1MO5A

Reca-atp-gamma-s-mg complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
317
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords RecA
total genus 81
structure length 317
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo5A01
5DI3A 4WA7A 1JNYA 4ZCIA 2VP4A 2XSZD 2UKDA 3N5CA 1J2JA 4PC1A 5JS7A 1TAGA 1IM2A 1XWIA 5AJWA 4TL9A 5FBRB 5TV2A 5FUXA 1HT1E 3QXXA 4IDPA 2FFBA 2GK6A 1CKEA 1F60A 2V7QD 1N0VC 4RD3A 3CX7A 4HB2A 3VNVA 1KI4A 3CF0A 3B8HA 4QHYA 3AM1A 2NOAA 1U90A 1E2GA 4PX9A 1KSFX 2FSFA 2IL1A 4TZ6A 4TMVA 4B74A 2AFHE 4IDQA 2V6IA 2GCNA 1WBBA 2NO6A 4KJZA 4PQFA 3QNUA 2B7CA 4TWZA 2IUSA 3OIWA 4CW7A 3UANA 3CR7A 1S9DA 3LLMA 2ATXA 2GAOA 2CE2X 1YRBA 3WXMA 4PHFA 4CEJA 1HA3A 2CCGA 4YC7A 5DLQC 1JXOA 3THWB 3QKRA 1ZIOA 2G0NA 1AZSC 2ZE7A 2XZLA 2ZVQX 3LH5A 4ZIRA 1RRPA 4PR0A 2IYVA 4NCIA 4EJSC 4PANA 4DUGA 4V02A 4JSTA 2R6GA 4F93B 2ODWA 5CLLA 1RW4A 3ND9A 4IOMA 4MYTA 3B2EA 3GLHE 1X1RA 4P4SA 4M9SA 1UKZA 4OHYA 1RPZA 1XTJA 1JBKA 2OLJA 3GJ5A 1LTQA 3AVOA 3ND8A 3SI7A 4I1SA 4MYHA 2GILA 4KV9A 3OFNA 3QBTA 2YC4C 4DLVA 5HR5A 3NBZC 1DO2A 1W5TA 1UAAA 2OM2A 2RGBA 1OSNA 1OXXK 1SKYE 3FTQA 3K09C 5IRCD 2F1RA 3LBNA 1G8YA 3CKLA 2O8BB 1VIAA 4TTQA 3GJXC 3IQWA 5A0FA 2NPIA 4JLMA 4W7SA 2FE4A 5KOYA 4A0FA 1DAGA 4FMCF 3R8CA 1WQ1R 3TKLA 3Q8XB 1FUUA 2GXUA 4XTCS 1R0YA 3EIQA 3SFVA 2WJVA 3B60A 2WMOB 1LS6A 4MH0R 2MSCB 5LPNA 2REXB 2XJ4A 4URZR 1KDPA 1DOAA 3WMGA 4Z1MD 3Q85A 1M7BA 2NZJA 3CNOA 2G3YA 1ZD9A 2FPKA 1S9HA 2QENA 3D31A 4AG5A 1NN1A 4B2IA 5HZHA 1OIWA 4BLOA 2EVWX 5FBVB 2GAAA 4PTLA 4NCKA 5E7IA 2XX3A 3BH0A 2VSFA 1R0WA 2VP9A 2C9OA 5H8WA 2PCJA 3KB1A 4Q48A 1HE1C 2NO9A 3HU1A 4QM6A 2R44A 2IXFA 1TF2A 2VHUA 3ASZA 3IGFA 1XEXB 3R7WB 5JI2E 2ZI4A 2JDID 1T8TA 3AVPA 3B13B 5F9FA 3R9WA 4M1MA 3SBDA 3R8FA 1M2OB 4AKEA 4PSVA 1E2HA 1KMHA 2QN6A 2ZYWX 4ZDKA 1XZQA 2Q9BA 1BMFD 1U0LA 3IHLA 4X8HA 1T9HA 5FBLB 4PAQA 4EJSB 1FP7A 3H4MA 1WBDA 5B57C 2CHVA 2EWVA 3T15A 1T5IA 2GKSA 2XZOA 2H17A 3NIBA 1U9IC 2I1VB 3EPHA 3TAUA 1OHHA 1S3GA 4MKFA 3GLFB 4RFVA 3BC1A 4FMDB 3THXB 3IKJA 4DSNA 1J7KA 3K9GA 3VKWA 2HLDA 1K5GA 4NONA 3QKSA 2VPPA 2GEVA 3QPUA 2R65A 2D06A 2PEYA 4A0GA 1FW6A 1F2UA 1KI8A 3HR7A 2FV8A 3BB3A 4DKXA 3LQQA 2CNWD 2CMKA 3U7EB 1W1WA 4TYQA 3CZQA 5B58C 2XAUA 2A5YB 4TN1A 1F2TA 1Z6TA 1UDWA 4QRHA 2ZANA 3W6NA 1AS0A 1P2SA 2XTNA 4HZIA 1C9KA 3LO5A 4BECA 4ZPXA 1XCGB 1XX6A 1GKIA 1VMAA 2QP9X 3THYA 2Z83A 4IOKA 4R2IA 1T4GA 4ILEA 4JKIA 1ODFA 2QMEA 5HKKA 1UF9A 1YR6A 2IXEA 1ZRHA 3RSLA 3RS7A 1ZINA 2QEQA 4WZAE 4MYCA 1QVRA 2WIBA 1E1QA 2YINC 1VYUA 1GILA 1XP8A 1WP9A 5J4HA 2FSIA 1WDTA 2GJSA 1PV4A 1ZCBA 2LKCA 3RYTC 3C5CA 4JLNA 3ZS9A 1E2DA 3ADCA 5EE5B 1NLZA 1XEFA 4BFWA 4JLBA 1S4QA 4D0NA 4K46A 4DLRA 1TU3A 4ERNA 3B9QA 3I73A 1P3JA 3SEAA 5HCNA 3AH8A 5LD2C 4M9XA 5BN5A 3KJGA 4JLKA 4V0MA 2NIPA 2QT0A 1KO5A 3CWQA 3KFXA 5JCZA 1VCMA 2C03A 1T6NA 3RRNA 1R5OA 3ZH9B 5HCIA 3E2IA 4N0EA 4XSHA 4Q1BA 3U5ZB 3CO5A 3E5HA 2BV3A 2VIIA 1GNPA 2Z5FA 5UKDA 1FTSA 3VMFA 1Z5ZA 5F2EA 4B48A 1US8B 3KKMA 4Z8YA 4UNPA 4LHWA 4C0LA 4C3ZA 3RRYA 2R2AA 3IPYA 3AUYA 4C4PA 1EK0A 4M8NE 5AUPB 3CUEF 2NO0A 3RS4A 2NQ2C 3PEYA 1TQ4A 3VR1A 2X8AA 2ZJ2A 4A0HA 1E9FA 4C0HA 4HAZA 1XMVA 4RCZA 3ZVMA 3SE0A 1G291 1LVGA 3L43A 4B3FX 5C4MA 4UXIA 3BOSA 4QG7A 5EP1A 3V4FA 1AN0A 1A82A 2RB4A 4ZDJA 4EPYA 2PL3A 2OFWA 1E2NA 3QF4A 5C4GB 2PMKA 2VO1A 1KKMA 4LYFA 4Q19A 4YLGA 1JR3A 4P33A 5JRZA 1Q21A 1R10A 5FR2A 3P4XA 3RS0A 3BORA 5KO2A 5B2ZA 2QMHA 2V9PA 4D4MA 4HEJA 3TW8B 1DEKA 2QSYA 4D25A 2JIZA 2ZVPX 4EPVA 4R71A 4CIDA 5AJZA 1R2QA 2BBOA 3FDIA 5J4LA 5FTJA 1UBCA 4MA4A 2CCKA 2DPXA 1M7GA 2QORA 1CR0A 3D7MA 1N6LA 3PUYA 3PEWA 2FJUA 1OJLA 2CJWA 3U3KA 1G8HA 1OIVA 5HPYB 4AURA 2A5JA 3H84A 4R9UC 1VIYA 2FPMA 2DFTA 2OESA 4LYHA 1F2TB 2Q3FA 2WJYA 2E9SA 3I32A 1NKSA 2YWFA 1XD2B 2OXCA 1II9A 1XDBA 1RZ3A 1IY2A 3L0SA 4UQOA 4UNQA 3TRFA 3W3AA 5H70A 2IWRA 4B6FA 1SQ5A 3KQUA 4C2UA 2GJ9A 3G5UA 1KNXA 4S2EA 3BFKA 1MRSA 4QGFA 4RD4A 1G4UR 3EG5A 3QEOA 2BCJQ 1Z07A 4XH9B 1E1QD 3CPHA 4B3CA 3VU9B 1IN8A 1QHHB 2O8FA 4Q1AA 4A8JB 1COWD 4R7ZA 1HTWA 1FX0A 3DMDA 5FH9A 4DSUA 3X1DA 1Z83A 1PZNA 1E6CA 2F6RA 1KSGA 1NY5A 2GXQA 4CRWB 1GWNA 4DLTA 2D62A 2QBYA 3AVYA 2AX4A 2ZE6A 3F0TA 1Q0UA 2X2FA 3D6TB 3DM5A 1R8QA 1E9RA 4IFBA 2BEKA 3L8YA 4TZ0A 4AD8A 1A2KC 2RGAA 3QKTA 2RKOA 1YVDA 3SJAA 2ZI3A 2J87A 1M7HA 3BH7A 2QU8A 1IAQA 2J0VA 4ITRC 4JBYA 4LRWA 4QGAA 3U3OA 3GLHA 1G3RA 2GRJA 3S1AB 5JFGA 2ZROA 2VLIA 5FUYA 3P32A 5G3YA 1DAHA 2C95A 2OBMA 4B71A 4B6EA 5CITA 5IT5A 2P67A 1J90A 2ASEA 2QY9A 4LBZA 2P3SA 1ZM3A 3GQBA 4M1OA 5C46F 4Q4HB 1W44A 2ATVA 3B1WA 4F38A 1CS4C 4S35A 1E3MA 1N5JA 1GAJA 2ZRBA 3X1YA 1UBFA 3RC3A 1FP6A 3UK6A 2G0TA 1EWQA 2XOKD 5A5GA 1EFRA 1OXVA 1E1RD 2ZRFA 5G3ZA 5J4YA 2AK2A 3AVQA 3N2EA 1FZQA 1G3QA 2WJJA 1OT3A 2GCPA 2ZUCA 2JLZA 1N0UA 4B34A 2GBLC 1UPTA 1S96A 3IO5A 5DYIA 4XD7D 2CNWA 5CIQA 1E9BA 2D74A 4FXPA 1BO6A 1RRGA 1H8EA 2BVNA 2JATA 2WMNB 3SZRA 4TTRA 4RD0A 5CK4A 2AN9A 4DT1A 4NP6A 4DCTA 2WOOA 3DVLA 1W36C 2P5SA 3B1VA 3IPXA 4CDGA 1MO3A 1SVMA 2CK3A 2O0JA 3REGA 2O0KA 4HAUA 4GPTA 3ZD6A 5ELXA 4KSCA 4PFSA 221PA 1F3OA 2C9CA 4PZZA 