1MO5A

Reca-atp-gamma-s-mg complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
317
Chain Sequence
b'MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 81
structure length 317
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo5A01
1W4RA 4BZQA 1DS6A 5EXTA 2B6HA 2BM0A 1HT1E 3KKNA 4A2WA 1ZM4A 1T3SA 1P2VA 1T0JB 4IDOA 1J8YF 4NCIA 3GP8A 4LJ6A 4ZPXA 4U00A 5P21A 2HDNB 2J9RA 2GZAA 1W46A 4PQRA 2HF8A 4AG5A 3UWKA 3I73A 2WV9A 2GJKA 4RD4A 1RRPA 4WAUA 3FKQA 3BH0A 1JPJA 2GF0A 2V6IA 3QEOA 3CUEF 3VTKA 1OIVA 3T1OA 2O0JA 1RC8A 3AVVA 1QHHB 4RCZA 1S3GA 4TMWA 5CLQA 4TMVA 3SBDA 4DLWA 2XJ4A 5EP2A 1D5CA 1KI3A 2ONJA 3SYNA 4YMTA 2PCLA 4O3MA 3IKJA 2NO7A 3NC0C 4NYIR 3SJCA 3K9HA 4DDWA 2ZRHA 2QAGC 4JKIA 4BFYA 4D0LB 2IYWA 1BKDR 4AC9A 5JJIA 3K09A 1ZC3A 4YDHB 3ZVMA 2ZI3A 1JR3E 3CF6R 4LWZA 3B85A 2V1XA 4U7DA 1TF7A 2PEYA 5HE9A 1E9AA 1OYWA 1CP2A 3FFBA 2ZETA 1NVXQ 4GRAA 4EIWA 1XD8A 1FTSA 2CJWA 4YMSA 3VMFA 2ZYTX 1ZYUA 2GK6A 2ZYWX 2ZU6A 2K5UA 1KZ7B 5JCZA 2ZI6A 3S1AB 3QKTA 1XZQA 5FOTA 4M2LA 4WW0A 4B33A 3RVBA 2PJZA 5JSZA 2OXCA 3NKVA 1T0HB 1W44A 2FU5C 3CRRA 1MABB 4TT3D 1PLLA 4A8JB 3QPVA 1AS2A 2G1JA 3TJZA 4NH0A 4TTPA 5CYPA 1GIAA 4QOSA 5JEEA 4Q5IA 1Z6YA 2DFTA 4ZKEA 3HYRA 4I1SA 1P6XA 2I3BA 1VPLA 2QROA 2F1JA 2Q3FA 2IS1A 3K70C 1I4TD 2RGNA 2IYSA 1IHUA 4KLZA 5DSZA 1KDTA 3HP1A 3LX5A 2YWGA 1UBEA 4RVCA 2YC4C 1YE8A 4AK9A 1KIMA 1E9EA 2GBLA 4C0JA 5BN5A 3TUJC 2RAPA 3RNLA 3Q7PA 5H68A 2AK3A 2ZI7A 1NVUQ 1XB2A 4ARZA 4HAXA 4IVRA 4BECA 1G16A 2BDTA 2V54A 5JRJA 2HCJB 3SYLA 3TR5A 5A5GA 2PT5A 4OYHA 4ITRC 2IYRA 4I1VA 1DO0A 3KUCA 4Q9IA 4TYQA 3CR7A 3AUYA 5D3QA 1G3QA 1Z22A 2RHDA 4KBFA 3VQTA 1CJMA 3E2IA 4D80A 2CK3D 1NG1A 2Y8EA 5FUVA 2ZJAA 5L3VA 2ZS9A 1P9NA 3DO6A 1KI8A 3IBYA 1CBUA 1CR1A 1ZMXA 4TMTA 3ZVNA 2Q3MA 2EVWX 2O0KA 4TL9A 1MR3F 1XPRA 2EFCB 4TLBA 1MT0A 3B9QA 2CE2X 1NNEA 1G3UA 4FN5A 1EFCA 4UKDA 1F2UB 4UNSA 5FPTA 1U9IC 1N6IA 2WMOB 1ZM2A 2IBMA 4C2TA 1DELA 2XAUA 3O8DA 3BH6A 3THOA 2CLDX 2ODEA 4Q4LA 2ZRCA 1GNQA 3KJGA 1IN4A 4HZUB 2Q0HA 2EFGA 2V7QA 4LCBA 4PPNA 2E1RA 2JLXA 3HWSA 4WVFA 2ZJBA 1KO8A 3R9XA 1ONBA 2OCPA 2IYLD 4TMZA 2GVZC 2JLUA 2BMJA 1MO4A 2ZRGA 3LDAA 4PQYA 5L8VA 4OKSA 4HZUA 3MFYA 2WICA 4PHFA 1XEXB 1FMLA 2BV3A 4V0KA 1RE0A 3VNUA 2O8FB 5FOXA 1Z2AA 5IT5A 4JKYA 2AHOA 2PH1A 1P60A 3KQNA 2WKPA 4Q1FA 3PVSA 4IDNA 3BERA 4G0NA 5A4JA 4RSGA 3CNLA 3Q85A 2WZQA 3GMTA 2F3RA 1F5NA 2B7BA 1GZSA 2C78A 4B3GA 4NCHA 4PX9A 2GXQA 1T4GA 1FTNA 4DIEA 4AI6A 4EFLA 4CF7A 5FFMA 3MMPA 4XTRA 3HDTA 4BUJA 5LD2B 1U98A 4AG6A 1WMSA 4JT4A 1RZ3A 3WXMA 1GAJA 3C8UA 3CRW1 4LY6A 2ZSEA 2IW3A 3HPQA 1E1RA 4WZAE 1Q1EA 1U0JA 4FCWA 1XCMA 3C5HA 1S4QA 1KSGA 3LY5A 2BWJA 4H9GA 2REXB 3EIQA 1OF1A 5AUPB 2IHYA 1QG2A 3KQHA 4Z8YA 2A5FA 4A0GA 1ZUNB 4S2EA 2GXAA 2V9PA 4LPKA 3G0HA 4A9AA 3SYKA 4R71A 3F0TA 4W5WA 3TUIC 1EWQA 1NMXA 2RGDA 1G3IA 5KSZA 4BLRA 4DB2A 4HB2A 4Q7MB 2ZSBA 4M9XA 1CULC 4JVLA 1JXMA 1ZCBA 3NVAA 4KFUA 2AD1A 1YHNA 4IJMA 2A2ZA 4JLJA 3P32A 1LTQA 1NRJB 2ZAOA 3SFZA 3PIRA 1HE1C 4A0FA 2OUKA 2ZI4A 3KTAA 4KJZA 4EJSC 4QBFA 5G41A 1QHIA 3QKUA 5LB2A 1XF9A 1MRNA 5EZ5A 4TTRA 2QY9A 3U3KA 2VRWA 1GG2A 2D06A 3A58B 1P61B 1EGAA 3WRXC 1ZCAA 2OFOA 3K9GA 1KO4A 4M53A 4D0GA 4EPVA 2WOOA 3A37A 2DCUA 1N3BA 3ADDA 2VF7A 3GJXC 1A2BA 1C4OA 4A6XA 5LBIA 4ZV4A 2GILA 1E1QA 4XSHA 1KNQA 3THXA 1M6NA 1NN5A 1RRFA 4QJ3A 3AF1A 1N5KA 3IQWA 1GWNA 2X77A 2OILA 1DAHA 5TY0A 2X2FA 1KSFX 1XJCA 3KKPA 2DFNA 3EWAA 4PZYA 3U44A 5GVRA 3H1TA 1ZU5A 3NG1A 1NIJA 3V00A 5JECA 4TYNA 2ZE7A 3SOPA 2G0NA 5FL7A 4K46A 2Q9AA 2MMGA 2Q3HA 5IK2A 3ICEA 2REOA 4B73A 1GL6A 2BJVA 3WP1B 4NYJR 3B2EA 3U7FB 1AS0A 4TLEA 3NTUA 3W6NA 2MMCA 1UKVY 1F48A 3MGCA 5DN6A 5A0FA 2VQSA 4DSTA 4LJ5A 1CJTC 2O8BA 5BYKA 1P75A 2IXFA 3HJNA 1GDDA 2QTHA 3TVDA 4B48A 2P6UA 1EXMA 1NSFA 1JAIA 3GLGA 1WE2A 2FMXA 5DHFA 4A1FA 3SN6A 2GVDC 4C0QC 1MV5A 3I5YA 4DSOA 4EKDA 1X86B 3C15C 8OHMA 4OBEA 4P32A 4DSNA 2WAXA 1D2NA 1LW7A 3L43A 4EPTA 4V0OA 4XIGS 2CHVA 1F3OA 2WSSD 4L16A 4ZDJA 4OI0A 3CPEA 2D2FA 3AVQA 1N5LA 1VECA 1PUJA 2WWXA 3KQKA 3A1UA 1OB2A 3BC1A 3QUSA 2X19A 4DZZA 1KO7A 2YWEA 1K5DA 3AQ4A 3ICQB 1NJGA 2FWRA 3OFNA 4JLBA 3TKLA 1T8UA 1N6PA 1ZD8A 4CZ2A 4MRVA 3AF2A 1IN5A 3ZIAA 1EESA 4G5SA 2ZYUX 1XMVA 2VHTA 4Q03A 1OH7A 1OB5A 3BGWA 1GUAA 2JLVA 3T35A 2AD5A 4PO9A 2FEOA 4IKEA 3D7MA 2VTKA 3UK6A 3SQWA 3QOFA 3W6PA 3KXKA 4MKIA 2V7QD 4TLCA 4D82A 1G6OA 4JLAA 2QAGB 1ZD9A 1CXZA 2CL7X 4AIIA 1LB1B 3U60B 4DB4A 4KLNA 2W2XA 3T12A 2Z4RA 3TAUA 1W4BA 1K6MA 2QT0A 3EPJA 4PSVA 2NGRA 3I3SR 4N0DA 4Q1EA 4RFSB 5BQ5A 3BB3A 2LWIA 5KDLA 1OT3A 5UKDA 2XZOA 5KUTA 1WXQA 1R8SA 5DYIA 1DBSA 1JR3A 4DC9A 1E69A 2GHIA 1WDTA 1X3SA 3AP2A 4Q4AB 2IT1A 4WZ6A 3ZD7A 4BFVA 4KITB 5TXGA 3KXIA 1FX0B 4G5GA 2P3SA 2XOKA 4Q1CA 4M9ZA 3F5FA 3MWKA 4MYUA 2FJUA 3GEIA 2HV8A 1U99A 3M1IA 4S35A 5L3SB 1W36D 2R6GA 5EQTA 2QE7D 5JJLA 2ORIA 2PCJA 3EARA 2JIZA 1US8A 3PR1A 3AF4A 2DFLA 3BS4A 3CO5A 1FX0A 5BN4A 2H92A 4LUCA 2HT1A 1RYFA 3KJHA 2ZANA 3WMGA 2V4ZA 4UXHA 3ADBA 3AH8A 4LJ8A 1E1RD 2VHQA 5C1BA 3R7WB 3U61B 1Q1BA 2NO6A 5L3SA 1G4UR 4D4JA 2WWFA 3GLHA 1Z28A 1E2NA 4D4MA 2VSXA 4FD2A 3TUZC 4A8JC 