2ZRCA

Msreca q196n form iv
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 89
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrcA01
1N3BA 4NDZA 2O0HA 2W2XA 2LKCA 4YXWD 2B92A 1LVGA 4D0NA 4OQXA 4BFYA 2DYKA 2GXUA 3KXLA 4DEYA 1IAQA 2IYVA 3C8UA 2MSEB 4GOJA 5EE5B 1X1RA 3X1WA 3ZH9B 1PLJA 5EUMA 3KQHA 5HCIA 4B71A 2AKYA 4Q1AA 4JSYA 4UXJA 2WOJA 5JZVA 3R7WB 4XD7D 3RSLA 4TMKA 3I1FA 1R6BX 4RCZA 4QGFA 4K81B 5AWFC 2F7SA 2MMCA 2F3TA 1KZGB 4QBFA 4NYIR 1XFAA 5FPHA 3L0IB 2RGDA 5A4JA 1RYHA 3LAWA 1KSJA 1KMQA 1XDBA 2C03A 1D2NA 3A1VA 1TQ4A 3A4NA 3VU9B 4C0AC 3DEFA 4BFVA 4ZI2A 2G6BA 5KDLA 4C3ZA 1XZPA 1P60A 2G88A 4KYUA 3T35A 2BM0A 1KY3A 1V43A 2ZYWX 2WMNB 2AR7A 3R8CA 1E99A 1GAJA 2O8EB 1MV5A 2VRWA 2ZS8A 4OK6A 1H8HD 1R7RA 3ZGXA 4CIDA 2IYYA 4JKIA 3RS5A 5CLQA 1E79A 1G9XA 4ZCMA 3FHTA 2OXRA 3SC3A 3RRZA 1BO6A 1IN5A 1Q44A 1CTQA 4G5OA 2V7QA 2NO9A 2WJVA 4A0GA 1ELOA 1Z6XA 2AXPA 4MRSA 4AC9A 4BUJA 4JJZA 4V0OA 4NE2A 3EPKA 1MOZA 4GMDA 5BXQC 1YQTA 2OO7A 4A2PA 4DHEA 5C2JB 2IX3A 3I61A 4OL0A 5HR5A 2R6AA 3KXIA 1N6KA 2HJVA 1AZTA 3EAQA 1E2EA 4LOAA 5EP1A 1X6VA 2ZSBA 2WIBA 5IRCD 2BKUA 2WIAA 1EXMA 1AQYA 3NIBA 1ESNA 1JXOA 4I1VA 2O5VA 2KE5A 4Q19A 5G41A 4AY2A 5FBVB 1XB2A 2XAUA 4U02A 3WYFA 2HUPA 3AP1A 1CJTC 3FHOA 2PEZA 3P20A 4XVQA 1ESMA 5CM9C 2BVNA 1DE0A 4DDWA 2IC5A 4URVR 3LBIA 4TQUS 2AX4A 3BK7A 4LPKA 2R65A 5ANRB 4MKFA 3SHFA 1FNNA 3LRPA 5FOSA 4KLZA 2JCSA 1Z5ZA 3JZAA 3R20A 3V9PA 2B6HA 1HY3A 3AUYA 4US0R 2N46A 2ZVQX 2V1UA 1NBMA 1UKZA 3FMOB 2IYSA 3QBTA 4I1UA 2QTFA 1XD9A 4PPGA 5CB8A 2QBYA 4V0LA 1JXMA 2RGNA 5JSZA 5L3VA 1CEEA 1NKTA 1ONBA 2O8CB 4RD1A 4G0NA 2ZJYA 3T34A 4OI4A 5IK2A 4A0HA 4RZ3A 2V1XA 1SQ5A 4Q4JB 2QSYA 2GZHA 3IDQA 4ZDWA 2O52A 5K8TA 221PA 3BGWA 2Q21A 4QBHA 2JAQA 3DKPA 4HEJA 2BCGY 2ZR0A 4IEEA 4QM7A 2ZRDA 1US8B 1YR6A 3KJIA 3MCAA 2FOLA 3THWA 1G21E 4B75A 4RD4A 3AGQA 2KB0A 3RS7A 4A9AA 3CUEF 1N6LA 3SFZA 3TQCA 5FPYA 3M6AA 4DUGD 1Z6TA 2J59A 1P3JA 