2ODNA

Msreca-datp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
326
structure length
310
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 83
structure length 310
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2odnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2odnA01
2Q6TA 2ZU0C 2W58A 2DFKB 2J0VA 3AF0A 5C1BA 4EJSA 4TQAA 2QPAA 3P27A 4Q00A 5JSZB 1W0KD 2QAJA 4KFTA 2J46A 3CRW1 3GLFA 1OFTA 1QBKC 1NG9A 1UAAA 1GUAA 1TEVA 1N5IA 4JLJA 3VR2A 2OILA 3KJHA 2XB4A 3DKVA 5KSPA 5DO9A 5JSZA 4WW0A 1KMHB 2YINC 4EJSB 3GMTA 3I4LA 4MRNA 2QSYA 2AX4A 3U3RA 3VHXA 2QGZA 5JCPA 3TQCA 4ZCMA 3THWB 3C15C 5FPTA 3SOPA 1QHHA 2ZI4A 4G1UC 1FMJA 1ZU4A 3OE7D 1W7AA 4M22A 4QOSA 1XEXB 1CRPA 3CPHA 3B60A 2DWQA 1DELA 5ANRB 1UKYA 5AJZA 4YMVA 3VX3A 1JBKA 3QF4A 3I3SR 3MWKA 4HUQA 3IQXA 2VPPA 4D4JA 2J0SA 4AC9A 1HT2E 3K09C 4JMPA 3AKCA 2ZS8A 1DTSA 4WVFA 4U02A 2ZRPA 4F4IA 3IEVA 3DVLA 4A9AA 1XMJA 2QN6A 3LX8A 3PENA 3TUZC 4CYMA 1LW7A 2ZRFA 4V0LA 1KZ7B 2JCSA 4HB3A 4DSUA 4TYQA 1T6NA 1ZYUA 4DCTA 2Z5FA 1N25A 4HAYA 4E5UA 5CM8B 3IHLA 2FNAA 1M1YE 4TL8A 4US0R 3I8SA 3W6OA 1KK0A 1KJZA 4W5HA 5DHAA 1U98A 5EE0A 5J4HA 1VKJA 3SYNA 2R44A 1J7KA 3IIKA 4LHYA 1LF0A 3UMRA 2FV8A 2IF0A 2QTHA 3GLHA 3L8YA 2HV8A 1YVDA 3SZRA 4Q18A 1XCPA 2HLDD 2ZE7A 1YR7A 2GCOA 3SFVA 4YMTA 1AS2A 2WWXA 5F9HA 1XTKA 3TR0A 2R8RA 1ZM7A 5AUPB 4Q4JB 1PLKA 5CDFE 3BRWD 3ICQB 4LOAA 1JAHA 1G21E 3VR3A 3R8FA 4JLAA 2D4HA 3RWMB 4UNNA 4KVAA 1EK0A 1E99A 1VG1A 2WJHA 1U81A 2WPDD 2RGDA 2BOVA 1OKKA 1UFQA 2BM1A 2G0TA 2GVDC 1CJTC 1XTQA 2GTPA 3NHBA 5IF9A 4ZCIA 3ZVNA 4OHYA 2LWIA 1XF9A 2O0JA 1JNYA 1E2JA 2ZVQX 2RGBA 3THXA 4TYYA 1Z06A 4HATA 5FI0B 1Z0DA 2VYFA 3AKEA 3K70C 2VEDA 3AVPA 4JLVA 2OSBA 3EPLA 1QHNA 1Q3HA 5KOYA 1XTJA 3ASYA 1IAQA 1ZIOA 1W2GA 2OE2A 3UATA 1BH2A 1HV8A 1KSFX 4CEJB 1E9AA 4RFSB 2F1JA 1OXVA 5EZ5A 1UM8A 5DI3B 3ND9A 3WBKA 4AKGA 2VSFA 4IDHA 1G7CA 4M9QA 3GJ3A 1CEEA 2D74A 2ZE8A 1IOZA 2V6JA 1G3IA 1AIPA 2ZRDA 1RZ3A 2DWPA 2G0NA 4MGKR 1Z08A 3V9PA 2UZ3A 3U7HB 3CO5A 4MKHA 1AZTA 1SXJC 4M1TA 1EFHA 4PZLA 2D2EA 2ZJ8A 3W8NA 4ACBA 2FFAA 2RGEA 5B2ZA 4DEYA 5FPKA 2W6JA 3ZD7A 4G5SA 3Q5DA 4FMCB 2G88A 1R0XA 1PV4A 1KDTA 2MSEB 2PMDA 1E1QA 2GVZC 2ODBA 4U5XA 4B33A 3V4RA 2QY9A 1VYVA 4FN5A 1YU9A 1A7JA 4Z54A 3SQXA 2FPLA 3THWA 3QKSA 3M0EA 4B32A 4Q1DA 2CL6X 2IA5A 1GM5A 1Q3TA 1OKKD 2QG6A 5FI1B 4FMCF 3K0FB 2YKGA 2J9RA 1NL3A 2WMOB 3K1JA 1S2MA 3EWSA 2QPOA 2VF8A 1PVOA 1TQ6A 3PG5A 3GEEA 3QQ5A 1WE2A 4B74A 2UVQA 3H2YA 3O8RA 2ZJOA 4RFSA 1VDZA 3BERA 4DCVA 5DE3A 4ASUD 2YJTD 4URYR 5EP3A 3BBPA 4Q1BA 4D82A 4Z1MA 1PZNA 3KQUA 4KFSA 1W36B 1ZNWA 3EA0A 4Z8YA 4D26A 1X1SA 2FSIA 2HXYA 5F98A 3PITA 1G5PA 4XTRA 4JVLA 1SHZA 3C7KA 1SKYB 4NZYA 3LXRA 3PUZA 4GI7A 3MUFA 1BS1A 1CTQA 4C2TA 3KJEA 1FP6A 3I32A 1SULA 1BOFA 1Q0UA 2N42A 4NHOA 3EZ9A 5IHPA 4TWZA 3SBDA 2E87A 3C14C 3BB1A 2XSZA 4LRWA 1KAOA 4GFDA 2ZUDA 3BIFA 4KHZA 3K0AB 1XDBA 2G1JA 3K9HA 2HDNB 4TTPA 4CT5A 1RRPA 1QHIA 1W5SA 1FUKA 4BFVA 1E0SA 5FOWA 1RRFA 2BWJA 1VG8A 1T4GA 3ZJYA 3TVTA 3KKOA 3NXSA 1W1WA 1RFLA 1S8FA 4TT3A 5FTKA 4EFMA 1N5JA 2IEYA 4QL3A 4V0MA 2GXQA 1X8JA 4D6PA 5ELXA 1EFTA 3O8CA 3LWNA 4R71A 4JKIA 4C0AC 2X2EA 1R0ZA 2CCJA 1T0JB 2IYQA 2ZJYA 3BH0A 4Q1EA 5EXTA 3BOSA 4TLDA 2NQ2C 2CXXA 4PZYA 2CCGA 1E0JA 5D3QA 4JJKA 4H1UA 4MUBA 1EWRA 1P73A 2XXAA 1YZLA 2O8BB 2NO1A 4BLPA 4HLUC 1QHXA 2HCBA 3AGQA 3KXIA 2GCOB 3AF3A 4URUR 3HDTA 3IIMA 4C2UA 4GOKA 1UBCA 1P4SA 3EW9A 3GLHE 1G8GA 3OZXA 1DS6A 4HAVA 2DHRA 3CZPA 4IJMA 2A5FA 2BVNA 3QIAA 3ASZA 4QNRA 3IQWA 1NJFA 2J7PD 4M9SA 4GP6A 5G41A 5CDFA 2ZR9A 1KIMA 1SVWA 3BB4A 3A58B 1S1MA 3SU8A 2V54A 3A8TA 4MITA 5FL3A 3FWYA 4L5BA 1E2LA 4X8MA 1KNQA 1KK1A 4M9XA 3ADDA 3RS3A 2QI9C 1G3RA 3C41J 4LJYA 4KBFA 2WMNB 4JL6A 3ECCA 3EPKA 3P4XA 5DSZA 2OHFA 4WZBE 5FPHA 3K0FA 1JXMA 4DRZA 3QSYA 1GL7A 2AWNA 2P65A 4RZ2A 2DY1A 5AJYA 1Z2AA 3P32A 4LYAA 5JI2E 4TYPA 5KSOA 2MMGA 3X1ZA 1ANKA 5H70A 4AG5A 1LV7A 1US8B 1E98A 3P4YA 3CRVA 5JRJA 5TVKA 2BCJQ 5J4VA 4MRPA 5BYKA 621PA 4DSOA 4I4LA 4MGZR 1P60A 4X8OA 1E9FA 3X2SA 4PR0A 4YDSA 1HY3A 3R9WA 1TPZA 1FTSA 1GNQA 3AP1A 4BEBA 1II8B 2WWHA 2ZSAA 4E07A 3H0KA 4PHGA 1SKYE 1E79D 3OIWA 1NP6A 3O8BA 1Z5ZA 5KHOC 2GNOA 2H7VA 2GBLC 5EP1A 4AYWA 1XP8A 4ACAA 1UKVY 2G9NA 3BD9A 1YE8A 3LDAA 2ZS7A 3PEYA 1P62B 4A6PA 2P2LA 4LV5B 4XD7D 3VR6A 3QENA 5DYGA 3WP1B 3HPQA 4QM6A 4YMWA 3OAAA 2IUUA 3V00A 5IT5A 1ZP6A 3U3KA 2O8DA 2RHMA 1IY2A 2XNDA 1P3JA 3MGCA 3B1VA 4OL0A 5LD2C 1AM4D 2Q9BA 2RHDA 3EXAA 4QKQA 3QY0A 4BFXA 1NN5A 1Z8FA 4B44A 4UNRA 3G0HA 3Q8XB 1SGWA 3OESA 1OLOA 1SVSA 2A5YB 2BMDA 3REFA 2ZQ5A 4B3DA 2AKAB 4PSVA 1UJ2A 2QMEA 4AY2A 2VP5A 3QVVA 4F93B 3TNFA 4JLKA 1NKSA 1WBDA 1L2TA 1SQ5A 4II7A 4DLYA 2H17A 2YWHA 5EE5B 5FOXA 2GILA 3K70D 2YNMA 3IEUA 4W5WA 4ZDKA 3RC8A 1SVKA 5CLQA 2A78A 1AKEA 3NBXX 4EIWA 2R6FA 3B8HA 1XJ0A 5EXXA 2JJ2A 5G3ZA 2VP6A 5CJPA 3I73A 2Q3FA 3QKRB 3SJZA 2XOKD 2NO0A 1TADA 121PA 4DIDA 3SNHA 2HYIC 1E69A 1IXRC 3CPJB 4HB0A 4NONA 3CLVA 3ZH9B 1GAJA 1GTVA 2OLJA 4F91B 4V0ME 5AJXA 2YV5A 4B47A 2WICA 5JBQA 4OQNA 2J7PA 2ZM5A 1SXJD 2ZRHA 3U6BA 1G20E 2CLDX 3BB3A 3QF7A 3T61A 1QZXA 2VHUA 