1MO5A

Reca-atp-gamma-s-mg complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
329
structure length
317
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecA
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 81
structure length 317
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo5A01
3PUYA 5K8TA 3BC1A 4Q7JB 2GETA 1DOAA 3PENA 5E95A 1W2HA 2F7SA 4OQXA 4NYIQ 5LD2B 1IBRA 5JWOA 2IS2A 3SNHA 4Q47A 4PZZA 2QBYA 3QXCA 3IBGA 3IHLA 3KQNA 3ZD6A 5KSYA 1N6OA 3SJZA 1GIAA 1T6NA 4V0KA 4NYIR 1TUEA 2IWHA 4FCTA 4MYUA 1E2FA 2ATVA 4TT3A 2V1UA 4CRWB 1E9RA 2GNOA 3QF4A 4TSFA 4HAWA 4E07A 3THYB 2ODBA 4KO8A 3LLMA 5DHFA 1XTIA 3U44A 1Z07A 4OHWA 2DCUA 2QAGB 4DLWA 5BYJA 4GL2A 1Z29A 1M7GA 3TH5A 3HPRA 4F38A 2QT1A 2ZI6A 4G5SA 4N3NA 3QVUA 3UATA 1KMHA 1WCV1 2A5DA 1OKKD 4MYTA 4OI4A 4QGHA 4X8HA 1GRNA 2AHOA 1T8TA 4WXRA 4MKFA 2JATA 1XMVA 3C5CA 4LHVA 1J70A 3QKTA 1I4LD 1NN3A 4MDEA 2GXAA 2J41A 3TLXA 2O8EB 5B64A 4DRZA 2LWIA 2VBCA 1MRNA 1HT2E 1VHTA 2OLKA 2RKOA 4LBWA 4Q9KA 3CONA 2NGRA 4MGZR 3CR8A 5KPJA 1ZU5A 1P5ZB 3KZ1E 4L9WA 1GFIA 3O8DA 3EW9A 4MKIA 4N1AA 3RS3A 3V9PA 2XZPA 2Q3FA 4D2IA 4B2IA 4DLXA 3EPLA 2ZUCA 1KI3A 1TX4B 3KXIA 4DUGD 3CR7A 2O8CB 2QA5A 4Z8YA 3MAAC 1NMYA 2C03A 3MMPA 4ITRC 1Z08A 4AD8A 1YZTA 2EQBA 2FEMA 4HLCA 1Z0IA 2O0JA 3QUSA 3ND8A 1TU3A 3L8ZA 1P4SA 4C3ZA 1P72A 4MGKR 1Z8FA 2OCYC 2FE4A 1R5NA 2GEUA 5HTKA 2YZ2A 2WJHA 5JCPA 1G8FA 4P4TA 1XPRA 4UNRA 3LRPA 4BE7B 2OLJA 2ORWA 2VO1A 4ZPXA 3MWYW 1OH7A 3K0CA 2VL7A 4PO9A 3E70C 5KHOC 3R8FA 3LA6A 1XMSA 5SZKB 3RABA 3CNNA 4LJ8A 2ZI3A 1U90A 4DLZA 1H8HA 4HDQB 2D7DA 2GVDC 4V0OA 2CEAA 2UVQA 3G0HA 2OEPA 1NBMD 1YRAA 4ZKEA 4DZZA 1S3SA 4A6XA 5UKDA 1W7AA 2OT3B 4EDHA 3W5JA 3UPUA 4XJXA 1KK2A 2O0KA 4KFUA 4RD2A 3AQ4A 2H7VA 4WBSA 3U44B 1EESA 4KFRA 2GZAA 3U7HB 1PJRA 1DAGA 3A58B 4CT4B 1JPJA 4ZDIA 2I3BA 2MMCA 2QM8A 4KCGA 3J81k 2DFLA 2W2XA 1N6HA 4WAUA 2IA5A 2GF0A 4Q19A 1J8MF 2IEYA 1PUIA 4B43A 3CZPA 4URYR 4B2PA 3U5ZB 1KAGA 2FWRA 2IXEA 1KY2A 2PLFA 1OT3A 1W4BA 3IQWA 4JVMA 4LZZA 3SE0A 1MABB 3W8RA 2IUTA 4EPTA 1FZQA 1FFHA 3GLHB 2PMDA 4MRPA 3SN6A 2PMKA 1KI7A 4OKSA 1XTJA 3GLIA 4YMUA 4Q4JA 2A30A 2ORIA 5IDVA 1UAAA 1N5JA 1FTNA 1IQPA 3SR0A 2CCJA 5B30A 3S1AB 5L3SB 3U3OA 5AJZA 4DDWA 4TQ9A 1FUKA 1XCPA 3AKDA 3WBKA 4F93B 1UKZA 4QBHA 3THWB 1MO3A 1EFRD 1ZMXA 5DN6A 4Q1FA 1FPMA 1G41A 1AM4D 5BQ5A 4C30A 4OQFA 1D6JA 3U3JA 1E0SA 2ZU0C 4JLOA 5IK2A 3U60B 1GL7A 1VECA 2C98A 1KKLA 3KKMA 2JJ2D 4LJ9A 2OXCA 4TYWA 4KHZA 1DAEA 2LCFA 5B57C 5JZVA 4FINA 4JL5A 4AKIA 4ZKDA 4W5HA 4UXIA 4XSGA 4AKEA 5J4HA 3PEWA 1OYWA 1W2GA 3GJ0A 4NCHA 3JVUA 4HLDA 1ZAKA 1HYQA 4P4UA 5EXTA 3KJHA 2NTYC 3NHBA 4W7SA 1E0JA 3PEVA 1D5CA 3WYAA 3BB4A 4Y0AA 4BFXA 4V0MA 1XU4A 4RD3A 3K0FA 2G0TA 1FP6A 2F6RA 1UJ2A 3E1SA 3OE7D 5CDFA 1EXMA 1TQDA 2QM7A 2TMKA 1D8TA 2Z4RA 3CZQA 3BORA 4PPGA 4M9QA 3PFIA 4AG5A 1E0KA 1VG0B 2XOKD 2UZIR 4EFMA 2W6JA 1XD8A 1ZC4A 2QMHA 3K70D 2IS6A 1NJGA 3GPLA 3VKHA 2CCKA 4TN1A 3RS7A 4URWR 1S2MA 4V02A 3IBYA 1FW6A 4LJAA 1F3OA 821PA 1E9AA 2F3RA 3LQRA 2QT0A 4TL7A 1ZINA 1HQYE 1YHNA 2XSZA 2O8BA 4RD1A 4OI2A 2C9YA 3BGWA 4LPSA 5CB6A 4Q4HA 3M4YA 1E98A 3OAAD 5FBLB 4LCBA 1YZKA 2A3RA 4JYBA 5E4FA 4D81A 5GADl 4PQFA 4KLNA 2KE5A 3OEEA 4RVCA 5BN5A 1Z0JA 1YR8A 1XX6A 1H8ED 3SJBA 1E69A 1TQ6A 4PHTA 4IJMA 1UF9A 3LVQE 1NVVQ 4IHQA 1NG1A 1P73A 2OO7A 1GILA 1HUQA 1XTKA 1BIFA 1KSHA 3RLFA 4NPHA 3AVXA 4C2UA 4NBSA 4M9SA 2R8RA 4Q4AA 3SC3A 4B3DA 4GSYA 2PH1A 3IIMA 3U4QA 1NVVR 1W36B 3TSOA 3T12A 4GMDA 4EQ6B 3NWJA 4UNQA 1KI1A 1JJ7A 2ZAOA 3TW4A 5FI1B 2J1LA 2QE7A 2AX4A 3QKUA 1T3SA 2XXAA 3AVYA 4JLAA 2BBSA 4HUQB 2JLSA 4Q03A 4IOJA 1G7RA 2BWJA 3NEJA 1OHHA 2GCOB 1YJ5A 4YXWD 1SHZA 2ZU6A 4QL3A 4TL9A 2VTKA 2QPAA 1ZRHA 2BV3A 3QPVA 5KTYA 2H18A 1PZNA 4XVRA 3HU3A 1OXTA 2YOGA 1GDDA 4FMCF 4D26A 3TK1A 2NG1A 3SI7A 2GHIA 5G3YA 3SDZA 4KODA 4B3CA 2W00A 5LD2C 2PZEA 4TYPA 3ZLJA 1KHTA 4AURA 2VSXA 1ZC3A 4DCVA 2X77A 4DEXA 2C95A 3FHTA 1P9RA 4O2RA 3GFTA 1S4QA 2XB4A 2I1QA 1YR6A 3K9NA 2O8DB 4NHOA 5JI2E 3TR0A 1A4RA 2JJ8A 4TQUS 5E7MA 1M2OB 1FNMA 3ZZTA 4B47A 1QDEA 5FBRB 4BRWA 3U3RA 5BXQC 2QL6A 1CR2A 4LUCA 2EVWX 3FB4A 1XXHB 1EFUA 5C4MA 4CW7A 1LS1A 3F5FA 3WYFA 1JR3E 6Q21A 2WWYA 3MJRA 4F4JA 4FW9A 3TRFA 2BKEA 4HB2A 2EFCB 1G64A 4CEJA 1AS0A 2AD1A 1RW4A 2WPDD 4RFSB 1JAIA 3WHKA 3X1WA 2C8VA 4XD7A 1N3BA 2V55B 4PAQA 4GOKA 3WMEA 1MH1A 4GMXA 4BPBA 3R7WA 5JS7A 4DCUA 3KB1A 4ACAA 3EWSA 2JDID 2FGKA 4HB0A 2DY1A 3P32A 2G6BA 2OAP1 4D4JA 1ZCAA 2QI9C 4D0LB 3RRNA 2ZUDA 1I4DD 1KI2A 2P6UA 4B3XA 4EPWA 3DEFA 1VG9B 5FPYA 3VX4A 1QZXA 3DZ8A 3VR2A 4EFLA 4UNSA 3SFZA 3AP1A 4Q01A 4YDSA 2OFXA 1XDBA 4M1YA 2NO7A 2ZJ2A 3LD9A 3VNUA 4G5GA 1R7RA 2IBMA 4ASUD 2DYKA 3NBYC 4FCVA 2Q6TA 3FHCB 3NH9A 2CCGA 5TVKA 2QRZA 4NKRA 1F48A 1UADA 4LJ5A 1KY3A 2F1JA 2HF9A 2DBYA 3GLFB 4TMXA 1R0XA 4I1OA 3CF2A 1MKYA 2D06A 3C4JA 4G3XA 3A4MA 1VYTA 3SHFA 1NL3A 3NDBB 2KWIA 3FYHA 4OI1A 1IN4A 2FOLA 2OXRA 3VKWA 3W34A 3EX7C 1EX6A 3CKLA 5HKKD 1Z06A 1BYUA 4FWTA 4IOLA 3QY0A 5AUOB 5EP4A 3TVTA 1VYUA 3LO5A 5GVRA 4C0BA 4JT4A 3TAUA 2ZRBA 3FPAA 3NC0C 1XJCA 4NP6A 3EA0A 2CLSA 1I2DA 3NBZC 2R6CA 2G0NA 2VLIA 