2ODNA

Msreca-datp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
310
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 83
structure length 310
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2odnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2odnA01
4BPBA 4JVNA 3RSLA 4KITB 5FBWB 4OYHA 1GOTA 1XRJA 4LK2A 1T8UA 3DZ8A 2PX0A 1Z6YA 2F6RA 5JRZA 2K5UA 2QU8A 5DSZA 4GBMA 4Q9IA 2ZM5A 2ZREA 3SZRA 1ZNWA 3GCGA 1W36B 4TYWA 5JJIA 2QGZA 4R71A 2JJ8A 4Q9KA 2AKYA 2ZYVX 1VYVA 3F3YA 2RGBA 3EC1A 4Q01A 2X77A 3EZ2A 1U8AA 4KFUA 4RKEA 4XVQA 2OCYC 4MGYR 5SZKB 2CNWA 1Y3AA 1JAHA 5FOSA 5KU1A 1GITA 1JPNA 2ERXA 3U5ZB 3ADKA 1R0ZA 3DOEA 3NG1A 2ZJ5A 2FU5C 4HZUB 2A9KA 3V4FA 1OJLA 1LV7A 1C4OA 3LBIA 1T0HB 3HPQA 1QHXA 4C0QC 1G3RA 3L8ZA 3Q7PA 2KJQA 4Q19A 2IS1A 3CNNA 3B85A 4LBYA 4OHYA 5KOYA 1SXJB 2W6JA 2JLZA 4P4TA 2YKGA 1EX7A 3K53A 2ZRLA 4JIMA 1I4TD 4Z8XA 2ZUCA 5BW8A 2ZXUA 1WMSA 1U99A 2ZI9A 4V0ME 1W48A 4JLBA 4PO1A 2I3BA 2PLRA 1FX0B 1KK1A 2PL3A 4KBGA 2V54A 4RD4A 5HZKA 3WBKA 1GTVA 2GJKA 1BO6A 4TLCA 4O25A 4B76A 4JVSB 3NHAA 2OBMA 2ZYTX 3RANA 4C9BA 1KI9A 5JJLA 1M7BA 2GA8A 1OFUX 4TMWA 1LNZA 2D74A 1BOFA 1KI2A 3C41J 4YXWD 2CK3D 2NO9A 2ZAMA 4G01B 1FTSA 5FOXA 4HDQB 4TYNA 2GEDA 4NHOA 1W4CA 2P65A 2HYDA 3B1ZA 1Q21A 2W6JD 1HH4A 3HR7A 4CVNA 2A2ZA 3RWOA 4QHSA 1W0JA 5KO2A 3ADBA 1G291 3RABA 3AF3A 2WKPA 3W8NA 5HCIA 3EPHA 5DO9A 5JEEA 2ZE5A 1MO4A 4JLMA 2HYIC 4PHTA 1RE0A 5DYIA 1ZUIA 1PVOA 3VNVA 3VTKA 1JR3A 4UJ3A 5JHHB 1Q12A 3GFOA 3A1UA 1U0HC 4QGFA 4WIAA 4DCUA 1CJUC 5FH9A 1S96A 3TGPA 4FWTA 1VG9B 3FDIA 3LQRA 2MMCA 1NVVR 1XMIA 1XTKA 3ZYCA 2NIPA 3LH5A 1S3SA 3I61A 2GCNA 2Y8EA 4DRZA 2GZHA 4KV9A 4NZYA 4AD8A 4GZLA 5BN5A 4JLPA 5L3RA 2X2EA 1OYWA 2RAPA 1MABB 4Q4HA 4A8JB 3HWSA 1J8MF 3ZDQA 4IOMA 2VP4A 1KDRA 4NYJR 3GEEA 2ZRNA 1P61B 4TL8A 4DUGA 5K8LA 3CBQA 2QG6A 4A92A 2QTVB 1UDXA 1N6RA 2AWOA 1TUIA 5AUNB 1XWIA 1E2NA 1E2LA 4MRVA 1V43A 2XB2A 2QROA 2FFHA 3AB3A 2OFOA 5FR2A 3P1JA 3SJZA 3ONWA 4GOXA 4DLYA 1HE1C 4Q1CA 2QE7D 3VNUA 3DMDA 2RGNC 1KI7A 1J8YF 1WQ1R 3IILA 3TW8B 1P2UA 1XEXB 4LV5B 4JL8A 2KWIA 3BB4A 3ZD6A 3NHBA 4KHZA 2VP0A 5FFMA 1KSJA 4I4LA 1E2QA 3TNFA 2O8CB 1E96A 1MH1A 4WZ6A 5TB5A 2JLUA 3AKEA 3KFVA 4C0AC 2B6HA 5K8TA 5GJBA 4W5WA 1ZD9A 2WKQA 2Q0HA 4FWIB 3NVAA 4LJ7A 1COWD 4BFSA 3X1YA 3B2EA 2X2FA 3AUYA 5FBVB 5FI0B 1YRAA 2IYWA 4KSCA 4M53A 1NMZA 3K9GA 3RS2A 1U9IC 5C1BA 1G20E 1Z63A 1FNMA 3U3RA 4Z1MA 4Q7KA 3K8YA 1XEXA 3CX6A 3CONA 1BS1A 4JBWA 2C96A 4O0MA 2YV5A 1OH8A 4ZDKA 4ESVA 2QP4A 4ZIRA 4Q4AB 3TK1A 1A1VA 2JJ1D 1NBME 5FR1A 1MO5A 1R5BA 4QJ5A 1DPFA 4O2LA 2OHFA 1Z8FA 4XSGA 3OEEA 1BMFD 4D4MA 3QBVA 4FCTA 2YJTD 521PA 3U3OA 2J7PD 4LPKA 4OBEA 2IUUA 1FFHA 1S9HA 2CHGA 4YXWA 4OK5A 3E5HA 1WB9A 2XZPA 4QHYA 2J46A 3C4JA 4V0NA 4B3XA 4DSNA 3TRFA 4V0OA 1MABA 3Q5EA 3NIBA 5FUXA 3M1IA 3REGA 5E4FA 3NC0C 3HYRA 3A1TA 3KJEA 2ZRJA 1NY5A 2ZJBA 1E9AA 1KKLA 4YDSA 1M6NA 2AHOA 4F38A 4UXJA 5FTNA 4A8JC 1KI6B 2BEJA 2IF2A 4C3ZA 3I73A 3EG5A 2D06A 1GDDA 2QZ4A 3NC1C 3CX8A 4KBFA 1L8QA 2WJHA 1YR8A 4TSFD 4Q02A 4UJ5A 1KY2A 4B47A 3FOZA 1JQLB 4PANA 1J2JA 2ANBA 2JA1A 1RRCA 4HI0E 1NLFA 1OLOA 1GNPA 1S8FA 1RC8A 2W6ID 2PJRA 4Z51A 1OIVA 1EFRA 2GCPA 1XEWY 1XJ0A 5B30A 1KY3A 4LYAA 3K0SA 4FIDA 2P6NA 4IXNA 4D0NA 2AL7A 4BFTA 2FN4A 2F3TA 3CPHA 5JWHA 4BLSA 1XEWX 4P4SA 3G5UA 4GP7A 4ERNA 3ECCA 2KBEA 1XP8A 2WHXA 1UEIA 1RVDA 3E1SA 1DAHA 3QJYA 3VKHA 3NBFA 3PCRB 4GMDA 5AR1A 2BCJQ 3FPAA 5FOTA 3UMSA 1NNEA 4TN1A 2IS4A 2GNOA 2O8DB 2IWRA 2JLXA 2G9NA 4B74A 4E07A 4AY2A 2J7KA 1GNRA 4NCIA 3TAHA 4LX0A 4ZDWA 5EE0A 4AYTA 4Q7MB 2CCGA 2YOFA 2ZSEA 3LXRA 5CJPA 2JDID 2R6FA 4M1OA 2ZRAA 1SULA 1FTNA 2FPMA 2NPIA 3OEHA 4Z1MD 1P6XA 4D25A 1UBGA 4JL6A 1G1MA 4HUQA 2VP5A 5DISB 4C30A 3UG6A 3OEED 4OKSA 4RJLA 1DO2A 4MYCA 1VCIA 2ZRBA 1OYYA 2ZE7A 5JMTA 4A1FA 2ZE6A 2ANCA 1JQJC 1XNJA 2IYTA 1BYUA 1ZNYA 2X19A 2QMHA 1SVLA 4QFMA 1N25A 1T4GA 2E1RA 3GLIB 1U9IA 2QORA 4DBLC 4M9ZA 4HUTA 4ESHA 5LBIA 2EQBA 3DHWC 4DCTA 2OCAA 1UPTA 2PT7A 1QZXA 4DCSA 1XPOA 4EPYA 5TARA 2D7DA 1II9A 1N5LA 3IO5A 2NZJA 1PJRA 4UQOA 1GFIA 2HUPA 3AP3A 2DFLA 4OI1A 3VX4A 3ND9A 3GEIA 1NBMD 4FW9A 5K8UA 3QENA 1C9KA 1KO8A 3OZXA 3QEJA 4A9AA 4RFVA 2V6JA 4ON9A 4BLRA 1B23P 5JI2E 4LOAA 1QVRA 3GPLA 5KHOC 2ZRDA 1KI8A 3TQCA 3I1FA 2OEPA 3L82B 2RGNA 1ZAKA 4R98A 2QRNA 1XJCA 1I4LD 2CHQA 1NKSA 2IHBA 5EE9A 2BOVA 1G6HA 2FSGA 4DSOA 4CEIB 4B73A 1M2OB 2IYUA 1GNQA 4M22A 3CX7A 3IO3A 4W7SA 3RSOA 2ZRHA 2ZIAA 3REFA 1II0A 1PV4A 4GP6A 4FMBB 4BLTA 4OJQA 3B13B 3C5CA 2Q3MA 2EFGA 3WMFA 4TYYA 1CLUA 1AGPA 1CP2A 2YHSA 3MLEA 3NBXX 4PXAA 4TTPA 1OF1A 3VQTA 4LJ6A 3ICEA 1PLJA 3AKYA 3DL0A 2GETA 5DN6A 3A4MA 1CBUA 3TR5A 4DDUA 1GUAA 1ZIOA 2WV9A 3VU9B 1U0JA 1VCNA 2MSEB 2SHKA 3HR8A 1R7RA 4FMDB 3RS5A 2QENA 4DLXA 1AJEA 4UNRA 1EESA 3B1VA 1XXHA 5JI3E 3AVUA 4EKDA 3ASYA 2O0JA 4GSYA 2J3EA 3SQXA 1DAMA 1OXXK 3OF5A 2A5YB 4LJ9A 1LF0A 3EA5A 1K8RA 2J45A 1JAIA 4OQNA 1W2GA 1E0KA 3AVTA 2P67A 2WICA 3QUSA 3R8FA 2ZANA 3K09A 4MITA 4M1SA 4LHVA 2YOHA 4HLDA 2NO6A 5IK2A 2ZI5A 1IM2A 2YYZA 4PPFA 5CM8B 1R0XA 3PG5A 4RVCA 3ZVRA 4M9XA 4MKFA 2CL7X 4OQFA 1E94E 3NBZC 2W83A 