3GJ0A 2GK7A 4URYR 3W34A 4E07A 1UADA 1OFIA 2LKDA 2V54A 4UJ3A 2HCBA 5KSZA 5M04A 2ZSEA 3RS2A 4EKDA 1A5TA 4RY2A 2P6NA 2V7QA 2ZRGA 2BCGY 4RFSB 2C99A 3NC0C 1SXJC 4LGMA 4IOLA 1G18A 3OESA 2OCAA 1GKUB 2VQSA 3ZZUA 4US2R 2BJVA 3C4JA 4QFMA 5FFMA 4JLVA 4R98A 4LBYA 4DLZA 4AKIA 2C8VA 3NHAA 2VBCA 2AK3A 3HJNA 2IS1A 1TQ2A 2O8CA 4GP6A 4OL0A 3TJZA 3UATA 5FL7D 2GZAA 2NO1A 4RKFA 3VKHA 1U99A 2PZFA 1AIPA 3R9XA 1R0XA 1NL3A 5DISB 3TSWA 2QL6A 4ASUA 4CEIA 1KSJA 1G8GA 1E0AA 3BBPA 4NU0A 4TLDA 2B92A 2QA5A 1Q3TA 3Q7PA 5HTKA 2Z43A 721PA 1TF5A 2QE7D 5BN4A 3K0EA 1XCMA 4LV6A 1JECA 3P4YA 1BIFA 1CJMA 1XXHB 1L4UA 1N6OA 1S2MA 2IUTA 3DMNA 3RLFA 621PA 1C1YA 3WYGA 1IOZA 1KYIA 1MOZA 1YHNA 3KUCA 3KXLA 2HT1A 1H8ED 4C7OB 1V5WA 2F9MA 1E96A 4P32A 3WYAA 3PR1A 2OO7A 4JBWA 2CCJA 3K0FA 3AEZA 2W0MA 4O0MA 2ZE5A 5AUQA 2PT5A 4I1OA 2PMDA 1TMKA 2E1RA 3LX5A 4KVGA 4YMUA 3C8UA 3G82C 3GEEA 1NVVR 5JCPA 2XNDA 4RD6A 3PQCA 5AR1A 4CEIB 3MSXA 4LHVA 4MGKR 1NJFA 2WZQA 5LBIA 2CL6X 4UNRA 1CRQA 4RVCA 5L3QB 3PUXA 5EXTA 5BYJA 3CPJB 3EPLA 2EW1A 3K1JA 2Q21A 4JT4A 1R4AA 2Z4RA 3RC8A 1KAGA 1JR3E 4EDHA 3ZIAA 5JWHA 3TUZC 3E70C 1N3BA 3TQCA 1CF4A 4L8GA 4IRUB 3NEYA 1E2IA 3GPLA 4EFMA 4U02A 5EP2A 4L4UA 3IBGA 1KI1A 3LBIA 3WMFA 3ZVNA 2X1VA 3NH9A 5F9HA 2N1BA 1WXQA 2RGGA 2GJKA 1RVDA 2ONJA 1GNQA 1MV5A 4JLAA 1TTTA 2FFQA 2JASA 4XJXA 1KKLA 1OPXA 1OH7A 5KUTA 1ZUNB 2J7PD 3QXCA 4IW3B 2A2ZA 1OXTA 5DI9A 4TLAA 4QBIA 2LWIA 3KB2A 5JS8A 3DM9B 3KTAB 3QXSA 4HDCA 1RFLA 1EWRA 4NDZA 1KSHA 4LC1A 4FMDF 4G5GA 4JIMA 4BFYA 1NIJA 1KOFA 4II7A 2AHOA 2ONKA 1U2RA 2ZEJA 3BD9A 2BDTA 2IC5A 3BWDD 3RDPA 5FPKA 3L8ZA 2Z6VA 4MGYR 4OI0A 1AQYA 3AP2A 1KI9A 2H1LA 3CH5A 1RE0A 1G20E 1E2PA 3TGPA 3V00A 3FKQA 1RJ9B 1JB1A 2YYZA 4LUCA 2P6UA 2VSOA 4TLEA 1M1YE 3QE0A 4KFRA 3LAWA 5GJCA 4Q4HA 2CJWB 5AJYA 3X1XA 5JJIA 1EXMA 3Q5EA 1SVOA 4ZCMA 2OILA 2A3RA 2D2FA 2WKRA 2YOHA 5JEDA 2MSEB 2VF8A 4Q4AA 3K0SA 2FMXA 3MAAC 4OK5A 4HUQA 2OSBA 3AVVA 3PV0A 1E94E 2SHKA 3CRW1 1HUQA 5SZHB 2VH5R 1Z0IA 2WAYA 3BB4A 1OF1A 1U8YA 3C5HA 2BC9A 2ZM5A 2ZR7A 4MGIR 1E9SA 2WJHA 5CB6A 1W4CA 4H1UA 4LWZA 1YZTA 3K70D 3QF4B 4KI0A 1AK2A 4NYMQ 4B2PA 5JMTA 1OH6A 3MFYA 3U3JA 4NCNA 2QPTA 4A9AA 3RNLA 1NSTA 2ZI7A 2FNAA 1IY1A 4BUJA 2WKQA 1E98A 2J9RA 3DOFA 5CJPA 1XMSA 4KFSA 1T0JB 3MJRA 4MKIA 4MKHA 4Q9HA 3O47A 3Q5DA 1GNRA 3TQFA 2REBA 3Q7QA 4KO8A 2CLDX 5FBWB 4FN5A 2L0XA 1NVUQ 4IEEA 4L9WA 5JHGB 3A36A 1XEWX 2CXXA 2IS6A 1XD2A 1HY3A 4TL7A 1GITA 3ZYCA 5KSOA 2DB3A 1SVSA 2EYUA 1N6RA 2F1HA 1SULA 1W0JD 3BGWA 3OIVA 4EFLA 3GLFE 5FOVA 1QHIA 1X3SA 2GBLA 4JLJA 2C2HA 4B33A 4G01B 5DYGA 3A6PC 1HE8B 2Q9CA 4DLXA 1AS3A 2CEAA 2QTHA 5J47A 1MH1A 4EPRA 3I5YA 3EZ6A 3KKQA 1G17A 4ZO4A 1CLUA 3OEHD 2WKPA 3RS5A 4PPQA 3V9PA 3T1OA 4NYIQ 3TVTA 2VHQA 4L9SA 4I81A 1XPRA 4P4SB 4AKHA 4YXWD 2RGCA 2EFGA 4Q9IA 3K9LA 5EJEA 2HUPA 4K8OA 4GOJA 1E0KA 4BLTA 4EPWA 1AGPA 4NYJQ 4KLZA 1YE8A 3P20A 2AXNA 4FD2A 4GMDA 1ZNWA 2V4ZA 3P1JA 3FVQA 1NMZA 3WBKA 2G77B 3LLUA 3VX4A 4CZ2A 4FWTA 2ZYUX 2DCUA 5FR1A 5L3SB 2XSZA 4LHXA 4F92B 3W90A 1OV4A 2OBNA 2NG1A 3OIYA 1HEIA 1EFCA 2UZ3A 2WWGA 5JJLA 3T35A 3U2QA 1R5BA 3CNLA 4PHTA 2ZJ5A 4JL8A 1Q22A 3ADBA 1D2EA 4G3XA 2EYQA 4KCGA 5KPDA 1US8A 4B3BA 5FUVA 4PC2A 1KI3A 3RVBA 4JVMA 2W6IA 4HAYA 4PQRA 4RZUA 4GDFA 1PLJA 4IJMA 2ZU0C 3EAQA 5G40A 2QGNA 4KBGA 4OHVA 2GF9A 5JSZA 2BMJA 5DHFA 4IVRA 4YMVA 1Y63A 2AR7A 3SN6A 2QGZA 4UNNA 1XD9A 3A8TA 3TH5A 1CXZA 2BWJA 5DN6A 4ZKEA 5KU1A 3ZD7A 1VCOA 4FMBB 3AKEA 2PJZA 3NBFA 2C98A 4TL6A 1CR2A 1IQPA 2I1QA 2GZHA 4IVQA 4C0BA 1GTVA 2XXAB 2FF7A 2JLWA 1Z22A 2XTZA 4DCVA 2IYTA 1CTQA 2ZR9A 1RYHA 4QL3A 3O8BA 3HR8A 1OXSC 4MRSA 3BE4A 4G0NA 4Q1DA 3SJZA 3TBKA 2YWHA 3ETLA 1ZJ6A 1CR1A 3EARA 1ESMA 3QPVA 1ZAKA 3K0CA 4B32A 3B85A 2A5DA 3SOPA 3CW2A 1QRAA 2GVZC 4DDTA 2C77A 1SXJB 1YR9A 4C0QC 3BAFA 3IQXA 4GMXA 4D2IA 4HUTA 1CULC 2A30A 5AWFC 1E9AA 3GP8A 2OUKA 4IKEA 5FL7A 2RGXA 4KHZA 5FTMA 1W47A 3MWYW 2EFHB 3FHTA 2JLRA 2WBLC 4FWIB 1CJUC 2Q3MA 2RHDA 2WAXA 2CDNA 2DFKB 3X1WA 3Q72A 3VQTA 2WWFA 3SS8A 2HLDD 2IF0A 4HATA 4LZZA 3PXGA 1XCPA 4UXJA 4DLUA 421PA 1VCIA 4PC7A 2B8TA 4QC2A 4C0AC 2GTPA 2WWHA 3F5FA 4NYIR 4XTRA 1AS2A 4DCUA 2XZPA 1KAOA 3DKVA 3HP1A 5G53C 1MRNA 5FPTA 3LXXA 4AG6A 4F7WA 4US0R 3H2YA 4XVRA 3EWAA 2BBSA 3CNNA 2QAJA 2BIFA 2UVQA 5JECA 1KO7A 2DBYA 4FINA 2CVFA 1I2MA 2P2LA 4DZZA 1D2MA 1P73A 3T61A 3VNUA 1VG0B 3V4RA 2YWEA 4IOJA 4A0RA 4E22A 2P0EA 1JJ7A 2J0SA 3KUDA 1W4BA 4QGGA 3NDPA 5E7MA 1SKYB 1KMHB 1DBSA 2IS2A 1G3UA 1P2UA 3GLHB 3EIHA 4NTZA 4Q4JB 2YOFA 5F98A 4HUQB 1IXRC 2F1IA 4FCVA 3A4NA 3PUVA 3HYTA 1TX4B 3CB4A 2JLUA 2N42A 5G41A 3QVUA 4CGZA 4DBLC 3PITA 1JPNA 2CLCX 1SVKA 2CE7A 1D9XA 4V03A 3IEUA 3JVUA 3B1YA 2Q3HA 2PBRA 3AF4A 1M74A 5TARA 3L82B 2CK3D 1UBEA 1W2HA 3GFPA 3SDZA 3ZDQA 4AY2A 1CP2A 4A8JC 2FX3A 3D8BA 1NY6A 1G3IA 3EZFA 3T06B 4LJ6A 3FE2A 4AYTA 4XWAA 4Q7KA 4DRZA 3UPUA 2RAPA 1Z2AA 1J70A 3U6KA 1G6OA 1SXJD 1KZ7B 2KBFA 2QMOA 4V0LA 1AKEA 3FYHA 4MQBA 3U61B 1CEEA 2RHMA 4A6XA 4LJ4A 2BMEA 3R20A 1E9CA 2KI5A 2FG5A 5FBQB 4EAQA 1N6KA 1Z6GA 1D6JA 3BB1A 1VTKA 2OV2A 1KO1A 3A58B 4C9BA 5CDFE 5ANRB 3SQXA 2CVHA 2H16A 3T34A 1EFUA 