4MGIR 3U7EB 1P3JA 3AVOA 3TQCA 5DH9A 1Z5ZA 3SJAA 4Q48A 1F2UB 1KDTA 4BLQA 2KI5A 3C41J 1MOZA 1N5KA 4IXNA 1BMFA 3RVBA 2VYFA 4TLDA 1PLLA 1YRBA 1OIWA 5L3QA 1KTVA 2ECKA 5C1BA 4FXPA 4L15A 5EE0A 1II0A 4XVUA 4M8NE 4MRVA 3X1YA 2CHQA 1QHGA 3TKLA 2P6NA 3R9IA 4TZ6A 1JQLB 4TYYA 3SBDA 3QOFA 4ZI2A 4BECA 3FWYA 1L4UA 2GXQA 3BH6A 4NDZA 3K0SA 3LQQA 1IJEA 2AXNA 4FIDA 2VSFA 5J4KA 4K46A 3B60A 4QC2A 1TU4A 1DPFA 3ICEA 1R5OA 1AN0A 2IUUA 3IPYA 4IDNA 3L2OB 1E1QA 1VCIA 4UJ5A 4C0SA 1JR3D 3CRRA 4O3MA 4TSFD 4Q1EA 4A0RA 2V54A 4LYAA 4A9AA 4BWYA 3AF3A 5JRJA 4Q9LA 4JT2A 1YR7A 2ZJBA 3UMRA 4XTRA 3BERA 4BRUA 1ESNA 2IYTA 2G1KA 4DIEA 3ICQB 1OIXA 4LWZA 1D9XA 4BLTA 2PT7A 1SKYE 1IJFA 3LXRA 3EZ2A 5FR1A 2AR7A 2JEOA 2VSOA 4NH0A 3T1QA 3KKOA 2RGEA 1AKYA 1E2LA 1RJ9A 1LW7A 4QBGB 2FZ4A 2GVZC 4KYIB 4M1KA 2AK2A 3Q3JB 3Q9LA 4M9XA 1UKYA 2C77A 2IS1A 4IW3B 2GJSA 2WSSA 4DLRA 3C14C 1CBUA 3MWLA 1ZIPA 2D2FA 2XTZA 3N70A 1N6NA 3EZ9A 3HYRA 2CK3A 3PUXA 1KJYA 2RMKA 1W4RA 2BMEA 3IKJA 5D3MA 4C0JA 3SEAA 3T1TA 3CPHA 2W58A 4V0NA 4WZAE 5F3WB 3VU9B 3KKNA 121PA 1S0UA 4JLVA 5TY0A 1SVWA 2VIIA 2E9SA 3B1YA 3O8CA 2HCJB 2D74A 3BOSA 3T1VA 1WE2A 5CK5A 4P32A 5AUNB 2IYYA 5JJKA 1ZNWA 2QPTA 4URVR 2B21A 4KSBA 1UEJA 5L3RA 5DI3A 1H8HD 1R10A 1W1WA 1P2SA 2BJVA 3I73A 2OV2A 2ZS9A 2NO0A 3FMFA 3QBTA 2H92A 3M6AA 2N46A 2O5VA 4GZLA 4PPQA 4M2LA 2JLQA 1N5IA 3WMFA 2ZYTX 1JEEA 1N5LA 1WDTA 2J7KA 2PT5A 5DISB 3KKQA 3NIBA 421PA 4OHZA 1XMIA 1XTQA 3C5HA 3IQXA 4PR0A 1SXJA 1OYYA 521PA 1COWD 3GLGE 4LY6A 4A2PA 3AP2A 1M1YE 3WYGA 3EIQA 2NO1A 2GZDA 3K8YA 5JSZA 4CEIB 5CB8A 2EWWA 4BQSA 3LW7A 4TMKA 3VMFA 4DCNA 1G17A 4B3BA 3FVQA 4ARZA 3SBEA 3QBVA 3THOA 3B13B 3K0AA 3QJYA 3A1TA 5FPSA 2D7CA 2RGCA 1NP6A 5FFMA 1ZD1A 2IXFA 4QBIA 3EC1A 4LPKA 3ZVNA 2GCNA 4JL8A 4X8OA 2V7QA 3PUZA 3N2EA 1XEWX 2OG2A 2A5GA 2P5TB 1G8YA 3BFKA 4URXR 3I5XA 5SZJA 2OCAA 2ZAMA 1TNDA 1TF5A 1KK1A 3QKRB 2FMXA 3AH8A 3BXZA 2OESA 3A6PC 2IYWA 2YHSA 3GFOA 2J7PA 5DYIA 3F3YA 3AKEA 2YINC 2EYQA 2N42A 4QJ5A 1Z6XA 3CX6A 4BGDA 4QGFA 2WHXA 4Q1AA 4B6EA 2OAQ1 1IY0A 2F43B 3UIEA 5IK2D 5EUMA 2BMJA 3A37A 4OQNA 1Y63A 2FNAA 4IVPA 3THYA 2WZQA 4TMVA 5CK4A 5FH9A 3LXXA 3IO3A 3HU2A 1CS4C 1AZTA 2R2AA 4HI0E 3EG5A 2QAGA 3R20A 3QPUA 1KI6B 621PA 2W6IA 4F7WA 1NY6A 2QAJA 1XFAA 2GDJA 1IM2A 4NZYA 2HT1A 3FHOA 4H1UA 3VHXA 4AG6A 2WJVA 1IY1A 1PLJA 2W2VA 1JECA 1L8QA 5JEEA 1GRRA 4WXPA 2GF9A 4F4CA 5DI9A 2O8EA 2CLCX 1MR3F 4G01B 4Q5IA 1VHLA 5JSZB 3V4RA 1FMLA 2G3YA 3H1TA 3EIEA 1EG7A 5HE9A 1VKJA 2QTVB 1XP8A 1N6KA 2OFOA 5C4GB 1F6BA 1XF9A 5EE1A 4F4IA 1WBBA 1N2CE 3NH6A 3OIUA 1XBTA 1U2RA 1ZBDA 5CYOA 3VR5A 2FV8A 2IYQA 3U7GA 3GMTA 4HZUB 2O8CA 2C5LA 1ZM7A 4IDHA 1E32A 2XSZD 2ODEA 4B76A 4LHXA 4N0EA 4MUBA 5FOXA 4Q7MB 3T34A 3ADKA 2FPLA 2WOJA 2RCNA 2ZE6A 1W47A 5J5CA 2QUZA 5J47A 4DXAA 2OCPA 1O3YA 4L8GA 2OM2A 4FMDB 4JJKA 1HV8A 1DO0A 3IEUA 4R2IA 2DFKB 5HE8A 2V3CC 1M7HA 2CBZA 2H1LA 3U7FB 3V00A 3BS4A 4K8OA 4AYWA 1YZQA 3K09C 1KDOA 4EIWA 4XSHA 1EFTA 2IEZA 3A1UA 3K9LA 5KSOA 2QPOA 3QXSA 5K8LA 2VEDA 4DB2A 2WOOA 2Z4SA 4TYQA 1I4TD 3LBIA 2ZR7A 3BD9A 1E1RA 3DO6A 3OFNA 4TMZA 2VPPA 3I61A 2EFDB 5EP2A 2BEKA 3ZVRA 5KO2A 1CJUC 2PL3A 5BW8A 1P9NA 4JSYA 1GUAA 2CL0X 3MWJA 4CIDA 2WWIA 1OHHD 2F1RA 1IN7A 2R65A 2ZE5A 3ADDA 3CLVA 4QFMA 3CNOA 2IT1A 2O8FB 1S3GA 2NIPA 3GD7A 3NG1A 3NVAA 1MABA 1KDRA 4AC9A 3GLHA 4IEIA 2FJUA 3BE4A 4JS0A 3GJ8A 3RRMA 1G20E 4ZI3A 4MKGA 4RFVA 4Q7LA 5FTNA 3V4FA 1T0JB 2WAXA 3QKSB 4EJSC 4QJ3A 2BJWA 1RC8A 4OQLA 4HEJA 2Q3MA 5EE3A 1JBKA 5L3SA 3S1AA 2DWOA 3ZQ6A 2CVFA 1G3UA 2AFHE 2IWRA 1LV7A 3K0EA 4NCKA 2J46A 1EWQA 4PZLA 4CDGA 4DLYA 3O47A 3TMKA 4D4LA 4DSTA 3THWA 4IXMA 3TVDA 4Q9JA 1CJMA 3LX5A 4KVGA 1DELA 1NLFA 2WIAA 3W6OA 1OLOA 3KXLA 3KX2A 1G3MA 4ESHA 1U9IC 2QG6A 2VHCA 3THXB 3KTAB 2VF7A 2RB4A 3ZVMA 3P4YA 3E5HA 3AKCA 1JPNA 3ASZA 3BH7A 4L9SA 4AIIA 5FBQB 3WY9A 1S1MA 1S8FA 2FFAA 2IF2A 2UKDA 4KAXA 3GQBA 1M34E 2JAQA 4MRSA 1FUUA 3NXSA 1D9ZA 1E2GA 2Z6VA 1OH8A 1TEXA 2C99A 1Q22A 1Q1EA 4EKDA 1XMJA 2F9LA 1IOZA 4QJ4A 4FN5A 4U02A 1C1YA 1QG2A 5CIQA 3WXMA 4WW0A 1K5GA 4G5QA 2CLDX 4KFSA 3B1WA 4A8JC 4A2QA 5FTMA 2JASA 5TMPA 2L0XA 1II8B 3P27A 3PXGA 3U6KA 5EE5B 1GL9B 5FL7A 1DO2A 4E03A 1N0WA 1AQYA 4B3GA 2ZM5A 1KZ7B 1NN5A 1NN1A 4C9BA 1XD2B 2MSDB 2XGJA 1OH5A 2HXYA 1KO7A 2KJQA 3AKYA 3IHWA 2QSZA 3UMFA 3F8TA 3X1ZA 1LY1A 3DDCA 3CWQA 1GP2A 1DG3A 4LBZA 2WVJA 3BFXA 2JIZA 2NO6A 1YZNA 1AIPA 4II7A 221PA 3LBHA 3W3ZB 2ZSAA 3ECCA 3DOEA 4M4SA 5CLQA 1BH2A 3FKSD 3QE0A 1G3IA 5JEDA 5JJLA 2DWPA 2IHBA 1E2MA 4Z1MD 3L0OA 1Z3IX 2QZ4A 4UQOA 3Q5EA 3OEHD 3K70C 2VH5R 5CYPA 2YOHA 4DBLC 2XZLA 2Q9BA 3WMGA 2XNDD 4RSGA 3GJ4A 4Q21A 1RRFA 2EFGA 4PO1A 4IFBA 2BMFA 5EXPA 3ZZ0A 5JLJA 5IRCD 3DPUA 1E79D 4EQ6A 1I2MA 3EWAA 3RDPA 3PUWA 2GZHA 2ERXA 3FDIA 5C2JB 4ON9A 3EZ7A 4RCYA 1BO6A 2D2EA 5KSPA 1ONBA 1RYFA 3CPJB 2G1JA 4HUQA 3MLEA 1BMFD 1XCMA 3A1SA 1LNZA 1X8LA 1NF3A 5FOWA 1R0WA 3IIKA 1U8ZA 4J0QA 3D8BA 2GCOA 2GBLC 4QBFA 5DNYB 2JLRA 2P67A 3KUCA 4MUAA 1DAIA 2AKAB 4QG7A 4PPFA 4PQYA 2BDTA 2R62A 3DZDA 3LY5A 1GSIA 4KBFA 3MUFA 2YKGA 1G5RA 4B35A 3EXAA 4IVRA 4YMSA 4D82A 5TXGA 2ZROA 3SQWA 3R9XA 4EPYA 