1FPMA 4TYNA 4DC9A 4XWOA 2VSOA 2PMKA 1Z0IA 3QEOA 3AGPA 3NH6A 5EZ6B 1Q57A 3EG5A 1GRQA 1YR9A 1P2UA 2C78A 1E79A 5FL7D 8OHMA 1X6VA 3AV0B 4C30A 1N5LA 2GEDA 3CH4B 1FNNA 4UNPA 4BFSA 4DVGA 1ODFA 2EWWA 2CHGA 3Q85A 2EFEB 2CNWD 1OFHA 1W0KA 2C8VA 2QQEA 2R9VA 1SVOA 2ZAOA 3FHCB 5JS8A 2WOJA 3T12A 5FH9A 1U90A 3FDIA 3K0EA 3QOFA 3T1OA 4DLTA 3CBQA 4UJ5A 3UK6A 1X86B 2EYQA 5GVSA 3VNVA 5SZKB 1CBUA 4NCIA 2GXUA 3SDZA 1CIPA 2XGJA 3K8YA 4URZR 5JJKA 2OCBA 4B2PA 1AKYA 3CUEF 4PANA 3RC3A 1OH6A 4OI0A 4HAUA 1T9HA 1SXJB 1YZKA 1I4LD 4TSFD 1VTKA 1TTTA 4Q4LA 2FSFA 4Q1FA 5G3YA 2WWGA 4TL7A 4DCSA 5TV2A 4C4PA 2AK3A 4MDEA 2X1VA 2X2FA 1RKBA 3ONWA 5D3MB 4NCNA 4IEEA 2E9SA 5FBQB 1NIJA 2B6HA 2ZYVX 3LQQA 2AXNA 3C8UA 4PX9A 1KGDA 1QDEA 1S1CA 4JLPA 1VCIA 1KDOA 3Q9LA 1R5BA 4Q1CA 4BQSA 1G7RA 5H68A 4JLOA 1E9EA 3M4YA 3A6PC 1Y63A 2H18A 3JVVA 4DDWA 4U00A 1TU4A 2ZROA 3MJRA 4GOJA 3RSOA 3PV0A 4V0OA 1CJMA 2GBLA 4IOLA 3SBEA 4PSKA 1GITA 4PXAA 2GJ8A 1IM2A 1Q12A 3X1YA 1WDTA 2GEUA 1V43A 1W48A 3KJIA 4A0FA 1NVUQ 4F4CA 1W2HA 3HYRA 1W4BA 4GMXA 4LYHA 2ZRAA 1J2JA 5FR2A 1XPOA 1DO2A 1EFCA 4G3XA 2ZEJA 2VIIA 4TLBA 4LJ8A 4OI4A 1KK2A 3U7GA 3OF5A 5L3SB 3BC1A 1XD2B 2H5EA 4AYTA 4EQ6A 4U7DA 3RRYA 4ITRC 3NKVA 2GK7A 1G18A 1AZSC 1Z2CA 3PR1A 2RCNA 5EJEA 2AHOA 4TTQA 1M7GA 4PHTA 4BGDA 1AA9A 4BFYA 1CJVC 4RY2A 4TTRA 4PC3A 4A82A 3GLIB 1L7VC 3HR7A 4JBYA 2Q0HA 2NIPA 2Q3MA 2VH5R 2PJZA 2ZETA 2A7QA 3LBIA 4OJKA 4C0HA 1JR6A 4I99A 3BS4A 5AJVB 1MO5A 4PAMA 2AFHE 2CHQA 4FINA 1FZQA 4Q9HA 1N6LA 1TU3A 4W5JA 2ORWA 2CK3A 3GP8A 1PLLA 2ORIA 2QM7A 2RH5A 5FUXA 4BPBA 3E5HA 4D4KA 3K0AA 5FOUA 3RDPA 3UXMA 1A2BA 1GRRA 1KI9A 3GEIA 3N2EA 1NMYA 2WJIA 2GJ9A 1JQLB 4RJLA 1IXSB 4DCNA 5BXQC 2BJWA 2GWHA 5AJWA 1OF1A 1QVAA 4ABYA 4ZKDA 1Z29A 4DHEA 3PJRA 1OHHA 4O0MA 3WNBA 3SQWA 1JPNA 1T3LA 1TF5A 4MKFA 3W90A 2H57A 4M4SA 3BXZA 2KB0A 2XSZD 3N2IA 5KTYA 3UWKA 2ZVPX 3A36A 1QRAA 1N0UA 3RS7A 1N6HA 2G1KA 5KPJA 2H8KA 4CEIA 4EFNA 2VP0A 1CS4C 3M6AA 4RD0A 3H1TA 1YR8A 4IVPA 3CNNA 4BUJA 2WAXA 4TMVA 3NH9A 5J5CA 1WXQA 3CR7A 4Q21A 2JLVA 1U2RA 1XEFA 4G5OA 2P5TB 2K5UA 5AUOB 3GLFB 4LSGA 1KMHA 1KKLA 3Q3JB 1ZBDA 3I92A 2FEOA 4A4DA 5L3VA 4QM7A 4A0HA 2FH5B 4IHQA 1Z6YA 2P6NA 4PHHA 5LPNA 3FHOA 5BW8A 2XNSA 5JI3E 4RFVA 1IJEA 5KUTA 1FMLA 1KJYA 3AVYA 2JATA 1QHHB 1H8HD 2O0HA 2O8EB 1P72A 4L15A 2QZ4A 3U5ZB 1ETUA 1U8YA 3NBFA 4P4UA 4B3GA 3IO3A 3OEEA 3EZ7A 2ZANA 4DB2A 2XJ4A 5LB2A 4Q48A 3BWDD 5FUWA 2OEPA 1GKUB 2QTVB 2EVWX 4MGYR 1H8EA 5F2EA 3SJCA 4PO1A 4Q7LA 4Q01A 4MDFA 2FPMA 4B3CA 2DYKA 4TMTA 3H4MA 3QPWA 2CCKA 4OKSA 1UADA 3HJNA 4LJ9A 1SHKA 2GCNA 1E4YA 2BJVA 4N3NA 1XMIA 3VR4A 3X1WA 2OM2A 3WNCA 2N46A 1E2GA 1RYFA 3IPXA 2XZLA 1CF4A 1JAIA 5G53C 1PUJA 1X8LA 3K0SA 4TN1A 221PA 1ZNZA 1RRGA 3UKDA 3LVRE 4KFUA 4JBXA 3UMSA 2BC9A 4BRWA 1KNXA 2WWYA 3GPLA 3PEUA 1UKZA 1R2QA 2WJGA 4B2LA 3DM5A 3LRPA 2PEYA 3BE4A 3LD9A 3T5GA 2FMXA 4HDOB 3SHFA 1Z63A 1NLZA 2DB3A 4M53A 3FPAA 1YRAA 1E9RA 4LI0A 4NYMQ 3QJYA 3UMFA 5HZHA 4MRRA 2J7KA 4LHZA 1P7CA 4FIDA 4PQRA 4UXIA 2CL7X 4LJAA 5KNBA 1G3MA 1GP2A 3T15A 1SVLA 4DLSA 3W3ZB 1Q1ZA 3A1WA 3QVUA 5E3HA 1QHYA 5HR5A 2G77B 4PC2A 2BKUA 1Z0KA 4JZKA 3CW2A 4JYBA 4QBFA 1I4TD 2ZJ2A 2IWRA 3VFDA 3NBYC 4JKYA 1RE0A 3RRNA 3QXSA 1HQCA 5JEEA 1G17A 2WPDA 3C4JA 3RS0A 2Z43A 1ZUHA 3DMDA 3N5CA 3AUXA 3ZZUA 3PUXA 4ZI3A 4PPGA 2PT5A 2OFXA 3GLHB 4C0QC 1UDWA 3B13B 1C1YA 1F2TA 4TQ9A 2RGCA 2ZRCA 2UZIR 3RRZA 3AEZA 3B1YA 4YXWA 1PUIA 1PLJA 2Q3HA 1R5OA 2FOLA 2W2XA 3U61B 4CZ2A 1G8PA 1F3OA 4LJ6A 4HZIA 1N2CE 2QP9X 2OBMA 1T3SA 4UKDA 2N1BA 1HURA 4CVNA 3GQBA 4AG6A 2ZRGA 1GIAA 1Q44A 2CNWA 1E9BA 2ZREA 2MSCB 3CX6A 3A1TA 3WRYC 1NY5A 2WOOA 3FVQA 3HU2A 3X1XA 2DR3A 4EDHA 3LW7A 1EGAA 3AVVA 1K6MA 2DFNA 2NPFA 1XTSA 1ZJ6A 3HR8A 1MKYA 2C98A 2D62A 3DMNA 4IRUB 2PLFA 1MO3A 1IN4A 2G6BA 3D8BA 4E22A 2OCPA 3N70A 2WJJA 3LNCA 3CX7A 4TT3D 1HA3A 3R7WA 1VHTA 2I1VB 1D6JA 5GJVC 2IX3A 4XOIA 1K5GA 5H8WA 2OCAA 1OIVA 2FX3A 2BV3A 4CT4B 1S96A 2BMEA 2NOAA 1RW4A 1KSGA 3T1VA 4Q7MB 1KO1A 1E2NA 4V0NA 5FBLB 2O52A 2GHIA 1II8A 2OAP1 2FN4A 2GCPA 4BECA 2VP9A 2ZRJA 2C9CA 3CX8A 3OIUA 4B3XA 2GXAA 5DISB 1KYIA 3CONA 3BORA 2B21A 1NVVR 4RD2A 5JCZA 3A4NA 3ZVMA 4LPKA 1OXTA 2IT1A 3HPRA 5IK2A 3EWAA 2L0XA 2AK2A 1XPUA 2GKSA 1F48A 4DCUA 1E1RA 4NP6A 3QUSA 3PEWA 2AFIE 2WWFA 3RHFA 1D8TA 3H86A 3THYA 2Z4RA 4JLBA 2W6IA 3D31A 2ZRLA 3CF2A 3LO5A 5BN3A 2XTNA 3QXHA 2J41A 4M1SA 4A8JB 2IYRA 1GKYA 3U44B 5DHFA 3S1AA 2AL7A 2FGKA 4HLUA 4YDHB 3TK1A 2ZYTX 1XU4A 5DYIA 3UG6A 3I5XA 2BHRA 4KAXA 3AB3A 3U3JA 2B92A 3AF1A 1M7HA 3MLEA 4KXFB 3KXKA 3L0IB 4NYIQ 3LA6A 4BWYA 4DBLC 5DNYB 3KJGA 5FPYA 2CBZA 4FWTA 4OYHA 4P4TA 5CK4A 4QGFA 3DOEA 2OO7A 1D5CA 2IXGA 4PPNA 3GJ4A 3OEHD 2C77A 4I1SA 3OFNA 5CB6A 2JIZA 2VP4A 3WY9A 4ZIRA 4K81B 4PO8A 3C16C 3GJ8A 2F3TA 4GZMA 3ZVLA 1DPFA 1U0JA 4LPSA 3THXB 2CE2X 1N6KA 2XOKA 5C4GB 4KJZA 5FOVA 4KO8A 3IDQA 3DO6A 4TMXA 1G8YA 2OFWA 3MWYW 1CU1A 2QQ0A 1VCOA 1NBME 2C9YA 3WP0A 2ERYA 3NC0C 1B0UA 1G19A 5DN6A 5FTJA 1KI4A 4P32A 4NYIR 5KYKA 1NF3A 3TAHA 5JHHB 4XTCS 3LY5A 3KFXA 2MMCA 2RGGA 1FQJA 2J0UB 4MKGA 4NCKA 3A4LA 2IS4A 2O8FA 1S3SA 3PEVA 4D80A 4P31A 2C95A 