2ZRCA

Msreca q196n form iv
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 89
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrcA01
1EG7A 1U0JA 2VSOA 3CF0A 3X1ZA 5K8IA 2ZREA 1LS6A 3CRRA 4CYMA 4MUAA 4O0MA 1L4UA 1KAOA 4TQ9A 2XNDA 4QGAA 1DAIA 1FQJA 1NG1A 1DAEA 4M21A 2QU8A 2REXB 4TMKA 2QGZA 3N5CA 5E95A 4Z8YA 3SR0A 3PENA 1N6OA 3NWJA 3PUZA 3NDBB 4HAXA 3QPVA 1XD2B 2HUPA 3A58B 1YZTA 4L8GA 3O47A 4R2HA 2VP6A 1COWD 1V43A 2OLKA 2FFAA 5EE1A 3I8SA 1TUIA 3CNNA 3QI2A 3B5JA 2ZJ2A 4FMDB 4QKQA 2B6HA 1ZU4A 4LBZA 4Q4HA 1XF9A 3KKMA 1YZGA 3VU9A 1F60A 3ETLA 2SHKA 4OI2A 3GD7A 3QXJA 3AVQA 3AVPA 4TQUS 1CJMA 2QSZA 1GL7A 1G64A 4PTLA 1KMQA 3KFXA 4LOAA 2JA1A 4JKYA 4RD1A 3WBJA 4D4LA 2J7PD 2V7QD 4UXHA 1KK2A 2ZYTX 3G5UA 1EESA 4TZ6A 1UBEA 1G5PA 4KFUA 4A2PA 2EU8A 2B8TA 1SXJD 1SVWA 1G291 4Z8XA 2ONKA 3BXZA 2WSSD 2GEUA 3CLVA 1E2HA 2J0UA 5FBQB 1N6KA 1GZSA 5GADl 3SNHA 2C99A 3WHKA 1SVMA 1TAGA 2Z0MA 3W34A 4HLQB 3EARA 1YU9A 5G40A 1M7BA 4LDJA 1N6PA 4M8NE 3R8CA 2DHRA 2ZI7A 3KB2A 4F7WA 2O8DA 1AQYA 3EASA 3BS4A 4QFMA 1KO5A 4NCHA 3WRXC 1Z2CA 4Q21A 3W5JA 3UPUA 2XB2A 1N6NA 5C4GB 4IVRA 1YZNA 4LC0A 2G77B 2A5JA 2FPLA 3KDSE 2RMKA 2WICA 1XJQA 2ZROA 4Q4HB 4NE2A 2WKQA 4RD3A 1I4DD 3VU9B 3AGQA 4PC7A 4NONA 4B43A 4XSGA 2A30A 2XOKD 1Y3AA 3VR5A 4PC3A 1MO6A 1HY3A 3DMNA 4A0RA 1T6NA 4Q9LA 4Q9KA 2IYXA 1YKSA 2WAYA 5FBVB 1XD9A 3B1ZA 4WXPA 3M6AA 1E9FA 1RRFA 4L15A 4MKGA 3RS2A 5FBRB 2D74A 3C41J 1E1QA 1M2OB 4KLNA 5FL7D 2QE7A 4GMDA 1EXMA 3NXSA 4KO8A 5KOYA 1CRPA 3MD0A 4Z1MA 1P7CA 3ADKA 2KI5A 2ZE8A 4JIMA 4XIGS 1SQ5A 3AVYA 3FOZA 1VIAA 2NO7A 5LDDC 2J0UB 1W36B 1LW7A 3VKHA 4CF7A 3KL4A 4M2LA 1SZPA 5BXQC 1Q12A 2HEIA 3ZS9A 4D0GA 3KKPA 2N42A 3TRFA 2Z5FA 2QEQA 2O8DB 1N6HA 3O8DA 2WZQA 3QXSA 5TDHA 3DZDA 1W48A 2O0HA 2ZE6A 4YMTA 4IKEA 4TLCA 4C2TA 1SVIA 3A1UA 3AKCA 3ASYA 2FF7A 2XTZA 2NG1A 3PIRA 5M04A 4PO8A 1T0HB 2RHMA 4A1FA 4JL5A 2VHTA 3TSWA 4QM7A 3IHLA 5GJVC 3W3ZB 4BLSA 2IF0A 5FR1A 3MJRA 2OCAA 2ZSFA 4LHZA 4ZO4A 1RPZA 4B2PA 1XTRA 4A8JC 4OQFA 1KDRA 2GBLA 4HDCA 2GNOA 3PQCA 4B2LA 2JLRA 3DZ8A 3T12A 2J0QA 2QBYA 3BGWA 4B2IA 3LY5A 4B3XA 4DCNA 1Q1ZA 1CBUA 3WNCA 3UKDA 1G3RA 1VG1A 3WMFA 5L3SA 2ZYVX 8OHMA 2VP4A 3QENA 3B6EA 5SZJA 4AYTA 2OXRA 2UKDA 3FMFA 4HAWA 1G4AE 4M9SA 3OFND 4OL0A 1HA3A 3UG6A 2IUSA 3CB4A 3GJ3A 1UPTA 1KO8A 3QXXA 3G82C 5CIQA 2VO1A 4EFLA 1YVDA 2ZI9A 3L2OB 1ZM7A 5JECA 3CWQA 2OAP1 1TEXA 4V0LA 2P6RA 1VYTA 2ZSEA 4JVLA 3TR5A 1XU4A 2J45A 1ANKA 4QRHA 2QE7D 4AURA 4WZ6A 2GK7A 4UNNA 1AN0A 4Q9JA 3RRYA 5JJIA 4Z1MD 3X2SA 3B7GA 3CRW1 4YMSA 1U2RA 2QENA 4P0TA 1EFCA 4RSGA 3VR3A 3CO5A 2D7CA 1XFAA 5FPKA 3U44A 2CEAA 5EXTA 4NYJQ 4PSAA 5SZIA 2ZJZA 1AGRA 1KI4A 3FFBA 2QBYB 2NQ2C 3A1SA 1QHIA 4YMUA 5EP2A 1FP7A 2QZ4A 1RYHA 3ZVMA 2GJ9A 5IRCD 3D8BA 1OFHA 3GLFE 5E3HA 4R9UC 3EZ6A 1W2HA 4XOIA 3VX3A 2ZRHA 4R98A 2J7KA 4PPFA 3Q9LA 5G41A 5L3SB 2KJQA 2GXAA 2WJGA 5HCIA 3TK1A 4NYMQ 1RRGA 3VQTA 3VNVA 4PHGA 2V4ZA 4PQRA 2O8CA 1IJEA 5HKKD 1XRJA 1N6RA 1Z6XA 2PT5A 4P4UA 1ZD9A 3WYGA 3PJRA 4KVGA 3CKLA 4G5SA 3Q7PA 1KY3A 3GQBA 1NIJA 3KJGA 2GAAA 3R8FA 1XPUA 3TNFA 2G0TA 421PA 3WY9A 3U3OA 4G1UC 2DFNA 3SQXA 4PC6A 3K9LA 1M7GA 3KJIA 1XD8A 2AK2A 1Q44A 4JZKA 3WBKA 2CLSA 2F43A 4O25A 1IN5A 2GRJA 2R6DA 4S35A 1XMVA 3PXGA 3U3JA 2FX3A 2FMXA 1M8PA 3BH0A 2DFTA 5HE8A 2XNSA 3VR2A 1UBFA 5KDDA 3U44B 4AY2A 2WJYA 2OCPA 5KNDA 2VP5A 4LGMA 5C2JB 2W0SA 5JSZB 1U99A 4LYFA 3FMIA 5JFGA 5H8WA 4D4JA 2Z43A 2GWHA 3QJYA 3AM1A 1ZMXA 4FMBB 4B6FA 3SHFA 2BMJA 1T91A 1XCPA 1XTJA 2L0XA 3PFIA 5EE0A 3AVVA 2LCFA 2EYUA 2IYLD 1EGAA 1WA5A 5AWFC 5BQ5A 1CF4A 1FX0A 3EWSA 3KKQA 1R5BA 2FGJA 1HYQA 3W9YA 1XEWY 1WXQA 2KWIA 4C0AC 2O8CB 2QPTA 3ND8A 3U3KA 5J40A 4HB4A 2ZVQX 4TLDA 4TLBA 1VCOA 3C7KA 3T5DA 2OBNA 1H8ED 3WP1B 5JS7A 4BEJA 3GMTA 2WMNB 1SHZA 4JT2A 3SI7A 4JLJA 2REBA 4KFSA 3PEVA 3O8RA 3AVXA 2IYUA 5KDOA 4R7ZA 2J46A 1S9HA 3B1YA 2F43B 3MCAA 4RFSA 1BMFA 1PZNA 1Q21A 2XZPA 2ZAMA 2BHRA 2V6IA 3CRMA 4ON9A 4A4DA 4V0OA 1NVVQ 5SZKB 4P3YA 4OHWA 4NDZA 3T1QA 2C2HA 4YQFA 2ZR7A 3RSOA 2CCJA 2GJKA 1UM8A 2YINC 4NYJR 5JHGB 1FFHA 5L8VA 4TTRA 3GLFA 1NVWQ 1YE8A 2XXAA 2PJRA 1YJ5A 4GBMA 1I2DA 3Q5DA 4AWXA 1U90A 4DIDA 3LDAA 1E32A 1NKSA 5AK0A 4OKSA 4DT1A 1VG8A 1OSNA 3TUZC 3K09C 1KZ7B 3CF2A 1JAHA 3C8UA 4Q7LA 5K8LA 4NYMR 2P6NA 4NZYA 2JIZA 1KY2A 1DAHA 1FX0B 2FGKA 2W6JA 1E2DA 3HR7A 1SXJC 4RFVA 4TMZA 4Y0VA 2F9MA 4OHXA 1D8TA 4Q47A 4H1VA 3V4RA 2EFCB 2QI9C 1GP2A 1KJYA 3L0IB 3RDPA 3AEZA 3W5IA 4OQNA 1VPLA 2QP4A 5FUWA 1UKVY 4MGZR 1EFTA 3U61B 3T34A 1P4SA 1IY0A 1G16A 4GMXA 4UNSA 3RRNA 3ZVRA 4US1R 3A4NA 4CW7A 3KFVA 1P2VA 4DSNA 4DEYA 3RABA 4WXRA 1L8QA 6Q21A 2KBEA 1F3OA 3RLFA 4RFSB 2IX3A 5ELXA 3OE7A 4XD7A 4G0NA 3AP1A 1NSFA 2CVHA 1SVLA 1U8ZA 2CHGA 2OCYC 3D31A 4L9WA 4DEXA 4DSOA 3GFPA 3LNCA 3O8CA 1FMLA 4GL2A 5A0FA 1G4UR 2EW1A 2W2TA 3EIHA 4Q7MB 3GLFB 2XXAB 1EFUA 2JLZA 2CE7A 3CR7A 4PR0A 2BM0A 5FH9A 2V54A 4M1TA 4UQOA 4AG5A 4XWOA 4LK2A 4DWJA 4DT1B 4BLOA 4CGZA 4AK9A 5HZHA 1W4BA 1Z63A 3BH6A 4AI6A 3MMPA 1P60A 1U8AA 4G5RA 4Q48A 4ERNA 4BLPA 3H84A 4MRRA 4ZDKA 1LY1A 1BMFD 2P3SA 4QBGB 3QPUA 4B74A 2GF0A 5D3MA 