1MO5A

Reca-atp-gamma-s-mg complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
317
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RecA
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 81
structure length 317
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo5A01
3FKSA 2CVHA 1TQ2A 1ZINA 2P5SA 2ZJ2A 1QHIA 1TTTA 3R20A 3ADKA 5TV2A 4RZXA 2J9RA 1A82A 3AKDA 4L9SA 1N6OA 1ZNZA 1OLOA 5KOYA 3CIOA 1EFRD 2CDNA 4R98A 1ANKA 2ZI7A 3DEFA 1K6MA 3SHWA 2BBOA 3ZD7A 1ZC4A 1NMXA 2GZAA 4URXR 3HR8A 2GKSA 2XJ9A 3DZDA 4TWZA 2E1RA 4HAWA 4XOIA 2REOA 3RLFA 2QTHA 1VHTA 5LPNA 3KTAB 4I99A 5EQTA 2ZS8A 4JJKA 4D6PA 4YMVA 5FTLA 3MJHA 2J7PA 1RE0A 1W36B 3PQCA 5JFGA 4YDHB 3OIWA 1SHZA 3ZZ0A 1FMJA 2ZRIA 3Q7QA 2GXSA 4DDUA 2J0UB 2PEYA 3LAWA 1LV7A 4O25A 2FZLA 1XCMA 3K9NA 4RD1A 2AL7A 4TN1A 2QNRA 3LLMA 4Q4AB 5M04A 1AKEA 3RNLA 4XWOA 1ZCBA 4TZ0A 4EPWA 1TQ6A 2C8VA 1N2CE 4JL5A 4LBWA 4GDFA 1H65A 2R62A 1GVNB 1VCMA 5DGXA 5EP2A 5TVKA 4HLDA 2ZRAA 4CYMA 2Q3MA 4RZ3A 3VU9A 3B7GA 3GLIA 1D9ZA 5FBWB 3Q3JB 4US1R 1UAAA 2FSIA 1NIPA 2QRNA 5B57C 2YNMA 3GJ4A 3N2EA 3E5HA 4DHEA 1UKVY 1MO5A 3NBFA 3N70A 4MRNA 1VG0B 2JLVA 2GESA 2GRJA 2IF2A 1E79D 2GCOB 1W46A 4N1AA 3SJBA 3C16C 1W2HA 4L15A 2ZVPX 3FPAA 1WQ1R 5FOTA 1SZPA 3WRXC 2QBYB 5FR1A 1AKYA 3UANA 2FFQA 3G0HA 1KHTA 3MWKA 5EZ6B 2ZRPA 3ZGXA 4MGIR 5AJVB 4F38A 4ZCIA 2NIPA 1ZIOA 1BMFA 3GJXC 3VHXA 3R7WB 1E69A 4LHVA 2CXXA 2ZQ5A 1TPZA 2WJIA 3HYRA 2N42A 2EFGA 3UXMA 4IFEA 5FTJA 3X1YA 4M1KA 4Q4LA 4TL8A 4XIGS 3RAPR 2IYVA 4KO8A 2PL3A 1J90A 1XD2A 1IY2A 4LX0A 5D3MB 1A2KC 1NBME 3PUYA 2MSEB 2WJJA 2CVFA 2F3TA 4XTRA 3CNLA 4CEHB 3KQUA 1DARA 5FBQB 4LHYA 4RY2A 1Z2CA 1KK2A 3HU1A 4BZXA 4H9GA 3MAAC 3VAAA 2J1LA 4WXRA 3CWQA 3AF1A 3VKGA 1DTSA 2ZI6A 4XWKA 2VSOA 3KUDA 2BCJQ 1OHHA 1I2MA 4C2UA 3ZVMA 5FOWA 3LFUA 2PT5A 1NN5A 3U2QA 4A6XA 2WWYA 4TZ6A 4HUTA 3I1FA 2NPFA 4IOMA 1AQYA 2FOLA 1NBMD 3QI2A 3BFKA 3PEYA 4D4JA 2C95A 4DCNA 3E2IA 2JJ8A 1N5JA 2NG1A 2H1LA 2QY9A 4OHVA 4B71A 3IEVA 2OE2A 3C41J 3TW8B 4PSAA 1ZM3A 1X86B 3W3AA 3GJ8A 3GLFB 4F93B 3K53A 3TR0A 3K70C 5L3SB 4FMBB 1YZNA 3CM0A 4M1SA 5DE3A 4JYBA 4MYUA 2IWRA 4PO1A 4A15A 1OXUA 2ATXA 5G40A 5HE9A 2ZRMA 1QHYA 2QEQA 3PEWA 3L0PA 5KSPA 1BS1A 1W0KA 5C1BA 3WNCA 1VMAA 2QE7D 4C4PA 3NG1A 5EXXA 2P67A 4DLYA 2JLQA 5J4YA 2FMXA 4JLDA 4OQFA 4EJSC 1WRBA 4JIMA 4JMPA 3C15C 1KK1A 2AHOA 4PQRA 1NJGA 5EZ5A 4RD3A 3DVLA 3M6AA 4P3YA 5LDDC 2MMCA 2KE5A 1WB9A 4XWAA 4ON9A 3HPRA 1G19A 4QHTA 4DLVA 3KB2A 1OIVA 3GLHB 1EWQA 2OFWA 2IYQA 1GILA 1RZ3A 3SC3A 3ASYA 2D7CA 2YVUA 3VR1A 4B3GA 1GZSA 1A2BA 1Q1QA 1B0UA 3EPJA 3IPXA 2EFEB 3EPHA 1KI4A 1T0HB 3KKNA 3CO5A 4IW3B 2C9CA 1R8QA 3LLUA 2JLSA 2O0KA 1Z22A 1KI6A 3K0FB 3V00A 4P31A 5AWFC 2H8KA 2I1QA 5HKKD 1OFHA 4B74A 2O8CB 3L8ZA 4NZYA 3GJ3A 3B13B 3DOEA 2B21A 4TTRA 3TLXA 2XNDA 4MDEA 1P61B 1KMHB 5DO9A 4JLBA 4DCTA 4AI6A 2QQEA 1DO2A 2FFAA 4PC2A 3OIVA 3MWYW 4JVNA 3T5GA 4UNRA 2ZITA 4D2IA 1W48A 5JJIA 3QNUA 1FTNA 2D62A 3AGPA 4TYYA 1WXQA 2VA8A 3TUIC 4A8JB 2ASEA 1ZM9A 2BEJA 3LH5A 3PUVA 3AVVA 2N1BA 2ZI4A 1NKTA 1Z83A 3RSOA 3KXIA 4EPXA 3CW2A 4LJ7A 1S9DA 4KJZA 3V9PA 1KJZA 2P6NA 3IIJA 1CLUA 1VTKA 2GJAA 1E9FA 4G5RA 4H1VA 2X1VA 4TT3D 1GUAA 4K46A 1KDRA 1Q0UA 2FEOA 1HE8B 5FBLB 1A7JA 3U7FB 3DHWC 4NPHA 2ZAOA 4GP7A 1XXHE 1QHSA 1Z2AA 1JXOA 4JSYA 5UKDA 3QKRA 4KSCA 2J59A 1VHLA 1GOTA 3SHFA 1JXMA 3ASZA 4HUQB 2CCJA 2X2FA 2V9PA 3CZPA 3SJZA 1ZU5A 3G82C 1AA9A 4M0LA 4A4DA 4GOXA 4C0JA 2FH5B 1J2JA 1OXSC 3KKQA 4C3ZA 2R6CA 1R8SA 1NSTA 1TMKA 2FSHA 3BIFA 3DDCA 2Z43A 5JSZA 3HU2A 2I1VB 5AK0A 1Z29A 1XMVA 4TTQA 4C7OB 1F3OA 1QRAA 2MMGA 1TU3A 4BQSA 1CBUA 4IDPA 1S96A 4KV9A 2J45A 1M1YE 4GOJA 121PA 2AX4A 2ERYA 2ZVQX 4D25A 2QMUA 3GP8A 5J40A 1Q22A 2OV2A 3EA0A 1AGRA 2WOJA 1Z28A 4KFRA 4YMTA 4IVPA 2H57A 4FIDA 1H8HA 2ZJ8A 4IEIA 4W5JA 4M1YA 1UBCA 5CK5A 4HAVA 2ORWA 1M7BA 1SVWA 1YZKA 3ZYCA 4W5HA 1JI0A 1NMYA 2ZI9A 1W47A 3BS4A 5JHGB 1CEEA 4YMUA 3FWYA 3OEHA 3FFBA 3B2EA 4D80A 2CMKA 4EDHA 2OM2A 4DSUA 1NG9A 2C5LA 3NC0C 5LD2C 3THWB 3QSYA 2YWHA 2ZRBA 2IEZA 2GILA 2BHRA 1E9CA 2W6JD 1X8LA 1SKYE 4ASUD 4KITB 2GEVA 4R71A 3C14C 1OYWA 1U9IA 2EFCB 3KDSE 5KO2A 2V7QD 4Q9IA 4PPQA 2C78A 4ZIRA 2ZJYA 1W44A 3BJIC 3GLGE 1SXJA 1R5OA 2GZHA 5J4KA 1UKYA 4U00A 4ZI2A 4KFTA 2ZSAA 2GXUA 3H2YA 4LBYA 1PZNA 3REGA 1VG8A 3MLEA 2IA5A 1R10A 3SQWA 5GJBA 4FWIB 3NH6A 3WXMA 2V55B 2VP4A 2BM1A 5CM9C 3LXXA 4QG7A 3TUZC 4BLOA 1YJ5A 3ADDA 4LDJA 2R8RA 1NY6A 4Q66C 1T3HA 2IEYA 2G88A 1UM8A 1EFRA 2NQ2C 3BK7A 1R7RA 3ND9A 2C9OA 1E4VA 2XTNA 3IEUA 4NYJR 1FOEB 1Q57A 2HF9A 1M6NA 4ZI3A 3UATA 3VHLB 3TVTA 3AF4A 1DAFA 2F1HA 4LHXA 4FW9A 2O8FB 2VSFA 3F5FA 3CRW1 4ILEA 4AYTA 2XJ4A 1DOAA 2C2HA 3B60A 4US2R 2ZR7A 2ZS9A 3MSXA 1QHGA 2X77A 1MOZA 1E1QD 3RS3A 1KSGA 5KNCA 4URYR 2EVWX 3QUSA 2ZIAA 2IYRA 1KO8A 1OKKD 4DBLC 1CR2A 1D5CA 4F4CA 1E94E 2F6RA 3RRMA 3BB3A 4OHXA 3W5IA 3T35A 3MWJA 2G77B 4JLPA 5AJZA 3EPLA 4BZPA 2RHDA 2ZJBA 1UKZA 2ZI5A 3UPUA 2HXSA 4OK6A 1XTSA 4F92B 4TYNA 3H0KA 3RABA 2RB4A 4B32A 2QPTA 4B34A 4M9XA 5FOSA 5EE3A 1DAGA 2IYXA 5EJEA 5KSOA 2Q9AA 2O8EA 4WXPA 1W4CA 4MUBA 1KO4A 1GL7A 3SBEA 1WF3A 2AK2A 3CBQA 