3VTKA 4Q00A 2ZITA 4JLVA 5FUYA 3VKGA 4FN5A 2OLKA 3BE4A 2DY1A 3PFIA 3KL4A 2B21A 4G01B 2GAOA 4HUQA 2OZEA 1JBKA 4KU4A 1S9DA 5FI1B 1W36C 3DKVA 2FH5B 1G7CA 2IXGA 3AM1A 4HYYA 2GDJA 3ZYCA 3LA6A 1Z0AA 3KQUA 2XZPA 4HLDA 4EPWA 5J4YA 1GRRA 4B48A 2QAJA 2FEOA 4Q9LA 1I2MA 3SN6A 4Q9KA 3O8CA 2JLWA 3U3KA 1EFTA 3NH6A 3WRYC 2QE7D 1KI6A 1SKYB 1YR8A 3L82B 3ICQB 2ZRLA 4DLRA 5IHPA 3AVPA 3MFYA 3ASZA 1VG9B 3VNUA 2ANCA 4QHSA 1NY6A 3KX2A 5FPTA 4DB4A 4LHVA 2X77A 2OE2A 2VPPA 3L2OB 4DBLC 2DCUA 1V5WA 2O8FB 2AFHE 3ZVRA 4B33A 3DMDA 3B9QA 4A36A 2ODWA 4BEJA 3AF2A 2ZJ5A 2P3SA 4RCYA 4KBFA 1G8HA 4MGIR 3CX6A 1KJYA 2AFIE 2VYFA 2I3BA 2OXCA 3EZ2A 5FTLA 1ZCBA 4KJZA 3O8BA 3OIUA 4M1WA 3B1WA 3KQKA 1OB5A 1BS1A 1H8EA 3SE0A 2GJAA 5JCPA 4IJMA 2QL6A 3T1QA 4LWZA 4V0NA 3UKDA 5EP4A 4TYQA 2FPLA 2ZIAA 3P32A 1FQKA 1OFUX 3AF1A 4L9SA 2IYLD 3K09C 4JKYA 2BEJA 2VP5A 2ZR9A 2ERYA 4LBYA 4RD2A 4F92B 1KO1A 1G16A 1CRQA 2B7CA 1GM5A 1CJUC 2XOKD 2PJRA 3LVRE 2VSXA 4R2IA 3V4RA 3RS0A 3G5UA 2PZFA 3OZXA 2GJSA 1KDOA 4NONA 4LJAA 3B78A 3KKMA 3THOA 4IVRA 2XZOA 1F60A 2JLUA 4FCWA 3FMFA 3UANA 1FX0A 4F4JA 4PSAA 1II0A 4QGGA 2F1IA 3PQCA 2QENA 4LYJA 4XJXA 3FPAA 2IF0A 1W5SA 1KO8A 5HE9A 2I1VB 1XX6A 5KNBA 1FP7A 1W48A 3CPHA 4WA7A 1YR7A 3FOZA 1NMZA 1TU3A 5DO9A 1VHLA 4DLTA 1QG2A 4HUTA 4DCTA 4Q7LA 2QZ4A 4UNNA 2E87A 2IYRA 4UNQA 3U3MA 3QPVA 4KITB 5FPSA 2QT1A 1E2QA 2QP3A 1F5NA 1T8UA 2OHFA 1CS4C 1TNDA 2YC4C 4OYHA 5EP2A 4QGHA 2ZI7A 3RRMA 1VYTA 5BQ5A 1T4GA 1SVSA 2KJQA 4QC2A 4KFTA 1XF9A 4OI0A 3ZVLA 1J70A 4ON9A 4HB0A 4PC6A 3ADKA 3IPXA 1XTSA 4PXAA 5FL7A 4NYMQ 3IQXA 1JPJA 1N0WA 1F3OA 3B6EA 2W2TA 2OG2A 3FDIA 5CB6A 4FWIB 2ONJA 5KPDA 2O8DB 3F3YA 1XTKA 5LBIA 4ZDKA 5G53C 2OFXA 4H1VA 1FX0B 5GVRA 3AQ4A 3TGPA 4IDHA 4M9QA 3FFBA 1OLOA 2RH5A 2QRZA 2QE7A 5FOUA 3W5JA 4YDHB 3U60B 2ZSFA 3QXSA 4XVUA 3AVXA 1Y3AA 1W5TA 4TZ0A 3MUFA 1U94A 4CEJB 3L43A 4E07A 1NG1A 3B1VA 3FWYA 1U0HC 4D80A 2V55B 5DI3B 1OXXK 2QORA 3T15A 