2H06A 2LGJA 1V6CA 3R4VA 3UV3A 3F97A 4ER7A 2JI9A 3GRRA 1KSGA 3PUHA 3QA9A 1MXHA 5KBYA 5AVXA 5JLAA 3IXMA 4HMPA 2JRLA 4KMOA 4A0QA 4PS1A 3KZ1E 4F1JA 3T95A 4PZEA 3AG5A 5M29A 4CLRA 1KETA 2ORWA 3FKQA 3MHPA 3QOYA 2UUBB 1JEJA 4BRUA 1XZ8A 1V1JA 2VJAA 3HYNA 5JVDB 3D8HA 4DDUA 3RRBA 5EKUA 3W78A 2F1KA 1ZIDA 2LDBA 3E1SA 2CNBA 3OM8A 3QJYA 2X0DA 3K31A 1FP6A 3R09A 4OU5A 1TYCA 1X7YB 2J31A 5D7NA 4ZI7A 2AI3A 2GASA 4JB3A 2R65A 1B8UA 4BNZA 1WS6A 4IMRA 5DTIA 3IAFA 3DLPX 4XCVA 5JHHB 1F0KA 5AVZA 1P0QA 3NT4A 2GBFA 3IBYA 4URYR 4EKNB 2V7EA 4DV6B 1GKUB 3Q9UA 1T1RA 4LY3A 1ZDMA 3S27A 4B2YA 2X7HA 2ZUSA 1K5PA 4BQIA 4I5FA 1MOZA 1Z0KA 3F7TA 3NNDA 4A82A 1NQWA 1A9XB 2PGNA 1WB5A 3GUUA 1ZHHA 3O1HB 3WGQA 2VJQA 1FB5A 1CZUA 1RJ9A 3IP9A 3M6FA 3NDPA 1K8YB 3TL6A 4CMIA 1E2EA 3HNOA 4ENSA 1N5DA 1E2HA 4UM7A 3T9BA 3MXOA 4EA8A 3ZU4A 1HPLA 1SCKA 4S1VA 4PLHA 4WPGA 4EKDA 2P3QA 2BC9A 2J4CA 5INTA 3L4SO 3THRA 4ZYXA 3C1TA 4WLNA 4D96A 1BVUA 4ZYWA 3ZV7A 2FPKA 2B9EA 4IYRA 3IQXA 4BFWA 3PHJA 2Y1OA 4E4RA 2EQ5A 5CEFA 3V8MA 1CZKA 3JD2A 4KOEC 3KBOA 3CLRC 4KI0A 4BVAA 1N6RA 3G7UA 4JLKA 4YAGA 2WSIA 5HJ2A 1YSCA 3QVTA 3IR7A 5AOCA 2CWDA 5CG2A 3ZLUA 4FHEA 3HUDA 4WN9B 1C7FA 2ZSAA 4M60A 1FF9A 1GG8A 3UJ9A 2QMOA 2R1VB 2VRCD 3H83A 2GD2A 4F3TA 3VZPA 1QDLB 3ZTTA 3G7NA 4YV7A 5TGDA 1NF3A 2GM9A 2PEYA 4RW0A 1X80B 2MYUA 2PBLA 1GLVA 1YTLA 1PFWA 2O4UX 2R00A 3KZMA 3NTQA 4KCGA 5DB4A 4EG5A 1CQIA 1RJWA 1OZGA 1E99A 1P80A 3A9CA 4HLUC 3I39X 5TARA 1N3IA 3R3XA 1Q1ZA 2QZJA 3AY3A 3TS1A 1DIGA 2VP3A 1I8TA 3Q7RA 4KH0A 2AEEA 4ZYUA 5JJBA 2DHQA 2Y05A 2XQIA 3MBOA 3DE3X 3O26A 1BSVA 3AV0B 3KVVA 4BAGA 2C5SA 3O47A 3P94A 1ISHA 2FUG1 2QMUA 1F2UB 1U2GC 4MA5A 1QC5A 3CX7A 4ZXPA 2J9FA 3W0LB 4I5EA 1FFBA 2L2QA 3QBVA 4ILKA 4I4NA 3B7PA 4Q7EA 1W47A 3NX4A 2FW6A 4F3NA 1ANKA 2W90A 4BZPA 5IDQA 2J3IA 2WIAA 1AKYA 1SWWA 4JJ6A 1Y7PA 4EPTA 4LFBB 3VU3A 3GFBA 2YN4A 1FUUA 5B1DA 3IBTA 3GJYA 5KOYA 4UD6A 3JSXA 2BD0A 4MR8A 1ZKDA 2P9GA 4FUQA 1DC6A 1P4AA 1XZHA 2BM0A 3ZV4A 1Y5MA 5KNLA 2FVXA 2JI6A 2NO5A 3K8ZA 1TCAA 5JZSA 1F0NA 4JEIA 1HMPA 1LJUA 1Z4JA 4DEXA 1NW6A 2X0JA 3P2OA 1T13A 5DRYA 5CA1B 1TAHA 4MRPA 4RJLA 4YXWD 2D0OB 1YB4A 3EY4A 3AVOA 3KQTA 1J0BA 3H9UA 1Q17A 4LVNA 3ZBQA 2TYSB 3HO6A 3GJTA 