2D06A 5DISB 4IXMA 3EPKA 3U3OA 2DFNA 3RYTC 4HLUA 1Z06A 3UWKA 4OL0A 1U8ZA 1E0AA 4DB4A 1XX6A 4M9SA 3QXJA 4GT1A 1NVUQ 1E2GA 2ZJOA 5BN3A 3P4XA 2QP9X 1EESA 2OO7A 1JJ7A 3B6EA 3VKHA 1II9A 3U5ZB 1FTSA 1SVOA 5CYPA 3R9WA 4LYFA 2DFTA 4JL8A 5CJ2A 4US0R 3F0TA 4F7WA 1NVWQ 1K8RA 4JVSB 4ARZB 3K0EA 4TTPA 2CHVA 2BM0A 4E5UA 1IXRC 3AVQA 3RHFA 1F2TB 1GTVA 1YR6A 3P1JA 2F9MA 3I92A 1ZUHA 2ZRHA 1FQKA 3T06B 2IYTA 5CDFE 2FGKA 2O8BA 1TX4B 2OILA 221PA 1KZ7B 3AVPA 4OBEA 4U7DA 1G16A 2CEAA 2XX3A 2CL7X 2PCJA 1XP8A 2OXCA 3CR7A 4M9ZA 3FE2A 2OCAA 3TMKA 1YZGA 3KJHA 4YONB 3W6NA 5C2JB 4L5BA 1E2JA 2OHFA 2RKOA 4OK3A 3PUWA 2XTMA 4LJ5A 1K5DA 4RJLA 2GEDA 1IONA 3JZAA 4NYIQ 1AK2A 4A2WA 3I3SR 4TQ9A 2VSXA 4WZBE 4QNRA 3MUFA 4FMDB 3U3JA 2DFLA 4LYHA 4MH0R 3QG1A 1GP2A 1R0YA 2JDID 3U61B 4QBIA 2PX0A 3B78A 3ONWA 4HZIA 5EUMA 5AUQA 4URZR 4QJ5A 2A5GA 4I1SA 2IHBA 3LXRA 2G1JA 2W2TA 1IY1A 1LNZA 2R6FA 4LCBA 3OFNA 4RCZA 2ONKA 4HB4A 5H8WA 4DKXA 2IF0A 4V0NA 2HDNB 1RYFA 4PQFA 3TRFA 1GM5A 3WRYC 2RGBA 2K5UA 4PPGA 3NBXX 3PEVA 2P6RA 4IJMA 2BMJA 3LRPA 3NBYC 3AVYA 4AKGA 4B35A 3FB4A 2XB4A 1HURA 1KSFX 3GLHE 4PANA 4A92A 3SJAA 1KK0A 1NF3A 1ZMXA 5FUXA 1QHNA 4NCKA 2P65A 2V1XA 4TYPA 3ICQB 3QVUA 1JR3E 1KJYA 1S8FA 2OLJA 2OSBA 3A37A 1G7SA 4PFSA 1Z6AA 3T15A 1ZAKA 1N0VC 4M4SA 3PENA 3VTKA 1YZUA 3EC1A 2KI5A 2RAPA 3DM5A 3THYB 1M2OB 1I4LD 5HPYB 5HZHA 1T4GA 1ONBA 3RWOA 5L3QB 1N25A 5JWRA 3QEOA 1QF9A 2N46A 3FTQA 1P7CA 2JJ2D 2AFIE 1VCIA 2Q9BA 1AA3A 2VIIA 5SZIA 1TUIA 2W83A 5A5GA 5AJXA 4NMMA 3LBHA 4RZUA 4DCSA 1U9IC 3NDBB 1ZCAA 1JR3D 5B30A 4OI2A 1F2UB 3T1QA 4DLUA 2QAGB 4B47A 1L2TA 3NIBA 4PC3A 3T1OA 1SXJC 3IO3A 4OQNA 1F48A 2AD5A 4NYMR 1IN5A 3RS4A 2AN9A 3GEEA 4YMSA 1IBRA 5JI2E 3AKYA 1R5BA 3OE7A 4CT5A 1F6BA 1CRQA 1W5TA 2YV5A 3AUXA 1KJWA 4DIEA 1B23P 4GSYA 3ZJYA 2E87A 2XZOA 4IDNA 5D3QA 4OI0A 3K0AA 1Q21A 4MKIA 4Q9JA 1UJ2A 2P3SA 4JBWA 4NCIA 1XZQA 1BYUA 3S1AB 4P4SB 2YJTD 2XOKA 4HAYA 3U44A 4BFYA 2D74A 3C4JA 4WIAA 3KKOA 2FSFA 4UKDA 4LRWA 3TQCA 2GEUA 4I81A 5K8IA 3DMDA 4WZ6A 3SU8A 4MKGA 4JSTA 2WSSA 4AWXA 5CYOA 1Q3TA 5EXSA 2CHGA 3WBKA 4TT3A 4PHGA 5J47A 2DWPA 2W6ID 2RGNA 1IJEA 4B76A 4F4JA 5FL3A 4MRRA 3VX3A 4LI0A 3WYAA 4D4KA 3QG5A 2G6BA 2EYUA 1RVDA 2WWGA 4AY2A 1GL6A 2DCUA 2PT7A 2BMEA 2ZE8A 3AVUA 4W5WA 3TSOA 3LX5A 2VEDA 4B3CA 3FOZA 1ZM4A 2CJWB 2HLDA 3GD7A 4GRAA 2L0XA 1J8YF 4G5QA 2IT1A 2W00A 1HQYE 1P2SA 3LBIA 4XSHA 3WP0A 1DAKA 4BFTA 1A1VA 4BUJA 1SKYB 3QPWA 2WV9A 1GFIA 3FMFA 1ELOA 3Q8XB 3FFAA 4WA7A 2Z83A 3EZ6A 4A0FA 3LQRA 5FI0B 4CVNA 1Z8FA 4EFLA 3UKDA 4Q9LA 3L43A 4HLUC 1KO1A 1XXHA 1IXZA 4OQLA 2F1RA 5EUQB 2XGJA 2GDJA 2DBYA 2XEXA 4W9MC 3GLGB 1I2DA 2P6UA 1COWA 2FDCA 3VR5A 4M1WA 3AQ4A 4DUGA 4YXWA 4WAUA 2Y8EA 4X8LA 5EP3A 5EE0A 1JPNA 2VHTA 2ZSEA 3TK1A 1WE2A 5KSZA 1E0JA 4Z1MD 3O8CA 1XD8A 4D0GA 4RVCA 1JECA 4RD2A 4IOKA 5FUWA 1T0JB 5AJWA 3DOFA 2G0NA 1R5NA 4LJ8A 3RC3A 4BFVA 3WNBA 2IW3A 2PZGA 3OAAD 1SVIA 5IHPA 3CRRA 4Z8YA 4PHFA 3LW8A 4UJ5A 5JRZA 4LJYA 1KSHA 1T3LA 1SQ5A 1DS6A 1C4OA 4E22A 5TXGA 3T12A 1N6LA 1HT1E 4OHYA 2BDTA 3A4LA 3AP3A 3D7MA 3U4QA 5FI1B 2J7KA 4D26A 4QGHA 2QPAA 3ZVRA 3W6PA 5DN6D 2CBZA 5CITA 4KVGA 2FFHA 2J0VA 5DI3A 2D2EA 5EE9A 3B1WA 4P32A 3AP2A 2O0HA 2VBCA 2WPDA 2Z0MA 2GF0A 4G3XA 4EPYA 4DLWA 1SVSA 3A4NA 1CJVC 1G5PA 2CHQA 3NC1C 2V7QA 1KAGA 1E6CA 4BPBA 4EFNA 2F1JA 1ZD9A 3U6BA 1NVXQ 1O87A 3CX7A 1MO3A 4LHWA 4D82A 3EA5A 1NP6A 3ETLA 4EIWA 1AQUA 3SEAA 2RGGA 3QXHA 2W0MA 2R6DA 1E1RD 1NVVR 2H17A 2WSMA 2HF8A 1XJ0A 5FUVA 2BVNA 4ZCMA 1S1CA 2V6IA 4P0TA 2LWIA 4LV8B 3OESA 2EQBA 1AM4D 5BQ5A 3BERA 3GJ0A 5K8TA 1HTWA 3SDZA 3GLGA 4B33A 4KBGA 4BLRA 3MWLA 4R2HA 1DE0A 4B2PA 2A5DA 421PA 1IXSB 2UKDA 4GNKA 1AZTA 4TLEA 1ZUIA 3LVRE 4PSVA 1FZQA 4HDCA 2NO0A 1PV4A 5C4MA 3KL4A 2BBWA 1D2EA 2BIFA 3BWDD 2JAQA 4BE7B 3EX7C 1E2LA 3KTAA 4GMXA 4LJ4A 5BN4A 1NN0A 4LZZA 1J99A 1OKKA 2R65A 5BW8A 1KI3A 2JJ1D 5L3RA 3SYLA 3NKVA 4FINA 1W5SA 2IUTA 2C77A 1ETUA 3ZIAD 4B75A 4QHYA 4XVRA 2KBFA 1HH4A 1Z63A 4B43A 1ZM2A 3QVVA 3NTUA 3KQHA 4KCGA 4CEJB 2A5YB 2J0UA 2WWWA 4RKEA 1Z6XA 4V0LA 2QL6A 4BEJA 4MRVA 1MR3F 3VR3A 2CLDX 1Z07A 4Q4AA 4F91B 3DL0A 4XH9B 2AWOA 4TYWA 1UPTA 3Q9LA 4A0HA 4MGYR 4DSTA 3EASA 1LS1A 2OBLA 2J3EA 5JBQA 4C0SA 4NHOA 3A6PC 1GRQA 1IM2A 1R0ZA 2PCLA 2DR3A 2QUZA 5CB6A 5KSYA 2D3WA 2GXQA 3IPYA 2ZSDA 3FMOB 4WVFA 4CEIB 3D8BA 2J0SA 2GJSA 4Q19A 5AUNB 1NI3A 3A1WA 1CR1A 4Q4HB 4M53A 2CK3A 3TKLA 3DMNA 1KZGB 1G6OA 1XJQA 3TSWA 4RFSB 2OESA 4C9BA 3ZLJA 2GCOA 3TNFA 1RW4A 4XD7D 1MH1A 4BLQA 821PA 2QBYA 1UBGA 3KJGA 1UBFA 3I8XA 3T5DA 4FCVA 2UZ3A 5GJCA 2CLCX 1L4YA 3EG5A 2JASA 4QJ4A 3C7KA 4S2EA 1SULA 2YINC 4Y0AA 1OFTA 2ZRGA 2CNWD 2F3RA 3I4LA 4TMKA 5DIFA 3R7WA 1JEDA 3J81k 2PH1A 2VTKA 3K9HA 5FOVA 3I61A 3CR8A 3B1VA 2EFDB 2A30A 4QNMA 3QY0A 1WBDA 1G20E 2R6AA 3B1YA 4C0HA 2IHYA 1CF4A 4EPVA 2G0TA 1TL7C 2RGNC 4I1OA 1WP9A 1XRJA 4MQBA 3A1TA 4TSFA 5D3MA 1YVDA 1WBBA 4ZKDA 4EUNA 1CRPA 4R9UC 3A36A 4LK2A 4M8NE 4CEHA 1VG1A 5GADl 1IN7A 1BIFA 3HYTA 4GI7A 4UNSA 1YR7A 4V0MA 1U94A 4XJXA 4PC7A 1G7CA 1TADA 1E4YA 2OLKA 1CR0A 2ZSFA 5K8LA 3LY5A 2H7VA 5E7MA 2DY1A 4ITRC 1AJEA 3ZS9A 2WAXA 2CCGA 2YWEA 