4NU0A 1W49A 2ZIAA 1G16A 4WZBE 1Z0DA 2RGBA 2FFQA 5KNCA 4NCJA 3UMSA 3EIHA 1XCGB 1AQUA 2HLDA 3LWNA 8OHMA 1VPLA 4Q4LA 4URUR 1SVOA 1ZNYA 5IF9A 4KLZA 1KK0A 4HLUA 1KJWA 5CJ2A 1A2KC 1G3RA 2O8DA 5DGXA 4A4DA 4HB3A 4NYMQ 2ZI4A 4QNMA 2AXPA 1XEXB 2R6FA 2YC2C 1JJVA 2ZRCA 2BM0A 5EUQB 2J5XA 3GEIA 2P5SA 3BJIC 3DM9B 5H8WA 1XXHA 2P65A 1U94A 4NYMR 1ETUA 2XNSA 5CJPA 3T5DA 3VR6A 3WRYC 2FGJA 2ZJ5A 4QHSA 2VHQA 1T3HA 4B34A 4KYUA 3QSYA 1Z63A 4Q1BA 1FX0B 2JLZA 3A1VA 1LVGA 4GBMA 3RYTC 1G291 1DTSA 4I4LA 4CEHB 3GJ5A 3GP8A 1NKTA 3G82C 2WJIA 4HLQB 4GP6A 4RFSA 2O52A 3HU1A 4BFUA 1WXQA 2QMUA 3QNUA 5K8IA 3PQCA 3T1OA 2Q3HA 4OHYA 4B71A 1US8B 1JAHA 1UEIA 4RZ2A 3FE2A 3RWOA 3QVVA 4M9ZA 2GJ8A 2CNWD 3I3SR 3WBJA 3ZYCA 1QG4A 2RGNC 1NRJB 4FMBB 1UBFA 2H16A 4URZR 1SKYB 1VIAA 1KDPA 2IXGA 3B5JA 2ZYWX 4R2HA 4PSVA 3VAAA 4D0GA 4KJZA 2MSEB 4PC2A 2C9CA 5LB2A 4DT1B 1SHKA 1XTRA 3RSOA 3QPWA 1W5TA 2XITA 4UNNA 1WP9A 2WMOB 4DLTA 1KO8A 2A5YB 1P2VA 3GLFA 3KQHA 3IEVA 3P4XA 3QXXA 1HTWA 2ZI5A 5AJWA 5JECA 4R71A 2Z83A 3UKDA 2FN4A 4O0MA 4BLOA 3K09A 1S96A 2ZRIA 1WRBA 1ZP6A 3PG5A 2GKSA 2JLWA 4U00A 1CJKC 4PO8A 5JHGB 1RIFA 1W0JA 1WB9A 1LFDB 3R8CA 2A78A 2VP9A 3TUJC 4QM7A 1W0KD 4C0HA 1OXXK 3MFYA 1SXJD 3OIYA 2ATXA 4DUGA 2IX3A 3LH5A 3BH0A 1TQ2A 3B9QA 2FA9A 3DKVA 1YU9A 4S35A 1F2UA 2YWHA 1PUJA 1Z83A 1KOFA 3CRQA 3QIAA 3CF6R 1NIJA 5KDLA 3LX8A 4DKXA 4ZCIA 3N5CA 2J59A 4LGMA 4QGAA 4HUTA 1TPZA 4IOMA 2V1XA 2AWOA 3UWKA 1J8YF 4KBGA 1TF7A 1NIPA 2IYZA 1L2TA 3DHWC 3AVUA 4HAXA 1VIYA 1E2KA 1M6NA 2JCSA 2AL7A 1WA5A 4TLEA 4D0NA 4IFEA 1DAHA 1NBMA 5DLQC 1UPTA 4NYJQ 5KDDA 3GLGB 4LDJA 1K6MA 1L4YA 1OFUX 1CR0A 2ZE8A 1WBDA 1EFHA 1E9BA 1NLZA 2GJAA 4CVNA 2CMKA 1AZSC 4U5XA 4KV9A 2EFEB 5FOTA 4JVLA 1A2BA 1P62B 2QORA 3FKQA 2HDNB 5AJVB 2P0EA 2ZYUX 4NYJR 4Q66C 3W8NA 4ZDJA 4LC0A 4EPXA 4KITB 4R7ZA 4DLUA 1Z0AA 1G8PA 2JLVA 1ZVQA 4YONB 1KMQA 4RKFA 4D6PA 2GESA 2ZI7A 4IDQA 3AUYA 3SJCA 1KO5A 3ZQJA 3BWDD 4N0DA 1DAMA 3AVPA 3WNCA 1OSNA 2W83A 3U3MA 1YZLA 4CGZA 3OIVA 3TGPA 1XJ0A 2W6ID 4E09A 3K9GA 2YNMA 4PZYA 2X19A 2WWWA 3VNVA 3Q7QA 3AGQA 2WKQA 3EC2A 3B9PA 2MMGA 3RWMB 1J90A 3IPXA 2QGNA 4E22A 2OHFA 1G1MA 3EPJA 2FX3A 4BZQA 1ZUHA 3QEOA 2PJRA 4KFTA 2ZRPA 4JLBA 1BYIA 4OHXA 2GCPA 4TTPA 2XTMA 3RS5A 4TYNA 3REGA 4PHFA 2F55A 3BRWD 1AGRA 3O8RA 4IVQA 1OV4A 2QNRA 2PCLA 4LX0A 2MSCB 4HYYA 4UKDA 1KI9A 1XPOA 2ONJA 4M1OA 2CJWA 2B8WA 4JJZA 1W4AA 4A36A 1SVLA 2KB0A 2JJ2A 4L16A 1FQJA 4A1FA 5FPHA 3HR7A 4G1UC 4JSTA 4QKQA 1J2JA 4C2TA 1MT0A 3VU9A 1P60A 2W0SA 4EJSB 3EZFA 3GJ3A 4QM6A 2OBMA 2GK7A 1HQCA 2HCBA 1W44A 3MG9A 3PIRA 4Z8XA 2PZGA 1DADA 2XJ4A 4OI0A 4PHGA 3GLIE 3NHAA 1N6RA 1NN0A 3H0KA 1A5TA 4AYXA 1E2HA 2REOA 3OE7A 1WF3A 4JZKA 3AF4A 3HJNA 4DCTA 4TT3D 4BFTA 4L4UA 2X1VA 4ESVA 1RE0A 2GXSA 3B6EA 3D7MA 3LNCA 4P4SB 3SYKA 4PQRA 3CRVA 2FPKA 2B7CA 5SZIA 5M04A 1HE8B 1G4UR 4GT1A 2EWVA 3MGCA 1FOEB 3NBXX 2ZSDA 1Q21A 2BBOA 3KJEA 3P20A 3QG5A 1CULC 4AYTA 3I62A 2VF8A 4BLRA 1EX7A 1NY5A 1G4AE 2ZITA 3G5UA 2FDCA 2J87A 3U6BA 2V6JA 1IXRC 2QN6A 4B48A 1QHSA 4KVAA 4G0NA 3LBNA 1T0HB 2BCGY 4CEIA 1FTSA 1T3LA 1CLUA 2IHYA 2FFBA 1G5TA 1QF9A 2DB3A 1G18A 1JEDA 4JYCA 4A8JB 3KXKA 5F9FA 3SHWA 3TAHA 3NDPA 1CR4A 4V0ME 1OXVA 3I5YA 5CDFE 2GJKA 4Q1CA 2QMEA 3B85A 5GJBA 2P2LA 3GEHA 2BHRA 2IYLD 3DM5A 2G9NA 3UG7A 2WBLC 2B92A 2CJWB 3I8XA 4M53A 4ZIRB 1X86B 4PC1A 1OXSC 2DFTA 3A4LA 3L82B 3OIWA 2JLYA 1RVDA 1AGPA 2H57A 3QKRA 1S9DA 2VP5A 1GKIA 3MD0A 1KIMA 2EYUA 4RCZA 1O87A 4B2LA 4O25A 2Q9CA 1OJLA 2D3WA 2BC9A 5JS8A 3ZJYA 3CNLA 2DR3A 3EZ6A 1J99A 2F43A 2Z0MA 3W6PA 1Z6YA 5JI3E 4OYHA 1MO6A 4M1TA 3NKVA 4MQBA 2AD5A 4RD6A 3AVTA 2F9MA 4YXWA 2XB2A 3AVVA 1EWRA 2QTHA 3VHLB 2YWEA 4WA7A 4LV5B 4DDVA 2CHVA 3K53A 4OK6A 4B73A 2ZEJA 2P3SA 1DBSA 3K70B 1KI6A 2QY9A 1VCNA 1DEKA 2C2HA 2NO9A 2ZJOA 4CF7A 1RFLA 2RH5A 4G5RA 4AY2A 1GNPA 2WV9A 4LBYA 1UBCA 2IYSA 2FSFA 1U8AA 4ZO4A 2PX3A 2WICA 3HDTA 1JI0A 2ASEA 4XIGS 2GAAA 5A0FA 2VP4A 2EU8A 4EAQA 3M0EA 2K5UA 4XH9B 1Q1BA 1ZNXA 5FL7D 3FMIA 1QHHB 3I32A 3SS8A 3W5IA 4IRUB 3SU8A 3DKPA 3ZIAA 5KNBA 3PCRB 5KYKA 2PBRA 1V5WA 2X2FA 2ZVPX 2A5JA 4HZUA 2QP3A 4UXJA 3WNDA 5B2ZA 3EPKA 3RC8A 1NJFA 1NSFA 1SGWA 1DE0A 4TLBA 1QHXA 2JIZD 3QEJA 5JBQA 2JJ1A 1NVWQ 4PAOA 2J9RA 3ZVLA 1GNQA 1SVMA 1G6OA 1G6HA 1RRGA 2G83A 4XWAA 4XWKA 4JBXA 1VCOA 3TQFA 1UKVY 4TL6A 3TBKA 5CITA 3LVRE 3UG6A 2B7BA 3L43A 2WPDA 3T35A 3WP1B 4OQMA 1FNNA 2UZ3A 1Z0FA 4HZIA 5DN6D 2ODNA 1AA3A 3DOFA 4L5BA 2IYVA 2ZRHA 1IN5A 3DL0A 5FPKA 1S9HA 1GTVA 1ZM3A 1RRPA 3FMOB 4MKHA 1IN6A 5K8UA 2C96A 3SZRA 1MO4A 2YV5A 2R6AA 2WWGA 4LJ4A 3KKPA 4P31A 3W6NA 3ZDQA 1SQ5A 3SYNA 3ZS9A 3B8HA 5KU1A 1GOTA 1OFTA 4FMCB 2JGNA 2RAPA 1WQ1R 4Q18A 3L0IB 4HATA 4I1VA 1HE1C 1VG8A 3VR3A 1QHNA 2AWNA 2GTPA 3CO5A 1EGAA 1FMJA 1C4OA 4A82A 2Z43A 4K81B 1QRAA 3GFPA 4OL0A 4RZUA 4XWOA 2O8FA 3H4MA 2R6DA 5A4JA 2W6JD 4ZDWA 1E9FA 1NKSA 2RHMA 2J0UB 1B0UA 4OK3A 4DSOA 2DFNA 4NTZA 3KFVA 2VHJA 1XZPA 3L0PA 4Z51A 1X8JA 3QKSA 5HKKA 1E2DA 1TAGA 3AP3A 2HLDD 2D62A 3PJRA 4ZCLA 1BOFA 2VP0A 2XJ9A 1T5LA 1KO1A 3CRW1 2KBEA 1B23P 1T4GA 2CVHA 5C46F 1IY2A 4D80A 2REXB 2CXXA 4DJTA 3THXA 3OEED 1G8HA 1Q3TA 3KTAA 