2MSCB 5EE5B 3TE6A 2Q9BA 5B57C 4IDHA 4NYMQ 2BVNA 2X1VA 2GDJA 2D7CA 5FI1B 2NO1A 1E3MA 4M0LA 5FUYA 1A7JA 2C9CA 1CJTC 5KNBA 2XZLA 4RCZA 3AVVA 1VHTA 1E0JA 2QSZA 4XH9B 1PZNA 5A5GA 4EPVA 1EXMA 1G3IA 3KL4A 4IOJA 4LCBA 1NIJA 1O87A 3VX3A 1DE0A 3NXSA 3PUVA 4XD7D 5FPKA 3FGNA 5EE3A 1R4AA 2A5DA 5E7MA 1MRNA 221PA 1X8LA 3IIMA 2ZRFA 1CU1A 5EP2A 3AGQA 2ZUBA 2GEVA 3T34A 4MUBA 3QOFA 1ZUNB 4PPNA 5G40A 2NTYC 3GD7A 4G5GA 3WP0A 4D4LA 1KI1A 4DSUA 2WMNB 2CJWA 3GLFE 1W36D 3FKSD 3BAFA 3SYKA 3IPYA 4BEJA 121PA 3EW9A 1AZSC 2ONJA 1Q20A 3KB2A 2PZEA 4MYTA 2QI9C 1PLLA 2F1JA 2FE4A 4XOIA 4KLNA 4NCKA 3TMKA 4NL4H 5AK0A 1U8YA 3MD0A 4TQAA 1ZM9A 1ZINA 3WRXC 2IYYA 3HP1A 1NY6A 4WVFA 1LY1A 3QKSB 3RNLA 1E2IA 2VTKA 4EFLA 3K0AA 1G5TA 3FHTA 1MKYA 3ADDA 1Z6TA 4JKYA 2ZU6A 1P60A 3QEOA 1U0LA 1E99A 4YMTA 2BDTA 1ESNA 3W9YA 1OIWA 1E2FA 2CCJA 5KDOA 4C7OA 4PSAA 2BMFA 1YU9A 4F91B 3F8TA 1OPXA 1GP2A 1WDTA 4D26A 1FOEB 2O0KA 1Z6XA 2FWRA 1XCGB 1UBFA 3G82C 2JLWA 4XJXA 5FTMA 4AI6A 4NYMR 4G5OA 2ZETA 2CLDX 4LJ5A 1HTWA 2ATXA 2CXXA 4JYBA 1U94A 1CR0A 4Q4JB 5C18A 3SU8A 5DH9A 2C78A 3SFVA 1W4RA 3T35A 4DB4A 3GQBA 3KB1A 4ZI2A 2W0MA 5TV2A 4DLZA 1YVDA 3N70A 4YLGA 2QPOA 2R9VA 4DEXA 4PC7A 3QF4A 1KYIA 1F6BA 3RS7A 1YZGA 3PVSA 3THWA 4NH0A 1KTVA 2FPLA 1YZQA 3KTAB 2V9PA 4Q4LA 3ZIAA 3VU9A 3GJXC 2F43A 3RS4A 1NF3A 2XJ9A 1Z0IA 3K9LA 1L4UA 3GFPA 4QNMA 4Q48A 4QOSA 2KB0A 1IY0A 2KBFA 3A37A 1DG3A 1LS1A 1KKMA 4IOLA 4CGZA 1KDOA 4B3FX 4WXRA 4CF7A 1UKVY 4HB3A 2P5SA 3BRWD 5H1YA 2RCNA 1NSTA 3GJ7A 4U5XA 4NCNA 5IF9A 4Q7JB 2BIFA 3I72A 4LJ4A 3SI7A 1W2HA 2O8BA 4LRWA 5J4VA 2C9YA 4DCVA 4GMXA 4OQXA 421PA 2MMGA 5SZJA 2A30A 5DLQC 3ASZA 3DZDA 5CLQA 2VHUA 3SQWA 3MCAA 1NG1A 1TUEA 4JBXA 3WNCA 3FTQA 4MRNA 4BFUA 3O8DA 4RZ2A 2WIAA 4IDQA 2QEQA 5JS8A 1WBBA 1FZQA 4B75A 3PUWA 4AYWA 1HEIA 2VSOA 4G5SA 4HLCA 3GLIE 3NH9A 2VH5R 1WA5A 3PR1A 3U6KA 3B82A 3FWYA 1VG0B 4P4SB 3IIJA 3AKDA 5LB2A 3U3MA 1P2SA 4BFXA 2OESA 3V00A 4MDEA 5BXQC 2P0EA 4PR0A 1Z6AA 3RHFA 3AVYA 4NPHA 5J5CA 1E32A 4IHQA 3AV0B 4WXPA 2DB3A 1ZP6A 2W6IA 5FOUA 4AK9A 2B21A 4JLNA 3GLIA 4C0JA 1II8B 4OJKA 3CRMA 3A4NA 2BJVA 1EFTA 1RYHA 1CR2A 3D7MA 3PUYA 1KSGA 3EWSA 2C8VA 2WWHA 1W44A 1D6JA 3M4YA 4A2WA 5KSZA 3K70B 1YZUA 4B3GA 4HLUC 1KI6A 1YQTA 1XZPA 4F93B 2YVUA 2FJUA 1CRQA 4XVUA 2R6DA 4JKIA 4H9GA 1RW4A 4EUNA 1NVXQ 3THOA 3I8SA 4HB2A 1ZRHA 4EFNA 3EA0A 3C7KA 4CW7A 4KXFB 2FFAA 4K46A 1G7TA 4GPTA 3JVUA 2FEOA 2V7QD 3HYTA 1H8ED 2DCUA 3IBGA 3ZS8A 1OXTA 2CLCX 4XIGS 3KQKA 4LYHA 3F5FA 5LDDC 4EPTA 1KMQA 2YWFA 1N0UA 3GLGA 2F1HA 2J0UB 5J4KA 4QRHA 1IXSB 2KI5A 3IQXA 2ZS7A 1KDPA 5LD2B 2RMKA 3D3QA 4LHYA 4DB2A 1P72A 1PUIA 3N5CA 4P33A 4PO8A 3IQWA 2O8EB 2ZEJA 2N46A 3QXCA 1KK2A 4JLAA 3AGPA 4JLDA 3I62A 2G88A 4LUCA 4BUJA 3L0IB 1OIXA 3VFDA 4IFBA 3ZJYA 2HCBA 4NCJA 4M9QA 3LFUA 2NZ8A 1TQDA 5EE1A 1SGWA 4BRWA 1LS6A 3NDBB 1OV4A 3LQQA 3KJIA 1QBKC 621PA 3E2IA 3TIFA 1QVAA 1AKYA 4FCWA 5D3QA 5KPJA 3KUDA 4LC1A 4FN5A 1X1RA 2C04A 4GFDA 1W0KA 2IK8A 1W4AA 3I5XA 3PENA 2GVDC 3CZPA 3EAQA 3RDPA 2PT5A 3CH5A 2B92A 4Q21A 2EWWA 1GVNB 2QT1A 3TVTA 3ZZ0A 2O8CA 3GLHB 1J7KA 1RYFA 1OHHA 3TQFA 1YRBA 2V7QA 3PQCA 3WBJA 3EZ7A 3TSZA 1OXVA 3EARA 5CIQA 4F4CA 5L3QA 1A82A 3V4RA 1IY1A 1DAEA 1CULC 3NH6A 5EZ5A 3W6PA 2BCGY 1G21E 4KVAA 3PFIA 1UBEA 1G41A 2UZ3A 2WZQA 2OBNA 5F2EA 3T1TA 4YQFA 3WP1B 2VP9A 1M1YE 2C5LA 3H2YA 3C16C 3BXZA 3LV8A 1T3SA 3QKUA 3SJBA 1FMLA 2I4IA 4PSVA 1G8HA 3BFXA 4JL5A 5SZIA 3T12A 1W5SA 2PMDA 1Z2AA 3LLUA 2CVFA 1I2MA 4POAA 4MKGA 5E7JA 2BKUA 5L3QB 1KZ7B 3SR0A 4IOKA 2ZI7A 5KTYA 1GILA 3LO5A 4BQSA 3MSXA 3CO5A 5DI3B 4BFWA 5EQTA 4L15A 1FW6A 4EPXA 3RRNA 2QMOA 1CJVC 1KAOA 1XD9A 2WWYA 3LWNA 4D0LB 3LW8A 3U2QA 2DFTA 1NN3A 1KK0A 4PAOA 2CE7A 2V4ZA 5J4LA 2GXQA 2OLJA 3QY0A 1N6PA 4URUR 4Z8YA 2EYQA 4US2R 1BIFA 4HB0A 3EIEA 4Q9JA 1N6OA 3GJ3A 3DM9B 4WZAE 1GKUB 3CPEA 2OZEA 3MWYW 4XWOA 5CB6A 4HAUA 2ZRCA 1TQ6A 5KDLA 1SZPA 2L0XA 1I4DD 2QBYB 1G6OA 1P4SA 3OHMA 4TTQA 1TX4B 2F55A 3CH4B 3RRZA 3QVVA 1QHGA 3ZS9A 4US1R 1G19A 2ZVQX 5JWOA 1XDBA 1ZD1A 4DLWA 1OB2A 2GJ8A 5E3HA 3VR3A 4KI0A 1GM5A 2IS6A 5ANRB 4PQRA 1FX0A 4PQYA 1IN4A 1YJ5A 3I8XA 2WAXA 5BN3A 1T6NA 2WSSD 4M1MA 3MJHA 3SFZA 3T15A 1XMJA 2DFNA 4UNPA 4HDCA 3K70D 1JEEA 3MMPA 2VHTA 1IBRA 4JMPA 1M8PA 4CEHB 3AH8A 3KKOA 1KMHA 1CXZA 5P21A 1UDWA 2GXSA 1B0UA 2O5VA 4L9SA 5BWMA 1BH2A 5AJYA 1VG1A 4B6EA 4NKRA 4ASUD 4DXAA 2ZROA 2XTNA 2GESA 4IXMA 4G5QA 3S1AA 3K70C 2H18A 3ETLA 3M6AA 4BZQA 2JAQA 4M21A 2IEZA 4MGKR 3LLMA 2F1RA 4PZYA 3GLFA 4B3BA 2W0SA 3AUXA 3GJ6A 3Q7QA 1IHUA 1T3LA 4JJKA 4R9UC 4PFSA 2Q9CA 2GILA 1U8ZA 1UKZA 1Z47A 3SOPA 2OE2A 4NDZA 4R7ZA 3EZFA 5DHFA 1VDZA 3JZMA 3PITA 3WRYC 2RH5A 5G3YA 5AUPB 4TYPA 4BZXA 3BH7A 3CNOA 1MT0A 1XJQA 3X2SA 2KSQA 2JEOA 2QPAA 3ND8A 4WOPA 3BJIC 5B58C 4OI0A 4RCYA 2XNSA 1QRAA 2GZAA 4Y0AA 1E9CA 2H57A 2BC9A 1N3BA 1IN7A 1Z22A 3LX5A 3TBKA 2XITA 3SBEA 1LF5A 4B6FA 4FINA 2PBRA 3IIKA 2QL6A 4BZPA 2C95A 3P26A 2GXAA 1YHNA 4MKIA 2FPKA 5CJ2A 4K8OA 3CF0A 1NN0A 3UK6A 3MWJA 2ZSBA 3KJGA 2ODNA 1W46A 3TUIC 3THXB 1VTKA 2J7PA 5L3SB 4PX9A 1IQPA 1P2VA 1L2TA 2DHRA 4TMVA 4QBGB 1G3UA 1GL7A 2J41A 2AK3A 