2YKGA 1ELOA 2IF0A 5GJCA 2FOLA 2ZE8A 3QI2A 1KDRA 4ZIRA 4KBGA 2O8EA 2ZRDA 2J7PD 4TN1A 3DOEA 1E4VA 3H84A 1QHXA 5KNCA 3DVLA 2VP5A 3LAWA 3WY9A 5FTMA 4HUTA 2A3RA 3HU2A 1W2HA 4Q4HA 4A92A 4F91B 3CWZA 1ESMA 3LO5A 3TGPA 4NKRA 4TL8A 4MDEA 4ZCIA 1TUEA 4CEIA 3QKSB 3QVUA 1G19A 2WJVA 4M1TA 3NBXX 4KSBA 5G40A 2G9NA 1Q22A 1W4CA 3THYB 1J8MF 3QXSA 4JBYA 4Q01A 4F4IA 1T5IA 1UEIA 4MYHA 2E87A 1DAEA 1SVIA 3A4MA 3BAFA 1TF5A 2R44A 3EPHA 2J0UA 2CVHA 2R6DA 2W6IA 3DPUA 2ZRJA 4QL3A 3THYA 1OXXK 2WKRA 2WKQA 3IQXA 1WF3A 2KJQA 4BFXA 5FPKA 1T3LA 2ZRIA 2VIIA 4Y0AA 1OH5A 3L0IB 1FP6A 1E1QD 1VG8A 4D25A 2NPIA 3NEYA 3GPLA 2JA1A 4HI0E 1OSNA 2H8KA 4LJYA 2BBOA 2CCGA 4B44A 1P2SA 3VR3A 1E2LA 2C95A 5B64A 1U9IA 1ETUA 1NVWQ 4ZCLA 4C30A 2DHRA 1GKUB 5ELXA 3PXGA 3FMIA 1X8LA 3K53A 1EX7A 1X1SA 5F9FA 1YZTA 4G1UC 5H8WA 4US1R 1EFUA 1R8QA 4AKHA 1RJ9B 4U5XA 1WP9A 2ASEA 3MRSA 1TX4B 4DLYA 3KKMA 4B75A 1W7AA 2ZR0A 1QVAA 2V3CC 3BE4A 1QHYA 2ATVA 3QENA 1DAGA 2AL7A 2XTZA 4DVGA 1XD9A 3DMDA 5DN6D 2GEVA 1UBCA 1JEEA 4KFRA 1X8KA 4OHZA 3P26A 1RJ9A 1HT2E 3MJRA 4Z54A 1E32A 1B0UA 2P5TB 2F43A 3LX8A 4RFVA 2J0SA 1L2TA 3CRVA 3QXCA 3WYGA 4LJ9A 2FX3A 4LYAA 5AUQA 1Q1QA 1UPTA 3SHWA 3SQXA 1KMQA 1VHTA 2L0XA 2D62A 2D2EA 5BYJA 3SS8A 3FVQA 1XTKA 1CS4C 2HJGA 5DI3B 3EG5A 2C99A 4LOAA 1XU4A 1Q21A 5EP1A 1Q57A 2RCNA 3SEAA 1VCNA 3AKCA 2GXSA 1TADA 3C7KA 2CL0X 4TT3A 2PLFA 4PFSA 3TE6A 2QTFA 1KGDA 4CIDA 3QG5A 4CYMA 4G5RA 4YLGA 2ERXA 2DWOA 1N6HA 2G3YA 3WMEA 2ZUBA 1GSIA 3RS4A 3EZ6A 4MA4A 4KCGA 1FL9A 4HDQB 1WB9A 2GDJA 2VHJA 4QBGB 2EWVA 1YKSA 2NPFA 5GVSA 2BJWA 3N2IA 5EUQB 2IS4A 4OK3A 2PJRA 3I8XA 2ZAMA 1WA5A 4EJSB 4BFZA 4C3ZA 4QHTA 1Z3IX 5FTKA 2PBRA 3RDPA 2GF9A 3T34A 4RZUA 5J4LA 5AJZA 4IEIA 2ZRNA 2C5LA 2VLIA 4P4UA 4MGZR 4B3FX 4A15A 1KMHB 5EE0A 1DARA 2WHXA 5HPYB 1F2TB 4CT5A 1NLZA 4NZYA 5JEDA 2OHFA 3RLFA 2WWGA 4L9WA 1Z08A 3WNBA 1YZKA 4IW3B 1H8HA 3UMRA 2HYIC 3QIAA 4MITA 4QHYA 1KO5A 2G77B 5FL3A 1OPXA 4DLRA 2IEZA 5BWMA 1GRNA 3FB4A 3Q8XB 5JS7A 2XOKD 4FI3C 1T5LA 2MSDB 1KI7A 1WCV1 5L3QB 2ZJ8A 2DFKB 1O3YA 1ZNWA 1FNNA 2ZREA 1VG9B 1F6BA 5EE9A 5CM8B 3OEEA 4R98A 5E3HA 2YNMA 5CLLA 1LVGA 3BD9A 1D6JA 1KKMA 4P4SA 4BE7B 5SZJA 5IRCD 1M2OB 1W48A 5L3QA 2UZ3A 1E9DA 4DEYA 1JAHA 4Q47A 2FDCA 1G5RA 5JHGB 2OG2A 1IN8A 3W8RA 2QENA 5GADl 2FH5B 5DYGA 3TQFA 1R4AA 1ZNZA 3WRYC 2WWIA 1GRRA 1E0AA 1QZXA 4NONA 1II0A 3K70D 2IK8A 3KDSE 3LVQE 3RS7A 5B30A 3KZ1E 3H86A 1RRGA 3B78A 3X2SA 1BO6A 1AM4D 1T3HA 1E2HA 1GKYA 2NO0A 2ZITA 4QXAA 2BBWA 3EXAA 5FBRB 4XVUA 3UIEA 3UWOA 2G88A 4IFEA 4E5UA 4IOMA 3VU9A 3QF4A 1M34E 2ZUDA 2CHQA 4QM7A 2LKCA 3RAPR 1ZP6A 1E99A 5G3ZA 1TU4A 4P0TA 3U7EB 5B2ZA 3VR6A 4MKHA 1II8A 4QGGA 3TR0A 4OHWA 3DZDA 2EYUA 1NIPA 3SDZA 4XVRA 4CEHB 4MYTA 2OESA 5FOUA 3AVPA 5AR1A 4WZBE 3OIYA 1CJUC 3CWQA 3NH6A 3U5ZB 2GXUA 1PJRA 3BJIC 1UKZA 1AQUA 4B35A 4IEEA 1FFHA 1XTRA 4NYMQ 3RRNA 4ZI2A 4C0KA 1T9HA 1QDEA 2WMNB 4UJ3A 5FPSA 3ONWA 2O8CB 4Q9HA 4TYYA 1T8TA 4A2QA 6Q21A 1VMAA 3THWB 2DBYA 4RJLA 4LPSA 3L0SA 1N6NA 4HAYA 4JBXA 1T6NA 3B1WA 3M0EA 4QBIA 4CEJB 1Z63A 1BMFD 1A82A 1DAIA 4Q18A 2W6JA 4AWXA 1OV4A 5JI2E 1JEDA 4EFMA 1MO3A 3C16C 4LC0A 2FNAA 2NMVA 2PLRA 1W49A 1PVOA 4PC7A 2XTNA 2J59A 3EZFA 1KK2A 1QHHA 2A5YB 3ZQ6A 3AKEA 1Q1ZA 1Q3HA 4V0NA 4WA7A 3ETLA 3TSZA 1F60A 2WWYA 2QSZA 2J0QA 1JJ7A 4LHZA 4Q1AA 2A5GA 2ZJ5A 2ZSDA 2I1QA 1Z6GA 5DIFA 2ODWA 4URVR 4DLSA 3FPAA 5FBVB 1DTSA 2ZEJA 4B3XA 1N6LA 3TMKA 2G1KA 5H70A 1AGPA 1Z8FA 1G21E 3AF3A 2C9CA 5AUOB 1S2MA 3B13B 2IL1A 4CVNA 1CR2A 2ZS8A 1M8PA 2FGJA 3R8CA 2JLYA 3VKHA 1VCOA 4NHOA 4Q1DA 3S1AA 1ZUIA 2QA5A 1C9KA 2EWWA 1SZPA 3NBFA 3D8BA 2ZJZA 4BLQA 2KBFA 3E5HA 4QGHA 3GLHE 1MABA 3CF0A 3LW7A 1CR0A 1X6VA 4QFMA 4RD6A 2J7KA 5ANRB 4A8JA 4C0AC 3QXXA 1JQJC 1NMYA 1P2UA 3B6EA 4JYCA 1ESNA 1N0WA 3DOFA 2FSHA 4N3NA 2XB2A 5EE1A 2E9SA 4B2PA 4II7A 2MSEB 1VHLA 3QEJA 3I62A 1Q20A 1PLJA 3Q3JB 5LPNA 3GD7A 4MH0R 3UKDA 5JHHB 2H18A 2ZXUA 2J1LA 1R0XA 2W58A 3AGPA 3CX7A 1KI6B 1S1CA 3A8TA 1GL9B 2H1LA 1R5BA 4Z8XA 1NBMA 2P2LA 2FSGA 1SXJB 1UDWA 4P31A 2OV2A 1MRSA 2RGAA 2GTPA 2WSSA 2QSYA 4DRZA 4PAQA 4RY2A 4HB4A 3AVWA 1H8HD 5CB8A 1I4LD 3HR8A 2YWFA 1E2QA 1Z6AA 4Q9KA 3PUVA 1OFHA 4JLKA 3CX6A 4CW7A 4KV9A 3NIBA 5H1YA 4Z1MD 2ZVPX 1L7VC 4GMXA 4OHXA 1XDBA 1IM2A 2FPLA 3OEED 4D6PA 3TNFA 3X1ZA 1NMZA 4GT1A 5K8IA 1E2FA 1ANKA 1FQJA 1FQKA 1OIWA 5FBQB 2PZFA 1F2UA 4TLDA 3PJRA 1SVWA 2QRZA 1MKYA 3ZD6A 1P3JA 4NYIQ 4AYTA 4QKQA 1E2EA 2VP0A 4GPTA 4PC2A 5DHAA 3FYHA 1V43A 3QG1A 3LV8A 4NU0A 1OYYA 5FUYA 3A4NA 1XEFA 2HUPA 3AF0A 1RPZA 1ZVQA 1HE8B 4PHGA 2H17A 3RRZA 3U3RA 4NDZA 2FG5A 1MH1A 2GNOA 2QEQA 2OAP1 3PUWA 1KK1A 3JZAA 3CH5A 3OIWA 2AFIE 3FKSD 2ZQ5A 2PMDA 4OL0A 5SZKB 1KI1A 1XEXA 4D2IA 5KSYA 1P4SA 3KQLA 3D6TB 2O8FA 1ZNXA 1AQYA 3CZPA 3SE0A 2V6JA 4PHTA 1G8HA 4AY2A 2HT6A 3GJ6A 4JSYA 4MQBA 3A6PC 1Q12A 1YZNA 2W2VA 3PUXA 2QE7A 2TMKA 4WXRA 1XJQA 3CKLA 2QBYB 2A7QA 2ZI9A 3LBIA 4DLUA 3G82C 1C1YA 2GJAA 3B1YA 4PPGA 1YZUA 3UATA 4OHYA 4NPHA 4GL2A 2EFHB 4JVMA 4MKGA 3IHWA 2W0SA 4MGYR 5SZHB 2XZLA 1QHSA 2VSOA 1E0SA 2NO9A 2O52A 3O47A 4BEBA 4LBWA 5KHOC 4HLDA 3KJEA 4PC6A 2C04A 1CRQA 1FOEB 1L4YA 