4KLNA 1E9AA 1GNPA 1JJVA 4M8NE 4D4KA 1JI0A 4MKIA 4LV8B 1QDEA 4GNKA 3R9IA 5E3HA 5D3QA 1ZU5A 3A1TA 1D8TA 4WIAA 3AKDA 4HZIA 2BCJQ 1AJEA 1GIAA 4CVNA 1Q12A 1R0WA 1W44A 1J7KA 1AIPA 4YLGA 3Q7PA 4DDVA 4URXR 4QOSA 1QVRA 2ZS9A 1JR3A 1NI3A 2WZQA 1PUJA 2YWEA 4TSFA 4A6PA 2QNRA 2REBA 1Q0UA 3K1JA 1ZBDA 4FD2A 4ERNA 4HDQB 1N6NA 3VU9A 3TW4A 4TLCA 3ZD7A 1UDWA 3EXAA 3DL0A 1RZ3A 2JASA 3R9XA 2GVZC 3VR6A 1MRNA 1II8B 3WP0A 1KO4A 1DTSA 3KB1A 3G82C 4HZUB 1XEWY 3OE7A 3L0PA 3RVBA 1W0KD 3U7FB 4Q9IA 3QPWA 2FSIA 2PMKA 1Q20A 4J0QA 4EJSA 4CF7A 1OYWA 5JJIA 2J0UB 3TJZA 4EPRA 4MRNA 3CRW1 1G4UR 1E2DA 3PJRA 1TU4A 5BYKA 3BH0A 1PLLA 2OEPA 1KI7A 3EC1A 3HJNA 2WJHA 4GZLA 4IFBA 4DSNA 5B57C 3GJ7A 1LS6A 4D4MA 1KI1A 2IHYA 3Q8XB 2BIFA 1DARA 2IEZA 1OPXA 4B2PA 5CYPA 3NTUA 1XRJA 4LRWA 2OFWA 3IILA 1GITA 1KNXA 2VH5R 3O8DA 3UATA 3VMFA 5A5GA 2GJ8A 5KSZA 3QKSB 4UJ5A 4X8HA 4PR0A 1ZAKA 2QRNA 3GLFB 2F6RA 4KFRA 4PAQA 3VHXA 2P6NA 5KUTA 3FMPB 1NJFA 5JRZA 1CR2A 3EC2A 2XSZA 3K9NA 2WWYA 3CKLA 5E7MA 1KK0A 5DN6A 1XJQA 3C7KA 3NBYC 3GLIB 3THWB 2NO6A 2BM1A 2ONKA 5FBWB 2H1LA 4HB2A 1G3QA 3KDSE 4FWTA 2OESA 4US1R 4B47A 2YOFA 4M0LA 2ZQ5A 4AYTA 1GKUB 1Z3IX 1ZINA 2IF2A 5K8IA 4MYUA 3Q72A 8OHMA 3THYA 2O8CA 1SXJC 2RHMA 4BLTA 3DHWC 3GLHE 2JJ2A 4RZUA 2OAP1 3VR2A 3FGNA 1UPTA 1SKQA 4P4TA 2IW3A 4EIWA 2D4HA 4DCNA 2EW1A 1TADA 3CR7A 3EA0A 3U44A 2PZGA 1L4YA 1CJMA 1US8A 2GKSA 2IUUA 1OV4A 2G77B 2VL7A 3RS2A 1R0XA 3AH8A 1NKSA 4O2LA 2ASEA 1OFIA 2DFKB 3A37A 4A2QA 1G5TA 3ZZUA 3HDTA 2VP4A 4DLWA 1Q21A 1LF0A 1UFQA 4GSYA 2QPAA 1MO4A 1ZNYA 3QUSA 1HH4A 4JT4A 5LPNA 1Z83A 4TL8A 2O8EA 1ZIPA 2WMOB 1COWA 2VTKA 2OV2A 3ASYA 1WQ1R 1QHYA 4TSFD 2GWHA 1SVOA 1KHTA 4WXRA 3KUDA 4HAVA 3K9GA 3T1VA 5EXPA 3CRVA 2J7PA 2NO1A 2WWIA 4IHQA 3TR5A 4A8JA 4I4LA 3FKQA 4KYIB 1WRBA 1XXHA 1LFDB 1KDTA 4GI7A 4M1OA 4BGDA 1M6NA 4LYFA 3I92A 5CITA 2QP4A 1JR3D 5IK2D 4C0KA 1RFLA 3ZDQA 2A9KA 2YYZA 4PQYA 2WVJA 1UEJA 1KKLA 2CHGA 2IWHA 3ZVNA 