1FUKA 3KTAA 3R8CA 2CHVA 4DT1A 2RKOA 2EYUA 3WNBA 1RFLA 3CRVA 3LBHA 2RGXA 3QVUA 1Z0KA 1U2RA 1TPZA 1VYUA 4H1UA 4UNNA 3PEYA 1XD2B 1Z2CA 3P20A 4B2IA 1DELA 4UNSA 2XTZA 1R8QA 4LY6A 3ADCA 4FMCB 4D6PA 2GXUA 5CK4A 4QBFA 1EFHA 4Q9HA 3ZZUA 1AQUA 5IRCD 4KFSA 3CRW1 3PEWA 3H1TA 3O8BA 3KXKA 3WNDA 5K8IA 5FL7D 2XSZD 4NU0A 1S1CA 5FTLA 2ZJAA 3AVXA 4MQBA 3T1OA 2QA5A 4PHHA 1QHSA 3EZ6A 2QMUA 3QG1A 4HYYA 4AKIA 2V8OA 3FB4A 2NG1A 2JLSA 2KE5A 1XD2A 4Q1BA 2C98A 3JZAA 3CNLA 4TL7A 2IX3A 1G7SA 2OO7A 2GF9A 4NP6A 4OI4A 3SC3A 1E9DA 2EW1A 1DS6A 1RJ9B 4DLTA 3U44A 2BWJA 4QGHA 5J4HA 2I1VB 3QSYA 5EUQB 3K0AB 2O8DA 2FNAA 3SBDA 5JSZA 4KLZA 1D2NA 3A1SA 1KAGA 5CB8A 4IVPA 3GEHA 3CZQA 4RFSB 5HE9A 4RZXA 4IDOA 2GVZC 2W2VA 2ZUDA 3M0EA 1Q22A 4BRUA 2PCLA 3QXJA 1LW7A 3FFAA 2F9MA 2QPTA 1F60A 5L8VA 1SVMA 2PX3A 3FYHA 1W36C 1K5GA 2DYKA 2NO7A 1WP9A 1NRJB 2ZS8A 1WRBA 3VR4A 3CR7A 1KMHB 3VAAA 1KGDA 2P5TB 4B71A 5EUMA 3WMEA 1T5IA 1P73A 5F9FA 2LKDA 2WSSA 4LHWA 3QPWA 2P2LA 3TSOA 4F7WA 2HEIA 2AN9A 4PO9A 3OAAA 3QPUA 1E1QD 2DBYA 1HE8B 2EVWX 4LV8B 6Q21A 5EP4A 3J81k 1Z0AA 4MRSA 5G53C 3OAAD 3WHKA 3BE4A 5DNYB 3NDPA 4DIDA 2WJGA 4L4UA 2LKCA 3UKDA 4ABYA 2IEYA 3RVBA 5BYKA 3DDCA 2WBLC 4II7A 4KO8A 1JB1A 2AR7A 4XSHA 5JECA 1SVSA 4RSGA 1E79D 3BWDD 3W5IA 2RGAA 4NE2A 1QHHB 4PPGA 2G77B 3NEYA 4QL3A 3Q3JB 4DIEA 1X6VA 1G9XA 4MKHA 2BBWA 4NCHA 4KYUA 4QM7A 3TR0A 2J0SA 1V5WA 1MOZA 1CJMA 5DI3A 1ZC4A 2VO1A 2OILA 1TF5A 1LB1B 4KCGA 1T91A 4Q4AA 2FFQA 3AVWA 1KZGB 1M34E 1OKKA 1DO0A 2JJ2D 3A1VA 2VHJA 1T8TA 2VRWA 4QNRA 4D82A 1PLKA 1G5RA 1NMXA 4DDVA 1WBDA 1F5NA 3W3AA 2A78A 3QNUA 4TZ6A 1CS4C 3I4LA 4V0KA 2OFXA 3H0KA 3LAWA 5GVRA 1S2MA 2QP3A 2AX4A 2EWVA 2Z5FA 4OHXA 1EK0A 1QHIA 2VBCA 4A6PA 2IYQA 4XWKA 1K6MA 3B5JA 4PHGA 2RGGA 3RS3A 3GLGE 3DEFA 2XSZA 1WXQA 5LPNA 1ZNXA 3BFVA 4A8JA 4DEYA 3ZQ6A 1NMYA 1E4VA 4NMMA 3QKRA 1EWRA 3Q9LA 4LDJA 3QKTA 4CT4B 2XZOA 3FMIA 1OHHD 1GRNA 3AVPA 4A15A 2JIZA 5C4MA 1RRPA 3OEHD 4QC2A 3W8RA 3U7FB 5A0FA 2DWQA 1OT3A 3BORA 1ZYUA 4GZMA 3I32A 1IN5A 3QIAA 1JR3D 3AF2A 2FDCA 2ZRKA 3R9WA 1GIAA 5CITA 2BM0A 5EXTA 1SKQA 1GZSA 4AG6A 1N5JA 3C8UA 2CLSA 2R62A 1R6BX 3BS4A 4YMVA 4GL2A 3FKSA 5AJVB 5JBQA 4QG7A 3RS0A 3NKVA 1IJFA 4L9WA 4CT5A 2FEMA 1X8JA 2BMEA 3L43A 3KXIA 3LXXA 4B48A 1VMAA 1TQ4A 2PEZA 1G64A 4B32A 3KQUA 5FBRB 1EX6A 3UMFA 2DPXA 2YWHA 2YOGA 3MWLA 4ZKDA 2ZPTX 1IY2A 3ZIAD 1H8EA 2YNMA 3A6PC 1UM8A 1YR7A 2HV8A 2ODBA 1CRPA 1OH6A 3KUCA 3MWKA 3BIFA 4WW0A 3L0SA 1W49A 1NP6A 5J40A 1JBKA 3X1ZA 4RFSA 1AS0A 4FMCF 3LVRE 1TU4A 4B34A 1W4BA 4HLUA 3T5GA 2RGDA 2WWGA 1Z29A 3U7EB 2J0VA 5FUVA 3W6OA 3LRPA 5AJWA 3CM0A 2VF8A 1JI0A 3DVLA 1RJ9A 4A4DA 1GKIA 4HATA 4CRWB 3EWAA 2PH1A 3LNCA 2GJAA 2G0TA 4IW3B 4P0TA 2XGJA 4P3YA 4CYMA 2MSDB 4JLKA 2AK2A 2ORIA 5F9HA 1VKJA 3LY5A 4A0GA 4I1VA 5KNCA 3KQLA 2CE2X 2QT0A 5JFGA 3T1VA 1DEKA 5CYPA 4X8MA 1P2TA 4C2UA 4CEJA 3KKMA 5SZHB 2HLDA 2QTFA 2R65A 3THYA 1KSFX 4JLVA 2QN6A 3PV0A 4DHEA 4PHFA 2IT1A 2QQ0A 2NMVA 5FL3A 1MO6A 3CKLA 4FCVA 3FVQA 1OFHA 1IXRC 2XOKD 2IHYA 2WPDA 3X1XA 1RZ3A 4PC1A 1G16A 2HCJB 3K9HA 1Z07A 2GF0A 4KYIB 3FMOB 1K5DA 3K9NA 1ZIPA 2Z83A 1JECA 3SJAA 3B60A 1SXJA 2G0NA 5FPHA 5J47A 4JJZA 2XAUA 4LHZA 5JHGB 1AGRA 2VIIA 2QAJA 1COWA 4ACAA 4DKXA 4EPRA 3OIYA 4EJSC 3TLXA 4B2LA 3CRRA 1NLYA 1JPJA 4QXAA 2ZS9A 3KKNA 1KJYA 3GFTA 2BJWA 3SNHA 3D8BA 4TQ9A 2WWFA 1US8A 2XJ4A 4AIIA 2R6CA 3DO6A 3EIHA 4LYFA 1HURA 3SHFA 5FTKA 4U00A 1ZBDA 1HV8A 2A3RA 3BOSA 1JR6A 4MYHA 1W5TA 4NYIR 2CCKA 4RD1A 1N6IA 3AVOA 5GVSA 1IN6A 1KO5A 4A0FA 1D8TA 1SVWA 1G7RA 5FTJA 2C03A 3IEUA 2BV3A 1MO3A 1KI3A 2DFKB 5JCZA 5L3VA 4PC3A 5KPDA 1FUUA 3IKJA 5EJEA 2CBZA 4JVLA 3MAAC 1R8SA 4Q1EA 1IAQA 4RZ3A 3FHCB 5EXSA 1OXUA 4PQFA 3VKGA 2ZR9A 1NG9A 2EFDB 2WOJA 3PIRA 5HTKA 4ZIRB 5J4YA 2ZQ5A 2ZITA 4TLBA 3OESA 1OSNA 2VP2A 1ODFA 3VHLB 2HF9A 1IONA 5F98A 1H65A 1N5IA 2GWHA 1GL6A 1P9WA 4P32A 4OQMA 2HF8A 2YWGA 5KYKA 1E9FA 5M04A 2ZJZA 1XX6A 4G0NA 1KDTA 3LW7A 3UANA 2IYVA 2EFHB 3Q72A 4HAVA 1NN1A 3SN6A 3SYNA 1XPUA 5TMPA 5D3MB 4A2QA 2WSMA 3B9PA 5GJVC 5CDFE 2OLKA 3QXHA 2ORVA 3RRYA 1AZTA 5KSPA 4TLAA 2ZRMA 1N6LA 1G8YA 1TQ2A 5KUTA 3THWB 1H8HD 4ZDJA 2P3SA 2EFEB 4L5BA 4B2PA 2OUKA 1M7GA 4FMDF 2V3CC 3Q8XB 1KSHA 3OE7A 5CK5A 3K09C 3IEVA 4DWJA 1ZM3A 1XTQA 1FP7A 5GJWC 4GI7A 3TUZC 3LA6A 3CF6R 5ELXA 2NO0A 3U6BA 4EJSB 3P27A 4PSKA 3FFBA 2H7VA 1X3SA 4KFTA 3T61A 1NL3A 2QQEA 1E1RA 4IVRA 1XZQA 4Q1FA 1A2KC 4UKDA 4FD2A 2ZI6A 4Q00A 4ARZA 5JRJA 3KX2A 2ZU0C 1GRRA 4C0LA 3QXXA 3KQNA 1NSFA 3B6EA 1XU4A 2IBMA 1Z0FA 3UMRA 2IYLD 4WAUA 3T06B 3EX7C 4BFZA 1F2UB 1G8GA 4QHTA 1L7VC 4I1UA 4R2HA 4ZKEA 4B43A 1JXOA 2V55B 3WYAA 1E2EA 4IKEA 1M74A 1S9DA 3WMGA 2ZSDA 4GDFA 2WOOA 3SYLA 3QKSA 1ZU4A 3K0CC 1VCOA 2CDNA 2ZYWX 8OHMA 5BN4A 4UXHA 3L0PA 3SE0A 2HDNB 2GJ9A 2OM2A 3A1WA 3HDTA 3KDSE 4TSFA 3AVQA 2IYXA 2QSYA 2IUSA 2PZFA 1S1MA 1VHLA 2XXAA 2J59A 4HAZA 5CIWA 1HQCA 4ZV4A 1J70A 5KDDA 3OFND 2GKSA 3KXLA 1TTTA 2FOLA 3MG9A 3N2EA 3AEZA 1TADA 2PZGA 1N6HA 2FSIA 3OIUA 5IK2D 5AJXA 1XXHE 3CW2A 1ZM2A 1ZNZA 2ZRIA 2IYRA 4PC2A 1JXMA 3VR5A 3HU3A 5KNDA 1ZVQA 1N2CE 1RRFA 3GJ5A 3HPRA 1GL9B 4ZDIA 2A7QA 3VR2A 1P9RA 