2ODNA

Msreca-datp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
310
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 83
structure length 310
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2odnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2odnA01
4O2RA 2J9RA 2AR7A 5JJIA 1MKYA 2OEPA 2IA5A 4FCTA 3T5DA 3TR0A 2PEZA 1ZINA 2JLSA 4O2LA 3A1SA 1R0ZA 3CIOA 1OE0A 1NIJA 4RCZA 1XWIA 3T1VA 4UJ5A 2QZ4A 4ASUA 3U7GA 1P62B 1XMVA 3NWJA 4CT5A 1G8HA 1VCOA 4BLOA 1PV4A 3HPRA 3JZMA 3M4YA 4BZQA 5JHGB 3VKWA 1DAKA 1G20E 1QBKC 4EQ6A 1Q0UA 1XEFA 3LRPA 3M6AA 1SXJC 2A5JA 1CJVC 2VYFA 2HXYA 1WDTA 4TSFA 5J5CA 2H17A 2VTKA 4HLQB 1CJTC 4EQ6B 4HLUA 2CCGA 2JLYA 3L8YA 1HEIA 3U4QA 2VO1A 4D0LB 3PXGA 1XP8A 4A2WA 2F6RA 4RD4A 4YXWD 2YOHA 1TUIA 3WHLA 3TBKA 1TQ4A 4IOLA 3TUJC 2WIAA 3NKVA 1RIFA 4KSCA 2B92A 4Q9IA 2PEYA 3NXSA 5C2JB 1XZPA 3QBTA 1F2UA 1BOFA 4EFNA 4MGKR 4M53A 2ATXA 1S9DA 4FMCF 4IEEA 1SHKA 4B35A 1K8RA 2VEDA 2ZVPX 3NG1A 4DLUA 1UDWA 4PX9A 1F2UB 4LV6A 2BJWA 1II8B 3THOA 3X1WA 1E2QA 1UFQA 2P6RA 4G1UC 1G8YA 2AWOA 5TDHA 1IN6A 1IONA 2O0HA 1HV8A 5JCZA 1YRBA 2VRWA 1Z29A 1KI2A 4ZV4A 3AVQA 2IYRA 4HYYA 4Q9LA 3TAUA 5J40A 1JXMA 1RYFA 1UBCA 2PCLA 2R6AA 2YV5A 1J7KA 1Q12A 3CX6A 1EWQA 2F9MA 1W0KD 3RRNA 5B30A 4LC0A 3L43A 4DXAA 2IYZA 2L0XA 3KKMA 4TZ0A 2CVFA 3OIYA 3L0IB 3JVVA 3RC8A 2J0QA 4DLZA 1KDOA 2JDID 3T1QA 2JJ8A 3BGWA 1P2UA 3DOEA 5JRZA 2XZOA 4RD3A 3LO5A 4C7OA 5KOYA 3GJ5A 1OF1A 4PQYA 2ZSEA 1TAGA 4PO1A 3BH0A 3BIFA 2WAXA 4AG5A 4C7OB 5CB6A 2VBCA 3F3YA 1DBSA 3V4FA 3L0SA 2IUTA 4CZ2A 5ANRB 3IIMA 3QVVA 2EVWX 4URVR 4XWOA 2ZM5A 3EPKA 3EPLA 4DKXA 2QMHA 4PFSA 3D8BA 4XTCS 4CYMA 1ZC4A 2ZR0A 4TYPA 1QHYA 2MMCA 3CONA 3LH5A 2W58A 1WMSA 2HF9A 2FSFA 3A1VA 3A1UA 2HCJB 2KI5A 3O8DA 2ZQ5A 1Q44A 3CNLA 1FQJA 3J81k 1G1MA 3A58B 3NVAA 1OHHD 3BB4A 3Q7PA 2AWNA 2CHGA 4OK3A 5F2EA 1KTVA 2G1KA 3RS4A 1J90A 5JHHB 3AKYA 2XOKD 1LTQA 1O3YA 1KSGA 1MT0A 3W9YA 1W7AA 3I73A 1P73A 1DAFA 1G291 3LBHA 4F91B 2AFIE 3B13B 4HAXA 2VSFA 5LD2B 3SOPA 4ZIRA 1ZIOA 2ZYTX 4PZZA 3N5CA 4V02A 5EZ5A 2C77A 1Z5ZA 4GFDA 2BEJA 1W5TA 2GRJA 3LV8A 4FIDA 4ZIRB 3HYRA 1WBDA 4QL3A 3VNVA 3GJ3A 5FOSA 1EFRD 3FKSA 1JR3A 4QHYA 3IKJA 3TW8B 5FBLB 2CL0X 3U2QA 1FP6A 4KFRA 5H70A 2ZSDA 2EFHB 5DHAA 1CR0A 5DNYB 4Q4JB 4RD6A 1Z0AA 4IVRA 1E2GA 5FPTA 1N0WA 5GJCA 4LJYA 2QG6A 3RWOA 2IYQA 2OCYC 2GZAA 2H1LA 1XRJA 1CS4C 3IO5A 4MRPA 2QRNA 4BGDA 1NG1A 2REBA 5KTYA 3EPJA 1NVWQ 2KB0A 2ZRMA 1ZMXA 4AD8A 2BWJA 3CF0A 2FZLA 5EP2A 1RJ9A 1U9IA 1XXHE 2EQBA 1DAIA 4PO8A 1N2CE 5BW8A 4P4UA 2PX0A 3I72A 3NHAA 1FFHA 4FMDB 4TL9A 2ORWA 1GP2A 3W8NA 1Z28A 2FPMA 2WM9B 4JLKA 5JRJA 1ZU4A 5E4FA 1E9CA 2J1LA 5CIWA 1RJ9B 2IS6A 4EFLA 4L9SA 4OHZA 5B57C 2CJWA 3Q72A 4KU4A 4B3DA 1G7TA 1N0VC 4FD2A 4Z1MD 2I3BA 1OKKD 3TMKA 1GFIA 1YR6A 2XGJA 2CJWB 4DIDA 1UKZA 4JLBA 2AL7A 2JCSA 5AJWA 4ABYA 3RWMB 1JECA 3RYTC 4TWZA 3WNCA 5KDLA 1RW4A 2BHRA 2W2XA 3D7MA 4XD7D 4B34A 2EWWA 3VX4A 1PZNA 3RS0A 4D2IA 2HLDD 4QGAA 1SVMA 1ZRHA 4PXAA 3MMPA 5JS8A 1I2MA 2EFCB 5DN6D 1GUAA 1KKLA 1ZUHA 2NOAA 5JLJA 1Z47A 4C0JA 3FMPB 1UM8A 4WZAE 3RRZA 3R7WA 5F3WB 2KE5A 5DI3A 1GWNA 4CEIA 1TPZA 2ANBA 1NIPA 3DDCA 4JLOA 5J4LA 4OHVA 4YQFA 5K8UA 4IVPA 3CH5A 4RCYA 5KDOA 1PLLA 3BERA 3R7WB 3EARA 4M1WA 3KX2A 1NY6A 3NBYC 4ZDWA 2Q9CA 3DKVA 3FMFA 1JEEA 2D7CA 2WPDD 5EE1A 1G19A 1KSJA 3IUYA 4GBMA 4TMVA 3OFNA 1ESNA 221PA 2G88A 2OCAA 2XAUA 2IHBA 1OYYA 4QBHA 4ESVA 1ZC3A 1YJ5A 3DZ8A 1WE2A 3THWA 2KWIA 1NSTA 2EWVA 4HB4A 1C9KA 4IDHA 4R2IA 3OIWA 1XEWX 2NMVA 4QC2A 3THWB 5JJLA 3CO5A 1TU4A 3AF4A 2Q0HA 1E2MA 4LI0A 1JNYA 2O0KA 3IIJA 1TX4B 2GKSA 3GLFE 4PHTA 4MITA 3I8SA 2FOLA 2ZRPA 2CVHA 1P75A 2Z4SA 1IN7A 3L8ZA 2YWGA 1KYIA 2MMGA 5CM8B 5F9HA 5JWOA 4C0AC 4F4CA 4LPSA 1Z0FA 1Z6AA 4RD2A 4TLBA 1DPFA 4PR0A 1W4RA 1AN0A 4NE2A 1L4UA 2VLIA 4Q4HA 4A8JC 3WMEA 1RRPA 2QENA 3KQNA 1E9AA 1VYUA 3LWNA 1PVOA 4A6XA 1NBMA 2WWIA 2EFEB 2B8TA 4Q4HB 2V7QD 3K0SA 4PAOA 1VG0B 3K70C 3SNHA 4UNRA 2YOGA 2F3TA 3SQWA 4IFBA 2IS2A 3LLMA 3U7EB 1UPTA 3ZQJA 3FYHA 2GESA 2GK7A 4G01B 1YZTA 3MWYW 2BMJA 3NH6A 3LAWA 1OPXA 2OBNA 1ONBA 2BOVA 4C0HA 5AJVB 1D9ZA 3R8FA 4XSGA 2W6IA 4B2IA 1BIFA 5DYGA 1JBKA 2QI9C 4FINA 5EJEA 3KKNA 5DIFA 1Q1EA 3B1ZA 3KL4A 3RS3A 3RABA 3BC1A 4DVGA 3X1YA 1K5GA 5AJZA 2WZQA 2C9CA 2WTUA 2QE7D 3KXIA 1KK3A 1KZGB 3PEUA 1QHHA 1G7CA 2ZRLA 4IKEA 2PMDA 1T8TA 1Z0JA 4EKDA 2AK3A 3UKDA 1YR7A 1QG4A 1YZLA 1J2JA 1QHHB 5L3RA 3OAAD 3PENA 1JQLB 3B5JA 1FMLA 4DLVA 5FPSA 2W0SA 3W8RA 4TL6A 4LHYA 1P2VA 4XWAA 4IDQA 2J41A 4NDZA 3KDSE 4US1R 2XEXA 4NH0A 2QRZA 3K0FA 4QGFA 1G7SA 3L82B 2AN9A 4LJ7A 2FDCA 5AWFC 1TF2A 4JJZA 421PA 1LVGA 3ICQB 5IK2D 1G6OA 1BYUA 1AQYA 3K0FB 4YMUA 2FF7A 1C4OA 3EW9A 4FI3C 4FXPA 2GILA 4Q4AA 3VMFA 2ZJ2A 1WRBA 2CLCX 4PQFA 2BIFA 2WWFA 1FX0A 5DLQC 2IXGA 4KFUA 4Q4AB 4M0LA 2XSZA 1ZP6A 4UJ3A 3M0EA 2RCNA 4X8HA 2JJ2A 2FE4A 2WIBA 4JLDA 1T3SA 4EPTA 5GVSA 1AJEA 4PO9A 2QAGC 4PPNA 1FX0B 1HT2E 4BUJA 2ZPTX 3EIEA 2Q6TA 4C0SA 3E70C 2QSZA 3SDZA 4DRZA 2WSSA 1QHGA 2VHQA 4ZKDA 4GRAA 4NONA 3NBXX 3QENA 3QE0A 4JKIA 1XMJA 1NJGA 2C9YA 4US0R 2GXQA 1P9NA 2NPFA 3CF6R 5ELXA 1HA3A 4GMDA 