4BRUA 1UDXA 2EFCB 2JLSA 3R9IA 1FTNA 2ZS9A 1ZNYA 1IONA 4GOXA 1P61B 1DG3A 4KXFB 3AP1A 3BH6A 3VTKA 2IBMA 4R2HA 1UKVY 2CHGA 1ANKA 1JR3D 2D3WA 4UJ5A 3ZZTA 4QJ3A 4M1SA 1LW7A 3ZLJA 3AP3A 3AVXA 2CLSA 1MO5A 1IXSB 2IK8A 3TE6A 2BOVA 1T3SA 2KSQA 4LK2A 1S1MA 4DWJA 1QHGA 2GXSA 3RRZA 1AQUA 3I92A 1TEXA 1XTKA 2QRZA 4DJTA 5IHPA 3FGNA 2F43A 3A1VA 1DARA 1R8SA 4NHOA 2XNDD 1WMSA 1OKKA 3K0FB 2QP3A 1S3SA 2F9LA 2ZRKA 1CJVC 3T1VA 4DSOA 1U0HC 5CIWA 3IDQA 1ZM4A 1Z06A 4DCSA 5BYKA 1LNZA 2R6CA 4DT1B 1QHHA 1G1MA 4JBXA 2DWOA 4LPKA 2W00A 1TL7C 4B3XA 1QHSA 1S8FA 3F3YA 2V3CC 2RGDA 3OZXA 1ZD1A 4A2PA 4HLDA 5J4VA 1GVNB 1UKYA 2YZ2A 1T0HB 2Q9AA 2D7DA 2YVUA 3MRSA 4GT1A 2O52A 4N3NA 2G88A 1K8RA 1J99A 4FMCB 3VHXA 1G9XA 1G7SA 3AGPA 1W2GA 2B7BA 1O3YA 4Y0AA 1BS1A 2ZSBA 4RD1A 5EQTA 4EJSA 821PA 2ZJBA 5AJXA 1KI6A 2PLRA 5JEEA 4M9ZA 5AJVB 1DTSA 1P60A 1KI2A 1BH2A 3SU8A 3GLIA 3C15C 3WHLA 1Z2CA 4YDSA 2PH1A 3W5JA 4EQ6A 4TMXA 3B82A 4OHWA 4Q1CA 5KSYA 3BJIC 2Q0HA 4WVFA 1HT2E 1MT0A 5GVRA 3UMRA 1KJWA 5CB8A 4B35A 3VKGA 3OEED 3W8NA 2QE7A 3I8XA 3KZ1E 4LV5B 1E69A 4PZLA 5EE0A 2JDIA 4DVGA 5FI0B 2ZYVX 1XTQA 4ZCLA 4GNKA 4JS0A 4Q01A 2JAQA 4PSKA 3C7KA 5JBQA 2E87A 2ZRNA 5KNCA 2R6DA 4OQNA 4RZXA 1QZXA 1F48A 2QZ4A 2OZEA 1A7JA 4A2WA 4QJ5A 2BMDA 1GL7A 1TEVA 3KKOA 3PCRB 1OW3B 4V0NA 4GL2A 2J59A 1ZNXA 2QAGA 4NCJA 2WPDA 3KKPA 4Q7JB 1G4AE 1W0JA 2H5EA 2O5VA 4JVNA 3UMFA 1VHLA 4URXR 4AC9A 2MSDB 3RANA 1FPMA 2PLFA 2IEYA 2IW3A 2VHJA 1TQ6A 3B9PA 5CLQA 4Q9JA 4O3MA 3PUWA 2IX3A 1Q1EA 3CRRA 5FOSA 2GCOB 1XTRA 1E2FA 4GI7A 5FOUA 5C1BA 2C96A 2XTMA 2HF9A 4HI0E 2GDJA 1SXJE 2VF7A 2FEOA 4LJ5A 3CIOA 1N5KA 4LOAA 5J5CA 4D81A 3PENA 3LNCA 5BXQC 2R9VA 3MCAA 1U94A 2ZSDA 4DLYA 5FOWA 4C0SA 3QF7A 3S1AA 2HCJB 5KPJA 2NMVA 2KWIA 2HV8A 1HYQA 2HT6A 3IIMA 4CVNA 4CT5A 3AGQA 2NO7A 2IWHA 1L8QA 4C2TA 1E2KA 4MRRA 3WY9A 5GVSA 1MR3F 3A4MA 4C0KA 4TYYA 1NP6A 4Q4JA 3KQKA 3AVTA 3EC2A 4HDOB 3CLVA 2AWNA 3WNBA 2XITA 3U3MA 2IYLD 4URUR 4F4IA 1ZVQA 4KITB 2R6AA 3I4LA 2V1UA 1NLFA 3FOZA 3QXJA 4DB4A 3QY0A 1FOEB 1O87A 1P7CA 3NG1A 3RWMB 4ABYA 1EESA 3LV8A 1F6BA 1NRJB 4UNSA 2QUZA 1P9WA 5FL3A 1G5TA 1N5LA 1G8PA 1P2TA 1XEWY 2FOLA 1XRJA 1W0KD 5FTLA 1KDOA 2GEDA 3C14C 4WOPA 4ZI2A 1PVOA 5EXXA 2OCPA 1AJEA 4JJKA 2GWHA 1P9NA 2ERXA 1W36D 5EZ6B 1XPOA 2VEDA 1KK2A 3W9YA 1TUIA 3AQ4A 3L0IB 2QM7A 4IDNA 1E2EA 1ZM7A 3U6BA 1GL9B 1NBME 1AKYA 3ZVRA 3JVVA 2H18A 3RWOA 1NIPA 4LJ9A 2ZAMA 4MYUA 4AYWA 2CHQA 5E3HA 2VRWA 4Q1EA 1KIMA 3EC1A 4PPFA 5A4JA 3QBVA 4HB4A 1TF7A 5CM9C 1K5DA 3ONWA 4HZUB 5D3MA 1GM5A 2JLVA 4G5OA 4GOKA 1DE0A 4OJKA 4PHHA 3NWJA 2BMFA 3DDCA 2OE2A 2HF8A 4POAA 5J40A 4D4JA 1DG1G 3TSZA 4PXAA 2IYWA 5FUWA 3ADKA 2JJ2D 4L5BA 3UIEA 3BXZA 3O8RA 3LWNA 4JLDA 3UWKA 1P4SA 4EFNA 1J8MF 1ZUIA 3GLGA 2WIAA 4P4UA 3B1ZA 5TXGA 3O8DA 3NXSA 3OE7A 1RC8A 1D2NA 2VP0A 4KAXA 5HKKD 1YZNA 4I99A 3R7WA 3B78A 3A1SA 4BZXA 2BM1A 2GCOA 2H57A 1U81A 3WYFA 3PEUA 2AFIE 1XD8A 3RAPR 3EASA 1OFTA 4XOIA 1Z6AA 3SHFA 4M9QA 2ZJ8A 5DNYB 3U60B 1NVXQ 4A8JA 4Q47A 3EPJA 5LD2B 4AK9A 3A1UA 4XVUA 2TMKA 4NCHA 1R7RA 1X8KA 1DPFA 4FCWA 3REFA 4B47A 4CEHA 3FMPB 2IYZA 3KJIA 2AKYA 1IJEA 1FNNA 2GA8A 2WSSD 2X19A 4CEHB 2KBEA 2YV5A 1VHTA 5KNBA 1KY3A 3CRMA 2AD5A 2RGEA 4QXAA 2B21A 3Q3JB 5IDVA 3RSOA 1NN5A 2DR3A 3KTAA 2W2XA 3AF1A 1ZU5A 4KVAA 2BKUA 2ZJYA 4QNRA 1H8HD 2BKEA 4BQSA 1FFHA 5FOTA 1RRFA 1NN3A 1E0JA 1GL6A 3K8YA 3AB3A 3VR6A 3UG6A 3SFZA 1ZCAA 5CYPA 3GLIE 4OI2A 1HH4A 2WWIA 2QG6A 4BEJA 1BYUA 1UKEA 3QQ5A 2F55A 4P4TA 2G9NA 1MABA 3QUSA 1QG4A 4LPSA 4RSGA 3SBEA 1HURA 1J8YF 4GZLA 1R6BX 3FMOB 2GEUA 3MWLA 4HYYA 1IHUA 4OK3A 2JLYA 5SZJA 1UJ2A 3MG9A 1XMJA 2OAP1 4BLSA 4TLCA 1V43A 3ZZ0A 3SQWA 1IBRA 2PX3A 2ZI9A 4HAWA 4BLQA 1QVAA 3IIJA 2DY1A 3DO6A 1CIPA 3LVRE 4OKSA 3VFDA 3K70C 2WJGA 3KQNA 5KSPA 4HZUA 1N0WA 2ZITA 4IDOA 1LS1A 2GVDC 5D3MB 2YJTD 5JSZB 4Z1MA 1ZP6A 1D9ZA 2HDNB 5EE3A 1KK0A 3O8CA 4AKGA 1CU1A 2DHRA 1B0UA 2YNMA 3GJ7A 1N25A 2FSHA 3U4QA 2WICA 4DB2A 2QQEA 1L4YA 1DAKA 4Q9KA 1KNQA 1SHKA 4OI1A 1Z0KA 4JMPA 4ZDIA 1ZC4A 2ZE8A 1E2LA 4WXRA 3FKSA 2GHIA 4W5HA 4WXPA 2O0HA 4Q21A 2XOKA 2VHTA 3ZVLA 2FPLA 4DLSA 4RZ2A 5GJBA 3ADDA 4A82A 1U9IA 1ZBDA 4QHSA 1YZUA 3NVAA 1DAMA 2FZ4A 1I4TD 1YZKA 4D26A 2EU8A 4LJAA 4DSTA 4I4LA 3GD7A 2VTKA 5DH9A 1UBGA 1LY1A 1BOFA 3AVUA 2ZRPA 5CYOA 3EPKA 1ELOA 4HLUC 5EE9A 1DELA 4ACBA 1BMFA 1VCNA 1XTSA 5TVKA 2RCNA 3M6AA 1JEDA 4D0GA 1XJQA 1II0A 1W48A 1A2BA 2QPOA 3HYRA 1N6IA 4V0ME 1N6NA 3GMTA 3AKCA 4BLPA 4Z8XA 3BFVA 3K0CC 5KYKA 1TADA 2GETA 4L15A 3FKSD 1IN6A 3MWKA 2X77A 1GRRA 4Q7MB 2FFHA 3FWYA 3NDBB 4QM7A 1FNMA 1ETUA 3CH4B 2FWRA 3I8SA 4W9MC 1NG9A 1M8PA 3ICEA 2IUUA 4B75A 4DHEA 5KDDA 4WAUA 4A2QA 5FPYA 2ZSFA 1NG1A 1Z6YA 3X1ZA 2RGNC 3AVWA 1YZQA 1LV7A 1IXZA 4XWOA 2VL7A 3QEJA 3TIFA 3AUXA 1L7VC 5JJKA 1NN0A 3EXAA 1D8TA 2JLXA 3AKYA 4YMTA 4QBHA 3QENA 3ZGXA 4U7DA 2JGNA 3X2SA 3ICQB 4RKEA 3CF6R 3CRQA 2GJ8A 1KO8A 1Q44A 2QAGB 3C41J 1E2JA 1TQDA 2QROA 4BFSA 3K0AA 3MMPA 2W6JA 3KQLA 2PJRA 3MLEA 3T12A 1NBMA 2O8BA 5B30A 2O8DA 1U98A 1TNDA 2FFAA 3DZDA 1KTVA 1Z3IX 3CBQA 4ARZB 1Q12A 4BFVA 2XB4A 2RGNA 2FGJA 5BN3A 1E2QA 3NH6A 2JEOA 4JVSB 4WIAA 