2YOFA 2Q9BA 1E0SA 2QPAA 3EXAA 1U0LA 2ZJOA 4HI0E 3D7MA 4PFSA 5KO2A 1E2KA 4A82A 1MABA 3C4JA 4M1SA 5FOWA 4MGYR 1MRNA 3ZZUA 2RKOA 1A1VA 2FEMA 1TTTA 4BFUA 4BFWA 4FW9A 2WKPA 1NVVR 1X8JA 2OAQ1 2NO6A 4LYAA 4EQ6A 2BKUA 4BFZA 5AJZA 2ZRCA 3CRQA 2JIZD 1ZC3A 2BOVA 1TMKA 2H92A 4JL8A 1HUQA 5K8UA 2IWRA 2H17A 4OYHA 1ZAKA 2A5DA 4MYCA 4ABYA 3ZD6A 3CPEA 1LV7A 2G6BA 4TTQA 4DZZA 1E3MA 4PSVA 2QQEA 4DSUA 4HLCA 5AJWA 4BUJA 3DOFA 1X8KA 3NH6A 3VR6A 1R0YA 5EE5B 2ZR9A 4V0NA 1S1CA 1G19A 4QGHA 4TT3D 4NMMA 1UDXA 4A8JB 1S4QA 1CR4A 4BPBA 1UF9A 4O2LA 4DLUA 1C9KA 3H1TA 4M9ZA 3I5YA 2Q3FA 4B75A 4XVRA 1JPJA 3OE7D 1E2LA 4DCTA 4L9SA 3RS3A 1XMIA 1E2PA 2R44A 5J5CA 4DLSA 3I61A 4QHSA 5GJBA 5FTKA 4OI0A 2YNMA 4NCIA 2GVZC 2QAJA 1VKJA 4U02A 1MABB 3E1SA 2BBTA 2B7BA 2ZE7A 1JECA 2EWVA 1Z07A 4TYPA 4YDSA 1P62B 521PA 2VH5R 1ELOA 3KXIA 3U6BA 2VHUA 4M22A 1U81A 5HE9A 4Q1DA 3FVQA 3NKVA 4TL9A 1IN8A 4EQ6B 3GLGE 1SXJE 2RGCA 3RANA 4N1AA 4D2IA 4TLAA 1Z2AA 2QRZA 1UADA 1NJGA 1R5OA 3JZAA 2D7DA 3SZRA 2JLXA 4EAQA 4FINA 4ZCIA 1Z47A 2G0NA 5BYKA 1TU3A 1Z5ZA 3TIFA 2DWQA 2W6IA 4IOLA 2YWFA 1S9DA 3PV0A 4B44A 1P9NA 2MSDB 1OYWA 1G3MA 2C9YA 4Q03A 4DLYA 3OEEA 3ZJYA 4URVR 4AD8A 4Z51A 4AKHA 2OG2A 3I4LA 2CCKA 2OBLA 1KAGA 1W2GA 4LC1A 4LV6A 1J90A 2F1JA 1FTNA 1V5WA 4Q9HA 5KPDA 2IUUA 3SOPA 1KI2A 1GITA 4BE7B 4I1UA 1IONA 1TUEA 2EQBA 4MKFA 4BFSA 5AUQA 4YDHB 3JZMA 3LQRA 1X3SA 4HAUA 3QVUA 4ZDWA 1P9RA 5DI3A 2AN9A 3T15A 3UMRA 1JAIA 4G3XA 1SGWA 1E2QA 3QEOA 4JVNA 2WKRA 4E22A 3BJIC 1ZNXA 2ZS7A 4G5QA 1ZVQA 4GFDA 4WAUA 1P72A 4L4UA 4XVUA 2EFGA 4FCTA 1XTKA 4C0KA 1Z6TA 3BB4A 4IJMA 1EWQA 1CR1A 3FHTA 4I99A 3GFTA 4CT5A 1Z0FA 1TQ6A 1DOAA 2WWWA 1FZQA 2AD5A 2WMOB 1GM5A 1SKQA 1LS1A 4PZLA 3P32A 4TL7A 1NLFA 3NVAA 4M1YA 1F6BA 2HF8A 4QNMA 1JJ7A 1COWA 2RAPA 3OZXA 2O8FA 4LJ8A 2QL6A 2HYIC 4G01B 2QM7A 2R9VA 2CXXA 3K9HA 1CS4C 3U3RA 1IOZA 4QC2A 1Q1QA 2Z4RA 4QHYA 3T5GA 3RS7A 4RZXA 1XCMA 1S0UA 2VLIA 3OIUA 5FFMA 3B85A 3K09A 2J7PA 2YOGA 4TYYA 3GFOA 4ILEA 1NVUQ 1WDTA 5DI3B 3GLGA 5LD2C 2FPMA 1SXJA 3QKTA 4DJTA 1UEJA 2W6ID 5UKDA 3RS4A 5KYKA 4CEJA 3V9PA 4EFNA 5EUQB 5A5GA 1N5LA 3OEED 2IYRA 4OBEA 1OFUX 4LV8B 1VECA 1MH1A 2Q21A 1KSHA 1G6HA 3U3MA 1Z0AA 3NEYA 5FPYA 4AYXA 4JKIA 2HJGA 3NC1C 2DFLA 5BYJA 1KO7A 1CR0A 1VYUA 4OK3A 4IDNA 2BMDA 1Z29A 3R9IA 2WPDD 2EFDB 4LSGA 3P20A 5CYOA 2H16A 2H5EA 3DHWC 3NH9A 3Q5EA 3FB4A 4LY6A 3K0FA 3PG5A 4M1KA 4MA4A 4RKFA 2O8FB 4LI0A 3AF3A 1RE0A 4JS0A 4F92B 5FOSA 1GAJA 2ORIA 3A6PC 1D9XA 3LLMA 4JSYA 1XEWX 2N1BA 4EPYA 3ICEA 4POAA 1CKEA 2XOKA 1GIAA 5KSPA 4TMTA 3W8RA 5LB2A 4JLBA 2FFQA 3LQQA 4FCWA 4HB2A 4RD0A 2HXYA 2ASEA 3AH8A 3BFVA 3K0CC 4UJ5A 5J4HA 2P5SA 1NMYA 3ECCA 1M74A 1ZIOA 2F6RA 2F3RA 1GOTA 1AKYA 5FL7A 3SFVA 3GLGB 2QTVB 1MO4A 2H7VA 1SXJB 2ANBA 3QPWA 5DO9A 5DYIA 2GHIA 3BORA 2W58A 3FDIA 1IY2A 2WOJA 3AF2A 3NBZC 1N2CE 3FGNA 2IYQA 4M1OA 4CEJB 3U4QA 1BYUA 3DOEA 4EDHA 3THWA 1DELA 3QF4A 5DN6A 5KSZA 1W7AA 1N0WA 2QMEA 3EC2A 1ZJ6A 2XITA 1E2MA 2RHDA 1JQJC 3FMPB 1GSIA 1UBGA 2NO9A 4QXAA 1NKTA 2E9SA 3FWYA 1XB2A 4Q7JB 2BWJA 4IDPA 3TVDA 4C2UA 1G1MA 3K0FB 5P21A 5DI9A 4UNQA 4A2WA 1L4YA 3MRSA 3C5HA 3SDZA 221PA 4FXPA 2PMKA 5ANRB 4BFXA 2FZ4A 3SFZA 1SKYE 2NTYC 4MYTA 5LBIA 3WXMA 3RVBA 2A5FA 4DVGA 1E2EA 1NY5A 1E1RA 2BCGY 3SS8A 1OIXA 1E96A 1ZD1A 3CF6R 2IBMA 4KFRA 4M1WA 1OXSC 1KO1A 2FE4A 3NBFA 3EPJA 2VRWA 1EK0A 1OXTA 3THOA 3RAPR 4MITA 3T1OA 2AKYA 4PO9A 1AK2A 1Z6GA 5JMTA 3TKLA 2WTUA 3WHLA 2IYWA 2IYSA 2O8EA 1G3IA 5FPTA 2D62A 3IQWA 2R6GA 1CJKC 3C5CA 3OFNA 2WAXA 3D6TB 3THWB 4DLZA 3QF4B 1LVGA 3B9QA 4GNKA 3THXA 5EP1A 5GVRA 4C0HA 1Q1EA 4DLRA 1IN7A 2BBSA 4B33A 1S3GA 1XCGB 3TJZA 2B92A 4C0QC 1CTQA 1U9IC 3EIEA 3VHXA 2ZPTX 4A92A 2OESA 1T0JB 2XTMA 4KAXA 4C7OA 4IOJA 1W0JD 2KSQA 2CBZA 2OLJA 4PXAA 4LJ6A 2F3TA 4DCSA 2WWYA 2IYZA 3RSLA 2C98A 1RZ3A 4LHYA 1P61B 3TBKA 3VNUA 4TL8A 2ZRBA 4HSEA 2NOAA 3LA6A 4Y0AA 5FOVA 1WE2A 5DN6D 1M34E 3BIFA 4Q18A 2JCSA 4EFMA 2IS1A 4MGKR 2CJWA 4PSKA 3VAAA 1HV8A 2JJ2D 4ESVA 2IEYA 5JHHB 2PCJA 1E0KA 1D9ZA 2VHCA 3ZQ6A 2R2AA 3I3SR 4LX0A 2JAQA 4Q9IA 2A9KA 2O8EB 4B3GA 4Q7KA 3LO5A 3PUVA 1DG1G 2HYDA 4RZUA 3JVVA 3THXB 3IO3A 2O0JA 1LNZA 4U5XA 3EA0A 3RWOA 5HKKA 1CIPA 2GXSA 3KQKA 2Z6VA 3LFUA 1E1RD 3HJNA 3AV0B 1G6OA 4JVMA 3BC1A 1E9AA 1JEDA 5TB5A 3UWKA 2AXNA 1WB9A 4C7OB 1S96A 3EPHA 2WWXA 3KQNA 2GCNA 4C0SA 2QP3A 2IXEA 2ZAOA 4AIIA 5EP4A 2AWNA 3I32A 5HPYB 2W83A 1ZNYA 4XSHA 5E4FA 4Q1BA 4QJ4A 2GJAA 3TSZA 5L3QA 1HT1E 3GLHE 1NN0A 1Q20A 4NCJA 4A15A 3A4MA 1RC8A 2YWGA 4Q4AA 1U0HC 1N6IA 4V0ME 1FW6A 3TUIC 3CH5A 4CRWB 3WNDA 1MT0A 4V03A 1E2FA 1E4VA 1XZPA 2QUZA 3N2EA 2CJWB 1N25A 3PITA 2QGNA 4IDOA 3EZ7A 4C0JA 2P2LA 4RD6A 5JS8A 2CCGA 1DO2A 2FWRA 4YMVA 1E99A 2AK3A 2VQSA 4KVAA 5CIWA 1CJTC 4D0NA 3U60B 2H18A 3LLUA 1RIFA 2JDID 3QKSA 1NI3A 4DLWA 3BH7A 3K9NA 5B30A 1BO6A 4QG7A 5AR1A 1KKLA 3T35A 2GVDC 1L2TA 1KJWA 5AJVB 3TQCA 2B21A 3UATA 1H8EA 4TQAA 5JZVA 3EAQA 2P65A 1E9EA 1BIFA 2GKSA 2YZ2A 4DKXA 1R8QA 1G9XA 4OI4A 4OQLA 3SU8A 1R4AA 5TARA 1CR2A 2BMFA 2HDNB 2OILA 1SKYB 4PAMA 5DYGA 4N3NA 2EFHB 4JLDA 1OB2A 4QBHA 1OFIA 1BYIA 1YR6A 3TE6A 3F3YA 5L3QB 