4L5BA 1AIPA 1DG3A 4JL5A 2QMUA 4ACAA 3W5JA 3I8SA 4URWR 2R62A 4URYR 1JXOA 2HXSA 2NQ2C 2J7PA 2XNSA 2X1VA 4MDFA 4HB0A 1Z6XA 3QY0A 1Q3TA 3EX7C 1KDPA 5FUWA 2W6JD 1SKYB 3IPYA 3U3OA 2OBLA 3JVUA 3OHMA 4NMMA 4Q9LA 3U4QB 1E0KA 1KJWA 5BN3A 2Q9CA 3GFOA 3D31A 1I2MA 1KI4A 1NKSA 4JJZA 1ZBDA 3E70C 2GEDA 3SR0A 3ZS8A 1OH8A 1R0ZA 5DH9A 3TW8B 2VP6A 4W5HA 4R2HA 4XOIA 5FH9A 2EW1A 3NXSA 4OI4A 4IXMA 4NCKA 1LS6A 2WBLC 2JLQA 1E9BA 2GCNA 4ABYA 4R7ZA 3WBJA 421PA 2YHSA 2DWQA 1G41A 4YMWA 4Q21A 1ZIOA 2IYTA 4M22A 1G18A 3K8YA 3NH9A 3LBHA 1CRPA 4B6EA 1KAGA 4O2RA 4QJ4A 4ZO4A 2F9LA 2GAOA 1E2JA 3HYTA 3REGA 3ZVLA 4URXR 1OKKA 3FFAA 4KHZA 1G7RA 3QKRB 2NO1A 3C5CA 4ILEA 4RZ2A 2PZEA 3AVOA 5KPJA 2FFAA 1EFRA 3HR7A 5FTNA 3TRFA 5EJEA 3KXLA 3LWNA 4JLVA 2BMFA 2FN4A 3Q72A 2Z4SA 4KSCA 4Q7KA 2ZU0C 4IOJA 1G3MA 2VSFA 3F3YA 4GP7A 4M1WA 3G5UA 2JLZA 3IHLA 5FI1B 3MG9A 2GJSA 3QXJA 2BCGY 1AJEA 3CM0A 1E2KA 1WBBA 3QXHA 2XXAB 1SVLA 1E2DA 2GAAA 4KI0A 3RS0A 5JCPA 2AN9A 1UAAA 1DPFA 3VKWA 1L4UA 5AJVB 2GK7A 4C0SA 3QPUA 1HUQA 3DM5A 3UG6A 2IXGA 2QN6A 2WIBA 1E98A 4HUQB 4M4SA 4A0HA 1Y3AA 1BYUA 1CJVC 3GJ3A 1NBMD 2J46A 1AGRA 1GP2A 1W0KA 2GZDA 1FP7A 1JECA 1E2PA 1UKYA 3CX8A 3DL0A 4LV8B 1M7HA 4HDOB 2SHKA 4IDQA 4AURA 3K0FB 3PEWA 4LI0A 5DI9A 3Q5EA 4UJ5A 3GLFB 4LSGA 2QP4A 4K8OA 2VP4A 1H65A 1VKJA 3AB3A 4M1SA 4G01B 3TW4A 2KB0A 3H0KA 4MRPA 4JBWA 3K0FA 4O0MA 3WBKA 3ZGXA 1FZQA 1GOTA 2F1RA 2ZUCA 3AVYA 2OBNA 1P62B 1QBKC 1X8JA 2C98A 2IXEA 1J90A 4JLMA 3R9WA 5LB4A 5TARA 1G8YA 2ZPTX 4LBVA 3U3MA 1HA3A 5D3MB 3W5IA 5EUMA 2F1HA 1XTQA 1CR4A 2GRJA 1IBRA 1TNDA 4GMDA 621PA 3KB1A 5AWFC 2ZJ2A 3NHAA 2W2TA 3RS2A 2QNRA 4DT1B 5B58C 1DAKA 1QF9A 2QAGA 2JJ8A 4Q7JB 4PR0A 5KTYA 3WNDA 1Z0AA 1N25A 1KJYA 1YQTA 4PANA 4RFSA 5JMTA 3FMOB 4X8OA 2XGJA 1HTWA 2H16A 2J87A 3CRMA 4FMCB 1HH4A 5DO9A 3R20A 2EYQA 2HLDA 4FW9A 3AKYA 5FOSA 4B32A 4W9MC 3IIMA 4WIAA 3GLIB 1PLKA 2J41A 2XNDD 2HJVA 4Q4AA 2NIPA 2ONKA 2UVQA 2VH5R 2O0HA 3TSWA 3CR8A 2H57A 3BFXA 2QZ4A 4YONB 1ZIPA 2RGXA 3P27A 4DKXA 5BW8A 3CPJB 3C41J 1YZLA 3DKPA 4HEJA 3LH5A 1KZGB 3B7GA 3GJ4A 1J2JA 2WWHA 4PTLA 1UM8A 1AN0A 4A2PA 3TSOA 1TMKA 3HPRA 5K8LA 3V4FA 4Q1BA 2PL3A 1G9XA 2OZEA 3N5CA 3EPKA 4RD3A 4E03A 1G5PA 4HAVA 1YZQA 2W00A 4I4LA 3R7WA 1P2TA 4RD2A 3W9YA 3MWJA 2C8VA 4X8HA 1U81A 4FINA 1YU9A 4NTZA 4BZXA 4C0BA 3UG7A 4FMDB 4AKGA 2PX3A 5KDOA 1A1VA 2XTMA 4OQLA 1U2RA 3BXZA 3RANA 4Q9JA 5JWRA 3X1WA 1ODFA 4M9QA 5KO2A 1MO5A 1WBDA 4BRWA 4PPQA 4PAOA 1U8AA 4BLTA 4EDHA 2RGNC 2VEDA 3FDIA 5K8UA 1SULA 4A0RA 4TWZA 3WYFA 3ZS9A 2QGNA 1NBME 3GCGA 4JSTA 4Q48A 2CE7A 2CVFA 3TLXA 1W0JA 5CIWA 1S96A 1HY3A 2GBLC 1G7TA 1KSJA 1P5ZB 1YVDA 3QKSA 4L15A 2BM1A 4NP6A 5KSPA 4BLOA 4EQ6B 2ZIAA 4BGDA 4KFSA 2EFEB 4OQNA 3K9LA 1SXJC 5HZKA 3DKVA 1J70A 1QRAA 2QU8A 4KAXA 1S3SA 2Z43A 3PEVA 3AM1A 5B57C 2XB4A 4C0LA 2GKSA 3X1XA 5DLQC 4LYFA 2VHCA 1G6HA 1OXVA 3FWYA 3EW9A 4EFNA 1YR9A 1GVNB 3UXMA 1GITA 4MRRA 4PXAA 2BKEA 5JBQA 1YRBA 1OKKD 1KK3A 4BLPA 1AK2A 2A5JA 2ZRMA 1BMFA 521PA 2H5EA 1BYIA 1ZU4A 3FTQA 5EP4A 2Q9BA 2WJYA 3ADCA 4DJTA 3IEVA 4TQAA 3N70A 1EFRD 2N46A 1HV8A 1QHGA 2ZJYA 3KFXA 5GJBA 1OLOA 5JZVA 4Q4JB 3X1YA 1N5JA 1XTJA 5HKKD 3P1JA 1A5TA 5M04A 4IXNA 5FUXA 3P4XA 4PSKA 221PA 1AZTA 3I92A 4LHXA 2ZROA 3IBGA 1IXRC 2J3EA 2IYQA 4E22A 4TMKA 4DCSA 4PO8A 1HYQA 1GILA 1ZC4A 3B8HA 1COWD 1SQ5A 4LBYA 1SGWA 2VYFA 3RWMB 1W0KD 3SI7A 4LV6A 2F55A 821PA 4TL7A 3GJ8A 2FA9A 4IVPA 3B1VA 3BB1A 2QL6A 3L2OB 5AJWA 4I81A 4B3CA 2AWOA 1NY5A 1EFTA 5DI3A 3RABA 2DR3A 3K0AB 1OXUA 3MAAC 4LBZA 4OK6A 4JLNA 5GJVC 2IUTA 2ZTSA 3BK7A 4HDCA 4AD8A 4QM6A 3BBPA 3SZRA 1E9CA 4L8GA 4HLCA 1G8PA 4ZDIA 2QUZA 1ZINA 2HEIA 1U8YA 3NBYC 1TF2A 4Y0VA 3CBQA 4RCYA 1M1YE 3ND8A 4HLUC 1JR6A 4Z51A 1R0WA 4ESVA 3ZYCA 4YMUA 2V8OA 2FSFA 3IGFA 4XVQA 5DISB 4TYWA 2FF7A 1P9WA 4QNMA 5AUNB 1JJVA 2NZ8A 1TQ2A 2YVUA 1GRQA 2PZGA 2CCJA 3HU1A 3QVVA 4BFSA 3CW2A 4OHVA 2RGEA 4QHSA 2F3TA 4GP6A 4Q66C 4DDTA 1E79A 3UMSA 4N1AA 3W90A 4EJSA 1W47A 4B6FA 4DLXA 3DZ8A 1G20E 4MGKR 4F7WA 2AK2A 2OE2A 3QF7A 1G7SA 2JGNA 1U8ZA 2A5DA 2XX3A 2JLWA 4L9SA 1VCMA 4DUGA 2YOFA 3EC2A 4IOKA 1P72A 1NKTA 3IIKA 2HYDA 4NYMR 4EPRA 1TTTA 1KMHA 3FGNA 1IOZA 2QI9C 1NN0A 1F2TA 3K0EA 2JEOA 1SKYE 3KJIA 1LF5A 3U2QA 2O5VA 3W6OA 4ZDWA 2HLDD 4PSAA 2BCJQ 3OE7A 5EXXA 1BS1A 4Z1MA 3K0SA 1IY0A 4XH9B 1YR8A 2BIFA 3LXRA 2GCOB 1XXHB 3PEUA 2OCAA 4DIDA 3Q7QA 2IYYA 2GJ8A 1FNMA 4TYPA 2MSCB 3BRWD 3FHOA 1XCGB 3AGQA 4MRNA 5KNDA 2GETA 3OAAD 1AA9A 4EPWA 1RYHA 3BFVA 4TQ9A 1K8RA 3I72A 3OZXA 5KSOA 3U6BA 2XJ9A 1Z0KA 2IWHA 1OIXA 5J4YA 1XFAA 2DPXA 1N2CE 2YC2C 4JS0A 1Z06A 4M0LA 1I2DA 3KKQA 4TLAA 2LCFA 3ZZ0A 4ERNA 5CITA 1H8ED 3EPLA 1R7RA 3MLEA 3L8ZA 3RS5A 1AA3A 3SHFA 1CJKC 2Z0MA 2RMKA 3FKSA 2JCSA 3U7HB 5JWHA 1N5IA 3WP0A 4B2LA 4YC7A 2YWHA 1KI9A 2DWPA 4DLTA 4I1OA 3SFVA 2DB3A 2RH5A 3RC8A 3KKOA 3GQBA 4XSGA 4P33A 2CMKA 5G53C 5LDDC 4LK2A 3VR5A 5AJXA 1SHKA 4LV5B 1CEEA 2W83A 3OF5A 1KNXA 3T15A 4DCNA 4URUR 3EWSA 1G8FA 4NL4H 3IDQA 1P73A 1W0JD 2WSMA 3PG5A 3WYAA 2JJ1D 4FMCF 3ZH9B 2BMEA 2JLSA 2F7SA 5KPDA 5KOYA 4GOJA 4KVAA 3CNNA 1K5GA 4ACBA 4Q02A 1W5SA 1XJ0A 2NTYC 2QP3A 3VR1A 