4OBEA 1T3HA 1G64A 1PV4A 1SXJE 5HE8A 1W2HA 1KSHA 3U44B 1FFHA 1L7VC 1K5DA 1KKMA 1AKYA 3A8TA 3GCGA 4R2HA 3KQLA 3WMFA 5TMPA 1NSTA 3QJYA 3ZZ0A 2RAPA 1FTNA 1R4AA 1UKYA 2E1RA 1JNYA 4BWYA 4EFMA 3I8SA 1QHHA 2PX3A 3TSWA 2QA5A 2X2FA 5B2ZA 2QAGC 4XWAA 1IY2A 4ZDIA 1JR3E 5JWHA 2BMJA 3GJ6A 1SULA 3MWJA 3KKPA 5GJWC 3T5GA 4QXAA 1Q22A 2YV5A 2A5JA 4LBWA 4MRVA 3IBYA 2CCJA 2X1VA 3HPQA 4ITRC 3BH6A 1W0KA 4GT1A 3WYAA 3K0EA 4PC1A 4A1FA 3D7MA 1NMYA 4M1TA 4URYR 3VFDA 1XJ0A 1N6RA 2JEOA 1I4DD 3EASA 4DIEA 2VP2A 1YZQA 2AWNA 2RMKA 3SFVA 3I62A 2H18A 2EFGA 2GTPA 1G8PA 5KTYA 4AYWA 3CZPA 2A5YB 3QEOA 4ARZA 1BOFA 1ZM3A 4PO9A 2QT0A 5KSPA 2CLSA 4UNRA 1SVKA 4AG6A 1UAAA 1KNQA 3KJHA 4EDHA 5CDFE 3TNFA 3CX7A 1NRJB 1WXQA 2Z83A 4OKSA 4UKDA 4C9BA 1HQYE 2FU5C 1G41A 1TF5A 3BXZA 2ZM5A 5JECA 2ORVA 2WKQA 3F0TA 4NU0A 2GCNA 2RGNC 2ZSAA 3C5HA 3ND8A 2PMDA 4NKRA 4ZCLA 1BMFD 1NLZA 4DWJA 4M1YA 4FINA 2LKDA 2WM9B 4HAWA 4LX0A 4M9ZA 4URUR 5FOXA 3SBEA 3B8HA 4C30A 5AUPB 4NBSA 4Q21A 3NVAA 5J4HA 1LW7A 5FPKA 1J90A 3C14C 4UXIA 3Q3JB 1CULC 3MGCA 4OJQA 2WAXA 2QPOA 421PA 1RRCA 1QHIA 5FBRB 2O8DA 4MA4A 2KSQA 2IT1A 4W5HA 5IDVA 1DVRA 3AKEA 2JJ2D 2CHQA 1UBCA 2IL1A 3GLFE 5TB5A 3REGA 1J2JA 4TL6A 2QQEA 4HLUA 3Q9LA 3P26A 4JBYA 3KUCA 2XB4A 3R8FA 1QHXA 1TF7A 1S9HA 1U0LA 1YU9A 4WVFA 3CF0A 1IHUA 3THXB 4JL6A 2J7PD 1P2VA 2QAGA 4HB3A 3C4JA 4BE7B 5L3QB 3TIFA 4FIDA 4Z1MA 3SYLA 5GADl 1G8YA 4TMZA 3DM9B 4Y0AA 3TUZC 4C0LA 2C77A 4QNRA 4HLUC 4XSHA 4YONB 1T9HA 3VKWA 1JAHA 2PLRA 3ADBA 1ZM7A 2ECKA 1S1CA 5CM8B 4G5SA 5FUXA 4ASUA 1CJVC 3I32A 1T5LA 3ZQJA 4ZIRB 1QRAA 3CONA 4QJ3A 1ZYUA 2RGAA 2QROA 1XEFA 3LO5A 2ZEJA 3QKRA 1OIXA 1AKEA 2JATA 5P21A 3LW7A 2VF7A 2V6IA 1VIYA 4C2UA 5H1YA 3CWQA 2EFEB 3IEVA 3LX5A 1R0ZA 1LS1A 1XEXB 3CWZA 4RY2A 1G8GA 3UMSA 1EGAA 1NVWQ 1ZD9A 2XOKA 5F2EA 4GFDA 3GPLA 4U7DA 3QBVA 1P61B 4OHXA 1NLYA 2IYUA 3BORA 4GPTA 1G7SA 1KI4A 4WOPA 1OIWA 3WHLA 4MH0R 2R6DA 2OFOA 2X8AA 2JJ8A 1NIPA 3QSYA 