2JIZA 2OFWA 3SHFA 3SFVA 1CLUA 4V0NA 5GJWC 1ZCAA 2CLSA 4D4JA 1Z8FA 4PC7A 4G5SA 5LBIA 4P31A 3W34A 3ADDA 1R6BX 4LPKA 2A5YB 3BFKA 3UPUA 3FMOB 2V6JA 3TSZA 1XCMA 1KAOA 2BJVA 1P6XA 1PUIA 4B76A 3MG9A 3ND8A 4CEHA 2ZRBA 4H1VA 3W90A 2EFGA 1WB9A 5DSZA 1NVXQ 5LB2A 4DZZA 3QVUA 2C2HA 3W3ZB 1KO1A 1TEXA 1AIPA 3GJ8A 4EDHA 4CEHB 1T91A 1V5WA 4EJSA 3ZS9A 4W5HA 1KNXA 2XX3A 2CBZA 4JVSB 2SHKA 3K9HA 2OAP1 1U94A 3IPYA 3W6PA 5H8WA 3IIKA 5EXTA 4OHYA 3RSLA 4EJSB 3C15C 5CM9C 1S1CA 1KI3A 2QP3A 2RKOA 3MCAA 3SU8A 4AURA 1HQCA 2OE2A 2O52A 1D8TA 4C9BA 3VNUA 1P5ZB 4DCSA 5JCPA 2GJKA 4QM7A 3ZGXA 2CCKA 1E79A 4E5UA 3ZDQA 1QF9A 3PCRB 3KKQA 1GL9B 3L2OB 3Q85A 4Y0AA 1DTSA 1CTQA 1NMZA 1ZM2A 3RRYA 5JJKA 1X6VA 5EE3A 3E5HA 3BORA 4QGHA 1SULA 1ZNWA 4GZMA 2FFQA 2A5FA 3AUYA 3LX8A 2GZHA 3LD9A 3P20A 1U99A 2J3EA 4QGGA 2RGXA 1PUJA 1E2EA 2ZU6A 5CJ2A 3RS2A 2FNAA 3IILA 2V6IA 3ZLJA 3UG6A 2ZRNA 5LD2C 2OILA 1E4YA 1U90A 4HZUA 5AUNB 2QY9A 2FSIA 3M1IA 4DDWA 4GI7A 2BBOA 4NP6A 4Q03A 5JWHA 4Q21A 4LJ8A 3PQCA 4TMXA 4PC2A 4MDEA 2ZRIA 4HZUB 1XD9A 4M1KA 4BFVA 4K81B 4AKGA 2GF0A 4GL2A 1GDDA 3X1DA 2CE2X 4R9UC 4TT3A 1VIAA 1CJMA 2J5XA 2YNMA 5FBQB 4Q19A 3ND9A 3NDBB 1LY1A 2XJ9A 2VP0A 3RNLA 3CLVA 5FOWA 1GILA 3C14C 2R8RA 3LX5A 3IO3A 3WNBA 5M04A 2WJJA 2IS4A 1EK0A 2ZJAA 2CHQA 2GJAA 3CX7A 4RY2A 1E0AA 2P6NA 3V00A 1T0HB 4Z51A 5IF9A 4P3YA 4F4JA 4MQBA 4K8OA 4JZKA 1U0LA 2WJGA 2BEKA 5DH9A 4R98A 4BZXA 1KOFA 3OEED 5E7MA 2J87A 3VKHA 2JJ1D 3SYKA 5G41A 1X1SA 3VQTA 2JASA 1U9IC 1JJVA 4BFXA 4Q1EA 1W4CA 1G6HA 2ZAMA 3RAPR 2G1JA 5TB5A 1I4LD 2WJIA 4HUQA 1KAGA 2P2LA 1R5OA 2V8OA 1E2PA 1FUKA 3QUSA 4B47A 1L2TA 4QJ4A 1GKYA 2QU8A 5FH9A 1MO3A 3HPQA 4YMTA 4HUQB 1NKSA 4LV5B 1EX6A 1X1RA 1R5NA 4R2HA 2I1QA 2ERXA 2WWHA 5CYOA 4ZPXA 4GPTA 2IC5A 3Q8XB 1BYIA 2RGEA 5HCNA 1H8HD 2J7PD 2ZYUX 3QXHA 2IYVA 2CK3A 1RVDA 3NBFA 4PSKA 2HCBA 2D4HA 1Q57A 2W0MA 3NIBA 1F48A 3HR7A 3OE7D 4AI6A 2DPXA 2JA1A 3CRQA 4S2EA 4HB2A 3WP0A 1YU9A 4LBWA 4UNQA 3B1VA 3GFPA 2QQ0A 3EASA 3SJZA 3KJEA 2YC2C 4U5XA 4LY6A 5BQ5A 3DOFA 4LBVA 1Z6XA 2OSBA 4BZPA 5BWMA 4B2PA 1E2HA 3CM0A 4JLJA 3TUIC 1Q1QA 1YR9A 4NL4H 3K70B 3P4XA 4RZ2A 1R2QA 4BFYA 2R6GA 1HURA 1G3UA 2NO1A 2ZTSA 4JIMA 5HE9A 4B3XA 3TIFA 3CZQA 2QPOA 1S3SA 4MH0R 3CX8A 5KHOC 1CEEA 1XXHA 3QPVA 1I2DA 1HH4A 4QHTA 3CRW1 3ADKA 4OI2A 5C46F 5CDFE 3NH9A 3RVBA 2R65A 3PIRA 4PHGA 1G3RA 2WWXA 4PAMA 3Q7QA 1XXHB 1T6NA 2BMDA 2NIPA 3T35A 1JR6A 3H84A 5HE8A 4GOXA 4BASA 1AM4D 1QHSA 3GLHE 1FP7A 2ONJA 5EUMA 4DLYA 1YRAA 2ZYWX 3QEOA 1W1WA 1A7JA 2VP2A 4N0DA 3BFVA 4M1OA 3BH6A 1J70A 1XBTA 3AKDA 1G64A 5EP4A 3SS8A 4CW7A 4CF7A 4I1OA 2WJHA 2DFNA 3B1XA 2J0VA 1UKEA 3AM1A 1AK2A 3X1XA 5B58C 2GDJA 5JBQA 1G3MA 2V1UA 1JXOA 4BRUA 3TSOA 3I32A 1OIXA 3O8CA 4QBGB 1FTSA 4NMMA 4KV9A 1SKYE 4IEIA 5LDDC 3AF1A 3ZZTA 1XCGB 1CP2A 1EFCA 1XTIA 3FHTA 4GMXA 5L8VA 3K0EA 2BVNA 1EFHA 3PEVA 3U5ZB 1O87A 5J4VA 4H9GA 2OLJA 1CULC 4OI4A 2PLRA 1P9RA 4BLTA 2PMKA 4X8LA 3ETLA 4B75A 2C8VA 4I1UA 1XJ0A 1JQJC 3VAAA 1BS1A 4AK9A 3AF0A 1QVRA 5FBWB 2GCPA 1R8SA 2CNWD 2OV2A 1W44A 3AF2A 5BN5A 1Z08A 1W46A 2FN4A 2GJ9A 2BM1A 3K1JA 2DCUA 1ZU5A 1SZPA 2XTNA 4ILEA 4NPHA 1LF5A 4E03A 4LHVA 1U2RA 2OM2A 5DGXA 2IUSA 2QAGA 2Q21A 2V1XA 3VTKA 1W0JD 3EZ6A 3N2IA 2D74A 2MSDB 1ZNZA 1Z0KA 5GJBA 1II8A 2QAGB 1JB1A 4OQFA 1Z83A 2I1VB 4A0RA 4BEJA 4MKFA 3K9NA 5P21A 3GJXC 3I4LA 1H8EA 4B74A 4OL0A 1N3BA 1R0XA 4IXMA 1CBUA 1M6NA 4XJXA 4TLDA 3TGPA 3LW8A 3EWSA 3MFYA 1CU1A 4QJ3A 621PA 5C1BA 1E1RD 2ZS8A 2QGZA 3QEJA 1B0UA 4IVQA 4AY2A 1MRNA 2GEDA 3U3JA 1KO4A 1E6CA 4PAQA 1Z2AA 3ADCA 1KK0A 1NN5A 1U81A 2GJ8A 4K46A 4LV8B 2W83A 5JS7A 2C5LA 4D81A 1YQTA 4YMWA 3GLFB 2C9OA 4IHQA 2FMXA 1M8PA 1G21E 2HYDA 2QEQA 3P4YA 4OK6A 1IBRA 4M2LA 1VYTA 2NZ8A 4DB2A 1CXZA 4GP7A 4A9AA 3ZVMA 1E32A 5HZKA 1RRCA 1UDXA 2ZRKA 1YZUA 4LBYA 1VDZA 3WRYC 1YZNA 2IF2A 1LF0A 4OJKA 3AQ4A 1XEWY 2ZE6A 5G3YA 1SVSA 2GCNA 1FNMA 4BRWA 3QXCA 1K6MA 1A4RA 1NMXA 1ZNYA 4DBLC 3SR0A 1G16A 3B7GA 1XTSA 2F1JA 4ERNA 2DWQA 5DN6A 3RANA 2GBLA 3E1SA 2P0EA 1ZM3A 1VCMA 4EAQA 3CR7A 1XDBA 3FHCB 4E22A 1JPJA 4DLXA 4KI0A 2Z4RA 1NSFA 1JI0A 4HATA 4OKSA 1HE1C 4A0GA 4DLRA 1QHIA 3OZXA 1GG2A 5AK0A 2RGAA 3HYTA 2GZDA 4F38A 1IN5A 1YVDA 1C1YA 3IPXA 4Q47A 2QAJA 3FE2A 2H16A 4JBYA 1E9BA 4KXFB 1GL6A 1CIPA 1BMFD 1KI1A 4CVNA 2NO7A 4BFZA 4C0QC 2WSMA 4C3ZA 4KITB 1KI4A 3TAHA 1W48A 3AVYA 4PPFA 2KSQA 3GJ4A 2QMOA 1W36C 4Q4JA 5L3QA 4QBIA 3MJHA 3GLGE 4CEJA 1IY2A 3KUCA 4MKGA 1VKJA 4HDQB 4JSTA 2JAQA 5FL7A 4TSFD 3EX7C 1M7GA 1E1QD 2PZGA 3QPUA 2ZI4A 3QJYA 5L3QB 5E95A 5IRCD 2BDTA 1QHNA 1WXQA 4EJSC 2C78A 4CEJB 2XXAB 5KSYA 3LDAA 4AKIA 3BXZA 3QSYA 2O8CA 5JSZA 2DFTA 4UNSA 2GVZC 3CPJB 4O25A 2FPKA 3HU3A 4NCKA 3RLFA 4TLEA 5E3HA 1DO0A 2O5VA 1EESA 3IEVA 2VL7A 1G8FA 2ATVA 5JSZB 2FWRA 1OIVA 2O8CB 1X8JA 3KJIA 1OYWA 2ZR9A 1E2IA 2G3YA 1W4AA 1GRNA 2RB4A 3AEZA 1ZM9A 2W00A 4Q7MB 1E3MA 5JMTA 3I1FA 2G0TA 4Q66C 4Q7JB 4KYUA 4B2LA 4LWZA 2NTYC 4NCNA 2GNOA 2PJRA 4J0QA 5FTLA 1BH2A 2YKGA 4H1UA 3BK7A 8OHMA 5E7IA 2P67A 2IXEA 1KI7A 2FU5C 4LC1A 3U61B 3K53A 4RJLA 1IAQA 4U02A 3V9PA 3W6OA 1EGAA 2IYUA 1NKTA 2NZJA 5FOUA 1TU3A 5FBRB 1MH1A 4YONB 