4LGMA 1OF1A 1GSIA 2FNAA 3M4YA 2BJVA 2NTYC 1KI8A 3IIKA 3B8HA 2LCFA 5G41A 1UDXA 1IQPA 5F9HA 1Q44A 3KFXA 3CH4B 2QMEA 1AS3A 3QOFA 1FL9A 1G3RA 1KMQA 3F8TA 2VHJA 4KSBA 3GFTA 4R7ZA 3GLFA 1X1SA 1XDBA 3EC2A 3A1UA 2C9YA 2JLXA 1Z0DA 2OXRA 3K8YA 5AUOB 3SZRA 2A3RA 5L3SA 3K70D 1HE1C 1GNQA 2I4IA 3LW7A 2JIZA 2R44A 3SQXA 1QG4A 1OH6A 2AKAB 2ZRDA 3LO5A 2OBMA 4MKHA 3WYFA 2ODNA 2SHKA 4Y0VA 3SFZA 1OYYA 1LF0A 2BV3A 5GVSA 1XPOA 2OEPA 1AGPA 1R4AA 2ZXUA 3UMSA 1OJLA 1PLKA 5IK2D 1E2MA 2YWGA 4PTLA 4PX9A 2GETA 3RVBA 1FX0B 2J87A 2REBA 4HAUA 1S4QA 1ZNYA 2PJRA 3QKSB 1NL3A 2ANBA 1LW7A 2WWIA 3IHLA 5FL7A 1Z6YA 2IWHA 4NL4H 2NO6A 3AEZA 4FMDF 5E7JA 2QM8A 1VDZA 1XF9A 3GLHA 2FG5A 5FPTA 2J41A 2ZREA 3LBNA 2O8DB 1DPFA 2WBLC 1VYVA 4UNNA 1U0LA 5B2ZA 2W2VA 1W2GA 1XEXB 1ZUNB 4MGKR 4OK5A 3ZZUA 3TBKA 1RC8A 4X8MA 3EZ9A 2MSCB 3MGCA 4AYXA 5FPSA 2ZE7A 3LV8A 1XEWX 1IJFA 1KTVA 4YMWA 1BOFA 5JWHA 1XU4A 2DWQA 2WHXA 2YOHA 1T9HA 2GCPA 3K0FA 4DXAA 5JCPA 1P9NA 5J4VA 1TEVA 3X1ZA 1LS6A 4JLJA 4M22A 4P33A 2O8CA 1OSNA 4FWTA 4C0QC 2WOOA 1LFDB 3BOSA 2WJVA 1MT0A 2PJZA 3GEIA 1VCOA 4Q1AA 5F9FA 3FKSD 4KHZA 5A0FA 1MV5A 1KMHA 2IBMA 2YHSA 4TLAA 1FNMA 2R2AA 4KBFA 3UG6A 2Q21A 5CIQA 5CM8B 4DEXA 2GJ8A 4LJAA 1OPXA 1Q12A 2H18A 4A8JA 3K0SA 3KXKA 5TARA 1G7RA 1Q3HA 4Z54A 2VHQA 3RS5A 2IUUA 2IUSA 1U90A 1UKEA 4Q1DA 5BN5A 3HJNA 1WDTA 4TMWA 4V0KA 4EPTA 4UXIA 2GK7A 3CNNA 3REFA 4D81A 2GBLA 3B1ZA 2W6IA 2WICA 4HSEA 2QGNA 1RJ9B 5JCZA 1CS4C 1W36C 2J7PD 3IILA 3OEEA 3GCGA 1KI1A 1E98A 1VG9B 4HZUB 1QVAA 5EE1A 2JLWA 2KB0A 2ZEJA 4TQAA 4JS0A 1VPLA 1CULC 4K81B 5F2EA 5FOUA 3AVOA 5F98A 4M21A 3CZQA 4A2PA 1NG1A 4EKDA 1U2RA 3TH5A 4HUQA 2NO1A 1XEFA 3ZH9B 2FEMA 1G8GA 1QDEA 4KXFB 3L0OA 4JVLA 5FH9A 3NEJA 2QI9C 3QJYA 2WMNB 5GJVC 4FD2A 2FE4A 5AUPB 2WAYA 4I1VA 1MABB 2F43B 1FMLA 4QM6A 4URWR 2AXNA 3K9GA 2WKPA 4PAMA 1A4RA 3QIAA 4PAOA 1PUJA 3LNCA 4C7OA 5FUYA 1KI2A 3R9IA 3GPLA 4ZCLA 3AVTA 2PMDA 2HEIA 5KDDA 1IN8A 4PAQA 1W0JD 4OQMA 2WJHA 3OIYA 2JLRA 1P60A 5DH9A 3NVAA 5E95A 1OIXA 3RS7A 2VHUA 1G8HA 3BRWD 2QAJA 3CKLA 4ZDKA 1G6HA 4D0NA 2GXAA 5HTKA 5LBIA 3SBDA 2H16A 3W90A 1MRNA 1RKBA 2FF7A 1BMFD 2QSZA 2ZRKA 1IOZA 2XSZD 2ZUBA 2HJGA 2CE2X 1OIWA 1YE8A 2GVDC 2GA8A 5JHHB 1GITA 3DO6A 1SVLA 8OHMA 1P75A 3E70C 3THWA 1NN1A 1GKYA 4LSGA 3WHLA 4F4IA 4DT1B 4CRWB 1OT3A 4UJ3A 4TLCA 3SYNA 2ODEA 1JB1A 2DWOA 5KPDA 3SNHA 4KYUA 1D9XA 2QROA 4NCNA 1TF5A 1US8B 2JATA 1II8B 1QHHB 4P4TA 4RZ2A 1ZBDA 2YOGA 1XMSA 4A0GA 3JVUA 2PZFA 2C98A 4QXAA 4GL2A 4OI1A 1EX7A 1JPJA 2B6HA 3NHBA 3PCRB 3QKTA 4DLZA 1ODFA 4BEBA 1E79A 1OH7A 1KYIA 1MRSA 1E1RA 3K09A 4JLKA 3NH9A 5CLLA 2HXYA 2IYZA 3K9LA 4RD0A 3B82A 3SYKA 2B7BA 2HYDA 3RRNA 4QGFA 2VP0A 2BJWA 2NOAA 3OZXA 3I5YA 4II7A 2P2LA 1S3SA 1AZSC 1CXZA 2ZUCA 3IBGA 1U98A 3NEYA 5AJYA 1JR6A 4FCTA 5FBRB 1YRAA 4DRZA 4RKFA 2WMOB 5A4JA 2TMKA 4M9QA 3CF2A 4EQ6B 4PC6A 3Q5EA 1II0A 2Z4SA 1UEJA 4WOPA 2O8FA 4JYCA 3ZVNA 3THXB 2OZEA 1W0KD 1UF9A 4Q21A 1BYIA 2WM9B 3FDIA 3MMPA 1RRFA 4B3BA 5B58C 1OW3B 4C30A 2JJ1A 3I32A 3Q85A 5TDHA 2W2XA 4GOKA 2WWHA 1PJRA 1XTIA 1T3SA 1X8JA 2OFXA 4NP6A 2IYUA 3EAQA 4XVQA 1GG2A 2VP2A 4HLQB 2WJGA 2PEZA 2PLRA 1KGDA 3PG5A 2VYFA 3IQWA 3NWJA 4ZDWA 2WVJA 1NBMA 2Z4RA 3THOA 2JEOA 4Q00A 4X8HA 1XNJA 3X1WA 3AGQA 1CTQA 3BFXA 4DIDA 3W8RA 4AD8A 2ZRFA 4AKHA 3KZ1E 1J8MF 5FTMA 2WKRA 4WZAE 2BWJA 1ZD8A 4E09A 2B8WA 1S3GA 2CL0X 4JT2A 4Q1FA 4TL9A 5G53C 3U6KA 3HP1A 4Q7MB 4ZDJA 2DPXA 5ANRB 1U8YA 1P2UA 4Q4JB 4B2LA 3K70B 2X19A 3DZ8A 4FI3C 4RD4A 2QP3A 1UEIA 1ZYUA 2KBEA 1XPRA 5ELXA 4A36A 3QF4B 4QL3A 2QE7A 3UIEA 3AM1A 2XNDD 4XD7A 4KFUA 5HCNA 1GWNA 4G01B 4MYTA 3WMGA 4ARZA 4EJSB 5HCIA 1J70A 4GMDA 1G5TA 2VP9A 4PO8A 2YC2C 4BFUA 2G3YA 1N6KA 1E9BA 4AC9A 4U5XA 3VNVA 2ZRNA 1F2TA 3SOPA 3FKQA 4A8JC 3EZFA 1AN0A 1R2QA 4LPSA 3HU3A 4XSGA 1VKJA 4MA4A 4ACAA 2JCSA 1EXMA 5FTKA 1P9WA 3KKPA 2YKGA 3EIHA 2Z5FA 1XEWY 3VMFA 4OYHA 1TQ4A 1OB2A 2DB3A 2GBLC 3P27A 1H8ED 1YHNA 1Q1ZA 3AF2A 3R9XA 1VECA 1MKYA 2QG6A 3QKUA 4DLTA 1XTKA 1Z5ZA 2ATVA 2ZAMA 5FOXA 2QN6A 4UXJA 2OFOA 2VP6A 1KIMA 2G1KA 1HT2E 3NBZC 4RCYA 5FFMA 4RSGA 4ZDIA 1JQLB 4G5OA 1OFUX 4B44A 3DKPA 2QRZA 5HKKA 2WJYA 4DDWA 5KNDA 4S35A 1N5KA 3U3MA 3NXSA 4M1OA 3EWAA 1G8FA 4UNPA 2IXEA 3T1VA 2FWRA 1RRCA 3IIMA 1T8UA 2NPIA 4OJQA 1R0XA 5DI9A 2Q3FA 1BKDR 1RPZA 1KKMA 4AURA 4MRSA 2J46A 2V8OA 5BWMA 1ZNWA 1Z3IX 1LY1A 1Z0FA 3EW9A 1SVMA 3D31A 5FTNA 2B7CA 4V03A 5E3HA 2XAUA 4O0MA 2BBSA 2ZRJA 4IFBA 1VYTA 2RGEA 1E2DA 2OAQ1 2QZ4A 1AS2A 1G3IA 1CU1A 1KO5A 3TR5A 2WWXA 1E9DA 1OH8A 3L8YA 3T61A 4Z8XA 5KYKA 2YYZA 3HWSA 3BD9A 4TMVA 1G1MA 2IYLD 2AKYA 1FUKA 2GJKA 1D6JA 4V02A 1WCV1 4LC0A 5IK2A 2EWWA 1NMZA 1S0UA 5FR2A 4DCVA 5JEDA 3TVDA 1H8HD 4DLRA 3NHAA 2H92A 4PPNA 4BFSA 1Z6GA 1P3JA 2BKUA 5H68A 1U8AA 1G41A 2WTUA 1NN3A 4MKFA 1QHXA 1E2HA 2IYYA 3AF0A 5FBVB 1SXJE 4FCWA 4NH0A 2RCNA 4GFDA 3THYA 1TU4A 4JLAA 1G3QA 2QENA 4NTZA 3PJRA 4HAXA 2AFHE 2ZM5A 1YZLA 2QPOA 4B73A 5L3QA 3LA6A 5LB4A 2QM7A 1T91A 3L0IB 5CLQA 1R6BX 2EFHB 4M2LA 1M34E 2D4HA 4LOAA 3R8FA 2DFKB 3A58B 1RIFA 3H86A 3HDTA 5CIWA 3VU9B 1KY3A 1YU9A 2NZ8A 1F2UA 2ZROA 3TAHA 2IS2A 2VLIA 2VRWA 2QAGA 1XCPA 