2D4HA 5DIFA 1OPXA 5FUWA 3REFA 3TJZA 4TL8A 2FF7A 2QMOA 5HZHA 4B75A 4KI0A 3UWOA 1KGDA 1GL6A 4GZMA 4B33A 4YMTA 4DHEA 4I1UA 5DO9A 5FBVB 2OZEA 4RD4A 1A82A 2NMVA 1R8QA 1CEEA 2ONKA 2IYUA 4B74A 1ESMA 1R4AA 4WIAA 4PAMA 3RRZA 2H5EA 2BOVA 4QXAA 4LV6A 2CL6X 4Q1DA 2ZRKA 2Y8EA 1Q20A 4TLCA 4PX9A 1E4VA 5GVSA 4US1R 5EP3A 4PANA 1KNXA 1QHIA 2QE7D 2WKRA 1IAQA 3BAFA 4P0TA 1UKEA 4QGGA 4YC7A 4C0KA 1P7CA 4FI3C 4F92B 1YVDA 1II8A 1G7SA 4H1VA 1NI3A 3IILA 3EPHA 1BS1A 1R5BA 1TUIA 2FG5A 1KYIA 3K1JA 4EPRA 1JR3A 1KSJA 3LV8A 4PC7A 1F2TB 1JXOA 1XD2A 1DVRA 1A1VA 1SKQA 3AUXA 1GRQA 2HV8A 5KNDA 3T15A 3QXHA 2NZ8A 1CTQA 1ZYUA 4JVNA 2OFWA 1AS2A 3OF5A 1P75A 5SZHB 5CM8B 3FGNA 4OK5A 1Q3HA 2QRNA 3H84A 4LHZA 1E3MA 3UXMA 2CE2X 1P2UA 1GG2A 1FP7A 4YDHB 2GEVA 4D4MA 1TMKA 2WSMA 3SOPA 1N6PA 4H9GA 1ZU4A 2IYRA 4C7OB 2N1BA 5B58C 4HAVA 4MITA 4TWZA 5J4LA 3GEEA 3PEUA 2LKCA 1XEFA 2RGAA 1W0JD 2DWQA 4M1MA 2ZRMA 1Q1QA 5CIWA 4JLNA 4JVSB 1OFHA 3NEYA 3TNFA 1GKYA 2BMDA 5FTLA 1E94E 3DMNA 3QF7A 4M1SA 1E9CA 1U0HC 5EJEA 1GM5A 2BVNA 4US0R 4HAUA 2NPIA 5CLLA 5HCNA 4ZCMA 4M0LA 5ANRB 2YYZA 4DEYA 4KXFB 3QQ5A 5ELXA 2GRJA 2ZSFA 4Q00A 5C18A 5E3HA 1RZ3A 3ZH9B 3EARA 5H1YA 1Q1ZA 4FWIB 3M1IA 4XD7D 3E2IA 3RHFA 3GJ6A 2FZLA 2QQEA 2X8AA 2BKUA 1HEIA 2A9KA 2QBYB 1NVXQ 3AF2A 3HYTA 2SHKA 1EFCA 4BASA 3Q85A 1U0LA 2IC5A 4V0LA 4DIDA 4UXHA 1YZGA 2ZQ5A 2ZR9A 3QF4B 3CPEA 5HR5A 5D3QA 1OB2A 5KDOA 1P9WA 3LAWA 5IHPA 4MA4A 3CRMA 3B7GA 3U3KA 5JHHB 4GDFA 3ZS8A 1Q12A 4YMVA 1J7KA 1OFIA 4OBEA 4PSKA 2PEYA 3GJ7A 3P26A 1GZSA 1COWA 4LHWA 4NCIA 1CRPA 1KMHB 3RSLA 4G5OA 1E9DA 2HT6A 3IUYA 4QOSA 3P1JA 3I1FA 1XEXA 5AR1A 2R44A 2J0QA 1LS6A 2EW1A 3K9HA 1TTTA 3RANA 2C04A 2QGZA 5FOUA 1CKEA 1HY3A 1QVAA 2NOAA 1WMSA 3QENA 5HCIA 5TV2A 4C0QC 1ZW6A 4R9UC 1XD9A 2QP9X 5FTKA 1N0UA 3RS2A 2Q21A 1P2TA 1FX0A 1E0AA 5A5GA 1T8UA 2GEDA 3PVSA 1G3QA 1L7VC 4LSGA 5FOVA 1P61B 4A0HA 3R9WA 2WM9B 4CEHA 2NQ2C 4NL4H 1TADA 1U81A 4RD0A 4MRNA 1QBKC 5FUVA 1LTQA 2HYDA 1RRCA 3QXJA 1F60A 1US8A 2GAOA 1CU1A 5TB5A 1W48A 1U0JA 1Z22A 2J3EA 1N25A 3RAPR 3CX7A 1E4YA 2ZS7A 2ZANA 1SXJE 2OE2A 1LF0A 1Z6GA 4JBWA 3SQXA 1S1CA 2CHGA 2RGXA 1E2PA 1GNRA 4GFDA 5FR2A 4NONA 3WP0A 2RGGA 3B2EA 4DSNA 3Q7PA 4OJQA 2WMNB 1JQJC 3C16C 4PC6A 2NZJA 3PV0A 1IXSB 3CX8A 2E1RA 4HDOB 3TW8B 1M74A 5JWHA 1X8KA 3B78A 3W9YA 1BKDR 5JJIA 4EUNA 1E2EA 4DT1A 2WAYA 1T9HA 2OSBA 3T06B 4RZ3A 3NTUA 2IL1A 5AWFC 5AUPB 4DC9A 3CIOA 3AEZA 3WHLA 1E1QD 3H86A 5BN4A 1ZJ6A 5EZ6B 1RKBA 4POAA 1UBGA 4JBYA 2F3TA 4IEEA 1ZUIA 2V4ZA 5AJXA 1XEWY 4PFSA 1W4CA 2QEQA 1NLYA 1PVOA 4R98A 1YKSA 4W5WA 5FUYA 5KSZA 1OXUA 1KSGA 1X1RA 5KUTA 3VQTA 4W9MC 5TDHA 1K5DA 1JALA 4LYJA 1VTKA 2KBFA 4A0FA 4DSUA 4FCWA 4XVQA 1ELOA 2EFHB 2BCJQ 1ZM9A 2DHRA 3I8SA 5GJCA 3GLIB 4Q4JB 3KUDA 2HEIA 2HUPA 1QVRA 3NC1C 4Z54A 2PX0A 3QG1A 3VKGA 4EFNA 2ZYVX 3B82A 4AWXA 4PPNA 4B32A 1G9XA 4LOAA 5FUXA 4D25A 5HPYB 4BEJA 3PEYA 1GVNB 1YZUA 2KSQA 2WSSD 3VTKA 5H68A 3MRSA 1LB1B 2CK3D 4DDTA 3KJIA 5JCZA 3GLGA 4JLMA 4AKGA 2ZTSA 3IDQA 3A1WA 2JA1A 2GA8A 4TTRA 2WJJA 1TF2A 5E7IA 4ERNA 1SXJC 4LYFA 2CDNA 4C4PA 4LJ6A 3ONWA 2B8TA 4PXAA 4A6PA 1UBEA 2J0VA 3EA5A 4P3YA 1UDWA 3ZGXA 1CXZA 4IOKA 1TEVA 1GKUB 4TMTA 2YVUA 5EXXA 4Q7KA 2RHDA 1W46A 1OKKA 4GOJA 3K0FB 4DLSA 2A7QA 2VP2A 4JLDA 1E9SA 4NE2A 2XX3A 5G3ZA 3TIFA 3QI2A 5GJVC 1X3SA 4DCSA 1HURA 3U2QA 1ANKA 2G77B 1OB5A 4I1SA 2FEOA 3CW2A 1IONA 1VG1A 3FTQA 3GJXC 1TQ4A 3OZXA 5F2EA 5J40A 2FSGA 2GXUA 1ZD9A 2PLRA 4TMWA 2O8BB 2OBLA 1Z6TA 4X8MA 4AK9A 4EPVA 1G8GA 3AV0B 2ZI9A 4Q4HB 4QHYA 1R0ZA 3ND9A 5L8VA 1R2QA 4BZXA 3ZIAD 2IYXA 2WWXA 4LC1A 4GRAA 5EE9A 5G41A 1N6IA 5BWMA 2P6RA 3C8UA 4PHHA 5E7JA 1E6CA 3TUZC 3CH5A 1RPZA 1ZM4A 3KDSE 1Q44A 3RC3A 1YE8A 2JLXA 1LF5A 3AVWA 2JJ1D 4RY2A 5FBWB 2V7QD 5DSZA 1E96A 5LDDC 4S2EA 2FSHA 2QAGC 4WZ6A 2IW3A 4NMMA 5G40A 4XTCS 3GLHE 4EJSA 4BFWA 3L8YA 2AK3A 3LFUA 4Q4AB 3OHMA 3U4QB 1JB1A 1Q0UA 3X1XA 1KK3A 4FMDF 2J7PD 4BLPA 4BZPA 2BBWA 3MJHA 1MO5A 4CYMA 3TE6A 1E2NA 2CE7A 3EASA 1HH4A 3LLUA 4QHTA 2HF8A 1KNQA 1PV4A 1GITA 1U9IA 3BB1A 2XXAB 1FL9A 1SULA 1VCMA 2R6GA 4IDOA 2ZRDA 4P4SA 4MYHA 5DE3A 3VR4A 5L3VA 3ASYA 4BEBA 1ZM2A 2H17A 3W3AA 1C9KA 1N6LA 1OW3B 1XB2A 1E9EA 5LBIA 2DPXA 2HJVA 1AJEA 4RJLA 1F5NA 3HWSA 3ADBA 2ZSEA 3A36A 3ETLA 5EQTA 1AK2A 3AB3A 3JVVA 4TQAA 3RS0A 4MYCA 2YWGA 4M1WA 4HB4A 5P21A 1SZPA 3EAQA 1HT1E 3FKSA 2YC4C 4A8JA 2ZJAA 3ZZUA 4XOIA 3FFAA 5IT5A 3FOZA 3CF0A 1K8RA 1NG9A 4HAYA 1EFRA 4ZV4A 3KQLA 4A2WA 1A7JA 4Z1MA 4X8LA 2J0SA 5EXSA 2OUKA 4IKEA 2FU5C 3SYLA 3RRYA 4F91B 3IO5A 2CL7X 2ANBA 2ORVA 1R8SA 3OEHA 4RKEA 4ZIRA 2BEJA 2F1IA 4LI0A 5KOYA 1AKEA 1Q57A 3KFXA 1H65A 4PTLA 1KJZA 2XNDA 5LB4A 1G7TA 4DLVA 4B44A 3VX3A 4FD2A 1E79A 1CRQA 1U99A 4LYHA 2QTFA 4BFSA 4CEJB 3UK6A 1KKMA 1UDXA 3I4LA 2ZRLA 1Y3AA 4RZXA 4M21A 3NBFA 3KL4A 2X2EA 1KO4A 3AF1A 3D6TB 4JLJA 2ZJ8A 5FI0B 3R7WB 4YLGA 4JMPA 2G88A 5H70A 2IF0A 1SVSA 2VA8A 2ZRNA 3D3QA 4B6FA 1JNYA 1MV5A 3BBPA 5FTJA 2XOKA 4BFYA 3D31A 3CM0A 2A5FA 4UNPA 4TZ0A 1Z2CA 3TSWA 5AJYA 1G19A 2PCJA 1UM8A 3TUIC 2XZOA 4WOPA 1E1RD 3OFND 1KAOA 2V6IA 4I99A 4C0LA 1D2MA 2C9OA 2PJZA 3BFVA 4UJ3A 4AI6A 5KPDA 4A15A 3MWKA 