4L8GA 5J47A 1A5TA 4W9MC 2CXXA 3U3RA 4MYTA 4URXR 1ZD8A 2ZROA 4HAZA 4E07A 5FPKA 5GADl 3ZZUA 1KI6A 2OCBA 2WKPA 4DJTA 4AKEA 5CK4A 5TXGA 1VHTA 1Z6GA 3KFXA 5AUOB 5K8TA 1PJRA 2D2FA 1KI6B 3CRMA 4TYQA 4QG7A 1NN1A 2AXPA 4DEYA 2LCFA 3AP1A 4BLQA 2ZUCA 1RRFA 1N6RA 3OAAA 4IDPA 1XD8A 4V0ME 5KDDA 1JJ7A 1OB5A 3TUZC 3R9XA 4YMVA 2RAPA 1M74A 2X2EA 1NMYA 2R9VA 2P5SA 721PA 3LLUA 3R9IA 4A0FA 2GEUA 5DISB 3RS5A 3THXA 4TYWA 1XTKA 5FI1B 1S96A 1L7VC 2PCJA 4RFSA 1W2HA 4JLAA 2R6CA 1G4AE 4Q48A 2IWRA 1ZD9A 2X77A 3THXB 2QUZA 4A92A 3NC0C 2ZVQX 1DOAA 4RFSB 3I5YA 1P2SA 4WA7A 1ZBDA 1GNPA 1U98A 3KB2A 1X3SA 1D5CA 4GP6A 2R2AA 4RKEA 3PEYA 2PX3A 1IOZA 3VKGA 4B33A 2YC4C 4LRWA 4BECA 4DDTA 1PLKA 3O8BA 3U3OA 2Q9BA 3Q3JB 3UANA 1MV5A 1R0YA 2ZSFA 1VG8A 4RZUA 4WZBE 5FTNA 3GD7A 2IYLD 1KKMA 3ONWA 4PC3A 3WHKA 2WV9A 1XPRA 3FPAA 4JKYA 3HWSA 1YZGA 2D06A 1DELA 1KK2A 3FKSD 1OXTA 3OIVA 2X2FA 4URYR 4F4IA 5TV2A 4QKQA 1K5DA 1A82A 1Z22A 2YWFA 1MO6A 3D31A 1RC8A 3A1TA 2FEMA 1YR8A 4LHXA 3AP2A 2VHTA 2W6JD 5FOVA 5F9FA 1Q22A 2F3RA 4IDNA 4EPWA 3QBVA 2XB2A 1IM2A 4JYBA 2ZIAA 4IDOA 1UJ2A 4BPBA 1N0UA 3N2EA 5L3SA 5A4JA 5AUQA 2MSEB 1P2TA 2VF7A 3GMTA 3EG5A 2WBLC 3LQRA 4M1MA 3I92A 4M1SA 3SBDA 1VMAA 1GNRA 6Q21A 5L3SB 5TY0A 2F1RA 4DSOA 4TYYA 1E2DA 3QKSA 1R4AA 3W3AA 3ZD6A 3O47A 4FMDF 5FR2A 1YZKA 4N1AA 1OFTA 4D0GA 3ZVLA 1DS6A 2IXFA 1DAMA 1DVRA 4AIIA 3QKSB 3EC1A 2C96A 1XFAA 3NEJA 4BLPA 4LDJA 2O8FA 1I4TD 1J8YF 2MSCB 2Z5FA 1F60A 3IHLA 2X19A 4NCJA 3QXXA 2QORA 4US2R 3GJ6A 1KDRA 1UKVY 3CRRA 1NLZA 1NL3A 2O8FB 2VQSA 4RD1A 1Z07A 1MRSA 3K8YA 3QG5A 1COWA 2HDNB 3DMNA 4LHWA 1G5TA 4C30A 2PT7A 5EXPA 3KUDA 2ZREA 1MR3F 1QHXA 3LW7A 1KMQA 2ZI5A 3T5GA 3I62A 1G3IA 1T5IA 3MSXA 2F1IA 2FH5B 2ZUBA 3E2IA 2QTHA 1E2JA 4JT2A 1Y63A 5FPYA 1E2NA 1IY1A 2GXSA 1ZD1A 3U6BA 3D6TB 4TLCA 4PANA 2GJSA 4PSAA 3LVQE 1XX6A 2IYWA 1XNJA 5GVRA 4IOKA 1HYQA 1VYVA 3GJ7A 3I3SR 3MUFA 4XOIA 4FMBB 3OFND 5SZKB 3SBEA 4HB0A 1SVKA 3QQ5A 2ZU0C 1Q3TA 1Q1ZA 3ASYA 3EZ7A 2TMKA 2AD1A 4A0HA 1X8LA 2J45A 5FPHA 1KY3A 4D80A 3NTUA 3WYAA 2CEAA 2JLQA 1Y3AA 3CKLA 4GT1A 5FL7D 4ACBA 1T4GA 2BC9A 3VHLB 4DHEA 2PZEA 1KMHB 1XCPA 3ECCA 1JPNA 5CDFA 2BBSA 4Q9KA 2G9NA 2OO7A 2QMEA 4P0TA 3PFIA 2VSOA 2G77B 1G8PA 2CMKA 5LPNA 2IYXA 2W2VA 3P27A 4F93B 1XTQA 3K9LA 2JLXA 4YMSA 1GAJA 2RGGA 2J46A 3MGCA 1TL7C 5A0FA 3FFAA 1RRGA 3OEHD 4LYHA 3C8UA 2Z0MA 3THYA 1RKBA 2EU8A 3GLHB 1TMKA 2OBMA 1JAHA 3CUEF 4TMWA 1XTRA 2C99A 1SXJD 4PPGA 4D82A 3THYB 1T8UA 5EE5B 1W36B 2JGNA 2GCOA 4IOJA 1UEJA 5KNCA 3MAAC 3KTAB 1MO5A 3QI2A 1YE8A 4HEJA 4URUR 5CK5A 4A2QA 1NBMD 4ARZB 2GCOB 1SKYB 2AKYA 2O8DA 1DG3A 2IEYA 3UATA 1OW3B 4M4SA 2IW3A 2J0UA 3EPHA 5EXXA 3H0KA 1OH8A 2ZI7A 2NQ2C 1CJUC 2A2ZA 4FCWA 4W5JA 1XF9A 2O8DB 5LB4A 4F7WA 2IF0A 4V0OA 3B6EA 1XTJA 2J0UB 2GXAA 1D9XA 1HE8B 1E96A 4QNRA 3BWDD 3ASZA 2XNSA 1SKQA 3ZJYA 2GBLC 5JWRA 2AFHE 1SGWA 4DEXA 3GEIA 4Q1CA 1LS1A 4TLAA 3WBKA 3TRFA 2W6ID 4L15A 3Q5DA 4DUGD 2ZR7A 4HI0E 3WXMA 4BFSA 4GSYA 2F43A 4MYHA 3QNUA 4WXRA 2HEIA 3PUXA 4B43A 1KY2A 2GEVA 2E1RA 3C41J 2F43B 2Q3FA 1II9A 3H2YA 2PBRA 4GOJA 2KBEA 2V54A 3BS4A 4B3CA 4C0BA 2JATA 2LKDA 2I4IA 3CW2A 1NG9A 1E0JA 1NJFA 3EXAA 4UQOA 5KPJA 2H5EA 4M1YA 2G6BA 3HR8A 1UBFA 5GJVC 4UKDA 3QXSA 1GVNB 3VU9A 3B82A 2A5GA 2WMNB 1YKSA 1QG2A 2WKQA 4LJ4A 3TW4A 3A36A 3VR2A 5AJXA 3W6NA 5KSZA 3R8CA 1VCNA 3VU9B 1G4UR 2K5UA 1FL9A 4W5WA 2V55B 3B60A 4NU0A 5CB8A 2WMOB 4QHSA 4EPRA 3PG5A 1N6PA 3BOSA 1E2KA 1VPLA 3K0AA 3L0PA 4GNKA 4QJ5A 1SXJE 4QXAA 4YDSA 5EP1A 5EUQB 2V9PA 3GCGA 1IQPA 2WOJA 4U7DA 2XSZD 3AVOA 4KVGA 4KAXA 3K0AB 1AQUA 2JJ2D 3V4RA 3F5FA 4A15A 4ACAA 4DC9A 4OJQA 4LOAA 2VPPA 4JT4A 3ZVRA 1KK1A 4G5RA 3KKOA 2WSSD 1N6NA 3W5JA 3O8RA 4X8OA 2ERYA 1P3JA 2QTVB 3REFA 1E2LA 2BBWA 3MWJA 1W2GA 3G0HA 2IL1A 1F5NA 2VF8A 4QBFA 3IQWA 2NO9A 4JL6A 4OQMA 3RSOA 2VHUA 2NO0A 1R10A 1M2OB 1WCV1 2JIZD 2ORIA 2XB4A 4L9WA 4YXWA 4DLSA 4Q1AA 1GKUB 1QRAA 1J99A 3GP8A 4WAUA 2AHOA 5KNBA 4JS0A 3ZZ0A 3FMIA 2H7VA 3HU1A 4JVMA 4FMCB 1LW7A 4L16A 4XIGS 3BE4A 3T1OA 2C95A 2FZ4A 4OBEA 3KQKA 1FMJA 4TL7A 3GFTA 4G5GA 5EZ6B 4UXIA 5DI9A 4D26A 3TLXA 3JVUA 3P26A 1FNNA 1IXRC 1N5LA 2XITA 3CNOA 2B8WA 4RD0A 5SZIA 1Z3IX 3SI7A 4JBWA 2WAYA 1X8KA 5DYIA 4RZ3A 1WBBA 4WZ6A 3G82C 5HKKD 2RMKA 5D3MA 3T06B 1VHLA 3K09A 4EIWA 4DCUA 1D6JA 1DARA 2DFLA 4HB3A 4R71A 2GXUA 4MUBA 1W0KA 1HT1E 4HLDA 5EE9A 3RS7A 2AX4A 2FFBA 2B7BA 5D3MB 4HSEA 5DO9A 2JDIA 1VCIA 2YJTD 1SVWA 1W4BA 3KZ1E 3TK1A 4DDVA 3B1YA 2FX3A 2ZJZA 3A1WA 3X2SA 2JLZA 3LXXA 2P6UA 4QFMA 4POAA 3CZPA 1JALA 2DWPA 3IGFA 3PUZA 4B44A 4A82A 3QKUA 4I81A 3QKTA 1LS6A 1DAHA 4M9SA 1KDPA 3SJBA 4NBSA 1PLJA 3TQCA 3H1TA 3IEUA 4LJ5A 5JECA 1VIYA 2QP9X 3T15A 1IN8A 1KHTA 4B3GA 1UBEA 4I4LA 4JBXA 1OFHA 5B64A 2QT1A 1MOZA 1DO2A 5D3QA 1R5BA 2OFXA 1NVUQ 3AH8A 3C5CA 1Z6YA 1SVIA 3KJHA 1JAIA 3UMFA 3EAQA 1OHHA 4KODA 1KIMA 1NLFA 1GRQA 2DYKA 4ON9A 3KFVA 5BN3A 2LKCA 3GQBA 1S4QA 1U0HC 4QOSA 4HLCA 2XOKA 1UADA 4KYIB 1KO8A 1KJWA 3AVPA 3GEEA 1W47A 2HV8A 2ZSBA 1KNQA 5C4GB 3VFDA 5J4YA 1BMFA 1E0KA 3SEAA 5C4MA 2A9KA 2RGBA 4MDFA 1OXUA 2E87A 1LB1B 5JI2E 2NPIA 2QN6A 2CHVA 3WMGA 2Z43A 4RZXA 5G53C 