3R9XA 4DZZA 1DAKA 4J0QA 4XWAA 1P62B 2A5GA 4H1VA 1S3GA 2ASEA 4QKQA 1G8FA 4EJSA 4Q03A 2RGEA 3RC8A 1YZKA 2WIBA 1ZM7A 2W2TA 4MGIR 2QUZA 1SXJC 5FBLB 1G3MA 2GCOB 5JLJA 1RKBA 5JSZB 3LBNA 4HAXA 2GBLC 2ZVPX 3DKVA 1JJVA 2Q21A 4KJZA 3AM1A 3QXSA 1OE0A 1LVGA 4LSGA 2R6AA 2B7BA 4EQ6A 3FMPB 1LFDB 1SHZA 1XXHB 3C14C 1ZU5A 2Z6VA 3B78A 5DIFA 4TYQA 4XTCS 3EASA 3HJNA 1F2TA 1Q1ZA 1Z6GA 4A82A 2XOKA 4V0MA 2AXPA 5E95A 1XEFA 1N6NA 2QGNA 3D6TB 1SXJE 4IEEA 4GOKA 4LPSA 4QBIA 1N0WA 2D2FA 3CIOA 2B7CA 2ZJYA 1NLZA 4C0KA 1GRQA 1Q1QA 4YONB 3VKWA 5CM9C 3D31A 2C2HA 4HSEA 3CWZA 3QPVA 4FI3C 4OHWA 4DLVA 3GLGB 4GRAA 5DGXA 1HQYE 4KSBA 4RY2A 1VCMA 1OW3B 3BH6A 4TMZA 1IXZA 1XPRA 1NIPA 2DWPA 3WYGA 4HAYA 5JS7A 3PUZA 3P4YA 3X1WA 2ZAOA 1UEJA 2VPPA 4DT1B 2C77A 4MRPA 3U3KA 3EPKA 3Q85A 2VEDA 1AIPA 3KQHA 3A8TA 3SJCA 4TL9A 2R6GA 1ZD8A 4NBSA 1XMVA 4IDNA 5FOVA 2PCJA 1UF9A 2FFBA 1VYTA 1UBCA 1R0YA 4TWZA 5DYGA 1EGAA 1P75A 2FX3A 4I1SA 1US8B 1HUQA 2ERYA 2G6BA 2V1UA 4LYJA 2HT6A 3ICQB 1Z83A 2W2XA 1FL9A 4X8HA 3GMTA 2GAAA 3IBYA 1ZCAA 2O8FB 3FMFA 4LBVA 4URVR 2VF7A 3AF1A 3QI2A 5TY0A 4PZZA 4U7DA 5GJCA 1T3HA 4EFMA 1XBTA 3L0OA 4RD2A 2WMOB 1YZNA 1F48A 4HZUA 1M7HA 4LWZA 2OAP1 2QP9X 2Z0MA 2FMXA 1E9EA 1XCPA 2UKDA 2WKRA 4MA4A 4URWR 4A36A 4QJ3A 1EFUA 2Q3FA 2BMJA 1ANKA 2QRZA 5HKKA 1AA9A 1NVVQ 2WWWA 4ZI3A 3TJZA 5KSYA 2J0QA 2OAQ1 1ELOA 4G3XA 2CVHA 4EPWA 3BD9A 1ZUHA 3IGFA 1A2BA 4ACBA 821PA 3K0EA 5HZHA 1UKEA 4V03A 1KNXA 4I1OA 1DARA 1D9ZA 2VHCA 4I81A 4DLRA 2I1QA 3QE0A 4O3MA 5EXPA 2O8FA 4TMXA 4DLUA 5L3SA 2E87A 4NYJQ 2LCFA 2PLFA 2IYSA 3EPJA 3OIVA 4RD0A 1FP6A 5FBQB 2GTPA 2GHIA 5G3ZA 3ZH9B 2N1BA 3PEVA 2OBLA 2N42A 3U61B 1T9HA 1XCMA 2V6IA 2G3YA 2QNRA 5HE8A 2GZDA 1BKDR 1Q0UA 3MRSA 2BKEA 2VQSA 1W7AA 2ZI3A 3BGWA 3HU1A 4HUQB 3RC3A 1RPZA 4BWYA 3GLFB 1SHKA 1TEXA 3U3JA 2OV2A 5JJKA 1E9BA 1C1YA 2JLYA 3ZGXA 2ZJOA 2GK7A 1S0UA 1QHNA 2AD1A 3WXMA 2J87A 3BC1A 1U81A 5C4GB 3H86A 1JALA 1OKKD 3EC2A 3B8HA 5FUWA 2GCOA 4U02A 2W58A 1D2EA 4CZ2A 5JWRA 3I92A 3KKPA 1KJWA 2IXFA 1FPMA 1WF3A 4N1AA 4Q1DA 1A5TA 4AG5A 1FQKA 2PEYA 2DWOA 2QAGC 3O47A 4IFEA 3B1YA 3S1AB 1UADA 1DG1G 2Z43A 2ZRGA 1EWQA 4TLDA 2VSFA 2NPFA 4CEHA 2HJGA 2P6RA 2CL0X 4GOJA 4Q1AA 1JJ7A 2J9RA 1XB2A 2CNWD 2D3WA 4TL6A 1E2KA 3BERA 4TLEA 5FPSA 2D4HA 2JGNA 4E09A 2AD5A 3W90A 5HR5A 2XXAB 3EXAA 4OK3A 1HA3A 2WJVA 2UVQA 2ZSFA 2O52A 5JEDA 1HT2E 4KAXA 1CJKC 2GEUA 5H68A 2REBA 1TEVA 2IL1A 4DSTA 4C2TA 4UXIA 2ODEA 1XD8A 4DJTA 4JVMA 1SVIA 2QBYA 2A5JA 2WPDD 3BB1A 1AN0A 2OT3B 2A5FA 4M1TA 3QKRB 5E7IA 4N0DA 1AQYA 1TNDA 3KJHA 4F4IA 4JS0A 4N3NA 1GG2A 1TU3A 2IWHA 5KSOA 4Q4HB 1Q1BA 4HDOB 2F1IA 2ODWA 1E9SA 1F2UA 2H92A 2AKAB 1VIYA 4MUAA 4S35A 4TQUS 4ZCMA 4AURA 1UAAA 1BYIA 1JNYA 1G3QA 2IXEA 4IRUB 4RZUA 3WY9A 721PA 1PUJA 4E03A 1QF9A 2Q6TA 2R44A 5IT5A 2HXSA 3G0HA 4XTRA 2JCSA 4BLPA 4ARZB 3B1XA 3TH5A 1YR6A 1ZM4A 1F2TB 5GADl 2OSBA 1NVWQ 1XTIA 1KI4A 4G5RA 1AKEA 3E70C 2DR3A 4M2LA 1JR3E 1E2GA 1NBMA 4Q5IA 1EFCA 2Q9AA 4W5JA 5EP3A 1OFTA 4C0SA 4ZCLA 4C0BA 3AF0A 1VG8A 2H1LA 3RAPR 2BHRA 1W47A 4A6XA 2VL7A 1GKYA 2ZJ8A 5EP1A 1U90A 3V9PA 1OH5A 4MDFA 1X8KA 2FG5A 2O0HA 3O8CA 1MRSA 2FA9A 4D0GA 4BLQA 3I5YA 2RB4A 1XTJA 3GJ4A 5F3WB 2R8RA 3LD9A 4OQLA 4YMSA 4D4JA 2RHDA 1E1RD 2YWEA 4DUGD 1G5PA 1TAGA 1R5OA 3UG7A 3ZQJA 1YE8A 1FQJA 4TMTA 4E22A 4HLQB 1NJFA 2ONKA 4LGMA 1KJZA 2GAOA 4QGAA 3PUXA 4BASA 1AA3A 3GLHA 2GBLA 2LWIA 4L8GA 4HAWA 1N6KA 1N0VC 2VP6A 4E5UA 2RGCA 4Q66C 1KOFA 5HKKD 4K81B 2XNDD 2RHMA 2XX3A 3AP1A 1G18A 5FPYA 3TKLA 4BFYA 3C5HA 3W5JA 1HT1E 3Q5DA 4Z54A 2Q3HA 2B8TA 2HXYA 3NTUA 3NWJA 4Y0VA 2ECKA 4ZO4A 1W0JD 2ZTSA 3WHLA 1DTSA 3OE7D 2YINC 3UIEA 1SVOA 1QHYA 1ESMA 3F0TA 3SEAA 1L4YA 3BFKA 4Q7LA 1FNNA 4QM6A 1CR4A 2D2EA 5DE3A 2FZLA 2C9OA 2ZR7A 4X8LA 4OHZA 2ZJ2A 2O8EA 1X86B 3TSWA 3QQ5A 2OCPA 4F4JA 2OFWA 2J0UA 2QTHA 4CEIA 3RYTC 1UJ2A 3OIWA 2WTUA 3DOFA 3DMNA 1TF2A 4LZZA 3RLFA 3K0CA 3QBTA 3HU2A 4W5HA 5BQ5A 4AKHA 5AJZA 3TW4A 3VR1A 4TT3D 4CIDA 1R5NA 4UNQA 2QAGB 1AM4D 3IHWA 1KK3A 1KO7A 2CK3A 2ZYUX 5TVKA 4DDTA 1CTQA 3DM5A 4M1WA 3CUEF 4Q9LA 4IJMA 2QY9A 1SKYB 4KU4A 3A36A 1S4QA 3QF7A 3RRMA 4DCNA 1JEDA 2ORWA 1DAIA 1J90A 2BEKA 4MRRA 4PAQA 4DVGA 5G41A 4OHVA 4LI0A 3ZVMA 5AUOB 2JJ2A 3UWOA 2EU8A 2Z4SA 4M1YA 1YZTA 2REOA 3R7WB 1XF9A 1D5CA 1II8A 3AKCA 1E9RA 3U60B 1VECA 2YC2C 3C15C 4ASUA 3O8RA 1XTRA 4LV6A 1EG7A 2F43B 4YDHB 1SKYE 2H16A 3UXMA 3B7GA 5IHPA 5LD2C 3BB3A 4RKFA 1P5ZB 1TF7A 5IDVA 2AFHE 2IXGA 1OXSC 3P4XA 4LJAA 5B2ZA 2G1KA 3I3SR 1E69A 5JZVA 1E0SA 4Q47A 3EZ9A 4LC0A 5CLLA 3R9IA 1YZLA 1P9NA 1SVKA 4URYR 1T5LA 2FZ4A 2IA5A 5AWFC 2AFIE 2JLQA 3THYB 4KFRA 3SDZA 2ZR0A 3GJ8A 4I99A 4R2IA 5DN6D 4TTRA 3U4QA 4Q4JA 3X1DA 2VYFA 4GT1A 2GRJA 4YC7A 3VHXA 5HCNA 3IDQA 4IDPA 1Z06A 3BK7A 4P4UA 2JLVA 4D2IA 2D62A 2OG2A 3R20A 1W1WA 3AQ4A 1E2PA 2F9LA 2P6UA 1ZJ6A 4DDWA 2VLIA 3W3ZB 1G4AE 2J5XA 1AS3A 1DBSA 1AS2A 1Z0DA 4JBYA 4DC9A 1OH7A 4EAQA 4MGZR 2QE7A 1MR3F 4B3CA 2VSXA 5DHAA 4B3DA 4OL0A 5FPTA 4PPQA 1G7CA 4PZLA 2QMEA 2C99A 5CYOA 3FHOA 3OFNA 1UKYA 1IOZA 2UZIR 4D80A 2CMKA 4ZPXA 2TMKA 2WVJA 4ILEA 3PXGA 3K0FB 2QAGA 2GK6A 2YZ2A 1FMJA 2WJJA 2V1XA 4TT3A 