2OBLA 3N2IA 1G3MA 1A4RA 1GDDA 1M34E 4KLNA 4LI0A 2WHXA 1UEIA 4TQUS 1W49A 1C4OA 1W7AA 1VKJA 1P5ZB 5GADl 1Q1QA 1XTIA 1MABB 3CF2A 5DSZA 5BQ5A 4N0DA 3DEFA 2AKAB 2G6BA 3HU3A 3P27A 3AF3A 5JRJA 1KI7A 2W6JD 2GZDA 4XD7A 1JI0A 4X8MA 3B5JA 1T5LA 4LBVA 2ORWA 4RCYA 4B76A 3U7FB 2ZRAA 4JYBA 4IDHA 3QIAA 1LF0A 3IILA 2ZJAA 4QGHA 3THWA 4DUGD 2R8RA 2ZS7A 4ZDWA 4HSEA 4IXMA 5TY0A 1B23P 2XXAA 1AA9A 1QBKC 2QSZA 1ZC3A 4B73A 1RYFA 1FMJA 3LVQE 1FX0B 4B3DA 1ONBA 1OXUA 4OK6A 3DOEA 5SZIA 3QPWA 2IYUA 1RJ9A 5FTNA 2ZI6A 4LX0A 2J7KA 3PG5A 1X8JA 1KK3A 3RS3A 2ZAOA 1Z47A 2Y8EA 3QKSB 1KZGB 2A5GA 2WPDD 2YC2C 3LBHA 4Q02A 4A6PA 5L3VA 3PVSA 1Z63A 4YONB 1WRBA 3SYNA 3WRXC 3BFXA 2FEMA 2C9YA 4C0JA 3THXA 3VR4A 1PUIA 2VA8A 2W83A 1OFUX 5FTKA 3HPQA 3P26A 1IN5A 2OG2A 3THOA 2FGKA 4BZQA 3H86A 3BRWD 1AGRA 2WWWA 2ZPTX 2Z4SA 1EX6A 2ORVA 4LC0A 1RRCA 2PCLA 2OLKA 3KXKA 3LRPA 1E9EA 3IBYA 3TNFA 4G1UC 3OEEA 2ZRJA 3OEHA 1AZTA 5H68A 4TYWA 3U44B 4M21A 3ASYA 4M1KA 2C78A 2JIZD 3MWJA 2FZLA 3KQHA 4GP7A 1Q3HA 3GJ6A 5TDHA 4DIEA 2ZJZA 4A92A 2IHYA 3W3ZB 1F5NA 5DIFA 3GLGB 4US1R 3KJEA 4K81B 1QDEA 1H65A 2QTVB 5C18A 3FPAA 3WHKA 2ECKA 4CT4B 4DXAA 8OHMA 4PPGA 2UZIR 5JHHB 1Z0FA 3DL0A 1I4LD 4BFTA 3FMIA 1G64A 1OYWA 2JJ2A 4CYMA 4JL6A 4LJ8A 4NBSA 4GZMA 2F7SA 2PZGA 4OBEA 3EZ2A 1RIFA 1SVWA 3GFOA 3IIKA 1E79D 2NTYC 3GJ4A 5L3QA 4JKYA 2BBTA 5EXSA 2FDCA 1Z08A 1EG7A 2MMGA 4Q4LA 4TT3D 2R6FA 1XFAA 1YRAA 3EIEA 2AXPA 1GP2A 4P31A 1GKYA 3PIRA 1JALA 2FH5B 1HQYE 1LFDB 4JT2A 2IYXA 4M1TA 5AUNB 2ZUDA 3CX6A 5BWMA 1W36B 2JJ1D 1QHYA 1G5RA 4U5XA 3NTUA 3AV0B 5IF9A 5D3QA 1PJRA 5JI3E 1CJKC 5KHOC 4TYNA 3D3QA 1BKDR 2X2EA 1JAHA 5E4FA 3Q9LA 1CBUA 2F43B 5EP3A 4LCBA 1GZSA 4TMZA 4D80A 1EX7A 1E79A 4PQYA 5K8TA 2VYFA 3KJHA 4X8OA 5CM8B 1ZYUA 4DDUA 5L3RA 3H0KA 1NI3A 3GFTA 4NL4H 2DWPA 4PHGA 1YJ5A 4XIGS 4PAOA 5L3SA 3NKVA 4A1FA 2O8CB 4M2LA 5KNDA 3U7GA 4JLOA 2QP4A 1K6MA 1XJ0A 3LXRA 1GRQA 4Q66C 4IVPA 1P9RA 3K53A 2KJQA 2QPAA 4G5SA 2OCYC 3I1FA 4QBFA 3TUIC 3LA6A 2GXAA 2P65A 3UWOA 4PAMA 5GJWC 2PZEA 1W0KA 2AWOA 2N46A 2A7QA 4MDEA 1G7RA 4DDWA 1YQTA 4URVR 3BS4A 3OHMA 5E95A 3RRMA 2Q6TA 4TMTA 4CEJB 3TMKA 5LDDC 1XNJA 3NBXX 3QKRB 4H9GA 5FI1B 4D0LB 1Z29A 3IO3A 5J4KA 2P5TB 1CR4A 1AM4D 3N70A 2AL7A 1N6PA 1UM8A 4MITA 1Q1BA 4BE7B 3M1IA 3WNDA 1U8AA 3SJCA 3DHWC 1FQKA 4LJYA 1Q1ZA 4Q03A 3FHCB 2LCFA 4Q7LA 3VU9A 4BZPA 2YWGA 5EUQB 3TK1A 3NBYC 2O8FB 2ODNA 1IJFA 1XZPA 4Z51A 1G8FA 1IN4A 2V55B 1MO4A 3KFVA 3MD0A 4JJZA 2F3RA 4KSBA 4NH0A 2HXSA 3OIUA 4PC3A 1G41A 1AA3A 3L0OA 1JAIA 1EFTA 4YMWA 3TSOA 2PT7A 5DI3B 1MKYA 3TVDA 3GLFA 3ZQJA 4B44A 5JLJA 2K5UA 4JYCA 4LJ7A 1SGWA 2C5LA 4FI3C 2QMUA 2V8OA 4W5JA 4MRPA 5EXPA 1Z0JA 4PPNA 4F4CA 4Z54A 3RABA 3T1TA 4M1YA 3CPEA 1Q57A 5H1YA 3TR0A 2ZJOA 1ZMXA 1ZIPA 2J41A 2GF0A 1SVIA 1E2MA 1SXJA 2J45A 1ZUHA 2WV9A 1FUKA 3FB4A 1XPUA 3WP1B 4A4DA 2VHCA 3K09A 2B6HA 2OFXA 3LW8A 3JZMA 3GLIB 2W58A 2ZIAA 1DVRA 4LV8B 5JWOA 2DYKA 4MGZR 2G83A 4GFDA 5LB2A 4E09A 3UKDA 1UFQA 1ZM9A 2KB0A 1NMYA 1KI6B 4A15A 2CBZA 3M0EA 2OEPA 1PLLA 2ZI5A 3H1TA 4NYMR 2J7PA 3WNCA 1HV8A 4BRWA 2W2VA 3FHOA 2IS4A 2OFOA 4BWYA 3ZJYA 4IHQA 2FA9A 521PA 2J0QA 1R0ZA 4RJLA 4YMSA 4XVQA 3SC3A 2ZR0A 4MRNA 1WA5A 4PSAA 1Y3AA 1EGAA 2IEZA 2ZRMA 1Z8FA 1FL9A 1P62B 4PZYA 4TMKA 1YZLA 4TSFA 4QKQA 1RKBA 5HE8A 1OE0A 2HXYA 4DEYA 4OQLA 2R62A 3K0AB 4LYJA 1DO0A 1JQJC 5DO9A 3DPUA 3ZIAD 3K9NA 2QT1A 3CONA 5TB5A 3MJHA 3EZ7A 4I1VA 4TYPA 1II8B 1OB5A 2A9KA 4TMWA 2NPFA 3A37A 2BHRA 2ZREA 1YR7A 3E1SA 2B8WA 4E03A 3HWSA 1VG9B 5EZ5A 4BGDA 4X8LA 1GFIA 2V6JA 1NMXA 1VDZA 3VX3A 2HYIC 2NGRA 1N5IA 3BERA 2ZRHA 2QAGC 2C04A 4O2LA 3QSYA 1X6VA 2ZRIA 2JLQA 3B7GA 2V1XA 1COWA 1DAEA 1ZNZA 3QG1A 4QNMA 3OAAD 4M4SA 4KODA 1NVWQ 3IEVA 2XGJA 3PFIA 4JLPA 3RHFA 4BFZA 1JJVA 4TQ9A 2O8EB 5K8UA 5JZVA 1VYTA 1G16A 1T3HA 4HB3A 1W4RA 2I3BA 4UXHA 1W5SA 4Q9LA 2O8EA 3SYLA 2BM0A 4B3GA 4PO9A 1XEXA 4V0KA 5LB4A 1PUJA 3A4LA 1NNEA 2RMKA 2PX0A 1W4AA 3NC1C 1KO4A 4M0LA 4D4KA 3T5DA 1OB2A 4NKRA 5BW8A 1XU4A 1Z6XA 2IHBA 2MMCA 3MUFA 4TT3A 3OFND 4BASA 2WTUA 2ZUBA 1TPZA 3ECCA 2QM8A 1N6HA 3LY5A 2ZRDA 2IF2A 1LF5A 3FMFA 3PEVA 4EIWA 3K9HA 3PJRA 2HEIA 3GJ8A 1M6NA 4OQXA 4DIDA 3T1QA 3TUJC 2XJ9A 1NF3A 3HU2A 4HLQB 4UKDA 2OCBA 5HE9A 2VP5A 2ZS8A 1XXHE 5TMPA 1KMQA 4C7OA 3QKUA 2ZETA 1G7CA 1NSFA 1SKQA 1G5PA 2DFLA 3EZ9A 3QOFA 2HJGA 3QXHA 4FW9A 5IK2D 3VR5A 2FU5C 6Q21A 1FMLA 2OHFA 4AIIA 5L8VA 2XEXA 2ERYA 3CZPA 5P21A 3I62A 3G0HA 1OYYA 3L0PA 3WRYC 1R5NA 3GJ3A 4NPHA 4KBFA 3M4YA 4M22A 1QHNA 2OAQ1 5SZKB 4LBWA 2QQ0A 3F8TA 4OQFA 1Q20A 2A5FA 2EFDB 2QTFA 4NMMA 3GLGE 3HDTA 2QNRA 4AI6A 2IYQA 4IXNA 2D4HA 4JZKA 4BEBA 1NVVQ 1SZPA 1JXMA 1EFHA 1KDRA 5CJ2A 5HZKA 4ZKDA 1LB1B 3C16C 4DDVA 1DAIA 5JWRA 2ZRCA 1E0SA 4KFUA 4WW0A 2GESA 4RFSA 4Q18A 1I4DD 4ZI3A 2JA1A 1SHZA 1S0UA 2AD1A 2EFEB 3AF2A 3SHWA 2GNOA 4FCTA 2W0SA 2WOJA 4F91B 1XB2A 4ON9A 1P6XA 3LW7A 4KYUA 1KDTA 5KDLA 1QHXA 1SVLA 4MKGA 1NKTA 3QVVA 4HLUA 4XSGA 1U8ZA 4D6PA 2VP6A 2ZRLA 1Z0DA 3I3SR 2IA5A 4D4LA 4E5UA 4QHTA 4M1WA 4NYJR 3UXMA 2CL0X 2J0UB 3CWZA 3LD9A 4ARZA 1KJYA 2J0UA 3W8RA 3LX8A 3HPRA 1VG1A 4P3YA 4DLWA 1WF3A 4LHYA 2KE5A 2A78A 