2CNWD 1NN1A 5DLQC 2WIBA 1AIPA 2ZUBA 3PEUA 3QBTA 3W3AA 2AFIE 4KU4A 4Q4AB 5EZ6B 1E2GA 3HWSA 821PA 2R6AA 2JLYA 1QDEA 2FZLA 1W0KD 1IM2A 1OH7A 2GILA 3HYTA 5EXPA 1YR9A 3Q7QA 4JLKA 5KDLA 3H0KA 2YWEA 1XTQA 1QG4A 4URZR 2F1RA 1KGDA 4KJZA 1P2TA 1XBTA 1T8TA 2GESA 2IS6A 1T5IA 3GCGA 1RW4A 2HCBA 2H57A 1Q3HA 2WM9B 1UFQA 1AA3A 5KNCA 1QHXA 1Q57A 2FSIA 1QF9A 3U5ZB 1YZKA 2VSXA 4A0HA 5KU1A 1HT2E 4OK5A 1VIYA 2ZJAA 4FIDA 4P4SA 2ZYUX 4PANA 5B64A 1KO4A 1JNYA 5JEEA 3K0CA 4QL3A 1M1YE 5BN3A 2HJVA 2D3WA 4A36A 4HZIA 4IRUB 4IXNA 2DCUA 5LD2B 4C9BA 1GL6A 2FFBA 2O8BA 2Y8EA 1OXVA 1E94E 1QHHA 1Z0KA 2PBRA 2ZI4A 4XTRA 1TU4A 1GKYA 2YHSA 3QY0A 2R6FA 4B48A 1NLYA 1P73A 1XP8A 2WVJA 2I3BA 2QMOA 3GLHA 5TVKA 4LPKA 1ZUHA 4FMCF 4BLTA 1E2IA 2ORVA 2C8VA 4V0MA 4I1SA 2ZXUA 3W6OA 5CLQA 3QSYA 4MRNA 2GA8A 3QNUA 1IAQA 3NIBA 1K5DA 3QOFA 4IVQA 2GEDA 1BKDR 4GRAA 3C14C 3DEFA 4NTZA 2FFHA 2IS2A 4PQYA 2DPXA 2ZSBA 2CLCX 2J87A 5FBWB 1ZUNB 4BRUA 2C04A 2H8KA 4EPTA 4MKHA 4NU0A 4A6PA 5HTKA 3TQFA 4U7DA 3KZ1E 3P27A 2BCJQ 2ZJ5A 2EVWX 4OJQA 3TMKA 4P4SB 1ESMA 1A82A 3GLIA 2Q3MA 1JR3D 2IA5A 4R2IA 1RFLA 1II0A 5AJXA 2ZRFA 5DHFA 4BGDA 3BBPA 4RJLA 1R0ZA 1J70A 1KI9A 3A36A 1XJCA 4CT4B 1A5TA 2O8BB 2P6UA 5FPSA 1QHHB 2FSFA 1XPOA 1JJVA 3ZZTA 1KI1A 1Q22A 4L5BA 4LPSA 5KSYA 3GLHB 1N0VC 1NVXQ 4HEJA 4MUBA 4HB0A 1GL9B 1CEEA 2QM8A 3OIWA 1T5LA 3ONWA 5JJKA 4JLNA 4D80A 3BWDD 3LBNA 3AVUA 1JBKA 2REOA 3DM5A 4F38A 1QRAA 1U9IA 2JLWA 3EZ9A 3BFXA 2VYFA 3HR8A 5JBQA 4TYNA 2IWHA 5JEDA 3PEWA 4ZI3A 4OHVA 1G5TA 4BASA 2GK6A 1C4OA 1GTVA 2O0KA 2WHXA 1H8HA 1T3HA 4GT1A 4H9GA 4P31A 4JVSB 1WCV1 2HT1A 1OHHD 2PX3A 3BK7A 1MV5A 1VG9B 4AG6A 1NMXA 4TT3A 2X19A 1TX4B 3AP2A 4J0QA 4P32A 3RC8A 3IHWA 4RCYA 2VEDA 2PT7A 1F2UA 1PLLA 2I4IA 5J4VA 1ZW6A 4WW0A 3ZZ0A 2XZOA 3GLIB 1VHTA 3ZS8A 1TADA 3LX5A 4EJSC 2XX3A 1YZUA 4JYCA 2CL6X 2VP0A 4DDVA 3LVRE 2G83A 1PVOA 4LJ9A 5L3RA 1KJZA 2FV8A 1FNNA 3R20A 1QVRA 121PA 3REGA 4HDQB 4Q1CA 4GPTA 2AKAB 1XPRA 4UXJA 2B7CA 3K70C 1X1RA 4PPNA 4E5UA 1JALA 3FFAA 3M1IA 2IF2A 3FYHA 1TPZA 2J0VA 1U98A 1IBRA 3OHMA 1P3JA 5B58C 3IBGA 1TF7A 2ECKA 5AUPB 4PHHA 1HQCA 2QQ0A 4C0LA 1OXUA 2VSFA 4W5HA 3EPLA 2J9RA 2OFXA 1S2MA 5B57C 1H65A 3PUXA 4DSTA 1HE1C 3OEHD 2BVNA 2HLDA 5JCZA 1B0UA 3IUYA 4FCVA 1FTSA 2F9LA 4NYIQ 4WIAA 5JLJA 1LF0A 1NJFA 4CVNA 2VL7A 1GKUB 1A7JA 4PO1A 1HTWA 2OM2A 3A1TA 1AS2A 2GCOA 5F3WB 1OT3A 2NO1A 2ZYWX 3B13B 2IS4A 2CMKA 2XTNA 4UKDA 3U7GA 1K6MA 3MWJA 3QKUA 4LYJA 5FTJA 4B3CA 1KSJA 4L16A 1OH5A 2WJHA 1RVDA 1R5NA 5CLLA 4I1OA 1FMJA 1JB1A 4Q66C 5C4MA 1E98A 3X1YA 4BEBA 3RS0A 2AHOA 1S1MA 2ZTSA 1WF3A 4GDFA 1GNPA 2MMGA 4ITRC 4ACBA 2QMHA 1KMHA 4B73A 5TMPA 3VKWA 3ZVNA 3VFDA 1H8HD 4ARZA 3EZ2A 1XMSA 3LH5A 1XWIA 1E9DA 1VCNA 3HDTA 2OEPA 2ZANA 2ZR0A 1YHNA 4OQMA 3R7WA 1DBSA 2ZRMA 1XXHA 2ZRNA 3P4YA 3LW7A 3NBYC 2ORWA 4TMWA 4Q01A 2V1UA 1A2BA 2YC2C 1GRQA 1R6BX 1KDPA 2QP9X 4HLDA 4A2QA 2IYVA 4HB3A 2N46A 5D3MB 3SBDA 5CDFE 1DAMA 4JT4A 2XB4A 4EPXA 2ZUDA 3WYFA 1FPMA 4CDGA 5CM8B 2IHBA 2GZDA 3EA5A 5IK2D 4IHQA 1XEXA 1S8FA 2BEJA 2EYQA 4TSFA 1NL3A 1DE0A 1QVAA 2GCOB 3KJHA 1M6NA 3L0OA 1P9WA 2YC4C 3KKNA 1F5NA 4BLRA 4F93B 2DYKA 3L0SA 4W5WA 4DC9A 1AS0A 4GP6A 4Z54A 2FSGA 5EUMA 4TMXA 4AKGA 2WWIA 2IXFA 4ZDJA 5A4JA 3F8TA 3IKJA 4KSCA 2CHVA 4ASUD 4EIWA 2KBFA 3SHWA 4AC9A 1W5TA 2J3EA 2HLDD 3IDQA 5FOUA 4ARZB 4QM6A 2OUKA 3CX8A 1KDOA 3A8TA 2DWPA 3ASZA 2RH5A 2LKCA 3DM9B 3CW2A 3H4MA 3R7WB 1DADA 3RS5A 1T3LA 4JL6A 3CPJB 4QGGA 1XXHB 1BOFA 3IIMA 3MAAC 2XSZD 4NHOA 2FDCA 2A78A 2G9NA 3BAFA 1MO5A 2ODNA 1ZBDA 3B2EA 3I1FA 4U00A 4DHEA 2AR7A 4JJKA 4LYHA 3KUDA 4MKIA 4PC2A 2AWOA 5EZ5A 1DAGA 4NYIR 1IY1A 3MSXA 2J59A 2ATVA 4FWIB 3ZDQA 4NBSA 2WPDA 2ZJYA 4I81A 1XEXB 5DSZA 2V8OA 3VR4A 3ZYCA 1R7RA 3EX7C 3A1WA 5EQTA 1CXZA 2P67A 2RGNC 1VG0B 4DB4A 3ZD7A 3I5XA 3AVTA 4K81B 4M0LA 1NBMD 4TLEA 1S3SA 3OAAA 1E9BA 2AL7A 4QHTA 1SHKA 1XEFA 4LZZA 2XGJA 3CNOA 5FBLB 3WMEA 3LW8A 3TUJC 3LRPA 4ESHA 2GXQA 4O3MA 2C9CA 1J7KA 2PZFA 4Q1EA 1E0JA 3NG1A 2BC9A 5EJEA 1WP9A 1RJ9A 3CH4B 4LRWA 3AGPA 1E4YA 2C96A 3LBHA 4LUCA 5FI0B 2Q6TA 1O87A 5F9FA 2RGXA 2JATA 3QUSA 2GJ8A 2QROA 4IOMA 2FOLA 3CUEF 2HV8A 1HURA 2ZU0C 2XZLA 3CIOA 3GJ7A 2QY9A 3AF0A 2G3YA 1KNXA 3AVOA 2ZS9A 3FHCB 4TSFD 4DB2A 4JMPA 4QJ5A 4MDFA 1MR3F 3LBIA 3P4XA 2YYZA 5J4KA 1MRSA 4F4IA 2ZETA 5CDFA 4LJ4A 2WV9A 4UNRA 2ZITA 1MO3A 3L0PA 5J47A 1CU1A 3DDCA 4RCZA 4IEEA 1IXSB 1D2NA 2J1LA 5BW8A 2ZJ8A 4US2R 1KHTA 5CK4A 3ZIAD 2JJ1D 4LJ5A 4DCUA 1IQPA 2PEZA 1N5IA 4XH9B 4FI3C 1VCMA 5K8TA 3SYNA 1OH8A 5FTNA 1ONBA 2I1QA 5BN4A 2WJJA 3NDPA 4O2RA 1II9A 2OBMA 1AS3A 2CK3D 4ZI2A 1P5ZB 2ZIAA 4B71A 1UAAA 1O3YA 3UK6A 4DUGD 1VCIA 3QXCA 2GEVA 3UANA 4KSBA 2H1LA 1G5RA 2W2XA 3SN6A 1R0WA 3JVUA 1KK3A 3OESA 1RJ9B 4NL4H 4JLVA 1RKBA 4BFTA 3EIQA 5FOXA 1VYVA 1N6LA 1TQ4A 1E79A 4MH0R 2ERYA 2RCNA 4GZMA 3PR1A 4Q1FA 3T1TA 4ZCLA 4CIDA 1QHSA 2FH5B 4E07A 4MRVA 3TW4A 4D0LB 4CEIA 3TH5A 4EUNA 1ZD8A 4BRWA 4EJSA 2NPIA 1MKYA 3E70C 4KYIB 2O5VA 1DAKA 4B3BA 4Q1AA 4UNPA 3OAAD 1FNMA 1YZQA 1WRBA 5CJPA 4DLTA 1KYIA 3IIJA 2VP2A 2F55A 3GJXC 1FOEB 3T1VA 2NZ8A 3P26A 2ZI3A 1A4RA 2ZVPX 2G1KA 