3ZS8A 5CJPA 3SS8A 2VQSA 3BH0A 3HR7A 4DDVA 4RFVA 1SXJD 1O3YA 2AWNA 1NLYA 2ZANA 1BO6A 2QGZA 4LV6A 3K09C 3VR6A 721PA 1E3MA 3MJRA 3CRQA 4EPRA 3A1VA 4QFMA 3I8SA 4PO9A 3VFDA 1E2KA 3QXSA 2H5EA 1G9XA 2FFBA 1ESMA 1FFHA 2P5TB 3BH6A 3S1AA 1CP2A 1UDWA 3PEUA 3QXXA 4P4SA 2OAP1 1RFLA 2RGCA 1W4RA 3WYGA 1IHUA 2OCBA 4Q18A 1OV4A 5G3YA 4AYWA 3AB3A 3VQTA 5HR5A 4IKEA 2QSYA 3CONA 3UK6A 1XMJA 5DYIA 4HATA 2OBNA 1E9EA 2EWVA 4UQOA 3N5CA 1EK0A 2DYKA 1XZPA 3CX8A 4L8GA 1GKIA 5LD2B 1M8PA 1FPMA 2LKCA 2IYWA 3KQLA 1XD2B 4QKQA 4Q7JB 2A7QA 2IC5A 2ZJ5A 3CNOA 3UMRA 2ZRLA 2W6JA 4ASUA 4Q48A 1X1RA 1GKUB 3ZVLA 1GIAA 4NU0A 3AH8A 4C2TA 1BH2A 1KI9A 5JS8A 1JQJC 2HV8A 4NYJQ 3T34A 3W3ZB 4ABYA 4BASA 3KFVA 3QPUA 4QGAA 2RGAA 2ZYWX 2YWFA 1Q1BA 3A1SA 1HUQA 3IQXA 1YQTA 2CJWA 2QMOA 3TW4A 5G3ZA 4URUR 1R0WA 3X2SA 1GRRA 5C4GB 2QA5A 3OHMA 2ZYVX 4KODA 5DHAA 2CL6X 2NO9A 1CR4A 1P2VA 2A78A 1ZNXA 3BB1A 1KNQA 1E2IA 3GMTA 3C8UA 1JAIA 4D0LB 2J0QA 4LJ9A 3W6OA 3I73A 1E9AA 2LKDA 2ZTSA 4IDOA 1W0JA 4MITA 3IGFA 1Z0JA 5L8VA 2QU8A 3BFVA 2KJQA 5JEEA 4B48A 4G1UC 3WY9A 2EW1A 1E1QA 2KSQA 2IXGA 1EFTA 2ECKA 4TL6A 2IX3A 2BEKA 2C96A 4R2IA 3VKWA 4A2QA 3O8BA 3PVSA 4LJ6A 4QHSA 1G7TA 3BORA 4IDQA 4I4LA 3R8CA 4OHWA 3P32A 1OXXK 3IDQA 4B3DA 1P5ZB 1N6RA 2V6JA 4IOJA 1G5RA 1WMSA 2AK3A 1N5IA 2XSZA 4JLVA 4YQFA 4YDSA 5KHOC 4B3XA 2PBRA 3IO5A 4TMTA 4A9AA 5B64A 2QT1A 2E9SA 1KO7A 2F7SA 2GVZC 3VR4A 1SGWA 4IRUB 1G21E 1ZD1A 4NCHA 2QT0A 1N6IA 2QTFA 1NRJB 1YKSA 1P9RA 3B9QA 4QBHA 4DSNA 4FMCF 2ZYTX 2WKQA 3LWNA 2QORA 4GPTA 3L0SA 2OG2A 4WW0A 3CRVA 5JI3E 4L4UA 1T6NA 4CDGA 2VO1A 2X8AA 1KI6B 1XCGB 3DM9B 3B1XA 4HYYA 3SI7A 4ERNA 1Z0KA 4DZZA 3GJ7A 2QQ0A 4BLPA 5H1YA 2RH5A 3ZD6A 4J0QA 1E96A 1KNXA 3B85A 4BLSA 3TSZA 3CPJB 1E99A 2XZLA 3RWMB 4B6FA 4HB0A 4A82A 1K5GA 3P26A 1E2FA 3OFND 4TLDA 1KDPA 4D4LA 3VR2A 4NONA 3LDAA 4GZMA 1I4DD 3FMIA 1LB1B 4NYIR 1DAHA 4DWJA 4Q1CA 4Q9KA 4AKEA 5K8UA 1IN4A 1TF7A 1XTQA 1XB2A 2CE7A 4RD6A 3MCAA 2ZETA 4TL7A 4BZQA 3Q5DA 2BBTA 3UWOA 1TUEA 1EFHA 4HAZA 3EWSA 4TMZA 1PLJA 1T8TA 4DC9A 4HB2A 2XNSA 5H70A 2KWIA 4FXPA 2V54A 2YOFA 1DEKA 1E2EA 3RC8A 1FW6A 1J7KA 2IL1A 2V1UA 5C46F 5HE8A 2XZPA 3TIFA 5CDFA 3QKRB 4MYCA 4JVMA 3RSLA 5LB2A 4IXNA 5F3WB 1G8YA 1TQDA 5EE5B 4CEJA 4DB2A 1Y63A 2JDIA 3TUJC 4PPFA 2IS1A 1PLLA 1U0JA 5P21A 4B2IA 5KUTA 1D2MA 2ZR0A 2C04A 4QC2A 2NZJA 5EXTA 2F55A 2FJUA 1QVRA 2Q6TA 3BH7A 1NLFA 5GJWC 2VF7A 3OIUA 3GJ6A 4LV5B 4Q5IA 5JSZB 3VNUA 2VF8A 2QAGC 5DHFA 2XXAB 1KKLA 3ZQ6A 5JJLA 2HCBA 4CEIA 1JALA 3ZQJA 3OF5A 3UG7A 1M74A 2RHMA 3K0CA 2ERXA 4DEYA 4Q4HA 4LBVA 3OE7D 1U99A 4P4UA 5CK4A 1TEXA 3QBVA 3QEJA 3D3QA 1NIJA 1JBKA 3WBJA 1VIYA 2D2FA 2FU5C 4LUCA 4RFSA 1TAGA 4LY6A 5KPJA 1OXTA 1N6PA 3AF3A 2CLSA 2V4ZA 3P20A 4NE2A 2GNOA 1N6HA 4G5SA 4V0OA 3BB4A 1G4AE 1KSJA 1LTQA 3PITA 2XOKD 3RRZA 3BAFA 1ZC3A 4PHTA 3CWZA 4NYMQ 2FPLA 1YZTA 3BGWA 2C99A 3ADBA 1L7VC 5KDLA 4IEEA 2JA1A 2ZJAA 2O5VA 1H8EA 2OCPA 3AUYA 3QF7A 4JBYA 1CJKC 3LX8A 5JWOA 2JJ2A 2WSSD 1DG3A 1W4AA 3QE0A 4JL6A 4QBFA 4QM7A 1XPUA 2NMVA 3AVWA 3W8NA 1P62B 4DLXA 2JLZA 1HA3A 2GZDA 3MD0A 1EFCA 4H1UA 3CPEA 1D8TA 1IN6A 1L8QA 4D4MA 2EYQA 4EAQA 1JR3A 2ZE5A 4GZLA 4LPKA 5JLJA 4KYIB 3BC1A 1W4BA 2GAAA 4MUAA 4ZIRB 4TQUS 1Z0IA 1HY3A 2QTVB 1SXJB 3B9PA 2OCYC 4KFSA 4PC1A 4PR0A 2ZU0C 1F5NA 2GWHA 2ZUDA 2FPMA 2ZE6A 2ODBA 3I72A 3WHKA 2HLDD 3V4FA 3DPUA 1E0SA 1XWIA 3CRMA 1EX6A 3X1XA 2C03A 1X8KA 4BGDA 1EGAA 4BFXA 1DAEA 4QJ3A 4O3MA 3H4MA 1DG1G 3AP1A 2XB2A 4DJTA 2BOVA 5C18A 1A5TA 3KUCA 2XXAA 1N5LA 1KY2A 1S1MA 2FV8A 3NDPA 3B5JA 3U3RA 3W9YA 1COWD 2RMKA 3KQKA 4DUGD 4YXWD 1N0WA 4U02A 5DLQC 2PLFA 5BYJA 5E4FA 4QOSA 4C0AC 4OQXA 4KU4A 3QQ5A 3SR0A 4ESVA 2BCGY 4O2LA 1VYUA 1X6VA 2HYIC 2DHRA 1AIPA 3KXLA 3G5UA 3PIRA 2JLUA 3ND8A 4G5GA 1FX0A 1KOFA 1XTRA 2FGJA 5TY0A 4XVUA 2MSDB 3GLIE 1S2MA 2ZSBA 3QENA 3DKVA 3GFPA 3QKSA 2Q0HA 2RGDA 1NY5A 1E32A 3PV0A 1IY0A 4AKIA 2ODWA 2BKEA 4FMCB 2O8EB 2PMKA 1DADA 1QG2A 3FVQA 2VHCA 1L4UA 4GBMA 4XTCS 4ZO4A 4Q9HA 4C0LA 2O8DA 1XEXA 2WPDD 4Q47A 3M0EA 2RGXA 1JAHA 1C1YA 3Q7PA 3GJ5A 5SZKB 4JLNA 2HUPA 3EZ7A 4DCUA 2UVQA 1FP7A 1LF5A 4AG5A 1JJVA 1G64A 2NO7A 5EXPA 2GTPA 5FPKA 5J5CA 1W1WA 5BXQC 4CGZA 4POAA 4Z1MA 3PXGA 1VIAA 4CZ2A 4LC1A 2ZPTX 1YR9A 3EZ2A 4WBSA 2G83A 4BECA 5KNBA 1KI7A 1G291 3GEHA 3OAAA 2ORVA 1RYHA 5KTYA 1I4TD 3QPVA 4L9WA 2HT6A 2FX3A 4MGZR 3A8TA 3LQQA 4LBZA 1DELA 1XJCA 4FN5A 1DVRA 1G18A 1E2NA 4I1UA 2IK8A 3D6TB 3ZDQA 5FPYA 2O8BB 1NKSA 1GNRA 4KI0A 3FYHA 3KJEA 3KX2A 4ACBA 3CPHA 3RDPA 2Q3HA 4JT4A 5DN6A 4CW7A 3MRSA 4NKRA 3TE6A 4DLSA 5JECA 4BRWA 4PQYA 4OKSA 4PHHA 2O52A 1NVVQ 4JKIA 1G4UR 4CIDA 1UBEA 2WIAA 3BXZA 4Q1BA 2BMDA 4YLGA 4BFWA 1IAQA 2A9KA 1RJ9A 4HEJA 2J5XA 1MO6A 4M1TA 3PUZA 1ZU4A 3BBPA 4ZKEA 1W36D 4UXHA 4MDFA 4HZUA 5GVRA 2AR7A 1U81A 1GAJA 4JLMA 3RS0A 1RRPA 3PUXA 1DO0A 1YRBA 4X8OA 5JJKA 1FP6A 2UZIR 3ECCA 5IF9A 1QBKC 5KDOA 1FNNA 1OHHD 1NLZA 4K8OA 1QZXA 1HQCA 4QGGA 4IOLA 2VP5A 3SJCA 4CF7A 3U3KA 2A2ZA 1HV8A 1G3MA 1Q20A 1ESNA 3RRYA 3QBTA 3TAUA 3F3YA 2ANCA 1EG7A 4MRPA 4AK9A 3W5JA 1F60A 4IDHA 3U60B 4MYHA 1MABA 2F43A 1FUUA 1Z47A 5EP4A 4CT4B 1JEEA 4BLTA 1W7AA 2ZR9A 