1GOTA 4BEBA 2Q3MA 1T9HA 1UKYA 4MGZR 1EFRA 1OB2A 1OT3A 2N1BA 2V4ZA 4Z8YA 4Q7LA 3UMRA 4V0MA 3LNCA 5CITA 3B85A 5FTKA 3TVDA 2H8KA 1RFLA 1AKEA 2QT0A 5A5GA 1E1QA 3NC1C 1N5IA 1R8QA 2CLDX 1OV4A 4DCTA 5DHFA 1EXMA 1AA3A 4IXNA 4I1VA 2DB3A 3NEYA 3CWZA 3DPUA 3P1JA 2XNDD 4TL8A 2N42A 1UAAA 3UIEA 4G3XA 2OXCA 2GHIA 2ZSAA 4PHHA 1VTKA 1Z06A 3FVQA 3DO6A 4JVNA 3S1AA 3T12A 2WJYA 2AKAB 3U4QB 3A4MA 1Q3HA 1UEIA 4TMKA 3U7FB 2BMEA 5K8IA 1XMIA 5JZVA 2REXB 5HCIA 3GLFA 2QP4A 4EPVA 3SJCA 4BLRA 5FFMA 5JEEA 3S1AB 3DM9B 3UWKA 2UZ3A 3EA5A 2ZANA 2CK3D 2RGNA 1TQDA 2QTFA 3R20A 1WF3A 2E9SA 3ZVNA 4XH9B 2FV8A 2O8BA 3D3QA 4PPQA 1Z0IA 4Z1MA 4P4TA 1II0A 3ZIAD 4DLWA 2VP5A 5BYKA 4HAUA 1OKKA 3CWQA 4JLVA 4UNNA 1N25A 2DFKB 2H18A 4FCVA 2Y8EA 4LSGA 2Q9AA 4ITRC 3CF2A 1NY5A 4D4KA 2O8BB 3HU2A 4N3NA 5EE0A 2OG2A 1S0UA 3AVVA 2NG1A 1GKIA 4D4LA 3K70D 4S35A 2QNRA 4LJ6A 4XD7A 3IQXA 3ZQ6A 4ESHA 3HP1A 2HLDA 3GPLA 1T0JB 4AKHA 3A8TA 4ZDKA 1DADA 4JL5A 3OF5A 1ZUNB 3SQXA 4AC9A 4FN5A 5J4HA 2LWIA 1DAGA 3IHWA 2QL6A 3G5UA 4ZCMA 3T1TA 4DIEA 2ZAOA 4Z54A 4MRRA 3U7HB 3TR5A 4HAVA 3U44A 2QQEA 4BFUA 1G18A 1T5LA 4A1FA 3DKPA 1ZUIA 2B7CA 1B23P 2X1VA 1VG1A 1HUQA 2CDNA 2WHXA 2ZI9A 4TTRA 4XVQA 3U44B 3C16C 5CJPA 4C0KA 4F92B 3C5HA 2WPDA 2IK8A 1TF5A 3AF3A 2HF8A 5EQTA 3SHWA 4P4SA 1E4VA 1LV7A 2QM7A 2FG5A 3ZYCA 3KKPA 2ZS7A 4PTLA 4KVAA 1ODFA 5BXQC 3PEWA 1OIWA 1LFDB 1R7RA 1DE0A 4P4SB 2QM8A 2QPTA 4ASUD 4LYJA 3HJNA 3QKRA 2FSGA 821PA 1M34E 1G7RA 2WVJA 1ZIPA 2GAOA 3QPWA 4D6PA 3SC3A 2UVQA 1CKEA 2YZ2A 1EX7A 1N6LA 1U8AA 3UG7A 1TF7A 2HT6A 1LNZA 3QKRB 4HAYA 1XMSA 4L5BA 4NCIA 5J4KA 2XXAA 3LBNA 1N6OA 1WP9A 4BE7B 4HDCA 2ZRHA 1CR1A 3BBPA 3WBJA 2ZI6A 4KBFA 3LY5A 1IXSB 4JJKA 1RE0A 4OHWA 3C4JA 4Q9HA 1D2NA 2ANCA 2OFOA 4YDHB 1M7HA 4U00A 2RH5A 4QRHA 1P61B 1M1YE 3K9GA 4OI1A 4ZO4A 1RPZA 4V03A 3SN6A 4MA4A 3GLIE 3VHXA 3BRWD 3CPEA 4TQAA 2ZXUA 1F6BA 2QA5A 4JLMA 2H92A 4LBZA 2W6JA 1S1MA 3DL0A 5B2ZA 4DCVA 4KFTA 2ODNA 4B6EA 1TTTA 4RFVA 3VR3A 1OH6A 1H8ED 4EPXA 3OHMA 3T61A 2XZLA 1CJKC 3B78A 4PZYA 3AP3A 1N6HA 4PZLA 4G5QA 1ZM7A 3TSWA 2V7QA 3TKLA 2BCJQ 4XWKA 2YWHA 1XJQA 1QZXA 4IRUB 1OH7A 3IBGA 1NNEA 3KQLA 2UKDA 4XTRA 3P32A 2CE7A 5TARA 3WNDA 3FB4A 3KQHA 4MKIA 2ZETA 3PJRA 1IJFA 1Z6TA 2FSHA 5TMPA 1CRPA 1KO7A 1KJYA 2J59A 1SQ5A 3GEHA 5KNDA 4ZCIA 1W5SA 4DSUA 3SJAA 2UZIR 1KI8A 2O0JA 4LZZA 2VIIA 3Q9LA 3ZS8A 1XB2A 2ZJ5A 3EIHA 3I8XA 4LJAA 1HQYE 3HDTA 1Q20A 2QROA 2QE7A 521PA 3JZAA 1V43A 1D2EA 3KB1A 4JSYA 2N46A 3U6KA 3A4NA 2X8AA 4KBGA 5FOTA 4JYCA 4OQXA 4B48A 2G83A 4Q00A 1G41A 1S3GA 4KCGA 4LJ9A 1E2FA 5SZHB 1G5RA 4CIDA 2WOOA 2KBFA 5JI3E 4YLGA 1G9XA 1E99A 2JLWA 3QIAA 5KYKA 1ZCBA 3F0TA 4M21A 5CLLA 5DI3B 3FGNA 4CEIB 2ZJYA 4PHFA 5IDVA 3WRXC 2B21A 1UF9A 5IK2A 3TNFA 4JVLA 4PSVA 5KO2A 2PJZA 4HZIA 2PH1A 4MYCA 2A7QA 5E7JA 4WOPA 5KUTA 1AKYA 1E9FA 2ZE7A 2ZRAA 5G40A 2QMUA 4KLNA 3BB3A 2QGNA 3AGQA 1E69A 1FUUA 4RKFA 4GZLA 4C2UA 1AGRA 1BO6A 2ODBA 5UKDA 3FOZA 3PUVA 2OBLA 2VP4A 2VHCA 2YOFA 3VR4A 4LX0A 1ZW6A 2R6DA 1SVOA 3U60B 3R9WA 1JR3D 1IHUA 4PC1A 4EPYA 4CDGA 2W2TA 4AYTA 1P4SA 4LK2A 4M1TA 4NKRA 1F3OA 2FEOA 1NN3A 2P5TB 3FTQA 4JMPA 1AZSC 1QDEA 4OHXA 4Z8XA 2A78A 3CBQA 3CR8A 1TQ6A 3AKCA 3B1WA 4P33A 4TQUS 4RVCA 2PL3A 4OI0A 2RGDA 5JEDA 2D3WA 2F1HA 5AUPB 3KQUA 3AVUA 4ZDJA 3UWOA 3OEHA 1YZQA 4G0NA 3RDPA 1Z2CA 1SHZA 1XPOA 2ZYVX 3AV0B 2ZUDA 4TMZA 3K09C 2ZE8A 1ELOA 2CCJA 1MABA 1SXJA 1I4DD 2C98A 4ZKEA 3UXMA 2VHJA 3ZH9B 2FFAA 1M7BA 1NRJB 4HUTA 3VX3A 2ZI3A 4WVFA 4AYXA 4UNPA 2WWYA 3UMSA 1MABB 1SXJB 2XZPA 1P60A 3FKQA 4O3MA 4M22A 1Z0DA 2VP6A 1U0JA 3REGA 4FW9A 4WW0A 4BWYA 1R0WA 4OYHA 1E94E 4GDFA 3LBIA 3RRMA 4DB4A 1NN0A 2Q3HA 4B73A 3MLEA 4CGZA 1ZAKA 2PT5A 1NF3A 1VG9B 4PC6A 2WJVA 1KZ7B 4FWTA 2FJUA 2G0NA 2IYTA 2QSYA 2RHMA 4Q4LA 4II7A 1X86B 4TZ6A 2JLRA 1BKDR 1KGDA 2CL6X 3SYNA 5HPYB 4TTPA 1FPMA 3K0CC 2IX3A 1US8A 4MUAA 4XVUA 4MRSA 4DUGA 1E98A 5HTKA 2IWHA 3QOFA 4TN1A 3LXRA 2GAAA 1TNDA 5KSOA 2IYYA 1US8B 1NI3A 1FZQA 4TQ9A 5FUWA 1FOEB 3WMFA 4M9ZA 3U3KA 2JLVA 4A36A 4IFEA 4MYUA 3DEFA 4B32A 4A4DA 1GTVA 3DMDA 2DBYA 4Q18A 1IJEA 1ZJ6A 2OHFA 4P32A 4MKHA 4NYMQ 2PZFA 3PVSA 1JR3E 4B6FA 2WICA 2ZRGA 1NVVQ 1S8FA 2DWOA 1HTWA 1OXSC 1DEKA 2H57A 3EZFA 2ORVA 1CRQA 3BD9A 4C0LA 4BLSA 4M9XA 2CL7X 1N6KA 1KMHA 2A3RA 4W7SA 1WA5A 1XEXA 3KXLA 1GITA 3MJRA 4LCBA 3ICEA 2BKUA 4NYMR 1KDTA 4D25A 2NO6A 2XTZA 3A6PC 1P72A 1NVVR 4TYNA 5H1YA 2IHYA 3TVTA 3EA0A 1XEXB 4EFMA 3AVWA 1XD2A 2A30A 5AJYA 1OH5A 1KI9A 1GZSA 1FQKA 4HLUC 4MRVA 4BFWA 1XPUA 1G5PA 2HJVA 4NCHA 1WQ1R 4IJMA 1XD2B 3OIUA 2C03A 4V0KA 5BN4A 2BBTA 1FW6A 3GLHA 3DVLA 3LFUA 3DHWC 4E09A 1N5JA 4HDOB 2ZRDA 3OEEA 1A2BA 1KJZA 1XZQA 2BCGY 1SVLA 2JJ1A 2J0SA 4DT1A 1KO5A 5FUVA 4KFSA 4EUNA 1VECA 3CNNA 5FR1A 3AVXA 1S2MA 4CT4B 3FDIA 1JEDA 3KTAA 4DT1B 5BYJA 4D0NA 2RGNC 4Y0VA 3Q5EA 1E9DA 2YVUA 4OK5A 1A1VA 1E9RA 3CH4B 4BFTA 3H86A 4ARZA 1HY3A 5AR1A 1YHNA 3B9QA 3IBYA 4X8MA 3NBZC 3T34A 3LVRE 1Z63A 2ZEJA 5EP3A 4KLZA 3BB1A 2EFDB 4C2TA 4WBSA 4WXPA 4AWXA 4GOKA 5K8LA 4NHOA 4D4MA 2C04A 5FOXA 4LYFA 1G17A 1Q1BA 2ZRFA 2AXNA 1H8HA 2J7PA 4LHZA 4WIAA 1L8QA 2F9LA 5C18A 4N0EA 2F7SA 2J7KA 