2ZITA 2R65A 3NHAA 2FU5C 1ZINA 4YLGA 1YRBA 5E4FA 4FCVA 3L43A 2G3YA 2J3EA 1FOEB 1U9IC 4M1WA 4C0JA 1ZCAA 1XEXA 1CJKC 3GCGA 1JQJC 1M34E 4LV6A 4P0TA 2AD1A 4AWXA 2GK6A 4B3BA 3LBNA 4EPXA 2XB2A 1NG1A 1QF9A 1XRJA 1KI1A 3MRSA 4JT4A 3THOA 4N1AA 1ELOA 4KLNA 1J8MF 1NRJB 3OIYA 2A3RA 2J59A 4AKIA 1CR0A 2FFQA 2X8AA 1E9SA 1EFUA 2VSXA 4UNQA 1N6OA 4MA4A 4WZAE 5E7IA 5FBRB 1IN8A 3CPEA 1XB2A 3SS8A 1UEIA 4B76A 2G83A 4US2R 3U4QB 4PHFA 3ZS8A 1GILA 3D6TB 4I1OA 2A9KA 1K5DA 2FEMA 3WMFA 4OHWA 3F8TA 3RLFA 3OFND 1MR3F 3SJAA 1B23P 2GETA 5CIWA 2DPXA 4A15A 2IYYA 1KHTA 1FP7A 1ZMXA 5D3MA 2J0QA 1GKIA 1AJEA 2GF0A 4H9GA 2DCUA 4EFLA 3D3QA 4CDGA 2AR7A 2BBOA 2D2FA 4UQOA 2A5JA 1IHUA 1N6IA 2GXSA 2HXSA 5G40A 1M74A 3LW8A 4RCZA 4A2WA 1DAHA 1Q22A 3VX4A 2IS1A 4Q19A 1JEEA 1XD9A 3CKLA 2IW3A 4B3FX 4CIDA 2W2TA 4FCWA 4HLDA 1TNDA 4P33A 3QBTA 1JJ7A 2O8BA 1AGPA 1G64A 2QBYA 4YXWD 3ZGXA 1E3MA 3QKRA 3NEYA 1E0KA 3CRMA 3SFZA 1MABB 4F4JA 3B1WA 4Z1MD 1E2FA 1G6OA 4HAWA 4NKRA 2IC5A 4ASUA 1TQ2A 4C0SA 2B7BA 1NNEA 4TL9A 1NKTA 2J87A 4IDOA 4NL4H 5C4MA 4LBZA 2VQSA 1KZGB 1GG2A 4O2RA 1MH1A 4URXR 3EZ6A 3MJHA 2GJAA 2O0KA 4POAA 3F5FA 3L0SA 1SZPA 4D25A 3X1DA 2PBRA 3WXMA 2RGXA 1E6CA 4BASA 2NO7A 1G1MA 2KBFA 2OLKA 3AKDA 4HEJA 2REXB 4AI6A 2CHVA 1YZQA 4PQYA 4GT1A 1OFUX 1LF5A 4NYJQ 5JS7A 4D2IA 3ZZTA 4JVNA 3UWOA 6Q21A 2HYDA 3WMEA 3RWOA 4AK9A 4KCGA 1KAGA 1OB2A 4R98A 3PCRB 3CWZA 4LHVA 1MRNA 1Z6TA 1JECA 3GJ0A 1HYQA 4LV8B 2ZYUX 1KI7A 4JVSB 2R6AA 4KSCA 4PFSA 1A4RA 2YOGA 2F43A 4L4UA 3VKWA 1KO5A 4MRVA 4XVUA 3OIVA 2MSDB 5KO2A 1JB1A 4W7SA 1FFHA 4P4SA 1OT3A 1N0WA 3FMIA 1XTIA 2P67A 2JASA 3EIQA 2V3CC 1XBTA 3E2IA 1W47A 3W5JA 1NN1A 2EYUA 1U0HC 2BMFA 2YYZA 4MQBA 2V9PA 5A4JA 4M21A 2QUZA 2V7QA 4TSFA 5L3QA 1IN5A 1OH5A 4WAUA 3GD7A 4RZUA 2GF9A 1TL7C 1GSIA 4QBGB 2NZJA 2RKOA 4NCHA 5TDHA 1E96A 5IK2D 1DE0A 4LGMA 2YOFA 1AK2A 4LYFA 2OFOA 1NBMA 3QPVA 4OJQA 2V7QD 3KKPA 1H8HA 2JIZD 4EPTA 1YZTA 3QKSB 1ZIPA 1E2HA 1ZNXA 1DARA 1XXHA 2ZI3A 4M1MA 2A5DA 3ZQ6A 3FMOB 5B58C 5KNCA 1R8SA 3D7MA 4RD3A 4AKHA 2O5VA 1FNMA 1VPLA 4M1OA 1QVRA 2IYVA 1F6BA 4Q4AA 3MFYA 2J1LA 5AK0A 1XJCA 4M1YA 4X8HA 3A1SA 2P0EA 3BJIC 2JLWA 2ZI5A 2WV9A 2QNRA 5HKKD 3IO5A 1KO8A 3UANA 3AP3A 1AQUA 3RRMA 4LHWA 1SXJE 1WP9A 2OT3B 2IL1A 4LWZA 4OHZA 4RD6A 5EUMA 4DT1B 4ZO4A 2B7CA 1MRSA 5DI3A 3TH5A 5C2JB 4GBMA 4A2QA 1P2SA 2LCFA 1Q20A 1G3UA 3K53A 4Q9LA 2GESA 4NPHA 1Z0JA 3U7FB 3ZDQA 4TZ6A 4MGIR 3FMPB 3ICEA 1G9XA 4GNKA 2VO1A 3TSWA 2ASEA 3TIFA 4DDTA 2QSZA 3SJBA 2HJGA 4QBIA 2EWVA 4AKEA 2QE7A 1J70A 2W83A 3EPHA 1RIFA 4FCTA 4OQLA 3KDSE 2DWOA 2C2HA 5DLQC 5BWMA 1WRBA 1ZU5A 2X19A 2FFBA 1Z0FA 1VMAA 1S0UA 4Q47A 3U3OA 4I1UA 3EPJA 2QROA 5JEDA 4QHTA 5F9FA 4HB2A 2PX3A 4IFBA 1FX0A 1E32A 3AP2A 3UPUA 4B6FA 2SHKA 3JZAA 1IY1A 2ZTSA 1S9DA 1W4CA 2OAQ1 1XWIA 3LQRA 4FW9A 3LAWA 5P21A 3VAAA 2ZR7A 3GJ6A 1DAIA 3KZ1E 5C18A 4QGAA 2C5LA 4DSNA 3PUYA 3AVOA 2JDID 3WYAA 4Q66C 3MSXA 4M1KA 5HCNA 3W3AA 5GADl 2YC4C 4WIAA 4ZDIA 3K70B 2QP3A 2C99A 1E0AA 2DFLA 4EKDA 1JALA 2JDIA 4MRSA 4BZPA 2O8FB 1GL9B 3GFOA 5CYOA 3WHKA 1OIXA 3HU1A 5B30A 4JYCA 2ODEA 3TR5A 4G5RA 1LNZA 4TQUS 1TUIA 1E4VA 4ZKEA 4JSTA 3B85A 1G8HA 3BFVA 3MD0A 4N0DA 1V5WA 1NN0A 421PA 5HZKA 4BZQA 4OQXA 1GNRA 1ZD1A 1P2TA 2OXRA 1ZW6A 4P4SB 3QPUA 1NI3A 1E2IA 2GZHA 1HH4A 1GL6A 5J4LA 2FA9A 2F9MA 3WYGA 3MWLA 4GOXA 2GZDA 4JBWA 4DDVA 3NEJA 2OBLA 2IUTA 4LHXA 2RAPA 4BLSA 4L9WA 1G6HA 2A30A 1NY6A 1AA3A 2ZXUA 4NH0A 1LY1A 4W9MC 2WIAA 2WAYA 1QG2A 3I5YA 2BBTA 2Q9CA 4HZUB 1EFRD 3TJZA 4Q9KA 3KQLA 3TAUA 2RB4A 5EE3A 5LD2B 2W0MA 2GJSA 3DM9B 5A0FA 4URWR 4OQFA 2YHSA 1LTQA 3KKNA 4Q4HB 3W8RA 1UBFA 4JS0A 1TEXA 2F9LA 2VHCA 3BAFA 2IYXA 1XZPA 3THYB 1XD8A 3U44A 2NGRA 2QU8A 3DZDA 3G5UA 3QF4B 3VMFA 3ZYCA 4YMSA 4Q7KA 4ESHA 1KMQA 3GJ7A 3IIJA 4BE7B 3FGNA 3B82A 4DSTA 3R9XA 3RS4A 1WA5A 1MOZA 2OV2A 2O8EA 3VQTA 1MO6A 4ZPXA 3OHMA 3OAAD 2YZ2A 3TRFA 4XSHA 4AURA 5HPYB 5C46F 4GDFA 1Z07A 3EASA 5FOTA 3KUDA 4R2IA 3M1IA 1XX6A 1W44A 1G291 2HLDA 4XVQA 2IS6A 3NG1A 4M8NE 521PA 2XZOA 1E94E 2KI5A 1RVDA 4URVR 3VR1A 4A8JA 5GVRA 1HQYE 4E09A 4RD1A 1BYIA 4ZCLA 4NMMA 3WNDA 1ZUIA 4G0NA 2JLXA 5CB8A 1XXHE 4BFZA 2CE7A 4GZLA 1A82A 1W4AA 1NSTA 1ZD8A 1DO0A 2IUSA 2Q21A 5EP2A 4QJ5A 5FBVB 1VG0B 2ORVA 1E2PA 1HEIA 1R4AA 3RAPR 2F55A 3HWSA 3IUYA 3I72A 5DIFA 3CRRA 1SXJA 5EE1A 3SR0A 2BDTA 1F5NA 1KI2A 4LUCA 4YQFA 3RABA 4NU0A 2FE4A 2WKPA 1P2VA 4QJ3A 2CVFA 3L0PA 1LS1A 2BIFA 3TUJC 4KLZA 1UF9A 1FQKA 5TXGA 2IS2A 1U0LA 1HUQA 1A1VA 2ZI6A 3VKGA 4S35A 1KDPA 3U2QA 2TMKA 1IXZA 3Q7PA 1KI8A 4E03A 3CNLA 4HDCA 2EFGA 1W49A 2GDJA 1Q1BA 2WVJA 4IDPA 2ECKA 2R6CA 4Q7JB 3B5JA 4KITB 3SE0A 3VNUA 4AD8A 1OHHD 1XCMA 3VU9A 3B7GA 2BEKA 5FUVA 4YONB 1GWNA 1CKEA 2JEOA 1W0JA 5JWHA 3HU3A 4D0GA 1WQ1R 2KSQA 1E2DA 1WBBA 4B75A 4EPRA 2WTUA 1Q21A 4D0LB 4IXNA 5E7MA 1G4AE 3KQHA 2CDNA 3A4MA 4DIEA 3LH5A 5BN4A 721PA 2FFHA 3NVAA 3QG1A 1X8KA 3B2EA 3K0CC 2KE5A 4CF7A 5LB4A 1K8RA 1Z0AA 3FFBA 1KSJA 5J47A 2P6RA 2ZS9A 4R2HA 1DOAA 5HE8A 2HF8A 1XEWY 5JLJA 1DAFA 1DAGA 3BH7A 5EP4A 3W6PA 4C0LA 4C7OB 3MMPA 1R7RA 4BRUA 1TMKA 2E1RA 3NDBB 1ZVQA 2CLCX 4QBHA 4R7ZA 1YZNA 4LC0A 1SVIA 