3BH0A 3W34A 4PC6A 2PMKA 4O2RA 2F3RA 4US0R 2IC5A 3P32A 4N0EA 3ZVLA 2O8BB 2IF0A 1E6CA 1NJGA 5EZ6B 4Q18A 3ZD7A 3T5DA 5A4JA 4P31A 3CR8A 1Y63A 1QG4A 1D2MA 4BFVA 1OB5A 1Q3HA 2FF7A 2E9SA 5FL7A 4CEJB 1NI3A 1GSIA 4ZCIA 2JLRA 2Z4RA 2NQ2C 2NGRA 3W6NA 1OFIA 1Z08A 1E2HA 4M4SA 4IEIA 3KKQA 4M1KA 4WA7A 4JSTA 1HY3A 4A2PA 4AKEA 4C0HA 1DADA 4IVQA 4XVRA 4GNKA 3MFYA 1SXJD 2YC4C 1HYQA 2CL6X 3AF4A 2VHQA 1TMKA 1MV5A 4M9SA 4NTZA 4JT4A 2IS2A 5DI9A 1E2DA 2BMDA 3A4LA 4OI2A 2G1JA 4EQ6B 5B64A 3UATA 3QF4B 3QG5A 2ZE8A 1CIPA 1DOAA 3IUYA 1GAJA 3K1JA 1Z28A 4D81A 4TZ0A 1E2JA 1G8PA 2XNDA 1E0AA 1CF4A 3CB4A 2OXRA 1F3OA 1IJEA 1Z0JA 2JDIA 2DY1A 4RD3A 3VMFA 1ZC3A 1ZCBA 2CJWB 4B35A 3VR6A 2WM9B 4ITRC 5JCPA 1H8HA 3EPLA 2OXCA 3U7GA 2XEXA 1KO1A 3BBPA 4PTLA 2JIZD 2OCBA 5C46F 1R0WA 2ZI4A 3CWQA 3UWKA 4D4KA 1ONBA 4XD7A 4A0RA 2H8KA 2VA8A 3LDAA 4C7OB 1KHTA 3L8YA 4BEBA 1QHHA 1QDEA 5TDHA 3CPJB 4KVGA 4AC9A 1YKSA 2XB4A 2QM8A 4AWXA 1CEEA 4EIWA 2H17A 1P3JA 1R10A 2BBOA 1J99A 1EFRD 2G83A 2IUTA 4QBHA 4B33A 4PAMA 4X8OA 2XTMA 4NYIQ 1CR1A 4JT2A 5HPYB 4LJ8A 3EIQA 4A0HA 1VPLA 4JYCA 5H70A 5H8WA 1QG2A 2R2AA 3CRQA 4HZIA 3IPXA 2ZRPA 5FOWA 1Q3TA 4HB4A 2BBSA 1T0JB 1KIMA 4AKGA 2FSHA 2IW3A 3MGCA 3UPUA 1VIAA 2QM7A 3TAUA 1ETUA 2FSFA 4NONA 3ZZTA 1E2MA 2AWNA 1E79A 4DLSA 1WE2A 5EXXA 2NOAA 2H5EA 4YMUA 2FV8A 2W00A 5C2JB 3H84A 1CKEA 4L16A 1KO4A 4V02A 5TXGA 1SQ5A 2WJIA 3RWMB 5UKDA 1BMFA 1E4YA 2WJYA 3PEUA 3GP8A 1D9XA 4B44A 1O3YA 1TL7C 3PJRA 2JJ1A 2FGJA 3NBYC 4F92B 1A4RA 3IHLA 1NKTA 2FGKA 1DAFA 1G17A 4TMKA 2J1LA 4QGGA 4LHXA 1YR9A 4JSYA 4C4PA 3NEJA 3ZLJA 3AP2A 3WYFA 2BM1A 2HT1A 2X8AA 3K0FA 4MYUA 2ATVA 4V0LA 4URXR 4AYXA 3LVQE 4WZBE 2EFCB 3FE2A 3MUFA 3LX8A 3DKPA 3B9QA 4URZR 3JVVA 1E1QA 1ZMXA 2JATA 3CLVA 3SHWA 4YMWA 1NVUQ 2GJSA 2B8WA 4BE7B 3TUJC 4RD6A 2FH5B 3TVDA 1X1SA 1ZW6A 3GJ0A 4HEJA 3U7HB 1XMSA 1E98A 4LBWA 2HJVA 4JLJA 4WBSA 2HLDD 1LTQA 2ZSAA 2AXNA 1I2DA 3MJRA 4OK6A 4G1UC 4MH0R 1DVRA 2F7SA 4CDGA 2WWXA 2WAYA 1AK2A 3U4QB 4JLOA 3A58B 5BYJA 4BECA 4W9MC 4S2EA 1KNQA 3KZ1E 5AUQA 1U98A 2CEAA 1RRGA 2REXB 3KFXA 1Z3IX 1DAGA 4EDHA 1Q44A 2PJZA 2WWIA 1Z5ZA 2IYZA 3B1WA 3U44B 3ZVNA 5LB4A 1GWNA 1RIFA 3SS8A 4JZKA 4QJ4A 3H4MA 3CF2A 3GLHE 3N2IA 5D3MA 1N5KA 1G4UR 3FKQA 2JASA 3L2OB 4KODA 5CDFA 3T1QA 4BGDA 3THXA 2BBTA 1Q1EA 4M8NE 1R2QA 1XFAA 4BLOA 1NN5A 1P7CA 4LJYA 1IN8A 4FXPA 4LBZA 1XTSA 1WCV1 3DPUA 1Q57A 3R7WA 1W0KD 1UFQA
chains in the Genus database with same CATH superfamily
2E55A 4DUPA 3ACDA 3RRJA 4G6ZA 4OYHA 1GOTA 3Q6IA 3SOZA 2CKDA 1JHDA 2F3UA 2PX0A 3V3KA 1JMYA 1XR3A 4CMIA 2PE5A 1A5BB 2F6RA 1VPDA 2I8LA 2QU8A 1KIFA 3MLBA 1Q0LA 3PFGA 2J6HA 3AUKA 4Q9IA 5DSZA 3H4TA 3TD6A 5LP1A 1WB5A 1ZNWA 4RHYA 1H9CA 3D81A 2C3PA 2JGLA 2AZ4A 4YT2A 5L6MB 2Q6OA 5JJIA 4Z7JA 2C9ZA 3E53A 4IX1A 4R71A 4TV9A 4Q9KA 1WXFA 1AF7A 2AKYA 1VYVA 3GN1A 1PJZA 2RGBA 3EC1A 4WWHA 1EGMB 3TLEA 2QB5A 1X2EA 5SZKB 4Z0HO 2V45A 1Y3AA 1JAHA 4TTTS 5C3UA 4BNIA 2XDQA 1GITA 4RF2A 3N8HA 5J43A 4KQ9A 3NIFB 1P8AA 3ZKWA 1KL7A 1VI5A 3RFXA 4BKOA 2ZJ5A 4FX5A 4I66A 3TL6A 3HSSA 4TVKA 1AHNA 3LBIA 5KNCH 2QDXA 1T0HB 4R1TA 5C53B 3ZDCA 1SUDA 1G3RA 3L8ZA 3Q7PA 1LDNA 3CKMA 4Q19A 5KQLA 3CNNA 5KVAA 2PQ0A 1IBKB 4OHYA 4LYYA 3I53A 4P4TA 3E9MA 1CFZA 1X77A 4BGEA 2DP4E 4R0MA 3K53A 4Y0NA 3FB1A 1WG8A 1KS9A 4JIMA 1I4TD 3HDYA 2CLFB 3LPMA 3QFRA 1WMSA 1U99A 4L6CA 3NV9A 1F6DA 3KVNA 4ZRMA 3T5MA 4BKUA 4QLAA 4DDKA 1WW2A 1YCDA 1Z4IA 4KBGA 5JLAA 4DAEA 2R1TA 4KNYA 1FS6A 4FR0A 4XDHA 3P9RA 2GPJA 1GTVA 4JT9A 2GJKA 1BO6A 1DRVA 2VDWA 3A2LA 4YAFA 3U39A 5ADWA 4F2WA 9MHTA 4HFMA 4CM5A 3IELA 1P1FA 1IM8A 3JD2A 4B76A 4C9BA 3NHAA 1Q7BA 2ZYTX 3DOJA 4WLFA 5G0UA 5I7HA 1XTZA 2XBUA 1M7BA 1U5AA 2NP7A 2DHQA 1UMBA 4EMBA 1OFUX 3WYEA 4IYJA 4TWAA 3OZGA 1ZOIA 1ISMA 2B5VA 2IP4A 1KI2A 3ZDEA 2FYTA 3O0TA 1GRCA 2ZAMA 3HYLA 1SBNE 4G01B 5T7BA 3UAYA 2RAUA 2OORC 1JUDA 1IVYA 1KYYA 1SHTX 4LS3A 3RHTA 3L8GA 3VMMA 4E5DA 5CCXA 4G85A 4NHOA 3BM5A 4WK6A 2BTOA 3ETCA 1CIVA 2WTEA 2VVTA 1P0PA 1Q21A 2BR4A 3UN1A 3S68A 2IOFA 3LWZA 2IP1A 3D7SA 4HNTA 2ZQYA 2WMDA 2A2ZA 2I4TA 3RWOA 5HS4A 1U3GA 4QHSA 1Y1TA 5H0IA 2J3JA 2VPTA 3RRFA 5EJMA 3W06A 1KEEA 2PS0A 2PKYX 5LUBA 3W8NA 2VWGA 1EVJA 3JASA 4FBMA 5H81A 1FBTA 4L5CA 5DO9A 5TLSA 1XYVA 2QTZA 2X4DA 2BGJA 4G4GA 4MAFA 2HYIC 4EHAA 2X7JA 2VPZA 4PHTA 4WNIA 2JGKA 3R7DA 3R3VA 1XYYA 3HLKA 1NATA 3VNVA 1FFSA 1JR3A 4D44A 5JHHB 2WU4A 3GFOA 3A1UA 3DONA 3IMGA 4QGFA 5LSAA 2X1MA 3LUDA 5MFPA 2PH3A 3KQPA 1U1IA 2W9XA 3N74A 2HFJA 1C30B 1XMIA 1XTKA 4PZEA 4WCFC 2IFTA 5AHKA 4YRCA 1R5JA 5HGJA 3GZNB 3LH5A 1S3SA 2GCNA 2HI0A 2FRDA 4PTYA 1SZJG 5A9SB 4MEBA 4DRZA 5FV7A 4NZYA 4AD8A 1R9NA 1KFCB 1T6ZA 1PN3A 4JELA 4MB0A 5F7ZA 2AV6A 2E4VA 3EK2A 2V0GA 5L3RA 2AJ8A 1OYWA 1HKHA 1RRMA 3HFGA 4Q4HA 1XNQB 3GROA 3MC1A 3ZJTA 5T4HA 5KVQA 1TVCA 2IUEA 2I2DA 3PDIA 4Q12A 3TLYA 1GCIA 3HKDA 3RYCA 1P45A 2O7SA 2QXYA 1GPUA 1KDRA 2X9NA 2Y71A 3GRPA 3PJGA 4NYJR 2ZRNA 2II6A 1TCVA 4LZWA 4IUYA 4P5EA 1CB7A 3K1ZA 4TL8A 4DUGA 2HBZA 4TXNA 3U16A 5ALKA 3IQFA 1U63A 4BNVA 2C3UA 3K9QO 4BVHA 4E12A 4JXJA 1R9JA 4I4TB 3EBLA 2WHEA 4LISA 1TUIA 3R3SA 1E7MA 3RKRA 4E31A 5I4IA 