3DZDA 3TE6A 4I1SA 1N6IA 1DAEA 2HUPA 4OQLA 4Q01A 3DM5A 3PUWA 2GETA 5CLQA 3LQQA 4MGYR 3TJZA 3OE7A 1OXXK 4A6PA 4UXHA 4BQSA 4TMTA 2F55A 4LYAA 1ESMA 3MWLA 3WYFA 4DCNA 3VR5A 2R62A 2GTPA 5HKKA 2A5DA 3LA6A 1G3QA 2OLKA 3QF4A 4Q7KA 1IN4A 2D7DA 4A2PA 4KHZA 4JL8A 5IT5A 1KSFX 2ZJ8A 5JFGA 2QBYA 1NP6A 4LGMA 2DHRA 1CR2A 2WKRA 121PA 2ZJBA 2ZS9A 1GNQA 1IY0A 2HT1A 3QF4B 1MO4A 1F2TA 1OFIA 2VA8A 3MWKA 2QBYB 4DDUA 1CF4A 2FA9A 5IHPA 4NTZA 4ZDIA 1COWD 3UK6A 5FL3A 1DG1G 5HZHA 2GF9A 1L4YA 1F2TB 2ZE5A 5TVKA 3B8HA 4DWJA 4KSBA 1W49A 2BV3A 3IDQA 4Q02A 2FGJA 4URWR 4ZCLA 3C7KA 4NYIQ 3SZRA 2BMFA 4NYJQ 2ONKA 3NHBA 1ZM4A 3PUYA 4NZYA 5F98A 4DSTA 2GVDC 4C4PA 1ZVQA 3WY9A 2IBMA 3CPHA 2P65A 3BJIC 1GL7A 4JLNA 3WYGA 1TQ2A 1OFUX 2QPAA 2BKEA 1T3LA 2ZRJA 1A2KC 2IYSA 4PQRA 4NYIR 4Q1DA 2ODWA 1P9WA 2Z83A 2ZJOA 4NYJR 2IEZA 1ZNXA 2IT1A 3MRSA 4YC7A 5KU1A 2ODEA 3AVTA 2FFHA 4MRNA 2KJQA 2XTMA 2FPLA 3BH7A 5EXSA 2HYIC 2REOA 3I5XA 1NLYA 1OSNA 2HXSA 4UXJA 3AB3A 1E0SA 3X1ZA 1GM5A 1ZYUA 3W5IA 3AGPA 4QNMA 2JLUA 1RZ3A 5HR5A 3EIQA 4FWIB 3QY0A 1NBME 5G3ZA 4JLPA 2WWGA 2DR3A 2XJ4A 3AKEA 3CRVA 1TEVA 4V0LA 5FTJA 4KO8A 3GJ0A 3OESA 4M8NE 1E9SA 2R44A 3MD0A 3N70A 4G5OA 4MGIR 4RSGA 2IUUA 1P7CA 1TUEA 2CNWA 2HJGA 2JEOA 3PITA 2DY1A 4O0MA 2VSXA 1S9HA 4I99A 3ZD7A 5FTMA 1KSHA 2BM0A 1RYHA 2D62A 1OJLA 1J8MF 1N5KA 3PR1A 5DE3A 1U8YA 2OESA 1W0JA 3CB4A 1W36D 1Q21A 3A37A 4OQNA 4Q9JA 3U3MA 4DLTA 1AS0A 1AZTA 3FFBA 4QM6A 1GIAA 4Q1FA 2AD5A 4B71A 3SFZA 4LUCA 3EC2A 3WP1B 3VR6A 4AG6A 1E9EA 1U8ZA 2D2EA 4IOMA 1EWRA 2XNDA 2FGKA 1IXZA 1UBGA 2B6HA 4M9QA 5KSPA 1EG7A 3KJGA 3SYLA 1CR4A 4HAWA 4R7ZA 5KPDA 3GLGA 2OCPA 1E1RA 4L4UA 1QVAA 4B3FX 3EWAA 1G8GA 3TH5A 2NGRA 3L0OA 2YYZA 2GA8A 2EYQA 5CIQA 3GLGB 2O8EA 5FUXA 2Z6VA 3QG1A 3H4MA 4B3BA 2RGCA 3PV0A 3ADBA 3FHOA 3F8TA 2GWHA 2OUKA 1E79D 2IS1A 2O8EB 4Q5IA 2R6FA 1OLOA 4A8JA 2GK6A 2YINC 1TADA 2VH5R 3ZIAA 3GLIA 2AK2A 3GFOA 1GRRA 3VR1A 3BAFA 5SZJA 4Q1BA 3EZ2A 1GSIA 4A8JB 4IW3B 1ANKA 5CYPA 1XU4A 3GLIB 1EFUA 4ZI2A 5FUYA 3RHFA 4CRWB 1D2MA 2OXRA 5L3VA 3NDPA 3QXJA 2P3SA 2ZITA 1XJCA 1AGPA 5FBVB 2ASEA 3B2EA 4AYWA 4XSHA 3B9PA 3KXKA 4TTQA 1AS3A 1AA9A 3TQFA 3K0CA 2ZRCA 3EZ9A 3SE0A 2ECKA 4DSNA 4KJZA 3FWYA 3RC3A 3A4LA 3I61A 1T3HA 4ZI3A 2YWEA 2OT3B 3BFXA 4TT3D 1EFTA 5FI0B 5H68A 2YHSA 2EYUA 3QF7A 2RHDA 4XVRA 1ETUA 1FTNA 3AUXA 2OAQ1 1OXVA 2VP9A 2OZEA 2V3CC 1H65A 2WWWA 4URZR 2EW1A 1AS2A 2PLFA
chains in the Genus database with same CATH superfamily
4O2RA 4UTPA 3MWEA 5JJIA 3DTYA 4BMCA 4BJ5A 4H7HA 4HMPA 1A96A 1B0PA 3SYMA 1T25A 2XZTA 4FCTA 3T5DA 1SN7A 2Q8QA 3X0DA 4EJFA 1UFOA 1V7ZA 1SXHA 2EZTA 3F8SA 3HCRA 4XASA 5JDIA 1BDMA 2BGUA 4G26A 1NIJA 4JP3A 1G6KA 4RCZA 2C29D 2QZ4A 3U7GA 4ZI7A 1T0PA 4YP6A 2DSTA 1MQ9A 3NWJA 4JYMA 4BLOA 1HDRA 1IBMB 3M4YA 2W93A 5IJ9A 1CP3A 1G20E 1QBKC 1W35A 2R00C 1O6GA 3TLYA 4UOZA 5BMVA 1FBNA 4AJEA 1YL5A 2WJZB 3HJBA 5IG2A 5HIJA 2HXYA 1ZAYA 4TSFA 5J5CA 3A6LA 2VTKA 5ESDA 1CJTC 3FPBA 3QQPA 5TGTA 5BPHA 2CCGA 2H00A 4IZ6A 1U8CB 2KPOA 1JJIA 3O0DA 2Z58A 1PZHA 1XHEA 2VO1A 4BP9A 4ZEVA 1MUUA 4A2WA 5IMSA 3O2NA 2F6RA 1PP4A 3AI7A 1EDDA 4OOFA 3T99A 3QNWA 1F1BA 2ZQYA 5BN5B 4IOLA 1XVIA 4CI0B 4Q7QA 3NKVA 1RIFA 4RC9A 4RF2A 5CBPB 2B92A 5KNBD 1B2LA 1XZPA 1F2UA 3LDHA 4MGKR 4M53A 3G0DA 2ATXA 4FEEA 3I28A 3E9YA 3EZLA 2FMTA 2PTHA 2C61A 2ZVPX 2ZZKA 4OU5A 5KVSA 4FFPA 3ESYA 4Q82A 4NICA 4BKPA 1KOLA 1UFQA 4KOEC 5ERYA 2P6RA 3PFBA 2P1DA 3R5HA 3KSZO 5F1YA 1G8YA 4AS3A 3OETA 4AXXA 3MWDB 4H1WA 2Y66A 4QREA 2FZKA 4D44A 1K7XB 2O0HA 4P5PA 3H5TA 1XWFA 3Q0IA 1YNOA 1SBQA 3NHPA 4ZV4A 4MW7A 2H85A 3TAUA 1ZUNA 4REQA 1I1HA 2R6AA 1X7HA 2WFLB 4ZGWA 1YUMA 2CGEA 3QWBA 3RRNA 1CDEA 1E8MA 2P2YA 3U26A 4MRMA 1QIEA 4TZ0A 2WY2D 2P77A 3LF2A 2ONYA 1Y0BA 5CNMA 2JJ8A 4CV3A 2X3FA 3D8RA 5KJCA 2IVZA 1PK7A 1ZOSA 4BMZA 1J9EA 1KYXA 1QJCA 1KP3A 5JRZA 1CUWA 2PXCA 1LBQA 3OTGA 3TPZA 1RP7A 2MOKA 2C2OA 4L74A 1GA6A 3G2JA 4BJHB 5SICE 2GJ4A 4QYIA 4U9HS 3LO5A 2BFDB 3M6XA 3GJ5A 4FNOA 2P0AA 3WGHA 2VBIA 1H2WA 3BIFA 3TIXB 2WM2A 2Q1YA 5I7WA 5KMGB 4C7OB 4MDYA 1IFXA 2PD4A 2PS0A 1M54A 3DVAA 4C2BA 1ND5A 2DY0A 4CZ2A 3A6JA 1T6XA 2FCRA 4JXKA 5LP6A 2QMHA 4PFSA 4DNOA 1VXRA 1PL6A 1TXGA 1VA4A 1Y82A 3EVFA 4CYMA 3KXPA 5CBKA 2PFSA 2W58A 1QIIA 3A1VA 3A1UA 4IQ0A 5HIAA 4I3HA 5KTMA 5TPWA 1PR2A 2ZQ5A 1Q44A 5B4UA 3J81k 1FQJA 3V2IA 3WG9A 1DTWB 4L28A 1OHHD 3CCCA 3Q7PA 1TTQB 1PU2A 2G1KA 1CRWG 5A1TA 1KRHA 1MGOA 1ZESA 2G28A 1LTQA 2XOKD 3AOEA 1O3YA 2VJYA 1W9HA 3O94A 3WWPA 4C4SA 3C3XA 5LQMA 1MT0A 3W9YA 4ZCQA 4PYLA 2EKDA 1SUSA 2VA9A 4KN6A 3ZV5A 5EYPB 4QYMA 3KR2A 5JH7F 1KWKA 5E6UA 3AFOA 4NEHB 1ZIOA 2H1RA 2RCYA 4W1QA 1SK9A 4V02A 4O4LB 1FFWA 3H6HA 5EZ5A 5EKSA 4G9GA 4MMXB 1ZK4A 4GFDA 4RJJA 4BFLA 2HCTA 2BEJA 2GRJA 5HKLA 5EIFA 1KPIA 4FIDA 4YT2A 4ZIRB 4OIFA 1SQGA 3JD3A 3W8FA 5BNZA 2HWXA 3LWBA 4ZYZA 5C5CA 3WMRA 4K3VA 1CY4A 4BN0A 1XVUA 4Z9YA 4QHYA 3TW8B 5FBLB 3NLLA 2BKVA 2CDBA 4XB2A 5H70A 2ZSDA 5EGNA 4CR8A 3ED1A 2EFHB 4MLPA 3RYFA 2A1UB 3TLEA 1PT9A 1Z0AA 3QITA 1E2GA 3KKEA 2JAUA 1YS4A 3HWX1 4IVRA 5GJCA 4LJRA 5KX5F 1H4TA 1J2YA 1D4ZA 4PYIA 1XTTA 1T9DA 1XRJA 1CS4C 1ZZEA 2WHQA 