2ATXA 4P3YA 3ZVRA 2ZRPA 4CEHA 4I1UA 3U6KA 1TL7C 1UADA 4FCTA 1CF4A 4PPFA 3A1WA 3MSXA 4KODA 4QG7A 4DSUA 4OI1A 3KFVA 3GLFE 3QSYA 2VP9A 5EE5B 1Q44A 5F3WB 2CNWD 4KYIB 2WVJA 3B1ZA 3I1FA 1SHZA 3RSLA 4PC3A 2O8CA 3WHKA 1CIPA 5HTKA 2IYXA 1UFQA 5E7JA 5E95A 3THWA 1FUKA 3EIEA 5TVKA 3EA0A 2ZRBA 1HURA 3B5JA 5C18A 3LVRE 1DE0A 2IYZA 3T5DA 4CEJA 1KAOA 2YJTD 2R6CA 1XRJA 4FMDF 5HE8A 3TAHA 2PX0A 5BXQC 2KE5A 5CDFE 4URZR 4ESHA 2Q6TA 1R10A 2HXYA 4BLSA 3KB2A 5TV2A 3WHLA 4BQSA 2IYUA 3LA6A 3U3JA 721PA 5CYOA 2BC9A 2F1IA 2EQBA 2FGKA 2XSZA 1GNRA 2CLCX 4U02A 5FI0B 4ZDKA 4B34A 5KNBA 3VNVA 2QQEA 2D4HA 2WOJA 2IEYA 4GI7A 4KO8A 2QMOA 3L0PA 2P5SA 2BKUA 5GJWC 1RVDA 2CJWB 4XWOA 4QNRA 4M21A 4NCNA 3DMNA 1E94E 4H1VA 4AKEA 2O8DB 1XWIA 4W5JA 4ON9A 2IYVA 2D7CA 2P6NA 2Z83A 4PZLA 4XJXA 4B3DA 3CZQA 4C7OB 2KWIA 2WTUA 5JSZB 5J40A 2NZJA 3GLIE 1HQCA 2ODBA 2I1VB 2C03A 3I5XA 2V1UA 3LRPA 1ZJ6A 3ADKA 1J99A 4O2LA 3Q9LA 2O8DA 1II9A 2JDIA 1OFUX 3T5GA 1N6OA 1J7KA 2C9OA 2G6BA 4BFWA 4C7OA 2Z6VA 1E4YA 1P7CA 3B60A 1ZNYA 3IO5A 4LHYA 2B7CA 4KU4A 4TZ0A 1Z0IA 3FMFA 3RC3A 4AYXA 1JQLB 4LYHA 1NVVQ 4IVQA 2DY1A 3PENA 4F4JA 4X8LA 1E79D 1IN7A 1TUIA 1KK0A 3MUFA 5FR2A 3RS3A 5FOVA 3WMFA 3VAAA 1VYTA 2OCBA 3PCRB 4HAZA 3TK1A 1EG7A 1JB1A 4B76A 4DXAA 2ORVA 3OESA 1S9HA 2YZ2A 4ARZB 1AKYA 2QTVB 3UANA 2XZPA 2YV5A 5EP3A 2IWRA 3P20A 3FOZA 3GEEA 4EAQA 4DUGD 5IF9A 2G0TA 4QRHA 3CIOA 2QRNA 1G5TA 2ZRLA 4LHWA 2JASA 1KI6A 4GOKA 3GFPA 4POAA 1SXJA 2IC5A 3OE7D 2NOAA 4M1OA 5J4KA 3PQCA 1W4AA 1GFIA 1PZNA 5CM9C 1XPUA 4FMBB 4B43A 2B92A 1D9XA 3UMFA 3VX3A 4B71A 3LQQA 1XEWX 3AP3A 3A1TA 3QBVA 1GTVA 3KL4A 3REFA 1V5WA 5FPHA 4PAMA 4RZ3A 2P6RA 4KVGA 4JL6A 3B82A 3P4YA 1NLYA 4GFDA 2QORA 3KX2A 5G3YA 2KBEA 1DEKA 2CL6X 1S8FA 4A4DA 1IJFA 2XITA 4D26A 1D2MA 3B1XA 4RD1A 2QPOA 3VHLB 4GOXA 1KI2A 3GJ5A 2F6RA 3RYTC 1IXZA 1XNJA 1RIFA 2CXXA 4HZIA 1Y63A 3KQUA 4A6PA 1UF9A 1NJFA 2CCKA 3O8CA 1ZW6A 4FWIB 4BEJA 2BVNA 2C77A 4N0EA 4UNRA 2QP9X 1DADA 5EE3A 2GZHA 2YOHA 4IOLA 1KY2A 3K0CC 1RKBA 3EZ2A 2WPDD 1KJZA 1XTSA 2OAQ1 4D0NA 3AEZA 1Z83A 2VF8A 3F8TA 1U94A 3SJZA 2XNDA 2PMKA 4JMPA 4DLZA 3OEHA 3TBKA 5IDVA 3FHCB 1JI0A 3LD9A 1YR6A 4WOPA 1D8TA 4B47A 1G17A 4TMXA 1QHNA 5E4FA 1W36B 2FV8A 5AJYA 5FOWA 4HSEA 2QBYA 1CU1A 3L82B 4LYJA 4I99A 3K1JA 4M8NE 4XD7D 1Z0DA 4OQXA 1KSHA 4ASUD 3C4JA 4GSYA 1KTVA 2FFBA 1VG1A 4HLUA 4HYYA 1KYIA 3ZJYA 4A36A 4JVSB 1KOFA 5TMPA 1YRAA 5L3RA 3ZDQA 4LGMA 3FE2A 2AFHE 3L0OA 3NBZC 3RWOA 5FTLA 4F38A 2WWWA 1NN1A 1E9SA 4NCJA 4UNNA 1SVKA 4RKFA 4F4CA 4ZKDA 1WQ1R 4UXIA 4EPXA 2YYZA 3CLVA 2FPKA 1PV4A 1QVRA 4DDUA 3OIUA 2YOGA 2LKDA 3KTAB 3MJHA 4Q7LA 1LNZA 1OFIA 1G7CA 1OFTA 4JVNA 3RRMA 1LY1A 2QMHA 4MKFA 3NHBA 2RB4A 3T61A 2R65A 4EPYA 1R6BX 5HCNA 3U4QA 4CGZA 3ZZTA 4TQUS 3SBEA 4ZI3A 1OXSC 5CK5A 2JAQA 3SC3A 4C0HA 3CNOA 4DHEA 1A4RA 2XSZD 4DLVA 2WJIA 4DCVA 2UKDA 2ZVQX 1S9DA 4G5OA 1MOZA 5FPYA 3EA5A 1XP8A 3GEHA 1IQPA 3NWJA 4DDVA 5TB5A 1DG1G 3THXB 2ZRFA 1UBFA 1OJLA 3ECCA 1JALA 121PA 1G4AE 1TAGA 4GZLA 4K81B 4G5QA 3DDCA 1AKEA 1I4DD 2PT7A 5KYKA 3U44B 1NF3A 5C4GB 2PEZA 1XXHE 5HCIA 4AKIA 1M7GA 3IEUA 1N6RA 2A30A 5SZIA 5JRZA 2JDID 4A82A 1IAQA 1EWRA 4OQFA 4UXJA 1E0JA 1D2EA 5CK4A 4DEXA 1SVMA 5HKKA 3QKRA 1DVRA 4TSFA 5CIQA 2F9MA 5C4MA 4CRWB 1PUIA 3M6AA 4UQOA 4C9BA 1HEIA 4FXPA 1GL7A 2O8BB 3NDBB 2CEAA 3TVTA 3ZIAD 4V03A 4KFTA 3DEFA 1OHHA 2CDNA 2ZS7A 4YXWA 3U7GA 1R5OA 2VPPA 3GLGB 1COWA 2N42A 3QQ5A 2BEJA 2OLKA 4MUBA 2XXAA 1E3MA 4BWYA 2VP2A 4F92B 2Q21A 1DAMA 4D4LA 2HF9A 1S1MA 5F98A 1BIFA 2C9YA 4HUQA 4CDGA 4HATA 3BORA 4FWTA 3CPHA 1SXJD 4LZZA 2GEUA 3DM9B 4V0ME 3JVVA 3IPXA 4EUNA 4C2UA 3RRYA 2OFWA 1TEXA 3GLFA 1BOFA 5FBLB 3BIFA 1Z5ZA 4MGIR 3VR2A 1NL3A 1UKEA 2AKYA 4OI2A 4Q19A 1NY6A 2OCYC 5KU1A 4HAWA 1WRBA 3PV0A 5TDHA 4JIMA 2AWNA 3AKDA 1U0LA 3A1SA 3GJ7A 2ZR7A 5JJKA 5DE3A 2C2HA 2X8AA 1IJEA 1TPZA 4JLDA 4L4UA 3T1QA 5CB6A 3JZMA 1XD2B 3PITA 2P65A 4RZXA 4GDFA 2OLJA 2QAJA 2FSIA 3MWLA 3FHTA 3MCAA 4JLOA 1RW4A 1FW6A 2RHMA 5D3MA 2ECKA 1DOAA 1OH6A 1L8QA 4YDSA 1OXTA 5CDFA 1XD2A 2GJ9A 5CJPA 3LFUA 2CHGA 1W1WA 2IS2A 2QGZA 4OQMA 1XMIA 2DYKA 1VTKA 3QPWA 4DT1A 4QJ5A 4IDPA 2QM8A 1Z0JA 4HAUA 1NP6A 2JJ2A 3VFDA 3EZ7A 3T1TA 1Z6TA 1JPNA 3B9PA 1XMJA 2ZSAA 2WAYA 2D7DA 1UEJA 1Z47A 2IX3A 2B8WA 1TEVA 3AVXA 3OEHD 5FBWB 3MD0A 5JLJA 3K09C 2REBA 1FUUA 2ZYVX 1ZM3A 2ODNA 1XZPA 3PEYA 4NYJQ 1G3RA 3M4YA 3I4LA 2ZJOA 3OAAA 4NE2A 3GLIA 1US8B 2ZM5A 3A4LA 1AZSC 1E96A 1IY1A 3LXXA 1NI3A 3DHWC 1KKLA 2AX4A 4W7SA 1H8EA 1E9RA 4HB3A 1XPOA 2BBSA 2V55B 4DCTA 4BZPA 1DAFA 1EX6A 1TU3A 3GLHB 3E1SA 3IILA 1Z0FA 3LBNA 2VO1A 1G8GA 1YZGA 2IUUA 4UNPA 4JYBA 2ZI5A 4LRWA 4BPBA 2JLRA 3H4MA 4ZIRB 1IXSB 1D9ZA 2FEMA 1Z2CA 3BOSA 4J0QA 4JZKA 3PFIA 4QC2A 3K70B 1A2KC 5C2JB 2O8EB 2GA8A 1B23P 2YINC 1NSTA 2EU8A 3TIFA 4YQFA 2FZLA 3R9IA 3VX4A 1G1MA 3EASA 1G291 4TZ6A 2OT3B 2BEKA 2UZIR 4Q4HB 5C46F 1R0YA 2R6AA 2A78A 4BFUA 4CT4B 4CEIB 3CH4B 4US2R 4KXFB 2H7VA 1BH2A 4OK5A 2B21A 2JJ1A 3LLMA 4LC1A 1TQDA 2A9KA 1ZM9A 3NDPA 5JWOA 2VHUA 2AR7A 4FIDA 2ZE6A 4M1YA 4PO1A 2QM7A 4E09A 2OBMA 1KDOA 1SXJE 2J0UB 2R8RA 1U90A 3Q5DA 4EQ6A 2OEPA 3H2YA 2GCPA 4NBSA 