3MFYA 4C0KA 4HLCA 3P4YA 3KQNA 4KLZA 1GDDA 2FA9A 5HZKA 5JRJA 3K0CC 2GK6A 3FGNA 3IUYA 1YZQA 3AKCA 2A5JA 1MO4A 2CK3D 3ADCA 1ZJ6A 4N3NA 2X2EA 4URVR 2W58A 1EFUA 4Q7LA 1UFQA 3I62A 1Z08A 3KJIA 2GJ9A 5JZVA 3CX6A 3WMFA 4PZYA 2B92A 2P0EA 1DBSA 1SVKA 4O2RA 1KDTA 2A5FA 1OH5A 4AIIA 5DYGA 1P73A 2PZEA 1GRNA 1T5IA 3ZIAA 3AVXA 1TF2A 5J4LA 4E03A 4HDQB 1P4SA 4V0ME 4LYJA 1HYQA 3H84A 4B3FX 2VPPA 1PVOA 1W49A 4Q1EA 4B6EA 2WIBA 1M7GA 1S9HA 3RANA 1Z0AA 2IYSA 1ZIPA 2ZRCA 1NJFA 1UADA 2ZS7A 3N2IA 1V5WA 4JKYA 4OI4A 2IXFA 2FZ4A 1P2TA 3EARA 5JMTA 3FMPB 3L82B 2CCKA 3WNDA 4BWYA 2O0JA 4DT1A 1LVGA 2ORIA 1KK3A 4Q03A 3LVQE 5SZJA 4TSFD 3U7EB 3KB1A 3RS2A 5TMPA 3LD9A 3I5XA 1CJUC 1ZP6A 3H1TA 2ZU6A 1E9RA 4TLBA 5DNYB 1US8A 4TMXA 1II8A 1QHHA 3O8RA 4Z51A 3IHWA 2Z6VA 2JGNA 4TYQA 2JLYA 4DSOA 3GLFE 4A6PA 2XTZA 4KLNA 4KAXA 4HI0E 4JBXA 1SHKA 2W0SA 4L16A 3X1DA 2F1IA 5AR1A 3JVVA 3ICEA 1XFAA 3V4RA 2D7DA 1ZRHA 3K0AB 1VCNA 1X3SA 3FHCB 3GQBA 2REXB 2ZJZA 1PUIA 5IT5A 3TQFA 4BFZA 3U44B 4JJZA 4HDOB 3CH5A 2WWFA 3TGPA 1CKEA 2B8TA 2V3CC 4LWZA 2CNWA 5IRCD 2BMFA 4IVRA 4HB3A 2VL7A 4KVAA 4EQ6A 1KAOA 1YR8A 2GHIA 1OFIA 1EWRA 2JIZD 2HJVA 4NDZA 4BRUA 2G9NA 4NBSA 3SFVA 3THXA 3AKEA 1N3BA 3UMFA 4Q02A 1ZW6A 2GCNA 3SN6A 3WMEA 3A4MA 2GF9A 1G8PA 3CUEF 5JS7A 4EFMA 2OUKA 3U7GA 4YC7A 1CJMA 3W34A 4ZV4A 5L3VA 5CB8A 4M1MA 3U7HB 1E2QA 2VH5R 1WA5A 1V43A 3K1JA 4UNQA 4DVGA 3E1SA 5FL7D 2R6GA 3PR1A 5KU1A 3QXCA 4LHZA 1N6NA 3KKMA 1GNPA 2GAOA 3O47A 4A0RA 2QP4A 3EIEA 3M1IA 2F9LA 3ZZTA 1DAMA 4Q01A 2ONJA 1E9SA 3FHTA 3C5HA 1NSFA 1P72A 1ZM7A 1XXHB 2BC9A 3SE0A 1D2NA 1G17A 1KDOA 3AV0B 2IS6A 4LYAA 1Z6TA 4A1FA 2WZQA 2QMHA 3BE4A 4C0BA 4ZPXA 1E2PA 2Q9CA 2YZ2A 4W7SA 4Q4JA 1OXVA 3Q72A 4PZZA 5TB5A 5BYKA 4IHQA 4QBGB 3WP1B 2YC4C 4Q7KA 1AS0A 3QF4A 3CF0A 2IS4A 1CIPA 3GFOA 1XMIA 2AD1A 2HCJB 3PFIA 2FN4A 2PX3A 2HT1A 2NGRA 5EP1A 4PZLA 5IDVA 4QRHA 4EJSA 1Y3AA 1XTJA 4N0EA 521PA 4DDTA 4GP6A 2R9VA 3U4QB 2AXPA 3FHOA 4OHZA 5E7IA 1JNYA 3IBYA 3OEHD 1Q1EA 5DSZA 2EU8A 4PXAA 1FQJA 1RRGA 4JZKA 5DI3B 1CJTC 1G3UA 1HEIA 3TJZA 4N0DA 2ZI3A 6Q21A 1GL9B 1NNEA 3EIQA 4JLOA 4NCJA 5SZHB 5J4HA 1M7HA 1T5LA 1OE0A 3JZMA 4G0NA 1SKQA 3MG9A 1C9KA 1DAIA 1ZVQA 2I3BA 3OEED 4E07A 3IKJA 2ZYUX 1XBTA 4IVQA 3GLIB 3HPQA 3CF6R 4OJKA 4PSKA 2OT3B 3CB4A 3CLVA 3VX4A 1U0HC 1XD9A 5FPHA 4AG6A 3C5CA 3EXAA 1OB5A 1N0UA 3T1TA 1P6XA 3O8DA 2FSGA 1TNDA 1E0KA 621PA 2FPKA 4ESHA 3L2OB 2XITA
chains in the Genus database with same CATH superfamily
3IDSA 3GUYA 3IAUA 1LPOA 2CVHA 3ELYA 4BO0A 1QHIA 1RP7A 2H2HA 1CVRA 1SUDA 3BRSA 3R20A 4H3VA 4HOYA 4RZXA 1Q1NA 1TB4A 4QOFA 4L9SA 3WGYA 5AI8A 3RSQA 3CIOA 1HDRA 4F2DA 2CDNA 4WNYA 1ANKA 2R1TB 3RHTA 2Q28A 3DNPA 5IBQA 3GBPA 5JSKA 1U5BA 2XWJI 4YPFA 1IQUA 4IM7A 1H4QA 5CG2A 4NMWA 1JFRA 3O4JA 5IKOA 1HKUA 1SIUA 3JQ7A 4JUIA 4X6UA 3IMKA 4RTJA 3HGQA 3S8YA 5I8ZA 3WHPA 2X7JA 1R0LA 3RLFA 1VHTA 1YAHA 3P0HA 3PJDA 4EG0A 2G8LA 2WJPA 5BSMA 1M72A 3B3QA 1JXAA 4JJKA 5K3SA 4CUJA 4D8VA 3N8KA 3WHIA 3E27A 5FTLA 3ZDRA 3L6RA 1RE0A 1FQOA 1NT2A 3H3JA 4ZU3A 2BF7A 2PRYA 2VF5X 1W4ZA 2JZCA 2YL2A 4YDHB 3E53A 3FSJX 1AUOA 2AFVA 1V25A 3W4IA 3Q11A 1FU8A 2GXSA 2H1IA 5LU8A 1JDUA 3OM1A 4JJAA 3BF8A 4DDUA 1P19A 4ND8B 2J0UB 4OFZA 3H5LA 3PR2B 5K0FA 1FRQA 1LSOA 1G63A 1L5YA 3LUBA 5AK4A 3W4JA 1VL6A 1XQXA 4B6GA 4R8VA 1GLVA 3AUAA 1Y1KE 1E3JA 2HBRA 5JG7A 3AETA 3CH7A 1TQ6A 2C8VA 2VDKB 4E3WA 3DEYX 4EPWA 1E66A 1DX6A 1OYOA 1EWVA 3NX4A 1B15A 2AN4A 3GGJA 3OT1A 2HL6A 3DR3A 4YQEA 5TVKA 1RI3A 3TLGA 1Q7CA 2QDXA 2X6QA 3B7GA 3G0OA 5C8VA 3GLIA 3HNOA 1DDIA 5DKFA 2NXCA 5AI0A 3Q3JB 1A5ZA 3W2HA 1B42A 4YPOA 3HTXA 2QRNA 2PZ8A 4PIVA 2QQFA 2YNMA 5DTEA 4HVAA 4BN4A 5DNCA 5HOQA 1U02A 1O1YA 3MMNA 4ZP1A 2R7MA 4BY9E 1K88A 4TRRA 5GPBA 4HQLA 3S5UA 4MRNA 4CCSA 2D1YA 5DLEA 1GA1A 1RP1A 3PTZA 3FOEC 2JLVA 3TLEA 4NE9A 2IF2A 1E79D 1WEHA 1FTWA 2VDUE 2VT3A 3ADOA 2DBVO 3C45A 4ND7A 3N9IA 5LXTB 1KWKA 1QU2A 4OHUA 4GG1A 1V8FA 1W85A 5IXJA 1UANA 2ZVPX 5FOTA 3RSZA 1O95A 3BRCA 3SR3A 3ZK9A 2QBYB 4AY4A 1YULA 3E3LA 4TRJA 4PGHA 1AY0A 2C5HA 1TCCA 1YI8A 2VS1A 3N2LA 3NJ8A 4IIJF 2QY6A 3MUNA 3J7AC 2VK8A 1BMFA 3WBBA 2I3DA 3R7WB 1XKXA 2Z2XA 3U16A 5JZMA 3LHIA 1SA0A 4H27A 4MP6A 2AOUA 1MB2A 1WHSA 2WFLA 3RYHA 3WK9A 3SMVA 1VKOA 3ILXA 1MB0A 3JXEA 4FX5A 3DULA 1B0AA 4GH5A 4WUVA 5L4NA 2G0AA 5B1YA 1TYEB 2PT9A 3RAPR 4BQOA 1V37A 3H2ZA 4BBJA 2WHPB 4E3ZA 1EE1A 2AC2A 1J90A 5JLAA 2OAEA 2BTOA 1J22A 2C3OA 2MSEB 2WJJA 3DAYA 5K8VA 4GWLA 1DC7A 4ALMA 4XTRA 1BD3A 1JG4A 4PYRA 4EY5A 4YDRA 3IBCA 1TIBA 1NW6A 2PO5A 2J1LA 4ZEVA 3CWQA 4C4SA 1E61A 4XWKA 5I9MA 1T2DA 4GC5A 4O2AF 1U4SA 1CCWA 3EODA 1I2AA 2WB4A 2GKOA 2PRJA 4TPKA 3RJ9A 1UIMA 5F23A 5FDFA 1NN5A 2WWYA 4EW6A 3FYUC 3I1FA 2OECA 4WINA 5HMMA 2NPFA 4Y6OA 4BV9A 1AQYA 4ZK2A 2EKLA 2XHEA 1ILWA 1H2FA 2JVKA 1NBMD 5LQRA 3SDSA 3CF4G 2FZGA 4B6QA 3PUJA 4WD3A 4DCNA 2JRCA 2V9ZA 5AVTA 2QY9A 2BJHA 2OE2A 3C41J 3HYCA 4PSAA 1RC1A 3TW8B 1WUHS 5JASA 3W3AA 3KJXA 3GLFB 1CRWG 2CLFB 2FEAA 3GA0A 3MIIA 2DSTA 4RY9A 3GO4A 2V7XA 2GX6A 5DE3A 3BCRA 4JYBA 5JNSA 5SY4A 5LQCA 1OXUA 4A15A 5HE9A 1U2PA 3W77A 3PEWA 1NDUA 2EATA 2K2WA 1WO8A 4QT0A 3ZE9A 