4PC6A 2CL7X 1OKKD 2WM9B 2J5XA 1CJTC 1QG2A 3NHBA 4J0QA 5DE3A 4NE2A 4QBGB 3EWSA 1XXHA 3LFUA 5CK5A 4F4JA 4ZV4A 1P72A 1QF9A 2WWYA 1VPLA 4JSYA 1XJCA 2H8KA 4TTPA 3WBJA 2BBWA 3GEIA 2J1LA 5CDFA 4H1VA 1MO6A 2ZQ5A 4NZYA 2G1JA 5AUOB 4HLCA 2G1KA 1GRNA 3KXIA 1KJZA 2QI9C 4MUAA 4TLBA 1E9DA 1T3LA 2F1JA 3OE7D 4EQ6B 4JL5A 4EUNA 4LYAA 4OQMA 3A1WA 3W6PA 4YDHB 1CRPA 4Q1FA 4BPBA 4GRAA 4KFTA 3AF0A 3BIFA 1A1VA 4G5QA 4Q4AB 3J81k 4HDQB 3IUYA 5KDOA 3JZAA 3K70B 2ZTSA 1OHHD 3CX8A 5EE1A 4B43A 2IXGA 2QBYB 1JR6A 2JJ8A 4KYIB 3SJBA 4WBSA 5FOXA 3LQRA 1ZW6A 2GJAA 2J46A 2WVJA 1W46A 2XB2A 2WSMA 4OI4A 4BFUA 4DCNA 1UEJA 2IYSA 5EUMA 2QRNA 3GEHA 2WWXA 2WJIA 4HAXA 5IK2A 3CR8A 4PO1A 1X1SA 4IEIA 4LDJA 4MUBA 4LY6A 5FPHA 3ZQ6A 2WSSA 1TU4A 1OH8A 2O8DB 4PO8A 1OLOA 1GSIA 1WB9A 2XNSA 3DZ8A 1X8LA 1GG2A 2Z0MA 1S1CA 1T91A 2OXRA 4CF7A 3VAAA 5GJVC 4URWR 2ANCA 2P6RA 1E4YA 1OFHA 1T8UA 4Y0VA 1G7TA 3GCGA 1WE2A 5C2JB 4BFXA 4AWXA 1XBTA 1VYVA 1KK1A 2ZU6A 3U4QB 3KL4A 4OHZA 2YKGA 1Z0AA 1IN7A 5DGXA 4O25A 3PUZA 2ODBA 3ZS8A 2REOA 1YR8A 3VHLB 1TUEA 3B6EA 4HB0A 4ASUD 4G5RA 4EPXA 3SYKA 1IY0A 4TQAA 5AK0A 1PLKA 3OF5A 3QG5A 1ESNA 1ZM2A 2W2TA 1GOTA 4LHZA 1DADA 1NBMD 1X86B 3I72A 4I1UA 4D82A 4RD2A 3U3RA 2IYRA 1GIAA 1E32A 2EQBA 1U0JA 4TL8A 3I61A 3MGCA 1G6HA 5F3WB 1NLYA 3WMEA 1OH5A 4TSFD 3EW9A 1G19A 4ZIRB 4WZBE 4O2RA 1P75A 4MRVA 3TW4A 2ANBA 2F3TA 2NZ8A 1EFRD 2OT3B 2PEZA 5E7JA 3CRVA 2VSXA 4OYHA 2BEJA 3U44A 4BLRA 1G21E 2I4IA 1WCV1 2HJVA 4OHXA 1DS6A 2BJWA 1ZU4A 2J3EA 4AYXA 1DAFA 4YQFA 1YU9A 1NJGA 4M53A 1KGDA 1Z28A 1XMIA 2FSGA 1VG8A 3KDSE 3WP0A 2JCSA 2ZYTX 1D5CA 2H7VA 3L2OB 4QOSA 1II8A 1VECA 3B1XA 3QJYA 2W6ID 2DWQA 4ACAA 2H92A 5KTYA 2ZXUA 4ESHA 1JQLB 4LSGA 1N2CE 1E99A 3DKPA 3LDAA 1F2UB 2ORIA 3BK7A 3QI2A 4V0OA 1YKSA 4Q00A 3T5GA 4B2LA 4N1AA 5EP4A 2JJ1A 3W6OA 3AKDA 1P2VA 4C30A 1HQCA 5K8IA 4Q5IA 3EA5A 1E1RA 2EWWA 1I2DA 3VR2A 5DN6D 3VR3A 2D2EA 3TR5A 2IT1A 4P0TA 4W5WA 1FQJA 1BYIA 3TAHA 1JPJA 4GBMA 121PA 1H8HA 2FN4A 4QJ4A 5K8LA 4WZ6A 4XWKA 3A1TA 3EX7C 3W5IA 4L16A 2ZSAA 1E4VA 4IFEA 1GUAA 2YOGA 2ODEA 3FFAA 5DHAA 5B64A 3SNHA 1KY2A 1YZGA 4HAVA 4FIDA 3EA0A 4JVLA 2DFNA 4DC9A 4A36A 3OAAA 4YXWA 2VP2A 3I5XA 1KHTA 2IYYA 2HYDA 4MDFA 5FPSA 3TLXA 1L2TA 3CM0A 4DEXA 3U7HB 3KX2A 1XF9A 2RH5A 3UG7A 1JEEA 3FFBA 4KU4A 3NEJA 4OJQA 2YHSA 4EPTA 4GSYA 3UMSA 2D7CA 3KKNA 4RZ3A 1OIXA 1ZD8A 3THYB 4ESVA 3IHWA 3SR0A 4U00A
chains in the Genus database with same CATH superfamily
2NV2B 3JWPA 4XWYA 3OM9A 1JNYA 3BZUA 2VP4A 2RHHA 4BMDA 5LMCA 2NVUA 1J2JA 1JG7A 1U02A 3DLAA 1KQPA 4JP3A 3R5TA 4UU0A 1A7KA 5TV2A 5AJWA 4A6EA 2AG8A 4ZXPA 2FWPA 3I5AA 4E30A 3E7PA 3KJNA 4LDAA 4GU5A 1Z5VA 1TC2A 2C97A 1O57A 2V7QD 4QGBA 5MDHA 4AJPA 4COKA 1BFUA 3NB0A 1CVLA 3CF0A 2J6CA 3I45A 3PDHA 5CLGA 3V55A 1P7YA 5G1NA 1U90A 4C3UA 1CUBA 2W2PA 2YYSA 1Z4OA 2IL1A 4YAEA 4Q15A 2HLHA 3U0BA 2GN6A 2NU7B 4O3FA 2ZRQA 2VPWA 3RJTA 4KJZA 4L2IB 4ZT5A 1W9HA 4E32A 4CETA 3SBXA 3A9TA 3ROZA 5CFPA 2QZJA 1DDIA 2ATXA 5BO5A 1Y6GA 1MMFB 4G86A 2BRUA 2CCGA 2HIAA 1YRHA 1MJGA 3JQAB 3ND5A 2NXWA 4H7PA 3MSCA 4OL9A 1AZSC 3CGGA 1BX1A 2ZE7A 2ZVQX 3OQPA 4YRJA 4B7XA 4ZIRA 4PR0A 2D00A 1B16A 2FPPA 2I6UA 4FFBA 3SC2B 3WYBA 1XNHA 3O31A 3D2LA 2JW5A 3O8OB 5IF3A 1FIUA 3G2MA 1FTQA 1PK7A 1YI8A 4Q1VA 3HKCB 1JEYB 5LQSA 4V02A 5B6IA 4JSTA 5CLLA 3MWDA 5GWXA 2V0NA 1RW4A 3AYXB 4RKRA 4MYTA 2I3ZA 3KVRA 3F7MA 3MM4A 5CH8A 2OB1A 4YFYA 4FYMA 2OO5A 1Z2DA 4ZOAA 2VJMB 4ARIA 3F1LA 4JB2A 4EO4A 1JBKA 2OLJA 3GJ5A 3SDSA 1C9EA 2E55A 4M8LA 4O4HF 1VXOA 1BHSA 1SVNA 2FAXA 1WM1A 4KV9A 3LYUA 2YC4C 1DO2A 3K8QA 2OM2A 2AJTA 3QYPA 1OSNA 3FTQA 2P2DA 5IRCD 3IHTA 3EGCA 2F1RA 3NAMA 5K0LA 1G8YA 2OP1A 1VIAA 5A0FA 3K7EA 1UQTA 1Z7GA 2AYXA 4IS3A 1RVV1 4JLMA 4W7SA 4LNAA 1QDLB 1GRVA 2OBBA 3BF7A 4KMRA 4DPLA 5LQDA 5KOYA 4JT8A 1DAGA 2Z8YA 3TKLA 1WQ1R 1XDGA 3KR2A 1G5HA 3Q8XB 2HBRA 2Z5VA 1Z35A 3IMEA 3JS5A 4MLDA 4R1MA 3W9BA 5B2EA 3EIQA 3SFVA 2WJVA 3B60A 1K7XB 4WBNB 3HY6A 4LRUA 4MH0R 5ALRA 2REXB 4URZR 3UYLA 3EFOB 4MO2A 5LPNA 2HPAA 3QX8A 3ODPA 1E60A 3KZKA 2Q8NA 4HCJA 4JNKA 2FPKA 1RZRA 3DOOA 3VI3B 1H0HA 3LTNC 1NN1A 2WV7A 4B2IA 3DJYA 4CODB 1OIWA 2O2GA 5ECGC 2EVWX 2DZDA 2ZK7A 3ECSA 5K4AA 4BLOA 5CFZA 4PTLA 6REQA 1GVHA 1Q7BA 3JALA 4U2GA 4ZREA 3FBGA 2VSFA 4Z3OA 2BLNA 2Q5IA 5F1KA 3ZWPA 1FFXA 3KB1A 3EDQA 4G8CA 5A4DA 1WUJS 3KQWA 5H3HA 1ZOLA 4HN9A 2QD1A 5IKOA 5REQA 1XEXB 4MUMA 2JDID 3IODA 2B6NA 2FRXA 2AI3A 3B13B 5JYBA 1RHUA 5DHRA 4CTNA 1RSZA 2OCIA 3SBDA 3R8FA 1PR5A 5E6UB 3ZEIA 1U0FA 4ZAZA 5KYXA 3VR6H 2GZRA 2J08A 4AKEA 2PUHA 4EHHA 4EHAA 3UN1A 3G0OA 5IKEA 1QS0A 1N7IA 1YCFA 1XZQA 2H1CA 2Q9BA 2REQB 1Y1QA 1U0LA 4G0ZA 4MCIA 4KX3A 4EJSB 5A4IS 2GCIA 1JG6A 1KMMA 2PSFA 4GE0A 3V80A 3WRWA 2BM8A 3UT5B 3U81A 1QF7A 2YJGA 4KIFA 1VIDA 3L6UA 3C2QA 2WA1A 5JC8A 3LFTA 4XVHA 2PUDA 2H17A 3TLBA 3NIBA 3ZGZA 2I1VB 3LY7A 4GC5A 3DYIA 3WWOA 1I3LA 4XIJA 1WW3A 2XCUA 3DTVA 4DQXA 2IH4A 4YPFA 1S3GA 1YI1A 4QYMA 4FX2A 4MKFA 3VH3A 3EXG1 2QD4A 3WYNA 3OD5A 2AVNA 3BC1A 3SBOA 5JH7F 3IKJA 4DSNA 3THXB 3LU1A 1FSZA 3VKWA 3N2NA 3T9DA 4D3DA 4NONA 3VVMA 3QKSA 2BGJA 2GEVA 3QPUA 4KPGA 4FFMA 2R65A 1FW6A 