2A0KA 3A3KA 3IO5A 3O95A 4FGWA 4MW5A 3L07A 4ZVKA 4YVFA 1GA4A 3NIWA 4GKKB 1ZK1A 2ZIXA 1CUZA 2IY8A 1P18A 1CDDA 2KB0A 2ZRMA 1ZMXA 5KOIA 3F5DA 3HVRA 1WPXA 5EPUA 2FZLA 3E8MA 1XXHE 3D8NA 3UMGA 3GG2A 3NHAA 3K8OE 2ORWA 6ABPA 3MIIA 5F5LA 3L0YA 3DUFA 4HWSA 1VE9A 1DJNA 1ZU4A 1E9CA 1ZA2A 2HA3A 1LI7A 1RJ9B 2GPJA 3K5IA 4O3FA 4EFLA 4L9SA 1GG5A 3C7CB 4MB2A 1QPZA 2PTGA 3QEMA 3O03A 3FIJA 5KOJA 4ZAYA 4ALJA 1OKKD 3TMKA 3UT6A 1A9XA 3I9MA 1GFIA 2ZULA 1ZSYA 2P35A 1I5EA 2AL7A 2CL5A 1YO6A 4ABYA 2Q8PA 3RWMB 3QYJA 4AP5A 2AZDA 2QWXA 1I8TA 3AB7A 5KDLA 1ZK2A 3ORQA 4XD7D 1KIAA 3OLVA 2D5AA 2FW9A 1I30A 4B79A 3NOXA 4KR9A 3VC1A 2KQUA 2WJ4A 4HGRA 2OCKA 2R8OA 5KTPA 5F7OA 3RRFA 1O8BA 2XQIA 5BWOA 1GUAA 1U2ZA 3JWPA 3ZCUA 3A6GA 2Q2QA 2QRHA 2Z08A 3OT4A 4WINA 5BOSB 4WZAE 3R7WA 1FFBA 4Z9AA 1GWNA 1NIPA 3H3FA 2A92A 1N75A 3WAJA 3PX3A 1MB2A 1PLLA 2YNMC 4Q3OA 2I3GA 4RO0A 2GLTA 3LKVA 2R7AA 4FC7A 3N2GB 4B5LA 3EARA 4M1WA 4DUPA 1R6TA 2RJNA 2Q9CA 1U02A 3E7WA 1JEEA 3FMFA 2P30A 3M6VA 3NV9A 3QEKA 1PFUA 1SU7A 4L72A 1ZVVA 2AUMA 1FLVA 2FDRA 1B1CA 1BD4A 4KVZA 3OT5A 1G19A 5EE1A 4D97A 4V3CA 3NTQA 4MQEB 5HILA 4ZEOA 1XMPA 2LVBA 5KJEA 3NUGA 3DE1X 2XAUA 4QBHA 1A71A 1U8UA 5AH0A 4YTEA 4YRJA 3OPNA 3WYDA 5HIKA 2PUJA 1T8RA 4IQ8A 1WUJS 4DR2B 4L7VA 4NZOA 3THWA 1WCYA 5E6RB 4XYLA 1GQFA 1O0SA 1H6AA 5G0UA 4E3ZA 2R8EA 3OIWA 5GONB 1JHVA 1MX3A 1UJ4A 3ED5A 2B1RA 4KQJA 4Z4EA 3DMHA 1OLSA 2JKZA 1H6BA 3CO5A 5JJLA 3AF4A 4Q4CA 3IYLW 3LNTA 1FBTA 1MOSA 2X22A 5ICMA 2B4QA 3IIJA 3V9AA 3VUFA 1ZH6A 2ZTVA 3NPAA 3I8SA 3WB2A 4AAYA 5FF9A 2G67A 4PCAA 4U7HA 1DBWA 2HB6A 3LKDA 1IN7A 1PEAA 5AXCA 1MAVA 1CRLA 1NQUA 5DX1A 3RV3A 1Y33E 4PLYA 3SLGA 3HP4A 4J6EA 1HE4A 5ALYA 4PCUA 2W98A 2IXTA 5JWOA 5F9HA 1V3VA 3M6IA 4C0AC 1DU4A 1GT6A 3EHDA 2WF7A 3A7DA 5LKRA 3GH3A 2VWPA 2NW6A 2WHRA 2JF0A 3BWMA 2AMJA 4B45A 4PR0A 3AJDA 2YCBA 3PLRA 3AJEA 5GINE 1FEZA 4XM0A 1N2HA 2QRGA 2P6MA 5FEUA 4YP5A 4DJAA 2QD2A 3ABZA 4QPZA 3PUKA 4A8JC 4A8TA 1M2HA 3BK2A 4M1ZA 1QDLB 3G2QA 2PQ6A 2WWIA 1Z15A 4Y3UA 3H7IA 3OMWA 2AF3C 4Q4HB 1P1JA 2J3IA 3BFPA 4JHLA 1T1GA 2DXIA 1VG0B 1H2ZA 3TDNA 3II6X 3ZWCA 5ARDA 3SNHA 3K70C 2YOGA 4U4AA 3FSGA 4NX2A 2BMWA 3V5NA 4TMFA 4X65B 1IZ8A 2IS2A 4LTMA 3LLMA 5EPEA 2QUKA 2QJWA 1UPTA 2I2AA 4AY3A 1B3BA 1UZUA 3ZQJA 3FYHA 4RCVA 1P3DA 1WPRA 4QOJA 3W9BA 3H5AA 2BMJA 3S2FA 3L4BC 4UDOA 1MIOB 3IAM6 2Q5CA 3L9XA 3U4GA 4KIUA 2BOVA 3DMFA 1L7AA 5AJVB 1D9ZA 1EI9A 1QYVA 3AR9A 2W6IA 3T41A 4B7CA 1BIFA 3DR5A 5CX1A 3KKNA 1B8VA 3ZGLA 2XT9A 1RDFA 1Q1EA 2DLNA 4PLHA 3B1ZA 1UJNA 3KL4A 4JOSA 5TQ0B 3BC1A 3RABA 5ITSA 1K5GA 2UZ4A 5T67A 1WV1A 1ACMA 1B74A 4N7JA 2UDPA 3W77A 5JPDA 5LQDA 3SF8A 3O8OA 3PEUA 3E9MA 3I6YA 1P0MA 1Y3DE 1JWAB 3G9UA 2NXNA 4JOCA 2BP7A 4XOUA 3WLFA 1AE1A 1MTOA 2CVOA 2ZFUA 5CURA 2Q7DA 2J48A 4NBVA 5LIPA 1E1MA 4CFYA 1IHPA 3PTZA 2XV1A 3N75A 4L4SA 1P81A 1EP9A 1B15A 1JQLB 4ZOAA 1FMLA 3DCIA 5EHNA 4UFOA 5FPSA 2W0SA 3NAQA 4IJ6A 3TCNA 1FU4A 4TQGA 3VU8A 1FTGA 2J41A 3HABA 4NDZA 1QIMA 5F1OA 1AQNA 2QRZA 3K0FA 4CHTA 2GPYA 4A6EA 3AUUA 2FDCA 3OU2A 3KHTA 2EIXA 3UJBA 3NVDA 4MCIA 2HBZA 3ROKA 3HCCA 1BYUA 1D6MA 4HDAA 4IUCS 2FF7A 2GX6A 3EW9A 4FXPA 5ELMA 3VMFA 2OGSA 3VZBA 1V37A 4BMDA 1PL0A 2CLCX 3P9PA 1MC8A 4MIYA 3ZE2B 3H5NA 2ATCA 2WWFA 3R3ZA 5BQOA 3SC2A 3IB3A 5A5DA 2EJWA 3M5WA 4KFUA 5AVRA 4UC0A 1PE0A 4UJ3A 4PBTA 1GUYA 1NMQA 4ENQA 4EPTA 2FE4A 1CRZA 2GO1A 4JLDA 1AJEA 2GFQA 4D9IA 2QL7A 3OZVA 1HDZA 2DM6A 4PPNA 1FX0B 3A1FA 1RD4A 3A14A 5AHOA 1TYCA 3STYA 3ZCPA 3ND5A 4ZFNA 4LC9A 1ML3A 1H1DA 4U63A 1MU0A 1R37A 3VH3A 3DYBA 1Y1SA 3OU7A 5IH3A 2QUBA 3UY4A 4C0SA 4DRZA 2WSSA 4Z99A 2FPGA 5K0ZA 4DR1B 1L8XA 3GGJA 4MCAA 4MAAA 3SS7X 5DEIA 4ZKDA 2V5VA 5J2UA 3CH7A 3PICA 4JKIA 1JRLA 2AG0A 2JRBA 5FTWA 4AO7A 3L7OA 4JT8A 2FQ1A 3QU4A 4ETNA 4GX1A 5HTOA 2JIZA 2OGWA 3TQIA 4D9FA 3NTXA 1NVGA 3X1JA 5ICSA 1ZCAA 2E55A 2WR8A 2CLSA 1P1RA 3LT1A 4P31A 2G1PA 3LCMA 1U3GA 2A5YB 3U4AA 2R5WA 1GSOA 3FMOB 4L9AA 4EGQA 4Z9BA 2H9YA 3IUPA 5IARA 3W90A 3R3XA 4O4IA 1NONA 5LB2A 3DJFA 3HJGA 4DZZA 1Y6GA 3G23A 4ZJZA 2C2HA 1KO1A 1TEXA 1SIBE 4EDHA 1N2BA 1T91A 1UMBA 2R8YA 2WLSA 2BAGA 2XUZA 3ZS9A 4BV3A 2WYIA 1YI1A 4K6MA 3IELA 2P9QA 3ORFA 3ODGA 4FCCA 2IZ7A 4KGXA 1WP4A 3VC2A 3ZLVA 2A59A 1L5GB 1WSBA 4HJXA 3W6PA 5K09A 5LNK1 5JYDA 4OHYA 3RSLA 5DPMA 1JYEA 4HKTA 4P2GA 4P4LA 4MICA 3LSTA 1R50A 2RKOA 2NUTA 3O3NB 3L1VA 2OE2A 1GUZA 4EJ2A 1SWWA 1THZA 2PA3A 3G8BA 4Y6LA 3T52A 1P5ZB 1ISHA 4KTVE 4EW1A 4XXHA 2I91A 3PUJA 2YWRA 4NULA 2IP4A 3PCRB 1NUPA 1C4KA 1PG0A 2XTJA 3L2OB 2OVFA 1Z2NX 3FPLA 1CTQA 4D42A 1Z12A 4NQRA 4HP8A 4TRNA 1P80A 1YOVB 2EKPA 3AFMA 5EHZA 4UBIA 3AUYA 3ZUGA 2A67A 1VE5A 3LD9A 3P20A 4IUDS 4RTQA 4MROA 3VYWA 5BV2P 4N18A 5FRDA 4N4AA 1EZZA 4M55A 2ZIEA 3NV7A 4B6SA 4WZZA 1NFRA 2YUTA 3LUHA 1FXUA 2AGVA 2GPNA 3IILA 4LG1A 3RFUA 4B3JA 5EJFA 3R2JA 4HVCA 4RKYA 1SNYA 5A7HA 1ZL0A 1DMSA 2OILA 1E4YA 2WHPA 1W85B 4K2AA 2IDZA 3DDUA 5BSRA 4HZUA 3W5UA 5AUNB 2FSIA 3OA2A 4U2DA 4DDWA 2AE2A 5K3FB 2XUKA 4GI7A 3TGWA 2BBOA 4GPD1 3IP8A 2X9VA 1TUBB 4GOLD 4WNYA 2FEPA 4Q21A 2C42A 4LJ8A 4WY8A 4TMXA 5CU7A 4BC0A 4HVAA 4MDEA 2VJLA 2J07A 2J5RA 4BGUA 