3SC2A 4DA9A 2VDNB 5D87A 3E5MA 4REMA 5F4BA 2ZU0C 3BE6A 1BU5A 1T0PA 5HKOA 5HKKD 1M74A 5EKSA 3RARA 3P4UA 1HE2A 4J07A 2RSLA 3B7GA 1E5QA 2HXSA 5T8KA 4FQ5A 5ITZB 1FEZA 3ZWKA 3IVRA 1CR2A 1BJKA 2R00C 3OCWA 3CUWA 1ILEA 1K3FA 3VHXA 3AUUA 2C3MA 1ILWA 5DYYA 1RYDA 3FWPA 3LD9A 2UVDA 4EL0A 4BX9A 4MPDA 3LLVA 1K2VN 1AK1A 4OB6A 2H07A 1PJ8A 3OEHA 3WA6A 2C9ZA 3BL8A 4XWWA 1RAAA 3AEYA 4H1WA 3DB1A 3AEQA 2ZSHA 1C3JA 1KC1A 4UUOA 2HDNB 2NYUA 4GFDA 3CH6A 4P98A 4E6PA 4Y6LA 2P5SA 1TRHA 2QXYA 1PUXA 1UXKA 1RRMA 5B12A 4N7JA 4AY4A 1HYQA 3C0KA 1VB5A 1UBLS 2NX2A 1UFVA 5TX7A 1UKAA 3GJXC 1WX1A 1E1LA 5JNSA 1DRUA 4P0QB 3WB9A 4B4DA 1DOZA 1ZIYA 1KI8A 2B8NA 4QTZA 4QWMA 3VBCA 1P1BA 1KTVA 4WINA 1HOXA 4DDMA 3AGPA 3V4VB 3D64A 3L0OA 1NQVA 4ZYZA 1GTJ1 1DX9A 1UP4A 4X9XA 3TSWA 4DV5B 1SAYA 4TWRA 2G67A 3U9TA 3AF5A 4NP6A 2CCGA 2V6MA 4REQB 1JHOA 1I1QB 2WMDA 2YMLA 3GJ6A 2PVCA 4XWGA 4CV3A 4WGFA 4PIMA 1FU4A 1Z5NA 2PGIA 4HNAA 3V1YA 3GDOA 5BXYA 2PTHA 1EFDN 3KZVA 1VYUA 4UE3S 4E7PA 2GAFA 1GAXA 1D04A 1G8AA 2RH9B 2EGGA 2EZUA 4AW9A 2VUSA 2GJKA 4X24A 5K6TA 4ALJA 4XEHA 3Q7TA 1DELA 1EQUA 4JL6A 5AW2A 1SUDA 4L16A 2Q28A 3BMOA 4EM6A 1E6KA 4BP9A 2HQ1A 3EXFB 3GEMA 4RBNA 3UC9A 3QX9A 1H2ZA 2OV4A 1OI4A 3PCXA 1JSCA 1RZUA 3V8QA 1V2GA 1Q21A 1SOUA 3M6MD 4PIPA 4U2EA 4UUAA 5ARDA 5JJLA 1K06A 2DSTA 3SLGA 4OHFA 2EFGA 2JBWA 2FFBA 2GEJA 4NDAA 4JUBA 3MWLA 2RHJA 2HBRA 2B4TO 2B25A 4ZVUA 4HAOA 3NM4A 1G20E 1PWZA 5BQPA 3ZHVA 1N34B 1MQSA 1ODIA 2VYVA 2PT5A 2H51A 3K92A 3F46A 3WDMA 2OBYA 2NYVA 1A97A 3N0RA 4KQ1A 4QEDA 4A5SA 4BNUA 4YLYA 1NI4B 1C50A 4NZMA 4ZQFA 4Q1AA 1ZA2A 2V45A 5KSOA 1RKXA 5I7FA 2YKPA 4L5IA 3KPJA 1KHHA 2CGEA 1GPDG 4XTCS 2HEGA 5AUQA 4QKQA 3I2GA 3G2PA 3ORFA 1P45A 4PX2A 1UPAA 3VR5D 3QV1A 4GMFA 4DQVA 1FC0A 5JZMA 4LSZA 5AVUA 1ZGAA 2FN8A 5D85A 1B43A 1GEGA 4J8PA 2X8BA 3O8QB 4C0QC 1XK7A 2VPPA 1N32B 2OCGA 1L7PA 2W2LA 1A69A 4GPAA 1HLFA 2WIJA 2GFHA 4DBVO 3UHPA 3H7AA 2NADA 3E3OA 4HD8A 2Y71A 3H9CA 2RHWA 1KRHA 2NGRA 3H19A 3DQQA 4YRJA 1F5SA 4H0FA 4EF4A 4BGDA 3GYBA 3ROTA 1QYVA 1GNVA 1QMGA 3U0VA 2CKMA 3GA5A 1WCYA 3DNFA 4KYTA 3TR0A 1PJ3A 1D9XA 1VXOA 4ETIA 4TTJA 3O91A 4GWLA 2Z57A 3CF2A 1T3HA 4QPZA 2GN1A 3VO8A 4CPDA 4M1MA 1I94B 1K92A 3NV9A 1MT3A 1W0KD 