5BV2P 5KOJB 4EG4A 1QXSA 1FNSA 1OGJA 3HR7A 4XDHA 3SEQA 3UPTA 4L7QA 2CMKA 1MC4A 1S2NA 1W1WA 3ULKA 4DCGA 1FFSA 4JVOA 5B58C 5B1DA 2XAUA 3NMUF 1GG9A 3AF5A 4EYOA 2A5YB 3URMA 1Z6TA 1V9SA 3T3PB 2ZANA 3HA7A 2QJFA 1QB8A 1ZWLA 4KZKA 1F2DA 1XCGB 1GKIA 2FPGB 3WGLA 1RWXA 4LMBA 2Z83A 3COZA 4I6EA 4IOKA 4AP9A 3IT1A 4RIGA 2V4UA 4JOCA 1THTA 5LNK1 2HA2A 4WCFB 4YASA 5FD8A 2JEZA 2QMEA 5FJJA 3OO0A 3RSLA 4CHGA 1ZRHA 2VK8A 4MQ5A 1NXOA 1XZHA 2B4AA 3HACA 4O63O 1QR6A 4WZAE 3TKYA 4QBKA 2WIBA 1GG5A 5BSKA 1CY7A 1F0NA 1X9HA 2R68A 3BZWA 3VO2A 3R6DA 4F4FA 1JZSA 1OBVA 2GM5A 2P68A 1NOKA 3F2IA 1GCUA 3VNVA 4AVYA 3COYA 4WZBA 3N1UA 3C3XA 3OQVA 4JLNA 1XLUA 3ADCA 1AKTA 1WNTA 5CVEA 4AZ3B 5EE5B 4DVJA 4ERNA 1EFAA 1RQNA 4K46A 3QE9Y 1P3JA 1RI2A 5EL0A 3SEAA 1FK8A 3AH8A 4Z7QB 1T1EA 4NZNA 4M9XA 5JTTA 3FUWA 1MF7A 3KJGA 4RHFA 2NIPA 1NONA 2DRIA 1K6IA 2QT0A 5K51A 3RWBA 7AT1A 2YX1A 1PRYA 1ZZEA 4IJVA 5JVDB 5JCZA 1K4KA 1FJHA 3FN4A 3WGMA 4P7KA 2CC2A 3QPAA 4L5JA 3ZH9B 2P79A 1PSZA 3H8VA 3LVFO 1RWVA 1A04A 1BFDA 4Q1BA 2P1RA 1O6BA 3PEFA 3U5ZB 1HLPA 3CO5A 3O4GA 4FGJA 3AETA 4I5FA 4YNBA 2IBSA 1FTSA 1JX6A 5IKXA 1Z5ZA 2MT9A 1ENOA 1US8B 4Z8YA 4DM4A 2XW6A 2J31A 3BXGA 1G55A 1VOTA 2OZPA 4DLBA 5LXTA 2O1XA 5HS4A 5KQSA 2WSYB 3IPYA 4J9VA 2PPLA 2Q5CA 1CDOA 4C4PA 1A9XA 4LJRA 1SWWA 5FEMA 3KYDA 4LZWA 3AF6A 4OXNA 2P2YA 2WVGA 1E1CB 1EIZA 3INTA 1HLGA 2NQ2C 4OX9Y 4Z0PA 3HA2A 2ZJ2A 4A0HA 2XMGA 3ROTA 2W2QA 4C0HA 1XMVA 2VQEB 3NOQA 3JQPA 3SE0A 1H2HA 1LVGA 4O6VA 5EGNA 4B3FX 4UXIA 1NFFA 4K2AA 4BVGA 5K4GA 5AKYA 4DUZB 5EP1A 4E2YA 4LQ4A 1BKYA 3G88A 1PX0A 4MWEA 4LXUA 1A82A 1YUNA 4NNPA 3W4KA 5LL6P 4EL0A 1EK2A 1WD5A 2BHNA 4K9KA 4O2AB 2GT1A 2OFWA 3T7TA 3QF4A 4URHA 2PMKA 1GQQA 2VO1A 2RAUA 2AMLA 1FLVA 5H9VA 4LYFA 4YLGA 1PEDA 1IWBB 5JAHA 3ZCSA 1V1RB 4Q7QA 5JRZA 1JJAA 1IBMB 4ZU3A 1ZLYA 2UYGA 1G60A 2XLCA 3M3HA 4Y9TA 5G4KA 4BQEA 4EMBA 2WM8A 3BORA 4EKEA 3DZCA 5LKAA 2QMHA 3W79A 3FCSB 4FQ7A 5KO2A 2C5GA 2DKOA 3Q87B 1V7QA 4DV6B 4PPYA 1FLDA 3DEIA 1ZQ1A 4BB9A 4HTAA 4WNCA 1PR0A 1EFLA 1MTZA 4G23A 1RZUA 2BJHA 4MW0A 1ES9A 1QYIA 2BBOA 1A4IA 3I5UA 1UBCA 4MA4A 2WQ6A 4LSMA 2QORA 1Q0SA 1YV9A 2JAWA 2RHBA 3ZI7A 3L4EA 1OJLA 1RDFA 2CJWA 2RHRA 5D5PA 4RUKA 3SWWA 4ZTZB 3WDKA 3IVCA 3H84A 3ZJ4A 3CNHA 1VIYA 1U31A 3FZYA 3PK0A 5AH0A 3KZVA 1GYQA 2Q3FA 2WJYA 1W85B 2HREA 2Y66A 3VDNB 8AT1A 2IKSA 2YRXA 4M7RA 3BXFA 3QEKA 1C7RA 4BS9A 4DCCA 1RZ3A 4ZRMA 3X1JA 5J5AA 2NUBA 5F3DA 1WR8A 4ZQEA 4WOBA 3USZA 4JXKA 4S2EA 5TNXA 2VDJA 1G4UR 1LRKA 3EG5A 1DBQA 3QEOA 4R8MA 4OVKA 5DOVA 1Z07A 4B3CA 3BM5A 5EOVA 5FWXA 1IN8A 2GH1A 3TW0A 4Q1AA 1KERA 1WOYA 4YJ3F 4CGYA 2EBWA 1DQSA 4X84A 4GKJB 4YIKA 5CT4A 2UXDB 5FH9A 2V7GA 3FG9A 5A05A 1AV7A 1E6CA 3JYPA 5FA5A 3WZMA 4EYGA 1NOIA 1LNSA 4IXTA 3P9SA 1GWNA 1KYWA 4QPJC 3PQ7A 2AX4A 2HLPA 5C0OE 1Q0UA 2X2FA 1C50A 1N9GB 4M86A 4AJOA 4JUBA 3D4IA 4LDNA 2VYQA 4AD8A 1A2KC 3QKTA 5B3JC 4JN6B 3WKEA 4BO5A 3NRBA 4M0CA 6NULA 1KETA 1ZN9A 4ANFA 1EVYA 5I7RA 4LECA 2ZI3A 2IDZA 5ALVA 1IAQA 1Y4AE 2OKGA 1WO8A 4PR3A 4QGAA 3TR6A 3W4JA 2LDBA 3S1AB 1T1RA 2IXBA 4GYJA 2FKAA 3ZIDA 4JQYA 1DAHA 3NIGB 2OBMA 3REOA 5EJ7A 1E5QA 2FR0A 1YR1A 5IT5A 3X2FA 1A2OA 2P67A 1J90A 4CIXA 3EOBI 4ZQBA 1QHFA 3GQBA 1ZM3A 2XE7A 1PZFA 3C1TA 1AURA 3VYWA 1R5JA 2ATVA 3B1WA 1S01A 1CS4C 3HI4A 4MS1B 4PLTA 2P9YA 2ZRBA 1JLRA 1V11A 1O03A 1ZMTA 1MIHA 1TO6A 1FP6A 1Y9ZA 2VDVE 1Y8RB 4MUGA 5CVCA 3UK6A 3ZD8A 3V4PB 2CDAA 2XOKD 2Q2QA 3UV3A 5CA1B 1N32B 4FLEA 5EESA 2ZRFA 4D3YA 4C6RA 4EFDA 3ZK8A 4YHHB 5JYCA 1JJIA 3PZRA 2A1TR 1G3QA 4DAEA 1M2HA 1OT3A 4DR1B 5CTAA 3W0LB 3BZBA 5TMDA 2JLZA 2P9CA 4LRXA 1YAJA 3RTAA 1OA0A 1UPTA 3IO5A 1FLAA 4XD7D 5JARA 1E9BA 2Y1XA 1JTEA 1CFZA 1S7CA 4TTRA 3EGDB 4KQJA 4M99A 2VJQA 4DT1A 1A8QA 5K05A 2VXBA 1FNDA 2I4MA 2WI8A 2DQSA 3A9UA 1RRVA 2R1VB 4BU0A 5L4SA 1MO3A 1SVMA 2O0JA 4DGQA 1VHQA 5LN1A 2WDZA 2ZYRA 3ZD6A 2CXPA 1FDIA 3M3DA 4IQGA 4ROSA 4E07A 3AB8A 1HMYA 3GJ0A 1L7OA 2R87A 3HKEA 2XZTA 3IXLA 5K3FA 3QE4A 5IZCA 3N75A 2UZ0A 1OX6A 1RYNA 3AHGA 3DEZA 2LKDA 4XCQA 2X5NA 4BE9A 5KSZA 2HCBA 3M5WA 4FJ2A 2ZSEA 3C3KA 2J85A 3TSYA 3F8WA 1Z4IA 1A5TA 5E6SA 4HH4A 2ZRGA 4LISA 4CN9A 1J49A 3A25A 4LGMA 5E1BA 4IOLA 4JWKA 3OESA 4QDZA 4PX3A 4IIUA 3QEBZ 4LA4A 7YASA 2VQSA 1GCIA 1I13A 1T2CA 3IC5A 4MCAA 3SX0A 3ZZUA 4JLVA 4RVHA 2C8VA 2BD0A 3OT1A 5DGTA 2VBCA 2AK3A 3IVMA 1J1IA 3GRAA 4OQDA 4U9HS 4KREA 4QPCA 4OL0A 5G1PA 4I5DA 3UATA 2O8CA 3V1KA 4RKFA 1FSFA 3OZSA 3VKHA 2FE1A 3AIOA 1I6WA 3RH0A 5D5HA 4IHJF 4BP8A 4BNJA 1EA7A 3N0WA 5DISB 3Q7EA 1ZCFA 2OG1A 4ASUA 4RTRA 4GNRA 5A9RA 3LT5A 4NU0A 3WGJA 5BVGA 1J2RA 4PCAA 5K3FB 1R4NB 3O8LA 2QA5A 4DWWA 1Q3TA 2V7BA 5ALEA 1EJ0A 3VC2A 2XODA 2C58A 1I32A 2RJOA 4HUJA 4AT1A 4MSUA 3TNJA 5K6RA 2QE7D 5LIPA 1AUQA 3K0EA 4OM8A 4RENA 4NV3A 2ZJ1A 4ZI7A 5JJCA 4UVIA 3ROGA 4CCYB 2HJSA 621PA 1C1YA 3ZWNA 1J5XA 4PYJA 1AHPA 1E7RA 3RYIB 3O73A 1DHRA 1Q17A 1CY4A 1AOXA 1W2WB 3AETB 5H0IA 4YPOA 3EIWA 2CCJA 4JBWA 5KIAA 3R5FA 5AUQA 4H2DA 2PMDA 4WSOA 2C42A 1MXFA 1ZH6A 2HMUA 3U4GA 1HGXA 3GEEA 4IDGA 3MYRA 4KIJA 5CFOA 5JCPA 2A7XA 4RD6A 3GLSA 3PQCA 3Q2KA 2Z4TA 3GZNB 3MSXA 3GGSA 4LHVA 4MGKR 