2QMHA 2D06A 2PCJA 4RSGA 1ZRHA 3FB4A 1EWQA 3QBVA 5AUQA 1JJVA 4WZ6A 2GJKA 4I81A 4UJ3A 2QE7D 3LVQE 4Q9JA 2RGNC 3J81k 1DG3A 1VIAA 3DHWC 1XD2A 1EXMA 3SYLA 2IK8A 2LKDA 2QORA 4HLQB 1H65A 4LX0A 5DGXA 4DLWA 4IVRA 5AWFC 2W2VA 2F1RA 4D81A 3S1AB 4JLDA 4QJ4A 1RJ9B 1Z6AA 3FFAA 1T8UA 3QKTA 1S3GA 3QXXA 4FXPA 2B8TA 4DWJA 1U8ZA 3DL0A 4V0KA 1KOFA 2AWOA 1YQTA 4PQFA 2ANCA 4Z8XA 3TE6A 2PJRA 1O87A 3DPUA 1EESA 2QM8A 4LYJA 1ONBA 2R6DA 2XX3A 2ZJZA 3CR8A 4IW3B 4IOJA 4I1VA 1JR3D 2FZ4A 2O8CA 2J5XA 1OYYA 2HUPA 3H84A 2P3SA 5LDDC 4QNMA 2YWFA 2IYLD 4QG7A 4C3ZA 1MV5A 3SN6A 5GJBA 1T8TA 3ZD6A 2XZPA 2ZIAA 3B1ZA 2ODWA 1KO7A 2AN9A 1WCV1 4XH9B 3R20A 4RVCA 1E1RD 1GOTA 3IHWA 4G5GA 5BN5A 4F92B 2OXCA 1BMFD 2QAGB 3AH8A 3EIHA 1YKSA 1XMVA 1E9DA 1XTRA 4HUQB 3FOZA 3WYFA 2VHTA 4TZ0A 1VG9B 2GZAA 1R0WA 2VTKA 4OHVA 2H16A 2BBWA 4LY6A 5FTNA 3LFUA 1BIFA 5L8VA 1NMZA 2VHJA 2EFHB 1CJUC 4JLNA 1AQYA 2QMUA 3ZLJA 4K8OA 2WBLC 4PTLA 2QMOA 1ZM4A 1P9RA 1YHNA 2IBMA 4OI2A 3SEAA 4B34A 5JMTA 2YWEA 5JJLA 1D9XA 3T35A 2R2AA 1NVXQ 3ZQJA 4F7WA 2IHYA 3U4QA 2YOHA 3HP1A 4NCJA 4DLZA 4D4MA 4GPTA 2JLZA 3B9QA 3DDCA 1G8FA 3NIBA 1S9HA 1OXXK 2CEAA 1Q1QA 3F3YA 1W46A 5KNDA 3QG5A 5SZIA 2EFDB 1P61B 1VYTA 4M9ZA 4PC1A 2WSMA 2OUKA 4TL6A 5A5GA 4KFRA 2ZRMA 3ZIAA 4GRAA 2I4IA 2QTFA 4IVQA 1XMSA 1M6NA 4EUNA 3ZIAD 3EARA 3FKQA 1DAEA 4MYTA 4LJ7A 2P6UA 1DEKA 4HZUA 1N5KA 1E2EA 3WRXC 4LC1A 3KKMA 3KB2A 3RS5A 1II9A 4N0EA 1CR2A 2F1IA 1XJQA 2ZAMA 4GSYA 3VHLB 4GL2A 2D7DA 2JAQA 4MYHA 3AVUA 3HYTA 1IJFA 1F2TB 3AVXA 1Z22A 4EAQA 1FUUA 4B35A 2V1UA 3JVUA 2W00A 1I4DD 1ZM3A 1N6RA 4ILEA 1M8PA 5JJIA 2PH1A 3A1VA 2XEXA 1W4RA 5M04A 3OE7A 3GLIA 5LBIA 4BFTA 2DBYA 2JJ1A 1KO4A 1T0HB 2V1XA 2BMJA 3KTAB 2ZJAA 1IBRA 5L3SA 5J4KA 4NE2A 3A37A 1T3HA 2GA8A 4A0GA 3ADCA 2PLRA 1G7SA 4NDZA 3KQNA 1D2MA 2ZRIA 1Z28A 2XITA 2RGAA 4Q9IA 2FG5A 4DXAA 4R9UC 3CNOA 2OG2A 1HE8B 3RNLA 2WM9B 5EE9A 5H1YA 3EZFA 1RPZA 2VBCA 3LLUA 4OK3A 5CK5A 1YZGA 5BYJA 2ZU6A 5HKKA 4ESVA 2QBYB 3NDPA 3CRQA 4XVRA 4US1R 4KSBA 4A36A 5CLLA 2HCJB 2WHXA 2F3RA 2IWHA 1N3BA 4XWKA 5DH9A 3ADBA 1AN0A 4EQ6B 1OXSC 1N0VC 2C96A 5B64A 1IN6A 2IHBA 3MWJA 1QG4A 2IYUA 1VIYA 4PAQA 3T34A 3PUWA 1E9CA 2ZRNA 4V03A 4QGHA 3A1UA 1N6NA 2Z4SA 4KI0A 2BBSA 4ARZB 3PUVA 3B78A 1NN3A 3GJXC 4CEIB 4HI0E 1WMSA 2JJ8A 2W6JD 4ERNA 2AKYA 1P75A 2CJWA 2QP4A 1OH7A 3VKHA 4Q1AA 4KYIB 1E2KA 1EX7A 2PCLA 2WSSD 4IOKA 1XXHB 2FGJA 2QT0A 4FMDB 4IDQA 5JZVA 1NLYA 3TQFA 3NTUA 4DLUA 1OXUA 1KTVA 2C9OA 3EA5A 4CRWB 2QRNA 1R8QA 4HLCA 1CRQA 1JXOA 3TKLA 1NLFA 1G4UR 3IILA 4MKIA 4HAXA 2KWIA 1R10A 4NBSA 4BLRA 3KXLA 3GJ5A 2LKCA 1JI0A 4MYCA 4EJSC 3DOFA 4OHXA 4Q4HA 3RYTC 2J45A 3TW4A 4PSAA 4CEHB 2FWRA 1XNJA 1OPXA 3VTKA 1CULC 2PL3A 4BEJA 4QHYA 1EFRA 4UNSA 4Q4AB 2IXEA 1CXZA 2FSHA 2QA5A 5FFMA 3ND8A 4XJXA 3T06B 821PA 2NMVA 1VECA 3GFPA 2VP2A 2VHQA 1U94A 5TY0A 1JR3E 3CIOA 1NVVQ 3JZMA 1KY2A 5KDLA 4DKXA 5EUQB 3IBGA 1NJGA 4TMKA 2XNDD 2Y8EA 5CM9C 2ZUCA 1D9ZA 4DUGD 4Y0VA 1XCGB 4RKEA 4WXPA 4X8LA 4XD7A 2ZJ5A 2QT1A 1T91A 1Z83A 1HT1E 4TLCA 3ZS9A 2W0SA 4D4LA 2B8WA 1YJ5A 1G5RA 5L3QB 3I1FA 5FR1A 5CIQA 1UDXA 2EW1A 2WSSA 4G01B 4ON9A 1CLUA 1E2MA 4KU4A 5K8IA 2IEZA 1Z6XA 2WJVA 1OE0A 4HDQB 3FMFA 4JL8A 3NWJA 2X77A 3GLGE 1CR1A 3BH6A 2R6GA 3AF2A 3CWQA 3AUYA 1SVMA 4C0BA 1VYUA 1TX4B 3IPYA 4LDJA 4WOPA 4TYWA 2AD5A 1ZAKA 2HEIA 1OB5A 4A6XA 1D2EA 4LZZA 3U7EB 1COWA 2J0UA 5CJ2A 2XTMA 3T1QA 1L4UA 4IDNA 2R62A 2PZEA 5EXSA 1L8QA 1C9KA 1QHSA 5HE9A 1A5TA 3O47A 5FOSA 4Q4JA 1XPRA 2ZUBA 3FYHA 1IQPA 4OBEA 3IBYA 1UEJA 1ZM9A 1M2OB 1L4YA 1UBEA 1ZC4A 3BK7A 3LLMA 3Q7QA 3BGWA 4KV9A 2O8DB 4KBGA 3K9GA 2CL0X 4WA7A 2EQBA 2HT6A 5JWOA 1W36C 3GLIE 1OFIA 4B6EA 4XWAA 1XZQA 5AUNB 2ZRKA 5KSYA 4PPFA 1AS0A 3B9PA 3RSLA 2IYTA 3AQ4A 2ZSEA 3KFVA 2NG1A 3ETLA 1U8AA 3L0OA 4O25A 1MO4A 4DB4A 2JLQA 3EC2A 4IEIA 3QE0A 2D3WA 4KODA 5HTKA 4PC7A 2OBNA 5KPDA 4WXRA 3PVSA 2ZE6A 4HSEA 2JLRA 3F0TA 3AVQA 3L8ZA 4FWIB 4NTZA 4PAOA 2HJVA 3EC1A 3C5HA 2BKEA 1Z3IX 1UBGA 3K0CA 2REOA 4QC2A 3TBKA 4TLEA 2V6IA 1GNPA 2VLIA 1XFAA 1R5NA 2ZE5A 3L82B 4UXHA 3UG7A 2C03A 5UKDA 3W9YA 1W0JD 4A92A 2ANBA 2Z0MA 4JIMA 5JWRA 3R7WB 1W5TA 2VF7A 3EZ2A 1FTNA 4ZI2A 2JA1A 2C04A 4JVMA 1US8A 5L3RA 2H92A 3I61A 2VL7A 3KL4A 4ARZA 4PC6A 2YC2C 4MH0R 5FUYA 4EPWA 1BO6A 2QRZA 4FI3C 4A1FA 3TGPA 2EFCB 5IRCD 2UKDA 4B73A 3TMKA 4XIGS 2QPTA 1OSNA 2QAGC 1KDRA 1JPJA 1F2UA 1NBMD 1WF3A 2ZSBA 3FKSD 3IGFA 4BFWA 1LS6A 2CLSA 4HAZA 4ZDWA 3AF4A 4RD4A 1AGRA 1MT0A 3QXCA 4RKFA 3SI7A 4OQMA 3W6NA 1R6BX 2PX0A 2XJ9A 4D0NA 2WZQA 1GRNA 1Z6GA 2GAOA 4G5QA 2NTYC 5TMPA 1H8ED 4ZDJA 3KB1A 1VCMA 3BFKA 1ZD9A 2ONKA 2RGNA 4C0KA 2VRWA 4LJ4A 1DADA 2FF7A 3MAAC 5CITA 4DUGA 3PFIA 3SC3A 1FW6A 1QHGA 1HTWA 2AXPA 1VHLA 3CB4A 3W34A 2V8OA 2ATXA 1BKDR 1P9NA 1TF7A 3E70C 3Q72A 4H1VA 1T5LA 4IOMA 4O2LA 5FTLA 3MCAA 1RC8A 2ZI9A 2GRJA 1F60A 1HE1C 1KK3A 3U60B 5CYPA 2ZYWX 1ZC3A 1KJWA 2I3BA 1UKEA 3LV8A 3EAQA 3TSZA 4B2IA 4B48A 1P5ZB 1RYHA 2F1HA 3GLGB 3I62A 4JT2A 4ZV4A 1G16A 1G5TA 5E7JA 4QGGA 2ZR0A 2ONJA 2ZJBA 1IONA 1JR3A 2V55B 1SKQA 5JHGB 2ZSFA 1TQ4A 2REBA 1GZSA 2KJQA 4LBVA 4B43A 1OIWA 4TMWA 2H1LA 1AS3A 1ZUNB 4QXAA 5F3WB 1J90A 