2NG1A 4MRSA 4XWAA 2QG6A 3LW8A 3L8YA 1E9FA 2ZRKA 1AS3A 1N0UA 1LFDB 1XTIA 2CNWA 1TQ6A 4JLPA 1NN3A 4QBHA 1N6KA 1E2MA 1NLFA 1R5NA 4P4TA 2G83A 1GNPA 1YJ5A 3EAQA 3LNCA 3O8BA 4FCVA 3K9NA 4UNQA 4WXPA 5J5CA 3W34A 2RKOA 4B2IA 1VYUA 2ANCA 4US0R 5J47A 1ZM7A 5HZHA 2ANBA 4F93B 1RFLA 4B3BA 3QNUA 4O25A 1P9RA 1XCPA 5F9HA 2B8TA 4PQFA 1VYVA 4OJQA 4IDHA 4TSFD 5EZ6B 2IS6A 2WJHA 4M9SA 3ZLJA 4JL8A 5FL7D 3LLUA 2W0MA 2ORWA 5IK2D 4PHHA 2CLSA 1OE0A 3PUYA 3QBTA 4Q4JA 2C96A 3FMPB 1IY2A 2J5XA 3K0CA 3X1DA 2KI5A 4QGAA 4XWKA 2F43B 3PUZA 1OHHD 4BRUA 4YXWD 3J81k 2FZ4A 3RSOA 3EZ9A 1ZUHA 1DO2A 3BH7A 5FTJA 5JS8A 2RGBA 3BB4A 2D3WA 1U0HC 3LQRA 3SJAA 4R2IA 3I61A 3W8NA 2J0VA 2ZRAA 4PZZA 2OFXA 5EXSA 3VHXA 2ZE5A 1SVSA 2AXPA 2KSQA 4PC1A 1EK0A 3SU8A 1T91A 2AXNA 5CJ2A 4E07A 1VCIA 1FMJA 1FPMA 1OW3B 2ZSFA 2RGCA 4RKEA 3ZQJA 1E2IA 1W36C 3R8FA 4DBLC 4QGFA 3O8RA 2J45A 1O87A 1VIYA 3K0AA 2IA5A 1NG9A 3VR4A 1XEWY 4KYUA 3W3ZB 2IF2A 2VBCA 4RD0A 2I4IA 2QPTA 3AUXA 1CTQA 4V0LA 2IUSA 5LD2C 3CRQA 3IO3A 1Z07A 4JJKA 2GWHA 2WIAA 3UPUA 1S0UA 2D74A 1W5TA 3OFND 3AV0B 5E7IA 1UBGA 1KHTA 3HU3A 3TQCA 1LF0A 5K8TA 2FFHA 4M1MA 4TL6A 3V9PA 2OM2A 1KY3A 3RHFA 5EXPA 3SNHA 1SVOA 4OJKA 4MUAA 3CF2A 1XX6A 1Z29A 2BBTA 1EFHA 4LJAA 1CKEA 3I32A 1R2QA 1ZD1A 4LJ7A 2AKAB 4GNKA 4YMVA 3A1VA 1JNYA 5IHPA 2QT1A 2WJJA 3GFTA 3KUDA 4LX0A 3ZZUA 3EC1A 3QJYA 3IIJA 3NC1C 3ND9A 2JJ2D 3C14C 1E2GA 1W2GA 5E7MA 5KDDA 3AVTA 2FFQA 3OIVA 1A7JA 4G3XA 2OXRA 3A36A 1TQ4A 2QQ0A 2R6FA 4D81A 2JATA 1Q0UA 4H1UA 4IRUB 3ASYA 4DWJA 1JR3D 1GKIA 1JBKA 4MYCA 2FE4A 2CK3A 4AYWA 1X1RA 2QMEA 4M1KA 4XTCS 2GCOA 1XXHA 4GZMA 3GJ0A 1CLUA 5F2EA 5J4HA 4P4SB 3D3QA 2P67A 2WJGA 1YR7A 4R9UC 2ERYA 1UDXA 1RRCA 1LV7A 2XEXA 2JIZD 3BWDD 1KO1A 2IHBA 3EIHA 1ZAKA 1M74A 1MO6A 2EFDB 1VG0B 4BASA 1UJ2A 1G64A 4LJ4A 4WBSA 3MWYW 4V02A 1LS1A 2RGGA 5JFGA 3BFKA 1QG4A 2X2EA 4HLQB 2P0EA 2WPDA 2HCBA 1HQYE 5AK0A 2OSBA 5DNYB 5FR1A 1GM5A 3VKGA 2WM9B 3SJBA 2OO7A 1VIAA 2QPAA 2BHRA 2FPMA 1XBTA 3N2EA 3T1VA 3NEJA 3VU9B 3QF4B 4IHQA 2R9VA 3ASZA 1E6CA 3QE0A 4TTQA 2N1BA 4LHVA 4Q00A 3IUYA 2VA8A 2ZR9A 2BMDA 2VL7A 3AP1A 3V4RA 2BOVA 4DCUA 4V0MA 1II8B 1M7BA 2CBZA 1ZRHA 2GESA 4GBMA 3GLGE 1IONA 3CB4A 4B74A 4XD7A 4C4PA 1N0VC 1XMSA 4ASUA 4D4KA 4ZCMA 1NVVR 4X8MA 3CONA 1IN6A 5HR5A 4JT2A 3TH5A 1SKQA 2R2AA 5J4VA 3WNCA 3W3AA 4LDJA 5DGXA 4BFTA 2W6ID 4IFBA 3AVUA 5JI3E 1VDZA 3T06B 2Z5FA
chains in the Genus database with same CATH superfamily
4BZQA 1E4EB 3Q3HA 2XUIA 5H82A 1LPPA 2BM0A 2QZSA 1SVUA 3KKNA 2GHQA 3VHRA 1T3SA 4AXBA 5J2TA 2XWBF 1Z5UA 3W2IA 4X6XA 3OSZA 1DBPA 1J8YF 1SQSA 1X7GA 2ATCA 2QMQA 1EDOA 2R85A 2G4LA 3H7AA 4K6OA 2OM6A 3IA7A 3M89A 4OHBA 3TLJA 3PZRA 4XWTA 1W46A 2E6UX 1WABA 2JIRA 4XCXA 3SK0A 3WXBA 4BTVA 4IUCS 3K4PA 2FK8A 3VPBA 1IQRA 2GF0A 3INYA 2V6IA 3QQPA 4ZHQA 1CYEA 2X0NA 3SZGA 4B4OA 5WRFA 2J33A 1E3WA 1TIPA 3WMRA 4CN9A 2W22A 2QK4A 5JNSA 1S3GA 2OAGA 4TMWA 3SSOA 1O03A 1GPYA 1TVCA 2GRUA 2J30A 2ONJA 2QL9A 4AAYA 1ES9A 4OHCA 3RU9A 1N8NA 5ESRA 2JBHA 4PZDA 2XYVA 4RX1A 4HWOA 3GN2A 3ELWA 4BFYA 5HRUA 3GG2A 1FFWA 3BGSA 3KKLA 4E5VA 3BSSA 5KNBH 3SZMA 4YAKA 1PCXA 3UOGA 4TSRA 4RK4A 5IAEA 1ZC3A 2BUBA 1AE1A 4YDHB 5U1PA 3ZVMA 1JR3E 3CF6R 4ZI5A 1R6TA 3D5TA 4LSWA 2UXCB 1RWWA 3B85A 2A7XA 2PEYA 4FBMA 2J5QA 3O38A 5JAQA 1KY5A 4N4AA 5EWLA 3LPMA 4GGMX 4L3OA 4PRLA 2ZU6A 3MYYA 2K5UA 1KZ7B 1O0SA 3QKTA 4UULA 5HIAA 4M2LA 2OCGA 3O94A 3X2EA 2JRLA 2ISSD 2OXCA 1R6XA 2WIKA 3O4GA 3ASUA 4NY1A 1ZQ9A 5EXDA 3S2SA 5ALSA 4FOSA 4WCVA 4RHEA 4AY3A 3LDFA 2YASA 1U11A 3PXBA 1VB5A 2G9RA 2W42A 1CZNA 1IEWA 3FIJA 5JEEA 1Z6YA 4YJKA 3PJGA 3V7FA 4GRIA 1P31A 2GYVA 2YXBA 5K0FA 1P5JA 4EUEA 3U4DA 4Y7CA 1P6XA 4Z4QA 3CJQA 3Q8KA 1L4KA 2A57A 2QROA 2R1VB 4E88A 3MBKA 4G9EA 3K70C 2RGNA 4HN4B 3FZGA 4TTTS 2C2WA 4LGCA 1IHUA 2GM5A 4KLZA 5KVVA 1ZSVA 1M72A 4EEKA 1DU4A 1UBEA 2YC4C 2Z6QA 3SR4A 1E6LA 3TM4A 3AR7A 4C0JA 1YR1A 1X80B 3RNLA 5BN5A 4I0WB 5H68A 3W2GA 2FTKE 3LUHA 2XDQB 3L7BA 1PQYA 2DQYA 1PFKA 1NRXA 1QGYA 1TCCA 3D2BA 4OXIA 2HQOA 5BV7A 3OPMA 2PT5A 4OYHA 3NBAA 1NSYA 3A6LA 1GNSA 4IDGA 3ZV7A 3C5WP 1K6JA 1QONA 2YCLA 3W4KA 2BAGA 4ZCSA 4AM8A 4E4TA 3AUYA 1G3QA 4KBFA 3KZMA 4JLSA 4RK1A 3RK4A 2I6UA 3E2IA 4TM8A 4D80A 4IQ4A 3RV3A 4I46A 4GGOA 2WEKA 3UMJA 4GMGA 2D13A 4R0MA 1AV7A 3BSFA 3D81A 1JMYA 3ED5A 1RWBA 1CBUA 3DZJA 4JLWA 4J3NA 3RFVA 2P68A 2EVWX 5FULA 3K6SA 1S8AA 1VDMA 4XZ3A 1ZH4A 1RQ7A 1NNEA 1G3UA 3AFHA 3BQMB 4FN5A 1V26A 2VK2A 1F2UB 4UKDA 1ZLXA 4BRSA 3ERCA 2HK6A 2OLEA 5E3IA 4GSKA 1ZM2A 5E4JA 2IBMA 3KEOA 4C2TA 2JG3A 1ARZA 3HI4A 2ODEA 3ZTYA 3KJGA 1GNQA 1O96A 4HZUB 2AQIA 2J3MA 4N5DA 3GBPA 4IHJA 1YRWA 4DR2B 4QULA 4BNYA 3R9XA 1ONBA 2OCPA 2IYLD 1AXEA 3P2IA 3R0QA 4FLMA 4TMZA 2FZVA 4AMUA 5HOEA 4GKKB 4O63O 3ZI0A 4C4AA 1PGJA 3H0EA 3WGIA 2I8AA 4PHFA 1SUAA 1TTHA 2OZLB 3P7MA 3PQ3A 2Q5EA 5TLSA 1T13A 5IT5A 4NENB 5KTRA 2AHOA 2W2OA 2X0RA 3KQVA 2WKPA 3PVSA 4QDXA 2VRCA 4G0NA 1QDUA 4HH1A 1IOVA 2OCDA 4YREA 4KC0A 3IPLA 4L9AA 2JGKA 5GZ1A 2F3RA 1HDCA 1Q3KA 5ALOA 3DMGA 2PXXA 3BWCA 1Z4JA 1GGHA 4MGEA 4RF2A 2PX5A 4NIMA 3STVA 4AI6A 2IZ5A 3QI7A 2PZAA 2VNJA 4FYVA 4HN9A 4TTSA 