2I91A 2O0LA 2FB9A 2VWQA 3AEUB 4UHDA 5K6AC 3GYBA 3T3GA 2OFOA 3P1JA 1ZH2A 3SJZA 1NJ1A 3OPMA 3ONWA 1MOPA 4GOXA 1M9NA 1PHRA 3Q6NA 4DLYA 3KETA 3EF3A 2QGFA 2W2LD 2EDCA 3FBWA 3JQQA 4HGQA 4Q1CA 3DLCA 4YDQA 2WHYA 2AOWA 2P1ZA 2R4TA 1NZDA 2WLTA 4ZGWA 2XR1A 1J8YF 3IILA 2VOEA 5K01A 1RCTE 4LV5B 3O7WA 3WWYA 1XK6A 2JRCA 1K3TA 1HLGA 3LYAA 4CF4A 4EYEA 3LCMA 1KSJA 5FFMA 3WTCA 4A1OA 4ARIA 1V9CA 3ANLA 1A95A 4XARA 2JEZA 2IDJA 3AKEA 5IT4A 1VRCA 3DDUA 4IV5A 4KR7A 4ZHSA 4PCAA 1EA7A 3GCWA 5GJBA 1FLDA 1ZD9A 3QWFA 4N5IX 2QJOA 4FWIB 1TE2A 2H2AA 3NVAA 4X44A 2ES4A 4BFSA 5I8WA 3OBIA 5MDHA 3WG9A 2X2FA 2DFVA 4MUYA 4UUBA 3COZA 5FI0B 3ESYA 1IEVA 4HWOA 2I03A 4NEHB 4KSCA 1NMZA 2C0QA 3K9GA 3OJ0A 4ZREA 4BWFB 2QN1A 3E9ZA 3NDRA 3HFRA 4MS1A 2IIQA 1Y37A 4KUGA 4NXMB 1XEXA 3TO5A 2HDHA 4AAYA 3OLCX 3WQSB 2YL2A 4O0MA 2HH9A 4F9GA 1F8YA 4I3HA 5BUZA 2QP4A 4FDUA 4Q4AB 1OBOA 3U9LA 1B6TA 1NBME 5FR1A 3STWA 1U3TA 4NK4A 3VU3A 1NI4B 2E5LB 4UM9B 5CNJA 5AM0A 5KVVA 4PVCA 3STHA 2B94A 4D9JA 4CQMD 4FHZA 1KRHA 1H1TA 1UC9A 3GB9A 4HVCA 5LYJB 5BORA 2QE6A 3VC2A 2O1SA 4DRXA 1FFHA 3R75A 5I45A 4KN9S 1PW7A 5BW4A 1LQTA 1WB9A 3I2KA 1U11A 2J46A 3DO8A 3AR9A 4MUXA 4Y9DA 1ORRA 2C84A 3C4JA 4B83A 3GUCA 4GKAA 2PD4A 3O73A 3TRFA 3U09A 3A32A 4GXRA 1OBCA 5A9TA 1LLCA 4LGVA 1ES9A 3T99A 3ZU4A 4XDGA 3EW7A 3NIBA 1MVLA 1YA4A 2MDTA 2WTBA 4O2BF 1IUPA 4UFOA 5CR9A 3ZW7A 1E5DA 3LA8A 4DQDA 5C7LO 2X7XA 2CMGA 1QGOA 2XCLA 3NC0C 3A1TA 4BZZA 1D4AA 3ZV5A 1M6EX 2JIQA 3DHVA 4ZOQI 3EH1A 3S6JA 4EKYA 4WBNB 1EHIA 3BSWA 4YDSA 1M6NA 2AHOA 4UXJA 3NT5A 1U6IA 4A8JC 1U0EA 1NHGA 1N2EA 2BEJA 1CJSA 1Q11A 1RKXA 4I6GA 1IWOA 4C3ZA 3G9QA 4AMBA 4BO1A 3N07A 3G8DA 1SOUA 4KBFA 1GU0A 1L8QA 4FX2A 1LDGA 4W6ZA 4DGSA 2G9UA 1BC5A 1LLUA 4LXUA 1YBVA 4Q02A 4TSFD 2W7TA 1KY2A 2P9HA 3UAWA 4GKKB 4PANA 1SCAA 5IKEA 2NZYA 4FLFA 4D3DA 1RRCA 2BMVA 4CM7A 3FWKA 1TFUA 1S8FA 3PC7A 5AXBA 1CQPA 2W6ID 3I01M 4H7DA 2PJRA 4UARA 2J9ZB 2NTEA 1N3IA 1PWYE 1YTLA 3JQAD 4UW9A 4L5YA 2M6KA 2GH1A 2GCPA 3ENQA 4BNFA 4J90A 5B30A 3THRA 5JNVA 3F8SA 2P6NA 4QVIA 3O5AA 4IXNA 5K4GA 1P2FA 2F3TA 3CPHA 4RBNA 3UCFA 4GP7A 4ERNA 1UP7A 1IDOA 2C7OA 1ZHOA 1QCDA 1F20A 3ZGVA 5DWVA 1NM5A 3OICA 3WLOA 1SQSA 4WOKA 5FULA 3DVAA 3ZBUA 2HK6A 3WK8A 4GMDA 1C7EA 1F8FA 2AIRA 1SHLA 1WF6A 2HWUA 5BR4A 3S3TA 2CFRA 2O8DB 1V9LA 1Z4QA 3O82A 3FCOA 1O77A 1YMUA 3BQMB 4E07A 4YV7A 5LOVA 3C3AA 2J7KA 2VJLA 2X58A 4WQMA 3E9EA 4LX0A 4ZDWA 5T6MA 3TAHA 4AYTA 4Q7MB 2CCGA 1I2AA 3VVLA 3LXRA 5CJPA 4M1OA 3KV1A 2ZRAA 1SULA 1L7BA 1FTNA 4XR4A 1QVWA 1H2WA 3C4QA 5EWLB 3QELA 4FSHA 4L8LA 4D25A 3UKJA 4TRMA 3WAGA 4MV6A 1UBGA 2NYUA 5GZ3A 1ENOA 4JL6A 4O4JF 2R84A 1UIRA 3GL9A 4EX6A 4C30A 3UG6A 4MYDA 2IXDA 4OKSA 4RJLA 4TQGA 1DO2A 1NVDA 3SF8B 1T1IA 1PJSA 2HMVA 2ZE7A 4FGZA 2H4JA 3CV3A 3A7DA 4E46A 3V8EA 3WGGA 2JFXA 5HIAA 4N82A 1XNJA 5JC8A 4FGKA 1SVNA 1DEXA 1GG8A 4QFMA 3GLIB 5IKMA 4JH0A 3UMBA 5L40A 1S5PA 3AINA 3RVRA 4NE7A 3DHWC 3N58A 4ND1A 1YAJA 1UT6A 4RGQA 3SYRA 4DCTA 4UPDA 4OAPA 4EPYA 1BN7A 2D7DA 1II9A 2WIFA 3NW9A 4TXMA 3VX4A 3ABQB 3ND9A 2CVPA 3GEIA 5DYTA 4FW9A 3ELDA 3RVJA 2XV1A 4RK6A 3EE6A 5A5VA 3AHFA 4MVJG 5LXTB 4NATA 3BE6A 2V65A 3DF9A 4CHGA 1DP4A 2QMYA 4EITA 4EUEA 5KHOC 4KK4A 3E4DA 1KMNA 3I1FA 3L82B 4LYEA 3IPRA 2QRNA 1XJCA 3LT0A 4G5HA 2VNKA 2HBYA 3D2LA 2IHBA 2DFPA 2WM8A 2CHFA 2PRIA 1NUAA 1Q15A 3NDJA 5AKZA 3PEEA 4R2KA 4BIIA 2FSGA 1G8SA 2PZAA 3AR3A 4B73A 4G0PA 2BI4A 2K6GA 3R0IA 4M22A 1H69A 3CX7A 3RSOA 3NT2A 2ZRHA 2VWPA 3REFA 3RK4A 4C2BA 1AMOA 1PV4A 1A9OA 1QMPA 2WNSA 4FDMA 1BRMA 4DYVA 4U9HS 3TEMA 1MFZA 1WLSA 3PE4A 3B13B 1DFIA 1N9GB 4TYYA 2CZGA 5K3AA 1B8VA 2FAXA 3DP9A 1XU9A 1AGPA 4TTPA 3VQTA 3W1EA 5CLJA 4JEHA 1Q0SA 1YJCA 4R2LA 2WG2A 2J4FA 2V7EA 3JR7A 2HREA 3DL0A 2DGDA 4AICA 4D41A 3A4MA 1CBUA 1MH9A 1JLRA 1GUAA 1IBSA 3LQFA 4QYSA 2VHXA 1TYCA 3KIPA 2P9QA 2QENA 4IGIA 3RS5A 1AJEA 2RJNA 1EESA 3KKZA 5F5XA 1OZHA 2D2XA 4EKDA 3ASYA 4MUHA 5F1OA 5JI3E 4GSYA 3I9OA 3N5KA 4LJKA 3SQXA 1E1DA 1T4CB 2D8MA 3M6LA 3OF5A 5CA1F 1NBWB 3H2GA 4LJ9A 2CMDA 1LF0A 4ND2A 4AMVA 4F4FA 3QVTA 1E2UA 1JAIA 3Q0EA 5AK5A 4RVDA 3AVTA 1JHXA 4NBNA 3FCYA 3IMKA 4E15A 4M1SA 2Q4BA 4LHVA 3LRXA 1X1BA 2ETXA 2NO6A 4HLDA 4Q9DA 4UZEA 5FPPA 5IK2A 1NR7A 4TROA 2CDCA 4ZXFA 1IM2A 2YYZA 1LI4A 4NI5A 1GLVA 5AKKA 1TJ3A 3HWWA 3QEKA 4WNYA 3ZVRA 4DA0A 1QGYA 5IZCA 3BGDA 2D4AA 3MOGA 1G9SA 3BHNA 4YAIA 5HQJA 1T9GS 3GW8A 5EOVA 2Q9BA 3TE6A 4D9CA 1O6CA 3FF4A 4GMGA 4IDHA 5KNCD 3ACCA 4GEGA 3VYTB 5LMCA 4TS4A 1VMIA 2D7CA 4U1RA 5FI1B 3ACBA 1N4DA 2O3TA 4GUDA 3VTAA 2Q5FA 2BKLA 1TYAE 3HKCA 1G59A 2FW7A 3EGXA 1JMVA 2C8JA 2Z1DA 3EFBA 1B0PA 1QB8A 1XNGA 3DTVA 4H17A 4KPGA 1QR2A 1WZEA 3R5FA 4QTTB 4RCZA 4RF4A 3WZ2A 3AVVA 3PD1A 1YE5A 4XH9B 5A5GA 1PZNA 2E37A 4IHAA 4EPVA 5E7QA 1EXMA 1DAOA 3GAMA 3NHWA 4QXMA 2C7PA 4RTKA 4F9EA 1L5YA 1NIJA 3TQHA 4Y1FA 1O87A 3ZPXA 3WLFA 1PK7A 1UZUA 3PUVA 1UFOA 2L2QA 3RSFA 2X1LA 4WZAB 3E9DA 2VJBA 2A5DA 3LC7O 4WI1A 1DXHA 1MRNA 2I6UA 2IDZA 4GI2A 2LPMA 3GJYA 5JQGB 1HT3A 1ZJZA 1GR1A 2ZUBA 2AUNA 2Q6LA 5CEJA 3X0DA 1QNLA 4Q4CA 1FDOA 3ZGZA 2NSLA 3QOFA 3BGSA 3PLRA 4EJ0A 1ADBA 3QVSA 3WP0A 1WP4A 1FQWA 