4AKGA 3NANA 2G25A 3JYLA 1X7YB 4PFQA 4WN9B 3OT1A 3WFIA 4E4TA 1RZRD 1MBZA 2PS1A 3X1DA 2CE2X 1ISIA 3WK5A 1W75A 2BI8A 1CFZA 3SZGA 3WAGA 1Z36A 3DG9A 3KPWA 2VZ9A 1XVAA 1C0IA 3AK4A 2HIMA 3ND9A 4Q19A 2XJ9A 2NU8A 2VP0A 1ODSA 4DRXA 1CY7A 3RNLA 3CLVA 4EK9A 1A98A 3TOVA 3ZG6A 3I9FA 5AICA 4QDZA 3J81A 5FIUA 3OQHA 1GQYA 1BS9A 5FOWA 2R8RA 3UUEA 1KEVA 2DHEA 2WJJA 2WIKA 2ZJAA 2CHQA 4Q37A 3CX7A 5F7JA 3DL2A 4TKVB 5JALA 2MINB 4R1QA 2FB9A 3LPDA 4Z51A 5IF9A 4P3YA 4F4JA 5T6MA 2FR1A 3LPCA 3WJAA 4K8OA 5LJLA 2EF1A 4RAQA 5H16A 1ETHA 2R8ZA 1R8JA 3JR3A 3UJHA 1VL2A 4KLAA 1KOFA 3PPIA 1PQYA 3SYRA 1FYDA 3TLBA 4Q16A 4BO0A 5M34A 3VDMA 3EPRA 5JZSA 4UOEA 5AJTA 2EW8A 1V9CA 1WDWB 1SBTA 1JVBA 3TLMA 3G1WA 2JNWA 3DB1A 4IXDA 6YASA 1W4CA 4YT5A 3RAPR 1MTZA 4PFJA 4EO7A 4PNHA 4P81A 1PZFA 1HE2A 3LUCA 4NOJA 4HN4B 3F78A 1O89A 3EBOA 1L2TA 1K8QA 1FMTA 3DT8A 4K87A 1JLHA 4UMVA 4W1SA 3HPQA 4YCBA 2QW0X 4ZYXA 4GGPA 4XW2A 1JMKC 1O6FA 4MI1A 3RC1A 3DC2A 3QW4B 2FUNB 1R5NA 1Y89A 2PJDA 3RBXA 2NNWB 4U5QA 4ZPXA 4TRJA 4N47A 2NVWA 2FZ5A 2RGEA 1H8HD 1KORA 2J7PD 3A6HA 3K92A 4NZMA 3ZI0A 2IYVA 4A26A 4NJMA 4C3OB 4BVEA 4CF6A 4BKRA 4C43A 2C4WA 2HNBA 3FCXA 4XB6B 1YB5A 3RVRA 2YJZA 4NCAA 1EDEA 1IMOA 2BUBA 3HR7A 4ZQEA 2XVYA 3OE7D 4AI6A 5ICCA 3KOZA 1ADBA 3KRTA 3L8MA 3OQPA 2OM6A 4S2EA 4TTVA 4E6PA 5KREA 1QP0A 4NAUA 4UUAA 4ZD6A 1RNLA 2AMLA 2J85A 2OZVA 2NTVA 3NTRA 1BW9A 1CJCA 4IMRA 4ES6A 1GTMA 3ROFA 4XGQA 2LIVA 3DOFA 3MT9A 1QGUB 1WAMA 3WZMA 1J4AA 3D8TA 3QE9Y 5BWMA 4RYDA 1IN1A 4I8XA 3MA0A 5BSKA 1E2HA 1KJIA 2V6BA 1H0HA 2PWPA 1WZ2A 1XA3A 4L4YA 1ZISA 1RTTA 1L1QA 5C8ZA 1JSXA 1G3UA 5HE9A 3NHUA 4JP5A 4WADA 1S3SA 4MH0R 3EEQA 3QPVA 1SC9A 1HH4A 1X74A 2X7XA 3GQVA 4QDJA 1ULSA 4JB0A 3NH9A 3U9LA 3W6ZA 2D0IA 2HQOA 3PC8A 1ZKMA 5M2QA 1TVMA 4W6ZA 3TX6A 1SD5A 4F5EA 4PRKA 2ZW9A 2NIPA 1L5RA 3H1GA 4RTNA 3I34X 2X2OA 5EJ6A 2KW5A 3F2VA 5ITZA 1MVNA 5EUMA 1CY2A 1YRAA 3MNFA 5HX7A 3DCYA 4K3UA 5FWYA 4GOOD 4N0DA 2HWWA 1XBTA 3AKDA 3IUQA 1EUZA 3L7NA 3GG9A 1QOZA 4I1OA 4CLXA 2J0VA 3BEDA 3WLJA 1Q1AA 1ULUA 4HQ0A 2I7TA 4CIYA 1EVQA 2NU6B 1RLJA 2V1UA 1JXOA 4BRUA 4J90A 1OAAA 2ESRA 2FOXA 2O2EA 5I4KA 3UWSA 3O8CA 1MAAA 1U1CA 1QUFA 1YDFA 3ZZTA 3TL3A 1FVHA 1CP2A 1XTIA 5L8VA 1XXLA 3R6GA 1KBOA 4FS3A 1WTCA 1O96A 3UGTA 5KQLA 3AEQB 2DPHA 1XCBA 4RW0A 1U6KA 1YTLA 4CMGA 4LMBA 4BLTA 3HKDA 2N75A 2PMKA 4EG3A 2Q4EA 2C54A 3JQ8B 1MHPA 1MVOA 4YEDA 5H4HA 3QLTA 4AK9A 4GMKA 1IEVA 1QVRA 1MEJA 3BJEA 4RORA 3A27A 2CNWD 1XAGA 1YCFA 2OV2A 1SUPA 2I4MA 4RA9B 4B4WA 4J1TC 4D9BA 4ZMBA 1GZ6A 4L22A 4AJ4A 1OGYA 5ALUA 2ALJA 2GJ9A 3HJRA 4NPHA 2DCUA 2XTNA 5JI3E 3HV0A 4LHVA 5DGXA 2QIOA 1EFVA 4PN7A 1W0JD 4GPBA 2EBUA 1EUDB 4RIHA 2B20A 1ZNZA 4MKRA 3TTTA 5IAAA 5LKAA 5IPFA 4DDHA 5LQUA 1II8A 2QAGB 3DTVD 4OQFA 2VLBA 5I9BA 1OMOA 2FWBA 3E1KA 3P0RA 5FQNA 3I4LA 4G9BA 3FYSA 3AMVA 1YZ3A 4B74A 1W93A 5AW0A 1R0XA 3HXKA 1GPKA 3UW3A 2C92A 2V6MA 1JA0A 1YR1A 2FOIA 1Y1RA 3A0RB 3RV4A 5LFAA 3KYBA 4B5KA 1WJGA 2QHXA 4FYVA 4HYQA 3C8MA 4D9HA 2IDMA 4KQEA 1JKMA 4ER5A 2QGZA 5GWXA 1UJBA 1SOAA 5D2CA 4AY2A 1TPYA 3BREA 3U3JA 3KQQA 1KO4A 1E6CA 2D2IA 1FRZA 3EMKA 2GJ8A 3L8EA 1DC6A 4RKQA 4XX0B 1B16A 3BILA 3CEAA 3G8DA 5T64A 3B36A 5FLEX 1KDVA 3GDWA 4RL6A 4D8YA 5DDIP 4RTSA 1BX3A 1HFJA 1AGYA 2FMXA 1T1SA 3MT8A 2FQWA 1IBRA 2NZ8A 1RPJA 2VDJA 2A9FA 4IYJA 1BOOA 4MI6A 1MT3A 5DBHX 4KLCA 3NJ8A 2ZRKA 4AJHA 2R6ZA 4G1MB 4JELA 4DANA 5I3ZA 2A57A 3MTEA 3CY6A 2OXFA 1KDZA 3AQ4A 5CAEA 2WQ7A 1NT2A 1WXEA 1SVSA 5L6MB 1GPMA 1UC4B 3VC3A 1FNMA 1WD7A 3QVGB 4EYKA 3Q11A 3QXCA 1JHDA 1Y8CA 4ZODA 4I4IA 3L7DA 4DBLC 3SR0A 3OZCA 4UCWA 1XRQA 4YLEA 2NXWA 3JRXA 3OJOA 2HHHB 5EQJB 4FW8A 5B4VA 3JTMA 1KYYA 1VOTA 2JFGA 4IIUA 4KWCA 5TF4A 3CVVA 4ZOEA 1E7SA 1JPJA 3M2PA 5JCOC 1W25A 3N2ZB 3FMGA 1DRUA 2EGHA 1UMCA 3T95A 4CL0A 1NUUA 3OM0A 3T3GA 1E92A 2Q9UA 4ZZIA 5DK4A 5HCUA 3VV3A 3TW6A 1HE1C 3O8QB 4A0GA 2PSDA 1JB9A 1Z5NA 4QFDA 4Q3BA 4BIIA 3ZY2A 5JAIA 2VYND 1YVDA 1C1YA 4W9NA 3NB0A 5EI5A 5AM2A 2SKEA 2H16A 1U80A 3M1LA 2OOKA 3QGMA 1KTIA 2FW6A 1SXPA 2FLKA 3Q4GA 3BXXA 3QVTA 1EFAA 1C4WA 3UJPA 4BNHA 4KXLA 1YVEI 1KI1A 3D3EA 1OA1A 3D64A 3FTCA 1HDCA 1KE1A 4C3ZA 4IS3A 4LF9B 1KI4A 2X1LA 4MUIA 2XBUA 1UBRS 4DCJA 3IBFA 1SOVA 3DF7A 2KSQA 4GWLA 4YS6A 3GJ4A 1ODLA 1U7PA 1W9MA 2QMOA 4AECA 2BFFA 3KKZA 4CWAA 1NA5A 2WT4A 1AHNA 4Q4JA 5HZMA 5C52B 1DX6A 3WV5A 5KOHB 4HDKB 2FPIA 4UEKA 2A6PA 3RJTA 2O1SA 4ZVNA 3DZHA 2VNKA 2VT3A 3JSXA 3RTEA 3KTFA 2FUCA 3FJ1A 1R4MA 5FL7A 1RWQA 1PBNA 5IP5A 1WLSA 2ZI4A 3QJYA 4F4DA 2BDTA 3ZDXB 4ADSG 2C78A 4CEJB 4LDPA 4QQRA 2XXAB 3AEYA 1RLUA 5BMVF 3LDAA 2A9PA 1IJBA 5KSYA 1U4OA 1MNAA 3T9AA 4BTEA 4KQ6A 1VP3A 3L3BA 4BO2A 4Z3KA 2PUDA 2O8CA 3EUEA 2JI6A 3EOAI 1BGXT 1H5UA 2HK9A 4FI3F 4FJ0A 4Q9DA 2XPCA 3TNDA 2DUJA 1ZKDA 1G8FA 3AHGA 2DLDA 3JASA 1OIVA 3NEPX 1KJNA 3OPVA 3ZE9A 4P82A 1LC0A 4ARUA 4F6LA 2ZR9A 1JDZA 2BDUA 3ZC3A 2G3YA 2QMZA 3MTAA 3SG0A 1UPAA 3GT7A 3WO1A 2XCSB 4ALMA 1XZMA 1ZM9A 2W00A 3CLUD 1XT6A 2EP5A 2JHGA 1JDNA 3TXAA 4AY6A 4YJHB 4Q7JB 1LBEA 4B2LA 2J8ZA 2NTYC 3Q15C 1OASA 4LWZA 5GZ1A 2GNOA 3QU7A 1XAHA 2IH5A 1RT9A 1C1DA 3P2YA 1CK4A 3T9BA 3D3WA 5CDGA 