2X0IA 3BBPA 3GZTB 821PA 1JJVA 3GY0A 3L93A 1HDXA 4LNAA 4R7TA 5EIBC 4YIHA 4ZAYA 2OVFA 3KIPA 5JQGA 4JV5B 2EZTA 4MI1A 5F1PA 3PUXA 3FVVA 2QQEA 3HFGA 4BKQA 3N39C 2ZRLA 1MVLA 2JRCA 2J0UB 4FGKA 4V0QA 4EZEA 1CY6A 1QH0A 4PPQA 3F6EX 1FSSA 2VP0A 1KQPA 5BQXA 5BV1A 1TQ2A 5I4BA 5E6UB 5FOUA 5COAA 3KQYA 1OHHA 1M6NA 1DKRA 2HGSA 5EHNA 4C30A 4XWKA 2XE8A 1YL7A 1FLDA 5K8CA 1ULUA 3M9LA 2V9ZA 1Y5IA 2A0WA 1N2JA 2DQKA 2EFCB 4MPRA 4GP6A 2O8EB 1G5IA 1ZEJA 1DXOA 1WLYA 1DBWA 3CZMA 1EKXA 4C06A 1G60A 3BCSA 3R3ZA 1EWTA 5CIWA 5DJ5A 1U8FO 4BHTA 1T1SA 3FYTA 4OIMA 1EE2A 4GVXA 2JAWA 4P8RA 3KJIA 3SJBA 1N6KA 1NOJA 2GERA 3ETEA 5JRZA 2WOOA 1TL7C 3LQFA 3J81A 4F5DA 5I9BA 1L5ZA 2O7VA 4AD8A 3AEQB 4KR9A 4C87A 1XRNA 2E49A 3QBTA 3V1KA 1G291 3S3TA 4W5JA 5HFAA 1ZISA 2A0XA 2X3UA 3PXUA 3PHGA 5HR5A 2AMLA 1DPFA 1NVBA 2TECE 3NH6A 4L6AA 2QN9A 3UCFA 1PJ2A 2DP4E 2VWHA 3VKUA 1NMQA 5JSFA 3CVWA 4B7UA 3BEOA 5EYPA 5HCIA 3AHHA 1RVDA 1T3TA 3NTUA 1W48A 2WUFA 1YHNA 2C98A 1ZJYA 2O5CA 4C89A 2Z5GA 5DCLA 2QW0X 3BWDD 3TZ6A 3W7BA 4E32A 4YAEA 1SG9A 4M9XA 1WXHA 4IHAA 4MUGA 3B2EA 3HSKA 4DC9A 4LFAB 3EF0A 2B99A 4Y0AA 1BMQA 5JANA 1KXZA 5DNVA 3CVOA 4N3BA 3RSHA 5CITA 2ABWA 4IS3A 1RWWA 1NVTA 3MCUA 5J3JA 4NCBA 4PINA 1S2MA 2D1FA 3R3HA 2YR0A 1Y9EA 3S55A 3A11A 4LJKA 4JL8A 1JEYB 1VDZA 2QENA 3JYHA 1MAUA 3O8RA 1PJAA 2IGTA 4WI1A 4C2UA 3CKYA 2FMHA 1YFZA 2OCLA 3ANMA 3AT1A 3GAFA 3L7BA 4NS1A 4BMXA 2PKCA 2QJTA 4WCDA 4BB9A 4CI0B 2IKSA 4K9DA 3OAAA 1ML4A 2XWJI 3V97A 1KOGA 3L04A 3P9IA 1NURA 4KXQA 1ZGJA 1Z2EA 4PCAA 3CSSA 4TM8A 5E8RA 4GGPA 4JLJA 1Z29A 1DBIA 4B84A 5B7GA 1WSWA 4XJXA 5DHRA 3DF7A 3P7MA 4IQ0A 2XDAA 3OH8A 1KVTA 3PFHA 5I47A 1V95A 1V5FA 1KJ9A 3NM6B 3KHTA 5DYWA 1CQJB 4GGMX 4HEQA 2J3KA 1EFKA 2NG1A 2RGAA 2EX4A 1DFIA 3WQQA 5DN6A 1NVGA 3DXYA 3HVKA 3VKVA 4TUYB 2LCFA 1H8HD 1O96B 2A4MA 4LN1A 4Q05A 3TTVA 1C9MA 4A2PA 4DG5A 5B36A 1NW3A 2O19A 3OF5A 1YNSA 1GKIA 3IPAA 4HYTA 3TGLA 5CCXA 2QPOA 1YQDA 2QTTA 1SHJA 4HFJA 3IIJA 3P9ZA 3G8BA 5SY4A 2WFMA 5H02A 3K1YA 3V3TA 2J08A 1HX7A 2H3HA 2JJQA 1XXHA 4C14A 4MV3A 4ARAA 4FWTA 4G3XA 2PJZA 4UBIA 3AOEA 2VHJA 1YH3A 2WY2D 2IOYA 1SG6A 2I3ZA 1H2RS 2JFXA 2TMGA 4QYIA 2YV3A 3E9QA 1M6HA 4ZIRB 1GU7A 2CV1A 2WF9A 1JHDA 4L5CA 4HWPA 