4BLSA 4QRHA 1G21E 4CZ2A 2ZE7A 3IGFA 2ERYA 1ODFA 3OAAA 1QHHA 2FSIA 1XWIA 5F9HA 3T61A 3TSZA 2V9PA 3OESA 3AF0A 3K0CC 1XJQA 2GBLA 1CP2A 5JFGA 3C7KA 3I72A 2ODWA 4JLKA 1H8EA 2Q0HA 5BN3A 1E2QA 2A2ZA 4GPTA 721PA 5JRZA 2WWHA 1T5IA 4LRWA 1T91A 2REBA 1AA9A 3KB2A 4JL6A 3B1VA 4O2LA 4JIMA 4P33A 4ACBA 1OIVA 4OJKA 3I92A 2J45A 4W5JA 5DHAA 1ZCBA 2W2TA 4Y0VA 3AM1A 1P6XA 2ZRGA 2XTNA 2QENA 1II9A 5LPNA 2QU8A 3TR5A 1CF4A 4LJ7A 4Q9HA 1E2IA 3FFBA 2ZUBA 3BB3A 2Z5FA 2QP4A 2IUSA 2VRWA 4LJYA 4MDFA 2FPMA 5TARA 5HZKA 1ZUNB 1U8YA 2CNWA 4TTQA 5L3QB 2ZRJA 1CIPA 3KQUA 4LK2A 1DG1G 4GNKA 5EP1A 1IN8A 3O8BA 1AS3A 2W0MA 1CJVC 5J4YA 2YJTD 1XXHE 1GWNA 4KU4A 2VQSA 3WRXC 3HP1A 1QHYA 3DVLA 1NVUQ 2YWFA 2I1VB 5BYKA 2RGDA 3H2YA 3L0SA 2WTUA 1SVIA 1KI4A 1R0YA 1E99A 2QROA 3PR1A 3Q8XB 2NPFA 4AKHA 5GJWC 1OF1A 2AN9A 5DYGA 1VMAA 3RS4A 2HXSA 2JLUA 3MSXA 1IXZA 1Z2AA 2WJYA 4Q02A 2J0UA 2FFHA 1OH6A 2OCBA 5CM9C 3T5GA 4PC3A 4MRRA 2WWFA 4PSAA 1GAJA 4US2R 2ZREA 2RGNA 4HAZA 3BK7A 1G7CA 2LKDA 2QSYA 4CT5A 1Z0KA 1XRJA 2ZRAA 1HA3A 2V8OA 4MH0R 1W36C 4JKYA 2BM1A 1W0KA 1PLKA 2ZPTX 2BBTA 3CUEF 2OILA 4V03A 5AK0A 1UFQA 5JMTA 4U7DA 4DVGA 2ZS8A 2AFIE 2Q9AA 3ADCA 1NMZA 1EK0A 3MCAA 2F1HA 4MGYR 1Z6AA 5FL3A 2VHTA 4Q9IA 1D2NA 1OE0A 4A92A 2IS4A 1X1SA 3JZMA 5F98A 5EZ5A 4BUJA 1XTSA 1D2EA 4BFVA 1ZD8A 3DMDA 1RJ9B 1VYVA 3Q5DA 1W5SA 1NNEA 3HPQA 2I4IA 4GP7A 4A0GA 3CBQA 2QQ0A 1CJTC 1KI8A 2JDIA 2VP6A 3PITA 3GLFE 2HYIC 1Z47A 2YOFA 4I81A 4DDUA 2C78A 2HJGA 1YR9A 2ZVQX 1W36D 2IK8A 1FQKA 1VDZA 2WIBA 1IHUA 4M22A 1DAKA 4DWJA 1XNJA 1ZNZA 3W90A 1N0VC 5AUQA 2AKYA 2ZSBA 5D3MB 2ZXUA 2H8KA 1R6BX 2GK6A 1M7BA 3AVQA 4DB4A 2BIFA 4OHVA 4HDCA 3B1ZA 5FOSA 4BFZA 3BIFA 4ABYA 4HLUC 4GOXA 4ASUA 2ZJYA 4NCNA 1KZGB 1TL7C 1JXMA 4YMWA 2WKPA 2ZETA 3FMPB 5G53C 5JWRA 4D4KA 1SVKA 1MRSA 1CR1A 4ILEA 2PZFA 3VR1A 1U98A 1V43A 4C0AC 1DS6A 1F2TA 2ANCA 4LBVA 3X1DA 5DI3B 1Z28A 1XPUA 3X2SA 3Q72A 1KSFX 2FH5B 1M8PA 3U61B 3ZD7A 4ZDKA 3AGPA 1YQTA 2XAUA 5FPTA 4GI7A 3VFDA 2GILA 1DAFA 1X6VA 4JKIA 4E5UA 4B3FX 3CH4B 4YQFA 1E2JA 2ZJZA 3WNBA 3RNLA 3GCGA 4TLAA 1ZIOA 3IIJA 4LV8B 3N2IA 3HR8A 4HSEA 1G5PA 1SXJB 1NBME 1DARA 2B6HA 4C7OA 2ZRFA 2GWHA 2R9VA 2ZR0A 3A4NA 4IDPA 3CB4A 3LW8A 3C15C 4JLPA 3LDAA 1RYHA 2VHUA 2XEXA 3JZAA 2GJ9A 4WVFA 5J4VA 3KJGA 1XZQA 4LHYA 4QNRA 3UANA 4ARZB 2O0HA 3F0TA 4KSCA 2WJGA 1NSTA 2OBNA 3B1XA 3K0AB 3PUVA 1JR6A 1NMXA 2PEZA 3A8TA 3SFVA 3CWZA 2E87A 3KQKA
chains in the Genus database with same CATH superfamily
3C7TA 3L1KA 1UZMA 4Q7JB 3BK2A 1GTRA 4R01A 4DA6A 3U26A 3EHDA 2R8OA 1W2HA 1QFSA 3HB7A 3SNHA 3IAS6 1QQ7A 2P7HA 1KEZA 1WHSA 2P9JA 2CWDA 2Q5QA 4M8IA 4PZZA 1ZJWA 2QBYA 4MQ5A 2HCTA 5TQVA 1QP4A 1XZBA 2R25B 3KT6A 1GQFA 5C8ZA 2BGJA 1KWGA 1T6NA 1I32A 2NV6A 1YIAA 1X7HA 4S1TA 4NYIR 4TXHA 3IMGA 4FCTA 3CE9A 5E6SB 2G9ZA 5CFNA 1E2FA 2ATVA 5BNTA 4JKOA 4TT3A 2GNOA 2R2GA 3RGWS 4HAWA 4GMGA 1LBEA 2G17A 1NA5A 1NYTA 2Z1DA 3THYB 2HBRA 5HBGA 5EL0A 4EGQA 5LUAA 4D56A 5A1JA 4M1ZA 2I78A 2D1FA 3PL5A 1PR3A 4KDEA 3SNKA 3U44A 2XGOA 2NQ8A 3BSYA 3GFVA 3KLPX 4UEWA 3JASB 2R7AA 3P9ZA 1Z29A 2VYVA 3STXA 4BQQA 1CCWA 4F38A 4G5SA 4N3NA 5C9ZA 3QVUA 2QQ5A 5JVDA 4P3KA 5AI0A 4OI4A 2JPDA 5JQGB 4B4VA 1XMVA 3B6KA 3RD5A 2R7LA 1NQAO 2GTHA 3ECAA 3TLXA 4YY3B 1HT2E 3M6MD 2ZBFA 3CR8A 4MGZR 1JKMA 1P5ZB 4XRGA 1GFIA 4QUGA 3O8DA 4MKIA 4LZAA 2HO5A 4HMPA 1JIJA 5CVJA 1WO8A 5AOVA 1V35A 2GN1A 1AUQA 4J3JA 4XR9A 1BFDA 4F5WA 1JE1A 3Q3IA 2ZUCA 4PLHA 1KI3A 1IYZA 4DUGD 2XCUA 4J0JA 4KIUA 2WVGA 1GZ6A 3WJAA 2C03A 3MMPA 2IZ6A 1H94A 3O4HA 4B85A 2PUGA 2FEMA 4G1VA 4JCOA 1ZD4A 4DBLE 5LKAA 4PRYA 4RVUA 2XADA 1YA4A 5BWBA 1QRDA 1R5NA 2FE4A 1CQJB 4RNDB 2YZ2A 3UK7A 3GVIA 4BVFA 2LDXA 4PG5A 4I3HA 3LRPA 4BE7B 1GUFA 4BMXA 4ZPXA 2V9ZA 3E4DA 2F90A 3MWYW 4S0XA 2PKWA 4LYDA 5AKEA 5HFAA 3LA6A 3QHAA 1XZ8A 3I9V6 4ZRMA 1XMSA 3CNNA 3OQIB 3VVMA 1O95A 1DCTA 1LPAB 3V6MA 3OLVA 1B6SA 1EJBA 1UXOA 3AIKA 2GB4A 4UBIA 1IG0A 2R8ZA 2UVQA 5FLKA 4CMEC 1NBMD 2Z8XA 4G56A 4QYIA 4EHNA 1VSQA 4BIMA 1XCOA 3RJ9A 3JQGB 4CMIB 4J9VA 5DCWA 3W5JA 3ZHZA 2EL7A 1KK2A 3Q11A 3PJFA 1GO2A 4H3KB 4XJXA 1GDHA 1IBKB 1QU2A 1AB6A 1WNTA 2Q5JA 2UVPB 3ICPA 4RD2A 2YWBA 3NBKA 2G40A 4TRMA 3OX3A 4KFRA 5IH3A 2Q41A 4CHTA 5KQRA 3PXBA 1DAGA 1B8NA 3A58B 5KNLA 5KWJA 4KCGA 5JZMA 3E6AA 3H6KA 1XP5A 4BNWA 4QT0A 2DFLA 4XWYA 1E8NA 4WAUA 1OWNA 1YTUA 4RVNA 3UA4A 1Y6ZA 3TE7A 3DL7A 3TZQA 2BSXA 1EFVB 1M8KA 3BTSA 2NPOA 3HFGA 5CURA 1WB5A 4B2PA 1KAGA 1VJCA 4C04A 1MP0A 3MJFA 2P9FA 4WVLA 3TQOA 3W8RA 3CGWA 1P6UA 1TZKA 3FYUB 5MN5A 3IR5A 1YI1A 4MRPA 4MGHA 3H5TA 4PYRA 2YNMD 4EW1A 3EDQA 3D4PA 8GPBA 2WFZA 2HJRA 3QA3E 1O97D 3PRJA 4LXIA 3GRFA 3L84A 1RHJA 1UZUA 4JI7B 3HJTA 3OA0A 1RXIA 1EFLA 1XTJA 2QG4A 4YMUA 4Q4JA 4BV3A 1KOJA 4AMUA 1FFEA 1FTNA 1SCAA 1ZHFA 3JVDA 4M8LA 4JYPA 3SR0A 4LQ4A 1RLJA 4BAZA 2CCJA 5L3SB 1FNDA 3S1AB 3J81A 1ONPA 4X6XA 2NO4A 4J7AA 1WQ3A 2DP4E 1Z8NA 4TQ9A 4WNYA 1XCPA 1FF9A 2CL5A 1A71A 1UKZA 4Y7CA 1MO3A 5EPOA 1ZMXA 1MD9A 5H59A 3KJZA 2EKZA 2VAWA 3PUHA 4UM7A 4BJHB 4C30A 4QVIA 3ZDXB 3DOUA 3ABSB 3B6ZA 3EEOA 4R51A 4JNCA 4IO1A 2ZU0C 4S1PA 1VECA 2H0AA 1KKLA 4DDMA 4QRIA 1F1BA 1L4LA 