4UHKA 4CF3A 1BS1A 3N53A 2PU5A 4RQBA 4ZREA 3OCYA 3WNCA 1VMAA 2QE7D 2Q0QA 5EXXA 1N9KA 1NFFA 4BX3A 4YACA 1FPQA 1WZNA 1HRKA 2JLQA 3SX4A 1VE1A 2I2WA 1WRBA 2FVYA 5JATA 2C2YA 4BDTA 3C15C 4ZO8A 3ETHA 1NC1A 1ZDMA 2PDAA 5H59A 2PLNA 2P4EA 4WLUA 2HV9A 4O8ZA 1P1RA 4QWMA 2FZKA 4P3YA 5KWEA 3L8FA 4J9UE 5DLPA 5C1PA 5HZGA 2R8EA 3KZVA 1HSZA 2K87A 2JIRA 3HPRA 3MJ4A 5EIXA 1SCUA 1IBSA 1BQ4A 5FLEX 3H04A 3OCCA 1OWPA 3GLHB 1ZK1A 1EWQA 3ML1A 2XF2A 1RZ3A 4L50A 2NSLA 3ASYA 2BHSA 5BO5A 4IQ0A 3KS9A 4RK1A 1A2BA 1Q1QA 2NZVG 1RWXA 4G56A 5GOZA 4DA8A 1QTNA 1NVDA 4NV0A 1DKRA 2EFEB 3N58A 3GX1A 1UP4A 1T0HB 3KKNA 3CO5A 4IW3B 2JFBA 3KEMA 4L6CA 1R8QA 3LLUA 4HO1X 1Z22A 1DJLA 1KI6A 3K0FB 3VXKA 5D84A 3VR5A 1BDHA 3ABOB 2H8KA 3U0VA 2VWGA 4JEMA 5LLDA 4H15A 1H2WA 2POCA 3DVAB 1XWFA 4BX0A 3JQ8A 4R54A 1MT3A 3B13B 1DV2A 4TTRA 4JJGA 3RSSA 3TBFA 2AI3A 4MDEA 3FZNA 5L9AA 1KMHB 1NI4B 4JLBA 4AI6A 1DO2A 1T6YA 2EF1A 4KDFA 2FPXA 3MGAA 4BWVA 5FJIA 4RK5A 3ENVA 4UNRA 1NAHA 4D2IA 4ARAA 4HYQA 3F78A 5JJIA 2Q1YA 1FTNA 2BGTA 4F86A 1TJYA 2IEIA 3GNSA 4M7RA 4WLNA 3QY9A 2CUKA 2J9ZB 5ESWA 2CLEB 2VA8A 3QHAA 3WWEA 4B2YA 2JI9A 3IAS1 2BEJA 2G4CA 3LM8A 3AVVA 2N1BA 4LRXA 4ECAA 4EPXA 1TKAA 2XITA 5PNTA 2A0XA 1FLNA 1YZYA 1KVQA 3O4FA 3ZGNA 3CNBA 3PZBA 5F4ZA 5I7EA 2P6NA 5KQSA 4YR9A 1CLUA 1QYDA 4IO0A 1VTKA 4PSDA 2IU3A 4GPEA 3WGKA 4D9EA 2FOIA 2CMDA 2GH1A 5BWOA 4YRNA 2BM9A 3KM0A 4CM4B 5BOVA 2VHEA 4ESOA 1XROA 2X1VA 1I5OA 1BDJA 2C3UA 3DPIA 3HB4X 3IBTA 4HH1A 4HWTA 4TT3D 3SP1A 3ZCTA 1ZD3A 4EJ2A 1KDRA 4DV7B 4KNWA 3EIUA 2FEOA 2HK6A 3G3EA 5IKPA 2XT9A 3U7FB 3STXA 3DHWC 2V97A 1RKUA 3HUFA 1JXOA 1GTG1 1KRWA 2J59A 1IJKA 3KVNA 2HO4A 2ZFUA 2PSHA 2EHDA 3CZPA 3HXTA 1G42A 3B6ZA 3HKCB 5I8WA 3WJ2A 1YHYA 3UAVA 2ZZNA 3G82C 1BD4A 2NAFA 3HFJA 3LC7O 3ZHSA 3QE9Y 3QK7A 1K1EA 4ITUA 2PQ6A 1DCFA 2HBZA 3CV3A 4GOXA 3PHIA 1J2JA 2H0AA 2HQRA 1E3WB 3JZDA 4FE7A 4Q3AA 4W9RA 3S2EA 1SCAA 2Z6QA 1KOGA 4QRDA 4G0MA 4D3ZA 1UMCB 1HL7A 5D5PA 4EMTA 2FSHA 2PNFA 4NFSA 1HTTA 2WHEA 1ZKMA 4IUDS 1MJNA 2Q1UA 5AK0A 1Z29A 1XMVA 4RMJA 1KZ9A 3ZCRA 2BSQA 3NHUA 1JIIA 1GLGA 5E1BA 2W2PA 1OA1A 3RV3A 1EKXA 2IQIA 4LWQA 4LCEA 1CQJB 1KEWA 1Y3IA 4EKGA 4YXFA 3AI2A 3L1UA 2B3DA 1ST2A 2MSKA 1MA3A 3VR6D 121PA 2AX4A 5NLLA 1TZMA 3D8UA 5ADUS 4PY2A 4D25A 1IZ8A 3HV0A 3WR5A 5C1DA 1YS2X 4A8PA 2H5JA 1AGRA 4G07A 2VYVA 4WY2A 4D9NA 2ZJ8A 1CY1A 2WUDA 3SK0A 2QMQA 2ORWA 3NFRA 5U1PA 4J49A 1YZKA 3HXKA 4FOLA 1Z4MA 3LT1A 4H7DA 4MUJA 4DV4B 1NMYA 2AZDA 3ZDFA 4F71A 4Z4FA 1DP4A 1TJ3A 1U2DC 3E9CA 3V8NA 3NMUF 5JHGB 1RBQA 2C5BA 3UAYA 2EKBA 3FGOA 3ROGA 1FFXA 2W71A 3OEHA 4M8LA 3FFBA 1OTXA 3GFFA 3K15A 3ZGYA 1FSPA 3FLBA 4NBKA 4L72A 4BCCA 2WWRA 4WEOA 2HQOA 1Y1PA 3DV0A 1H66A 3C3MA 1FRNA 3L05A 5LDGA 2W7TA 3TNJA 3LDGA 3JS5A 3GUVA 2HPZA 4IV8A 1CSEE 1JEQB 2BHRA 1OREA 4ASUD 2A84A 3OWHA 3T3EA 4NDAA 1XV5A 5F7XA 3NR2A 5BVHB 4YA6A 3GGOA 3VOAA 1C7ZA 2ZIZA 4RDCA 3HA2A 4TMFA 2J30A 5EJIA 2Q4TA 4Z4GA 2QTVA 4UASA 3GLGE 4YJGA 4GPIB 3FYSA 1I33A 2IIVA 4B09A 3QOYA 4ZZ3A 1RWWA 1NLUA 3GRYA 4KFTA 2ZSAA 1F8GA 1N2CB 2IS1A 1E1CB 3MLEA 2Q8NA 4F04A 1YQUA 5BNIA 5GJBA 4FWIB 3NH6A 3WXMA 4BC1A 5CM9C 5F1OA 1OOEA 1XQ9A 1QH1B 4RACA 5LZ2A 4GKAA 2CV0A 1M34A 4BLOA 3OE5A 3PFBA 4LDJA 2I8CA 3AV3A 4NEQA 1K7YA 1XIVA 1T3HA 3NTLA 4MIKA 4MO2A 5DHSA 2J48A 2NQ2C 4BVGA 4YUYA 5K0SA 4UCWA 2CXOA 2R97A 1E4VA 3O31A 1NVMB 4IZOA 3KXDA 4C06A 3CVUA 5GINE 4NYJR 4N41A 1FOEB 3D4LA 3H5IA 1ZK2A 2HF9A 3NALA 4X6LA 5FI5A 4HVTA 3WADA 2C4TA 2RHHA 3UMCA 3V8MA 2F1HA 1P0QA 2P3OA 2WW8A 4HRVA 2FWBA 4Q4DA 1WM1A 3CRW1 5KNDH 4AYTA 2X3YA 3QMMA 4FE3A 1T36B 3FWHA 2ZS9A 3BSFA 3H5WA 3KYCB 1ENYA 3IDOA 1MOZA 3RS3A 1B26A 2H4HA 4C4ZA 2FI1A 1TEHA 3AF5A 1FNBA 4TRMA 1KSGA 1WPXA 4URYR 5AK3A 5I3ZA 5LQMA 4DUZB 4COKA 3S68A 2EV9A 5H80A 4DBLC 3GN1A 1YDGA 3Q7EA 3T1YB 2FLKA 3BB3A 3L6BA 1C5KA 1WCYA 3W5IA 4AG3A 3DXFA 5EGSA 1JW9B 3ZE1B 1IK4A 1KR2A 2G77B 5AJZA 4AQYB 4BZPA 3ZHCA 5HKBA 3IELA 3V1NA 1DBWA 4WCFC 1PVVA 1UC5B 3UPUA 2HXSA 4OK6A 4GSKA 3VR4D 1GGFA 4TYNA 3H4TA 1QQ6A 3D6UA 3OZCA 4RGVA 5JVDF 3TMYA 3DCYA 3PI7A 3QVJA 4PNEA 5CA0F 3O2NA 3L07A 5EESA 5JYBA 2MDTA 2JGDB 1L4FA 1W4CA 5FQNA 1KO4A 4LE0A 2IODA 4INOA 3SBEA 4WZZA 1V48A 2AK2A 4CMIA 3CBQA 1EAMA 1KMNA 4HDMB 1SBIA 1PQ4A 2DBZA 3H16A 1IBMB 2NWQA 3FJOA 5HUJA 4OL0A 3A1DA 3AOEC 2OCDA 4M9SA 3QXJA 3MGKA 4EQZA 1NVUQ 4U7HA 1NSYA 2H1FA 3P4XA 3SXPA 3OX4A 1NUQA 3REQA 1BW9B 5FPQA 5H4HA 1IY8A 4A2CA 3U5ZB 1FTSA 3P9ZA 4N54A 5CYPA 3QWIA 4LYFA 4PG5A 3RU3A 1AMOA 5CJ2A 3GI1A 4PGMA 1G2IA 3IJPA 4JVSB 3R5XA 1HDXA 4NNOA 1NZJA 5KJEA 1W52X 4ENQA 3W2IA 2QUHA 1VJRA 4FDVA 4HNRA 1QK3A 3M49A 3L7CA 4MZDA 1HFKA 1MB9A 1EI9A 1YR6A 1PTKA 2RD2A 3UOGA 1UXKA 4B85A 2NV2B 3I92A 4K6KA 5C8YF 1VIDA 4IY1A 1L5RA 2C00A 3BMOA 4K6OA 4RVFA 3PFHA 3T06B 2FGKA 3V3KA 4C04A 5CDFE 3ESYA 1Z39A 1KZ7B 1XZGA 3H13A 3LP5A 2CEAA 4U7DA 1U9ZA 3KR9A 5JNLA 2PGLA 2PCJA 3RYIB 1TW3A 4J1TC 1MVNA 5J2TF 1D2HA 3PTAA 2GBFA 1ZR2A 1CDEA 2WC1A 3T7AA 3KJHA 3R4VA 4PG4A 5C2JB 1IY9A 1H6AA 2Y05A 2ZYDA 3R5HA 5CX4A 3W2FA 1NM5C 3DDSA 4KE7A 4FQ7A 5KX5F 4X1YB 3DFUA 1WS6A 1TJPB 2ODPA 2OHFA 4AUMA 2HW8A 1ADGA 2RKOA 