4CHGA 5FFMA 1B00A 1DJLA 1EXWA 2Y3IA 4B3MB 5LD2B 1U98A 3TIGA 4AG6A 2IGTA 2FR1A 3LK6A 2YHBA 2Z5VA 5CT4A 1X0XA 1E58A 5EKXA 4QDUA 2ZRQA 4RMGA 2JRBA 4I14A 5T4EA 2HZ7A 4TWIA 3UXYA 1R9NA 1BJTA 4BQNA 5CXXA 1IHPA 4DIUA 2NO4A 1I5OA 2FK7A 1Z4OA 1CG6A 1E1RA 2XHEA 1MGPA 4DNPA 3ZCUA 1U4NA 3C5HA 3ZE9A 5AUPB 4E46A 1EBFA 4TRNA 2PXAA 4V2IA 3KQHA 1Z5VA 5L9AA 4A0GA 2I91A 4S2EA 3WGGA 2GXAA 1Z8NA 2QRGA 4K40A 1YS2X 4Y1RB 2ZB4A 3V7WA 4AY6A 3F0TA 2M2IA 1DBWA 3MJDA 2RGDA 3F2VA 4WK6A 5KSZA 2VJYA 4EHFA 4MJLA 4I1YA 4UDOA 3S1SA 5A4MS 3GDFA 3MT7A 4WSOA 2ZSBA 4P8RA 3QA3E 3R5HA 4W8HA 2Q4BA 2PMEA 4J7CA 4KFUA 4XJTA 3WBFA 1Q19A 3A4IA 4IJMA 2AMFA 1LTQA 1NRJB 3JRXA 4K9KA 1DRKA 4KYVA 1HE1C 4UBNA 2FFJA 5LZ5A 2A9VA 3G8DA 3V8VA 3TSYA 1KFKB 1B0AA 1XHFA 4OATA 1L5HA 2D2IA 5FWYA 3TF5A 1QHIA 1JDZA 3UMCA 1JPVA 2PO5A 1L3BA 4DV7B 1XF9A 1YZVA 1QLWA 4W8GA 4TTRA 4QDZA 2CLLB 5BW4A 1C41A 3FD8A 3WRXC 1CD5A 4XARA 1XAJA 1PK7A 4ND5A 1OFUA 5AQEA 3LXMA 1Z45A 2IU4A 2B37A 3PHJA 1TYCA 4E15A 2LZ0A 2IUEA 4EFDA 1E77A 1KO4A 1Z74A 2IY7A 4EPVA 2WOOA 5CNIA 1XL0A 4R3NA 2P9ZA 4IH9A 4OFZA 4WWHA 3BREA 1GQYA 1CVIA 3EGCA 4MWDA 1DZIA 2VDLB 5EHNA 2FXIA 3GJXC 5JSQA 1DMRA 2FFRA 4A8TA 2UDPA 1PT8A 1V11B 1B8PA 2PBZA 2R7KA 1KNQA 3U80A 3GLRA 4EFKA 3FDFA 2XIJA 3TZEA 3UMVA 2HU7A 1OI4A 4M0KA 3WICA 3FOEC 1ZVKA 4PXSA 2F8LA 4YI3A 5TY0A 2G5PA 1IZZA 2X2FA 1MOSA 3EWAA 3OJOA 2SCUA 1QIDA 3ZQ4A 4E5PA 3AQIA 3D7SA 3NG1A 1NIJA 4KGVA 4YCLA 2ZE7A 1EB8A 2XMRA 4B3SB 3SAJA 4H0CA 3F67A 3IJPA 2IHZA 2GPNA 1GL6A 2BJVA 5DZSA 2SECE 3GJTA 3QX8A 4Z9XA 1BOOA 3B2EA 3C8DA 1J00A 4XM1A 1N4AA 5JARA 1XWWA 3WGMA 3R3YA 2VSNA 3W6NA 3C4VA 4EG4A 3LE8A 5FLYA 2J9FB 4YV1A 1F48A 5LVAA 1T1GA 3ZGLA 2ZIXA 5DN6A 2AJ8A 2PVSA 2A9JA 4FNAA 3F5SA 3BSWA 3Q3EA 1O6ZA 4LJ5A 3LFTA 4K2HA 4FGJA 4DSTA 4Q4CA 2O1WA 3GLUA 4Z4FA 3HJNA 1GDDA 1M0TA 3V4ZA 5BUQA 3LHSA 3S81A 2Z3ZA 3HZHA 1O1YA 2Q7DA 1XELA 5A3RA 3HO6A 1M34A 1XA0A 2CXOA 2DMRA 4A1FA 3MCTA 2GVDC 3MBOA 3A6HA 3BDIA 2QUAA 3DKIA 5BR8B 5JSYA 4DSOA 2XCSB 4WA8A 5ED0A 2I6GA 3FCUB 8OHMA 5JQGF 1X1BA 1KOJA 1ZR2A 2EGUA 1D2NA 1ATZA 3L43A 2R1TA 3K05A 4EPTA 5CVUA 4XIGS 1CY0A 5EUBA 5K2OA 1KU0A 1ETHA 2FLWA 1CIVA 3KQSA 1KMIY 4HDKB 2OGUA 4L95C 1QRTA 3CPEA 1YQXA 1O4VA 1N5LA 3JRNA 3E0XA 1NOKA 4KQGA 4HNSA 4QPDA 4RKWA 3T5CA 1KO7A 3LHIA 3Q3CA 1BGWA 3AQ4A 1Z2OX 2R6JA 4UVHA 1NJGA 4NE7A 1QKIA 3OFNA 5REQB 1SC6A 2QVZX 1N6PA 2I55A 1VL0A 1AT1A 3ELDA 1IN5A 3EA4A 3B70A 4MRVA 1EESA 3HTXA 4TXNA 3AL3A 1ZN2A 3U17A 3EN0A 1XMVA 4H2DA 4Q03A 1DG9A 3G2OA 1OB5A 1YL6A 1XLTC 3SX4A 3UCFA 1KC1A 1PJAA 1P5FA 2EF0A 2FEOA 3D7MA 1NPTO 2VTKA 3SQWA 3QOFA 1SPXA 1NHWA 1TM4E 4JDUA 3KXKA 3C85A 4D82A 5E9AA 2J4DA 4EGQA 1BHQ1 1U7TA 2P3QA 1CXZA 1QG0A 2HLPA 2XWSA 3AV3A 2YQZA 4G4GA 1PG2A 3R5FA 3KLOA 2JI7A 3FB1A 2QT0A 3TAUA 3EPJA 5BQ5A 4IAOA 4N0DA 2QRVA 3V55A 2GBCA 1Z73A 2XMGA 2ZCUA 1OASA 5DWQA 4ZAXA 1KBOA 1IUKA 1JR3A 1CUEA 3DZBA 1PVDA 3T7KA 3JD1A 3UT5A 1JA9A 2EQAA 1G21B 3HZRA 1X3SA 5AJHA 2DT8A 2JH9A 2ERCA 2LW7A 3DLHA 3K4QA 4G5GA 4OU4A 2VDQB 1YKGA 2R0QC 4HV4A 2NYAA 4FZ3A 3BRCA 4FD3A 2FJUA 1YDHA 2AOXA 4EHJA 1BHO1 2GHTA 2YFHA 3H87A 3M1IA 4EHDA 5HZGA 1V5IA 5L3SB 4TLMB 4OMFG 2RE8A 5JJLA 2QXTA 4MQEB 5HILA 3RIMA 2JIZA 4YX9A 3PR1A 4JJAA 2DFLA 2WW8A 3BS4A 4QARA 4AY4A 2I65A 4HRAA 3KU1A 1X7XB 1NPDA 1T36B 2VBFA 3N6VA 4J6FA 4PLCA 1Y4ZA 2VHQA 3TL3A 4CM9A 4Y1FA 2DXIA 5C1BA 2PGJA 3R7WB 3LUCA 4WE3A 1AQJA 1G4UR 2WWFA 3FFWA 3GLHA 3NGXA 3KSZO 4L5JA 1RPTA 4DN6A 2P3OA 3SIXA 2H7CA 5IFKA 4D8TA 3VGPA 1C4KA 2PUJA 2YKGA 4RLQA 2FOLA 4J0EA 3QI2A 2Q0QA 4D4GA 1NNUA 4ZIRA 4KBGA 3RKSA 3TPZA 4MICA 2J7PD 1KVQA 1Y4AE 1PJSA 3E3NA 4TN1A 5D84A 4CMEA 3OWOA 1QHXA 3CVOA 4BS9A 1DC8A 8ABPA 3DVLA 1LDMA 2VP5A 2ISCA 4C7MA 3JWGA 3LAWA 1VKZA 1PJCA 4C2BA 2GN8A 5GINE 1HYGA 5GV7A 1TYAE 3NIFB 3NTRA 4Q4HA 1MMFB 3LO5A 4NKRA 4MDEA 3WLLA 3I1YA 5BQFA 5AKZA 4M1TA 5TPZD 2WJVA 4D0RA 1ZWLA 4EA8A 1YR3A 4UBKA 3R3UA 1VMEA 4CDRA 1ITZA 2JLAA 4ZTUB 1J8MF 2ID7A 3RAGA 3UJCA 3J80A 4XX0A 3IMFA 4A73A 1SVIA 1NJSA 2QKYA 3FZNA 3A4MA 4K6FA 3A4TA 2X5NA 3H7IA 4L7QA 2R44A 5DMHA 4EGSA 3DW1X 3PUHA 2W6IA 3AHGA 5C8VA 1YWGO 1K8YB 2ZRJA 4IUDS 3PC6A 1UK7A 3D2CA 1CZOA 1QS0A 2WKQA 1WF3A 2YVAA 5J5AA 1UBTS 3TXAA 1RCTE 4WKCA 2F3QA 1Z17A 2XVYA 2XWPA 3UGTA 1WZEA 5B37A 4D9BA 4MLCA 1R66A 2H8KA 2XTAA 2CCGA 1DC6A 1P2SA 3Q12A 1MB3A 2EDCA 2X3YA 4ZCLA 2G17A 1JG1A 5ELXA 1V0JA 1GGVA 3RU7A 1EHYA 1X8LA 3AMVA 4FOPA 2BFBB 1QHFA 4ANFA 5C5DA 1EX7A 1YZTA 3AESA 5H8WA 4YV0A 1WY5A 4US1R 3G2HA 3LUKA 3UFBA 1KFBB 4UAVA 1TCAA 1R8QA 3JYPA 1Z26A 1YFZA 2YR0A 2V45A 3FPFA 1CW2B 2IZ0A 4OP3A 4AKHA 2HOQA 3PD1A 2AFIB 4X90A 3L4JA 3MRSA 2ASEA 1TX4B 1VPVA 4ZODA 3M3PA 1Z2DA 4FZJA 2YW9A 5CEJA 3BE4A 3PLNA 1C9EA 3QENA 1T4CB 4JT8A 3FCOA 3IBTA 4UD6A 4DVGA 3SS7X 5HM6A 2H59A 3KS9A 1GHTA 1OWOA 1Q1AA 4GLOA 1AY0A 4OHZA 1RJ9A 3QH4A 3HN2A 4CKEB 1X7ZB 1B0UA 1DIAA 1JQDA 4GR4A 1L2TA 2AOTB 1H94A 3CRVA 3IVGA 1C9JA 5T5QA 4EYKA 3GPCA 5A4FS 2FX3A 4LYAA 5I6DA 1UPTA 1Q0ZA 1PFQA 3SHWA 3GB9A 1NFFA 2I71A 2VRBA 3ITKA 1A95A 4K9NA 1CERA 3BCHA 5BYJA 3KC2A 3R5SA 2ZTVA 2OO3A 5DI3B 1HLPA 3T7SA 3B9RA 