4KDFA 4RGYA 4CQLA 3ZDCA 1XP5A 3UA3A 3N8GA 3SQLA 1EVZA 2YUIA 1U1GA 3VXKA 8OHMA 5K0JA 2IXEA 1FUIA 2FU5C 4FGZA 3K53A 4DREA 3HO8A 3R3HA 1ID8A 2C7GA 3HJUA 4MR7A 2IV3A 4U02A 2CYAA 4HWPA 3BMNA 1DQZA 3W6OA 3UK1A 3HEAA 1AMUA 2H59A 4Z9XA 1BXRB 3I2JA 2IYUA 5E6SB 2NZJA 3G2NA 1TU3A 4YONB 3WLQA 5J47A 1A5TA 2PNFA 3VSBA 4BAUA 3AEKA 1T2VA 2OY0A 3U3RA 4OXRA 1OBCA 1JHUA 3CCFA 5DT2A 2XUHA 3EVEA 4DR7B 2NZWA 4ID9A 1I3KA 1VDMA 2IODA 1KI6A 4B4OA 3HJAA 2OCBA 4OHRA 1M67A 4DJTA 2I67A 4ZZ2A 2P9JA 1FUYB 1G1AA 2EFJA 3K4PA 3MZ0A 5TXGA 1RR6A 1VHTA 3T54A 5BRJA 4EM6A 1BHO1 4XAQA 4C08A 1C30B 1MG5A 2W37A 4BWGA 4TYQA 4DXDA 1P4JA 3U5TA 3N74A 2I4NA 3O75A 1CG6A 3OJWA 1KARA 4PCLA 1NR5A 4JAVC 3WLAA 2LCFA 4BLQA 4I4TB 1VZ3A 3I5UA 5BSMA 3VU3A 1RRFA 3INTA 4JBHA 2J9ZB 1UAGA 4G0QA 1RYMA 5E9QA 4V0ME 5EZYF 1JJ7A 2EKQA 3A2MA 3E7XA 3LUKA 4RTLA 4YMVA 1SB9A 5A4IS 2X2EA 3OMLA 1RPTA 1LVHA 3Q1LA 1NOJA 1Q15A 1XYVA 2P5SA 3R9IA 3THXA 3FZEA 3RS5A 2X8BA 1P4RA 4CKXA 5FI1B 1VBKA 1Y8QA 1EA7A 2B94A 3ORSA 4J49A 2PCJA 3L8GA 1W2HA 3PC4A 4JLAA 1CZHA 4PYQA 3AHEA 4RFSA 5DMHA 2O5EA 1E1CB 1G4AE 2H1FA 1KDYA 2B98A 1P74A 3A11A 5KCMA 2XMBA 1KQ3A 2AOUB 4UE6A 2X2PA 4W63A 5SYMA 3H5VA 3LVBA 3QRWA 3KELA 3TLGB 3D6VA 4WA7A 4EARA 2CXRA 1R27A 3KB2A 4RFLA 4O02B 3PEYA 2QRUA 5C1OA 2AVDA 4RKEA 3G02A 3I04M 3ILVA 5ENDA 1IOZA 2VHWA 3AU9A 4M0KA 1E60A 1Q19A 2OTCA 4LRWA 4B33A 3VSDA 4L0MA 5LN1A 4ZVRA 2H07A 2Q9BA 4KQKA 1Z45A 2VDWB 4PWZA 5FTNA 5CP8A 1HGXA 4OEHA 2VZ0A 3WHKA 1KKMA 1XPRA 3FYUC 4O33A 4FNAA 1WPQA 2YXEA 3HA3A 3FKSD 4DYVA 4F3TA 1OXTA 1XLVA 4F4IA 2C9MA 3ONNA 3H2GA 1TJ4A 1NXQA 1K5DA 1Z22A 4BCCA 4KGZA 5AKGA 1Q0ZA 2AEJA 2ZSHA 4OSPA 1YR8A 4XLZA 5FOVA 2VHTA 4IDCA 4K6OA 1NV8A 1RXYA 2JHCA 2FHSA 2XBLA 4QQKA 2HXGA 3QBVA 4EPWA 1E5XA 5HGJA 1ULZA 5ITWA 5K45A 2XCRB 3L4KA 3PTLA 1KE2A 3G6WA 1W6UA 3FJOA 5KTSA 1ADFA 1EVJA 4TVOA 3VISA 3ZV3A 1N0UA 2XUJA 3N2EA 1JIXA 1RM3A 5IKXA 4L0DA 3DOIA 2HQ1A 1HNZB 4C76A 4EHAA 4M1SA 2VATA 5E3IA 3E3NA 4MWTA 4COOA 3D4IA 2F1RA 3ROPA 3T7AA 1VA5A 4YAGA 5L3SB 4TYYA 3RM3A 1DRWA 2YJ5A 3HCBA 4CM6A 5K99A 3QHPA 1RKXA 1Y7TA 3AIMA 4JSRA 5TQ2A 1GPDG 3QHQA 3VBCA 4D0GA 2QJTA 1JEAA 1EHIA 3JAWB 1PFGA 2BW0A 3QKSB 1QIKA 2AEFA 3E3MA 1P7WA 1U9ZA 4MVXA 3NEJA 1Z5OA 2CVZA 4HAOA 3U4HA 4BLPA 2TMDA 1UEXC 4QU8A 3C6QA 2O8FA 5C9ZA 1FDTA 4LZLA 1I4TD 1RXUA 1QS0B 2MSCB 4BNMA 2Z5FA 5L40A 2OG1A 5BNFA 3CRRA 1TYDE 1MDBA 3GGCA 3UAZA 3EMDA 5JJCA 1J56A 1I3CA 1MRSA 2C7BA 1JYSA 3EODA 1JIJA 3I9LA 4EW6A 3IXLA 2H51A 2O7RA 2R4TA 5DWQA 3WDMA 2ZIGA 2HDNB 2IUFA 2D1SA 2VDVE 1IPEA 1G5TA 2WYOA 2XUIA 2EWMA 4QASA 4C30A 5EXPA 2VOJA 3FBGA 2ZREA 3KUDA 4TS1A 1QHXA 3EDQA 4UOQA 4CQJA 4DG9A 3GUZA 1VIVA 4D4IA 1XZLA 1GYRA 3MSXA 4AF6A 1IWPB 1JDPA 2F1IA 3WRYA 4CMEA 4E5SA 2HMAA 5JZ9A 3DEJA 1E2JA 1TKBA 3VR6H 2NWQA 4L76A 3M9WA 1QJ4A 1E2NA 3BDVA 4JIGA 4NMHA 3U6BA 4QYTA 5CVUA 4PANA 2GJSA 5C8YA 4CIWA 1FDVA 2YVQA 1XX6A 3FG9A 1YS9A 3PCXA 4X6XA 5EKDA 3E5RA 2RAFA 3MTJA 4EKEA 5BUZA 3T1NA 5EJAA 2EX0A 3EVDA 4KIFA 4TV9B 4DILA 4UM9B 1GGFA 1JHAA 4PLGA 4S0XA 4QRDA 3DVQX 4W6QA 4XOIA 5EJ2A 3V1YA 4EMUA 3RR2A 5KQSA 4IHAA 4HB0A 1ZJZA 4QDXA 3JWGA 2FRVA 5DFAA 2ZU0C 5KYVA 5KJ6A 3MCVA 2GN4A 2BFMA 4QVKA 5IASA 1JE0A 2F3UA 2YV1A 5IHXA 5FPHA 2I2CA 2VPWA 5IM5A 2OHHA 2E7ZA 1IDOA 3EXFA 3P4UA 2CEAA 2JLQA 5EIOA 2M6LA 3WYAA 4ACBA 1JHOA 3GWGA 3VR4D 5CFLA 4DHEA 3ZNQA 2O57A 1GZ5A 1WW8A 3EXIA 1JPNA 3E3OA 2RHGB 3N8NA 1AD2A 3C1TA 1Z34A 3L5OA 3NJ4A 4TX1A 4ZV9A 4Q9KA 2O6HA 1XZGA 4D7AA 3PE6A 1CZKA 2IDKA 2VSOA 1G8PA 4OX9B 2JI8A 5EMJA 1CT9A 3SK0A 4OI0A 1DCMA 2VTBB 3VNBA 1V8OA 3A05A 4BP3A 2TRSB 1PRYA 5CTJA 4H7EA 4OFZA 7GPBA 3EBPA 2YXLA 3O4HA 5H59A 3SC4A 1QOPB 2Y71A 1RRGA 2DX7A 2NSDA 2VF4X 3EH1A 5LIRA 5F7ZA 3GCWA 3WV4A 2J3DA 1PWXA 3VC7A 3THYA 3C8HA 3GLHB 3MCZA 4HQRA 2QNBA 4I50F 4JJEA 1QQAA 4MKZA 3OICA 5EWMA 2B9VA 4MUMA 4QLBA 1XTRA 3TLCA 1IATA 2AG1A 1MXFA 5KC8A 2G9VA 4JQSA 3CZ5A 3C6BA 3BN3A 1T8UA 4NATA 1VBFA 1PZMA 1P2DA 1XKQA 2XDWA 3PFNA 2HNAA 4I08A 1QCDA 3KOOA 2GCOA 2BCEA 2WFAA 3QPDA 3TD9A 3LE8A 3MAAC 3QI2A 3U0BA 1KFCB 3E58A 1IE3A 5ISMA 5JC1A 3GXBA 1SKYB 3GHHA 4G1FA 5CYGA 1DG3A 5CB4B 5B12A 5AW9A 2I9PA 1BCRA 1RTKA 5A62A 2J0UA 2V58A 3I2KA 2H7XA 1P9LA 4MW4A 2PKEA 4Y30A 2FF5A 3NZEA 1CJUC 5F21A 5REQB 2A2ZA 4CTMA 4HH1A 2Q1UA 5LXTF 4YT4A 1F3LA 3WLMA 2ZR8A 2EGUA 4EYQA 2IF0A 3GA5A 2O8DB 4V0OA 2B2XA 4QT4A 1GPNA 1XTJA 3B6EA 2GXAA 3QV1A 2RHRA 1LI5A 2X6RA 3NT5A 4L02A 3BGOS 5JWRA 1UBLS 2VG8A 1TM4E 2GBGA 1SGWA 5IEBA 4Q1CA 1NVKA 1UMDA 2PV0A 4MVJM 2AOVA 4GICA 5AVVA 1Z4NA 3E8XA 2VJMB 4G4JA 5CT9A 5G4KA 5D7BA 5HVNA 4J7AA 2C4NA 1SBNE 4HSGA 3WXMA 3QUCA 1F4PA 1T5DX 2W6QA 3MGBA 3MS7A 5FHRA 1GNLA 3E7PA 3QUBA 4MYHA 4B46A 4ZO7A 2CLOB 4RUKA 4WXRA 5F5NA 1BS2A 3FAZA 4B43A 3N8HA 1KY2A 4MVJA 1XYYA 2JGKA 2CXPA 2F43B 4CCYB 1XKTA 1I01A 3PIDA 5KQRA 3R6WA 1II9A 1IPFA 1SCDA 4OQ4A 4B8ZA 1LQ2A 4I9FA 1QP8A 2NXEA 5F4BA 4WN3A 5AVZA 3PGA1 1J0DA 1K06A 4EVQA 1KR5A 2HO4A 3B70A 4RWZA 2I4IA 1VJCA 1FU7A 1NJFA 4KNYA 2O14A 4H08A 2Q5FA 4UQOA 3ZI7A 3Q9UA 1AY0A 1TLTA 4LHEA 4M1YA 5KPJA 2WIJA 1AV7A 3UB2A 4NJEA 5ESRA 3DT9A 2XD9A 3BJRA