1DIRA 4LJ5A 1MG0A 5EWJB 4RJLA 5KOHA 1WETA 2P91A 2Y3IA 3ND7A 1IONA 4QIHA 1P74A 3R44A 3JZAA 5G0VA 2PYDA 1AK2A 1OVMA 2SBTA 2VSXA 3D2AA 5EZYB 1XVIA 4AUEA 3L7IA 1HI9A 1CFJA 3V6MA 2DFLA 1MNQA 3QG1A 1GP2A 1Y4AE 4G5HA 5EZQA 3U61B 1KMIY 2GZ1A 2I7CA 5TGTA 1QS0B 3O4RA 3OHPA 4URZR 2R7KA 2GASA 2E4XA 4FFBA 3WJ7A 2B37A 2I7TA 3DUFA 3U48A 4YAWA 2ID7A 2ASVA 3LXRA 1MVOA 2PL5A 2W2TA 4HGRA 4M1QA 4NBVA 4E5NA 2R6FA 3M6IA 4EBBA 2NUPA 4Y2SA 1JIUA 1J7JA 5JFTA 3SHTA 5EFZA 2B0CA 5B1IA 4H7EA 2HX1A 2Z9DA 4ZVTA 5H8WA 2ZK7A 3JY6A 2IF0A 4DPLA 2X42A 2DM6A 1K8XB 1RYFA 3VPFA 3TRFA 3V3TA 4PS0A 1B3RA 2RGBA 4YYZA 4PPGA 3FB1A 2FPPB 1FUIA 1XDZA 2YX1A 4JD5A 3RQIA 3OLXA 5LFAA 2BMJA 2M1XA 3NBYC 1KEEA 3AVYA 3WQHA 5EJ5A 1ZGHA 3Q3IA 3W1WA 3GJRA 2FF5A 4A8TA 2I6QA 5AD1A 4WXYB 4D9GA 1FA9A 5EN4A 4Y2JA 1VMEA 2ESRA 1OQAA 4EKYA 4A92A 3JR3A 2PMCA 2REQA 3A9RA 1E7YA 1X2BA 4MQFA 1Q74A 3IUMA 3L4BA 4G65A 2P65A 4NCKA 1PNTA 2HBYA 1RJEA 1KJYA 4GZ3A 3A37A 5AXCA 3GRKA 5AKGA 1U63A 4JB3A 2ZIFA 1N0VC 1UMKA 2H2WA 3TPFA 3L9WA 3EXFB 3JQFA 3PENA 3VTKA 1N2IA 4B40A 3EC1A 3LNTA 5JJCA 2ZIVB 2RAPA 2HI0A 3H7AA 4BRZA 4JJIA 1M2OB 4HTFA 4ZT2A 5HPYB 2CUNA 3E18A 3HYSA 3VNQA 5JZOA 1USUA 3O1IC 4C7MA 4HD8A 1N25A 4BO6A 4B4VA 3PVZA 1IUKA 1UPXA 3R3ZA 2XWBF 4R01A 3BMNB 5DNAA 1VCIA 4KRFA 4CKBA 2Q9BA 1XA4A 4UREA 2VIIA 3ZHXA 1TLLA 1W93A 2A6PA 4RZUA 3LBHA 1DTWA 1GU7A 1GG9A 1U9IC 2OV1A 4PRZA 1ZCAA 1JR3D 3AR3A 1F2UB 4BO7A 2ZT6A 1G8KA 4XPIB 3SXJA 1PE0A 2R4QA 3KWMA 3G6KA 3R9KA 5ADHA 2NX2A 4QPZA 4Z4EA 1DJNA 5DWDA 5EKDA 2ORYA 1M0EA 1U3TA 1IBRA 2YRXA 3WQSB 5JI2E 3R41A 5C52B 3H5VA 3D9QX 4AKSA 3FN4A 3PLAE 2P9ZA 3AUXA 2YV5A 4DIEA 2JFYA 4FGJA 2ZYAA 2XZOA 4WK4B 4X71A 2CVOA 4MKIA 1Q0ZA 1UJ2A 1UK9A 2VOEA 4ZMSA 2A8YA 2I66A 2O7SA 3FUUA 1NF2A 4UHCA 5CAEB 3N8GA 3G79A 2XMQA 2FPGB 5B53A 3C4JA 2FSFA 4MEJA 3GOQA 2Z09A 5EFOA 5FO0A 4OQ4A 2HFKA 3DMDA 4JSRA 4FFRA 1T0PA 4MKGA 4EP1A 4B7UA 3WTCA 4FD3A 2FWPA 4NMHA 5A4IS 4I9FA 1Q3TA 2CHGA 1PT9A 4TT3A 2XUDA 4CL0A 4TV9B 2GEKA 4H3SA 1SXHA 3QHPA 2RGNA 1W5EA 4IHJA 3TQOA 1JKJB 2IELA 3PFGA 1T9ZA 3FHJA 4MRRA 5FL3A 4IRMA 3A4VA 1OR8A 3OCJA 5LP6C 1CEYA 1FEZA 1ZH2A 4LRUA 1URPA 5CR9A 4IXWA 4UTPA 1A98A 1GPLA 1TM3E 1TUGA 3U9TA 4W99A 1XALA 1ZUWA 2X8BA 4YP9A 3E61A 1Q0TA 4AJ4A 1SH7A 1A9XA 3TCNA 2CFRA 1Z4QA 3PYMA 3U7IA 3GAAA 3UWPA 1JFFB 2CJWB 2AGVA 4ND2A 2FTKE 3HBFA 2W00A 1NI5A 3EGOA 1X3LA 3AFIA 4U2DA 3KU4A 1L3BA 4XSHA 5AKJA 5IJ9A 1U2GA 2EHJA 1SKYB 1JMKC 2IV3A 4LS3A 1R6VA 4YT5A 3FFAA 4WA7A 4A0FA 4YV0A 5FI0B 5LNK6 4Q3EA 4BQRA 3VDMA 3BILA 4HYTA 1KO1A 2O2GA 3KZMA 4J3NA 4GR9A 2AMFA 2YXBA 3KELA 1XRMA 2G67A 2OR3A 4QVGA 4QPJC 3RT1A 5EJ4A 4W9MC 1LFAA 3VH2A 2DU8A 3IP8A 3PQFA 3A3NA 1RCUA 2FDCA 5HK9A 4DUGA 4YXWA 1G1AA 4XM1A 3JAKA 3UH1A 4E14A 4KR6A 4AO7A 3HB7A 1WE2A 4OHOA 4R3WA 1HZZA 4RVDA 5EXDA 2GNPA 4V2UA 3NHMA 1ECGA 4D0GA 4N9WA 1YRYE 4XGIA 1JECA 2B3TA 4DL9A 4CXMA 3PX3A 1OZ0A 3DOFA 1M3SA 3CEHA 4LJ8A 4TOIA 1G8AA 4WN9A 3FYCA 3DE3X 2H2GA 2IW3A 2PZGA 3GZNA 4P83A 4U39A 3GLQA 2RAUA 1SVIA 3DBOB 4PHFA 3LW8A 2EKPA 4UJ5A 4E4RA 2NUAB 3BJMA 2ONYA 5I9NA 3RUDA 1SQ5A 1DS6A 3U80A 2OO5A 5LQAA 5LOVA 1N6LA 5B2FA 1HT1E 1FVXA 2BDTA 3D7MA 1M8KA 2DKNA 4ZTZB 1QBGA 4FS3A 2J7KA 4D26A 3ED1A 1IRIA 5DM4A 1UK7A 3D6MA 2BF4A 5DN6D 3D1LA 4JI6B 2PD6A 3PQDA 2W8BB 4J16C 4QODA 4MWEA 4H7IA 4GUAA 5KJFA 2H08A 3F2IA 2FDXA 4BNXA 1A9ZA 1XMXA 2R47A 5DZSA 1KZ1A 1M1NA 2P62A 3RAGA 3B1WA 5IAEA 1N4AA 3KOYA 3WE7A 4B79A 4DKJA 3ZWBA 1SBZA 2O0HA 1GT6A 3M8KA 4G3XA 4AF8A 3DWGA 5E38A 4UU7A 1MEEA 1U5AA 5EIBD 1G5PA 1U3FA 4XDZA 2NZXA 2CHQA 4E21A 1GG5A 4K03A 1NNLA 2DTEA 3KZCA 3QTBA 1ZGGA 1CY6A 3U13A 2NU6B 3MLBA 4AVYA 4CM9D 4BN0A 5KVSA 1C8BA 3Q9UA 1ZD9A 3FF1A 1O87A 4L2IB 3CX7A 3FJ1A 1LD3A 3LY9A 1MO3A 2EQAA 4LHWA 4MAMA 4BV2A 2CXUA 4R9NA 3ETLA 3GLUA 4EIWA 1AQUA 4G1FA 2C7VA 2H4FA 1H0HA 2RGGA 5F7JA 3SEAA 2W0MA 2X1LA 4L4SA 4AZTA 3PYXA 3IPLA 2ZR8A 1E58A 2WSMA 2HF8A 2I3GA 5AW0A 1S1CA 3FCAA 4RJKA 5IAAA 2ZM6B 3WLPA 5IC5A 2YASA 4H1HA 4CMGA 2G28A 4FSHA 1EDDA 2EQBA 1AM4D 3AHCA 4M89A 5G4LA 1MAAA 1NRIA 2Q1SA 4C89A 4E11A 1DL5A 3ZWCA 3OX3A 4GLJA 5K8TA 3SDZA 4EEZA 4KBGA 2R1TA 2Z3WA 4OLAA 1MHTA 2PUTA 3GJYA 1JF8A 1IXSB 2UKDA 4TLEA 1AZTA 3DE5X 2EBFX 2VVTA 4EGQA 1JBEA 3VSBA 4DRXB 1FZQA 3D3JA 3DCIA 4KPYA 2HNBA 4KQJA 3I8OA 2BIFA 3NORA 5JDCC 2O1WA 2JAQA 5I7FA 1HX7A 1R12A 1QAQA 2YMPA 5TJ9A 2P2DA 3W5BA 4DAOA 1RLIA 4GMXA 1PT5A 4LJ4A 1NN0A 3EGWA 5FA6A 3DXXA 1J99A 4I50B 2R65A 1CUEA 4YI3A 5JNVA 3KOXA 1HETA 3OOYA 5AQEA 1APBA 5AKYA 5LBTA 4YV1A 4IMJB 3WVNA 3BIWA 4QHYA 3TWOA 4XVRA 1TEZA 3K0KA 2GYVA 1BFUA 4OSPA 5LWQA 1V5IA 1JHZA 3TINA 4KCGA 2EDCA 2H0QA 2J0UA 4ND8A 2WWWA 4KGZA 4N8DA 5C37A 2QL6A 3CJRA 3FSEA 1D7AA 1X15A 1V26A 4K9MA 1T6XA 3HBMA 4J4TA 4CL2A 1TKBA 4F91B 1WKCA 2BFEB 2R4UA 4XH9B 1TO6A 3B1FA 4MGYR 2I7XA 1DBRA 3MGBA 1Z82A 3L01A 5ITVA 5C4IA 4DGQA 1PGOA 3ESRA 3ER8A 4MLDA 4MUYA 4G9BA 4NHOA 4PN3A 1GRQA 1R0ZA 2PCLA 3LLCA 4WZBB 3O1JC 2JIBA 4P7KA 1U2EA 2GXQA 3DEAA 3LZ6A 4REMA 2VHWA 5G0UA 2J0SA 2I4NA 1ZG3A 4FLMA 4GMHA 4EY7A 3HKBB 2PBLA 3WIUA 1NI3A 1HEYA 1JU9A 5TX7A 3V4ZA 5ISMA 1G6OA 1HT3A 1XJQA 