4RTRA 5T41A 2I67A 1E3QA 3K15A 2A9PA 4BMOB 5T67A 2OCIA 3CBGA 4D44A 1NT4A 2XMBA 3GLQA 4IL5A 5EIAA 1YVEI 1RJFA 1NWHA 4AUKA 1XDWA 3WR5A 3GL9A 3GQBA 4B4WA 3LP6A 1P72A 2X8LA 2OBXA 3RSQA 3F8SA 2O2JA 4H9GA 4I1PA 1S4MA 2PX3A 1NBMA 4UDYX 1T2CA 2OR3A 1Q57A 3IKLA 3FNEA 3PNQA 4IXNA 4LK3A 5EQDA 1G7CA 1WSAA 2FLKA 1BTOA 1HDGO 3NT5A 4O4JA 3ABQB 3F78A 2HRDA 2YVQA 4JWKA 5IBRA 1XZGA 3WTBA 4LBZA 2BGKA 2OBFA 4HGRA 3KXPA 1DTWA 3J81k 3GRZA 2EIHA 4M9ZA 3VM6A 1MAAA 3OX4A 4MV6A 4JI7B 3TB6A 1X87A 3R9XB 2Q9CA 4LI3X 4QTXA 4DMRA 2PANA 1E2FA 1Z6PA 1BE6A 5HM6A 2ZYDA 4L72A 5T4HA 4QGGA 2F8MA 2OO5C 2HQBA 3GFVA 4RH0A 3KKOA 1KERA 2W2VA 4E2ZA 5F1YA 5EA2A 4TYNA 1ULBA 4NZ9A 2W8ZA 5DNAA 1Q7RA 3RC2A 3CJQA 3D6UA 1IATA 4REQA 2OQIA 2F90A 1KARA 3HVHA 3O2QB 4LY6A 1SKYE 5KAPA 4BO2A 3PHLA 4LG1A 3OQIA 1U1CA 3PXEA 3ZVKA 3OQVA 3AOEC 5CRIA 3E53A 1COWD 1A2OA 2PQ2A 3O8NA 5CH5A 1RXSA 4Y9TA 1AKEA 2JA2A 2JIRA 2HIHA 4BV2A 1IWOA 4LZLA 3OEYA 2X2PA 2CL7X 1KDVA 2BFAA 5BSUA 3EGXA 3T3HA 2NYAA 4A03A 4Z53A 1XDDA 4NMWA 2WFAA 3RRJA 4NOMA 3UXHA 2RHDA 2JZOA 2YBEA 2B2NA 1D0SA 1PR2A 1BJTA 3C1UA 2Q2VA 3CLTD 3GGJA 2B8JA 3QWFA 4PC1A 5CGZA 5DNUA 4X6UA 1T26A 4J0FA 4BNFA 1BN6A 5C2JB 4LJ8A 2BDUA 1JB9A 3TJZA 4G4JA 3R0JA 2B1JA 3KVOA 4PVDA 4KUGA 1Z16A 4BLTA 3MUNA 2FFJA 1FSGA 2JCYA 2AB0A 1V11B 4XX0A 4XRGA 5BMVA 4GT1A 2XVYA 5HS4A 1QU3A 3PZRA 3U7HB 5E3JA 1OLSA 1Z7EA 3RQSA 3R9XA 2Z9CA 3QXSA 3W2TA 2QRKA 3T3NA 1YT5A 3C16C 3W4IA 1N6HA 2QB5A 3D8SA 4L4ZA 3WICA 3R44A 1F0YA 5PNTA 3TLJA 2QM8A 3L01A 4NULA 4Q1VA 3L6CA 3PEYA 4D3SA 4ZYTA 4OFWA 3K72B 1W1IA 1ZXLA 4KXMA 3TZKA 4E4TA 5CBPB 3HJFA 3P9PA 4MTCA 3IAXA 4N6GA 3HU2A 4R9SA 4CCAA 3EXEB 5AM2A 4YV0A 4IIJF 5AFSA 3OE7A 1DDGA 2JVKA 3DMRA 2I4TA 2L17A 3F4BA 3G5MA 4JR2A 3HYLA 2R5FA 4CI9A 2Q9UA 2DFTA 2BKEA 1Q7BA 3RF6A 4YJ3B 4C4ZA 2HJGA 1TFRA 2RE8A 3C3WA 3O8QA 4ZRMA 4JI0B 2WG1A 5IZCC 5AVJA 3O3MB 2CBGA 4Z4EA 3MCTA 4NNPA 1A4XA 3I34X 4BLVA 5JYEA 2PGAA 1EBBA 3CF4A 1YBHA 4RMJA 3LW8A 3ZE0B 3ZYCA 2GM4A 2GVDC 1LX6A 1JPNA 3GEEA 4F96A 1CZOA 4HQFA 1I7LA 2O1XA 5ALLA 2ADMA 1MX5A 1MR3F 3S70A 2JIQA 2YXLA 2IHNA 1OE0A 4IY1A 1NTOA 5IBPA 4AUNA 4DV4B 1L4BA 2AJBA 2QTVB 3IMKA 3W8FA 4ZJUA 1KBZA 3JAKB 1Z8DA 1AKWA 1O96A 4WHMA 2R7MA 