2ODNA

Msreca-datp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
310
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 83
structure length 310
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2odnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2odnA01
1JBKA 1KYIA 4M1TA 3P26A 1G5TA 3BD9A 3D31A 3FGNA 2JEOA 1ZP6A 3K0SA 4DUGA 2JLSA 1Q3TA 2IUSA 4WA7A 2A3RA 5EQTA 4TL8A 1CJKC 1XMSA 1XP8A 3LDAA 2ZJOA 5IK2D 2GXQA 4KLZA 4V0ME 2R6CA 2HLDA 4DSUA 4S35A 1I4LD 2CVHA 2FSGA 1N6RA 2QGNA 4DCUA 3PG5A 4OI4A 1DAFA 5DIFA 4P0TA 2CMKA 3KTAB 1NIPA 2OXRA 1UEIA 3FTQA 3MWYW 3JZMA 1G41A 2QRZA 4DB2A 2KI5A 2GBLA 4L9SA 2A5JA 2JLRA 3PUVA 2B21A 3ICEA 1XCMA 1F48A 1MRNA 2IYLD 3IHLA 3QUSA 1PLKA 3Q5EA 3PFIA 5FL3A 4CEIA 4CEJA 2ZYTX 4QGGA 4Q9HA 1Z08A 4D0GA 1FL9A 2Z83A 2GEVA 5FTKA 2YJTD 5CDFA 1MO5A 4BFWA 4HAYA 3EARA 4MRRA 1E2FA 2H7VA 4FMBB 1EFRD 1P7CA 3UIEA 2XOKD 3SFVA 2O8CB 3O8CA 2ZUBA 2UZIR 3EC1A 3QVUA 4LHXA 2RH5A 4TSFA 5D3QA 1GFIA 1TF5A 5SZJA 3FVQA 1BS1A 1MO4A 3DM9B 4TT3A 1YZUA 1N0UA 3ZDQA 2QENA 2PT5A 3LV8A 1XX6A 1SHKA 1RZ3A 1AS2A 1E9FA 4EQ6A 2W6IA 3U3RA 2OUKA 3PVSA 3V4FA 1X3SA 2XXAB 3KKPA 4MA4A 5GJVC 2OCYC 2EW1A 4PHTA 4FWTA 1YQTA 3TAHA 3FHOA 1FX0A 1GRRA 2ZS9A 4HAWA 1U8AA 1ANKA 3T5GA 4EUNA 4O3MA 3HR7A 3T06B 3TKLA 2MSEB 4UNQA 2O8DA 1R0XA 3SZRA 3AEZA 3UATA 2FGJA 5JZVA 2D62A 5G53C 4DLXA 4YQFA 2BKUA 3GJ0A 4D80A 4YXWD 1G64A 3SEAA 4DJTA 5JEDA 3K8YA 5K8UA 5E7MA 1W47A 3W9YA 2GJ9A 1JQJC 1SXJA 5HR5A 2VRWA 5JS7A 4H9GA 5IDVA 1SVWA 5EXPA 1SZPA 4XTRA 4QNMA 1N0WA 3FMFA 4TSFD 4IXNA 1ZNXA 1MOZA 5AJVB 2ZRGA 5KDLA 5DH9A 3PV0A 1M7GA 4ITRC 2P67A 2PZEA 3C41J 4NYMQ 4B75A 2V6IA 3QXSA 3M6AA 2W6ID 5KSYA 1I2DA 5EE9A 5FTLA 4HAUA 4JLNA 1ZCBA 1PLLA 2YV5A 1KI3A 1XTIA 4EJSB 1OKKD 2E1RA 1OH6A 2F1JA 4NPHA 1G5PA 1B23P 2CDNA 2VHCA 3G82C 4BRUA 1KMHA 4NYIR 3MJHA 4A0GA 2AKAB 4LYAA 4Q18A 5AUQA 5FL7A 2YHSA 2D3WA 3W90A 3ZJYA 4A4DA 3TQFA 3N2EA 3NKVA 2XNDA 1AGPA 1GP2A 5KDDA 2LKDA 2NTYC 1K5GA 2IUUA 3IIKA 3PEYA 2JIZD 4M9ZA 2FEOA 1JB1A 3JVVA 5DGXA 2A7QA 2IBMA 2NIPA 5JBQA 4B2IA 2VBCA 4YONB 3QKSB 1DAIA 1M1YE 4I1VA 4KBFA 4UJ3A 2ZREA 5FOUA 5J40A 4B3CA 1ZBDA 1DAEA 2NGRA 1XJ0A 1Z28A 5FPKA 2NOAA 4M1KA 1U99A 5CK4A 4TLDA 3TK1A 3OEHD 1YR6A 3THYB 2PZGA 3EIQA 4QFMA 3W3ZB 4C3ZA 2ZU0C 1SVMA 4OK5A 3U2QA 1YHNA 1XXHE 5KUTA 1JR3D 2OFOA 1CJMA 4LV5B 4BQSA 1DBSA 2GBLC 4F4CA 1P73A 1D2NA 2DR3A 4IJMA 5JI2E 5CB6A 1XCPA 3NBYC 3TLXA 1GDDA 3KXLA 1NF3A 3EZ7A 3RAPR 1NLYA 2JDID 1NMZA 1GTVA 3Q3JB 3GLHE 4II7A 4P4TA 1RJ9A 1CJUC 4GL2A 1IM2A 2J0VA 3Q5DA 1F3OA 2GK6A 1FQJA 4JL6A 2XNSA 3AF0A 1U0JA 4I1SA 4G5OA 4JVLA 5FL7D 3CNLA 3S1AA 2WPDA 2R6DA 4IOMA 2FPLA 1E9DA 2J0UB 3H86A 2ZUDA 2HYDA 1KDTA 2X2FA 2QE7D 3ND8A 2WWHA 4PQFA 2F3RA 2V6JA 1P2TA 1P4SA 4MKGA 4HZUB 4BZQA 1W0KD 2IYTA 1UBFA 2O0KA 3MWKA 2ZJ8A 3IO5A 4C0AC 4E03A 3THXA 2QU8A 2J45A 4AYWA 1KO1A 1KKMA 1ODFA 4POAA 2GJKA 1NRJB 4NH0A 3I8XA 3Q85A 4Q19A 1FNMA 4IOJA 4IVQA 5AK0A 2ODNA 4TWZA 4BZPA 3GPLA 3W6NA 2IS2A 3C5HA 2KSQA 5TV2A 3EXAA 1XEXB 2OFWA 4QM7A 3LVRE 4TMTA 1KO7A 2ZRIA 4BLRA 3QY0A 4QJ3A 2ERYA 3L8YA 4P4SB 4URUR 1G3MA 5JRZA 5FOTA 3CRRA 1Z2CA 5TARA 4LBZA 1GL6A 4QGAA 1UEJA 1F2UA 4WAUA 4MRPA 2V1UA 4PC3A 2RGEA 1R0WA 4JLVA 5LPNA 4A2WA 2QG6A 1Y63A 1XD9A 2WPDD 1YZGA 1KAGA 1KSHA 2QAGB 1SXJC 3B6EA 1II0A 3UANA 3VR6A 3AVVA 4V0OA 2JJ1D 3NH6A 3REFA 4N3NA 3CZPA 5EE3A 5J47A 2HDNB 5BYJA 3H1TA 3RLFA 3LX5A 3DPUA 3TR0A 2NO1A 3ZIAA 1Q44A 3UMFA 2CXXA 3CX8A 1W44A 4HLDA 1MABA 2QT0A 3DM5A 1EXMA 1OYYA 4UNNA 3CX6A 1ZCAA 3K70D 5FBRB 2W0MA 1N6KA 3NHAA 2I3BA 1P3JA 1DG3A 1QHSA 4R9UC 4XWAA 3ZZUA 1KDOA 2NPFA 4V0NA 2HXYA 5FR1A 2AFIE 4QGHA 4MRVA 1T0JB 2AK3A 5IF9A 5FOWA 2FV8A 3LX8A 5FUYA 2VF7A 1WBBA 5JSZA 3Q9LA 5J4YA 2EFDB 521PA 1G4AE 1NG9A 4RD2A 4Q7LA 2CL7X 2VA8A 3LRPA 3PUZA 5JS8A 2ZUCA 1D9ZA 1NLFA 4GRAA 1RW4A 2K5UA 3CUEF 4ZIRA 1LS1A 2A5YB 2GZHA 1XD2B 4TLEA 3B1XA 1DPFA 3GEHA 2CNWD 1II8B 3HYTA 4KHZA 3ZQ6A 3AKCA 3ZS8A 2QI9C 3OAAA 1PVOA 2G77B 4O0MA 5BN4A 1VG0B 1VIAA 4N0EA 2ZQ5A 1DO2A 1E9CA 5FH9A 5TVKA 2BDTA 5AWFC 1RYHA 4EPWA 1WMSA 2W6JD 5FBLB 3IIMA 3R9XA 1N2CE 1GKUB 2FH5B 3FPAA 2J59A 2BBSA 2OLKA 2GA8A 4OHVA 3SS8A 4DEYA 3ZVNA 2GCPA 3Q8XB 1KI2A 4LK2A 4KSBA 4Z54A 4CEIB 5FPTA 4CEJB 2IUTA 2X77A 3AKYA 3KZ1E 4DIDA 3U7GA 4HAXA 3QXHA 2G0NA 2QUZA 2CK3D 4MUBA 5CLLA 1RE0A 4WZAE 5GVSA 1NG1A 2G0TA 2NQ2C 4Q1AA 1Q22A 4PO1A 1X1RA 1HE1C 1D5CA 1ZNYA 2Z43A 3UWOA 3QXXA 3T35A 5BN3A 121PA 1Z06A 2G6BA 1KI9A 2VL7A 3HDTA 1YZNA 1CJVC 3MGCA 3TIFA 5J4VA 1KOFA 3EZFA 3BXZA 4AYTA 4BFUA 1AZSC 1T3LA 4PC6A 3IEVA 2B7CA 4LV6A 4LJAA 3N5CA 2AFHE 3KKQA 3BH7A 1EFHA 1KI4A 1UFQA 2ZRBA 1SQ5A 3FE2A 3OAAD 4HUQA 3RSOA 4UNRA 2Q21A 4EDHA 4RFVA 3BAFA 2RB4A 1U0HC 2WIAA 3QXJA 2JJ2D 1DAMA 4NCJA 2JAQA 5FTJA 4Z1MA 3H84A 3DO6A 3AVOA 3FMPB 3H2YA 3SYLA 1N5JA 4GMXA 1NBMA 4OHWA 5ANRB 1CP2A 1FP7A 5EE0A 1G4UR 4LPKA 2VHTA 1G8PA 2IHYA 2N1BA 3ZVLA 4PPGA 4X8HA 1JPJA 4AG5A 5GJWC 2HYIC 1E9BA 2GETA 4IDOA 1NI3A 2XZOA 1KO8A 3PEWA 3A1VA 3KXKA 2C04A 2EU8A 3QG5A 4WBSA 5JJKA 2IYXA 3BWDD 5IT5A 2CL6X 2PCLA 3GLIB 2OHFA 2AHOA 2QMUA 3EWAA 2WJVA 4Q1CA 1C4OA 