2WZQA 5AM2A 5J3JA 2CL6X 2GDZA 5BVGB 1NBWB 4MLCA 1CRQA 4RVCA 3D6HA 5AVKA 3PUXA 1N7GA 1J25A 3PWSA 1KDZA 1B3RA 1AKQA 1IQ0A 2Q21A 2QTMA 4W9RA 1VYHA 2RI1A 1UL1X 3QBJA 4NBNA 4S0XA 3QITA 5AP9A 4MZDA 4D43A 3RC8A 3H1EA 1JSZA 4I7EA 4NFSA 2PGDA 2LGJA 3D8NA 1W4ZA 3TNDA 3TQCA 4Z7JA 3TUZC 3DL4A 5AVSA 1DL5A 4XD2A 4PG5A 3E0XA 2DQKA 1H2BA 5DBEX 3GPLA 4UM9D 1H4VB 4QFBA 1HEYA 3EY9A 4LG1A 3ZHTA 2EW2A 3ZVNA 1QYCA 4KX5A 1FJ2A 1EBBA 2W6CX 5KNDD 1I4WA 3BTUA 3HUDA 4GKAA 3TOCA 2A88A 4K3VA 3Q0IA 1VMKA 3F9CA 3TRKA 2FFQA 1Q7EA 2WYIA 3GLQA 3KJXA 4XJXA 1OPXA 1CB7A 1IZYA 5AI6A 5KUTA 4RMHA 3QX7A 2A2ZA 1OXTA 2JFXA 1PV1A 1YKGA 1QIIA 2Q8PA 3E8SA 1R9GA 4N82A 5DI9A 5JS8A 4KWTA 1XAJA 2DEUA 1CC1S 3KHTA 2NU8B 1RFLA 1PNTA 3ELWA 4UFOA 4CMEC 1EWRA 1S8AA 3VDRA 4ZMBA 1GSHA 3LQ4A 4FMDF 1A9RA 2J09A 3DAFA 4BQIA 1PD0A 4TROA 5JD6A 2WE8A 5L7TA 1JVSA 1TZCA 2R25B 2ONKA 3T6KA 4DV2B 1KF0A 1S02A 4WLUA 5IJ9B 3BJZA 3DFZA 2Z6VA 4MGYR 4RF5A 3R7NA 4OI0A 3G85A 3C24A 3AP2A 3IQHX 2OORA 3S5UA 1SUSA 1KI9A 3IV7A 1GQOA 1ZCZA 1FS4A 4MV6A 4BNNA 2CFRA 1S2GA 1SRRA 1ZL2A 3NKLA 4TLEA 3I28A 1B3BA 2DQ4A 3F47A 5M29A 3BEDA 3IP1A 3QE0A 4P92A 3W5BA 3RV3A 1QGOA 4LJLA 4MVJP 3X1XA 4LY0A 1ZNQO 5JZMA 3Q5EA 3L7MA 3S1SA 3AR9A 1M0EA 2JCXA 2OILA 4MR8B 1GGNA 4RK0A 2ONCA 4OO3A 5K0EA 3QWBA 3K0SA 2FMXA 1AQNA 4BRZA 4HUQA 2X2OA 3F96A 3MQFA 3AVVA 3K9FC 3KVYA 1NF9A 1ZX1A 4L3WA 1Y8QA 3UUEA 1N2OA 3JQGB 2Q2NA 4RAQA 1C9MA 1HUQA 5H81A 1M6EX 1IHXA 3B48A 1OF1A 2OXFA 1FFDA 1U8YA 2JHGA 1R0BA 3C5HA 3UGKA 4R81A 3LHIA 2QLJA 3LDUA 1P4RA 1RD4A 2X58A 3W7AA 5JBNA 1MPTA 4JOSA 2ALJA 4LWZA 4HG2A 5IULC 3OSZA 1RLOA 2HQ1A 1V41E 2QYOA 3I42A 2I2CA 3AXTA 4CLDA 2H2DA 2IP4A 3ZKWA 1GPBA 3MFYA 2GPYA 5T64A 4NCNA 2QPTA 4NK4A 4A9AA 5M7EA 3RNLA 4E94A 3KSDO 4Z4QA 3PX7A 4CKXA 1YDFA 2WKQA 1E98A 5ALLA 1QLWA 1QZZA 5KYUA 3MJRA 2WG2A 2MIIA 1RBQA 1KJNA 4Q9HA 1YS2X 2DKNA 2Z98A 4QOGA 1GNRA 3DV0A 2FN8A 3TQFA 1QYXA 1NVUQ 4IIFA 3N8IA 5LZ5A 4E6PA 3A36A 4RMGA 1XEWX 1ZI9A 1O95D 4HY3A 4Q7EA 3JYNA 4C1BA 1GITA 1I9CA 1K7SN 2BUAA 3H9UA 3UH0A 5IS2A 1E3QA 4PGHA 4R1QA 2G70A 1CRZA 1RYYA 3ICOA 3N6VA 4Y6SA 4NZPA 3WLAA 3OIVA 4EFLA 3UBTA 5IBRA 1CERA 1NW7A 4U9UA 1QHIA 1JT9A 2IE8A 3DXFA 4NMLA 4B33A 2EX1A 3AFNA 4KWCA 1SBIA 3A6PC 2P41A 4N49A 1AS3A 2CEAA 3D0KA 2OAGA 3ETHA 5JSYA 2UZAA 4EPRA 5JNUA 3EZ6A 1Q7TA 2XEDA 1HKHA 4A3SA 1CT9A 1CZKA 5B5SA 5GIPE 4F5YA 5KYUB 1RFGE 1VLLA 3ZDFA 4NYIQ 4C7BA 1GUFA 2Z3VA 1OXKB 5ETJA 4E6EA 4L9SA 3TKAA 1RHKA 1TT5A 3O38A 4MQ6A 3RYHB 4P4SB 3G0BA 2B1RA 4MS3A 1O5OA 4DXHA 1LPNA 1A9SA 4GOJA 1OGYA 2OVFA 4BLTA 2E18A 4EPWA 3IRUA 4YJDA 3HCOA 5KQMA 1VLZA 1ECJA 2AXNA 4FD2A 2V4ZA 2XF8A 2GERA 5CDUA 2F4NA 4G1VA 3FVQA 4UM7A 1ADFA 1RRMA 4N18A 3H8WA 3WBKA 4RVGA 3WSTA 2WG1A 2E6UX 3FMVA 4EUSA 5K3EA 4FWTA 5G02A 2QKYA 1HYHA 1PGQA 1OV4A 1NP7A 4Y7CA 2ZJ3A 1MT3A 2WWGA 2ZSUA 4KIUA 5F2KA 2GN2A 1RXIA 3RK1A 3B9BA 4XWTA 3CXRA 3L9XA 5GV8A 3U2QA 4PHTA 1F4LA 3SS9X 2FXIA 4NBUA 3EC7A 4JL8A 1Q22A 1XYYA 3TX6A 3EDMA 5IVIA 3ADBA 1YQQA 1D2EA 1OU4A 3WX0A 3TWOA 1UMDB 1J9ZA 3QFCA 4F71A 3BHJA 3UFXA 5C5DA 1Q91A 1DDOA 1RC1A 2HB6A 3GCXA 5KPDA 3REQB 2QX6A 1B14A 5A06A 5DKFA 2PL9A 1B1AA 3NBAA 4I4CA 1NI5A 2C88A 3PA8A 2F1KA 4I50B 2M6RA 3RVBA 1JL3A 4CCYA 3DZFA 3TLGB 4HAYA 4MB0A 4G8DA 4RZUA 4WXEA 5GTDA 2ZU0C 1WV0A 3EAQA 3KLOA 1L7QA 4KBGA 3AZPA 2B4KA 2YZ7A 1C4WA 3GO4A 3DDOA 3WGZA 4YMVA 4GX5A 4CNBA 4BX3A 2AR7A 5AW4A 1V3TA 1XD9A 4UNNA 1U0EA 1W25A 1CXZA 4MDHA 4S2UA 3VR2D 1OWMA 1SXHA 1VCOA 5KU1A 3ZD7A 3GG2A 4JEUA 1RM4A 1VE3A 1Y9DA 2PJZA 3DUFB 2C98A 1CR2A 1IQPA 1O9BA 2GZHA 3D8SA 4IVQA 1UP4A 1Y4SA 1YMQA 2HF7A 1T8PA 1UIMA 1Z22A 2CB9A 3DEHA 2JLWA 1CTQA 2H4HA 3EGOA 5CA0A 1A7AA 1ACMA 2KPOA 3QE3A 3ZV4A 3SXUA 3HR8A 4EUEA 1HPLA 1TUBB 4JI6B 3S2ZA 4IHKA 1QONA 3ENWA 1FU7A 2BRUC 3PPVA 3STWA 1CR1A 1OAKA 4M6WA 3COPA 3EARA 1T5OA 5JMWA 1QAMA 3K0CA 3ORQA 3VU8A 2A5DA 4MWSA 1XFDA 1QRAA 3CZRA 3KYCB 5HOQA 3HKEB 2FMKA 5LMZA 4JP2A 3R4VA 2Z56A 1YR9A 2QTNA 3V8MA 2ZR8A 4WEOA 5C8DA 4CKBA 5F9MA 1OUMA 1OX4B 5JUWA 1CULC 4G0WA 2EIXA 1NVEA 2Q5FA 3DHNA 4D6XA 3IT0A 2OUKA 4IKEA 1TKBA 1TC1A 2JIQA 1DCTA 5BN3B 5AVRA 4QDTA 2EP5A 3FCOA 5FTMA 4YI5A 3UJ3X 1W47A 2QRJA 5IASA 4J0IA 5JJBA 5KVAA 4E2ZA 3FHTA 4DREA 1XALA 1ZGAA 1B73A 2Q3MA 1ADBA 3AJDA 1KQ3A 1ZJZA 2WWFA 3HCRA 3G2QA 4TTTS 1RLJA 3SS8A 2VAPA 2FPSA 4HATA 1XCPA 1O8CA 4GMKA 3EH2A 4PC7A 1ULZA 5AM1A 1MC8A 5LP6C 1HX7A 5G53C 3WQSB 4EI8A 1RNLA 4YRCA 3G0DA 1QH8A 1IOVA 4MHOA 3U3ZA 1ZA1A 3UJAA 4YACA 3SG0A 1YK1A 3ZKAA 4HEQA 1H1LA 2QX4A 3EWAA 4WECA 2BBSA 3CNNA 1POXA 1L5NA 1BJKA 4RESA 2AG5A 2UVQA 2IP1A 4G07A 4XIIA 3WE7A 1JLLB 1M6YA 3ETGA 4FLFA 1CUYA 4KDFA 1D2MA 5DM2A 5HFAA 3IRVA 5ILGA 2R86A 4GZ5A 4EX6A 3V4RA 1NI4B 5FAXA 2OZLB 4KPYA 2ECFA 3NDPA 2PKQO 5JTUA 3DV2A 3A05A 3T9AA 1E3EA 1T0UA 4TS9A 3UAXA 2XADA 3R7SA 4J76A 2EDAA 2XGMA 4NTZA 4A8TA 2IXDA 3HJBA 4R3UC 3QP9A 4NZ9A 1K1EA 4JJEA 4FCVA 1NULA 2HRQA 3IKVA 1K0UA 3GIDA 4ZQFA 3PD1A 3UJNA 3JVIA 4P7GA 3TIVA 1Z37A 3FSJX 3HB1A 5G41A 5KYGA 5CDSA 1EFDN 2OFPA 3EEFA 5HKAA 1GL3A 2PYZA 4M54A 1SUWA 2I6SA 5I01A 2CLCX 4BJ6A 1VSBA 1D6MA 1I5OA 2MDTA 