2ZU6A 4DLVA 2F1IA 4Q5IA 1W0JA 2J5XA 1KDTA 2B8WA 3RWMB 5E7IA 5GJWC 2ONJA 2R8RA 1ZU5A 3FKSD 3ZLJA 1DAFA 1WBDA 3WRYC 1W4CA 4S2EA 4TN1A 5G3YA 2ZRAA 4LWZA 3TW8B 4F4JA 1AQUA 3WNBA 1TF5A 1ZP6A 1G7RA 4HDOB 3IPYA 3IO5A 4JLPA 3TAUA 4LJAA 2OXCA 3ICQB 2ODBA 1FP6A 1JQLB 2JJ2A 1GILA 2PLRA 4TWZA 2OSBA 5H68A 1XMJA 3I62A 2IUTA 5FTLA 2UZIR 3QVVA 3MGCA 2OV2A 2ZJBA 3FE2A 4CEIB 3KKOA 2D06A 4EJSB 3GPLA 2A2ZA 2GDJA 1D2EA 1C1YA 1KSFX 1Z28A 1Q1BA 5HCNA 4Q4LA 5KNBA 4NP6A 2ZSAA 3CONA 4W7SA 2HF9A 2CL0X 5DHAA 3THYA 4P4TA 1ZM2A 2DY1A 2ODWA 4AKEA 2A7QA 3VKGA 4X8MA 2BDTA 2YOHA 2BV3A 1Q0UA 2A5GA 5FUVA 4FWTA 2IHYA 3B60A 1ZM4A 4JYBA 2AX4A 1G8FA 2IL1A 3B9PA 3KQHA 1ZM9A 4MRSA 4Q19A 5DISB 3WP0A 3K70B 4GOXA 2NPFA 3W6PA 4HAZA 2WWHA 5E7MA 3R9XA 4GSYA 3T61A 1E79D 4RD2A 2CHQA 4B3FX 4WZBE 1Z0JA 1CJVC 2OZEA 1W1WA 2ZRJA 3L43A 2BBWA 3U4QB 3FTQA 1G21E 2ZRKA 4DLXA 721PA 1ZCBA 4H1UA 1GWNA 3VTKA 1W49A 1HH4A 2GAOA 3K1JA 1I4LD 3MLEA 4LHXA 1RRPA 4A6XA 3U6KA 4M9QA 5KSOA 4QOSA 4IXMA 2XJ9A 4B35A 4B76A 2ODEA 1KIMA 1Z0DA 2UVQA 4URYR 4HATA 5FOTA 5AUOB 3KXKA 4M53A 4KHZA 4Q4JA 1Y63A 4US0R 2RGGA 5J4LA 2FNAA 3AUYA 1XTIA 4XWKA 4X8LA 3H86A 4K46A 1BS1A 3K70D 2JLQA 1LB1B 2JDIA 2PEYA 1Z22A 1OF1A 2JEOA 3L8ZA 3NEJA 3CR8A 1UJ2A 3GEEA 3O8BA 2G88A 2WJVA 3W6NA 2X2FA 3THYB 2WSMA 1SULA 3C15C 5DGXA 5FTMA 1JR3E 4JLMA 3A4LA 2JGNA 3NTUA 4BZXA 3ND9A 3SE0A 4X8HA 2IYYA 3AKYA 2XNDD 1CULC 2YV5A 3IBYA 1IXZA 4DDWA 1OFTA 1M7HA 5HZKA 2V3CC 1G41A 2OCBA 1QG2A 2W2VA 2CNWA 3F5FA 4HUTA 4EKDA 5HR5A 2QAGC 1B23P 3ZVLA 3PEYA 3V4FA 3BERA 2BM1A 4LJYA 2AD1A 3FMOB 4PAQA 4D4MA 2AFHE 4QJ3A 1UKEA 4JLAA 4LBVA 1QHYA 1TQ2A 2WBLC 4PPGA 1ZRHA 2QNRA 1W0KA 1XTSA 4MRPA 2C9OA 1NF3A 4PPQA 1KI7A 2VBCA 3ADCA 4IFEA 5IDVA 3SJCA 2RGNA 2VIIA 1ETUA 1F48A 2J41A 4Q4JB 3VMFA 1LF5A 5FL3A 2GXUA 4C30A 4B6EA 5LPNA 1YR8A 4IFBA 4OQXA 2JLVA 5CM9C 1WQ1R 2ZEJA 1KKMA 4ZIRA 3KQLA 1TL7C 1FUKA 4WVFA 1XNJA 4CZ2A 4RVCA 4WBSA 5EXSA 1W44A 3L82B 4C0BA 4DIEA 4DRZA 4F4CA 4ZDIA 3QKRA 2GJSA 3HPQA 1J8MF 1E9RA 3HYRA 1DO0A 3GJ6A 3LX8A 2BMEA 2IYTA 3SYLA 4LV5B 2FEOA 4XTCS 4RKEA 1OLOA 4N0DA 1J99A 3B1WA 1W36D 2OFWA 2V1XA 3I72A 3QXHA 1VMAA 1X8LA 2D2EA 1ESNA 2ZE5A 2Z4SA 3KXLA 1P2SA 2OE2A 3GJ0A 1ZC4A 3J81k 1Q3TA 1ZUIA 1YQTA 3CZQA 3U7EB 3SC3A 4KI0A 1TEVA 5JJLA 1W4AA 3TAHA 5SZHB 3ADDA 4IW3B 3N2IA 2ATXA 1DG3A 2PL3A 1SVOA 2E1RA 4W5JA 4TYQA 4B3DA 2DR3A 4UXIA 4KLZA 4AYWA 3GLIE 2OT3B 2QRNA 4HAVA 4KBFA 3VHLB 1YRBA 4D26A 2CL7X 3DKVA 5AJYA 1GRNA 1Z83A 4PC1A 2FN4A 1WMSA 3B8HA 3S1AA 1CP2A 4IVPA 4ZIRB 2C77A 2NZJA 4LBWA 3RRMA 3IEUA 4A0GA 1E1QD 4QBFA 3QKRB 2ERXA 4URXR 3T06B 5H1YA 1JR3A 4DBLC 1SVKA 1QBKC 4TL6A 3K53A 2YVUA 3REFA 4TYWA 3U7FB 1E9CA 1G8HA 2K5UA 1AZSC 4OHZA 3U7HB 2P5TB 3GEHA 2FJUA 4JBWA 2QTHA 2V9PA 1Z08A 1ZINA 2A3RA 3IPXA 4ZV4A 3MWLA 5JSZA 1KNQA 1N0UA 1T8UA 3CPHA 5JRZA 3SYKA 3EPKA 3HPRA 2IEZA 1DS6A 5JWHA 4B32A 2GZHA 4RD4A 1NG9A 3GEIA 2NGRA 1NSTA 2WJIA 3CM0A 3QKSB 4MYUA 3NHBA 2QT0A 4G5OA 3IQXA 2MSEB 1J8YF 3BD9A 3Q3JB 3V00A 4LHVA 1XJ0A 5CB8A 1PV4A 2JJ8A 3BOSA 4RZ2A 1G18A 5AUNB 2X2EA 3CX6A 2FG5A 2QT1A 3E5HA 1OHHA 3CWZA 1GNQA 5C1BA 1Z06A 2PJZA 4BECA 3CZPA 3S1AB 2UZ3A 1CJUC 4JSTA 3BB1A 5H70A 5L3VA 2Z83A 2V55B 2AXPA 3AP3A 3I92A 4QNRA 2QORA 2R65A 3AQ4A 1N5JA 2VHJA 3OIYA 5GJCA 2Q9AA 1N3BA 2C03A 2IXGA 2ZUCA 5DIFA 4WOPA 3LXXA 5JRJA 1U8YA 2MSCB 1U94A 1G7SA 1ZNZA 2FU5C 1XDBA 4E09A 2J0SA 3F0TA 3SEAA 4D82A 1ZNWA 5FR2A 1OIVA 2WOOA 3IILA 1GNRA 3NC0C 5IHPA 5C18A 2LWIA 1OXXK 3G0HA 2BIFA 1KI8A 5TV2A 1ODFA 1KI3A 2ZM5A 1KK1A 1G17A 2O52A 3TSOA 2I1VB 4ZKDA 4Q00A 5KTYA 1Z6AA 4PHTA 3EW9A 4QGFA 1EFHA 3FHOA 2DB3A 2X8AA 3MFYA 3OEHA 1FUUA 1AJEA 1E9SA 1OKKA 2VHQA 4KODA 4M9XA 4GZLA 5IT5A 2KE5A 4PZYA 3D3QA 3WYAA 2F7SA 2EWWA 4UJ3A 3KJEA 3LD9A 5TY0A 4EPVA 5BN5A 2VP9A 2ZRLA 4ZPXA 4YXWA 1JPNA 3DL0A 3R9WA 1OPXA 2FA9A 5JI3E 2QMUA 4JLOA 1R0XA 2A5YB 3LAWA 5G3ZA 2IK8A 4XVQA 1HEIA 3QG5A 2ANCA 4DCVA 5CITA 4IDQA 2JASA 4V02A 1PUJA 5GVSA 1NBME 3B82A 3QEJA 1KTVA 2PH1A 5FPHA 3K0AA 4PHFA 5F9HA 3LV8A 2PMDA 5EP3A 2PCLA 3K0EA 1IN6A 3RHFA 4TZ0A 1G3UA 3EZFA 2RGAA 4ZKEA 2HT6A 1ZYUA 4DDUA 1P75A 1XXHE 3A37A 2VF8A 3Q72A 3UXMA 1CLUA 3U2QA 3ADBA 2QPOA 3BRWD 3E2IA 4I4LA 2GTPA 5F2EA 1DEKA 4B47A 1ZM3A 3K0SA 5B2ZA 1I2MA 1D6JA 1AKEA 2CDNA 5EE3A 1K8RA 3SQWA 1JXMA 4I1VA 1JEEA 3QBVA 2XEXA 2PX0A 4FN5A 4D4KA 3NBXX 4HLUC 1K5GA 4EPWA 3MUFA 5DH9A 5IK2A 1R8SA 4F91B 3WMGA 4LHWA 2XAUA 1N5KA 3DPUA 2QAGA 3C16C 1XX6A 1BH2A 4PX9A 1PLKA 1Z3IX 2CE2X 3KB1A 1DARA 4TTPA 2D2FA 3TVTA 3OF5A 4RY2A 3NHAA 4NKRA 2HCJB 2GETA 5FI1B 1KI6A 3TLXA 3DVLA 3X1DA 3K0AB 4LJ7A 3AF1A 1KOFA 1UEIA 1YR7A 2NMVA 4II7A 4ASUA 4BQSA 5JI2E 3P1JA 4M4SA 1X86B 3IEVA 3SJAA 4D25A 1KZGB 1OKKD 1E0AA 3MG9A 3CNLA 2PZGA 2BJVA 3ZQJA 5G53C 3QE0A 1AM4D 5BWMA 3QQ5A 4NPHA 2C5LA 3HU3A 4YXWD 4C4PA 2IW3A 1XZQA 1IJFA 2XSZA 1F2UB 1US8A 5CJ2A 3UMFA 5JWRA 4A8JA 1RRCA 1AGPA 4FMDF 2MMCA 3HP1A 1II8A 1NLZA 3QF7A 3W90A 1RYFA 1X6VA 3CBQA 5DE3A 2VF7A 5J4YA 2C78A 2BKEA 3UMSA 4WZAE 5JWOA 5KUTA 3B78A 3W8NA 1EX7A 4LBYA 2JLUA 1X1SA 4CEHA 3QG1A 4BFYA 2QAGB 4KITB 4Q02A 1PUIA 1FQKA 