3AYZB 2ID4A 5KKNB 1PDWA 4DSUA 2OUIA 4D9IA 4TTJA 2WMNB 3I42A 4MWBA 3CVXA 3AM5A 3FKSD 1NPTO 2JVIA 1RWPA 4QYXA 1J1IA 3IPYA 3MJCA 4DEVA 3PHBE 4PR3A 4QDOA 5HWSA 1YKFA 3KB2A 4BOYA 4MYTA 1A9XA 1PWXA 2FW1A 1GXSB 5H3CA 3GGOA 3Q40A 1SJ9A 2WUGA 1EQ2A 1PX2A 2I6TA 2JCXA 3FCXA 4AJOA 4AW9A 2H1HA 2QN3A 1YONA 1F38A 3MGAA 1LBEA 1SD1A 3TMKA 2M1ZA 2W6CX 3UGJA 1KZ9A 2WABA 1U8YA 4HTFA 1K08A 2R48A 1O0BA 4DLKA 1H66A 1BX0A 4LZPA 1VPVA 4F5WA 3PJRA 3UK1A 4YRIA 1R88A 3CHYA 4F7DA 5AIBA 3ELUA 3FXAA 3BHIA 3OFJA 3LHKA 3K0AA 5GY7A 5B3LA 5COBA 4NEGA 3W8FA 4M87A 1VJDA 1MKYA 4U6NA 1DV1A 3A1DA 1P3Y1 4JKYA 4K7JA 2ZU6A 3QEOA 4R8KA 2KX7A 4K8RB 4ZRNA 1OIWA 3O38A 1EKXA 3HO6A 5KDOA 5I7AA 1V3TA 4L51A 4F5DA 2BMFA 3QJ5A 1YU9A 2PL9A 3DLTA 4IJQA 5TC4A 4C76A 3G0BA 3UV6A 1WDTA 3FWHA 4KN5A 4I9UA 5AD1A 4D26A 4WBNF 4FNMA 5FWNA 1N5MA 3G82C 5EJAA 4Y6RA 4XJXA 2QQFA 3JQGB 2V7VA 4NYMR 5K2OA 5HF9A 3BE5A 4LJ5A 2ATXA 4Q4JB 2GZ1A 1U94A 1CR0A 1TM1E 4NOLA 5E1OA 3SFVA 1RJEA 3D8SA 3KB1A 4ZI2A 3L6RA 5H3HA 4CKXA 2GPNA 2W0MA 2XQIA 2YASA 4OIFA 1YVDA 3EUWA 1THGA 4DLZA 5A3JA 4TYMA 4PC7A 4CKWA 3VDXA 3V1YA 5JARA 2RGWA 3DEIA 5CLIA 5DPMA 3PVSA 5FBHA 3RV4A 2XMDA 4S1TA 1RJFA 5EGNA 2HPAA 4R2JA 2V9PA 3KO8A 2QD4A 2YZ7A 3AXTA 3E15A 1YCGA 4PO3X 4Q4LA 3ULKA 3H3XA 1Z8HA 2XJ9A 3CSDA 3K9LA 1W75A 5EA2A 5DBGA 3K1YA 4EFDA 1LS1A 1ETHA 1REQA 1PR6A 3OD5A 4MUJA 5D3KA 4ETWA 1XZLA 4DA6A 2X42A 5BQFA 2YXEA 2C57A 4TGLA 1RKQA 3SM3A 3FZNA 4B3FX 3MCTA 3LU1A 2J9FA 4HHEA 2V5AA 3DFMA 5HOEA 5AJTA 1J23A 1BXRA 2ECPA 4ISCA 1L4GA 4OMCA 1CIJA 1HL3A 1GZHB 5H1YA 4AF7A 1YVUA 4ZGGA 3ILYA 2AYZA 2GPWA 1F0YA 3DMTA 4OLAA 3I72A 4LJ4A 2JAHA 4E4TA 4P3NA 4L22A 3UMCA 1K9SA 4LRWA 3LK7A 5J4VA 2DERA 2DZDA 1U7TA 1CY8A 3L06A 2BFFB 1UPXA 3RPEA 3DBLB 1TK3A 2V9ZA 4O4LF 4RHEA 4DCVA 4D4IA 5L45A 3VNQA 5DLQC 3DHYA 3MCAA 4HL6A 4JBXA 4A26A 3OM9A 5CJJA 4MSUA 1E64A 3E82A 2BZSA 3CEJA 3O26A 3FTQA 4G1CA 3GJQA 2X9VA 4D42A 4HGNA 2ZW9A 1T2AA 1GKKA 4IDQA 4WCDA 4DKJA 1Y3HA 3RTAA 4IHKA 1BDMA 4FFBB 4B75A 4CKZA 5D5PA 3R7LA 1ECJA 4QTYA 4ZA2A 4B4UA 2QTWB 3G5LA 3PQ3A 2YY5A 3CH6A 2DHEA 2R1ZA 1VG0B 4ZQFA 2HHJA 1H2FA 1QQTA 2FN3A 3OJWA 5K0TA 1YU6A 5LB2A 3U3MA 1SC1A 2QRPA 1RI3A 3OIFA 4BFXA 3V00A 3EGIA 2EGUA 2VCEA 8ATCA 1QO7A 3HLYA 2BGRA 3A2NA 4ROSA 3RHFA 1JJFA 3KLOA 4S05A 4F3CA 4NPHA 1JTFA 4MMYB 2GN9A 4I50A 3TM5A 4WXPA 5DYWA 3HN6A 4JN6B 4HZGA 4GEKA 4JLNA 2V7WA 3M82A 1QIEA 4XIIA 5KYYB 1RQRA 4BMSA 2BJVA 1EFTA 4S3MA 5KCZA 3VUEA 2YS7A 2V6FA 3PUYA 1EVYA 5FHRA 4BMZA 2FMTA 4JR1A 1FU7A 1JZSA 4JROA 1QMGA 3RKUA 1Z5VA 3Q8MA 2F90A 3JD1A 1SMKA 1XZPA 2PD3A 2H2DA 4NV1A 5HBRA 3AKZA 1W19A 1E7SA 2FJUA 1DWUA 2WYOA 2R6DA 3ORHA 3GJTA 2OGUA 2OHJA 2B9VA 3KYIB 4GGPA 4JKIA 2NU6A 1QYWA 4N65A 1NVXQ 1QONA 1Z3CA 4W1SA 1L1FA 2XQKA 1ZRHA 3KQSA 4CV2A 4DLBA 5IM4F 3FNHA 3C7KA 3MF4A 1HNZB 3PGXA 3H11B 3MCUA 3NLLA 4JA2A 4MWTA 3ZJVA 3H65A 4K46A 2VUIB 2FEOA 1P4GA 2XEDA 3HYTA 4S24A 1TZCA 4OM7A 2OSVA 5KAPA 3E8SA 1KXJA 3NVDA 3VZQA 3ZXSA 3OLWA 2Z2XA 4EPTA 3VSEA 1N0UA 1W94A 2F1HA 2J0UB 2ZWPA 1FFCA 1HG1A 3GR6A 4QRHA 2P3QA 3OCYA 4DY4A 2ZS7A 2N1MA 5LP6A 2RMKA 1XCBA 4GRDA 5LD2B 1E92A 2NP6A 4LHYA 1PUIA 2EFYA 1XAJA 1U3CA 3GFSA 3I0ZA 3QXCA 4KYVA 4AMUA 3C87A 1IB0A 1TEHA 3NM5A 3KTDA 4JLDA 4RL6A 2OHOA 1UJ6A 2AE2A 4YBRA 2I6QA 4BUJA 4F6LA 1CNEA 4NZPA 5IFKA 3D0KA 1OIXA 5KB3A 1TT5B 1YB1A 3IDSA 1H3EA 4WA8A 1IOLA 2HXGA 4BRWA 1LS6A 4OQEA 4OGKA 2BZGA 5IAJA 6REQB 4DIOA 3KJIA 1QBKC 3E2IA 2GM3A 1NM5C 3CT4A 2NNWB 4KQHA 5BV1A 1DFHA 1A9TA 1AKYA 4FCWA 3CG4A 4JC5A 5GV8A 2WJWA 2W8ZA 2ZWAA 3KUDA 4RMNA 5CT6A 5CVCA 1X1RA 5KPJA 2PYDA 1NYLA 3U0VA 1O95D 1W0KA 1DJQA 4O8CA 3I5XA 1Q1AA 2ZB2A 3CZPA 2JFGA 4UBKA 3RK0A 4RZHA 5G4KA 4DL9A 2B92A 3I39X 2EWWA 1GVNB 4IUBS 4Q21A 3TVTA 3TIXB 3P5BA 1HFKA 2F4NA 3EZGA 4MGEA 4H7JA 2JH3A 3TQFA 1GPWB 1RXYA 3ROPA 1DBRA 3IXLA 5F2KA 1JXQA 5CIQA 1XAIA 4N3BA 1OV6A 2JHPA 4O02B 1IY1A 2CMFA 4G1FA 2R1VA 1L5HA 4YCLA 1NI5A 3QBJA 4XFJA 3I30X 1OWOA 5A1JA 1T9AA 5BQPA 2UZ3A 1RRKA 5KNBH 2WZQA 5F2EA 4YQFA 1RLTA 4J29A 5FEMA 5AVQA 4PGHA 3KD3A 2Y0CA 1R6AA 1T3SA 1GGFA 2CLIB 4A3SA 1FMLA 4PSVA 1XKTA 2VR1A 3BFXA 3DAPA 4JL5A 1X8XA 2V6BA 3UAOA 1A69A 1Z2AA 4EG7A 4LF6B 1RM5A 2LR0A 3LLUA 1ZY2A 2DHCA 3G17A 4IOKA 1V7PC 1XXLA 3BDAA 5F2OA 1GILA 2YJ6A 5IN4A 5KTMA 1U7DA 4X6LA 2YXPX 5DI3B 2HWYA 4AULA 1FW6A 2EF0A 2QMOA 1SCDA 4MPJA 2J3KA 2VPXA 2WWYA 4D0LB 4NIMA 3MGGA 3UAVA 2DFTA 1P9LA 2YHBA 1YI1A 1Q84A 4DR3B 2BGIA 3QUCA 3E3NA 3VPBA 2DEUA 3P0IA 3CTMA 2H5IA 3NEPX 2A35A 1U2EA 3OQJA 4Z0TA 3VJMA 4HB0A 2JPDA 2D59A 3FUWA 4IBOA 4UHHA 1GKUB 3OD1A 3CPEA 2OZEA 4JENA 4PYIA 4WZAE 1MZVA 1ZWKA 2ONZA 1M10A 3E7FA 1N2GA 3F9IA 4R8LA 4XYMA 1CSEE 2W2MA 2ZRCA 1OVMA 4GVPA 4HAUA 3WKDA 1DDIA 3V8VA 3OMXA 3TW8A 1MPXA 2XXJA 3OHMA 4LE1A 4GR5A 4TTQA 3CH4B 2P75A 4KNWA 4NJEA 1QLWA 4BVFA 3SS9X 1JVBA 3B1FA 1XRNA 1PAUA 1UK8A 3E7XA 1XDBA 4AUKA 3A9RA 1ZI8A 2CVZA 1XHLA 1J6UA 1KQPA 1U7UA 4JMLA 1OLXA 3OT4A 4MW4A 1NW8A 4YJ2F 4RSMA 4PQRA 3OLZA 3SXJA 4F9FA 2B4TO 1RS0A 3EF1A 1AQIA 1VPTA 4U8GA 1SXHA 5JPDA 1FFEA 2NTVA 3W0LB 3R5SA 1WSAA 1XMJA 3IH5A 2Y0EA 1EI9A 4UNPA 1JEEA 2P35A 