1U9IA 2JLUA 3REGA 1TAGA 4MYUA 1ESMA 4PPQA 3E1SA 3CH5A 3FKSA 4C7OA 2F7SA 2FZLA 2FJUA 2ZPTX 5B57C 2IYZA 4L9SA 3QXJA 1J8YF 4FMDF 3MG9A 2F6RA 4RZ3A 2A5GA 3WMGA 2JJ2D 1TUEA 4LJ5A 4DEXA 4LBYA 1OJLA 4Q5IA 1MABA 3RVBA 1II0A 4Q03A 1BYUA 3TUIC 1EX6A 3KKQA 1DAMA 3GEHA 4QFMA 4A8JC 1T5IA 3TSOA 5KSZA 1DVRA 4Z51A 2IYWA 2CMKA 4OK6A 1G3QA 2ATVA 3P26A 3OEED 4CEHA 4YC7A 3GLGA 2BCGY 2JGNA 1VCNA 4NYMR 1DBSA 1IY0A 1R0YA 3V4FA 4M2LA 3EX7C 2CK3D 3TW8B 1C4OA 4O3MA 2Z83A 1KI3A 5KU1A 4S2EA 2A2ZA 5JRZA 2IXFA 3GLFE 2Q9AA 1EG7A 4KYUA 3C5CA 3QKUA 2XTZA 1OW3B 1IN7A 5FL7A 4DDUA 3FE2A 4IXMA 1CP2A 1E2QA 2HF9A 2QEQA 4DZZA 3TLXA 2JLYA 1ESNA 1M7BA 2O8CB 5KDDA 2BEJA 2PEZA 4DLRA 3B1XA 2GAAA 5GJCA 4BZXA 4IKEA 5J40A 4UXJA 1RRCA 4CGZA 2YVUA 1X1RA 4MUAA 1KI6A 1S4QA 4DT1A 2WJYA 4IFEA 3ZZ0A 2WWWA 5TB5A 5K8LA 4K46A 2OESA 3FHTA 1RJ9A 4OK5A 4JSYA 2KBEA 4NYJR 3T5DA 4AYXA 2NO9A 1KI6B 4P3YA 4XSGA 1O3YA 3RS2A 1TF2A 3PIRA 3CZQA 2RMKA 2QENA 4JL5A 4BFUA 3SHWA 4FD2A 2QGNA 3P1JA 3LXXA 4QHSA 2JJ1D 1CR4A 4DLXA 1FL9A 3KUCA 2JLSA 4BLQA 4AIIA 1COWD 4Q02A 1OH8A 4C9BA 2FPKA 1ZCBA 1NSFA 2FDCA 4BLTA 5FPSA 2OCYC 1ZM2A 3LBHA 2ZI7A 3KX2A 4F38A 1W36D 1TQDA 3NC1C 1U99A 2QAGA 3PXGA 3DEFA 2IF2A 3LX5A 4EPVA 1G7TA 3CM0A 3T1TA 1D2NA 3G82C 1NVWQ 1DG1G 4WBSA 4CEJA 5FTMA 2NO6A 3B6EA 1PJRA 3ZVRA 1N6PA 3CF0A 3PQCA 2XXAB 3AVTA 3SYKA 2PZGA 2ODNA 3K09A 2I1QA 4QRHA 1G41A 1LB1B 5J4YA 3QNUA 4GP7A 3QEJA 3L2OB 5E95A 2VA8A 3U6KA 1YZUA 1LFDB 2F43B 5SZJA 2Z6VA 3NBZC 2NPIA 1KY3A 1GVNB 5TARA 1P6XA 2GEVA 2WKRA 5SZHB 2QL6A 3VU9B 1KSHA 4V02A 1BMFA 2NZ8A 5DI9A 4BLOA 1WB9A 4LK2A 2IYSA 4KVGA 1A2KC 5KDOA 1J99A 3W5IA 4DJTA 4ZIRB 3KQKA 2PZFA 1E1QD 1KKMA 4A0RA 2D7CA 5IDVA 1GFIA 4PO9A 4FMBB 2OZEA 1YR6A 3IKJA 4LCBA 5AR1A 1Z47A 2ZRBA 3KTAA 5EQTA 2WKQA 3K9NA 3R9IA 1I2MA 3VR5A 4B71A 2ERXA 1I2DA 5EXPA 4EPYA 5BQ5A 5JFGA 3AVWA 1OYWA 1P9WA 2PT7A 1Y3AA 1X3SA 3ADKA 3EIEA 2DFTA 2WIBA 4HUTA 4RZXA 2EU8A 4L8GA 3BFXA 3WBJA 4J0QA 2WWIA 3P20A 1OV4A 2W6ID 5DN6D 2BM0A 2FSGA 4HYYA 1ZNYA 5JECA 3AM1A 3I8XA 2P5SA 4RCYA 3RANA 5FBWB 4A2PA 3FTQA 4CW7A 4TLAA 1UPTA 3U3MA 4DLVA 4HB4A 1FX0B 4PZZA 3DKPA 4JJZA 4Y0AA 3WHLA 3CF6R 4JLMA 3OEHA 4GMDA 4TMZA 2ZSDA 1F2UB 1NIPA 1Q1EA 3UIEA 5GJWC 4YMUA 3R8CA 5K8TA 2V4ZA 4M0LA 1XEWX 3K9LA 4LBWA 2HT1A 3GFTA 5HCIA 3AKYA 3Q5EA 4OI1A 1LVGA 5K8UA 3TVDA 4L16A 2CVHA 3QI2A 1GDDA 2YWGA 1JEDA 3DZ8A 1NMXA 2CJWB 2XAUA 1DAKA 3O8DA
chains in the Genus database with same CATH superfamily
5L4LA 1Y9ZA 4YBZA 2ZU0C 3B38A 4IXTA 5EMKA 4P9NA 3WLOA 4EJSA 2FRDA 3C1UA 3FNGA 3LUFA 1X1TA 1DT3A 2CLKB 2XMCA 3P27A 2X8JB 2Y1OA 1W0KD 3S81A 1ZI9A 3SZLA 4ZYYA 1Z37A 2EKLA 4XDGA 3DCNA 1OFTA 4HRXA 3W9SA 4KPEC 5I5GA 1NG9A 5G1OA 1N5IA 3V33A 4EI8A 2E5LB 1UAAA 1OLXA 3N8HA 2OILA 3KJHA 3LNTA 2F8MA 2Q4DA 5JNTA 3OUZA 3P9KA 3ZZNA 2GKGA 2IEGA 2LVBA 3GMTA 3I4LA 1S2OA 2DR0A 4GF5A 4MRNA 4RPLA 4WXHA 4EW6A 3MA0A 1RTKA 3EVZA 3OTGA 3VHXA 4DMCA 5B6PA 5CG1A 4R81A 5JCPA 4Q0MA 2VPTA 2YWBA 4A1OA 2HIAA 2O48X 1K7XB 4PTZA 3PQ8A 1QHHA 5CR9A 4MS1A 3UK7A 5KSWB 2EL9A 1FMJA 4L5AA 2XRZA 1ZU4A 3OE7D 4U39A 3EFBA 3IAHA 3F49S 4BB5A 1JF8A 4BQPA 2G25A 4JEIA 5AJZA 2C0PA 4BBZA 3WJ2A 1J0AA 1C7ZA 3VX3A 3QF4A 3I3SR 2QN3A 4ZJZA 2R3SA 4IP0A 3U48A 1B0PA 3AR5A 3H99A 4D4JA 1UIRA 5AVZA 3GLUA 4OXYA 4DIBA 1UWKA 2ZS8A 3DT6A 1XFDA 1N4AA 3HO1A 1EM8B 4R8RA 1C8BA 5BOSA 1R8JA 3DVLA 3IEVA 4A9AA 4CM3A 1E6UA 3NTVA 2I4MA 4IDFA 4EM6A 4CYMA 2P4HX 1JH9A 1DBQA 1V95A 2JCSA 3UBMA 5BRAA 5KYYB 1POXA 4PFQA 1V7CA 3JQ8B 3EGDA 5KJ1A 1QUEA 4RXMA 1P4HA 2Z5FA 5A9SB 5DWVA 4HAYA 4B5LA 3MTJA 1PWXA 1WKVA 1CV2A 2RAVA 5J5AA 4R7TA 1T2EA 5EY5B 3G23A 1M8FA 5EE0A 3L01A 3AG6A 3ANLA 2R44A 5DT9A 2PPLA 4UM9D 3A3YA 3AJDA 3SYNA 1Z73A 2FV8A 2V6GA 4YLYA 2ZBPA 4YX9A 3KQYA 1H0RA 2A0XA 4BO8A 2EGUA 1DINA 5BSVA 3KPYA 4JHLA 4UTOA 3SFVA 1N5MA 2VJPA 4GH5A 3HXTA 3G0BA 1W29A 4X90A 4ALNA 3RVRA 2J3JA 3HDHA 2VT6A 4LOAA 4Q3BA 4EGAA 2BYTA 4XPIA 1W25A 1EK0A 1QZUA 5COQA 4HN4B 1CERA 3WDKA 4LNHA 5C81A 2WJHA 2NX2A 5JXWA 2RGDA 2G0TA 1OKKA 2GVDC 1HYGA 2BM1A 2QT9A 3CFYA 3LP8A 3NHBA 1NM5C 4A73A 4ZCIA 2V7EA 4AX8A 1XF9A 3LYLA 3S1LA 1JZSA 3MCWA 1C3LA 3N1UA 4KQEA 2PV7A 1FFXB 4CMBA 5ADWA 1C3OB 2GO7A 2X0EA 3THXA 2P4QA 3O4FA 5IYZA 1RBMA 4Q3DA 3EFHA 5FA5A 2DUUA 3CO0S 3C3JA 3GFVA 1FXUA 4TM7A 3OTOB 3QZUA 2OSBA 3ZE7A 4DY4A 3WRVA 5IJ0B 2WDPA 1JDTA 3EFOB 1PRYA 3LC7O 2PGOA 3R0JA 1IAQA 4RF4A 2PGLA 3KOZA 2Y0BA 4YI5A 2CMFA 2JCVA 4QDOA 1HV8A 4CTNA 3HCOA 5KTTA 1U5AA 4N5DA 3D1VA 5I7RA 1E3LA 5MDHA 1Y8RB 4KQ6A 5EJMA 4RTSA 2FMUA 1UM8A 1DX4A 3IELA 4HXFB 3JWGA 4B80A 4WJLA 1YBAA 2VSFA 2W2KB 4IDHA 2ZSUA 2IIQA 3GJ3A 1L5LA 3QVLA 1YDMA 1IOZA 3CEAA 4FQ5A 3U3KA 1G3IA 4JA2A 3ZNNA 4X41A 2O6HA 1A9PA 2C54A 2VDJA 4MGKR 5CVTA 5AVYA 1QPGA 3RK0A 3V9PA 1BXZA 3GGDA 5I9SA 3CO5A 2YHAA 4IM7A 3U7HB 10MHA 2Z9CA 1AZTA 1PL0A 1SXJC 4M1TA 4PZLA 3UOAB 3W8NA 5GONA 3EHEA 3RI3A 1K0UA 3JZDA 3O4JA 3HCAA 2EJCA 2HCRA 2W6JA 4G5SA 1NXSA 1R50A 4AO7A 4J0KA 4FMCB 2G88A 4TV9A 2PMDA 1X1QA 1E1QA 2GVZC 4IWYA 4OGGA 2G9ZA 2EBUA 3V4RA 1D09A 2ZYRA 2PSDA 2WILA 2HN9A 1WY7A 3QA3E 4FN5A 4XYGA 1N57A 4Z54A 5CXXA 4W7IA 