3AKDA 4YMWA 2WWFA 1NBMA 2WWGA 4KFTA 4OJKA 1GRRA 4KBGA 1VTKA 3KUCA 1JXOA 5EXXA 1KI6B 1OIWA 1NRJB 4BFVA 3AVWA 1G8PA 3ZH9B 2ZS8A 3RYTC 1GG2A 1A2KC 2D4HA 3AKEA 4JBXA 3SJZA 1TQDA 1W46A 4E03A 4A0FA 2W6JD 1J2JA 1T4GA 2BBOA 1JI0A 4DXAA 1ZCAA 1E2NA 4A9AA 2Q0HA 3PUWA 1PJRA 4URWR 2VPPA 4GOKA 2DFKB 1W36C 1EFRA 2FPKA 3I8XA 4PQFA 1CRQA 1T9HA 3K8YA 1F2TA 1HE8B 2R6CA 1QHGA 4D81A 4YLGA 1NN5A 1IXRC 4HZUA 2GZAA 3KQUA 2RGDA 5KPJA 2W00A 4C3ZA 1US8B 4DDTA 1GDDA 4KXFB 2QA5A 1II8B 1MOZA 3FPAA 1WBBA 3BB3A 4OI1A 4HYYA 4XD7D 3KTAA 2QTFA 4MQBA 3ZIAA 1E2JA 1Z0IA 2JJ1A 3A1VA 2Q3HA 2IT1A 1Z6YA 3GP8A 2QG6A 1DTSA 3GJ8A 2WIAA 4CEHB 1DVRA 3LWNA 2KB0A 5KHOC 1GFIA 4W9MC 4BWYA 1KMHB 2PLFA 1QHNA 3N70A 1UKYA 3TR0A 1OE0A 3RC3A 1OV4A 2CK3A 2JLSA 2IC5A 3B1VA 4QBIA 5CYPA 3UG7A 1QZXA 3DKPA 4B34A 4DUGA 1GKIA 4GI7A 4IDHA 5FUYA 1NP6A 1UDWA 1D5CA 4IEIA 2DWOA 3KX2A 4LCBA 4ACAA 1IHUA 4WA7A 5EE9A 1KSGA 1FL9A 3ZGXA 4XWAA 2ZI5A 3FKQA 3GJ4A 4N0EA 2EFEB 4BLQA 3SBEA 1F2TB 3UIEA 4HUQA 3EG5A 4P33A 2NO0A 3MWKA 2HXSA 1G7CA 4HZUB 5C46F 621PA 2YKGA 2OFOA 1I4TD 3DO6A 3SJBA 3HU1A 2YWHA 1UBCA 3IIKA 4FMCB 5F98A 5IF9A 2G1JA 1NY6A 2YJTD 4URUR 3RRZA 2C95A 3K9GA 1G7TA 1W5SA 3KTAB 5FUXA 3BE4A 1VDZA 4V0KA 4MDEA 5JCPA 1VHLA 3TGPA 2E87A 4D6PA 2VA8A 4EPRA 2F1HA 3EC1A 4XJXA 1G8GA 3IGFA 2GBLC 4GOJA 1R10A 3CX7A 3FKSA 3BFKA 1T3SA 1OB5A 2XJ4A 1EFRD 1YZLA 3Q85A 1PLJA 4OHYA 3CRVA 2ZI6A 3QIAA 2TMKA 5LB4A 1JR6A 2RB4A 2BEKA 4G5GA 4TMVA 4YONB 2ZRIA 1P2UA 1DPFA 2ZSDA 3GJ5A 3HU2A 3PCRB 3PVSA 4PAOA 4R71A 1SVSA 3OIVA 3I73A 1G20E 1NMZA 4NCKA 1LTQA 2GF9A 3RNLA 3X1WA 1TNDA 2RGEA 4HUQB 5D3QA 1TF2A 1AZTA 1EX6A 1W47A 3AB3A 4NCNA 4BZPA 1OYYA 2CLDX 1Z8FA 3LVQE 2QSYA 3LXRA 5TXGA 2BJWA 2W0MA 2P0EA 2ZQ5A 4OK6A 3M0EA 4YC7A 3UWOA 1W4RA 3B1XA 4NH0A 3Q8XB 5E7JA 4AKIA 2ZRGA 1EWRA 1E6CA 3EWAA 3MJHA 2CVFA 4MGIR 1LFDB 1OJLA 1HQYE 2V7QA 1P6XA 1UKZA 1ZIPA 2QN6A 4KV9A 3M4YA 1IN4A 1L7VC 4PZZA 3X1XA 2X1VA 2RGBA 2WSSA 4JBYA 1E69A 1XD2A 4RZ3A 2PZEA 2V6JA 4KYUA 5CB6A 1D2MA 1G3QA 1GUAA 2DBYA 3H2YA 1OW3B 1YRAA 3L8YA 1GVNB 2ZRPA 4HLUA 4KCGA 1NN3A 5DNYB 2FSHA 4ZCMA 1NIPA 3AUXA 2OHFA 4HAYA 1G8YA 3MWYW 2VTKA 4GP7A 3DMDA 2Q9CA 4IOKA 2X77A 3AF4A 4K8OA 1AA9A 4X8OA 1KK0A 4JJZA 4MYHA 2OO7A 4FD2A 1OH6A 3VX4A 3VR1A 1R2QA 4BZQA 1NNEA 2LKDA 4M1MA 3PUYA 2ZRDA 2NIPA 2R62A 2GCPA 5CK5A
chains in the Genus database with same CATH superfamily
4QPDA 1EX1A 3QTLA 4COOA 3RRBA 2BH9A 4DRXA 4MPJA 2XE7A 3CRRA 4DRYA 3DTVD 2ZAYA 1YBVA 3BD6A 4N12A 4O0MA 5A04A 5LR6A 1DOHA 4YASA 1AB5A 3AHJA 4RYLA 1RLOA 2O2SA 4NHEA 1WS6A 4LF6B 3H7IA 4CKYA 5EI5A 1NG1A 4LFAB 4TMKA 1GNSA 2G28A 2I6TA 4EGJA 2QGZA 2EOAA 2OCDA 2HPAA 4CODB 4Z8YA 4XE5A 2VQEB 1CQJB 4ZVMA 3NWJA 1L5HA 4AY3A 2PIAA 3OOYA 1JJFA 1U2DA 5IT0A 3E1GA 3IMFA 3RBVA 3A58B 3ZWPA 4B17A 4L8GA 3O47A 1NRWA 2RAVA 4TWRA 2XMBA 2ZWAA 3SIWA 3WFZA 3QI2A 4L0DA 2ZJ2A 4JC5A 2B6HA 4LBZA 4IPTA 3C98A 4NABA 2WYIA 3MINB 3QU2A 2WMYA 3DAYA 1IHDA 4DR2B 1I1NA 4ROTA 1BAPA 2EZTA 2X23A 2J4FA 3VC3A 4EABA 1J5XA 4GBGA 1QGUA 1YCGA 3EXG2 3RC9A 3GLVA 5B5SA 2XVMA 4PTLA 3KFXA 5TEWA 5EJEA 4HDKB 4FGUA 4JKYA 2RCYA 4UXHA 1EESA 1RABA 1CDEA 2Q2WA 2JLCA 2YRXA 2ZYTX 3I9KA 1UBEA 5SY4A 4BV9A 1G2IA 4LZLA 2EU8A 3GRKA 3I2JA 4XIIA 1E62A 1EVIA 1TZMA 4V38A 3ESAA 3LL4A 5JR3A 1OLUB 3IPAA 1W25A 1JPUA 1DQYA 3PC6A 2ONKA 3BXZA 2G1UA 2YCBA 1KBZA 2G07A 4DTCA 3Q8LA 1R64A 1YQ9A 1Y48E 4J1NA 2Y6VA 4L9RA 3VRHA 4DIFA 1GZSA 1Q11A 3HCAA 2O8VA 2IPAB 3WLRA 5A4FS 1BFDA 1UFOA 3BMQB 3LUHA 1YU9A 2C7PA 4Y1FA 5IAGA 1MX3A 4TTAA 4M8NE 3R8CA 1C3JA 2DHRA 3D64A 4FZ5A 4JYPA 4JXJA 2C20A 4WKPA 4FGJA 1PS0A 2VZ8A 4NCHA 3GUHA 4WK6A 3W5JA 4HWPA 2DBRA 2KYRA 3WL5A 2XB2A 2NU9B 1Z5UA 5CFNA 2CF6A 1N36B 1GRCA 2G77B 2XT9A 4F9GA 4OSEA 5HHTA 2FPLA 4E31A 2RMKA 1BFKA 1TC2A 1CUSA 1LTKA 3MPOA 3DUFA 1ZXLA 5AFSA 4M0CA 4PC7A 4XSGA 1ZD3A 1Y3AA 1M0EA 3GEGA 1WXFA 5TE9A 5BUQA 1MO6A 4MMYB 5K9ZA 3NNNA 1ZVMA 3DMNA 3GUVA 2OHOA 2OV6A 5EUBA 1YQQA 2WU3A 2E7ZA 3DMHA 2ZP1A 3B1ZA 3DUWA 4TVKA 1TCAA 2R7LA 4L15A 1DKUA 1TRKA 3C41J 2VHXA 4ZGGA 2QE7A 1PT5A 2ZT7A 5KOYA 1A5AB 3BTSA 3MD0A 3LQYA 4Z1MA 4EW3A 5IBCA 4INOA 4MYDA 4WCFB 4JIMA 2ZE8A 3A70A 3DSRA 1JDZA 1FVFA 5LDDC 5HNKA 2J0UB 1LW7A 5EIWA 3JARB 3QLVC 1XA3A 4QJBA 4F3NA 3ESYA 2M32A 2EZ8A 3OLXA 2B2NA 2HEIA 3CH7A 3GFFA 3NV9A 4MUNA 3KKPA 1XAGA 4RH3A 4BDTA 5HBGA 3IP1A 1CW2B 2VYVA 4CPDA 2FUG1 4UHEA 5TDHA 3PX7A 3DLTA 2O8DB 3BMNB 1YSCA 4N9QA 3SY8A 5FYDA 2AN4A 3OZSA 4O2BB 2CWWA 2KMLA 5E1BA 4KFCA 1NUAA 4CCAA 2ZE6A 3GRPA 1D04A 5I8ZA 4X62B 4IKEA 1I6MA 5WRFA 5DLYA 2GZ1A 3W2FA 3AKCA 3ASYA 2FF7A 2XTZA 2NG1A 2D54A 1E1DA 4P08A 2I54A 1RXEA 2RHMA 5M04A 1PIWA 1R74A 4JL5A 3W3ZB 2PBLA 2WY2D 3B3AA 3K6KA 4PXYA 5HF9A 1KH3A 3QWAA 4NZPA 3WL4A 4A8JC 3P19A 3U4HA 2C4HA 1BQ4A 1KOJA 2GBLA 3QFSA 3QSGA 4XQCA 2WHPB 3LWZA 3PNLA 1F3LA 4NR0A 3DB1A 3HP7A 5A4DA 3T12A 2J0QA 1O8BA 3WG9A 4B2IA 2NUTB 4ZEWA 3AIIA 4I9NA 1WV0A 3LY5A 2HIHA 3PPWA 5FQOA 1DIGA 1E8DA 4DCNA 3TL3A 2NZ2A 6AT1A 2CFSA 2IPOA 3G5AA 1FPQA 3HY4A 1GL3A 1HK7A 1IG0A 3BGVA 3E8SA 3HYNA 4PWZA 5JSKA 1LLQA 1G3RA 2B5WA 5AMXA 3VYUB 4XYBA 