2QP3A 2BM1A 2ZJ2A 3CH4B 3EPJA 3IQXA 5DISB 3A1UA 3R9WA 3VHLB 2O8BB 3ADKA 3GD7A 2DBYA 2WWIA 4GT1A 1ZC4A 1G291 4KVAA 3OF5A 3QF4B 1D6JA 2ZPTX 5AUOB 1DELA 3AUXA 5DYGA 4HAZA 4LHVA 4KITB 2WICA 2VHUA 1AS0A 4IHQA 2OBLA 3N70A 1Z0FA 1GWNA 3V00A 2EWWA 3LBNA 2ZRKA 1T8TA 3AVYA 1KO5A 1OIXA 3AF2A 5F98A 3QKRA 3VR3A 3K0FB 2ZSFA 2P5TB 1E2LA 2FX3A 4EFMA 2QY9A 1KTVA 3CR7A 4BLOA 1NSFA 2V7QA 2IF2A 4I1OA 3O8RA 1Q0UA 4OJQA 5E4FA 4Q9IA 5EJEA 1AA9A 5FFMA 1G1MA 2YWHA 4WIAA 4BLSA 2PX0A 4URZR 4JT2A 4TMWA 1PUJA 3BORA 3OEEA 3L2OB 5HCNA 1WB9A 4B3GA 4BPBA 3TSWA 2CJWB 3NVAA 3DMDA 2ORVA 4MUAA 4Q9KA 2JLWA 4NHOA 4LDJA 3EA0A 2OXCA 5DI3A 3L0IB 1OV4A 1JALA 3F5FA 1IAQA 2XEXA 4HEJA 4JIMA 4NYJR 2GXAA 4GP7A 3ADDA 2MSDB 1E2HA 3GJXC 4C0SA 4JYCA 4ZI3A 3WHLA 1JXOA 4TYWA 4F4JA 1NVWQ 2GRJA 4DLSA 1RRCA 4IOKA 3A37A 2VQSA 2YWFA 3NBZC 5FUVA 4BFYA 4ACBA 2G83A 5DN6D 1TQDA 4DXAA 3RWOA 3HU2A 1KO4A 2QROA 2VSFA 1OFIA 2V7QD 5L3SA 1W4BA 2WSSA 4RZXA 1ZUHA 1CR1A 2AXNA 3PQCA 4K8OA 5FI1B 1Z6AA 4IFBA 2ATXA 1CTQA 2XSZA 4DLZA 1QZXA 1NVUQ 4DT1A 4JJZA 4ZDIA 1RIFA 4L4UA 3VKHA 1W36C 4P32A 1XPUA 1MT0A 2JATA 1NMXA 1S0UA 4LZZA 5FOVA 2LWIA 2DFLA 2P2LA 2RMKA 3T15A 4IDQA 1TEXA 3AVTA 4ZKEA 3KB1A 2B8TA 4HSEA 1NVXQ 1VYTA 1N3BA 4G01B 3TSZA 5K8IA 1II9A 1XJQA 1E1QA 4GOJA 3K70B 2BEKA 1TUIA 2CBZA 4ZDKA 3BJIC 1P5ZB 4HB3A 3KQKA 3ZVRA 4DCTA 3D6TB 1FMJA 4JBXA 1E2KA 4XIGS 4P33A 3C15C 5J4LA 4XD7A 4DDWA 3I8SA 4V03A 2ANCA 2ZRFA 1CU1A 4OQMA 4GDFA 1Z0JA 1ZD8A 2AWOA 3UMSA 721PA 3KKMA 3CH5A 2GVZC 1K8RA 1KAOA 3LXXA 4W5JA 3CF0A 3KQLA 2ZS8A 3U4QA 1H8ED 3DZ8A 3RS7A 3VR1A 1MH1A 1DAHA 3QXCA 1E79A 1SVKA 2GKSA 3KFVA 4NONA 3SR0A 3LW7A 4AIIA 1ZM9A 1EESA 4OJKA 3TH5A 2IX3A 1OH7A 2AK2A 2VHQA 4ARZA 5EZ5A 4KFRA 3CRMA 1AQYA 2QORA 4CEHB 1P61B 4NMMA 2GZDA 5FPSA 2EFCB 1Q20A 2MSCB 1MV5A 2OV2A 5JHHB 1TQ2A 4Q5IA 1CR4A 1XNJA 4PQYA 1QHHA 2ZRJA 1J8YF 3WHKA 2WOJA 2GWHA 4AKIA 2HJGA 1G7TA 3M1IA 3CM0A 4DIEA 3OFND 3MWJA 2JLVA 3IIJA 3U3OA 1E1QD 1XMIA 2RGCA 5EE5B 5J5CA 2TMKA 4OI2A 1K5DA 2WKPA 4RFSB 2YNMA 3U61B 3QI2A 3SN6A 2VP2A 1IBRA 2A5GA 3WP1B 1TPZA 3T1VA 4LWZA 3MWLA 2SHKA 1HQCA 1OE0A 4JJKA 1QF9A 2V1XA 4GZMA 4EPYA 1Z6TA 5FI0B 2DPXA 1IN7A 3NDPA 4DSOA 4LJ9A 1DTSA 3LAWA 4C30A 4OQFA 3VR2A 4NYMR 3FOZA 1JJ7A 2GHIA 1XTKA 2RHDA 1XJCA 3BB1A 4LBYA 4RY2A 5C2JB 3L82B 1GRNA 3KJGA 4C9BA 1UDXA 2IYZA 3LW8A 2V55B 3GLIE 5EP4A 5KSOA 1IJFA 3A58B 3PCRB 2C9OA 1W0JA 3I92A 3IBYA 2O8FB 1IXSB 1JJVA 5KPJA 3RVBA 1Z22A 1FOEB 4R2HA 1Y3AA 2GDJA 4Q4HB 4C0JA 3GFTA 3K0CA 4KFSA 2GCOA 4BGDA 1E98A 4DDUA 3AKEA 1CRPA 2QP9X 2W83A 3TVTA 4BASA 4E07A 1US8A 1ZC3A 4UJ5A 4LI0A 2YZ2A 4A9AA 1GITA 2WOOA 4DDTA 4YMTA 3PJRA 2J7PD 1BKDR 1J99A 4XWOA 2WSMA 5F2EA 1FTNA 4PHGA 2Z5FA 4B6EA 4LJ8A 2V4ZA 4C7OB 2VO1A 1EWQA 1W49A 2V9PA 1N6NA 3K0AA 1S96A 1VIYA 2BWJA 1KSGA 5KSPA 4A2QA 3ZD6A 4YC7A 4Q4AB 2HV8A 3WNBA 1GNRA 1V43A 4A8JB 4KAXA 5L3VA 4IEEA 2XB2A 4QRHA 4OHYA 2GEUA 1HH4A 3A4MA 2FFBA 3FKSD 4GMDA 4U00A 5C4GB 3HP1A 1TQ4A 4LJ5A 1E2PA 2D4HA 4TQ9A 3UPUA 3EZ6A 2DB3A 1P60A 1VPLA 5C4MA 3TJZA 4DUGD 4CGZA 2ZRCA 3AF3A 4Q9LA 1Z3IX 1EFCA 4Q48A 2KE5A 2ZTSA 2HLDD 4PAMA 1R8SA 5KTYA 2FSHA 1G7SA 2C2HA 5KNDA 3K9LA 3KQHA 3CNNA 5AJXA 4L5BA 4BZXA 3KB2A 1O87A 2BOVA 4G5GA 2B7BA 3PUYA 2ZI7A 1OXSC 3CLVA 3CZQA 3QVVA 1R10A 3NBXX 1E9SA 2C5LA 1GM5A 3SJZA 3RS5A 1G3QA 1SVLA 3AVPA 3U44A 4P3YA 4Z8YA 2AKYA 1NN0A 4PSKA 1PZNA 1ZD9A 4W9MC 4URXR 3THWB 4KCGA 3PEUA 2W00A 4D25A 1Z47A 3CBQA 3G0HA 4XSHA 1IN5A 1MRSA 3DEFA 4QJ4A 1GZSA 1KSFX 4DWJA 2IYRA 3QEOA 4CIDA 1CEEA 4AKHA 3IGFA 3LFUA 4MKHA 4TMKA 4C0QC 3TUIC 2EQBA 3P20A 2OESA 2HF8A 4TT3D 1KK0A 1HEIA 1S9HA 3X1WA 1HTWA 4I81A 1NY6A 2IA5A 5KOYA 2RGGA 2OT3B 5FTMA 4DKXA 2I1QA 4QJ5A 1KSJA 1FP6A 1TTTA 1QHYA 1KY3A 3BIFA 2PMDA 3PITA 4XH9B 3MFYA 1IN4A 3AF1A 4V0MA 1W46A 4URVR 3IPYA 3QJYA 5CIWA 5TY0A 1OH5A 1X8JA 4PZZA 3BC1A 2JLUA 2AD1A 4DDVA 1UPTA 2IXFA 1OYWA 4MGZR 4RZ3A 1TQ6A 1GSIA 2IK8A 5JWRA 4M4SA 2ERXA 3GJ8A 4RD4A 2AD5A 2GJSA 4FW9A 4KJZA 2NO0A 2CCGA 2VYFA 5JJIA 2A30A 1A4RA 2HF9A 3QG1A 3RRYA 4E5UA 3EPHA 4RD0A 1Z2AA 3U3MA 1KK2A 5BW8A 4C4PA 5F9FA 3UXMA 2W2TA 3B82A 1R6BX 1TNDA 4UNPA 5FPYA 4GOXA 1JI0A 3GFOA 1NKSA 4LJ7A 3AV0B 4C0HA 5A4JA 3IILA 1VKJA 1ZNWA 2BKEA 3AVQA 3QQ5A 1SXJD 2OCAA 3BBPA 2F43A 2OBNA 3K0EA 4L9WA 4BLPA 2F9MA 3EIHA 1KNQA 2R2AA 4JT4A 1P9WA 2ZU6A 2JJ8A 2VH5R 3X2SA 3U60B 1ESMA 3R9IA 2F1RA 2I1VB 2ZI6A 3K0CC 3ZZTA 2KBEA 4B6FA 2C03A 5CIQA 4CF7A 4JBYA 4LHWA 4UXJA 3NH9A 4F93B 5CYPA 5P21A 2J0QA 4G1UC 4AY2A 4FCVA 2EYQA 1QRAA 3OESA 2YWEA 4QOSA 4YDHB 3DHWC 5JLJA 2D2FA 2IYWA 1F2TB 1QHGA 2ZITA 1YR8A 3K9NA 5GJBA 5DNYB 4JYBA 5L3QA 1J2JA 3GLFB 2H16A 1KI6B 4BFZA 1R5BA 4IDHA 3WRXC 2ZSBA 2GAAA 1E2EA 3KL4A 2G3YA 5JFGA 3P27A 2C78A 4AWXA 4Q4JA 3ETLA 4B3FX 3VKGA 3HU1A 4PPFA 1OB5A 1YRAA 5KNBA 3RC8A 1RRPA 2XNDD 2BJVA 3L0PA 2O8EA 1TEVA 2WAXA 1GNPA 1ZUIA 2WKRA 4BWYA 1VG9B 3C4JA 3NG1A 1P62B 1KI8A 3AGQA 3SFZA 1R2QA 5H70A 5FUXA 4HZIA 3VU9A 3SQWA 4CDGA 4FMCF 1E1RA 1LF0A 1YRBA 2RGAA 2R6FA 621PA 5K8TA 1XFAA 3O47A 2MMCA 4KU4A 5LB2A 4NP6A 3RSLA 3ZH9B 3DDCA 2KB0A 5JHGB 2O0HA 2P65A 3HWSA 1GNQA 3ECCA 1NN5A 