4YACA 3BA6A 3U49A 3K16A 1XA0A 2PV7A 4L0MA 4E1BA 4IIJB 4MLDA 2CVQA 4RFSB 3WGZA 2RKOA 1O9GA 3FPCA 5C5EA 4ZT5A 5JPIA 3LKZA 3PX2A 2ZB7A 2AC2A 4KYIB 4OJTA 5K99A 1SXQA 2JASA 1WOMA 5A4MS 2WF8A 4GE3A 3U26A 4D4LA 3T5TA 3KUUA 4L5JA 6REQA 2CC2A 3AM5A 5EOVA 1TGYA 3KS9A 4M0MA 1JKJB 3DZDA 5SZIA 3DTVA 4QDUA 3UMJA 4KE7A 4BO7A 5LXTF 2H7VA 3OIUA 4C3ZA 2R6DA 2PH1A 5EAIA 1CQZA 1VBKA 4OKSA 1Y6FA 4AROA 1SHUX 1YI8A 3AKCA 1H2HA 1PS0A 1Q0ZA 3G2QA 4HR7A 4XCXA 5BMVF 1EUDB 4FLFA 2O8NA 1DFGA 5TEVA 1PSWA 2Z4RA 1NZJA 2HUPA 2WPNA 4K9PA 1ZOLA 2JW5A 4MS3B 1Z34A 1I4OA 4Q4AB 5IVHA 1M8PA 1S6YA 2LRHA 2PWAA 3PDIB 2XYRA 3RGWS 1JR4A 2WWFA 3G1WA 4DSTA 1QRUA 3A7EA 4KE8A 1NW5A 2IHKA 1LLCA 3DAPA 5K6AC 1JAZA 1XI2A 5KQGA 2GF2A 3JQAD 1C1XA 2PX2A 4RVHA 3TD2A 4MUIA 4ZVVA 1NRIA 1XV5A 3O3NB 4MDFA 3AHCA 3COVA 1WG8A 3BH0A 4URUR 4CHTA 5CDUA 3PF9A 4GKKB 1GG5A 4RHFA 3ZU5A 1GT6A 1I2BA 5F7OA 1U1EA 3OMWA 2FF7A 4IWNA 2QN7A 4YAIA 3ZLJA 4YCSA 2NZWA 1ZM7A 5HYVA 4H08A 4P36A 3HN6A 3STTA 1E3WB 1OFTA 3EH2A 4GMKA 1LBQA 4Y2TA 5CJ2A 1FSPA 4PR3A 1PZNA 2FQXA 1GKYA 2OO3A 3K0FB 5C9ZA 1QIHA 1MFZA 3K05A 4M0DA 4AJ2A 2VA9A 5BSHA 5HGJA 3R6GA 6REQB 4C07A 4DCVA 4C76A 4UVEA 1N6NA 1H4QA 1M7GA 4ZTZB 1FDSA 1M2EA 1M8JA 4KQGA 2ISCA 2P2CA 4I5IA 3OCXA 4FEGA 3V46A 3V4SA 1OC2A 4IJQA 5HKAA 5CX4A 1AZLA 3LG2A 3VPCA 1NULA 2VT3A 5F9FA 1P5FA 1OXTA 2R97A 1U9YA 2RAVA 4L08A 4B6SA 1R9MA 3K70D 2EJTA 2IHUA 1W49A 3E6AA 4IKPA 4GW3A 3UCEA 4LF5B 1NLZA 4RCZA 3REQA 3N0WA 2BRUA 3EIXA 4LE0A 4PSVA 3WRYC 4CCYB 1PEYA 3C7TA 3CUEF 1J2EA 4OBBA 1NBIA 2P2GA 1HDYA 3BSFA 1W4RA 3A7DA 4O33A 4IFBA 2O8CA 3SP1A 3Q98A 4CFYA 3M3DA 5JLJA 4IXMA 2RGNC 3IV9A 4FP9A 3FM9A 1Q7GA 5ECYA 3T99A 3IDOA 3C1AA 5BVHB 2BHRA 2JIPA 4O5OA 4UREA 4F86A 5KTKA 5AMXA 1CCWA 3I4FA 1R88A 3C3MA 4HBGA 3RSGA 4TTTS 3OI7A 4KW7A 4IH4A 3L7CA 2EV9A 2JAOA 4YK7A 4LI0A 4W5WA 2WP0A 1J42A 5CDGA 4ZVRA 4HXYA 4EPVA 2R2AA 3L43A 4QFDA 1REQA 3GLTA 5LZ4A 1ZD9A 1AE1A 3LNCA 1P5JA 1DOHA 3AF1A 3QWHA 1KRWA 1P39A 1T9KA 1W25A 4WXMA 1U1GA 5JFTA 1CUYA 2H7YA 3OY7A 1VCNA 4OMDA 2A88A 1IJFA 3VU9B 4Y30A 3M1AA 3MJTA 5DWQA 4DSUA 1OFVA 3W4JA 2ZRAA 1Z6YA 3I2HA 5HHTA 4UKDA 5HF6A 2MT9A 1EDOA 2OLJA 3D0KA 3T7EA 3ZN2A 3R5JA 2X4DA 3DMDA 2C5EA 3D4PA 