4B32A 4Q1DA 2CL6X 1GM5A 2C7VA 3EIUA 4MGHA 5I51A 2QG6A 4FDAA 1X80B 2HPZA 5BSWA 4B4VA 1S2MA 3EPPA 1IWBB 5T3YA 2X0KA 1RYYA 2QPOA 3EWSA 3BWXA 3UZUA 1UC9A 5FNVB 2D1RA 5JNVA 2FUEA 4D4IA 4Z9AA 1NONA 1WE2A 1Q84A 3AR8A 3QQ5A 4OSEA 4JYPA 3OMLA 4B74A 1SA0A 2GFHA 1WLYA 1JJAA 2DH6A 2ZJOA 3CVOA 4HEQA 4ZEOA 5DE3A 3UUGA 1LDYA 2BI4A 4Q1BA 1JEJA 2C94A 1M2KA 4P7BA 4Z1MA 3M3DA 2M9MA 2UUPA 3A4YA 4NZ9A 2RHHA 3HKDA 2C31A 1W36B 5AVWA 2RC6A 3ZH2A 4EEXA 5JADA 1Z2OX 4JXKA 5F98A 4XE5A 1SQFA 4BGIA 3IB3A 3GGOA 1HR0B 4BYMA 1SKYB 4NZYA 5AVQA 1E3SA 3V2HA 3CLSC 4AFNA 3JQ9C 4GI7A 2PY6A 3SX4A 3P2IA 1UJ5A 5F2KA 3WQQA 4DKJA 3IP9A 1AKVA 1I5OA 1G2OA 2ODTX 1BOFA 1Q0UA 3EQ7A 4OHFA 2O5EA 3SBDA 4LFAB 4V24A 4AF7A 1Z4JA 3I37X 3OZGA 4A0SA 1JTEA 1B6SA 3OOWA 4GFDA 4D99A 4ALKA 4DEVA 1G6KA 2RI6A 3PGMA 4XQCA 3PKJA 1VBFA 1N7JA 2YCLA 2G1JA 4M1QA 1WVGA 4CT5A 4I9UA 4ZI5A 1RRPA 1V3TA 1QHIA 1W5SA 4UMVA 3DHYA 1YFKA 4BFVA 4A0QA 4YV0A 3D8SA 1RRFA 3CISA 3G9UA 3QE2A 1GV1A 2OPHA 3TVTA 4CETA 2BTEA 2ADOA 4MVXA 1W1WA 3ZY5A 4BFLA 5HM8A 3WXBA 1N5JA 4URFA 2NU8B 2GXQA 5IBQA 1AF4A 1C29B 4BFCA 4CM9D 4R71A 4JKIA 1R37A 3U09A 5L3ZA 1VXRA 5F2OA 1U6KA 4MYSA 2WG0A 1M2FA 5TJHA 2UVPA 2HMVA 2XYPA 2FPGA 3BOSA 3DD1A 2HEGA 4UVIA 3TG8A 2CXXA 3HBNA 2Q8PA 1YVPA 1E0JA 4NJMA 1XRNA 5D3QA 5BYAA 2ISSD 2WM8A 4PGMA 4UAVA 5I01A 4QQNA 4H08A 2FZWA 5HFNA 2CXSA 2FB9A 2JLAA 3WDMA 4NICA 3N8IA 4IVNA 3CLTC 3E3MA 3KWFA 3CMMA 4CMIB 3WLTA 3M3HA 4BVLA 1QRTA 1SD1A 2I03A 2ZCUA 5EIXA 2Q0QA 3R3VA 4EVIA 1G8GA 5FWAA 4CM6A 5L40A 2DBQA 2DHRA 4IJMA 1BC5A 3FF4A 1WMBA 3IQWA 4M9SA 2J7PD 4E4RA 4GP6A 4IH9A 5G41A 3HB4X 4PLGA 2PPVA 4X6YA 3UV7A 2H2WA 4YT5A 2H9YA 4BN5A 4EG4A 3VPSA 3ECSA 3SU8A 4FJ0A 1LDEA 2R1TA 5LQUA 4R2WA 2VDMB 2V54A 1QK4A 2Y4NA 3A8TA 3KD2A 3F2VA 3OFSA 3RRXA 3EHDA 3ZKWB 3ADDA 3LPAA 3RS3A 2H0AA 4XD2A 4DR2B 5DHPA 4L6CA 4KBFA 2WMNB 4BBPA 2GYYA 3EPKA 4LA4A 3EGCA 3P4XA 1LW6E 2OHFA 2JFZA 2WTAA 3E0XA 3K0FA 4WZBE 5FPHA 1MF7A 3WK8A 5JNUA 3BMOA 3L7CA 1UH5A 1U1GA 1XZCA 3AR7A 4RBNA 1HYHA 2AWNA 4RZ2A 2BHSA 5HQJA 1KMIY 2Z8ZA 3H1GA 3KHTA 1TIPA 4OA8A 4KEAA 4D43A 4D8UA 1Z2AA 2JJQA 4UDOA 5JI2E 4TYPA 4BMZA 5KSOA 4FLFA 3X1ZA 1YZVA 5H70A 2IW1A 4AG5A 1AMOA 1US8B 2GYUA 2QTLA 3P4YA 3F6SA 3R3WA 3RYIB 4BNUA 1ATIA 1GXSA 2CLLB 4Y30A 2BCJQ 5BYKA 2C2MA 621PA 5L45A 4DSOA 4D3XA 1LCIA 2K2QB 1J39A 4Q4DA 1E9FA 1L5SA 4TKUB 4ZMRA 1TUGA 4PR0A 1RHMA 3NNSA 3QEMA 2FDXA 3JQ9A 5EIBD 2ZYIA 3WGLA 4UQPA 3KVYA 3AB8A 1VHDA 2C7BA 4BE9A 1YC5A 4QSMA 4WUTA 3B20A 1GGMA 4D98A 1DTEA 2JIRA 2NXJA 5DW0A 4E07A 3V7NA 1JRLA 1SKYE 2DPGA 4MW2A 1T0PA 2IUEA 1Z4QA 3OIWA 3LQ2A 4EQ6B 1L1QA 2HLHA 2P9CA 3IH5A 4RV5A 2NVUB 3R4VA 3TLCA 6LDHA 2H7VA 1TRHA 2GBLC 4JVOA 4MR7A 2EERA 4PR3A 1JKXA 5HZMA 4F56A 1L5KA 1UKVY 4PZ9A 3UM9A 1QBGA 1U2GC 3FDXA 2OHOA 3EAFA 4N8EA 1UDBA 2P2LA 4LV5B 5A6SA 2WFLB 1GZUA 3QGMA 3WP1B 2VHWA 4YMWA 4F5WA 3LKZA 2IUUA 3V00A 4BV8A 5LQJA 2ZB7A 1MGOA 1QO0D 4E3WA 1Q91A 2I67A 3IQGX 5AKYA 1IC6A 3MGCA 1DWPA 3B1VA 4D7AA 5CNIA 4MHOA 5HDBB 5KTSA 3ESAA 3QY0A 4BFXA 3O75A 1PFUA 2X5JO 2ZBRA 5LJLA 4UNRA 1M6HA 3WZLA 2AVDA 1YT5A 4IIDA 4CDNA 3OESA 1HSOA 2BMDA 1LQTA 5K6AA 2R97A 3DMFA 4NIMA 3GU3A 4MCHA 3RE1A 4B3DA 1AQNA 2V7WA 2RI0A 1GTG1 1MPTA 2FFJA 4TTAA 5AW6A 1Z9BA 1CSEE 2W4MA 4O4LA 3AIMA 3QVVA 2AJDA 3HJRA 3G68A 2PWYA 3TNFA 1NKSA 4B85A 3REQA 2WJAA 1CRLA 2V74B 1A1SA 2GYWA 3EZYA 3O84A 1L2TA 3EODA 3OC6A 2OGTA 3RM3A 1CUEA 4I6GA 1J2EA 4G37A 2GNAA 4DLYA 1P1BA 2GILA 4NBRA 1MNQA 4ITVA 3RTAA 4JSRA 4LQCA 2BM9A 2ZQZA 1KDVA 1SVKA 1DKLA 4I8IA 5B1DA 2A78A 3EEQA 2MWMA 3UJ3X 3NBXX 4JUCA 4EIWA 1IY9A 2WU0A 3B8HA 4C7MA 1T15A 5I4CA 1UBLS 3HYCA 2JJ2A 3RVSA 4GI2A 1ODCA 3E8MA 5DBFA 5CJPA 3JQAD 1A9QA 4OQYA 3I73A 2Q3FA 3QKRB 4DGSA 4K1LA 1NT4A 1LDGA 1OXKB 4CR8A 2PX4A 5JZSA 1QYXA 1HEUA 3F3SA 3F8SA 3CPJB 4HB0A 4CV1A 4C2AA 3P0RA 3M33A 1GAJA 5LQSA 1MENA 4G4SP 1Z6QA 5AJXA 2A92A 1EDZA 1F8XA 2COUA 2W6QA 4F1WA 1G20E 1IU9A 1M1YB 3BB3A 3FF1A 2GGSA 3A3OA 1ID8A 4QUHA 2VHUA 4KE7A 4CM8B 1FPMA 2FG7C 4TYNA 1HNZB 1VI5A 4CT0A 4YY3B 1PIWA 4IJUA 2WB2A 2PMKA 4IHAA 1P29A 4KXUA 5EZ6B 3W4KA 3EG5A 2DHCA 3P2MA 4PGAA 3WGVA 4FGLA 1FUEA 3QHAA 4CIXA 3G5TA 2GCEA 3OPYA 1NNSA 4WBXC 5FL7D 5KU7A 5DEOA 1EVIA 2W2LA 4DVGA 4UNPA 1WSDA 4BVKA 1L1FA 4FC7A 4RIEA 1U31A 4U0JA 3WIDA 4OLBA 4K9PA 2B83A 4F4UA 3PZRA 3IERA 2EFEB 2CNWD 1OFHA 2C8VA 2R9VA 4PCVA 1SVOA 1DRUA 2WOJA 3AUJB 3T1OA 1MA0A 4UJ5A 3OE5A 3ZI0A 4EMTA 1Z0SA 4RTRA 1OBCA 3BA1A 3O82A 3ANYB 3HZHA 4JQSA 4LE0A 2NXEA 3SDZA 4AP6A 3K8YA 4URZR 3O21A 1TYZA 4W9NA 1NWCA 3B1KA 1YZKA 4M7OA 1E3JA 3CN7A 4RJJA 5LUAA 1VA4A 1VHWA 2R6HA 1L4EA 3HI4A 2W6PA 4PCAA 4WDQA 2JGFA 2PUHA 5JD5A 4FLMA 3OQMA 1MEEA 1LX6A 2DJ5A 4TL7A 2Z58A 4DCSA 1W73A 5LNK1 4FBMA 4QUGA 1WPQA 3FVRA 1C9DB 1F0PA 4AECA 3CLRD 4Q4CA 3ONWA 4N65A 3FCEA 1WL8A 5B37A 4QYXA 4MVJF 2NTJA 1LJ8A 5JY6A 4R83A 3RT9A 2C7QA 2I33A 3LPDA 1D0IA 3BL5A 4YRAA 1QDEA 2EZ8A 4JLPA 3FUWA 3Q9LA 4Q1CA 2AQHA 1PJTA 1L5NA 3O8NA 1G7RA 4PG6A 3GNLA 3ZI7A 1IUNA 4G1VA 2JIOA 1TYDE 1NMEA 1U3FA 2EEPA 3GF4A 1UK9A 3K1TA 1OWNA 1AU9A 1Y63A 2JD0A 4QOIA 4DUPA 4EH1A 3HXQA 2FSSA 2LIVA 