1Z0IA 3E2IA 3BGWA 2NZ8A 5FBWB 2ODWA 5GJCA 1S9DA 1A82A 1LB1B 5EXXA 3IDQA 2FZ4A 4HB0A 3FDIA 1IN6A 1OIWA 2FE4A 1U9IA 3CB4A 4MRNA 4B33A 4C0BA 3GLGB 2QAJA 2W0SA 1CR2A 1T5IA 2VTKA 2N42A 4CT4B 1D9XA 3I73A 1JR6A 2OAP1 2IT1A 1FUUA 1G18A 1UKEA 3CIOA 3WBKA 1AKYA 3EZ2A 3SYKA 3VX3A 2HT1A 2OE2A 1DG1G 1X8LA 2OAQ1 5HE8A 4ABYA 5KDOA 2H1LA 2P6UA 5KNCA 1E6CA 3GFPA 5EXSA 4IEIA 2ZI4A 4RZ2A 2AR7A 3BRWD 1KZGB 2Z4RA 1Z0AA 2PEZA 3MCAA 4DRZA 1T8UA 2C98A 1QHIA 4M1SA 1I4TD 1SGWA 2J1LA 2ZYWX 3GEIA 4RD3A 1AIPA 3PXGA 3R7WA 4M1WA 5LDDC 1JPNA 2GVDC 3ASZA 2OILA 3F3YA 4GZLA 4PFSA 2Y8EA 3VX4A 5DI9A 1E1RD 2ZVQX 3H4MA 4F92B 1LFDB 4C2TA 2XB4A 1ZJ6A 2ZRAA 2NPIA 2QBYA 1E0JA 1M34E 5KU1A 1X6VA 4PZYA 3KJHA 4X8OA 2BIFA 4ESHA 1QVAA 5BYKA 3SU8A 2IYVA 4WW0A 4URYR 5D3MB 5AJYA 2ZANA 2ECKA 5EXTA 3WNCA 4B3BA 1P6XA 1AGRA 1Z0KA 1ZINA 2W2XA 5HKKA 4TLAA 3RS0A 3M0EA 2FU5C 4EFNA 1XXHA 1G19A 3F8TA 3ZS9A 1VCMA 5L3RA 4GBMA 2C9CA 4TTPA 4AURA 1Z0DA 1TL7C 2WJYA 2KBFA 1PLJA 3PUWA 1Z83A 1ZUNB 4TMXA 3HYRA 4TN1A 2EFGA 4XVQA 3C16C 3GLHA 2YINC 3U7FB 2FOLA 2JGNA 1S8FA 4UQOA 2X2EA 1OXTA 1G6HA 2OM2A 5AJWA 4MYUA 3TE6A 1R0ZA 5EE1A 2FJUA 2D74A 2FGKA 4LUCA 1NN3A 4FMCB 1YU9A 4P31A 2WWYA 2CHQA 4LSGA 3ZIAD 1R5OA 1OLOA 3FHCB 5ELXA 2V8OA 4ZDJA 3Q7PA 2PLFA 2G9NA 1P72A 3WYFA 3B85A 4DSTA 1YZLA 4URWR 3RS4A 3TRFA 1M74A 4ZDWA 4V0KA 3W3AA 2ZSDA 1NNEA 2BMFA 1DVRA 1UF9A 1UKVY 1KJYA 2OG2A 3T5DA 3PENA 3BFXA 4H1VA 5G3YA 1H8HA 1D2MA 1E4VA 1LW7A 3QPWA 5EZ6B 3THOA 4B71A 2GJ8A 1TF2A 1ZNZA 1P2UA 1G3UA 1P2SA 3T61A 2AN9A 4PSAA 1G9XA 3FKQA 3KTAA 5CJPA 1SHZA 3BB3A 5HKKD 3IEUA 2NMVA 3C8UA 1KJWA 3LO5A 1E0SA 5JEEA 1L2TA 4M21A 1XCGB 3KQUA 1G3IA 4YMUA 1GOTA 4JVNA 4IKEA 1NP6A 3FFBA 1OFHA 1T91A 3MRSA 4LYFA 1EFUA 2HJVA 5B30A 1NN1A 4G5QA 3VFDA 3ZGXA 4EQ6B 5SZKB 4MYTA 1LY1A 1FZQA 2L0XA 3NIBA 5B64A 3AKDA 3CPHA 3QPVA 1E99A 1E2QA 4AKGA 3SBDA 2FNAA 4MKFA 1SVOA 2AX4A 1G6OA 3B9PA 1YR9A 2O8CA 3VKWA 1ZYUA 1FX0B 1UBGA 4LJ4A 2PBRA 1T3SA 2WJJA 1FQKA 4JMPA 1Z6YA 3CR8A 4BFXA 3RS2A 1A7JA 1IQPA 1OF1A 1E94E 4D0LB 3CRQA 421PA 1UJ2A 2O8DB 4LYHA 3IO3A 2IW3A 4OI0A 4Q4LA 2FDCA 1VMAA 1U2RA 4B2PA 1G7CA 1U9IC 4YMSA 3GLFE 2XXAA 2A5FA 3B1ZA 1JAIA 2IYQA 3I72A 1JNYA 2ZIAA 2Q0HA 4C0LA 5L8VA 5KO2A 4WVFA 1KI1A 4B43A 1Q3HA 1VG1A 4US1R 1SXJB 1EG7A 4PO9A 1BMFA 4WOPA 3BK7A 4PPQA 4L16A 1RRGA 1Q1BA 3E1SA 4E09A 1W36D 4Q7KA 4JKIA 1QDEA 2ZRDA 3CW2A 4P4UA 4M1OA 4KLNA 4TL6A 1KZ7B 1GG2A 3AGPA 2XTZA 1GAJA 3JVUA 4HLUA 3IUYA 1XWIA 3A1TA 2QTVB 1A2KC 1OH8A 1R5NA 1CULC 5LBIA 5F3WB 2PLRA 4DVGA 3DZDA 4BRWA 2F55A 4MH0R 4OBEA 5FR2A 3OE7A 2IXEA 4D26A 1VCOA 1R7RA 2G1KA 1Q57A 4JLKA 2RGBA 4Z1MD 4A0FA 2GXUA 5FBVB 2J0SA 1Q21A 1NBMD 5KSZA 1KMHB 3VAAA 4B35A 4TLBA 1BYUA 4FI3C 2QGZA 1GUAA 1CIPA 3I4LA 2WMNB 3KXIA 5H1YA 1NVVQ 1EWRA 2RKOA 2BHRA 3BOSA 4B47A 3L8ZA 4CZ2A 3GLGE 1OW3B 3EW9A 5TDHA 3K9HA 5E3HA 1UDWA 2X8AA 2VSOA 3ZLJA 3P1JA 4W5WA 2QTHA 1L8QA 1JQLB 3OIVA 4EJSA 1ZRHA 1QVRA 4LX0A 3C5CA 3A36A 4QKQA 4FCWA 4XVUA 4D4MA 3B13B 3BERA 2FA9A 4IDPA 1VCIA 1X8KA 1YZTA 3U4QB 3CRVA 3TSOA 2F9LA 1RVDA 4JVMA 3UKDA 3ADBA 2FPKA 2JCSA 2AXPA 2BBOA 3I5YA 4GI7A 3W5JA 8OHMA 1N6OA 4O25A 1HT1E 2O5VA 2WJGA 2GEDA 3LQRA 1Z6GA 3GMTA 2ODEA 1HURA 2CHGA 4U5XA 3TAUA 4V02A 2XTMA 1IJEA 4IFEA 4Q7MB 4ESVA 2RGNA 4A15A 4A0RA 3QKSA 2FG5A 2Q3MA 2ZI9A 4JLMA 4Q7JB 1P9RA 5UKDA 4DCNA 1UKYA 4DLTA 2JA1A 4B2LA 2ZRMA 1RJ9B 3MD0A 1AA3A 1JEEA 3BH0A 2ZM5A 2KJQA 3KUCA 4KBGA 1WRBA 2JLZA 3THYA 4GOKA 2ZRNA 4QBIA 3S1AB 2XTNA 4A92A 5HE9A 2G1JA 2QMEA 2BMJA 4QNRA 4TL9A 4U02A 3TVDA 1XPRA 1CXZA 2ANBA 3L0SA 1BH2A 2IXGA 3OEED 1DE0A 4NU0A 3U7EB 1ZD1A 4LHYA 1T6NA 1DO0A 3RWMB 1OHHA 1XMJA 1KJZA 3I5XA 2KWIA 3NHBA 2WWXA 3THXB 2VPPA 4WXPA 3BE4A 3D3QA 1DEKA 1FW6A 3J81k 3W6OA 1IY2A 1YKSA 3X1ZA 2J7KA 1OSNA 3F0TA 5EP2A 5C46F 2J0UA 1CLUA 4Q00A 4D82A 4HB2A 3A4LA 4GNKA 2ONJA 1ZVQA 2H92A 3QBVA 4TYYA 5SZHB 4ASUA 3GEEA 1LS6A 1L4YA 4M9SA 4NTZA 4B3DA 3ZVMA 3OIWA 1U81A 5CLQA 4HZUA 3WNDA 2XAUA 2RAPA 4TQAA 1F2UB 1ESNA 1Q12A 3B7GA 2IYUA 1YVDA 4GFDA 5K8LA 4UKDA 2ZJ5A 4CRWB 2X1VA 4G5SA 1XDBA 1WP9A 2NG1A 5CDFE 2WSSD 3SHWA 5HZHA 4A36A 2QMHA 4AYXA 4J0QA 1BYIA 1LTQA 1XEXA 1X1SA 3AVWA 1B0UA 4JSTA 4KVGA 2R44A 3RRZA 4AG6A 2IS4A 1J70A 2XSZD 1N0VC 3BS4A 4ZCIA 4P4SA 1E0KA 4QHSA 4OK3A 3U3KA 2BMEA 5FUWA 3I61A 4D4LA 3EPLA 5FOXA 3E70C 3R8CA 3LVQE 4AI6A 1I2MA 1MABB 2IS6A 2QEQA 4XVRA 2WIBA 2WM9B 4HLUC 4MGKR 6Q21A 5IK2A 3SJAA 2YKGA 4N0DA 1TU4A 4BUJA 2QAGA 2OSBA 4Q47A 2GF0A 2QNRA 1RFLA 3AB3A 4TZ6A 4M9QA 2X19A 4LRWA 2XITA 4XD7D 2ZYUX 3AP1A 1E32A 4IVPA 1AKEA 4ASUD 4DLWA 2CCJA 1AS3A 2BCJQ 4R2IA 3VMFA 5HCIA 4JLBA 2H5EA 5JSZB 1G8FA 1HA3A 2I4IA 2ZJYA 3V4RA 2DWQA 3SNHA 2WVJA 2ATVA 1N5IA 3LH5A 1E79D 2BC9A 3NTUA 4JL8A 3SJCA 3ASYA 4ZI2A 4ZIRB 3AH8A 2FFAA 2RHMA 3EWSA 3RYTC 1HE8B 4WXRA 1LVGA 1SKQA 3PIRA 3UG7A 3GLHB 2BBTA 4EJSC 1G16A 2C9YA 4B44A 3LXRA 4EIWA 3TUJC 1LF5A 4XOIA 4M9XA 4RSGA 2VEDA 2ZSEA 1ZW6A 1EFRA 4XSGA 3X1YA 4KYUA 4TL7A 3V9PA 1VTKA 2YC2C 2VP5A 3W8NA 1ONBA 3QNUA 4OI1A 1XRJA 3LY5A 1CS4C 2DYKA 2QA5A 1JR3E 3B1YA 4LYJA 4NBSA 4QBFA 5DSZA 3VTKA 5TMPA 4A0HA 1FTSA 1XD2A 1AM4D 