3H1GA 2FQWA 2H29A 3D5EA 1D03A 1P7WA 1ZIOA 3HP7A 2SKEA 4KVGA 4XDHA 5DSXA 1XQ1A 3KR2A 4BASA 4BX8A 3DF9A 2AA3A 3HJAA 2XRMA 3REQB 4LA4A 2UYHA 2DFNA 2RGDA 2X13A 3O8DA 1I1OA 3R6TA 3CM0A 4DIBA 4KQMA 3URMA 1HZZC 3AUJB 2FF5A 2NAPA 1XJ5A 4G01B 3DONA 3HV0A 4L0QA 2IV2X 4GUAA 5DX1A 3DGFC 3G2IA 2WQ7A 3TQCA 3LXMA 4MI6A 4KQXA 3MXTA 5LZ2A 3EVBA 1S5PA 2QN2A 5AJYA 4DJFC 1DEKA 3L1HA 4P9NA 4MMXB 1IBKB 2ZBVA 2AFRA 4QLAA 1YE8A 1BXRA 1RYMA 1OLXA 1MJFA 2B4QA 1VHDA 3EXAA 1YF3A 4LOKA 5JTTA 3UMFA 2RGUA 1T9ZA 1QTRA 1YZNA 2QRNA 2YBDA 3VV3A 4AMZA 1QHHA 1LU9A 1Y0BA 3WO1A 1GITA 1UOOA 2PEZA 3IQHX 4XM2A 4P3YA 5JNUA 2NXWA 2C7PA 2XNKA 1R15A 2DBZA 3N2LA 1MF7A 3L82B 3MTQA 3KU4A 3M8KA 1L1RA 1RHKA 3BK1A 4FEAA 1LKZA 4XWOA 3E8SA 2HI0A 1WMDA 2ECOA 3FR7A 9LDBA 5BNTA 3M0EA 2I1WA 1G5RA 3QPUA 4QHSA 2JFYA 4RS3A 3TWOA 4BTEA 3IP1A 4F6RA 1JG4A 1YO6A 3IUQA 2Q9BA 2OL4A 4RK6A 1VPVA 3BIXA 4LRXA 3T5GA 5JWRA 4LJLA 4LOJA 1UXHA 3BKWA 4KO4S 3O8LA 4WZAE 5TPWB 3WWEA 3PBKA 4PZPA 3N86A 1AB6A 5A2GA 4HTAA 3I09A 3BH6A 3HCDA 4I8XA 4DLVA 4ZPXA 4MDEA 1E64A 1L8XA 4RVFA 4GBGA 2X86A 3D3EA 1J5XA 1HZZA 3G0BA 3EJ6A 1P4JA 3AM4A 3B2QA 3HB4X 3HFJA 1EX7A 2FOIA 4MW7A 4YP7A 3AW9A 5H82A 4DWVA 4UTVA 4R16A 4YUAA 2BZ0A 2I91A 3QTBA 3CSDA 2WWVD 1W2GA 1BFDA 3GNSA 1CY8A 2QSZA 2BGJA 2FWAA 4C22A 3G88A 3CR7A 3ORQA 1SU8A 5EQTA 2ZLBA 4Y2GA 5LQRA 3AXTA 5FTNA 2OXFA 4NAVA 1E98A 1XCMA 3VYVA 2FDXA 3WL4A 3ENVA 3IE0A 3QELB 2VBCA 4XIFA 3TQHA 5EJ6A 1FUKA 2FZ4A 2WWWA 3KE8A 5KQLA 5CB4A 2Z09A 1AO0A 2AXEA 4MJ7A 2JGIA 5EZQA 3PHIA 1S2OA 1YQWA 1R4NB 1NXPA 1NUTA 4IH1A 5HBRA 4YTEA 3GFTA 3TINA 2E4ZA 5ITSA 3G8CA 3NH9A 3ZDZB 2YWBA 2FE4A 5LD2B 5DM2A 1SCNE 4EF5A 1ADGA 1WHTA 1WBBA 5KC8A 4TV9A 4GLOA 3E22B 5IM4F 2UYGA 2POCA 1EE1A 3RF7A 1P18A 3IDSA 2YIVX 4JWTA 1RXCA 4DDWA 1SXJD 2I54A 4YJ2F 1XT6A 1HDIA 1VPDA 1E8NA 1YRQA 3EZ2A 2ZRIA 2M2IA 3GLIA 1G9SA 3L0ZA 4EG4A 4AY3A 1AXRA 2Z9DA 4GL2A 2H57A 2A4KA 1WCIA 1V26A 1C29B 3A26A 4X64B 4CIYA 1WUIS 2YIDA 4QOSA 5CCDA 3O8CA 3LUFA 1G98A 1VIVA 2ZVPX 2C88A 4GOND 1ADYA 1ADFA 1M1YA 1R4ZA 2QN8A 3AYZB 3VDXA 4OMCA 5AHRA 3M81A 1J7KA 2F55A 3EDRA 2YWHA 3O0DA 3VPBA 4D4IA 2QD5A 4R3WA 4TMKA 4ZQBA 3TIGA 1VRCA 4H4DA 1N77A 4HUQB 4M0UA 5BWBA 1LQ2A 1L5NA 