1QUFA 2I71A 3JVUA 3UK1A 4DPKA 2Q1TA 1NAHA 5D1NA 2Q3HA 3JAMA 1WXXA 1M74A 3I9FA 5TARA 4IDFA 3OJCA 4TKLA 5KC8A 3SDZA 1RI3A 2YIDA 1M75A 3R6LA 3HRHA 1IFXA 2PLNA 5C32A 5I5GA 4HJXA 4A8JC 2VYND 4YQZA 2VC2B 3KVNA 3D8BA 1NY6A 2ZIXA 3ISTA 2I6FA 1IAVA 4PEVA 1VSQA 3FE2A 2Q7DA 3QX3A 4GM4A 1ZH0A 4N3AA 3I6BA 4G84A 1CD5A 1Q16A 1X1EA 3HK2A 1E1YA 3DTVD 1U5BB 1KZ7B 2QMOA 3E9EA 1MAUA 2O2SA 4P2BA 3K5WA 4JLWA 2WK1A 9LDTA 4Y2PA 4C05A 1HNXB 3CC8A 3EYWA 2RHMA 1IM8A 2NQTA 4YTEA 1E9CA 4IFIA 4CM3A 3WR5A 1JFFA 2OBYA 3ML1A 1T8RA 2FG5A 5JS6A 3PQ6A 4FQ5A 1C8LA 5FBQB 5DM70 5IM4A 5JIBA 4X1OA 1D6JA 2DPYA 3DE1X 4DUPA 1KAQA 4C9BA 1ABFA 4P7JA 4AM8A 3GHHA 4BRUA 1EFUA 4CQLA 4F5WA 2E3JA 1A3CA 3HXTA 3FYCA 4NJEB 3GEBA 4UVDA 1FTNA 4ZC1A 5ALNA 5BY2A 1U1DA 2GS9A 3LPNA 4H6VA 4QQ8A 3T99A 4AF7A 4H15A 2OCXA 1G2OA 2WJ6A 4ZTUB 2PXCA 1P61B 2VDRB 1KZ9A 5FRDA 3U5TA 1AKVA 3AP1A 2H63A 3BH6A 4MEAA 1MZVA 1SOVA 2IBMA 1GTJ1 4R2HA 3RAJA 1UKVY 2CHGA 3AI3A 5I7OA 3G9UA 2R3SA 1V16B 1OLUB 4UJ5A 3P9RA 3AVXA 3ZLJA 3AP3A 4JK3A 3FRJA 5IMBA 3UMCA 2A94A 4JB3A 1KEEA 1ORTA 1T3SA 3EEBA 5BPFA 3PC8C 4BXOA 1RXSA 1FP4A 1YIAA 4NMHA 3U80A 2QRZA 3HR4A 4WINA 1PK9A 1UP6A 2R97A 3DEJA 2F43A 3HABA 5G0TA 1GAEO 2CEKA 3A1VA 3LPLA 4NHOA 1MFPA 2GO1A 1SFRA 3K0FB 1S3SA 2F9LA 3AY7A 2ZRKA 1CJVC 3CYFA 4TKUB 3O95A 3LJKA 4GVLA 1NKVA 1U0HC 4S1TA 4ER6A 3L6RA 3IDQA 1ZM4A 1N8SA 3G6WA 4DCSA 1LNZA 1G1MA 4J75A 3I2HA 5DCWA 3CFYA 4NU5A 2B2CA 1DINA 3A1DA 2DWOA 4E33A 3IQEA 3AHEA 2NYVA 3A7DA 3WNZA 1A5SB 1CEXA 4ZOLA 4IG4A 3R5JA 1BC5A 3F3YA 1N2CA 3CF4A 2XDQB 4HLDA 3EPLA 5J4VA 2OC9A 3V8BA 1SZCA 4I19A 3OZ7A 3TO5A 1UKYA 3V1YA 3Q0TA 4X6YA 4X94A 5TPWB 3BGVA 2IQIA 3FVRA 3Q7SA 2A57A 4F04A 2ZUTA 3GAZA 4OREX 1Q0TA 4ZAWA 2O52A 1P0MA 5BOSA 3AU9A 2G88A 2I76A 3KHSA 1JHDA 4JJGA 1P8JA 4DC0A 2GZ2A 4MUXA 1VJTA 1I3OA 3KHKA 4EJSA 1CDZA 5AJXA 3NVKI 5JQGA 2JZCA 3AY3A 3KQOA 4MMXB 2QJOA 4M9ZA 4W6ZA 5DM60 1BH2A 4U2DA 1DZ3A 3D6NB 4FR0A 4WK4B 4X6XA 1UH5A 5F73A 3WHLA 4ARBA 4N76A 1QK3A 3L1HA 4YDSA 5DGDA 3WO1A 1LRLA 3P45A 4K9NA 1GUBA 5HX7A 4Q1CA 3MRVA 5KSYA 3V42A 3LCRA 1P5JA 3U09A 1QVWA 2VPIA 1MT0A 3QM1A 3N0VA 3N87A 1TUGA 4F5EA 1I3NA 4ZCPA 2NSJA 4PF1A 5I9SA 3AWDA 4LV5B 3KZ1E 1M8FA 4MPRA 5DTMA 1KE1A 4ZCLA 4FW8A 3AK4A 4GNKA 4JS0A 4NCAA 3H4IA 1ZPDA 4PSKA 1EP2B 4HWGA 1ISJA 3JTEA 3VHXB 4ZYTA 4UBIA 2JGKA 3RVJA 2Q3BA 2Q1SA 1L7BA 3PLNA 3EVCA 3OZDA 4RZXA 1QZXA 3L7JA 1U2QA 2J5BA 2OZEA 4P81A 1P0QA 4N9QA 1PKEA 4X60A 4JV5B 2BKVA 3KKOA 4CMHA 3R6TA 1OW3B 1EKXA 1THGA 4GL2A 3P71T 2J59A 2DH5A 1EMDA 1YA6A 3LFHA 1VPEA 4JUAA 4Q7JB 3QHQA 2H5EA 2GD2A 3ZQUA 4ZZ1A 1JKIA 5ALDA 2CKDA 2FZCA 2Q41A 3ESAA 4JVNA 5AKGA 3UMFA 3M82A 4F72A 1CX9B 2NO4A 2YVLA 5CNJA 3IP6A 4PIMA 1FPMA 5HKOA 1T9AA 3PHLA 4CL0A 3RIEA 2GKGA 1BD4A 2HA5A 1D0VA 4N5LA 2VDWA 2PD6A 2C3YA 3G1WA 3PUWA 5KTKA 2IX3A 2W37A 2VT2A 1L5GB 4F3CA 4JDPA 2C96A 2HCRA 2ZXFA 2HF9A 4HI0E 2HFKA 4JR2A 1Y6RA 2VF7A 4RQBA 4CL3A 3ZDAA 1UCFA 2YDYA 5DHQA 3KYBA 5AJUA 4TUYF 1IZZA 3BCRA 4CTOA 3P2KA 1S3IA 1UMCA 3I5MA 1P39A 3QF7A 3WDLA 4UHBA 3ZLUA 2NMVA 2BCEA 1FZTA 3KZMA 5A4KA 1QV7A 4X7RA 2JRBA 4RK5A 5CT9A 2FHPA 4MVJF 3QA9A 4GPEA 2IDKA 2QM3A 1XROA 1WG8A 1Z5WA 1MR3F 1PZHA 5BR4A 2YMPA 1CE8A 3C6XA 3H5NA 4MQUA 3H1GA 4TYYA 3MGGA 1JKJB 4QOJA 4UUOA 2VAMA 1NP6A 4Q4JA 2Y71A 3MTAA 2JAOA 5EMJA 4HDOB 2AOUA 2AWNA 4O2AA 2XITA 3KB6A 2IH5A 2IYLD 1NMSA 4EI7A 3OP1A 1G66A 2DR0A 4WMLA 3SC6A 3WGIA 3I4LA 2JD1A 3FLBA 3VC7A 5BSWA 3OCWA 3FOZA 3QXJA 3KAPA 3VZSA 4HPJB 2Z8XA 3NG1A 1P7CA 1YO6A 1EESA 5DHUA 1U3TA 2VT6A 5AXBA 3RKSA 3T1YB 1SHLA 2B94A 5HG0A 1XEWY 2FOLA 2Q2VA 3H11A 1RQPA 1J33A 3SZUA 4HWTA 1L5ZA 3KYDB 4PLZA 1B26A 1KDOA 2GEDA 2KLBA 2PZ8A 3N53A 3NHUA 4KDEA 5FTLA 3IEMA 3DZIA 3ZHVA 4EJ0A 2GLUA 2OCPA 4PWZA 1ZK4A 3ADPA 4DHWA 3F7TA 3DDSA 4LZJA 1P81A 3TDNA 5EZ6B 4DMRA 3W9YA 2FZWA 3L0IB 4OB8A 3U6BA 1GL9B 4KXUA 1IMJA 3G5LA 3ZVRA 2YBEA 1JWLA 4Z7NB 2YFQA 4P54A 5SYAA 1NIPA 4K6OA 2ZAMA 2DFDA 2C1ZA 4KQ9A 2CHQA 3A27A 4LJ9A 3RU3A 1QH0A 3EC1A 3ZBTA 3QBVA 1E3TA 4M8IA 3FUVA 3TDKA 3RFFA 2NUPA 1E6KA 5CM9C 5ENZA 4ZXFA 1MXHA 4PICA 2Z08A 3R23A 4KLCA 4IFTA 1X2BA 5JAMA 1HNZB 4ZQCB 1FRVA 1L4BA 1XVUA 2H3EA 3DDCA 3EYAA 4KQ6A 4RLFA 2DVMA 2WE7A 1UC4B 1R8XA 2FKNA 4L51A 3USES 1ILEA 3U9TA 2I91A 1QU2A 1PJZA 5EXEA 4D46A 2BW0A 2IYWA 2VSQA 5FUWA 4B8YA 2WVHA 2QUAA 2XTAA 3AR8A 4L4SA 4Z9BA 3FTEA 1KFJB 3LWNA 4EFNA 3A3OA 1DU4A 1X7DA 2WJZB 3GUZA 3M8KA 4GMHA 4P4UA 5C8ZA 3L49A 4MIOA 1YVEI 4Q9NA 4KSYA 2F1OA 4WRRA 3WO0A 3OE7A 5EHXA 1GPDG 1M2OA 3C3EA 1QE0A 2QS9A 2AYYA 1JLLA 1QGED 2K4MA 2HJWA 2VXCA 3QVXA 4WI1A 3GRYA 1YZNA 3CVYA 4I99A 4LOIA 4HNTA 5HSGA 5REQB 2ZM6B 3OQJA 4P86A 5H3CA 1Y9EA 1DBIA 5EKTA 2HTEA 3AR2A 3WC4A 3BIWA 2H57A 3WYFA 4BMYA 2BONA 4YBRA 3PEUA 5C7IO 4NZZA 4U0JA 3WQRA 3AJRA 2QF7A 3GJQA 4EG7A 3EXHC 4G97A 1IY9A 1XLTA 2PYDA 4QDKA 1LSUA 4A8JA 3EPJA 3NTQA 4LYEA 4HFMA 4S1OA 4TRJA 3FSEA 3LT4A 3B53X 4XVUA 1ENZA 3T7EA 3TE7A 2J9YB 4H0FA 5EJ9A 1T5TA 5KYNA 3SGLA 1X8KA 4CEHA 4FCWA 4B47A 5ALXA 1D7AA 4QUDA 2WSSD 1YQDA 5C34B 3I23A 3RODA 4GKBA 1KY3A 2BLLA 4KB5A 1LK5A 2RGEA 4QXAA 2X8BA 3CF4G 4KOAA 5IDVA