1YZQA 2QP4A 1II8A 2J87A 3L43A 2RGNC 3W34A 2DWPA 3B8HA 2A9KA 1GRQA 4ZO4A 4A82A 4F7WA 4TYQA 4FD2A 1OB2A 1KGDA 4BEBA 3GJ7A 2AL7A 4L15A 3AP2A 3B1WA 3AM1A 1W5SA 3UK6A 5EP1A 2LCFA 1VYVA 3H0KA 3C14C 1W36B 1IONA 2GK7A 4MGYR 3CRW1 1FMLA 4ON9A 4JVSB 4JZKA 3RANA 2PX3A 4H1UA 3SC3A 3U5ZB 1W1WA 2IL1A 2WWGA 5E7JA 4QC2A 4PC7A 2WKQA 5H8WA 3BH6A 2QSZA 4YXWA 1W0JD 4MGIR 1ELOA 4Q02A 1CKEA 1QG2A 3B9QA 2NO9A 4HUQB 5EP3A 2QTFA 221PA 3DKVA 5TB5A 4PZLA 2QL6A 4M1MA 2F1HA 1ZAKA 1T3HA 4KSCA 4EKDA 1XEWY 3FMIA 3SDZA 4TTQA 4Z51A 5J4KA 2R8RA 4JLPA 5JECA 3LLUA 2NO7A 1G8GA 4JS0A 5G3ZA 1OFUX 3Q72A 1BO6A 3SI7A 3FHTA 1NL3A 1W2GA 5GVRA 4HUTA 1NJGA 1OIVA 4MQBA 1T9HA 2JLQA 4O2LA 5HZKA 4Q9JA 1OKKA 1OXVA 1OJLA 4G5RA 4NCHA 1HQYE 3SYNA 4X8MA 4FMDF 2C77A 1JAHA 3W8RA 1U0LA 1AJEA 2H57A 4NE2A 1WA5A 5G40A 5HTKA 2REXB 2Q3HA 1G8YA 1QHXA 1VDZA 3LWNA 4A6PA 3WP0A 1NMYA 4M53A 1YR7A 2ZE5A 2BBWA 2ZR7A 2QMOA 5KHOC 2ZAMA 1AK2A 1U8YA 1YJ5A 2FF7A 3NXSA 3QOFA 4KODA 3MLEA 5AJZA 3VR5A 5KPDA 4KI0A 4U7DA 2JIZA 3OZXA 1S3SA 3RHFA 4NCNA 2B6HA 1CJTC 2VIIA 4D81A 3GLIA 3EZ9A 4DC9A 4PR0A 2H8KA 3QKRB 2GESA 1G5RA 4KXFB 4BFTA 5LD2B 1NY5A 1ZU5A 3FB4A 4M2LA 5CM9C 3WMEA 3LLMA 2O8BA 1SULA 4TMZA 1PUIA 1OT3A 3QF4A 2QAGC 2ASEA 4OQLA 3SQXA 1DOAA 4R7ZA 3OEHA 1E9RA 3R20A 4Q21A 4TYNA 4ZCLA 1G20E 1HYQA 1IXZA 2QM8A 2YOFA 4ZV4A 4GSYA 3VQTA 4O2RA 1JR3A 2CL0X 5JCPA 1JEDA 2YWGA 1KMQA 4LGMA 1ZM2A 4FCTA 4TTRA 5FOSA 1GKYA 4Z8XA 3K0FA 3UG6A 2BCGY 2LKCA 1M7BA 2N46A 2VHJA 3BB4A 3EA5A 2JDIA 1SVIA 1UAAA 1IXRC 4UNSA 4CVNA 1S2MA 1XZQA 4CT5A 1C1YA 4ZPXA 1Q1QA 4AD8A 1TUEA 3NEJA 4NL4H 4PHFA 4Q1DA 4D6PA 5BN5A 4DHEA 5DI3B 2H17A 2ZJZA 4IOLA 2JLYA 3SE0A 4F38A 2D06A 1VG8A 4DBLC 2HT6A 1VECA 2P6RA 2D2EA 5FBQB 1L7VC 4OKSA 2QE7A 3I1FA 2XZLA 2OFXA 4E22A 2ZXUA 4K81B 4DLUA 2CJWA 3T12A 2WZQA 1KNXA 3ADCA 2ZI3A 3M4YA 5FTNA 1U90A 3I32A 4I99A 3GJ5A 1W0KA 5EUMA 2UKDA 3E5HA 3HPQA 1P2VA 2FSFA 4XWKA 4QHYA 4HDCA 4F4IA 4GPTA 1M7HA 1IHUA 4Q01A 5L3SB 2FSIA 1LV7A 3DMNA 1G21E 2E9SA 1WDTA 3P32A 1N6LA 1E9EA 2GZAA 4IXMA 4Q1FA 2ZE7A 4TLCA 5CYOA 4KV9A 3K9GA 4JLDA 4N1AA 4QGFA 1GVNB 2XJ9A 3AP3A 1G8HA 3WXMA 4DT1B 4EPTA 4UXHA 5SZIA 3TMKA 1Q1EA 1Z07A 1G7RA 1KDPA 2FN4A 3EG5A 3IPXA 3LNCA 1TADA 3P4YA 4FMDB 4IVRA 5DHFA 4RD1A 3HU3A 2WMOB 5JWHA 5TXGA 1I4DD 4AC9A 2YYZA 4JSYA 4MYHA 2C96A 4K46A 5JI3E 4PO8A 3U3JA 3CF6R 1EK0A 3KKNA 2VP9A 3K09C 1F6BA 2W2VA 2MMGA 3KFXA 4LCBA 4Q1BA 4UXIA 2Z6VA 4FXPA 2AWNA 1K6MA 1BIFA 1WQ1R 5F9HA 4JLAA 2DY1A 3IHWA 2QQ0A 5DHAA 2EVWX 1N5LA 2WV9A 2JJ1A 3EIEA 3QENA 3A1SA 3CF2A 2UZ3A 2PH1A 3DKPA 1UBEA 5AUPB 2RGXA 4EFLA 1KK1A 1N25A 1NJFA 1UADA 4QHTA 1XD8A 1HUQA 2R62A 1GL9B 2YVUA 2ZYVX 4D0NA 3EX7C 1X86B 5B2ZA 4L8GA 2HCJB 2QM7A 4A1FA 4PHHA 1M8PA 2C95A 4S2EA 4D4JA 2PZFA 4QBGB 4PAOA 2Q3FA 2CEAA 3I3SR 5BXQC 3AF4A 1TMKA 4X8LA 3R8FA 1QG4A 2GJAA 2RGDA 2GXSA 1YZKA 3P4XA 3LBIA 4OQXA 4BFSA 4ARZB 4IDNA 821PA 2V3CC 3KX2A 2JASA 2REBA 1NIJA 2ZE8A 3T1TA 5CITA 1MO6A 3TW8B 1QHHB 1UM8A 2WWFA 4HLQB 3VNVA 1XTSA 3WY9A 1NLZA 3CWZA 4QBHA 3LBHA 1S3GA 1WBDA 3W6PA 3A4NA 1VHTA 1J7KA 2ZE6A 1XTJA 2VSXA 5CJ2A 2EFHB 4DLVA 2ODBA 1GILA 3IKJA 2BJWA 2CNWA 3GQBA 1G17A 1W4AA 4US0R 1AZTA 4YMVA 1YE8A 2QN6A 4NYIQ 1J90A 4CEHA 1NBME 4XTCS 2Z0MA 2P0EA 2XGJA 4CYMA 4A6XA 1KIMA 1KHTA 3NWJA 2W6JA 4MKIA 3NC1C 2ORIA 4Q66C 4PSVA 4OK6A 4B76A 5B57C 4V0LA 1HV8A 2QQEA 1UBCA 2HUPA 5BQ5A 1A1VA 2OLJA 4G0NA 3ICQB 2J5XA 1NSTA 3BFKA 5HPYB 1COWA 3QBTA 1Z5ZA 2B92A 3C7KA 2VP0A 4A2PA 1XZPA 3PR1A 2Q6TA 4RFSA 1V5WA 5IHPA 4AK9A 1XU4A 3U6KA 3O8BA 3UWKA 1RRFA 3NBFA 2CK3A 2EWVA 2ZJAA 3PUXA 4RVCA 1D2EA 2PEYA 2VP4A 2OZEA 1OPXA 3QSYA 2IS1A 2GCOB 3TR5A 1W7AA 3LA6A 3B5JA 3N2IA 1U8ZA 1HY3A 4C0KA 3D8BA 2JLXA 1NVVR 5EUQB 4EPRA 1XEWX 4PQRA 2OEPA 1RC8A 3VNUA 1US8B 5AUNB 1R8QA 2QSYA 2ZEJA 1S1CA 2ZI5A 1E2JA 1U98A 5JMTA 5IRCD 2YC4C 3BFVA 1TX4B 2V54A 3KKOA 1T4GA 2DFTA 1C9KA 3AUYA 1OXXK 4R71A 4MDFA 2O8FA 1Z29A 5FPHA 4BLQA 4Q4HA 4EAQA 4RCYA 1MO3A 1E0AA 3B2EA 1N6PA 3K0AB 1IN8A 2HXSA 2JJ2A 5C1BA 1F60A 1A5TA 1KDRA 2FFHA 2Z4SA 1EFTA 2CCKA 2Q9CA 4LBWA 4LPSA 4D4KA 3VR4A 3AVXA 2P3SA 1CF4A 2BVNA 3G5UA 4I1UA 5A5GA 3FMOB 3LD9A 1GIAA 1IOZA 1EX6A 5DLQC 1NKTA 1OFTA 4DLYA 1KY2A 1COWD 4KFUA 2ZRPA 2ZJBA 4M22A 1W4CA 4HAVA 2C99A 1Z63A 4LOAA 4OL0A 3TW4A 3VHXA 3WBJA 3O8DA 2YOHA 2QPAA 4HDQB 4C7OA 1R0YA 2XJ4A 4RJLA 3U7HB 4NZYA 3REGA 3TBKA 1XMVA 3U6BA 4LHZA 1CR0A 1Q1ZA 3ND9A 4OHXA 4NCKA 4Q4AA 4Y0AA 3DVLA 3RNLA 4HLCA 5J4HA 4FN5A 3NDBB 3GJ3A 5CK5A 4A8JA 3KJIA 4TZ0A 5LB4A 4US2R 2PJZA 2GF9A 3TUZC 1PJRA 3OIYA 4BE7B 4LV8B 3WYAA 2F6RA 1ZMXA 2ZR0A 2ZETA 2XX3A 4IW3B 5BWMA 4TQUS 1DAGA 3A6PC 2DWOA 1ETUA 2DHRA 2B8WA 3OIUA 3U44B 2G88A 3QEJA 1KKLA 3DOFA 2J9RA 3RS3A 1M2OB 4LY6A 1CBUA 1SKYB 1H8HD 2GILA 3CWQA 4NCIA 5A0FA 3RC3A 2WWWA 3CPEA 1KI7A 5AR1A 1T0HB 3K70C 3FWYA 2EYUA 4DCVA 2Q9AA 3MAAC 1F5NA 3KQNA 4I4LA 1XTRA 4IRUB 2ZR9A 2ZRLA 1E2GA 4PX9A 4GP6A 2HCBA 4JLJA 4KYIB 5CB8A 4YDSA 3CX7A 4M8NE 1Z6XA 3PEVA 2WTUA 1TF7A 1DAKA 4JL5A 3CNOA 3FFAA 3D7MA 1G3RA 1XB2A 3WYGA 2BV3A 3THWA 3AVUA 1E2DA 4MRSA 2D7CA 2F3TA 4FWIB 4B32A 4EPXA 2R65A 4B74A 2VP6A 4KFTA 