3SR3A 1EVJA 2JNWA 1I1NA 1US8A 1T10A 1TZMA 3MJVA 1Q16A 3VSDA 2OAGA 4FDLA 1BD3A 4QGBA 3Q3JB 4MV5A 1Z56C 1GQSA 4TT8A 5JMPA 1N3BA 1P3JA 1R1DA 2ESRA 2LP4Y 3W2IA 4B3BA 3R9WA 4RPHA 2IP1A 4CF4A 1XXHE 1Z8NA 2W2TA 3M4ZA 1HK7A 4P4TA 1FSFA 1BEEA 2D1SA 3CZQA 3D6JA 4LRTB 4Q39A 2G76A 4JHLA 1Z2DA 1H2AS 3KQQA 1IY2A 1KVQA 4KUHA 4Y2RA 3VYRB 5LQSA 5IWCA 2E7ZA 3W5HA 1PDVA 5ALIA 1GG9A 3IRUA 4L5BA 1HEUA 3QKRA 4LCEA 4KXNA 6AT1A 2IYNA 2NU6B 1JU9A 2BFBA 4MTLA 5KNCH 1YBAA 2ATXA 4MLZA 4EIWA 2JLYA 1ODKA 9ABPA 3UHOA 2XDWA 2BIFA 2DULA 5IKMA 2B1IA 1MAVA 2MINB 2RAUA 3NQ41 4K9NA 1DEOA 2FEWB 2JAHA 5E4JA 2IPOA 2FP4B 1G2PA 1N2GA 4NE9A 2B8EA 1KIFA 2EXXA 2HLPA 1JUDA 4HG2A 3R9KA 4EPWA 5LP6F 1WZNA 1DL5A 3NWPA 1G8YA 2HPZA 4FMPA 3NOQA 3RG2A 4AX4A 3DT9A 2Q99A 3IUBA 1D2CA 1IN8A 1U3WA 4F9EA 4HNVA 1KP9A 3BMNA 3FZQA 4QBHA 4P0PB 2C4MA 5BSKA 1GZ3A 4NFSA 3RUDA 1KDYA 1T8UA 4F72A 1P2TA 2UYYA 3O7MA 1E6WA 1W85A 3GJRA 4WZZA 3FOBA 1UWLA 1SUSA 5G1OA 1WOYA 3ON5A 4GXRA 2D13A 3DMNA 1KE2A 2GFQA 3C6XA 1HUQA 4JNCA 4Q7MB 3ZJVA 4HLCA 2K87A 2ZZNA 2CL5A 4IGFA 4B3HA 1IVSA 4K46A 4C21A 3LZCA 3T52A 6Q21A 4CIBA 1BW9A 2CXSA 4TMZA 2NVUB 4KPGA 1N3YA 1T5LA 4LKOA 1ELOA 3KAJA 5B55A 3B1ZA 2VHQA 4GSKA 4JA0A 1F20A 1N0VC 1FK8A 2B35A 4EAAA 3SICE 4C2TA 3SC6A 1QYIA 3BICA 3IEPA 5D8DA 3ZU2A 3LSYA 3VNBA 2XUKA 3Q72A 1CYEA 2QNRA 5DM1A 4Z9FA 4DIKA 2A6PA 4F0JA 5BYBA 4O4HA 3RAPR 3ZG6A 2QN3A 3RODA 1UBKS 2XH8A 4WMLA 3GNLA 2VPYA 4OQEA 3L7MA 2Y1DA 3NATA 2JIMA 1SBIA 3RVMA 1Y7IA 3RD5A 2FPRA 3DFFA 4CDNA 2R8PA 5FWAA 3O9VA 4LHWA 4EF6A 3ILXA 1F6BA 2ZKIA 2ORYA 2VNAA 1SCAA 3A06A 3L9WA 4FFDA 1T5SA 2R4QA 4MCAA 3GBPA 1QO0A 4KEAA 3KQUA 5HDBB 1F8YA 4JKYA 1HNXB 3FN4A 5JCZA 2EBFX 4E2WA 1N1GA 4JUCA 4ESEA 2A30A 5MF6A 5C8XA 4KLCA 3CX8A 1LQUA 1Z4KA 1I14A 3RIMA 1K8XB 1KDPA 1VTKA 5EQJB 1GDDA 2WPDA 3QX7A 2RHGB 1PNOA 1J4AA 1HL3A 1M73E 2W37A 3BWMA 3IAM1 1QORA 3IDFA 4EJFA 4QG3A 6YASA 3KQKA 2X22A 3PF8A 1XRMA 3I8SA 2HJSA 3M1IA 4RVDA 5EJ2A 4EG6A 2O8BA 1SB8A 4YP5A 4S0XA 4IVPA 4O63O 1PR4A 3ROFA 1RBMA 3ZWBA 2FG6C 5EMLA 4HQLA 1EZ1A 2RJOA 5L3SB 1HTBA 4KSBA 3LWDA 5FI1B 4BP8A 5I3CA 4NEGA 3ICCA 3R3WA 1SZDA 2I66A 4GAEA 4B1FA 2VT7A 2GEKA 4XWTA 2UYCA 5EMHA 2QK4A 2P1DA 4IVRA 3D59A 2IKQA 