2X8JB 1ODJA 2OESA 2Q5EA 1A8UA 3R5FA 1DKNA 1QG6A 1GG8A 2BAGA 3PRJA 5BMVF 5LXTA 1QOQB 1RM0A 2J0EA 4XD7D 4ZOAA 4BLQA 1HLGA 1FCJA 2QZJA 4C7VA 2QBYA 1MOQA 1XQ6A 1UBFA 3OKFA 5DNEA 4FCVA 1B8OA 4UUQA 2UZ3A 3N3BC 4IH4A 4YO7A 1XNRB 3OQIB 4O1HA 2PWAA 4RH1A 1YDEA 3RSCA 3SVZA 1T0UA 3GUZA 2WE7A 2YINC 5CBKA 3GIDA 1LSJA 1IMOA 1GZ5A 2DH5A 1EP1B 3HZRA 3I4LA 4MUGA 4TMKA 3R7WA 3Q9NA 2H52A 2VTKA 3K9HA 3PCTA 4QNMA 2EFDB 4ZPJA 1O8BA 3IUNA 1G20E 3B1YA 4ENTA 1CF4A 4Y6QA 2G0TA 1CD5A 4LSWA 2PZMA 1F20A 5AMXA 1IN1A 3WLNA 1ST3A 2WHPA 1XRJA 3CZRA 5K3CA 2GDZA 2X23A 3KAKA 4CLXA 5K0TA 2C42A 1EPUA 3A1TA 1HDZA 4J03A 4HJRA 1DBPA 1PL6A 2XDAA 1UK8A 3T6KA 3C2QA 1MAHA 3AERA 4LK2A 3A1CA 2YFKA 4M8NE 4U1RA 2D7JA 5LQKA 5JTUA 3Q2OA 3HYTA 4GI7A 5IS2A 1PTJC 3MOSA 1U94A 2QL9A 5I7SA 2X41A 1CR0A 4OPMA 1NXWA 1S8NA 5EIHA 3LY5A 5K8LA 2PLAA 1S2LA 4RDIA 1UXGA 3LRTA 3WFZA 1PR9A 4QULA 4CF5A 2OKGA 2AFIB 2G25A 2ZB4A 2O6LA 3N05A 3ZS9A 1RRKA 2KLBA 3AZOA 1J20A 1N2OA 2VSYA 2H1CA 4KQXA 1CZRA 1KI8A 3DEKA 3SC4A 5GONF 3I45A 3F3KA 5EYPB 1W59A 3QW4B 2B1QA 4NECA 1SBCA 5F9HA 3H2IA 1Q44A 1Z4IA 2I3AA 3KFXA 3NNNA 2EW8A 1HNNA 1FL9A 4OU4A 1AB5A 2G9ZA 3U9LA 1JR2A 2FJPA 2RI1A 4QU9A 4QREA 4WOCA 2RHJA 3TRHA 3TW8A 3URKA 3A6KA 2VHJA 3GFTA 4R7ZA 3GLFA 1X1SA 3H19A 3A1UA 1VI2A 4PG8A 4XKJA 2ZB2A 5AUOB 1GEEA 3LYHA 3PGA1 2WSLA 4GVLA 4KVZA 1GNQA 3RK1A 4DIKA 3K70D 2XCQA 2Y1GA 1R4ZA 3SQXA 5M5BA 1X1DA 1U28C 1BE8A 2OBMA 3WYFA 2SHKA 3UHFA 3SFZA 2JFOA 4L74A 1SRRA 1XN4A 4S0ZA 2IEAA 3SJUA 2Z57A 2GOYA 4R69A 1XPOA 1AGPA 2R3SA 2OGWA 5DN9A 1JAYA 1T1GA 1V45E 2VUHB 4O02B 3W9BA 1E2MA 4GPAA 1QX3A 4PTLA 1PJCA 4PX9A 4RVOA 5GIPE 3C4QA 1DEAA 1K3FA 1S4QA 1WWKA 1XKTA 4ZAYA 3WYNA 4RULA 1F8UA 2IYEA 3QKSB 1Z68A 2YCLA 1NL3A 5EY5B 1LW7A 4HNUA 5BSGA 1T1SA 3HACA 3T95A 5JOQA 1W96A 1Z6YA 1SCNE 4AKTA 1O6FA 3DV2A 4UBOA 4D9BA 3BHIA 4D43A 5IUJC 3GLHA 2FG5A 3HB0A 1QGDA 2A1IA 2VT6A 1ZW1A 1O9GA 1E89A 4LRSB 2O8DB 1VYVA 4JP2A 4N5MA 1PJ3A 5JMWA 1XEXB 1CQWA 3AF6A 1C9EA 3RS9A 2I6UA 2G4VA 3OH8A 3U3DA 5FPSA 2GGSA 1TI7A 1Z2NX 5GAJA 1XEWX 2NU9B 3TL2A 1KTVA 4KZKA 1BOFA 4YMWA 4YFVA 4MWSA 1T9HA 2GCPA 3LYUA 3K0FA 1MCZA 1X1TA 1Y7IA 1VCHA 2APJA 3CT6A 4MS3B 3ZHZA 4DXAA 1QIEA 5AJTA 3X1ZA 5FWNA 4DQKA 1PQPA 3MPOA 1HRDA 4G8JA 4O6VA 5JCJD 3R8FA 1V1RB 3DVAA 1LDNA 4UHHA 3WLJA 3SHVA 4OUDB 4FWTA 2WOOA 1LFDB 2YFHA 1TVKB 4IS2A 3DAPA 2PJZA 5ALRA 5EIAA 5LWHA 6YASA 1PSWA 2PGDA 1LCIA 3FKSD 4YHBA 5LVAA 3AI1A 1KMHA 3DT6A 1NI4A 2C2OA 1M6EX 4C6RA 2B8EA 1SPXA 4QYWA 1Y1QA 2LIPA 3SWWA 5ECWA 1ZGAA 1N2XA 3NTXA 3HCRA 3VYUB 1I9GA 1RTTA 1CZLA 4HX5A 4LCJA 3UG6A 2Q21A 4HWOA 3EFBA 1I6WA 3OOWA 3LQ1A 5CM8B 1C4KA 2CJYA 3TGLA 4X92A 2IDMA 1OPXA 4B8YA 1BVHA 1UK6A 3RT7A 3EDRA 3TLZA 4PM4A 3RS5A 2IUSA 4KAJA 4ZICA 2RHGB 4C6HA 1EZZA 3PA8A 4V0KA 4ZEOA 4UXIA 2VNIA 3MGGA 1KJIA 4D9HA 4EPTA 3DBLB 2JGKA 2IIQA 2WPNA 2H1WA 3KR1A 4XWTA 2ZVDA 2WICA 4CM4A 1M1UA 3FVWA 1XZCA 3IVAA 3P0EA 2OYRA 4N3BA 2X22A 4PCUA 1UQRA 3IILA 3OEEA 2VF2A 5D3KA 2XUAA 1EINA 2CLMB 1KI1A 1P7YA 2DQYA 2YVQA 5M2QA 1FXUA 1E98A 1VG9B 1T4BA 1QVAA 1XP5A 3NWOA 4MB6A 2O48X 3V7YA 3VOTA 1OWMA 4UHJA 5IJ0B 2JZOA 3EXHB 5HHTA 3NM5A 3PT9A 1X9HA 5FOUA 2V5UA 3V8QA 2V6BA 3PF8A 1PWXA 4XM2A 4OYYA 3WGTA 4NJMA 2XUQA 3CZQA 5F98A 3AFOA 4DSZA 2RBEA 1NG1A 4A2PA 4EKDA 4JYAB 1W88B 1V96A 2Q4RA 3A6EA 3C7DB 3DR5A 5AKKA 1U2RA 2WUWE 3L7OA 4YCCA 2NO1A 4LJLA 3HKCA 2B2XA 2EQ5A 3HXQA 4P80A 3AMVA 3UCEA 1K7EB 4TXMA 3V8VA 3OSUA 3GCZA 4G4SP 1PK7A 2F3PA 2VCYA 3ZWKA 3ZIDA 1W6UA 4O5OA 2QI9C 4JI5B 1D8AA 1E3WA 2FE4A 3LBYA 1CZOA 2WAYA 4I1VA 1MABB 1N3LA 4E5DA 4WTOA 1YRHA 3V97A 1UMCA 1SC9A 5T4BA 1Z9BA 3UV6A 1KPGA 1D4AA 1EHCA 3JQBC 4MCJA 4ENVA 1ZJWA 3TOSA 2AJLI 1KQNA 4E88A 2H63A 2PGNA 3H99A 1GPNA 4IGKA 1X1CA 3P2KA 1NJ8A 1NX6A 4PGFA 3ZY3A 4O4IA 2ZJ0A 2DH6A 2PMDA 5DHRA 1CX9B 3A06A 3TTYA 1QKIA 2CKDA 2FR1A 2O7QA 2ONZA 1V8BA 2WF5A 1L3IA 3P0IA 3AWIA 2FPRA 3F4BA 1BN6A 1OIXA 2XA9A 3HCOA 4OB8A 5SYNA 1ORWA 3RS7A 1G8HA 1PS9A 3VSAA 1G6HA 4D0NA 3QE4A 2BH2A 1Y6GA 4ZO9A 1EP2B 5BWLA 5DYYA 3SBDA 3WGJA 3I4CA 3LOQA 1JHYA 1JLKA 2JGMA 1N9ZA 3CW8X 5K6AA 1EX1A 2ZUBA 3O74A 4YAFA 1TYZA 1OIWA 1RWQA 4HGPA 4EY3A 1RHJA 5EVJA 3KPJA 5EJ6A 5IP5A 4UEOA 5JHHB 2AC4A 3UJNA 1T6BY 1D1QA 3MMSA 3STVA 2I34A 3EOBI 4D45A 3CG0A 3EVCA 3IQEA 3E70C 3GLRA 1GKYA 5CT4A 3RLIA 4F4IA 4ENUA 4WWHA 1AXEA 2PUWA 4AF6A 3ZDZB 3NASA 1Q91A 4HEA6 1JEQA 3WMWA 2VJAA 5ALOA 3OJEA 1IHOA 1Z26A 3GZJA 4P4TA 4RZ2A 2AEFA 3F7OA 5K0NA 1KC1A 3HMKA 4LXHA 5BVHA 1GR0A 3W5VA 2C98A 1NW9B 4OI1A 2XWSA 1CZHA 1Z25A 3QKTA 4AW9A 1W19A 2WG1A 1DUVG 2GZ3A 3ZEIA 3Q88A 4KE6A 2Z2ZA 4LFBB 3OJXA 1OH7A 1MRSA 1N2CA 2I1WA 3K09A 1E1CA 4WLEA 5CLLA 2RIRA 4BAZA 2HXYA 3K9LA 4C3UA 3SQLA 3B82A 4KQFA 3SQDA 3RFFA 3ZLBA 1L0BA 1QH1A 1FK8A 3AHEA 4G5YA 4MS4A 3W7VA 1SG0A 3I5YA 4X3PA 5FWAA 4QOJA 1ID8A 4HNAB 4FLEA 2YHAA 4PO3X 4QFDA 1CXZA 3IBGA 5HA5A 1DLIA 3NEYA 3UM9A 3O03A 3QQPA 4FCTA 3H2SA 5ECDA 3TPZA 5BQFA 3ZNQA 5AK6A 1ATIA 4OOFA 4PC6A 2A9RA 1II0A 2Z4SA 2J5BA 4YH1A 1PDWA 3ZVNA 3DMGA 2Q7XA 2OZEA 2VUIB 3A0UA 3HCEA 4MUKA 1W0KD 1UF9A 2F00A 2AX3A 3C5VA 2VBFA 3Q3VA 1BYIA 1T36A