2FMXA 4OQNA 3MJRA 3GJ6A 2IWRA 3QKUA 2QPOA 3CONA 3RDPA 1ZM7A 1M6NA 2PJRA 2ZAOA 4Q1EA 1ZM4A 3IBGA 2WBLC 3QIAA 5DE3A 3T1OA 4LBVA 2RCNA 4M0LA 2PL3A 3A8TA 4MYCA 3K53A 1N5KA 2GCNA 3CPJB 3RRMA 3I62A 4PTLA 1ZIOA 3L0OA 1AQUA 4B34A 1PV4A 4R98A 1SVSA 1W4RA 4LJYA 1DS6A 4DSNA 4DZZA 2GAOA 3WMFA 2CE2X 3QF7A 3X1DA 4OYHA 1LNZA 1MR3F 2OCBA 5E7IA 4HI0E 2PMKA 4CW7A 5DN6A 1JXMA 2QRNA 2C8VA 1XPOA 3RABA 3T34A 1ZIPA 1BMFD 1N6HA 2F43B 1U94A 4QM6A 2FFQA 1XEFA 5JJLA 1H65A 1VHLA 1IY1A 1FFHA 4BLTA 3K09A 3GP8A 3SBEA 4W7SA 2GNOA 3T1QA 4HDOB 2OCPA 1E2IA 5JCZA 2IEYA 2R6AA 2IC5A 2CLDX 1VCNA 4TYPA 3IQWA 2O52A 5C18A 1W2HA 3KUDA 2ORWA 1D8TA 2PT7A 3OE7D 1S1MA 2IYYA 2D7DA 4OHZA 3JZAA 5L3QB 4RD6A 1HT2E 4JBWA 2A5DA 3QE0A 3AQ4A 3TGPA 3SJBA 4WZBE 4DEXA 3ZQJA 2FPMA 2PCJA 2ZS7A 1OXUA 2H18A 2OO7A 4Q4JB 4KO8A 2IWHA 4QL3A 4NDZA 5B58C 5GADl 4Y0VA 3CO5A 4AKEA 1ZU4A 1GKIA 2IHBA 4B48A 2DCUA 1W48A 2FWRA 4RKFA 4DB4A 2O8EB 3A1WA 1JECA 4M1YA 1E9AA 1H8EA 3X1XA 1F2TA 2ONKA 2QZ4A 3B1VA 3HR8A 1R4AA 2Q9BA 4ILEA 4FINA 1KK3A 4HB4A 2IF0A 2FZLA 3GLFA 5JWOA 4C2UA 2WJIA 1KI6A 4WZ6A 3VU9B 2A2ZA 2UVQA 2ZROA 2FEMA 3K1JA 4RKEA 4PXAA 3TNFA 2BM0A 5DO9A 3SOPA 4B73A 2ZVPX 1TU3A 2DFKB 3HJNA 4PAQA 4BECA 4DLRA 2J41A 3NEYA 1S4QA 1EX7A 1N6IA 3CKLA 3DL0A 5G41A 1XTQA 1RYFA 4ERNA 4ZKDA 2ZSAA 4PC1A 4A8JC 3OHMA 1QBKC 4G3XA 3GJ4A 3KJEA 2WAYA 4TMVA 1XF9A 1WCV1 3W5IA 4QG7A 2BMDA 4JLOA 1T5LA 1WXQA 1WE2A 4MDEA 1EGAA 2NO6A 1O3YA 2F7SA 3MUFA 4BFVA 1A2BA 4D2IA 2NZJA 3EC2A 3OFNA 3MMPA 3DOEA 2QPTA 2CHVA 2IYSA 3SHFA 4EPVA 4YLGA 3RRNA 2QT1A 4YMWA 3HPRA 3WMGA 3LQQA 2ZRHA 2IEZA 3TQCA 4RZUA 1E4YA 3ZYCA 5KYKA 4QXAA 2W58A 4ACAA 4F91B 3GCGA 3QPUA 4LC1A 1MKYA 3EAQA 2CVFA 4DCSA 3KDSE 1W5TA 2E87A 4ZCMA 2VLIA 1UKZA 3MG9A 2WHXA 2J3EA 4FIDA 3GLGA 3UMRA 4PANA 1AN0A 1FPMA 1GL7A 5E95A 3R7WB 1VYUA 2EFEB 5H68A 1OHHD 3QKTA 1DADA 2HEIA 1J8MF 2A78A 2CE7A 1RKBA 1TAGA 2VF8A 1P75A 4HATA 1Z8FA 2DFNA 1DARA 2QBYB 1BOFA 4LJ6A 2BEJA 4W5HA 5DYIA 4MITA 3ZZ0A 3ONWA 1FUKA 3B78A 2O0JA 2R9VA 3FYHA 3EASA 2GTPA 3ZD7A 2J46A 4Q03A 4B3XA 1L4UA 5M04A 1XXHB 1E2NA 2OBMA 1E69A 4PPNA 1SKYE 2R6GA 1E96A 4XJXA 1IY0A 5JRJA 1CRQA 2CLSA 4RCZA 3EPKA 2J7PA 3Q7QA 2P5SA 2REOA 3B60A 2P6NA 5CM8B 3MSXA 1P9NA 1XBTA 2CLCX 1QHNA 4JKYA 1SXJE 3WRYC 4NKRA 1RPZA 1E3MA 4HYYA 1FNNA 1WF3A 5LD2C 1ZM3A 2WJHA 4BEJA 3NC0C 4NYJQ 5D3MA 2XZPA 2YOGA 4PC2A 3FKSA 4LC0A 1E2MA 2F1IA 2XOKA
chains in the Genus database with same CATH superfamily
4KQJA 5B4VA 1JBKA 4P8RA 3HUUA 3HKBB 2R5WA 2X4IA 4CMCA 2WF7A 3K0SA 2PT9A 3LC2O 2JZCA 4XFJA 1VOTA 2QD4A 5LJLA 1D4AA 1IHXA 2HMVA 4TL8A 3UEOA 1CJKC 4Q16A 1EFKA 4UCFA 4XYGA 3RSFA 3BWBA 4RLHA 4DSUA 4BNTA 2HLDA 1ICEA 1MQ8B 4S35A 1F17A 4HX5A 3L0ZA 3OU6A 4CFYA 4U3JB 1NLUA 2QUBA 2C5FA 3PG5A 5DIFA 2P79A 4PSDA 2HR1A 4EENA 3CXUA 5IARA 2J5RA 4QGSA 1N78A 2OXRA 4MAAA 3UYKA 3MWYW 4NE9A 2QD1A 5K2MA 5LL6P 3DNPA 1B2RA 3SIWA 4CL3A 2J4DA 5KJEA 5LWHA 1OLXA 4RAOA 4XZ3A 3ZXXA 4C43A 1NZJA 3PUVA 5BW8A 2XKKA 1M2GA 5FD8A 1TFRA 3UKOA 1XCMA 4FYJA 3TB6A 3ZLTA 2KMLA 3D6AA 3E3LA 2OPHA 3PFIA 3AL2A 3V6LA 5A2QA 1ZFNA 2W6QA 4Q9HA 3IOBA 3D1LA 4ESOA 1GLNA 3EGXB 2AIRA 2Z83A 4I6GA 2GEVA 4L5JA 5FTKA 3IBTA 4E4YA 1EE2A 1WXXA 3ZUGA 1MIOB 4MRRA 1U0NA 1MA3A 4FMBB 3IKVA 5LQMA 3WIUA 1JILA 4P08A 1HDEA 1PQYA 2XOKD 3UIEA 2P78A 2ZUBA 4BKUA 4X93A 5CXXA 3DLBA 4NX2A 4K9PA 1V1MB 3UQYS 1QV6A 1JFFA 1QO9A 3L02A 3ELBA 1HE4A 3MTJA 3DM9B 2XHZA 4PLPA 3S2EA 4JQCA 1E2BA 3ZDQA 3RV4A 1VP3A 2PT5A 1SHKA 1YS4A 1RZ3A 4K6GA 4D5GA 1K2WA 4QEKA 2GZ1A 4B85A 1IOVA 3D6UA 1CNMA 1NHWA 2Z2IA 3FCUB 3V4FA 1HDXA 3KKPA 3R3UA 5IFKA 1Z6PA 3G8AA 3JPWA 1T36B 3GPBA 3O4RA 1L5GB 1MVLA 3CSSA 1U0BB 1KP2A 1TKRA 3I52A 3EIOA 1T5TA 3FHOA 3ZDEA 3LT0A 3P2MA 3VVBA 1GRRA 1QWSA 4FFMA 4J16A 3IQDB 1ANKA 1VRCA 1RMTA 3K1ZA 1WZUA 1LGYA 3QYAA 4DIBA 5C7OO 2VTDA 2NUTA 5KKCA 4EUNA 5HKAA 3GT3A 1ADGA 2NUAA 3TKLA 2MSEB 2K6GA 2VYND 4PG6A 5A71A 3MS4A 4OJNA 4AVYA 3UBTA 1C14A 1L5MA 1V2GA 1VPVA 3FFXA 3HC7A 5CX4A 3DTTA 2PTGA 1QJCA 4PONA 4ZYXA 1VSQA 5EHZA 2FWIA 3A9RA 1N8TA 4JJIA 3DTVD 3TEFA 4YX9A 4LJKA 5JJCA 4YXWD 1X80A 5JFOA 2IVFA 3IT0A 4UU8A 5B3JA 3FMVA 4DLKA 2AUTA 5TMEA 2G4VA 3AEQB 3W9YA 1SXJA 2VRWA 2VTBA 2WIKA 4ARAA 1Y3IA 3UWSA 3LXUX 4C4AA 3O3NB 5EQFA 4Y2YA 5TVGA 3MQ4A 3NYIA 2YDXA 2V5AA 3TTYA 1MOZA 2FSSA 3FUCA 5KDLA 3G7SA 1DLJA 3AW9A 3K96A 3C7AA 4OTZA 2UU9B 2GBIA 1E63A 5AI9A 2P67A 2REQB 4F21A 3MPUA 3C41J 4EI7A 1ZHHA 1N2CB 4IQ8A 1J7JA 4JCCA 4UMFA 3ZD9A 4S05A 3C1TA 4KGXA 4DY6A 4QXPA 5EY5B 1V45E 3C5EA 3TIXB 1E6MA 1S4MA 4B0OA 5DYTA 4R7GA 1R6VA 1BXGB 3IJEB 3TR6A 4R31A 5CXQA 3DE1X 2V6FA 1OKKD 2E1RA 2QDKA 4ER3A 5K99A 4X41A 1F20A 1B2LA 2QXUA 2YCLA 2F1JA 3EZLA 4U6NA 3V2GA 3ULKA 2KHZA 3MA0A 3OT4A 2HPHA 4IGFA 1PFWA 4ND8B 3QWHA 3GELA 4WJZA 2HMTA 4K9RA 4EHLA 5JASA 5JAZA 1AXRA 1T8YA 3STXA 1ZJJA 1FXUA 1GFSA 1QE5A 2NU7B 3H05A 3HGQA 3L1HA 3F46A 4LYAA 5ESDA 3DE5X 5TPWA 2Q45A 4RZQA 3IXMA 3GLQA 3KVYA 3NM5A 4A4DA 3T9BA 1NE7A 1GLGA 4P3NA 5B37A 3TQFA 5JDIC 2XNDA 4ECAA 1LJUA 1FDTA 4LTDA 1J9EA 2IUUA 3AWIA 1X9IA 2XCLA 2QJFA 1JS1X 1KYVA 1T35A 1JJBA 4JVOA 2WZBA 3G2HA 