1XSEA 2OAEA 5CNJA 3G8YA 2DGDA 2YFKA 5FDFA 3HSYA 4RKRA 2J0SA 1GUFA 2H4WA 3P27A 5KJFA 3H05A 4WSOA 3PFCA 1MAHA 4G5HA 3O8OA 3FWYA 4X65B 1L4KA 1WXWA 4R81A 5KB3A 3KUKA 3NRBA 4KRFA 2QP3A 2VF7A 1L7MA 4PPYA 3LOQA 1J9GA 2ZBDA 3OE7D 1B14A 3R20A 4D3FA 4D3YA 2Y9MB 2IYZA 2O7SA 3C70A 5D2CA 5H4GA 1E1DA 1Z15A 1RACA 2G5PA 3OX2A 4B0OA 4J7UA 3U3JA 2XCUA 2NV2B 1E1MA 3MMXA 1PQWA 4JUFA 4WJKB 3K9FC 1JG3A 1HBJA 2O8FA 3OUZA 1E7SA 3V1LA 4AY5A 5LOVF 2BRUC 2YZGA 2IH4A 4KKXB 5JD3A 4DMMA 1IN7A 1R9JA 4GWGA 4TKZA 1YC2A 4BFVA 3ER8A 2HRCA 4JT9A 4LY9A 4J9UE 3ET5A 3RVSA 1JDZA 1GV1A 4IDCA 5C5IA 3JQ6A 2YKQA 3AL2A 1VQ1A 1GGHA 5BSGA 3KPYA 2I62A 4FBMA 4FCWA 4KAJA 3ZHXA 2PIDA 5CJJA 1F1BA 5CH3A 2VOJA 4OHOA 4CL3A 3QX3A 4F9TA 2AS0A 2Y1XA 2HJHA 2QJOA 4DANA 3WWPA 2DBQA 2FVYA 1E0KA 2W2XA 3FIUA 1JNXX 1I7PA 4K1XA 4I5DA 3TE7A 1ZONA 4F9GA 3GUCA 3AUSA 2OFPA 1YB6A 2H08A 4ITRC 2TSYB 1LPPA 2NPIA 4MYHA 1Y4ZA 5HVNA 5JAMA 2EEPA 2ZB2A 3ZYZA 7GPBA 2CHQA 3Q10A 4QDJA 1BS1A 4JOQA 3PQ2A 4R7GA 2RC6A 4G24A 1BRTA 1WBDA 4OXKA 4LTNA 2ETXA 4NZYA 2HPAA 3HEAA 4PO8A 1TM3E 4CV2A 1U02A 2FOXA 4URFA 5DN6D 3CX4A 2PHZA 3ADKA 5KX5F 3DTVD 3WGYA 3FUTA 5LQMA 4C4TA 3QENA 3FDZB 2YFHA 3MN1A 3HPQA 3NOOA 3GG2A 4OA8A 4DMKA 2GPYA 1CY2A 1XC7A 2AOUB 1SVLA 2HHAA 2VK8A 2MJLA 3NVMB 3ZWAA 2JH8A 4YROA 4ZOLA 2W4MA 4K2HA 3ODGA 2EDCA 1QDUA 2XVXA 3PPIA 4YUVA 2VZLA 3MCWA 1V8OA 3OCZA 3OX1A 4RZIA 5J43A 3OJWA 4WFQA 1P6QA 1UKEA 1ARZA 4BVHA 4DCNA 3PXCX 1JTFA 4JBWA 5AJVB 1ZH8A 3LMKA 2VAMA 3LP5A 1E18A 4EO4A 2KE5A 1V1MA 1N7HA 4RPCA 1AQ6A 1B8NA 1R4MA 1RWPA 4OSEA 2VK2A 4JSTA 3BXGA 3N8HA 1UH5A 5TPWA 1BGXT 1DUSA 2H5JA 4BRWA 2WG0A 2IYTA 1A95A 5E2AA 1FMCA 3M2TA 2J6CA 5D6OA 1D2RA 4TYYA 3ADOA 5IHXA 3GLGE 3DTTA 1ZZGA 4V1CA 4DABA 4PAWA 3E27A 1RI2A 1WPRA 4EYSA 3UPTA 2OC9A 3V1MA 1SUPA 4U02A 3JASA 2EOAA 4NZPA 1QLWA 3C14C 2QAIA 4P34A 3B51X 5EUCA 5AD1A 5ERXA 2I2BA 2R3SA 4DNOA 1BDMA 2UUOA 4B44A 2QZ4A 1B0AA 2QX8A 4FKZA 1JDBB 1CQWA 4ZT4A 4H4CA 3PE3A 2J6BA 1A2QA 1DBVO 1GUDA 3IDQA 4FIZA 4EHKA 1GFIA 3K96A 1JILA 2REBA 3QYFA 4PG6A 2UUPA 1UKZA 5CNIA 4BO1A 4UNQA 4BFYA 1JN0A 1PGOA 4JS0A 1U7UA 2DUMA 2Y8EA 4KDFA 4LYAA 2E6KA 1M2WA 2ZJZA 2FDCA 4NZNA 3F73A 1XZDA 2RAFA 3KSBC 1QM5A 1RQXA 3NUQA