2IPOA 2Q1YA 1EPUA 1YUBA 1XU4A 2CLMB 3G8BA 3WYDA 2ZUEA 2GB4A 3G6KA 5EP1A 1JDTA 1P2FA 2GVNA 2QD3A 1K3TA 2GXSA 1TADA 3C7KA 3ZE0B 3TZHA 4DBLE 2JNWA 4TT3A 3A25A 3GXBA 4JITA 3U0VA 2JAWA 5C1DA 1YJQA 1UZUA 2CXPA 3GVIA 2HR1A 2MU1A 4WCFB 3GBVA 9ATCA 1GSIA 4N3BA 4X20A 3RS4A 3EZ6A 1YA8A 4MJ3A 5AOVA 5CTAA 3UMGA 4S1TA 5CG1A 4HDQB 4TV8B 4QBGB 1NBWB 1C7EA 1YKSA 2NPFA 1UPAA 4B09A 3KV3O 1U1IA 3D4PA 4HWTA 2BJWA 3JYNA 4MR8B 1IOLA 5EUQB 2QLMA 1SBHA 2QD2A 4H08A 4OK3A 2QQ5A 3NNDA 4Y0NA 2ZAMA 4DA9A 4EJSB 2XYHA 3GNTA 3AHIA 3U16A 3CYFA 2Z3VA 4K05A 4KR3A 1M2GA 3G59A 5DBHX 2V4MA 3WK4A 2EARA 1BC5A 4LDZA 3PB3A 3JCZA 3KT6A 2C5LA 2OV3A 4TN5A 4HG2A 4TVKA 1EH5A 3DOCA 4J4BA 3I2GA 4P4UA 1M5UA 3ANNA 1DUIA 1F8UA 1THZA 3QM1A 4MGZR 4L5AA 4BO2A 1KMHB 4D3DA 1F2TB 1PWYE 3EMBA 3Q2IA 3PR2B 3CUWA 2WAMA 3HUUA 3BHIA 3L7MA 5HG0A 4CLEA 5JEDA 4Q3CA 1SB8A 2PUGA 4LJRA 1TZCA 3RLFA 1PHRA 2WWGA 2Q6IA 3BVPA 5EGNA 1Z08A 1HC7A 3RADC 1UP6A 1FXWF 3I1JA 4NXMB 3NTLA 1H8HA 1MG0A 2HYIC 3QIAA 1WIWA 5FL3A 3TQQA 4NNOA 5AVQA 4MPDA 5BWMA 1NXWA 2XH8A 1TA0A 4YJFB 5KNDH 3OCYA 3J81A 2XOKD 4PTYA 1DBIA 1KI7A 1L5MA 1PL8A 4RIFA 1XTPA 3EMKA 2GBIA 3FZEA 5T3UA 3L6BA 1GYRA 1I7NA 1VC2A 2DFKB 2PTHA 3KELA 4WOKA 5F33A 1RWNA 2ZREA 4IM7A 3UC5A 1H2FA 5FWXA 4NBWA 5EE9A 3ZW7A 1P5RA 3JQRA 3B5IA 4YJ3A 5FBHA 4EF5A 1LVGA 1L8LA 1XZJA 2C82A 4I5DA 4IJVA 1KKMA 4MUFA 3UW3A 4J16C 1M2OB 3I45A 5L3QA 3M5CA 4RPLA 1PT5A 2C1ZA 4AJNA 4P7GA 2QD4A 2BGUA 2EG5A 3UJHA 2J48A 4HQKA 3QVWA 4MW9A 2PUWA 1G5RA 1YNOA 3EGIA 2HSWA 1ZFNA 3W8RA 4PVCA 5CEEA 3M9LA 4XUCA 4Z53A 3K9CA 4YT4A 1VHJA 3SDSA 4LRUA 3JAMA 2WWIA 1GRRA 1E0AA 3ZUGA 2O7RA 1QZXA 3VBCA 4DY4A 1P29A 5LDHA 2Q2QA 1E7RA 3EXFA 3LS2A 3EUFA 4NONA 2F8SA 3FYTA 2G80A 4E4RA 2IK8A 3KDSE 5LQKA 1IHOA 1TM1E 4XE5A 5B30A 5ALLA 4YPVA 2WYUA 5IABA 1IG0A 4A27A 3B78A 3X2SA 1PD1A 5U9CA 1T3HA 4YV2A 4JB2A 3FOWA 2ZITA 1YONA 3PXUA 2BBWA 2P2SA 3EXAA 3G7UA 2HLNA 5FBRB 6CHYA 4PAWA 1DEOA 1FNBA 3NATA 2D1FA 4IFEA 4IOMA 1OC4A 3DV0B 3C8ZA 4OQ4A 2ZUDA 3UB2A 6NULA 4ZVVA 4JBGA 1SOUA 3EQ9A 3MD9A 3LYLA 4NZPA 4RHCA 4CM8A 5DKFA 3WGYA 1KYYA 2HBYA 2ZUUA 5B2ZA 4MKHA 4UUBA 3VR6A 2A3NA 2OHXA 4L22A 1G60A 1HT0A 4PINA 5BWOA 1NIPA 2VNKA 4XVRA 3ZBPA 1B74A 4MRMA 4MYTA 2OESA 1JHQA 4XIJA 3T7IA 3W77A 3IOMA 4YP6A 3N8IA 1DUVG 4GECA 3NH6A 1Y6ZA 2PWZA 4QFDA 3HCWA 4UEKA 4EHAA 1AQUA 3QK7A 3V1MA 4KI7A 1XTRA 4MV3A 1XVVA 4G8BA 4B35A 3G5AA 5C1PA 2WILA 1ZJ5A 2WMNB 1QDEA 2EJBA 5FPSA 3VR3D 5L51A 16PKA 1HTBA 3L92A 5I4KA 1XMQB 4E31A 2O8CB 4Q9HA 4ZN6A 5KTTA 1E4EA 4OXRA 1Z25A 2JGEA 5D86A 5AI0A 1Z7GA 3U4GA 4G37A 3G9TA 5CYGA 5JZBA 2O2YA 5BO5A 3IVXA 1PWHA 4RJLA 3DMTC 4JC8A 4JBXA 1ICIA 4PG5A 3B1WA 4HH3C 4N40A 3B7PA 4KQ9A 3KVRA 4CWAA 5K0SA 3GDWA 4AWXA 1UAGA 1LLQA 4HADA 4L9RA 4D02A 1SZDA 1TKBA 4PRYA 4R6XA 3C6KA 2GCGA 2IITA 2IPMA 3E6AA 3U39A 1E18A 3C16C 2FNAA 5DK6A 1WDLA 1NHGA 3A3YA 1PVOA 2Y1GA 3TDKA 4PC7A 3HA5A 2A14A 1KK2A 5A2QA 2Y2UA 4KK4A 3AKEA 5CGQB 1Q1ZA 2KPOA 1LRLA 4L78A 3HP7A 1SC3A 2O6LA 3M9WA 1XRQA 1RWXA 4WA7A 3SHQA 1QCCA 1GD1O 5EIFA 3WISA 3WL5A 1QSGA 5JQGA 4BCCA 4LHZA 4K0KB 1VPEA 5JZ9A 4Q1AA 2W7TA 2XNJA 4XB6B 1BU8A 3SKXA 1TAQA 2P1ZA 2I1QA 4PNEA 1Z6GA 5DIFA 2ODWA 1J09A 4DLSA 4URVR 1DTSA 4MPRA 4B3XA 2C3MA 3TMKA 4NPCA 1Z8FA 4JIGA 1G21E 3IVCA 1H22A 4QYWA 4FEGA 3EF1A 5B3KA 2IL1A 3MXTA 2IGBA 3KPWA 2IHKA 3AIKA 1CR2A 1NBAA 2EIHA 2JCBA 3C8HA 3WMWA 4DA0A 2QRHA 1IOWA 5BNWA 3HVHA 2FGJA 2JLYA 3R8CA 2HO5A 2PKCA 3A3NA 1ZUIA 4L6CA 5I7UA 5B3AA 2MSLA 3NBFA 1Z6PA 3D8BA 4B79A 2ZJZA 2K4MA 3A1NA 3E5HA 2F62A 1A04A 2H0RA 3LJKA 1YK1A 3FUCA 4B3JA 4R7GA 4QELA 2WWTA 4KWTA 4WASA 1P2UA 1C1DB 4XEUA 4DMRA 3WBBA 1YBAA 4MULA 2BFMA 4N3NA 1CHNA 1NQVA 3CVJA 3DMPA 3EG9B 4IY1A 2ZTHA 1U8UA 4ZPJA 3V4VB 2VUUA 5B7QA 4I3GA 1J8VA 2R7MA 4B2YA 4JHXA 3GVPA 4INZA 3UKDA 4WK4B 5LBUA 4I1PA 5LR6A 2H18A 2TECE 1IEVA 2ZBGA 1KJIA 2G9UA 3KWJA 3PX3A 3BMNB 2Q1XA 1CWUA 4R2XA 3MOSA 4MVJP 1X3LA 5DXJA 3LY8A 2ZJ0A 2BHLA 1X80A 2M1XA 2ZT6A 4BAZA 4KTVE 1ISHA 3FNHA 4ENQA 2JVJA 5LZ4A 2XDQA 2RGAA 1M1XB 2GTPA 2WSSA 3BM5A 3PGMA 2XAAA 4U2DA 5AW1A 3UGQA 1I36A 4ZYXA 5BW5A 2MYUA 3L6EA 3LHDA 3Q3VA 4E33A 1I4LD 4DCCA 1T5SA 1E2QA 1N8SA 2PUVA 4Q9KA 4RADA 1MC1A 3V5NA 1PJ8A 2HHHB 3GRYA 2CUKA 1UJCA 4KVZA 3GGPA 4JLKA 1J2RA 4CW7A 4KV9A 4KXVA 3NIBA 5H1YA 3IP7A 3TLYA 4BVHA 4CLDA 1FVOA 3KCNA 2JPDA 1UDBA 4F2HA 5I51A 4MIEA 2QG4A 2PSEA 2FPLA 1T4MA 4FUTA 3C24A 2AXEA 3DXYA 4D6PA 2EX0A 3N2YA 5K05A 1RC0A 3X1ZA 5EQDA 1DQPA 2WG1A 4GT1A 1WUHS 3QOXA 4ZGBA 4F86A 4P7BA 4PR3A 2UXBB 2C4KA 1FQJA 1OIWA 2JIPA 2PZFA 1F2UA 4TLDA 2AI1A 1SVWA 5FBQB 5GY7A 3ZE7A 4GR9A 3SDBA 5FWNA 2J9YB 1JI3A 5DHUA 1O57A 3H3JA 3WHPA 4AYTA 4XWGA 4JUFA 1GSAA 4BMOB 3FYHA 1NR7A 2DUWA 2G70A 2QB5A 3T99A 5B1EA 5AVTA 3LV8A 5FUYA 4JN6B 2XNKA 4H35A 2MINB 2HUPA 4PEVA 1RPZA 4DPLA 3GRFA 4LF9B 5B2FA 2J3HA 3EDQA 5CFRA 4FX5A 2ZJ4A 4CN8A 4M9CA 3G2LA 1MH1A 2OAP1 5CB4B 3PUWA 1TMGE 1ABEA 2VJOA 3JZAA 2AFIE 4UUQA 1Z62A 2AR9A 1DKLA 2Q3BA 4GICA 3W5BA 5JBNA 4D2IA 5H9WA 5KYUB 1JDPA 2PTGA 3T5AA 1ZVMA 2QUJA 2XQIA 3CZPA 4REOA 1U1GA 1W6UA 4TXMA 4NENA 2H1VA 3GT4A 1H5QA 3T0FA 