2ZYSA 3DXXA 4UCXA 4EGQA 1TU4A 7MHTA 1PCXA 2YXEA 5LBUA 3BWYA 3HGMA 4H60A 1CJMA 1I5RA 1WD5A 2GBLA 2BGTA 3AEUB 3C3XA 3VSDA 1GITA 3NORA 4PXAA 1IM2A 1DAPA 1BEUB 2Q07A 3HP4A 2X4DA 4R1LA 1Y4AE 1W48A 3KJIA 4R9RA 1VP9A 4H7PA 3HYRA 3EGXB 2KYRA 2YN0A 1J2JA 1XQ6A 3K9BA 4F5YA 1XPOA 3LUCA 3ZXXA 2IOFK 4GZ6A 4U0KA 1OVMA 2OCXA 2NU8A 5EEHA 4AL4A 3U7GA 4MQEB 5L3SB 1RZUA 2I6TA 3CZ4A 1E59A 5IXJA 4U7DA 3EBLA 3UHAA 2P1DA 1K5HA 1THTA 2V5VA 4LNAA 4DSAA 1QTIA 2WU3A 3H2JA 1DG9A 5DTMA 2JEYA 1UAGA 1GAQA 1TXGA 2Z5LA 1V5FA 5AYVA 1GJRA 3GG2A 3IAXA 3PUIA 4R3WA 5A71A 4LGYA 3VGJA 4AJOA 5JRDS 2H7CA 4AJ1A 2AHOA 2PUEA 1TCBA 2C8KA 3F67A 1E6MA 1N2CA 1KGSA 4PHTA 2C7PA 4BFYA 3CURA 2WP8J 1PGPA 4GYWA 4X1IA 1PWZA 2H48A 3N28A 3OY7A 4RY2A 1ZMRA 5HA5A 4PC3A 3RF6A 1L7VC 2AMFA 3HR7A 4Y1RB 2VH5R 2PL9A 2GMWA 2LD4A 3OPVA 4YROA 3HKBA 4DDHA 2PJZA 5U9CA 1L5FA 1JR6A 4I99A 4GQAA 1MO5A 3ZCVA 2WQ7A 3EF1A 5LR6A 3MBOA 5AKEA 2Y1FA 3GLKA 5H3HA 4FINA 1PJQA 4LSZA 1P7ZA 1N6LA 4TRRA 4W5JA 4Q9HA 2ORWA 3W5SA 3L49A 2CK3A 2QM7A 3TFQA 4QXRA 4K7JA 3PTAA 1GZDA 3K0AA 3UXMA 1UBRS 5FI5A 5K3SA 3LF1A 2M6RA 3RDPA 3WRYA 4MVJE 5AFSA 4GVXA 4MUJA 1UAYA 4RJLA 2X0FA 4DCNA 1QIEA 5BXQC 3QOXA 1EH5A 3COYA 1JJFA 4MQFA 3CHYA 3DXFA 4UHEA 2IV2X 4JY7A 4YRNA 4MROA 3PUHA 4ZKDA 2WJ3A 1Z29A 2P8JA 3DQQA 3PJRA 4NG5A 1OHHA 1B8UA 1M1UA 5B1IA 3V6LA 5KWVA 3WB2A 3B3JA 1D1SA 2CD9A 3HSYA 4JHXA 4NOMA 1NU6A 4QOHA 1L8OA 1Q2UA 4LSMA 3ZZMA 2RKBA 4OHYA 3BXZA 3OCYA 4MV5A 4ZV9A 5AKXA 2QHXA 4TX1A 4D6XA 1FU8A 1J00A 1YQGA 3AUTA 4IIYA 3UVEA 2E18A 1QRAA 1A9TA 1TIKA 5J2TA 4CEIA 4M8KA 2NLOA 2X76A 3I6IA 1XHFA 1P2FA 1LUAA 2CEKA 3H1TA 1YR8A 2PL5A 2DTEA 4QT0A 4TMVA 3NH9A 1DQYA 2BGKA 3AR9A 3NIWA 3P0EA 1QNLA 4DCCA 2JLVA 1U2RA 4JXZA 4KO4S 1DQSA 5ADHA 5AI8A 1VKOA 1KKLA 3BM5A 1ZBDA 1S7GA 2CJYA 3I92A 4MW6A 4FFNA 5BV7A 5IDYA 4B45A 3H4TA 3NYQA 5L3VA 2P6NA 4ZZ1A 1FC0A 4PHHA 4IH4A 2O7QA 1ZCZA 2XNSA 1IJEA 4J3JA 3L04A 5ALMA 3OT1A 4ETNA 1C9JA 3LCMA 3AVYA 1HETA 2JGJA 5IMSA 4N39A 2UZAA 3ZKAA 3MOGA 1XQ9A 1ZGBA 1H8HD 2NUAA 3IXMA 2O0HA 1UBTS 2JGRA 3LQFA 4P08A 4TM8A 3LFTA 4UDYX 4XW2A 2XKKA 3BMCA 1CS0A 2XJ4A 5EKSA 5LB2A 1TM1E 3AY0A 3BWDD 1FDOA 4MLDA 5TR9A 4Y2RA 4OTZA 2PZLA 1GKUB 2CLMB 2X7JA 1FFXA 1GYQA 2QTVB 3P0HA 4MGYR 1H8EA 1TZJA 2Q50A 4PO1A 3QEKA 4RVSA 1IOVA 5CTJA 4Q01A 1FTGA 4F4HA 4MDFA 3CJQA 2H4XA 3I01M 1GHTA 4NI5A 2OP1A 4MV4A 4NY1A 5GV7A 1JIUA 1CWUA 3H4MA 3KOWA 2CCKA 3TZLA 2GPNA 1P4RA 1XAJA 1SHKA 3GLSA 1Z3CA 1SBZA 1XG5A 1J8QA 3A1EA 2OM2A 3PFWO 5AKIA 3DF9A 1U5CA 2CJPA 3G88A 2YCBA 4DGQA 2HIGA 3ROQA 2TRSB 5G53C 1R4MA 2HA7A 3LIIA 1PFYA 3F96A 1ZNZA 3D2BA 4L02A 4JB3A 2VZLA 5E4JA 1ORTA 3L6RA 2B9EA 4QIHA 3SK0A 4BRWA 2NAFA 4MWDA 1PR5A 4MVJH 5ALEA 4PLZA 2GOYA 2MOKA 2YMQA 3EXHC 1HDGO 3GUCA 1BS2A 4R01A 4RZHA 4HDOB 4XUGB 3FM9A 1NLZA 2A35A 1EZ1A 2JCBA 3FPAA 4M53A 3SHFA 1HK7A 3LJKA 3PLRA 3FOAA 3JYQA 3N05A 4LI0A 5HZHA 4IWNA 4KXQA 4FIDA 1XTTA 4MKRA 4Y1FA 3PC3A 2CL7X 1EK2A 1Y5MA 2PMEA 4DDMA 3B6JA 1SG6A 3HV2A 3T15A 2ID8A 5BN4B 5DGCA 1JLKA 1F0YA 3IAS6 4RFLA 3OA2A 4N5IX 1RXUA 4ZQGA 5ED0A 3D5TA 3W3ZB 5E3HA 3GN1A 1IYZA 2PZMA 4A8PA 2L19A 2YDYA 3CW2A 2D13A 1I4TD 4YGYA 2IWRA 3ETDA 1JI3A 4EVSA 4RS3A 5IKXA 2H06A 1G17A 4J2OA 1PYGA 3WLKX 1CEYA 1VDMA 1ZUHA 3Q7EA 3MFQA 1ZOOA 1GCAA 2Q2OA 2PT5A 4BWFB 2E4WA 4C0QC 1UDWA 4WZAA 5C7LO 3KZOA 1ONOA 3PHLA 3HUFA 3AEZA 3B1YA 2VZEA 4GXNA 4HBZA 4OPMA 4YXWA 3RRZA 3ABIA 1IJBA 1KA9H 2Q2NA 2Q3HA 2WLSA 3U61B 2WMDA 1F3OA 2FG6C 4UUMA 1Z4KA 1Z5PA 2X9VA 4HZIA 4IQ8A 2QP9X 3RRBA 4BQRA 1ISJA 5DN9A 2JKVA 4X20B 5DIZA 4INZA 4Y2HA 4MQ6A 3IV7A 1L5GB 4LOJA 1RXSA 4PFJA 5ESDA 2MSCB 5JDIA 5LFAA 4ZYWA 5C7IO 3CWCA 4NK5A 1ILWA 4D3SA 1Q77A 2DJIA 5E3IA 3TFWA 5LQCA 4OA5A 4O2BF 4EL0A 3LW7A 4M1ZA 5K0BA 1GKLA 3SICE 3AY6A 1EGAA 3RQSA 3FNHA 4IG4A 2CW5A 2NUTA 2AFHA 1UK8A 4M7WA 4NARA 1YJQA 4BATA 1CDOA 5T7BA 8AT1A 1Z2EA 1C50A 2C98A 3DMNA 2VHYA 1Q7GA 4M86A 4CV0A 1JXQA 2IX9A 1JGTA 3N76A 3ZN2A 4YEDA 1SXPA 3A0UA 4UHDA 3DZBA 5FJIA 3D8BA 1LZLA 3ON5A 2YVKA 2OCPA 3KEGA 3N70A 1J25A 4E11A 3K2IA 5ABPA 1ECPA 3CF4G 3CX7A 3IYLW 4TT3D 1E2UA 3GLVA 3NB0A 1D6JA 5JQGB 5HFAA 1IUPA 3WQSB 1YU6A 1DJMA 2IX3A 4EECA 3OT1B 3DTVA 1HE4A 4KLCA 3V7YA 4BO6A 2IBTA 3WKCA 3IX7A 5EWMB 2ZIXA 4B2YA 2YY6A 1JHRA 3DMGA 3T1VA 3FNIA 3EMVA 4Q7MB 4V0NA 4IFTA 4CMHA 2W5UA 1TRKA 1X0VA 1P1FA 2GHIA 2GCPA 2OAP1 3GJSA 5E9WA 3T3GA 1CZOA 2VP9A 1UZNA 3NU1A 3TLJA 3MQ2A 1QP4A 3OTHA 1GL3A 2IDJA 1I10A 3ZR4B 3CVWA 1CR6A 1W88B 2JFWA 2GDZA 4FDLA 4MPDA 4QUIA 4YJ2B 3G13A 2DFDA 3ZVMA 2YJ5A 1WUHS 2BH2A 3I34X 4UAUA 5ETJA 3HLYA 5HKOA 2AK2A 5HF6A 1SH7A 3OE1A 4DCUA 4I14A 2PH5A 3FWKA 3Q3IA 2W71A 3VGPA 3QUSA 4B4WA 1ML3A 4D45A 1DWOA 2QR2A 2I4RA 2WWFA 3KP1A 1QB8A 1ULHA 3RHFA 3SGLA 5LOVF 2AJTA 1EUCA 2W6IA 4IH1A 3N75A 3ONFA 5CVEA 3RKRA 3GGSA 2XTNA 3PVCA 4Z9YA 5KI6A 4BP1A 2QUKA 4M1SA 4OQQA 3BQNB 1FA9A 1M1ZA 4II3A 1YS7A 3F78A 4YQEA 3DPIA 4TXNA 4WJZA 3TK1A 5FEUA 3IPLA 1I4OA 2AOWA 2H8GA 2ZYTX 1OY1A 1EFVB 2OCKA 1JR2A 4L9RA 2B92A 5EJAA 3KXKA 1T1IA 3NHKA 4NBWA 3CUYA 1ZCFA 4M38A 4CU5A 4YV7A 1ORIA 4QGFA 2YICA 2IY7A 5HFJA 3U5TA 3NKLA 3OFNA 5LQMA 