2PKQP 2GLUA 2Y99A 2JA2A 2ZYVX 2XWJI 1IZZA 3ZNNA 4ZTZB 4F92B 4B0OA 2UKDA 1WCIB 4M9SA 2H3EA 4OL0A 1S2IA 4EI7A 3S7TA 5I7FA 1ODIA 3UMMA 4WQMA 5E6RB 4Z9YA 5FLXA 2P75A 1N2CB 1WU7A 1F8YA 1LU9A 3ECAA 5FF9A 4CDRA 3JAMA 1ZM7A 2QJTA 1WUKS 4ND7A 3H5NA 2HLHA 4FGSA 3ESQA 4O63O 2ZSEA 2FR8A 4JVLA 3FDJA 3EGVA 2J45A 4CKCB 1ANKA 4D41A 3WISA 4Y2VA 1GXSB 5H7XA 2OV8A 1KHHA 4YO7A 1U2RA 3HUFA 3NVKI 3FNHA 1TYEB 1WEHA 1JE0A 1LPBB 3QNMA 1Z9BA 4K6HA 4RSGA 1Y8QB 4NZNA 5FPKA 5F78A 1H4SA 2CEAA 4YJFB 3KQQA 4NYJQ 2FXVA 3FFBA 1KI4A 4IHJA 1QDLB 4R81A 3WGNA 2RDMA 4W9RA 2I5PO 4UM7A 2QRMA 1FP7A 3RKSA 5JO0A 5EJGA 2Q5QA 3I3OA 3QHAA 4GGPA 1PQUA 4AJPA 4OFZA 1QFYA 3R3SA 4EB6B 7AT1A 4FP9A 3VX3A 5JNRA 5TIIA 3WBBA 4C08A 5LFAA 3TWOA 3QW2A 4PPFA 1X9HA 3Q9LA 4DA7A 2KJQA 3DEZA 3F71A 1JG7A 4KHPB 2HRBA 2I62A 4NYMQ 4K6OA 3BCSA 2CZCA 4PQRA 1Y37A 3DQQA 4YRAA 4MI3A 4H7PA 3JQAD 4H7FA 2B78A 4E13A 1Z6XA 2CLEB 2UZ0A 1F8UA 5LDGA 1VBKA 3CKLA 1CERA 3KUXA 3MVEA 4R8RA 4XM1A 3GQBA 5IVDA 1ZICA 2IQIA 1ONSA 1C81A 1PNOA 3BRWA 4G24A 3KJGA 4TV9F 3R8FA 3DZBA 4LZAA 1JVNA 3IP3A 3ZGLA 3IUNA 3MWDB 4WPGA 1YQWA 1V4VA 2J9ZB 3U3OA 2WW8A 4G1UC 5LP6F 3SQXA 5LYJB 4M76B 1C9NA 1M7GA 1LNSA 1ST2A 2V9ZA 4K1XA 2IV7A 1Q44A 2FI1A 5DBIA 1CZOA 3UWSA 4O25A 5H3LA 3N7UA 1WPQA 2ZBRA 3NTXA 3U3JA 5C1PA 5HTOA 1M8PA 3SCZA 3WLTA 1MJHA 2PMBA 2PKCA 4KDCA 4LRXA 5IAAA 2XB8A 5DBEX 5KDDA 1ADBA 2DT5A 5CXXA 3U44B 3DNMA 3JRWA 3ZHRA 4W6QA 1C3VA 3TG8A 2GM4A 2W0SA 2PUFA 3TQHA 3I01M 4N49A 3EUAA 2HHLA 1IIBA 1RBMA 3GF4A 4I66A 1LPPA 3FMIA 3H99A 2YJ3A 2GWHA 3QJYA 1YHYA 4FDVA 4GQIA 4X45A 2ZIUB 5CT4A 3SR3A 4D9FA 1ZBQA 1VQ1A 1JMKC 1KXJA 1XAHA 3AKZA 2Z57A 1DKLA 1ONNA 3TFWA 3VZDA 1SC6A 5K3BA 1NP3A 2M1ZA 5HF5A 2XUGA 2X7JA 3PYMA 3UHFA 4UVHA 2QPTA 3AF5A 1RACA 5I3ZA 2O8CB 1K4KA 2OZLB 5EWMA 3HMQA 1D4AA 4GQBA 4HB4A 5J40A 3SYTA 2FJ0A 2XUAA 3OT1B 1HQKA 2BP7A 4TLBA 4LVOA 3VJLA 4TMYA 3WP1B 5JS7A 1X7WA 1VLZA 3Q6NA 4IFTA 1ECCA 1THTA 1OZFA 2OK7A 2R7AA 2R85A 3EAFA 1YT5A 1BZYA 1SHZA 5TVGA 3C4QA 3REQA 4FJ0A 4JLJA 2REBA 4FFOA 3PEVA 4UATA 5LC1A 2NUBA 1WL8A 3E15A 1RYDA 4FX5A 4H3VA 5F1YA 2J46A 5ITZA 5KDOA 4CL8A 1Y1SA 1MW9X 3C6XA 1XVTA 1X77A 2F43B 2J9FA 1O4VA 3G8AA 1BMFA 1YHZA 3MCAA 4RFSA 2ZAMA 2BHRA 3QUCA 4JBIA 2V6IA 4ON9A 4A73A 1J07A 4BMNA 1JEYA 4V0OA 1NVVQ 4TMFA 1B76A 4P3YA 3RUFA 5LQAA 4ATNA 2HSZA 4DY4A 3RSOA 1SWWA 3V9AA 3V7WA 1AXEA 4DIBA 1T6YA 4TTRA 1HX7A 3GLFA 1C0KA 3O4RA 5ALIA 1UPFA 1SQSA 3DVAA 5KYUA 3OF2A 4GBMA 2PJRA 3Q5DA 3SR4A 2BW0A 4GE0A 4MCHA 1V3QE 3BSFA 3K8QA 4OKSA 3GUUA 4DT1A 1VG8A 3IFSA 2EHJA 4UNIA 4BWVA 3TUZC 3SF8A 3TS1A 1Y6JA 1J42A 1D4FA 1JAHA 1DXHA 4PINA 3OKFA 4TSKA 2GOYA 4LGYA 2JIZA 2W6JA 1DAHA 1FX0B 1VJ0A 4LF8B 3GEPA 3QOWA 4TMZA 2QN9A 2Q2OA 4AKTA 4DBLE 1W9MA 1QO9A 1JDSA 1H22A 2VDMB 3V6MA 3G9TA 3PHBE 5HA5A 4Q47A 2HH9A 2AF4C 3N53A 2UUPA 1JJAA 4FUTA 4YAKA 2B82A 4KQ6A 1K4MA 3L0IB 3W5IA 3RCBA 2D2VA 3LTNC 3A14A 1A72A 4RJ2A 1IDOA 1K98A 1M8FA 1DQZA 5KNDD 4UDYX 3Q3VA 3ZVRA 3RUCA 3LKDA 4PYRA 4DSNA 1CPYA 4DY6A 4LC9A 3TNYA 3QGMA 6Q21A 2KBEA 1HETA 2VHZA 2PVPA 2PIDA 4MVYA 1GQSA 3HBFA 3K6JA 3HDQA 1T35A 2EHDA 2AJ8A 3OE7A 3CEPB 3CZ4A 4P9NA 1N3IA 3PDIB 2QUBA 2QRJA 1U8ZA 4GKBA 2CHGA 3BIWA 4IQGA 1FYXA 2ZTLA 4I5IA 3OJOA 4PGFA 3N8IA 2W2TA 3EIHA 1WHTB 4R5HA 2XXAB 1V7QA 1NUQA 2WJ6A 1X7XB 1UR5A 2Y0PA 2FW1A 1UBNA 4LQDA 3BIOA 3OCCA 5DIZA 4EARA 3Q88A 3U16A 3C5VA 5HZHA 1W4BA 3R7FA 1Z63A 4AI6A 1TVMA 3MMPA 3NVDA 2Q4BA 4YP9A 1VFNA 3WGLA 1DHRA 1Z26A 3RS9A 3PXAA 5IP5A 1ZD4A 2IITA 3H84A 4MRRA 4ZDKA 1BS9A 1WU8A 1YR2A 2OP0A 3MUNA 3HJFA 3TX6A 1PK7A 1WABA 3HCPA 4HQLA 3TLBA 3X2FA 1EVLA 4JYMA 3OZBA 4N47A 3WKAA 1SRQA 3PDHA 2CWDA 2X6RA 1L5YA 3FCCA 2YOFA 4PLPA 5CX1A 3I64A 4MVJF 5FAXA 4EKNB 4F1KA 1OJ7A 3EXAA 3H9EO 4DXHA 4DILA 3A6JA 3O8OB 4ER0A 3D7MA 2UUCB 4EGCB 2HBQA 5A3JA 2Q0XA 1GT91 4RMGA 3OJ0A 2VNAA 2EKDA 3P9IA 4PIPA 5T8KC 2HK9A 1A1VA 2FEMA 3SHQA 4BVHA 3N87A 1J8VA 3WB9A 3NHFA 3M1YA 1TW3A 2WKPA 4FEGA 2OAQ1 3OPYI 5LLTA 3UQYS 2BKUA 4BFZA 4Q3NA 3L0ZA 3CRQA 1JZSA 3I01A 5FTLA 1TMKA 3R3WA 2XPCA 1HUQA 3QFRA 4KYTA 3CJQA 4FHFA 1M2KA 2MSNA 5C4IA 2D2XA 2FZGA 2A5DA 2BEUA 5SY9A 1T9KA 1QIGA 1DQNA 5TGDA 1ZH8A 3CPEA 3JQ9C 1SH7A 4U9UA 4EHJA 1XR3A 1CQWA 3WRVA 4I50A 3SICE 4DZZA 5K2OA 3TXAA 4YI5A 5DMXA 4OHBA 4HLCA 1OX4A 5AJWA 1SCQA 2J9XB 1V1RA 1WM1A 1WXWA 1FS5A 4IGFA 5EE5B 2ZR9A 5FORA 3T9BA 2E82A 1S1CA 1Y81A 1VIDA 2Z2IA 3NP7A 3Q1LA 4TT3D 3D7NA 4MICA 4A8JB 4BPBA 4BO1A 1UF9A 4O2LA 2R87A 4DLUA 3CISA 4REMA 2X2PA 3I5YA 1QK5A 5IF3A 3GZTB 1HKUA 1UJBA 1K6JA 2B1IA 3D1LA 3I4CA 4L51A 4L9SA 1XMIA 4MW2A 1E2PA 2O2XA 4H7JA 3TJMA 1Q7CA 4DLSA 2FPPA 2X14A 4DLKA 4OI0A 1JEQB 4NCIA 4EGSA 2ADFA 1VKJA 4QBTA 1BJKA 3HJTA 2DPLA 4MROA 4HVCA 5A5FA 4KNWA 1DCTA 1JECA 1O97C 4YDSA 3TTYA 3QKWA 1GV0A 3RVLA 4YX9A 1XJ5A 2BTQA 3KXIA 3U6BA 3CMCO 3U3DA 4OMUA 3PNSA 3ZV7A 2PHZA 3CO0S 4UM9D 1G8AA 4TL9A 4EQ6B 3I1JA 1WNFA 4UTVA 1CUHA 4CM9A 4DZTA 4S1VA 1Z16A 2RGCA 3FNRA 4N1AA 1ODTC 4TLAA 1GPH1 3WZLA 4A27A 1Z2AA 3CEMA 5DEIA 3DQPA 1TT7A 5LKRA 2ESRA 3JZAA 1H2EA 2JFOA 4LNHA 4BJ5A 4HWGA 4QU0A 3SZRA 4F3CA 2WJWA 