4P7JA 2VHTA 3RIGA 4Z4IA 1I13A 1XZGA 3QU4A 4HO1X 2UXBB 1SG6A 3B89A 4Y9RA 2VAWA 1OMOA 2OQIA 2GXSA 1M5UA 3V80A 3VYSB 1VG1A 4NKRA 2ENUA 1U9YA 3R5KA 3EDCA 4CR8A 5JV5A 1I7PA 1L4NA 4L74A 3EODA 1DJPA 4TWIA 5TS2A 5D85A 5KWSA 2FQYA 2PTHA 4Y2RA 4BZQA 3K70C 2AZMA 2IEZA 4MGKR 4N0MA 2A1UB 3COJA 1U65A 4B3BA 4F04A 3PL1A 5EIEA 3GJ6A 3L41A 1P3DA 2X3YA 4ZRDA 2IJGX 3DNMA 3IBSA 4WN9B 5ARCA 4QU9A 2VF5X 4BN0A 5B1YA 4WASA 2JKYA 2OE2A 1FYVA 1H9BA 2HEGA 4NDZA 1VDZA 1BXZA 2HA3A 2WFLA 4G9BA 4R7ZA 5DHFA 1AHIA 3WRYA 2IEBA 2RH5A 2A33A 2YBEA 3RCBA 4DQXA 2HIMA 4MXDA 3CEHA 2X3UA 3LL4A 3H99A 2AFHA 3CZCA 2JEOA 1WNFA 1PR9A 1LPPA 2SKDA 2QTBA 2RHRA 4OB7A 1MIHA 2HLHA 3H9BA 1X7WA 3HE3A 5CB4F 3QX7A 3NUZA 3G2NA 1ORTA 2DUNA 2BI8A 2BC9A 2H57A 4K9OA 3WQRA 1QRTA 2G4LA 1VB5A 3HA5A 4P0PB 1YZVA 2HSDA 3AUTA 3HVJA 4FS3A 4B6FA 4BZPA 2ZSJA 2GXAA 1YHNA 3IJRA 1AKQA 1AUXA 2I2AA 4GYYA 2FPKA 2RH9B 5I5EA 1W34A 2WFLB 3EVTA 1WV1A 4LTMA 3KSMA 3B3GA 4P4GA 2HL6A 3ZV3A 4AN0A 5EZYF 3U7IA 1R8JA 3KJGA 3LWDA 8ABPA 3THXB 3L5OA 1EJ0A 1IQPA 4RLHA 1NKVA 3A3KA 5IUJC 1GUYA 1HR0B 3BMOB 4DS3A 4YASA 3R7BA 1GL7A 1EFPB 3RVLA 4ZZ0A 1FUKA 3KOXA 4L95C 4NQZA 4DT1A 3GBSA 2RKOA 4UEKA 3PVCA 2D5IA 1YR1A 1TPZA 4PICA 3WNZA 4F72A 1RMQA 1SD2A 3D7NA 1DELA 3JRXA 4UNSA 1R8QA 4LY6A 9ABPA 2BH9A 1Y33E 2GEBA 2R8XA 2UZ0A 3L7NA 2OCIA 2ACKA 2YZGA 2HKIA 4KFSA 5HF6A 3PEWA 2QLBA 1BE0A 3H1TA 3C98A 1CW2B 2REQA 2XUFA 3WNDA 2GM4A 1U9ZA 5DOZA 5K8IA 2XBLA 1XZCA 2EC5A 2UZ1A 2XSZD 4BEVA 3OH8A 2ZJAA 3DLAA 4EYGA 3K7EA 4OQYA 3T1OA 4PHHA 5EJ7A 5GWXA 3EZ6A 3WAJA 2QMUA 1WEKA 5FD8A 2FR8A 3CN9A 1AO3A 1KC1A 2X4IA 3D3EA 2NG1A 2JLSA 3FB4A 2FPRA 3I2FA 3QHQA 4HYQA 3JZAA 4Q1BA 5CX1A 2NSHA 2XKBA 5FADA 4E1BA 3VPCA 3T7JA 1G7SA 1OCEA 2UYQA 4MV8A 3CEPB 3JQ8B 3L3BA 3IXQA 5AW5A 1I14A 5CGQB 3B3FA 4N6GA 1YE3A 2EW1A 4GX0A 3FPHA 5HUHA 4RTOA 2ZWMA 4DV5B 2BWJA 4MW1A 3GH3A 4KEAA 1L7MA 3TLMA 5J4HA 2I1VB 1JKJA 5EUQB 2RB5A 4J9UE 1SBIA 4R8RA 4ZTBA 4MTLA 4OGGA 5JSZA 3RIHA 4KLZA 2HMWA 4XLLA 1N5DA 3W3AD 2Z4TA 3IT3A 3GEHA 1JHPA 5TQ2B 3QIVA 1N92A 2FMKA 5KQMA 2R1UA 2ID9A 2I3DA 2W2VA 3D0OA 2ZUDA 5BWLA 2CXSA 1EBBA 1M1XB 1IEWA 3IRUA 2VRCA 2I4LA 5EAIA 1NC1A 1LW7A 2IUFA 2QPTA 1F60A 5L8VA 1SVMA 3FYHA 1GTG1 4YP0A 4F8YA 3JYNA 1HYGA 1K2WA 2ENWA 2HHCA 1C7QA 1PWHA 2E0IA 3VAAA 1UMKA 3FYDA 1RMYA 5C32A 2P5TB 4B71A 3UT6A 1FSZA 4KRYA 4AP6A 1J0EA 2JANA 3G0DA 1T8PA 3WMEA 4JI2B 1HL7A 3U37A 3F4BA 3LY8A 3CUVA 5F9FA 3DEJA 3QPWA 2GCGA 3HWX1 5JXGA 3P9KA 2IU3A 4PO9A 3IUMA 1UPCA 5JTTA 1HE8B 3JR3A 3RYIA 5L95A 1E8MA 4RE6A 5JPCA 4XIYA 1GPBA 1WDWB 2Y76A 5C7YA 3GNQA 5K09A 4OOFA 1CUBA 4DABA 2CUNA 3WHKA 3BE4A 1RM0A 3DEZA 4DV6B 2FK7A 2A9RA 5DTEA 2WJGA 3KTFA 3PFNA 2XCTB 2QHXA 3TYXA 3RVBA 5T4EA 5BYKA 1CJBA 1JB1A 2AR7A 4XSHA 3L05A 2V7XA 1U7PA 5DEOA 4XW2A 1Q6YA 3OJXA 2PRJA 4HNRA 1E79D 3NBUA 3HBFA 5CCDA 2Z58A 4UZFA 4JU9A 4D9MA 4NE2A 4E5SA 1EM8B 1SEVA 2O1EA 3NEYA 4YS6A 5CDTA 4YJ3F 1TMOA 3BG5A 1XVLA 5JZSA 1LUAA 1X6VA 3TEFA 1A4IA 2H29A 1V9SA 2BBWA 1OX4B 2J6CA 4NCHA 2OCDA 2UVPA 4KYUA 4F60A 1ISSA 1V5WA 2C7VA 4Q7EA 4ZP1A 2HIAA 1CJMA 2J0SA 1SOAA 4WINA 2PL1A 1XMQB 3EXG2 1L4EA 2EGHA 4TM8A 1X80B 5JSYA 1M34E 2PPVA 3GAZA 1G9TA 1I33A 1SN7A 1NHWA 1DO0A 4O4LA 3E3OA 1MF7A 4FNOA 1NVMB 2PU5A 5CPBA 3E23A 1E4OA 5KJFA 2VHJA 4OXYA 5FUBA 3KZXA 4D82A 3GDHA 1WDMA 1VIVA 1NMXA 3HVHA 4OFBA 3W5VA 1WBDA 2W4MA 1JR2A 1NONA 1HSZA 1UOEA 1QR6A 2IIBA 3AUSA 3W3AA 5CB4B 2A78A 2WYVA 3R6WA 1CS4C 1H2RS 4V0KA 3UT5A 5ALFA 1C3JA 5CHEA 1VE1A 2QRUA 4KLCA 3M2PA 3RTCA 1FDVA 1I3NA 1QV7A 2VT3A 4MUMA 4N54A 1AHPA 2QP3A 2N75A 2Z5FA 3CWCA 3LUKA 2ON6A 3F49S 3L18A 3RC2A 3ZWBA 4AZ0B 5ECGC 4AL4A 4XB2A 1K6MA 3B5JA 4IJ5A 1P1CA 3K2EA 3O83A 1PCXA 2PSHA 4B4DA 4BY9E 5L9AA 1Y80A 1ZNXA 2F62A 4PSUA 1C3VA 4LXQA 4A8JA 1O58A 4Z2AA 3LGXA 3NASA 5ICGA 4NMMA 5BNWA 1K89A 3NNSA 4W5RA 1NQXA 3OY2A 2PUEA 1JTEA 1TMGE 3I9KA 1FX1A 1X7YA 4PS0A 2CF5A 5LWQA 2FZKA 1JR4A 1GRNA 1WQ4A 4O2AF 2XDYA 3AVPA 4MS3B 3EB9A 1JSXA 5FNVA 4ARVA 1Y89A 5DRTA 3ZHBA 5C4MA 5CFPA 5JT1A 2DE0X 1T26A 4ETNA 3HWRA 3OEHD 3W8RA 1J0XO 3EFOB 4JB2A 2KYRA 1OT3A 3BORA 5ED4A 1ZYUA 2EX1A 2O6HA 3H2IA 3BEDA 1IN5A 3OZWA 3SGLA 3TINA 1JR3D 1SCNE 2OC9A 2SNIE 2VCYA 3MS2A 4GM1A 1NXPA 3H2KA 2G76A 3ZH2A 4HYEA 1WS6A 3O94A 1NRIA 2QK4A 4TXJA 4HFJA 2ZP1A 4RETA 2RIRA 3F90A 1HMPA 2BM0A 5HZMA 1N33B 1XEAA 1MJHA 1QOZA 1TIBA 2IH5A 4HH0A 3C8UA 4IS2A 2R62A 4KBYA 1Y8ZA 3UJCA 3OEWA 3RS0A 1NYRA 3VTFA 2Y1LA 3NKVA 1V2HE 2R87A 1YS9A 2FPGB 4REQA 2OP1A 4ZO7A 4DPMA 4JWTA 1X8JA 2BMEA 1FP2A 1RLIA 3L43A 1N2XA 1A27A 1VMAA 2W2QA 3SSOA 2XIJA 1TQ4A 2AA3A 2HMYB 2PEZA 4ZAVA 1SUIA 1EX6A 3UMFA 2DPXA 2HBRA 2YWHA 2Q50A 4PS1A 4KAFA 4BTEA 5CD1A 1F51E 3HB9A 3JATA 3MWLA 3R5XA 4OY3A 4RXUA 2ZPTX 3K5PA 2JI8A 1V2GA 1P7ZA 2A14A 2V8BA 3RFTA 1UM8A 2FPXA 2HV8A 2Y1XA 4QQKA 2HPHA 4UTRA 1N7JA 2W2KB 1OH6A 1SB9A 3MWKA 1C7IA 1YHYA 2IY9A 4WW0A 5AJHA 3L0SA 3ID6C 4PPYA 1GNSA 1N1EA 1JBKA 3W3AH 5FLXA 4RFSA 3HXQA 3K2QA 3NIDB 4UAVA 2C0CA 2HZBA 1G5QA 3T5GA 4ARAA 1P1BA 2RGDA 1EVEA 4FYMA 3AR6A 1GTL1 4XPIA 1ZKDA 4FFRA 5AJWA 1J24A 2VJMB 3NOXA 3RTBA 3IJPA 5KNDH 5TS3A 3AO0