2EAUA 2XDQB 5TGZA 3ZGLA 4TYWA 3K9CA 4H1WA 2LCFA 3IUNA 5B57C 2CN1A 1Q3KA 1R0KA 4UXIA 5J4HA 4AKEA 1NRWA 1W2GA 4EHFA 2PKRA 3AXTA 4EI2A 3H4VA 5CYFA 2QRHA 4BGEA 5IXJA 2NTYC 4ZO9A 3FUXA 2NU7A 3CNHA 3H0EA 3OZAA 1E0JA 2FW0A 3B3QA 5K3OA 1TUBA 3KYCB 1DC5A 4BN5A 5JY1A 1LPBB 2I91A 1XU4A 2ZJ1A 3TZ6A 2H1SA 5CDTA 4RD3A 5IJAA 3K0FA 1XCBA 4ACBA 4DG9A 5DEIA 5JCOA 1ZUWA 1UJ2A 3OE7D 1EXMA 4MVJF 3SKYA 4M9QA 4PPGA 3BQMB 3PFIA 4R3WA 2X3FA 4BQFA 1E0KA 2BPOA 4KGVA 3P2YA 3W1EA 4F3TA 3A6KA 4EFMA 1U0EA 3FM9A 4GH5A 3WZ2A 1XD8A 1ZC4A 2XUFA 1UKBA 2YW9A 4E32A 2UXDB 3GPLA 1QCZA 4H4DA 1X80B 3RS7A 4PU0A 4B31A 2GFIA 2R8BA 4LJSA 3A05A 4AXBA 4XCQA 1FW6A 3NAGA 2PQ6A 3FOFC 1NVMB 1YBAA 4XQEA 2M32A 5TMBA 1E9AA 1YUNA 1H4SA 2GDZA 1PDOA 2NP7A 4Y1RB 1U9YA 2ZIEA 4NBVA 1H1LA 1YHNA 4EP1A 3IQGX 4RXUA 2H85A 3LHDA 3L8DA 3NYWA 3NWOA 3KKLA 1E1LA 1E98A 3M4YA 1QB8A 3OAAD 4INPA 4MO2A 1XRSB 3O31A 4KDRA 3WKBA 4CLRB 1RZRD 3DKIA 4KDCA 2G4VA 3FCOA 3UMJA 1CYDA 3JATA 3EDYA 3MM4A 2EKQA 1XZNA 1YVEI 1JV2B 2CXOA 2PY6A 1TOAA 2XXBA 3OEEA 5E3JA 5G1PA 2A1TR 4C43A 2XTJA 1XX6A 2YQZA 4DNPA 2QZSA 1QO0D 3ZCPA 5AFSA 1E69A 2VZLA 3N2GB 2HNKA 4G41A 1HYHA 1C7JA 3AK4A 3QJGA 3HYSA 2VCHA 1U31A 4EB8A 4X1YB 3PPYA 5BV2P 4IHQA 1PJSA 1IEVA 4J43A 4CNQA 2XYVA 2OO7A 2G09A 3IDZA 2YVKA 1RAHA 1UQTA 2BMWA 4ZXPA 1DX9A 3TIGA 4NOMA 1JU9A 1QLHA 3SHVA 4ME6A 4C2UA 4M9SA 2R8RA 3I2HA 4BKOA 3ER8A 2FQWA 3U4QA 2NZ2A 3IIMA 1W36B 1NVVR 4IZ6A 4ESOA 1PBTA 3T12A 2OV8A 4EQ6B 5I7WA 3ZHTA 5DHQA 2CGEA 3EXIA 4ERXA 3KSAC 1KI1A 3NHYA 4HRAA 4NOKA 3TW4A 4BNIA 5I3CA 2J1LA 4NENB 4WX2B 5AM2A 2H52A 2OXTA 2QE7A 3SVTA 2AX4A 1DL5A 3QKUA 1T3SA 1I0LA 4JJ8A 4NLLA 1XEAA 2I03A 4IOJA 1G7RA 1Z15A 3T7SA 4D45A 2SCUB 3LZ6A 3NEJA 1PNQA 4G4IA 3MWEA 5CTJA 1SHZA 3K20A 4HWKA 1P4GA 3T5PA 5K0SA 3OC6A 2BR4A 4XE5A 5HXAA 5ICCA 2QPAA 1PT9A 3JZIA 3C3YA 4ND5A 2HFJA 3PC6A 5BSTA 1VBNA 4WLOA 5DNVA 4XVRA 5DM1A 5SICE 1Q1GA 3CCCA 1TZ2A 4JGBA 3BFJA 4Y6LA 4JC8A 2R4QA 4DA0A 2OZLB 4PS1A 3OBIA 2WAOA 3CNQS 1K6JA 1PFWA 1NR5A 1RT9A 4JBNA 1IBSA 2PT6A 1YCFA 4WJLA 1NP3A 2Y99A 1ZC3A 2O8VA 1NI4B 2D54A 5F2OA 5LQNA 4KQWA 1NDQA 3ZDEA 4B3TB 3FHTA 1P9RA 3GFTA 3MCUA 1YR6A 1TD9A 1DT5A 4MI1A 3LCRA 1YRHA 1D04A 1YR1A 2CD9A 5DGIA 3D4NA 2KHZA 3RTEA 5JTTA 3ESDA 4XVHA 1WPXA 3HDYA 3ONFA 1EB8A 4JK3A 1QDEA 3PU6A 5E7MA 4BRWA 2PFKA 2GVNA 3DMPA 3V5NA 2O0MA 5C4MA 4LOJA 8ATCA 1BFUA 1LS1A 4P3XA 4WKGA 5LMCA 4M8SA 2GT1A 1JR3E 2X1MA 3DT8A 4JJ6A 4JR2A 5CP8A 5CPBA 6Q21A 3EZNA 4FW9A 1ENYA 2QTZA 2P9YA 3PHLA 4OG2A 4P6VF 3II6X 3CVYA 2VJMA 3STVA 4J16C 3N9IA 4F6RA 2EFCB 1G64A 4MUIA 3FUVA 4CEJA 2AE1A 3KOYA 4YPFA 4E30A 4CKBB 2WPDD 3WHKA 3X1WA 1N3BA 2PL5A 5C80A 1ZWLA 1R15A 1L5SA 5F52A 4GMXA 4KXQA 4BJ5A 4BPBA 4GG1A 4Y9DA 1XVAA 1NFQA 2EIHA 3DE6X 3UEOA 4ACAA 3EWSA 4HB0A 3NOVA 1A8UA 3BD7A 1PAUA 1BDMA 1BWRA 2WV7A 4PSDA 2Q1XA 2G0AA 3OCCA 4CMHA 3SC4A 2DY1A 5B4TA 1WMBA 1P17A 1ZCAA 1E2BA 1Q83A 3GYBA 4U7JA 1I4DD 1FIUA 1CQXA 2DXIA 1ZVJA 3VX4A 2XB9A 2HK8A 4AUNA 4EFLA 2KW5A 4EG1A 1Z5WA 3ER9A 3G0GA 4H16A 5EJ8A 1H9AA 3CRNA 3T3EA 4Q3EA 4ZOAA 1KDVA 3ZK9A 4ALLA 2ZJ2A 3GGSA 4MW7A 1Z18A 2IOQA 4G5GA 4KH0A 2DYKA 5U4QA 1M83A 3T94A 4L9RA 4ZMBA 5K0ZA 1IDN1 2IDJA 2XDWA 3LT2A 4NKRA 2I8AA 4EMUA 3HWX1 2BFPA 3GLFB 4TXLA 1R0XA 4I1OA 1KQFA 1Y81A 1Y6FA 3CF2A 2UXCB 3G8YA 4G3XA 1IIBA 1YQDA 3UV6A 1VYTA 1J06A 4BVJA 1N92A 1E66A 1R50A 3NDBB 1SC6A 2VXOA 1Z7BA 4MPDA 5E8JA 1EX6A 4MPJA 5HKKD 4FWTA 1BYUA 3QY9A 1K9VF 1EMDA 1UC5B 4UAVA 1DFIA 3TVTA 5JMOA 3SIPA 3HBFA 3WGLA 3E1KA 5GVRA 4C0BA 2I2XB 2Y1XA 3EBPA 3FPAA 2H1FA 1AN9A 2NT3A 2HPHA 3NC0C 1NUAA 3TRIA 1QANA 2X42A 3GN1A 4MGIR 1KFKB 2F3UA 4IWXA 4N3AA 3BMOA 1LDMA 4WPGA 1MH9A 3U7EB 3AVOA 1O1YA 5DASA 1TCUA 2OO3A 1Z5ZA 3M3PA 3SJAA 2JD1A 2JIPA 1EM6A 1KDTA 4BLQA 4D1YA 4G25A 1GV1A 2KI5A 3C41J 4RMNA 3BXGA 4Y9UA 1USGA 3RIMA 1FJHA 2IPMA 1YRBA 1OIWA 3F6PA 3JZFA 2ACKA 3ROPA 5L3QA 5CVUA 3IJRA 4L8WB 5DTJA 5AVKA 4XVUA 3WIEA 2GI4A 4IJUA 2OORA 2IV7A 5CB4A 1RADA 5IAGA 2PS3A 2WSBA 2OHGA 5D6NA 4EX7A 2P6NA 3R9IA 1W25A 1TYBE 2H9IA 1NPTO 2A57A 3COVA 3QOFA 2EJBA 3H99A 3QVXA 5DHRA 4ZT2A 3A6HA 3WDSA 1UANA 1PX0A 2G1UA 2J09A 2GXQA 1DIOB 2P77A 2FWIA 3BH6A 3EDOA 1R12A 1UK7A 3TEJA 4BGVA 1IJEA 4P54A 4Q9NA 1NZFA 4IHJB 4HN4B 4MVJG 2AXNA 3GH1A 3L4KA 5KBYA 4BNVA 4H35A 4UE2A 5J4KA 2PSHA 3ZH2A 4X91A 1YBFA 3RC9A 1R5OA 1G1AA 2X40A 1XYGA 3IPYA 4HJRA 5E2IA 5G4LA 2D4AA 3CRRA 1LRKA 5LU9A 4RTJA 4TSFD 1DWQA 4A0RA 1MOQA 3O8OA 4DQUA 4D6XA 4O3MA 5THKA 3LECA 6PFKA 2JEZA 5KQPA 3KLNA 4LZLA 2WF9A 4QICA 3HP4A 1RWQA 1YDGA 5LA6F 5TT0A 4Q7QA 5FDFA 5ES4B 3UMRA 3TEMA 5TVGA 1FLAA 3QX9A 4XTRA 4YUYA 4K8RB 1H1DA 1I2CA 1D9XA 1BXKA 1IOWA 2PT7A 4H6WA 1D7AA 3OE4A 4O5AA 3EZ2A 5M29A 1OGYA 2AR7A 5C35A 2MSWA 5CXXA 1C1HA 4NH0A 3TX6A 3O0TA 2A1TS 5F77A 5K0TA 1HWYA 2C4WA 2ZXEA 3CN9A 4F3YA 3A6DA 2RGEA 1AKYA 1RJ9A 1UBMS 1LW7A 1GUZA 2HY7A 2QD4A 4FJ2A 4X85A 3CY6A 2GVZC 4KYIB 3V6LA 4WLVA 1RFGE 3OLYA 1NXXA 2AK2A 5IDQA 4L5IA 2YN4A 3ZIUA 4EHIA 3Q3JB 5BV0A 3THRA 4M9XA 3DFFA 2IS1A 2GJSA 1NQXA 4DQLA 2XCTB 3V4LA 3WRWA 1R6DA 1RVV1 1PP4A 2WG2A 3HL4A 3HYRA 3I04A 3PUXA 4AAYA 2RMKA 5FD8A 