3T3DA 3W7AA 2NIPA 5JBQA 4B2IA 2GUGA 3LNTA 1DV1A 1WIWA 4KQHA 4YONB 4I1VA 5FOUA 1H4SA 4FBLA 1DAEA 3WJ7A 1LTHR 4ZVUA 1Z28A 4MI9A 5JQGA 1ISPA 2VXBA 2R6JA 1YUMA 2ZYRA 2H0RA 3TZKA 2Z1NA 3TK1A 3HCAA 3OEHD 3NPAA 4BJ6A 2FPSA 3EIQA 1QTRA 2IDJA 3GOHA 4HDRB 4DPMA 1JAZA 4C89A 3D5QA 4TKLA 1YHNA 3KEOA 3U2QA 1FFGA 4MLPA 2ECFA 3VSAA 4CM8A 1JR3D 2OFOA 2HX1A 1DBSA 4PYLA 3UMBA 3STHA 5LP6B 1D2NA 2DR3A 1YR1A 5JI2E 2DKOA 5CB6A 3IOYA 5THQA 3I01M 5LOVB 4C0KA 1QFZA 2GD1O 1ICIA 3CWCA 4WCFB 3TLXA 1M5TA 1NLYA 4M83A 1H2YA 2JFXA 4I9UA 3F47A 4X65B 1RJ9A 2RHCA 1G2QA 3SS9X 3MJEA 4G8BA 1F3OA 3WK7A 2P4HX 1U0JA 2XUAA 1QP0A 3JWHA 4JVLA 3RUCA 1FFWA 1PJZA 1UPXA 3BXEA 4LXUA 5FL7D 3RU2A 3ZE8A 1UJ5A 1O6GA 4IOMA 2PSDA 5AI5A 3H86A 2VPTA 2PGDA 5JROA 1KDZA 5D1HA 1HLFA 1TGYA 1RPNA 5EGNA 1O0CA 3DMGA 4I5GA 2ARKA 1UBLS 3ND8A 3HR4A 4BNJA 1BFKA 3RUHA 4BO9A 4W1QA 5AW7A 1L4BA 2O2YA 2H65A 1OLSB 2ZUWA 3KT0A 4N6GA 5TT1A 3Q40A 3UCXA 3I2FA 4FB5A 1NXWA 1SJ9A 4N3BA 4O8ZA 2IYTA 4A16A 1J5EB 3QW4B 1PN3A 1HDIA 4E03A 3HA5A 2Q7DA 2DUUA 2AJLI 4PU0A 4A5SA 7REQA 1KP9A 2BFBB 3LPAA 2VCYA 5J2TF 5F3DA 1T26A 2GJKA 1NRJB 3I8XA 1FNMA 4IOJA 1A98A 4M36A 5B1IA 3W6NA 1FRZA 1QZUA 4B6OA 2KSQA 2PH7A 3EXAA 5HRAA 3QJGA 4RHEA 4TMTA 5E6SB 5F7ZA 5THXA 4CNQA 4QJ3A 3T5MA 1Z5WA 2FZGA 4J16C 3L8YA 4P4SB 2BCEA 2I1LA 1VFPA 2XVYA 1M33A 1OLUA 1Y1RA 1IRIA 1MZVA 1PVVA 3AR2A 3H11A 5IBRA 4RVSA 2Z5VA 5TARA 5A4AA 5KYXB 2AA3A 1UEJA 1BCRB 1E6EA 1F2UA 4ENTA 2ORED 4XASA 4XQCA 4ZOLA 3LYAA 4FNOA 1T2AA 3AETA 3NWBA 3S2GA 4EKGA 1R0WA 3M6IA 5HDBB 1XDSA 1MB9A 3DAGA 5EWJA 5U9CA 3RC9A 4R1MA 1KQOA 2WFMA 3C0KA 4M3NA 3V8QA 3EPHA 4RANA 3CYFA 2PR7A 4N41A 3HB5X 4BP9A 3OZVA 4FN4A 1C29B 1KSHA 1SXJC 2WHEA 3ICWA 3UANA 4KPGA 1SH7A 1SUPA 3S68A 2VYVD 4BNWA 3USCS 1M8JA 4N3NA 3CZPA 4CMEA 5A0TA 4O8CA 3E4CA 5CVDA 1G6Q1 3P9RA 4ENPA 1ZGAA 2IU0A 4XJSA 3V1YA 3ZIAA 1Q44A 4CKBA 3UMFA 3CX8A 4YRJA 1W44A 4EA6A 4HLDA 3MOGA 1MABA 1U7XA 2QT0A 4OJTA 2VHWA 2Y93A 5CA1F 4X44A 1DT5A 4MVJD 2W0MA 1N6KA 4DR1B 1BXZA 4D9HA 1NF9A 2F2TA 4JUAA 3T94A 3E8MA 4QU0A 3MJFA 3ZZUA 2NPFA 4ZXFA 4V0NA 1G66A 4UDNA 4BO5A 4CR6A 1KJIA 4QGHA 1M6VB 2FP4A 3ZQUA 1NW9B 4HGZA 2HY7A 4IX1A 1L0BA 1T0JB 1UBHS 2AK3A 1C3EA 1NTOA 5FOWA 4F56A 3MUNA 1I2CA 1Y4ZA 1XTZA 1O95D 1VKRA 3WO0A 4AM8A 4F60A 4ZICA 2VF7A 5DXJA 5BY2A 1FF9A 2I7CA 3KL2A 1WBBA 2GNAA 2EFDB 4XPZA 5JNTA 3IVXA 3RYCB 1XVAA 1ZKDA 3QYJA 4Q7LA 2VRBA 3CVUA 2VA8A 4OP1A 2O9JA 4XQ9A 3PUZA 2ZUCA 1ZHOA 3G2QA 2C2YA 4GI1A 1IK6A 2UVPB 4GRAA 1Y8CA 3HABA 3DAOA 3H5VA 3JQAD 3F2IA 1MC1A 1Y4DE 2A5YB 4LN1A 4YI3A 3BDVA 3V4SA 4TM7A 3R5FA 3H42B 2HQOA 3ANXA 2OYSA 3GCXA 4I9GA 3FD8A 4QUEA 2CNWD 1II8B 3AEUA 3MCUA 1Z12A 1DX6A 3ZZNA 3ZS8A 1CT9A 2XOEA 1APBA 1SOAA 4CN9A 1C30B 2XT6A 3D4NA 1VIAA 2WLSA 4F4UA 3I6MA 5JS6A 4N0EA 1OZGA 1WB4A 2C0CA 3H9UA 2RGRA 1QU3A 1YDFA 5ENDA 1VXOA 5AWFC 1XK6A 5B3AA 5FBLB 3IIMA 3MIZA 2OQRA 1A9PA 3PWKA 5EA2A 3LK7A 4QQFA 5DLEA 1GKUB 1ZRNA 2F1KA 4Y30A 2FLVA 2OLKA 3O31A 1QVVA 4RKRA 2G70A 1QGUA 2LD4A 3Q8XB 4DFDA 2ZYGA 4LK2A 3ZDDA 1O6FA 4CEJB 4ZZ3A 4G0ZA 1MQAA 3E81A 3U7GA 1E9VA 4HAXA 2AN4A 3QXHA 3GF4A 3CXRA 2G0NA 4GOMD 5B1HA 3EQ9A 1DOZA 2F8LA 4OEHA 4F06A 2C7QA 1F8XA 4WZAE 1U1DA 5CH8A 1MBZA 2EZUA 1K98A 3H2SA 1YS7A 1ILWA 3I9V1 1NUQA 2ZYDA 1Q22A 1XDDA 1X1RA 4Q1AA 4QPDA 1HE1C 2UUPA 3Q8WA 4HDKB 5ALNA 4CWAA 4GLJA 4H7EA 4W7HA 3DOHA 2J48A 2G6BA 1KI9A 3QZUA 5LA6A 3UJ3X 3NBUA 2QZJA 3TIFA 1WQ3A 3A14A 4BMZA 4D9KA 2KM1A 5GMOA 2I6SA 1KFCB 1U2DA 3HGTA 3VR5H 5JTUA 1NBIA 5BPHA 1AZSC 5F3RA 4BAGA 4G56A 4M54A 2ZXFA 2ZBVA 1RI1A 3T7RA 5JSYA 4P7JA 2OCLA 3KKQA 3N5CA 1P31A 2D1FA 3GEBA 5KHAA 2AC4A 3RBXA 5BSEA 3ZIDA 4WGFA 3BAFA 5HF8A 1L7NA 1U0HC 2NU9A 2JHCA 4FCCA 3PCXA 4TSKA 1N5JA 1NMSA 2C57A 1NBMA 1SIOA 1FP7A 1UR5A 3HSKA 4OHWA 4P35A 5ANRB 5EE0A 2Q2QA 3VR4D 4B80A 3U1BA 3W7BA 4D8YA 1BQEA 1G4UR 5M7EA 3JYNA 1JDNA 4LPKA 1MG5A 2VHTA 4QVKA 3VVCA 3ZVLA 4Y6QA 5JCOA 4PGGA 2ISSD 1RWKA 3U0VA 3GUCA 2A4MA 4RELA 3A1VA 3NHZA 4HGYA 5IJAA 2DWCA 3A1DA 4LYGA 1N2JA 4M98A 3F6BX 4LXHA 1Q19A 3KTFA 4WBSA 2WT9A 4FC7A 4R8VA 3G68A 3BWDD 4BFYA 2CL6X 2PCLA 4TQGA 1ZGHA 1JIKA 4O6VA 2OHFA 1DC6A 1AT1A 2GVNA 1AGXA 1UP4A 2PDAA 4QJIA 1C4OA 3T5CA 4YV0A 5LMUB 2OV8A 4MWGA 1NE2A 1I80A 2W22A 3A1UA 3VHLB 3WK4A 1GA1A 2HCTA 3GD7A 2YFYA 3IPCA 2GH1A 2WWIA 3LCUA 1GQFA 1RYZA 5CCDA 4UU7A 3TDNA 1OTXA 4BN5A 2NNWB 3VZDA 3OF5A 2IHNA 1NFQA 3Q7RA 4M8IA 4L22A 1DELA 5DYGA 4HAZA 4J4TA 1ZGZA 3AU8A 3DNMA 4LHVA 4YBZA 3C6XA 4KR3A 4A3SA 4CMEC 4RFLA 3P8ZA 2VJMB 1I3LA 3AONB 4IHQA 4ZTUB 2HJHA 3AVYA 1T8TA 1Q3KA 1ULZA 3C3BA 2C54A 1OIXA 4Q3OA 1IUOA 3NT2A 1M8KA 2FW6A 3PRKE 1A8HA 2GZ3A 1KR2A 5I9NA 3HE3A 2FW8A 3FPJA 3C3XA 3LSTA 1LLQA 3QE4A 2P5TB 3D5TA 4YHHB 5KJFA 2QY9A 3GEGA 1P0PA 1BE6A 5FI5A 2IF2A 2ZJFA 5BN5B 3X1MA 4Z4QA 1A7UA 3HDGA 5AKIA 4AX8A 5IKXA 1TVKA 5J43A 5GGYA 4BLSA 1G98A 4Q3LA 4URZR 3GRYA 1CUAA 1JLLB 3PGXA 4TMWA 1PUJA 3P7MA 2OD7A 5IX8A 3AJDA 5ALMA 4C29A 2I3DA 1BJTA 3CU5A 3E0XA 3KSUA 3TSWA 5HJEA 2RHJA 5JD4A 5BW5A 3D4PA 2H31A 2XE8A 1A9QA 2EEPA 2P8SA 3LQ2A 3AIOA 1PJLA 1SWVA 4F5DA 2DUMA 3OMLA 1H66A 2DRIA 2I2DA 4L4RA 