3QYAA 4EAQA 1SJ9A 1TC1A 3GCDA 3VO9A 3WDKA 1Z5ZA 2BGLA 3DQZA 2D8MA 3TIFA 9ATCA 4IOLA 3TTSA 1QFSA 3KD3A 4OB6A 4AXBA 1OYWA 2C9YA 1SUBA 3NCTA 5TC4A 3IDSA 2FWMX 3H83A 3ML1A 3EEYA 3N2ZB 3ZJYA 1T5BA 1YL7A 4Z2YA 3HUTA 5KTPA 4KQXA 3AJAA 4LKOA 2J32A 1ZUWA 1W2GA 3OZUA 1J90A 4BFCA 1MIOB 1V5WA 2F1JA 2VQ6A 3MCWA 4QYIA 4Q9HA 2IUUA 2X8BA 2F3UA 5CFZA 2CNLA 2UVPB 2HF2A 3FYUA 3SOPA 3K2BA 4YJ2F 5EKXA 2NU6A 3PQ4A 3Q7EA 3ZOKA 1XZNA 3RC7A 4D02A 2ZVDA 1IPHA 1KEZA 4I1UA 1TUEA 4DMLA 5JAIA 1IULA 1VIVA 2B3DA 3JQ6A 4FNMA 1CX9B 4FB5A 3A1EA 4CR6A 4EH1A 3H8SA 1X3SA 1FUEA 3D8RA 3LVFO 3NHMA 1NGSA 2ZOSA 3C97A 3O4IA 4HAUA 4HDNA 2JBAB 4MRAA 4WDRA 1T36A 1W29A 4DG9A 3NDIA 3G89A 1V1JA 2AN9A 5CUQA 5A62A 2UUBB 3V4SA 1DBRA 4LIPD 3CNQS 4DNPA 1JAIA 1KYTA 3IULA 3EIXA 2A9RA 5A06A 3LFHA 1E2QA 1E20A 1Z33A 3GNQA 2WDPA 2PX8A 4IWXA 1K92A 4J2OA 5AOAA 4AMYA 5AVQA 1ZNXA 3FAZA 4RO0A 4XVUA 4UFNA 3RR2A 1AHNA 4EWLA 4IJMA 4W5QA 4HT3B 3MB5A 3C3XA 5T4EA 5F21A 2H4XA 3A4YA 1Y7TA 4CT5A 1PQYA 1Q2UA 3ADOA 1SKQA 5LWHA 3S68A 3P32A 4GPIB 2YNMD 1F0YA 1L5LA 1HZZA 4A10A 1Y0BA 4MARA 1QS0A 2PJUA 4QNMA 3TEJA 1IB0A 2YZ7A 9LDBA 4NE9A 5H9WA 4PN3A 4P80A 1U2GA 2HYIC 4ZP1A 3HH8A 2OFFA 2CXXA 4CV1A 4F2GA 5IKMA 1PW7A 4UZEA 1CS4C 1S8NA 4P58A 2HRDA 1RWPA 3FHJA 3NTQA 3T5GA 2P11A 3R7NA 3DPIA 1SVUA 4BB0A 2VLIA 5DGDA 1YCFA 3P2EA 3UY4A 1VPDA 2HPHA 3K09A 4GGMX 7YASA 3UJBA 1ARZA 3ICVA 2BR4A 4ILEA 5H02A 3OZCA 3GLGA 4LAFA 4R7TA 2QTVA 1W75A 1SXJA 3QKTA 4DJTA 2X6QA 3ABIA 4Z99A 4D9NA 3VPSA 4F8YA 2HIAA 1WTCA 1XZBA 4TM7A 4MJ3A 3I30X 3GVPA 5DBFA 2P1ZA 4EFNA 1AA6A 5EUQB 3ZJ4A 2H2DA 2E4ZA 2FSVC 3DL7A 3FUXA 1GY8A 1PX0A 2P6RA 2O48X 3DTVB 2NYVA 2RHHA 2Q21A 1HF3A 2K7ZA 3HKDA 1G6HA 3BRSA 3PJDA 4UDOA 5FPYA 5K0ZA 1QYXA 1RCFA 2BFBB 3OZEA 4OQ4A 4QUAA 4ZTUB 5A9RA 3E18A 3MRXA 1ADGA 5FUQA 1KO7A 3O03A 4HN4B 3OT4A 4J07A 3TMAA 1WEKA 3E82A 4FHEA 4BNYA 3OPQA 1DIAA 3PFGA 2BMDA 4RHEA 3R9IA 3JQPA 4EMSA 4ZOAA 2WPDD 5CYOA 4MI6A 3DHWC 3UT6A 3NH9A 3FB4A 3K0FA 3EXFB 4IM7A 3SZMA 2XA2A 3UUFA 3F73A 1LK5A 1RE0A 3GJRA 1CF9A 4NX2A 1YK0A 4DR3B 2VPWA 2PNJA 2ORIA 4UVEA 3ZBTA 1D9XA 1R18A 3QU5A 4JSYA 4LMBA 2DR2A 3ICEA 4POAA 1CKEA 2ZDGA 2Z1NA 1T0IA 3UAGA 1PFQA 4TS9A 4PNEA 1GTSA 3W8RA 3HFGA 2W6QA 1FFAA 4JLBA 4O4LF 4FCWA 1SVNA 3QUAA 3EMKA 5F7ZA 5KQLA 2P5SA 2RKWA 1PZHA 3IAUA 3PGMA 3BHMA 4JEHA 1IFXA 2ZTUA 1JVBA 2J3IA 2JRCA 4FDTA 3AIMA 5FL7A 1SXIA 4G86A 2GN0A 2ANBA 4RTNA 2R751 2ZW9A 3CEHA 1F4PA 2O2CA 4MIEA 3W77A 3NBZC 2O3QA 1AKWA 3EJ6A 2DKOA 4QOIA 3SOOA 1P9OA 5IKOA 2YJGA 1DO8A 3DOEA 3GG2A 2QD5A 2LCIA 3OY2A 4IXWA 4JELA 4LECA 3NT4A 3RF7A 1DELA 3QF4A 4EDHA 1W7AA 3L93A 3QTBA 3N2NA 1EDOA 2F1KA 1ZJ6A 2QMEA 3EC2A 1OVGA 3BZBA 4H7DA 4C04A 2RHDA 1Z5VA 2UVDA 4OP2A 3W1EA 5AHKA 3OTOB 2D0DA 4MGEA 3T7TA 4DCJA 3W06A 1RJDA 2E9SA 4A26A 3NORA 4Q7JB 1OAOC 5JCJD 1K1EA 2BWJA 1V9LA 2UZ1B 3MOIA 2WG0A 3ENQA 5TQ2A 1VLHA 3RU3A 2VTVA 3QBJA 1NW8A 4UNQA 3MRSA 3UXYA 4A2WA 1SUAA 3C5HA 3FLBA 221PA 4CKWA 4F7DA 1JHUA 4H18A 4UCFA 2XODA 4BFXA 1RPJA 1T2UA 1TTHA 1XRSB 4Q9AA 4ZYVA 2RGUA 5AICA 4AWBA 2YN0A 3RVBA 2PS1A 2BEWA 2X9GA 2RK6A 3B53X 2YMLA 3MCTA 2ZAIA 3N8GA 2NTEA 2UUOA 3QU9A 1FFXB 4IIEA 3SHOA 5B1SA 3ZWCA 1V8DA 2RGRA 1OXSC 4LWQA 4EFDA 2VRWA 3P2MA 1EK0A 5DJ5A 5K51A 5AW0A 4Z3DA 2I4LA 3RAPR 2VJKA 1Z6GA 1QWSA 2Y0EA 4P4GA 3PL1A 5B1EA 2I4RA 2FUCA 3VYWA 1S5PA 3WIUA 2G7MC 1OI2A 1ORRA 1G3IA 2GT1A 5JSFA 1T8PA 4XARA 2D62A 4BV8A 3NT2A 4GUDA 1X2EA 1CZHA 4J91A 2XZDA 2R6GA 3B7WA 3EVTA 3I28A 4OY3A 1DRJA 2WAXA 3THXA 4X6XA 4AF7A 1LVGA 3B9QA 3GL9A 3OFVA 4GNKA 3ZE7A 3DW3X 3P94A 5EP1A 2LRHA 4C0HA 2ZDHA 3EIFA 2BBSA 4JI5B 3TQQA 4A36A 1UMCB 2VDWA 3FB1A 1S3GA 3KDAA 4IYJA 2ZPTX 2UYCA 3RT9A 3U4CA 4HH0A 5JALA 3ICOA 1X7HA 1PCXA 4KAXA 4O6VA 5LXTB 2ZPAA 2R0QC 2PWYA 2KSQA 2Q5OA 2CBZA 4PAGA 4DNXA 1JSZA 1NAIA 1Z88A 1TK9A 2W2KA 4YWHA 1U5BA 2IXAA 3LPLA 3BD7A 3T3IA 4NBVA 5TQJA 4CM4B 5BWCA 2IPNA 3FW1A 2JGAA 4GKVA 2XECA 3O7WA 1YB4A 1K7YA 1X7DA 2HDOA 2IYZA 1G6Q1 4UHJA 4DZRA 4LYDA 4ERXA 2XVXA 1PZFA 1I3CA 4RA6A 2NU8A 1FDRA 3ESZA 4FNOA 1Z5PA 4PG8A 1M34E 2JAWA 1GTG1 4PQEA 1GPWB 4YFVA 1W87A 2CJWA 4XDGA 3GROA 3VAAA 4KQFA 2BM9A 4Z2AA 2JGJA 3B9BA 1HV8A 1OWNA 3WJ2A 2JJ2D 1C1HA 1DIBA 1QRRA 4W7HA 4C4YA 5IABA 2VHCA 2VWGA 3ZQ6A 1WMEA 2WHRA 5AK3A 4D46A 4BY9E 2O8EB 5H16A 1GN9A 3LO5A 4ZOLF 2HYDA 1RTKA 2WTBA 4G5HA 3KAPA 5JVDB 2RBKA 1MMFB 2BHNA 1P0CA 1L5WA 3OQHA 4DM7A 5BV8A 2O0JA 3HRIA 4I55A 4U5XA 2J67A 3S7ZA 5BMVA 1ZFNA 3LRTA 5JMOA 5C51B 1LCIA 4L4RA 1TO6A 2GF2A 1ODKA 3BTUA 3M83A 2VJPA 4HMPA 4ALJA 3KQKA 2I9PA 3LPDA 1I7NA 3E5MA 3GFGA 1NW9B 1ZI6A 1EH5A 1ZONA 1E1RD 4JENA 1G6OA 4JVMA 2ZJ4A 4AMUA 4XJSA 5TB5A 5E9WA 4B9AA 4DUPA 2WWXA 1Z2NX 4ARAA 4WJLA 4C0SA 1AGNA 2QP3A 3KYJB 2CB9A 2IXEA 3IQZA 2G9QA 3HR4A 3V7YA 1AQJA 4BMZA 2C8KA 2FTKE 2PYZA 3MPUA 2W83A 3QHPA 3OTWA 2ZQYA 2QAIA 1Y5NA 1JFFA 2J31A 3JWEA 4XSHA 5E4FA 3HEMA 1NX9A 1DBQA 4QJ4A 4WK2B 3O4FA 4DREA 4OXYA 1Q20A 1JHAA 2I3DA 1QLJA 1RC8A 4BTVA 5TEVA 2YWGA 1YRHA 3KAQA 4G4SP 1N6IA 4A5SA 3GN1A 4D9JA 2JEYA 2HA4A 2NTVA 3WNDA 5K01A 1E2FA 4RZIA 2QUZA 3Q5GA 2EF1A 3E53A 2IUYA 3OX4A 