5JNWA 3GVCA 3JWJA 3IKJA 2BEWA 3MT8A 1LRJA 1O94D 2PZJA 4UFOA 3FMVA 4ZAFA 4Z9YA 4C0JA 1Y8AA 2AN1A 3VOBA 3RJMA 1P5RA 1RAEA 4KTTE 3G85A 3V55A 1QIIA 2HCJB 2D74A 4U0KA 3T1VA 4YRSA 4R54A 2IHNA 3AWIA 2R4TA 3QWBA 4URVR 2B21A 1X42A 3G0IA 3EVEA 3I9JA 4FYIA 1N9GB 1R6XA 2HJHA 2PPVA 5L3RA 3WWZA 1H8HD 1SVUA 5ESDA 1P2SA 4NBRA 3I73A 4R5MA 1PU2A 5JPCA 1KP3A 4FQ5A 4MOWA 2FUG1 1RQ2A 1Z17A 2H92A 3ZU5A 1UWVA 2NZVG 2ZJ6A 2A58A 1WR8A 2VNAA 3R0IA 1CQIB 3N0VA 1C7EA 4IHAA 3BBLA 2JLQA 1N5IA 4L75A 1WZUA 1WDTA 2PT5A 4N54A 4RK1A 4N6GA 1SUPA 2V7WA 3KKQA 2XWSA 4OHZA 5JSKA 3LTNC 1TIBA 3IQXA 4LN1A 3L79A 4PR0A 1NXVA 5FA5A 1YB5A 1OYYA 2C4VA 5K3CA 3NHRA 1B42A 3DE5X 3L0YA 1SRRA 2DQYA 3DVQX 3ZHCA 2WIFA 4KQIA 2GZDA 4QFCA 4E2FA 5JSZA 4DV2B 1HLGA 1ULBA 3EGIA 4AXXA 4LJRA 5CB8A 2QJOA 4WV3A 3SXPA 3LW7A 3PKIA 5EJ9A 1EXDA 3OUZA 4DCNA 2EFYA 2FW8A 4UOQA 3SE7A 3FVQA 3MBOA 3VSDA 3C97A 3DVAB 1NQVA 5CIYA 4W82A 4A0QA 1EK5A 2J6IA 1Z5OA 2O4CA 3BCRA 3KQOA 4QBIA 2RAUA 2X5KO 1X92A 5K4AA 2GCNA 4JL8A 3ZVNA 3LBAA 2DPGA 4X8OA 2QX9A 2V7QA 3DLHA 2C3YA 3N2EA 1DJOA 1RMYA 2A5GA 3ZV7A 4RACA 3ONNA 1HZJA 4ES6A 1ZRMA 1C8LA 2WU8A 2H5LA 5IG2A 1J21A 2R48A 2FMXA 3A6PC 3V7WA 1XLVA 1F2VA 3WL4A 3RFFA 3GFOA 2J7PA 3BXEA 3F3YA 5DYIA 5LP6C 3QWFA 2BTQB 1L0BA 2YINC 4MXDA 3HK2A 5FPQA 1ZH0A 2VFAA 5E6SA 2YV2A 3EQ9A 4B6EA 4RSMA 4XUDA 5IDYA 3LVBA 3CF4G 2P8SA 2H1OA 1ORHA 2FNAA 5DXFA 2QIPA 1DB3A 1Q77A 2B4QA 2J67A 3NT2A 5EGSA 1DJQA 3SHOA 3THYA 2YIMA 5FH9A 1CP3A 3G7UA 4F11A 4NABA 3G49A 3HU2A 4WECA 4H2DA 5AW7A 1AZTA 1NJ1A 1UFVA 1EGHA 1G8KA 2R2AA 2R68A 3DE4X 3EG5A 3FYDA 2PR2A 3JASA 3KPVA 2VQDA 1KI6B 2QK4A 3QPUA 2W6IA 621PA 2AZXA 3FA2A 3NJRA 2QAJA 2ODTX 1YSCA 3VAYA 4CV3A 2OO5A 3TSCA 4IGIA 5B6IA 5JQGA 1P3DA 1SD5A 4H1UA 2IGTA 3Q2OA 5F2NA 1YQQA 3L0BA 3QTTA 2PGIA 1IY1A 1M1NB 4L5CA 4BGIA 3BMQA 4JC0A 1ZR4A 3M4ZA 1Z2NX 2BZ0A 4LSWA 1YA8A 2GF9A 2OKGA 3L7AA 5DI9A 4MR8B 5HS4A 1HGXA 3AM5A 3PI7A 4Q5IA 1R88A 4RQTA 3ZJUA 5HE9A 4WGGA 1DIBA 1EG7A 1PFGA 2JVKA 4ISCA 5ALJA 3RVPA 3WWOA 5BNZA 4ARCA 4LF9B 3DBLB 2V7TA 4I9GA 1A77A 5CEFA 1GQOA 4F4IA 4F85A 1VHJA 2Y1CA 3MRVA 3OCZA 4G4JA 4NNOA 1U2RA 1OX4B 5CYOA 2FV8A 1EVKA 2GSDA 3ZDFA 5BUZA 3CKKA 4HZUB 4PZ0A 4F4FA 4PS0A 5IJ0B 5K05A 2AMYA 3U7GA 2C5LA 5IT9A 2ODEA 1P9OA 1T2NA 2CFTA 3KQPA 3WMRA 5FOXA 3RUPA 2R1VB 2FPLA 2RCNA 2CXUA 5J5CA 5TEVA 1G8AA 2DETA 3T0FA 4KSYA 5KB3A 1IVYA 1CQJA 2J3QA 4RE5A 5FCDA 5H3HA 1Q0LA 3LLCA 2P6MA 1PD0A 2CYCA 3PQ7A 3N8KA 4KW7A 2O2EA 4YIKA 3P2EA 3P52A 5D84A 2DFKB 5HE8A 1XOIA 3LGSA 1M7HA 3U7FB 4R3UC 4OPMA 2Q6IA 5BR7A 2OB1A 1Z75A 3OQIA 2YRFA 3P0FA 1PZHA 3W5HA 4CR8A 3K09C 4YP1A 1T6BY 8AT1A 3LKZA 1EFTA 2IEZA 5DDIP 3U4GA 4DKJA 2GLUA 3HI4A 1GPLA 1Z6ZA 1U04A 3ECSA 3DDUA 3WJ7A 3KTFA 3JQGA 1CJCA 2NTNA 4CMIA 1GPMA 2O7NA 4EYGA 3DV0B 1WZIA 4CL0A 2PWZA 3LBIA 3HFJA 1T5OA 5JAOA 3BD9A 2UVPA 1VXRA 3DYIA 3KKEA 5ALHA 4C2AA 5C1DA 3I2IA 3ICWA 1N2BA 4MV8A 4JI4B 4HAOA 4GKBA 5IC4A 5JAHA 3I61A 5EP2A 3JQ7B 1N33B 1C1XB 5KO2A 1CJUC 2CNOA 3KWMA 4RLFA 3ZI7A 2ILTA 1ML3A 2GRAA 1J2YA 3NAZA 2WU1A 4HUJA 2VT7A 3NORA 2WWIA 1XZAA 1OHHD 4IYJA 1EFVA 1N2GA 3KU4A 5JR3A 5LWQA 2XH8A 1N32B 3WYNA 4DBVO 2BUAA 2ZE5A 3OOJA 1KEKA 4QFMA 3E1GA 1PR4A 3FYCA 4ML3A 4RPCA 4YK7A 1E3IA 1V1RB 3GD7A 3KXDA 3M5CA 1KDRA 5G0SA 4AC9A 4RYDA 5LJLA 3FYUA 1U8EA 3L7DA 4XYLA 4KHPB 1OFVA 3EQZA 4MP3A 2I80A 3GCWA 4WACA 4CLDA 4E1VA 2JRLA 2I6TA 2PMWB 3P0IA 4OXIA 2FI1A 5CDGA 1U0GA 3HUUA 3L1HA 4FDVA 4RFVA 1XZDA 1FU7A 3DE2X 3TLEA 5D5PA 4QJ3A 2CFRA 4LXTA 2BJWA 1RC8A 1FDIA 3RJTA 1Q7CA 4QUDA 3ESAA 5EE3A 2YRWA 4N0PA 4YRNA 4DC1A 5L3SA 3S1AA 5B3LA 1NM5A 4I5IA 3TD9A 2P1ZA 1LV7A 2H2WA 1R1DA 1AHHA 2J46A 5HGXA 4HGOA 1JJAA 2H7CA 4D4LA 1X1DA 4LRTB 3IOYA 4OFWA 4QXPA 5ER6A 4CG2A 1CJMA 3ULKA 1TU0A 2BT4A 5IKPA 3KX2A 1EDDA 1F20A 2QG6A 2NSDA 2VHCA 4YQYA 3UF0A 4WKOA 2RB4A 5JNRA 3SC6A 2GBCA 4B4WA 1X14A 1CVLA 1SJ9A 1TVMA 1U5BB 4PZDA 3RVQA 1D4AA 5GGYA 3WY9A 2XDQA 4IP0A 3LUCA 4RPIA 4XPZA 1PFKA 3WMWA 2IF2A 4RHFA 4F0JA 2H2FA 4L6IA 1K0UA 2J3KA 3EYWA 2JAQA 3QPBA 3UM9A 1MORA 1ST2A 2R87A 4FFBB 3VV3A 2Z6VA 3MTIA 4D8VA 4ZODA 3MNFA 3MQFA 3URKA 3K05A 4KB5A 3T95A 3D6VA 1YQXA 3T9AA 3GJTA 3KYCA 1PUXA 3ZDZB 5IXSA 2F9LA 4PYMA 4QJ4A 1GLGA 4U02A 1C1YA 1QG2A 4EHJA 2BLLA 4JOCA 3W05A 3P9YA 4KQ6A 4WCFA 4PGAA 2CJPA 1G2PA 1JIIA 2V3WA 4LIPD 1KBZA 4UCQA 4J0FA 3A6JA 3OQMA 1II8B 2QL9A 2QF7A 3HV2A 3IH5A 2P9GA 1VL2A 3OG9A 3U6KA 4TWAA 2LCIA 3TXXA 3BSFA 3P5SA 3O3MB 4E03A 1DO2A 2GFQA 3CUTA 4WKCA 4D5GA 1WLYA 1X80A 4OU4A 1NN1A 1NN5A 2OKCA 2X58A 4N5IX 4QU8A 4A1FA 2IHVA 4JOBA 3TD6A 5JCJD 2R47A 1KO7A 4CF4A 2PR7A 3NI2A 2XMQA 3K1TA 4X97A 3X1ZA 5DNCA 1JWAB 1GGMA 2QRUA 3CWQA 3JY6A 4Y1RA 3AWDA 4LBZA 3BFXA 1YZNA 1KYWA 1AIPA 1TZJA 4PFKA 4YUVA 1VYHA 4QDJA 2F3PA 1Y7HA 2K7ZA 1CZUA 2AF3C 3IXQA 3W3ZB 4CLRA 3ECCA 1MDBA 1ZPDA 1PJ4A 3DOEA 3OHPA 1B0AA 1A27A 1BH2A 3QE0A 1FDRA 2J6HA 4FR2A 5JJLA 2JI7A 3WQSB 2IHTA 2DWPA 3O73A 1MENA 1E63A 1GR1A 3PQ2A 3N2GA 1XAIA 1YDFA 4TXJA 1Y4SA 3L0OA 4Z1MD 3UUWA 1KVQA 3PPVA 4K87A 4KIJA 2FQYA 4X1YA 3W6UA 4A73A 4BQEA 2QVCA 4CKYA 4BMNA 5G2OA 1OU0A 2YIVX 3Q3HA 4DGSA 2BH2A 