4NK4A 1IAQA 5JAPA 3PUKA 2MOKA 4LWPA 4GP7A 3ADDA 2MSDB 2X1HA 3FPHA 3WX0A 3PXBA 3WXBA 2Q62A 4MX8A 4TYWA 1GPKA 5ALYA 4OIFA 4Q6WA 3ZBPA 4LDZA 4DLSA 3BSSA 3IV6A 2FCRA 2FWMX 4Y7DA 5AVYA 2VQSA 3NBZC 5ARBA 5FUVA 2PBFA 1U3TA 2Q49A 4GZ3A 1ISFA 2G83A 2VZ9A 1K92A 3VOSA 2JCYA 5BSMA 1F9EA 1TQDA 5HCUA 3TJMA 4DXAA 1YL5A 3IDSA 1SUIA 3QMPA 1I2BA 1TA4A 2PRZA 5DN9A 1KO4A 5DGIA 2LTAA 1O9HA 1OFIA 2Y05A 2CYCA 3AFOA 4UBJA 1DIRA 2EW2A 3ZEAA 3KQTA 4QUGA 1W4BA 2RBEA 4I4TB 4RZXA 2BONA 2G9ZA 3SCZA 4MQ5A 2WD9A 1CR1A 1J8VA 4R16A 2CLLB 3OQIA 3MT8A 3IEMA 1NMEA 2ZSJA 3BF8A 4ZO6A 5FI1B 4DA8A 1L8XA 2I8LA 1YFLA 1CTQA 4DLZA 1RHKA 1QZXA 3WB0A 3ZQ4A 3EFHA 5IDQA 1G1AA 1FW8A 2EIXA 3QVWA 4YRMA 4ZDIA 2QTLA 1E1YA 1W36C 4P32A 1MT0A 2JATA 1H69A 2VNIA 1O6ZA 1XVVA 4KH1A 1AZWA 3T15A 1GPH1 1RJDA 3QVOA 4MVJG 5BVHA 4F85A 5KYGA 4ZKEA 3AVTA 2J5KA 4UM9D 1MX9A 3TSZA 1U2DC 1DSSG 4IUYA 2ST1A 2PUBA 4AMBA 5K0ZA 3AIMA 1CERA 4GVXA 1Q7CA 1SK9A 3FCXA 3L7YA 4OQ4A 1XUOA 3KQKA 3HNPA 4DCOA 1T2UA 5FOQA 4UZFA 3ZVRA 4DCTA 1PGOA 3T9EA 3NFYA 1UBRS 1YASA 2IU3A 1T24A 4IYRA 2JD0A 5CD1A 3HV2A 1WW3A 1RP1A 4HDMA 4V03A 3SLKA 4TWBA 3GGDA 4OQMA 3OETA 3MGGA 5TMBA 1N0IA 3RB8A 3SM3A 2Z5LA 3OCCA 4Q37A 3CH5A 3IQFA 4Y2HA 1K8RA 3UT5B 3LXXA 5I7RA 1EEHA 3CF0A 1ZSNA 2IUEA 1L3CA 1BWQA 1U1IA 2VAXA 3SXUB 2DC1A 4W8HA 3TDMA 4E5KA 2OC9A 4EJ0A 5C5CA 1GYQA 5JCOC 4FSXA 3HEMA 3M6LA 3K9FC 3QXCA 4LE1A 4D98A 1WUKS 4YCBA 5K3BA 1QGYA 1WOYA 4NONA 3FOAA 4AP5A 1V4VA 4AIIA 1PR3A 3JQAB 5JD3A 3HNOA 3RFVA 2HWXA 3SEFA 4DCJA 4HVLA 2EZ4A 1EESA 2DTXA 1GPJA 1OH7A 1L4KA 2FWPA 4AJJA 2BKAA 2XVAA 4ARZA 3VM6A 3ZZMA 1VBMA 3HQ4O 4E4TA 4NOJA 1Y8QB 3CRMA 1ZA1A 1DTEA 5KREA 2NT3A 4LTNA 3VOAA 4CEHB 1P61B 2X5JO 3Q8MA 2GZDA 5A5FA 4O4IF 1Q20A 2QX6A 5HRCA 1QOPB 2A92A 1CR4A 1XNJA 3DE2X 2ZRJA 3Q7IA 1ZVKA 3M1IA 4DIEA 3EQ2A 4KXVA 1IYZA 1OMOA 3MWJA 1H1LA 3P0HA 4FYXA 3IIJA 4Y9TA 3U3OA 1RVV1 1SM4A 1E1QD 1XMIA 4QFCA 4RNCA 4EUSA 5FV4A 2ZSKA 5J5CA 1XTVA 4OI2A 1CY0A 2GPWA 5EKUA 1E3DA 4YYEA 4X90A 3T3MB 3B5IA 4RFSB 4RK0A 2PNJA 3W5BA 4HNSA 4F2DA 1IBRA 3WL5A 2J9FB 3CVJA 1GNSA 4OB7A 1TPZA 1HZZA 3UCEA 4D7AA 1Q6ZA 2SHKA 3C3MA 5KEIA 1WMFA 1QF9A 1P7ZA 5B53A 4OHCA 3G2MA 2ZYAA 3B8EA 5FI0B 1TD1A 1IN7A 3NDPA 2X6TA 5KVSA 1NFRA 1X0VA 1GR1A 1O8CA 3O4FA 1QNLA 2YHAA 4OATA 3LHDA 4ZT3A 3FOZA 4MIOA 5FTWA 2R8XA 4TVKA 2XB9A 3H5RA 3W2FA 4PCVA 1LPMA 1CEYA 4JBNA 5J2UA 4DMUB 4B45A 1W93A 2V55B 4L5IA 2H2DA 2HB6A 2YZ7A 1QYXA 1W0JA 4Q3CA 2O8FB 1CPYA 4IL5A 3WADA 5IUNC 2Q1UA 4J4HA 4PZUA 4C0JA 1W0CA 1ZQ1A 4CM9D 3K0CA 4XJTA 2GCOA 3S8YA 2JHAA 4E3WA 1DCFA 4ZEXA 1JV2B 2I03A 3TVTA 3I6QA 4CNBA 4FGUA 1K7EB 2W93A 4BASA 1D1TA 5KQGA 1WZNA 5L45A 2YXLA 1R6TA 1ULBA 1Z75A 3COWA 4FT2A 3C4VA 3QITA 1J5XA 4AMGA 1QOZA 2C8KA 2JGDB 1NJ2A 4ZREA 3DBLA 3GFGA 4LI0A 5ETJA 4A8TA 2BFCA 4QNNA 4BNLA 4CE6A 5GZ3A 4EG4A 3IAXA 2C29D 3NV7A 4IO1A 1ZK1A 2J7PD 3PJRA 1XZIA 4YP6A 4XWOA 1NQUA 1H3NA 5F2EA 3VHXB 1NOIA 2ZIXA 2EKQA 3L1KA 4B6EA 4LJ8A 4MAFA 1NRWA 1GPBA 2B37A 4RY9A 1T2DA 3AI1A 3ISTA 3K0AA 2ZZMA 5KINB 2DQYA 2XKJE 3U4DA 3PWTA 4YC7A 2GZRA 4MI1A 5CYFA 1EP9A 3PCTA 1G38A 1JJAA 3G9XA 5HJ5A 4OHYA 3KRTA 5CMLA 4PYOA 2FFBA 3FKSD 5C4GB 5T4FA 5CAEA 1M1NB 1PJCA 1ORHA 4YUAA 1ZEMA 2NVBA 5DPMA 3RYHA 1TQ4A 3RUPA 2HTEA 3U7JA 3M1YA 4TQ9A 4II2A 5FBHA 1FMCA 2OV4A 3W8FA 4QT4A 2GS9A 4I8DA 1VPLA 3K9WA 4S1OA 4BMDA 4OX9B 3TJZA 4IWXA 4V39A 1ZY2A 4XGRA 1HYGA 2PY6A 3P9KA 3I2JA 1JB9A 3BG5A 3SKXA 2KE5A 3IUMA 5D84A 2AEJA 2J6HA 3F67A 3KPWA 1H2RS 3BMQA 2XCTB 3JASB 3VA7A 3WQRA 3FZNA 3L7JA 3S2IA 3VC7A 3EFOA 2ID4A 4G5GA 1PYGA 4OO3A 4XWWA 2B7BA 3PUYA 3ZWCA 1FTWA 2ZI7A 2NU6B 1JDSA 1OXSC 3PX3A 1JKXA 4FNGA 4TV8F 5IUKC 1JHQA 1R10A 3EIFA 4K9MA 4RJJA 2FR0A 1EM6A 2QX4A 2QTCA 2XQKA 1C80A 3RJZA 1IG3A 2Z6AA 4IRXA 1OU4A 4O4JB 1SVLA 3IKLA 2CV2A 4V24A 3ESBA 2J3DA 4RAQA 1NN0A 2HDHA 3L04A 4E21A 5AW3A 1IFXA 1M2OA 3R5JA 3AYZB 4PSKA 1VJDA 6ADHA 1SBTA 2QRLA 1NBOA 3ANNA 5E0OA 1XQ6A 3K4HA 3OIGA 1AKNA 2WJWA 2HUNA 1NF8A 1XKTA 3EUAA 4I08A 2Y68A 4RHYA 3SVZA 3FI9A 5IYZA 3MHTA 3G0HA 1KH2A 4R2XA 1ACJA 2PS0A 4F3RA 1Y0BA 2IODA 4XSHA 1YCDA 4N82A 1MRSA 4CV2A 3IR5A 1GZSA 1KSFX 3M4JA 2IYRA 3ER6A 1TCCA 3HYCA 3EEIA 3E0QA 1NQ5A 2DMRA 3GDHA 4CIDA 3IGFA 4WNAB 1HE3A 2PBLA 1E7WA 2IQIA 3G0BA 1GGKA 2C0QA 3ZKWB 1JYEA 1DIAA 4TT3D 5FO0A 1Y81A 1H2XA 5DNVA 4W1SA 3PS9A 4I81A 1IEWA 4A7PA 1ZI8A 2I1QA 2M2IA 3EF1A 2BSAA 2DECA 1X9HA 1FP6A 5K0NA 1TTTA 4JB3A 4MJXA 1B00A 3WRVA 3QX7A 4UU0A 3R3VA 4WSOA 1GJRA 3G13A 3IIEA 1RHQA 4IDEA 1Q7EA 3OX1A 1GL3A 3E2PA 3D2BA 2RFLA 4URVR 3VYWA 1JR2A 1MB2A 1S5PA 1VIDA 4PZZA 1ECBA 4L6AA 3JALA 2HD4A 3BC1A 5HYVA 5JJBA 1HNNA 2JLUA 6AT1A 3AR3A 2AD1A 3GDFA 4DDVA 3Q6IA 3SF8B 2IXFA 4NU6A 1T5SA 1TQ6A 5C1IA 3RW9A 1F9AA 4J0EA 1ISJA 2FW0A 1FVFA 1HZZC 3GJ8A 1C7JA 3ZY4A 1HFJA 4RD4A 3N8NA 1NX6A 3WC4A 2HRBA 4ZAWA 5IC4A 1IU9A 4XLLA 5JJIA 1P2FA 1X2EA 1XXLA 1XTBA 1W6RA 2HF9A 2HA0A 2CFRA 4RV5A 3P2JA 2H4JA 2JFHA 1TNDA 4GOXA 4KIWA 1JI0A 4PLCA 1GZ5A 1NKSA 4C0HA 4RYLA 1VKJA 1I94B 2PA3A 2R5NA 3AVQA 3QQ5A 2JRCA 3IP6A 4UM9B 5TPZA 1JIQA 2BDEA 3FPSA 4BLPA 1C9NA 1KY4A 4MQMA 4YQEA 3STVA 2RKWA 