3G0OA 4BQEA 2WUEA 1PQWA 3E84A 3KWLA 1N25A 3MCUA 5L51A 3QJGA 4C07A 1C0LA 1NU6A 2JS7A 2HBZA 2P2LA 4RD6A 5JS8A 3T4UA 2AC4A 4Q16A 1E2BA 1WW8A 4A1FA 1EK1A 2AK3A 2VQSA 2F17A 2YVQA 2I6FA 4KVAA 3WLFA 5ICMA 4NXMB 3BICA 3KYIB 3AHCA 3EBLA 2CLHB 4K26A 3QKSA 1OA0A 4DLWA 4Z9BA 2JFNA 2Y77A 3BH7A 1G5IA 3WYEA 1BO6A 5AR1A 4NBTA 2JFVA 2GVDC 1L2TA 5AJVB 3M3PA 5LP6C 4JYZA 1H8EA 3WLAA 4JXKA 5CA0A 1TUGA 3WJAA 4EF4A 1ECJA 4DNFA 3C8ZA 2GKSA 2WU8A 1JZTA 2AJBA 4H6WA 3KEOA 1H6CA 4OI4A 3SU8A 3R0ZA 2VK8A 3CB2A 4YDQA 5HZMA 3KQWA 5JSHA 1V5EA 1SCJA 2A4KA 2Q46A 3S5UA 4MWGA 4HQNA 5B4VA 4CNBA 3TE6A 1A9QA 5EYPB 2IJGX 1KVRA 1U0SY 1YAHA 3FBGA 1GHTA 1NN1A 3KLPX 4K0KB 1AIPA 3IELA 4XGNA 3WK7A 1R9GA 5DK4A 1ZSNA 3BAZA 3ABQB 3JALA 1JHYA 2JLYA 2GHQA 2FZLA 4JV5B 5AH0A 3S70A 4ZZ1A 5D1HA 2GILA 5CBPA 1YR9A 3Q7QA 4LF9B 5KDLA 1V45E 3K9FC 3MM4A 1WCYA 2JHAA 3M6MD 1JQBA 1XTQA 3O6VA 3ZWYA 1EFVB 4MUIA 4IZIA 1T8TA 2GESA 4BWFB 3C4VA 3GCGA 4LY3A 1XG5A 1RW4A 2HCBA 2FZCA 4PWYA 2WM9B 1ODLA 1ZUD1 2QD1A 3I52A 2C5GA 1QHXA 1YB1A 3GNLA 2B4TO 3HBLA 4QTTB 1QF9A 3U5ZB 1VE3A 1RPNA 1O9BA 2YY7A 3PGVA 4JBNA 1M6VB 2ID9A 4PYLA 3TX2A 2EKBA 2II6A 2FUEA 3E9NA 1RJWA 2ZYUX 4B4OA 5JEEA 1KO4A 4O08A 3V1LA 1DU4A 2XA1A 3K0CA 4AWAA 3ELDA 4S24A 4C3UA 3K1AB 4Y6GB 4FFPA 3OFKA 4TRRA 5BN3A 4B45A 5JYCA 1NUTA 4HZIA 4XIYA 2BE7A 4FKBA 4IXNA 4HXGA 4R4JA 2VG8A 3RTBA 1XZFA 4IRXA 3JTMA 2PBRA 2ZI4A 1GKYA 2CUKA 2G4CA 3N58A 4JJIA 3WFJA 4B48A 1PK8A 3FTDA 3K0HA 2I3BA 3DCJA 2CN1A 3GLHA 4LPKA 2JGDA 4FMCF 5LIRA 5K8CA 4GOND 4KLAA 1P7VA 2G6TA 1SA0B 3W6OA 3PPXA 3UV3A 4AP6A 3LHSA 4TS3A 1WDKA 4MRNA 3UOGA 3HG7A 4HDSA 3QNUA 1IAQA 4P6VF 5AO9A 3OU7A 2YJ5A 4ILKA 4GRAA 3KHKA 2AG8A 2R8YA 2QLFA 3C14C 5A7HA 2RGYA 2VR1A 2VYND 2DPXA 5HK9A 3MGAA 3CU5A 2CLCX 2XMGA 4OFWA 5TQVA 1ZUNB 1Y80A 2RK4A 3L4KA 5DHSA 4EPTA 5HQ3A 1N0HA 1CNEA 1U2EA 4E4YA 2YHAA 1E3QA 4RKRA 1LGYA 1L7NA 4Q34A 2DPYA 2BCJQ 4DB4A 2SKDA 3F6SA 4OJQA 3UT5B 5AM5A 1ESMA 1NXQA 1TJNA 2IA5A 3Q0EA 4ARCA 3V2GA 2CW5A 2IX9A 1GCIA 1II0A 1QE5A 3SXPA 4CIAA 1WXHA 5LMNB 2ZRFA 3I9V1 3W3AD 4BGDA 2A33A 3GJZA 3QXGA 4X1KB 3A36A 4BGUA 4LE0A 4GM1A 4UPEA 1PJTA 3BXEA 2BZSA 4I3FA 2FOXA 3V4OA 1Z4NA 5DX1A 3WIBA 4AZSA 2HB6A 1JJVA 4J4HA 2Q29A 3O31A 4DIKA 1Q7BA 4LPSA 3ZX5A 4AJIA 4BBZA 4KKVA 3GGGA 3ITNA 4QFCA 4HEJA 2G80A 3N75A 1CEEA 1GL9B 3UTDA 2QM8A 3JRNA 3LYLA 3RC1A 5DYWA 2OQ2A 3LBNA 1CUBA 3DGEC 1FBNA 2BFFA 2HTEA 4FC7A 3LA8A 4QA9A 3S2UA 1U9IA 2JLWA 5BUCA 2W5UA 5IEBA 5JEDA 3PEWA 3DE5X 2JI9A 4ZI3A 4BMDA 4J4TA 3FSJX 4BASA 4WFIA 5BNWA 3VU8A 1C4OA 3I04M 2ONYA 1H4QA 5LA6B 1T3HA 4AJHA 4P31A 4YCJA 4DV0B 1W5FA 5IANA 1WCV1 3AG6A 2HT1A 4NBNA 4QVIA 3BK7A 5MFZA 1DC5A 5IEJA 2R96A 3ONFA 2I22A 4LK3A 3E7FA 4P32A 1UJ5A 2OYCA 3IHWA 4HTFB 2JH8A 3QWBA 3ZZ0A 4F2PA 2XZOA 1XGKA 3GT3A 3ORHA 4C2AA 3JX9A 1YZUA 3CR3C 3CMMA 5BR7A 2CL6X 4IBOA 4DDVA 4HN2A 3IJEB 4UDNA 2JHCA 1S7CA 3AMVA 3GOHA 1E6EA 5CHYA 4YP0A 1HYGA 3B38A 2G83A 4UM8B 4BO0A 4QOGA 3N6VA 5L3RA 1ZRNA 2FV8A 3U0BA 4I4TF 5AD1A 1SHUX 3PXXA 4BMPB 1SURA 1THZA 1NMSA 4OLJA 2BKLA 3ZCVA 1SZCA 3ZQ4A 3PNYA 4DUZB 4KMSA 4R9NA 4UXJA 5AYVA 2TMGA 3ZDZB 1U7OA 1ESZA 2FYTA 1Z8HA 2ACVA 4FQ8A 2ES4A 3M33A 4IIXA 4PPNA 5KYVA 5LLSA 1X1EA 4J43A 1IC6A 1SUIA 3DW1X 2IF2A 4S1OA 1TPZA 4Y7CA 2IHNA 1B8UA 1U98A 1EWKA 4JFRA 3K1TA 2PUJA 2QVGA 1TF7A 5AUPB 3F3SA 4PHHA 4FHZA 5DLPA 1Y34E 4QPNA 1WVGA 2VSFA 4DLPA 3PL5A 4E30A 1HFKA 3TRJA 1ISPA 1S2MA 3MCZA 3WADA 3PUXA 4DSTA 5B57C 2YWJA 2WQ7A 4PYNA 2BVNA 2AJDA 2HDWA 2C5FA 3RPEA 1K2WA 2F9LA 1P17A 3W9SA 1TLFA 1NJFA 1AKRA 1WY7A 5B1YA 4EUKA 1A3CA 2NZYA 3KLMX 3HKCB 3HN7A 4PO1A 1K9SA 1UC9A 2GCOA 2Y68A 1OT3A 5BRAA 5BSHA 2UUAB 3OHSX 5C5IA 3LKVA 4CQMD 4K9KA 5F12A 3FPLA 2O0LA 1CUXA 3MWJA 5IWAB 3QKUA 1QAQA 1O6CA 3P52A 4LYJA 1KSJA 1N8SA 2A35A 4B3CA 4L16A 5G0SA 4Y6LA 5D84A 4EELA 1OH5A 4YAFA 4N6NA 2H1FA 1VLQA 1FMJA 3AHHA 1QRUA 3GFQA 1I8TA 2OG1A 2IYAA 1R4ZA 4BEBA 3T5AA 1B7GO 2CSXA 1HNWB 5CB4F 3OM0A 1BA2A 1WF3A 4GDFA 2YIJA 1ZZEA 2G9RA 1UBLS 4G9GA 2QMHA 3OQPA 3EXHC 3TLYA 4DJDC 5TMPA 3VKWA 2ZBDA 1RXYA 4UBKA 3VFDA 1JR4A 1XWIA 3Q9NA 1VCNA 1YGYA 1BE1A 1YDEA 4D4GA 1CIJA 1PEDA 1CYDA 1YHNA 4KPYA 3R7WA 1W0CA 1X70A 4GMFA 3P9KA 1X7YB 4O4JB 2IY8A 1NW7A 4PYIA 3EGDB 4LJRA 4CMGA 3P4YA 3IP6A 2GYYA 4TMWA 2ZJ7A 2QX9A 4CV0A 1N7HA 3ZX4A 5K0BA 2V1UA 4CLRA 4IIYA 3L0DA 1Y4DE 2ZK7A 4R2XA 1KL7A 3KYDA 4LNAA 3FOAA 3URMA 2D5AA 4R1PA 2D4AA 2XB4A 1FDWA 5EIFA 3NDJA 4EPXA 5EWJB 1ICEA 1PR0A 1C30B 1QUEA 1XAJA 4MX8A 5FJIA 4EHKA 3MW8A 3DEKA 3BJMA 4IHQA 5I01A 2QSUA 4YS6A 4LWPA 4JJ6A 4Y8VA 5FA5A 1QVAA 5D87A 1U6KA 4XGQA 3X44A 5ALRA 5FUMA 1U7XA 4F97A 2HFKA 2JL1A 2QTBA 3UUGA 3U0VA 4F93B 2YQZA 4W5WA 3G59A 4Q1VA 2QRQA 4Z54A 1T0BA 2A9QA 1QPGA 2FSGA 3IOBA 5SY6A 3ZBQA 1H6AA 4TMXA 4AKGA 5ADUS 1TCVA 2QUIA 3EIOA 4QNNA 4CMHA 4DWOA 5A4JA 1IHXA 4QRDA 1GU7A 1Y9DA 1GUFA 1RYZA 1X38A 4Z53A 4OJTA 3SHWA 4OU4A 2PUVA 1IH8A 4OX9B 5DT9A 3NJRA 1XF1A 2HLDD 2P0AA 3A6LA 3IDQA 3K35A 5FOUA 6PFKA 4JZYA 3B48A 5EHGA 2AEJA 1BHQ1 4Q15A 4LX8A 6GPBA 1CVLA 1W5BA 3ASZA 2DH5A 2LKCA 2PR2A 4BX3A 1C7EA 1DADA 3RS5A 1T3LA 1MIHA