1JPUA 2Y71A 3B3GA 3NX4A 4JSYA 1DWOA 4MQBA 3A6PC 4GKJB 1E2BA 2D59A 2W2VA 1F8XA 1XNHA 2QE7A 1XJQA 5LQSA 2E4WA 3MBIA 4ZCQA 3ZK7A 4CUKA 4GL2A 2JLBA 3GCZA 3OZTA 5F2KA 4JVMA 3QUAA 1V6CA 2ZM6B 3VXKA 2XZLA 1OYOA 4IWYA 2O52A 3O47A 3JYQA 1C0PA 3E9EA 5B1YA 3H5TA 3DEJA 3H17A 5TJHA 4W1RA 4IIVA 1TKAA 3RFUA 1AIPA 4U9HS 1OZHA 4RA9B 4DZTA 3KTDA 3W5JA 1DDIA 2HXGA 4NBVA 1G20B 1P81A 2NQ2C 1Q15A 1SXGA 2GNPA 2XNSA 1I2ZA 2X1VA 3AM5A 1PNTA 3WRVA 3LLCA 1QZ3A 1WQ3A 2AHRA 3AUJB 4Y1RA 3ZDAA 5I9LA 1CUBA 2KLBA 3INRA 4E5KA 1Q3TA 1KDPA 2Z9CA 2J9ZB 3K30A 5FYQA 3KSBC 4KR2A 2BZGA 5CBPA 5CCEA 1ZD3A 4CM3A 2RK6A 1AH2A 4CXMA 1BQ3A 2R7AA 2Q8NA 1NJ5A 1NC1A 4NMMA 5AHRA 1L5ZA 2DBVO 1K2VN 4LZPA 1UDCA 1U7WA 4GDMA 4TM7A 2HPAA 6YASA 2Q9CA 3LSTA 3TIVA 4MX8A 1N2EA 3GFOA 4ZQGA 3W5DA 3T9BA 2I6FA 1I2MA 1KI4A 5JASA 4JJZA 1YDMA 1GUFA 1O4WA 1T2NA 4MWGA 1OH8A 1R0ZA 4PQGA 4ZVLA 4OOFA 3NAMA 4KQFA 4PN7A 4W82A 5I7AA 1EFPB 2VJDA 5FQNA 1IM5A 1KU6A 2LR0A 3IDSA 3UHJA 2QTBA 1T2AA 2RI6A 1H6BA 2WI8A 2PZKA 4NCKA 5K0BA 3MXOA 3ROKA 1RLMA 3TN7A 3MMXA 2VYQA 3OPNA 1NMQA 4HP8A 3WBJA 4EB8A 2ACVA 3I5UA 4IWXA 1M2VB 3EZYA 1J1UA 4HFRA 4D3XA 3IULA 1N2CB 4RTSA 1ZIOA 2PKXA 3FNRA 2JEYA 4M22A 3M6IA 3WLEA 4EHBA 4KWCA 1QGZA 2FCRA 4B6EA 1V11A 4QJ4A 4J1QA 4O2RA 4Q6WA 4XD2A 3VPXA 5SY9A 4ZOQI 1E2JA 4J16A 4W9RA 3ZVLA 1H1DA 5AESA 3N0WA 1JLMA 1ZOLA 2BKVA 5ALKA 3IXQA 4NAVA 5FA8A 5TQ0A 1V3VA 1N3LA 2I4MA 3FFAA 1G7RA 3NGMA 1UMDB 2ECOA 3UOWA 5FQOA 3VDXA 4EW6A 2ZYGA 4EJFA 4MMYB 5A3VA 3QP9A 4YRBA 3L41A 2FFAA 3KIPA 5FTNA 3TRFA 1NF2A 5EJEA 5EY5B 1XQYA 3KXLA 2MDTA 1YAJA 3OT1B 2XUHA 4MV1A 1CIJA 2Z4SA 4M46A 2UYYA 4Q7KA 1ZY2A 4UVGA 2ZU0C 4IO1A 3OJLA 4IOJA 4GP7A 5FEUA 3PRJA 2AG8A 2PQ0A 3O2SB 4LCJA 3G5UA 1FRZA 3PHLA 5FI1B 2BW0A 1C50A 1ESEA 1JHYA 3FBWA 2J9FA 5CLGA 1I3MA 2R8YA 5G1PA 1WBBA 2GPWA 4I5GA 1K8ZB 3IV7A 4KI0A 5A6VA 1Z7YA 5D5PA 3WLHA 4UOQA 1TIBA 1L4UA 3QUTA 4PIPA 2CC2A 4ER5A 1NLMA 3CEHA 3AI1A 3DM5A 1DJMA 2XYQA 1FXWA 3UWMA 2P9CA 4XJVA 1RR6A 4BMSA 1UUFA 3WK5A 2PPLA 1NBMD 3GJ3A 4N3GA 2JKVA 2D1QA 1GP2A 1W0KA 3DL0A 1HQDA 1R18A 5FP0A 3FBGA 4P36A 1P91A 4WXHA 3G0IA 5DLDA 3TLBA 4YCNA 3LUDA 2Z09A 4AURA 3K0FB 3PEWA 4CKYA 3Q5EA 1OWPA 4QE3A 4ENSA 4UJ5A 3ZDYB 1XU7A 3B2NA 2RH8A 4F46A 3AEKB 2NPOA 4RTKA 3HCCA 4HGNA 4ZVKA 1RQGA 1TZJA 4BC0A 4DNFA 2OQ2A 4HMOA 1H65A 4PG4A 5EMJA 1DKQA 2FHSA 4HDKA 2KB0A 4MRPA 2DFVA 4JUIA 4HEA6 4UU0A 3H04A 4FDMA 4J3JA 2WWVD 3VNQA 4P54A 5D6NA 1R5JA 5DSTA 1GOTA 2F1RA 4YEDA 2D5IA 2J85A 2KQUA 4FE3A 4GC9A 3BTUA 3F3MA 3KYCB 2AJTA 4DV3B 1KEPA 5FUMA 2VH1A 3C3BA 1AKNA 1LBHA 5HIMA 5REQA 3EULA 4EW3A 3R9WA 3VPSA 3JWHA 5EKTA 1XZIA 3LOUA 4ED9A 4LBVA 5D3MB 5EUMA 2ODTX 3DMTA 3VYWA 2V3VA 1I7PA 1XTQA 3WO0A 1MZPA 3WVNA 2QX4A 3PD0A 4PSDA 1QFMA 1AXRA 1TNDA 3GUHA 1E7QA 1YBFA 2NSLA 2ZJ2A 1UINA 2GM9A 5JAZA 3SC6A 3RF7A 5AW9A 2QNRA 4DT1B 1EUDA 5B58C 1FC0A 1AOXA 2N1MA 4FWBA 3HN7A 4GX2A 1YQQA 3H1FA 2PD3A 5IJAA 3FMGA 6ADHA 1WZNA 1KJYA 1JLKA 1QGOA 1YQTA 1RJEA 2AEFA 2ZKIA 3EE6A 3PGKA 4NBUA 3QWBA 1SR8A 3CRMA 3K1ZA 3ZX4A 1UBJS 4EI7A 2AFRA 3NMUF 1FQWA 2EBFX 4V0QA 3UBTA 3VPCA 3AKYA 1BSVA 1W85B 3JS5A 3IIMA 1T2VA 1G21A 1RJWA 1K7EB 3GLIB 3Q15C 4OIFA 1PLKA 5HOQA 2UVQA 4Y2TA 3OQ1A 1EUQA 3HE3A 2C7RA 3RAEC 3MINA 4YONB 4RAQA 3RAFC 3P27A 3E27A 3C41J 3KKZA 1N2JA 2POCA 3I9KA 3OFKA 3GJ4A 1J2JA 1XCOA 3QW2A 2BM9A 4CF3A 3U13A 2WWHA 1MQSA 3KLBA 3JALA 3N3BC 4E11A 3BE5A 2Z08A 1TMKA 3TSOA 5KYGA 4BXOB 3OT5A 4MQEA 1G59A 2C0QA 2YN0A 4Q1BA 2PL3A 2OZEA 4ZQBA 1VFNA 5IUKC 1TJNA 5AD1A 2J6BA 4YGYA 4E03A 3EPKA 1X7XA 1T36A 4HAVA 1QMGA 4HX2A 1N75A 1YZQA 2WTXA 4HBZA 4I4LA 3R7WA 3WWPA 1AGNA 1P2TA 5A0VA 2QQGA 1JVSA 4RD2A 3W9YA 2C8VA 4CNQA 1U81A 1M6EX 4NTZA 2C2ZA 3DAHA 5LWQA 2PX3A 4X65B 4WUVA 7GPBA 3PFGA 4F8EA 4AZ0A 4EJ2A 4INAA 2WQ7A 1KP3A 4AZTA 1JWBB 2HO4A 2PHZA 5JPDA 5LQMA 3IMGA 2RK3A 3KAJA 4UAUA 5FB3A 4UCXA 1NUQA 4BRWA 3IS3A 3FDIA 5LXTB 1MB9A 2NU7B 3L0BA 2EGGA 4IIGA 2QGNA 1B1AA 2HSEA 4JSTA 4Q48A 2CVFA 3H99A 3M5WA 4RK5A 3TLXA 1W0JA 5KJCA 1S2DA 2O54A 1KORA 5J2UB 4WQMA 4E21A 3U3XA 2EFEB 4OQNA 3QVXA 5C81A 2Z2XA 3V1UA 4ZI7F 4DUPA 2JGIA 1X87A 2P9GA 1XU9A 1LBEA 2GLTA 3LHKA 3OWXA 5HZKA 1QRAA 2IVZA 1PDOA 2WTEA 2NXJA 1DX6A 4XCVA 3EQZA 4TVSA 4J0IA 1LQUA 2MSNA 2WC1A 2Z43A 2WFMA 2XB4A 3PQ8A 4GI5A 2DERA 1RRMA 4OM8A 1EJ6A 3CSSA 2GKSA 4C0LA 2A6PA 5DLQC 4WKPA 2VXBA 4M99A 4MMXB 5AKHA 4LYFA 2VHCA 2H7YA 5F2NA 3NAZA 4FYKA 3QLUC 1PO7A 3E0QA 4QQFA 2W6OA 1YR9A 1GVNB 1JG6A 3NOXA 4V1CB 3IAEA 2DAPA 4PXAA 2BKEA 3R6LA 2P30A 5HEKA 2W6NA 1DKUA 1KK3A 3VPDA 1AK2A 2A5JA 1BMFA 2OPBA 5KKCA 2K7FA 1BYIA 3ADCA 4YT2A 2BFBA 3IEVA 1XJWA 4MDHA 4XVHA 4YUWA 1ZHOA 2WF9A 4N7MA 4GIBA 2HWUA 1Y3CE 3I9MA 1BGXT 3KKKA 2I7CA 2K7ZA 5GJBA 1OLOA 3BWMA 4Q4JB 3VYRB 3X1YA 1KWGA 1XMOB 4I50B 4TMYA 3MPUA 4CQMA 2OOSA 2C7PA 4MWOA 3PXXA 1U6IA 1IN1A 2O9JA 3O21A 1A5ZA 2HJWA 1T4CA 3AY6A 3PIDA 4JYPA 4NS4A 4XX1A 1SKMA 3I92A 4HY3A 1DKPA 1UXGA 3A1FA 3ST7A 1ONOA 3NPMA 3ODGA 4CKEA 1X7ZA 2EFJA 4N41A 1Q92A 2DLNA 4G2TA 3NM5A 2NZWA 2AOTA 3NHYA 3H18A 3MTAA 1ULTA 3RSHA 4MPTA 4BKRA 4MHOA 3CX4A 2HNKA 5CVEA 2BZ0A 4DJEC 3SIPA 2PL5A