1KNQA 2PXAA 4ZVNA 3FMGA 5KYUB 4JT4A 2GCEA 5HM8A 1RLUA 3ZHTA 3HJBA 3K0CC 4NPCA 3CSUA 2KBEA 4F1JA 1XRPA 4GMHA 1JP7A 2C03A 3KQWA 4E2FA 2GPAA 1KQ3A 4LQDA 2WG1A 1M2EA 2B1GA 4LHWA 2I2FA 4UXJA 4F93B 4WBNA 1JPUA 4PQGA 5CYPA 3T5PA 4HV4A 1EFVA 3TD6A 4FCVA 2EYQA 4YDHB 4DN6A 2R0QC 4FR5A 3HHPA 2VDJA 2D2FA 2WT8A 2IYWA 3H5TA 3A9WA 1T5OA 4GKJB 1PHPA 3UV3A 1PZFA 4JYBA 5EI5A 1TZ2A 2PQ0A 4JJEA 4Q3AA 3WLSA 2RBGA 2MYTA 3GC6A 3QOXA 4L51A 1CVRA 5AM2A 1TZCA 2QL7A 2FKAA 1BJKA 3BILA 2EFJA 2XUIA 3IMGA 4AJ9A 3KVVA 3W1EA 2QN7A 3IB3A 5IT0A 2G3YA 1FQWA 2QWXA 2W2LA 3HU5A 3I1JA 3P27A 2VQFB 3NPMA 3II6X 3LDUA 4Q4JA 4NZNA 2L69A 3EVBA 1KU0A 3ILVA 1RYBA 4PPFA 3PD7A 4QRDA 1OB5A 4K0RA 2R11A 3IDFA 1CQIA 1KU6A 1UC8A 2AEFA 1NW5A 1TEVA 3MCVA 4O4HF 3I37X 2WKRA 3WLHA 4BWYA 4DR5B 1VG9B 1BD3A 3OJLA 3NG1A 3PTZA 4LDAA 4DJFC 5C8XA 1W34A 5HFAA 3MTIA 4ZAYA 3FSJX 1HT3A 4BNIA 5H70A 3O21A 2V7GA 4N5HX 1F2DA 3LT5A 4FFNA 4PAGA 5FUXA 2HF2A 3OOWA 4MW7A 5K0TA 3SQWA 3UAWA 1ENOA 1JHPA 1PZMA 4CQJA 2BLLA 1XRQA 3SYTA 1YRBA 2XIQA 2R6FA 2UZ1A 3SXJA 5IABA 3BD7A 1XFAA 3JAKA 4UMVA 5AOBA 4KU4A 3A1CA 5MN5A 4DV5B 4ZQEA 3ZH9B 2YXDA 2KB0A 5JHGB 2O0HA 1T8SA 2CXOA 3FCEA 4PS0A 5B4TA 3ME5A 3MERA 4DBZA 4DG9A 4DQDA 4CUZA 4B4KA 3G5AA 3W6ZA 4KEAA 1OR8A 1U7HA 1DCKA 2IYOA 1M1XB 1KFJB 3O7WA 2QVLA 4YRFA 2B0JA 2CGEA 3QMVA 4ZT7A 2ILVA 1U9IA 2VBIA 2WP0A 3KQMA 5I4BA 3GLGB 4K0KB 2Y1CA 2R8EA 5D5PA 2FW1A 4WKOA 1T5IA 4CI0B 4P4GA 2CJXA 5CTAA 1JPVA 1D9XA 3AUKA 3ZDYB 1Q16A 3I73A 5C7IO 2PUGA 4GM4A 2EKLA 1C9YA 3UMVA 1ZOPA 4E5VA 4RVFA 4ALMA 1UKEA 4EYGA 1LH0A 1N5DA 1AKYA 2B0CA 2XNHA 3DQQA 3JRWA 3SYKA 3VX3A 1E64A 2OE2A 1ISHA 4BHTA 5HE8A 5KDOA 2P6UA 2BUBA 1N5OX 4BNHA 4BCCA 2ZI4A 3OUUA 4P80A 4JX9A 4ER0A 3V46A 1W7AA 1L5OA 2E21A 4JLWA 2ONZA 2Z4RA 1CZNA 3MCAA 3V8EA 3VNSA 1GUBA 4R84A 5DHRA 3NV9A 4EJ2A 4RK4A 4RLFA 4KK3A 1NOKA 3HB0A 1E58A 3DW1X 4M1SA 1N7HA 1SBIA 3GEIA 4XLZA 2IXDA 3GLKA 1O0SA 4EMBA 4KWHA 5LQUA 3F3YA 2X86A 2E18A 1G2PA 2QR5A 2MIIA 3EXG1 4O2BF 5DI9A 3VX4A 5IZ4A 1I01A 2ZVQX 3H4MA 5K03A 3CNEA 1M1YA 2ZRAA 1C7RA 1Y5IA 4UUPA 3UMJA 1OYOA 1YB7A 5L6LB 5CVJA 4OHKA 1M34E 2OGWA 1RAFA 2PD3A 4O1HA 4MPPA 4WLVA 1Y6RA 1X6VA 4WZBB 3KJHA 3T7TA 4AMVA 1EDOA 4ENUA 2A57A 5AJYA 4F91B 1Z33A 4B40A 6LDHA 3HKCA 4FPXA 2WG0A 5HKKA 4TLAA 3RS0A 1MAHA 1VL8A 5DXFA 5DCWA 2EZ8A 3F8TA 4LWQA 3FR8A 5EPUA 1RWBA 3BWXA 1F8UA 3MAGA 1QZZA 1EE1A 4F84A 3ZTWA 1R4MA 3MF4A 2GAFA 2COUA 1P9LA 3PC6A 3PUWA 2HSWA 1Z83A 1FZTA 1ZL0A 1IWOA 3TZBA 3F97A 2JFGA 4TN1A 1Y9DA 2VNKA 3GLHA 1KWGA 1Y7IA 2R751 1J0EA 1FP1D 2FOLA 2FTKE 2NV6A 2ZKLA 2X2EA 5DHSA 4M49A 5TNXA 3K6SB 1U3CA 1KEUA 3D3KA 4EB6B 4RETA 2EKZA 4L3WA 3H13A 4MYUA 4XUCA 3TPCA 2JI7A 4K9KA 4MLZA 4WLEA 3P96A 4MUYA 2O2ZA 2XYRA 2O48X 4Z0HO 2JH9A 3F90A 3LP6A 1YU9A 4H4CA 4D9NA 3EOZA 3L7BA 3HKBA 3MGBA 4GE3A 4WKBA 3FOFC 1N33B 4ZC8A 1C0KA 1AB5A 3WL3A 4ZDJA 3Q7PA 4YRNA 4FFOA 4UZSA 4EVRA 3FGZA 1QV9A 1UBTS 1GXSB 4G0MA 4DSTA 4MV7A 3RS4A 1SWWA 4ZDWA 2OWEA 1K6JA 3N8DA 5E2BA 5HK8A 3TYXA 1UF9A 1TM5E 1A88A 3VGJA 3SD7A 1H8HA 1D2MA 1E4VA 1VQ1A 3JS5A 4INJA 4N7BA 1V5FA 1FU8A 2GJ8A 2OV6A 3ILXA 3LC7O 4H35A 5DZSA 3TBHA 3NDIA 3ESYA 4YJGB 5L53A 1P2SA 4JI3B 1WDLA 2XKBA 4AZVA 2H2HA 4FDLA 4HYTA 4LVCA 1IIBA 2HSZA 4BKRA 3LO5A 2FWJA 2WA1A 1E0SA 5DHTA 4TKUB 1UJCA 3CMCO 4XGNA 4Q12A 2APJA 2AH5A 1JQKA 4N7JA 1VJ0A 2AN3A 2QK4A 1PJAA 1G3IA 3B3QA 3N6XA 5AVJA 3ROKA 1GOTA 1KYZA 3KTOA 4BL5A 3MRSA 1OFHA 2HKIA 5B30A 1NN1A 4UTNA 2X23A 2OHOA 2JI4A 1K8XB 1PT6A 3RUIA 1YUNA 3BL8A 3EGXA 3FLEA 3JARB 4EQ6B 3FF1A 4OM8A 1LY1A 1FZQA 3NIBA 1UM9B 2ACKA 1GFWA 3QPVA 1MIOA 1TEHA 1E2QA 4QVGA 3SBDA 2FNAA 4L75A 2AX4A 5B1SA 1G6OA 1YZYA 4C4SA 1AUQA 4G5XA 1R3UA 2FN3A 3GXOA 1FSPA 3VKWA 2GCGA 3WHPA 4C76A 1FX0B 4GRIA 1TK9A 3O93A 1OI3A 1T3SA 2WJJA 1V1MA 3EFEA 3JYLA 2BGTA 3IMKA 3CR8A 1MDFA 3I0ZA 5KTTA 1PTKA 4J7CA 3QHPA 3KLOA 1E94E 1ZLYA 3CVOA 3CRQA 1BDMA 1UJ2A 9ABPA 1YB6A 4LYHA 2IW3A 1PF7E 3B6KA 1KWKA 4OI0A 4HXGA 2FDCA 3NHFA 2JAPA 1U9IC 2CHEA 3JYHA 4KQ6A 13PKA 3H9EO 4D0RA 2A5FA 3OFJA 5SICE 1TLFA 2ZIAA 5A05A 4F7DA 1ODSA 5L8VA 1T36A 2OHJA 1H5NA 1UBSB 3JWGA 2E4AA 4FEGA 1KHHA 4KI7A 4OHPA 1PQWA 4B43A 3AF6A 4US1R 1EG7A 4PO9A 1BMFA 2OK7A 4ZANA 2WDPA 3BK7A 3QLUC 2VUHB 4TMFA 1MC5A 4G0OA 1TLLA 3E1SA 2VDPB 3F6SA 3JQPA 2PX4A 3FSRA 3PNMA 1VGVA 2WF8A 4FYHA 4IJ6A 4U7HA 5LR6A 2C58A 1ZCZA 4N3CA 4JKIA 2QRMA 4P83A 1FFEA 1LDBA 4P4UA 4M1OA 5AKYA 1RLOA 1UJ4A 4TL6A 4AJPA 2Y1DA 4B3TB 1KZ7B 1GG2A 1V48A 5AK6A 4EECA 4M0MA 4KKXB 1GAJA 5JNLA 4HLUA 4CKEB 5DWDA 1XWIA 3RS8A 2Q5CA 2QTVB 1Q1NA 1TPYA 4OCZA 1YI8A 2D0DA 2VF5X 3IKMB 3E35A 3UJPA 3IAS1 2VVTA 4RLSA 2F55A 1NUPA 3AEQA 4GM1A 4HVAA 4MH0R 4WQMA 2O8NA 4PIMA 4HNGA 3JWEA 2OXIA 3PHLA 3WOHA 5GTDA 5JISA 3SKVA 2RGBA 1CD5A 2X6QA 4M37A 4Z1MD 5FBVB 5KVCA 3QFHA 5KSZA 4YT2A 2EKDA 1YIAA 1ZWLA 3EMDA 4IIJF 1J24A 1TYBE 2G25A 1BYUA 3FNQA 4GKBA 5CT6A 4B35A 3VZCA 2W6MA 3W9SA 2WMNB 4UCWA 4FX5A 5P8WA 2CNLA 1PNVA 2REQA 3KWJA 1NVVQ 2FN9A 2Q1TA 1EWRA 1CV2A 2RKOA 3BOSA 1N2CA 3W2TA 1JG4A 3L8ZA 1QGOA 1DFHA 4YPVA 4X97A 3I2YX 3WGUA 3K9HA 2FCAA 4G89A 4L95C 3AFIA 3GJQA 1FTQA