3WGVA 4EY3A 3C6MA 4E08A 2HMAA 3FF1A 4O1HA 2XZLA 3WMGA 2ZBRA 4RSGA 1NOJA 4PO1A 4FPXA 2BMFA 4MW9A 5EXPA 3DPUA 4EQ6A 1PW5A 3EWAA 1U11A 2JCBA 3K0HA 3RDPA 4BMYA 1PKXA 1P2BA 2I1WA 4G81A 2P9ZA 4NENA 1ZG3A 3LHFA 2QW8A 4RH1A 2W93A 1BO6A 3ZHVA 3FTCA 2D2EA 1ONBA 3CPJB 4E6PA 3MLEA 1BMFD 3VVCA 3SWWA 1IOVA 2SCUA 3NTOA 2PE5A 1BWQA 3O4VA 1U2DC 1L5FA 3KUCA 3NXKA 4J0CA 4MUAA 1DAIA 2WWVD 1QYDA 4QG7A 2GAIA 1MNQA 4PPFA 2R62A 3LY5A 4R8SA 3DBIA 3M3DA 4CMKA 5I4BA 3A28A 3PNKA 3F9CA 4D82A 3SQWA 5TXGA 1OA1A 3K8ZA 3RROA 2ADOA 3RKUA 4NU0A 2ZIAA 2OZLA 5CX4A 3HACA 5LYJF 5J9FA 5KNCA 3WICA 2W9XA 3H18A 4GU5A 2WJPA 1H66A 4HXFB 5DX1A 5JDCA 5KOJB 3TRKA 2IY9A 3KP1A 4KYVA 3U7JA 4D9GA 2QY6A 4ONEA 2NU8B 1DRJA 2RHBA 3H97A 4X3PA 1T3GA 2XWJI 4M86A 5FQNA 1NI4A 1RCUA 4J29A 1VPLA 3GNTA 3LSYA 3C4VA 3Q8WA 4Q4LA 5KWIA 3UJAA 1ZSYA 2XCLA 1WMEA 4HLUA 1G3RA 5DGXA 1H2YA 3WLMA 2A14A 4NYMQ 3B1KA 1TCAA 4H4EA 1EBUA 4QNMA 1FJ2A 1RJGA 5CNKA 4UVIA 4F3RA 5HUHA 2FUEA 2BW0A 2ZFUA 2WMYA 3FXAA 2BM0A 2ZRCA 2XUQA 1ZA1A 5EUQB 2AUMA 2BKAA 2WT8A 1M33A 3GEIA 3TR6A 5AVUA 1E64A 1BHO1 1NR7A 2FETA 1HE2A 3DM9B 3IE2A 1U94A 3T5DA 3W0LB 3G2NA 1E5DA 1R66A 5CG1A 2B30A 2VPWA 4HXEB 2VHQA 4BMOB 5TR9A 3QSYA 2ACWA 3OPXA 1FX0B 4OREX 3A1VA 1J2UA 3U09A 2NUTB 3KQSA 3ED5A 1G291 1DTSA 2PGOA 1IATA 4DNQA 2PZLA 1NWCA 4HWTA 1AXGA 3QFCA 4FWBA 3G82C 5JNUA 4CKBA 2ZULA 2O52A 1NMSA 3IE0A 3QNUA 4RM3A 3T1OA 1YFJA 4RLSA 2ORYA 2Q3HA 2X4IA 1PWHA 4I4CA 3C6XA 3VO8A 4B71A 3T1HB 1IWBB 2AQHA 4OHYA 3I9OA 1JAHA 4P8RA 1RAGA 4Z6KA 1XKTA 4DY4A 1IXYA 2C2ZA 1OA0A 3D7KA 4RZ2A 4GI2A 3ZHUA 2GCEA 3NOOA 3WBFA 2D2IA 5IT0A 1XZHA 5BWNA 3DF7A 4XQCA 2FX5A 3QVVA 4LCJA 4M9ZA 5BORA 3H5VA 1QG4A 2RGNC 1NRJB 4CU5A 3DZHA 3J7AC 3QLUA 3M6XA 1JDZA 1WP4A 4FMBB 2JKZA 1K7CA 2H16A 4DV1B 1I94B 1D5WA 1DRVA 1SKYB 2O3RA 1E60A 1QDLB 3JSXA 1KDPA 4D0GA 3VAAA 3K2EA 4YRFA 1QNFA 3R3UA 1JG1A 3KE8A 3TZLA 4BVEA 1MJFA 1SHKA 2B3DA 4CI9A 3NHKA 2IYPA 3EOZA 1FSGA 4JJAA 3RSOA 4D3XA 1H9CA 1NOIA 4UNNA 2SKEA 1P2VA 1T5BA 3C6KA 4ZVOA 3ZTWA 3GLFA 3PHCA 1HTWA 3ROFA 4KXLA 4MWBA 1V8PA 2HPAA 3BZBA 4O0MA 1T25A 2OMEA 2PWAA 1HG0A 4BLOA 2PSJA 3HSYA 3LKBA 3QZUA 4E70A 5IJXA 4M7PA 1ZP6A 2FMHA 3HKDB 3JW8A 4I08A 5I47A 3OQBA 2VDWB 4KQJA 4LF7B 1RIFA 1VJGA 3Q9UA 2A78A 1TYCA 1U2GC 3A14A 4N9WA 4WZAB 1RLMA 2G80A 2Z1NA 4FILA 1M73E 1NFFA 3TUJC 2BD0A 1W0KD 2ZSKA 4EI7A 1VKZA 3I76A 1S8NA 2ATXA 2QYOA 1GPNA 3V48A 2VEOA 3P0EA 4MQUA 1L1FA 4ARAA 5IVDA 1DDIA 2J0EA 4FOLA 3B9QA 4AZWA 3ROTA 3W8DA 3KLMX 1XHEA 1PUJA 3AW9A 1P3Y1 4HADA 1DAOA 1K75A 1FUYB 2E6UX 1F3LA 2COKA 2GPBA 3CRQA 3GLTA 1NIJA 1SK8A 1XZKA 4YRBA 3C1TA 2XKJE 4HUTA 4EB0A 2AWOA 3KOXA 3TF5A 2EKBA 2HIGA 2W2LA 1XQ6A 1QO7A 1VBMA 3OQJA 3PGXA 4GX2A 4AMBA 2IYZA 4B6JA 1C8KA 3DHWC 2DAPA 1HFJA 2CKDA 4LGYA 5T57A 2V0GA 2ACEA 4B3HA 4YUZA 5LQJA 2JCSA 1FXWA 2OYSA 5K2MA 3REOA 4H77A 4FOSA 3G17A 4Y2PA 1EX1A 3QHQA 5G0VA 2AYXA 3GLGB 4N12A 1K6MA 1L4YA 4PYLA 2ZE8A 4OAOA 1WBDA 4C05A 1TT5B 3DFUA 1WVIA 2CMKA 3ZWKA 2W37A 5KKAA 4TV9F 4GLLA 4R2LA 1QP0A 1POXA 3FKQA 4JVLA 4O4HB 3ZNQA 1ZISA 2H1RA 3OJFA 4IHJA 2P0EA 3OLCX 3W8NA 2H1IA 4X6LA 4LC0A 2PUDA 4R7ZA 1X15A 4DLUA 1NVDA 2OGZA 3WOVA 2VJDA 1TEZA 2CUZA 1ZSNA 1DCMA 4HDMB 1F8YA 1ZVQA 1KMQA 3FBTA 1DLIA 1GADO 1AF4A 4ZOLB 3T3NA 4XCXA 2ZI7A 4M0PA 2WNIA 1ZUD1 5REQB 4DA8A 4BNDB 1KO5A 2FVYA 4G1MB 4C3UA 5KNCH 2YKPA 3BWDD 3SSOA 1EU1A 2EGHA 4N0DA 3WGZA 1ZJJA 1DAMA 3HKBB 1I3KA 2E4YA 3AI7A 3WNCA 1W9HA 5BMVF 4FNMA 4QDXA 1DV2A 1QYVA 3H3FA 5A5EA 1R27A 1Y3IA 2X19A 5I7FA 3U3DA 3X43A 5ALWA 3LUFA 2OHOA 3O8NA 4CM8B 3WAKA 1FYVA 3B9PA 5K0GA 2IEGA 1HI9A 1XTBA 2JAWA 1AUOA 2OHFA 1G1MA 1SH7A 3EZGA 3EPJA 1FUIA 1H22A 2H0RA 2X76A 3QEOA 2CFSA 2P79A 1GCIA 1Y7TA 2DUWA 1DKRA 4HPWA 4C78A 3GJRA 1BYIA 1XA3A 4RNCA 2BGRA 2GCPA 3UY4A 3WO1A 3J80A 3UH0A 1GPWB 1TM2A 4HRYA 5EGNA 3ZHOA 3O8RA 3NRBA 4LX0A 2FRDC 1QM5A 4IZIA 3UBMA 4YAKA 4L95C 4UKDA 4DLLA 4ZYLA 4LQLA 4G0OA 3MHPA 1WW3A 2CJWA 4M1OA 2B8WA 4P5PA 3L04A 4JJZA 3EVGA 1JLMA 2ISQA 2KB0A 4TZTA 5T8KA 3KQQA 3V8NA 3UTDA 1Z4JA 3GJQA 4PY2A 2GZ2A 4E5DA 3A2NA 3F98A 5EHNA 5T4HA 4JSTA 5AICA 3SPXA 1K27A 1C8BA 2Z3ZA 3G5TA 2X0JA 1NBIA 1MT0A 2O5RA 2ZT8A 3PRHA 5FA6A 4EJSB 4GPZA 5ECYA 2P4SA 3EZFA 3OA2A 5A4AA 4QM6A 2OBMA 1XG5A 4OHRA 2Y6UA 1DADA 5ILQA 4PHGA 2GWRA 3RU7A 5EERA 2H2GA 1CK4A 4E4TA 1N9GA 1QCCA 1PJTA 5DX0A 1HNNA 4MVJA 2OXIA 2ID7A 1E2HA 3BXFA 2OCXA 2IV2X 1WF3A 1N2CB 2XODA 1LSUA 3HJNA 1HMPA 3EQ6A 3GEPA 3VOTA 1RXVA 4L4UA 5FNZA 1HQDA 3KUXA 4XA8A 1X87A 3EZYA 3HCFA 4P4SB 3FIUA 2GUWA 1CQIA 1BWSA 1HE8B 1G4UR 5B3JC 5JIBA 3F47A 1FOEB 1QUFA 3NBXX 1L7AA 1QIDA 4J1TA 1LD3A 4AUKA 4AP6A 1CULC 1U2TA 4OMFG 4OKSA 4OV6B 5ALFA 3I62A 3G5UA 1P81A 5B3KA 4GPAA 2J87A 3U6BA 2V6JA 4NE9A 1IXRC 2QN6A 3NV7A 1KPHA 3Q40A 4KWHA 4II2A 4WL0A 2D1QA 3GDGA 4B3IA 4DE5A 4KIGA 5A4MS 2BE9A 2P8JA 4REOA 4B87A 1EIZA 1L4MA 2IHYA 4HX9A 1L6RA 2GO1A 2YJ3A 3BREA 5E1DA 4HT3B 1G18A 1JEDA 2UXBB 1U02A 3DVAA 2IDMA 4JI8B 1ZY2A 4MLDA 5F9FA 1UR5A 1O95C 1QFYA 2TMGA 3KAPA 1NLMA 1RXCA 1S7GA 2B25A 3DJFA 3E22B 4GXNA 1OXVA 3L93A 3LL7A 4QAQA 1RAIA 4F2GA 1YK1A 4Z0HO 1P7PA 2WAAA 2X7XA