4FFSA 4OHKA 5B1YA 4CF3A 3C16C 5CGZA 2J0EA 4ROSA 1HTTA 1H93A 3SPXA 3ZVLA 4AMVA 3PZBA 3ZUPA 2H85A 2B61A 5CFOA 1FLVA 1N6KA 2XOKA 4KWHA 3I5UA 1NFFA 4KO8A 1JIIA 1I9CA 4XSVA 2VQ3A 3DO6A 4PIPA 4C6SA 4WBNF 2BFBB 4AJEA 4Q37A 1GPH1 5K03A 2V5AA 3GEDA 4UBJA 1EUQA 4KC0A 3NI2A 1V8DA 3NC0C 3R5TA 5LYYA 1G19A 4UULA 1FZTA 3K0KA 2M32A 2VK2A 3NETA 4BNDA 3W4JA 3HWX1 5KYKA 1KF0A 2E4AA 3K35A 3LY5A 1LK7A 4GYYA 3DBOB 2J0UB 4MKGA 3ZU4A 5C5CA 1R0SA 4E46A 5EIAA 3A4LA 4N3CA 1RCUA 1ZICA 2OTCA 3OECA 2QRLA 2JVJA 3MUEA 4B6OA 2YFYA 5JARA 1PSDA 5KQGA 2WFMA 5B3JA 2FU5C 1ZINA 2QZZA 4UUOA 2VK8A 2G3YA 3I8OA 4O33A 3D7RA 1U9IC 3V5NA 4C0JA 1Y6QA 1JKMA 5TPWA 3FTNA 3TLEA 4Y67A 1NULA 3GCGA 4P0TA 3CZAA 1EVQA 3HR4A 4ENRA 2XNJA 4R8KA 1PJ4A 4EZIA 1M2WA 4B3BA 2BGNA 1DIRA 1R9JA 2E3JA 3JAKB 3SLRA 2XB2A 1TM7E 5U1PA 1XRJA 3LLVA 1Z5WA 3LMKA 4X71A 2CV2A 3AL3A 3AEQB 1OYVA 2P9YA 4P6VF 1ELOA 1I1QB 2BGJA 1NRJB 2NUPB 2PYDA 2X8AA 1MEJA 1V25A 3DDNA 4J1NA 3GVHA 4UNQA 1N6OA 2VYCA 1HLGA 1X9HA 4FNGA 1UEIA 1FU7A 2QPLA 1RHJA 3O7MA 3QMPA 2DM6A 4L95C 2Z5VA 1TT7A 2EKBA 3D2CA 3FTPA 1N2IA 2HU8A 3C3MA 2A9KA 1J1UA 4E5YA 4ZP1A 1QRSA 2XPCA 3EJ6A 1JEAA 5LYJA 4OHWA 4JI3B 3WMFA 5DNVA 2FKAA 3RLFA 3SJAA 3V4VB 5CIWA 1YS1X 2FPIA 1FP7A 4O4HA 1AKQA 1P17A 1AJEA 2PLNA 5GOZA 2OORA 2DCUA 4EFLA 4CKWB 5K01A 3D3QA 1BCRB 1ZK3A 2QLTA 4CDGA 4N6NA 4U2GA 1N8KA 3ZC3A 5CX1A 3ZI4A 3EDYA 3WLPA 1GTRA 5SY4A 2JAWA 4HEHA 4YP1A 3X0DA 4DBVO 3ORQA 4H3SA 1XN4A 1ECLA 2FW9A 5AVVA 3ZTWA 1DQPA 3OKAA 2LP4Y 2I7VA 4A2WA 4C6TB 2PRIA 1H2HA 4HS4A 2P2NA 3GP3A 5BVHB 2OXEA 2UYYA 4LNUA 2IS1A 4ZZ2A 3WAKA 4LS3A 5GIOE 4Q19A 2VJCA 2IW3A 4ME6A 4EA8A 1YR2A 2RHLA 4KGXA 3K1AB 1J56A 3HNOA 2O8BA 4NZZA 2XGMA 4C1NA 1GCOA 4REOA 1E0KA 3CRMA 2QN7A 5FUBA 3R7NA 2XADA 1F1JA 1MABB 4F4JA 3B1WA 5AXCA 3HE3A 4E5MA 4Z1MD 4PYNA 1E2FA 4ESEA 4FXOA 3UWSA 1WDWB 2LBPA 3AILA 4A3SA 3JQQA 1FSGA 1S8NA 4HJRA 4TL9A 3GWGA 5JTUA 3G8BA 4TXMA 5SYNA 1VE6A 4FM9A 3NWOA 1XDZA 4B3HA 3R23A 2ZYHA 4B8ZA 3FYDA 1TJ3A 3RREA 1LLDA 1GTL1 2WTMA 3FRHA 3HEBA 2PKEA 2Y9PB 4KO1S 3RPEA 3SVZA 2G67A 2HQBA 3IKMB 2WYVA 3FFWA 1U7PA 4K87A 1KVTA 1K9VF 2CC2A 4CM7A 5KNBD 5H80A 1G1MA 3FDFA 4YIKA 1TZMA 4HEJA 4AI6A 3SKYA 2WHPB 3PI7A 4MS3B 4W5NA 2SNIE 1UUFA 3D54D 1L7PA 1TMOA 2VOEA 5JS7A 3L07A 5A0VA 2FPRA 2CF5A 1CIVA 1VFPA 3K5IA 6Q21A 4AK9A 3RG2A 4R98A 1PZEA 3L5OA 1MRNA 7ADHA 1JECA 1USGA 4E2FA 2P6MA 1X94A 3IT3A 1KI7A 1HG1A 2AYXA 4S0XA 4JVSB 4KE8A 2IHVA 4QXOA 4RKYA 5BSTA 3VMMA 2VTBA 2F43A 1CHDA 2OXIA 1KO5A 4MRVA 2GWRA 3T1NA 3VKWA 2YUIA 3EEBA 2MSDB 4F2DA 1JB1A 4W7SA 2H5IA 1OLSB 3H1BA 2NZYA 4P4SA 3QFRA 1OT3A 3GARA 4PYJA 1A5AB 5C8YB 2V3CC 1SCIA 3R5HA 3E2IA 2Y9MB 3D3NA 2HA4A 3DB1A 3GXOA 3OIDA 4HAIA 2NO5A 2YYZA 1V8FA 4MQBA 4A2CA 2Q8QA 5A4JA 2Q1UA 1P2BA 1QO0A 4KGZA 4TSFA 3I6MA 3JAWA 3ZGVA 5L3QA 4QPNA 1AMNA 3MRXA 3OPNA 2GF9A 1B6TA 4QBGB 2NZJA 4RAOA 4NCHA 4W6ZA 5IK2D 1V7QA 4JJFA 4F8EA 1FTQA 2LXNA 1BE1A 2IKQA 3KB6A 1QCDA 4F4DA 3ER6A 2YKQA 4DLBA 4ETWA 3CBGA 3MOIA 4RH1A 2Y93A 2HO5A 3AERB 3V3TA 1OZAA 1GLNA 4D44A 1GTMA 2GM5A 2JIZD 1C0EA 4R84A 4QU0A 1H85A 1UZLA 4H4EA 2FQ1A 2OGWA 1NQWA 2PVPA 1DARA 3KHUA 5K6TA 5CD9A 5LM3A 3F2IA 3NZEA 1R8SA 3D7MA 1SXHA 1IDOA 2FQXA 3VVCA 3DWGA 5AJTA 1QVRA 5JAQA 3S1SA 2QLBA 1PT5A 4CEIB 1KPGA 2ZIFA 3BE5A 5AK0A 4KE9A 4I66A 4CIBA 2Y66A 1P1KA 2WUVA 3A1SA 3FWHA 5HP4A 4A7PA 2FSVA 1A8IA 1U2ZA 1YNOA 3IO5A 1MJGM 4MVCA 1KBQA 3CLSD 5HKKD 2HGSA 2VDLB 3MC1A 3ODPA 2BKAA 2ZUVA 3RRMA 5HYVA 1SXJE 3V8EA 4HNUA 3AKZA 4RD6A 4DT1B 4MUIA 2C84A 3H19A 4YI3A 4BB0A 1GY8A 2NUPA 3A9RA 4GPBA 1O4WA 5SV2A 2PSSA 3GIDA 4IWXA 2GZRA 2C88A 3K53A 5F78A 1EXVA 2GESA 3RU2A 3U7FB 4NNPA 5B6IA 1UMKA 4QLOA 3FMPB 3D8NA 1S2NA 3PD0A 1G9XA 3UJ7A 4GNKA 2VO1A 3PB3A 3TSWA 4AJLA 1OTYA 2M98A 1OLUA 3L9WA 2Q28A 2HJGA 2PZAA 3NVDA 3Q3EA 4HH1A 4QBIA 4E4TA 2CVPA 5A5EA 4G81A 2R00A 1KVSA 1QO9A 1UXJA 3A4IA 5AKLA 4RZSA 2HHHB 2HCTA 4G0WA 2ZJ1A 1QKIA 4NMWA 3AMVA 1RIFA 4MYDA 2FP4B 3G6WA 4MR8A 3FXAA 5L4NA 5BWMA 1MC8A 3OSZA 4RHFA 1WRBA 3BD8A 3V7UA 4D1YA 1MVOA 3K15A 1VMAA 4YNBA 2LCIA 1K5PA 1I0IA 2C2YA 3A6JA 3PUJA 4I1UA 4H0FA 2VZ0A 4PZPA 5AM0A 4HB2A 4IFBA 4XR4A 1FX0A 1E32A 3SP1A 4FHEA 2IZ1A 3WB1A 1U2SA 5H59A 3OO0A 2OAQ1 1CG6A 1SCUA 2AJBA 3LQRA 2HRQA 2JJMA 4GPEA 3GJ6A 2DQYA 3P5BA 4G5FA 3QHQA 4J0DA 3RW9A 3BHIA 4ZVUA 1QE5A 1VJTA 3F6YA 1VHQA 2JDID 1BMTA 3ED1A 3HYLA 3MIZA 2GD1O 3AO0B 5HCNA 3WYAA 2H31A 1JHZA 1VYHA 2NZUG 2WZBA 5DBOA 1EYZA 3UWPA 3K70B 4B48A 1ESDA 4EKDA 1XOIA 4P7JA 2JGEA 3ICVA 5ALWA 4GKJB 1RI2A 5EMLA 2GCGA 2Y76A 4RPCA 2NZ2A 2XA9A 3TPCA 3Q41A 1HFWA 1EUDA 2GBFA 5DNDA 2C2KA 3WHKA 1JA0A 4LJKA 1QGYA 1OIXA 1JLRA 3HYSA 2GI4A 3D6NB 3SC4A 2ODEA 4AX4A 2EKQA 4G5RA 5CRIA 2AN4A 3E9DA 1LNZA 4RVFA 4CMIA 1Y6GA 4ZKEA 1G8HA 3UNXA 3MD0A 3JAKA 1ZI8A 3KL2A 4ZPJA 4OQXA 5HF8A 3UEOA 1JR4A 1ISPA 2Q2QA 5DM4A 4MOWA 2ZJ6A 5AM1A 1NI3A 1HH4A 2VT2A 3BKWA 1RFGE 1PDOA 2FA9A 3M1YA 2F9MA 3OZBA 4QDZA 5LU9A 3PC7A 1OV6A 4R9SA 3MPOA 4NBKA 3WYGA 4CLEA 1KORA 2CJFA 4ZZ0A 4KQ9A 4K9LA 2AUNA 4FBLA 1EUCB 5H81A 3DOJA 4I55B 2RAPA 3LQ1A 1MXFA 4L9WA 3I23A 3TSCA 1O96A 3CCBA 1QSGA 1DWQA 3L6U