1ZCAA 3WBJA 5KNDA 1YZKA 2QTHA 1FZQA 1EX7A 2IXEA 4LDJA 2AK3A 4LHZA 3A58B 5L8VA 1U99A 1YZLA 1XJCA 1KO7A 2Q9BA 4DXAA 1OB2A 1Q1EA 2CLCX 1ZU4A 1W4AA 1E9CA 3X1DA 4AKEA 3NC0C 2XX3A 2ZRIA 4DLYA 1XMVA 3EPJA 3EX7C 4XTRA 2NO0A 3D31A 3IQWA 2P6RA 5J4VA 1TL7C 1H8HA 4JVMA 1TUIA 3RC3A 3EZ6A 3FB4A 1CRPA 3BB4A 2W6ID 1VYVA 2GEVA 3U7GA 1X8LA 5BW8A 5EUQB 2CE2X 5CYOA 1AM4D 1BKDR 2AD1A 5CIWA 1GTVA 2J0QA 4NMMA 5EZ6B 4HAZA 1VYUA 3RRYA 1YZTA 2H7VA 4PQFA 2WSSD 5DH9A 1WMSA 3BBPA 4B74A 2VF8A 4B2IA 4R71A 1IXZA 4TYWA 4TT3D 3TVTA 2GXAA 3LDAA 3QEJA 1GNRA 4POAA 3LNCA 3L8YA 1OHHA 2Z0MA 2C2HA 2CJWB 5FFMA 4X8MA 1HEIA 3RDPA 2R9VA 4Q7KA 4ACAA 4O2RA 4DDUA 4YQFA 2WJGA 3RNLA 1QHSA 3NG1A 3SQWA 1R8SA 1ZMXA 3BFKA 2FE4A 5BN3A 4XH9B 2QGNA 3P27A 3CZQA 3KXKA 2X19A 3SJZA 4QFMA 3WNBA 2BOVA 1VCNA 2YC2C 1BMFA 1P9NA 2WV9A 4EFNA 1Z0KA 2BJWA 2F1HA 2O0KA 3GLGE 2OUKA 5ELXA 1RE0A 3AV0B 2BEKA 4Y0VA 5FTNA 4I81A 3IBGA 1OKKA 3ZD6A 4HSEA 1E1QA 2XGJA 4QM6A 1HTWA 1X86B 2P6UA 3RAPR 1X3SA 2GETA 2OCAA 2BBOA 3MWLA 5JCZA 1XU4A 4Q4JA 4IOMA 1RYFA 2HLDD 2Y8EA 3UG7A 4BFZA 1F48A 2JIZA 1S0UA 1XCGB 1ZM9A 1M74A 2CNWD 1KAGA 3D3QA 3CLVA 2P65A 5DN6D 1XEWX 4JVSB 4LCBA 4F38A 4LJ9A 2R62A 1VG0B 3TAUA 1KJZA 1CR1A 3W90A 2Q0HA 4P33A 1XD2B 1PLKA 2PT5A 3V4FA 3B82A 2EWWA 4TWZA 2BBWA 2RGEA 3CRMA 2VBCA 2ZRFA 3BFXA 1FTSA 3KTAB 3ZIAD 3X1ZA 1KI6B 4E03A 2J9RA 3F5FA 1GKIA 3WMGA 1E0KA 4NCNA 4DSOA 1Z6AA 2C96A 3VNVA 3WYGA 4W7SA 4BRUA 1ZM4A 2C04A 2IYZA 4XTCS 3B60A 4LV5B 1D2MA 5DSZA 3FHCB 4OQLA 1G5RA 2JLZA 3WHKA 3NC1C 2YWGA 3TLXA 3DPUA 5TARA 1VG1A 4ASUD 1A4RA 1NN1A 2IBMA 1WP9A 5EJEA 2CK3D 1NG9A 2OBMA 1UKVY 3CX8A 3LWNA 4TMXA 2PLFA 4C2TA 2H92A 3IIKA 1DO0A 3GQBA 1P2TA 2JDIA 1M2OB 4QJ5A 1U8YA 3MWKA 2QBYB 3WBKA 4D25A 4YXWA 1DS6A 1ODFA 4B43A 3QXXA 2CEAA 4PTLA 1MO3A 2J1LA 2WICA 2GF0A 4PPNA 4P0TA 4F93B 1U0JA 3GLIA 3F8TA 2D2EA 3J81k 1M34E 4JBWA 2KI5A 4NYJQ 4Q01A 1NSFA 1DEKA 2DWOA 2FX3A 5DHFA 2DB3A 2C78A 1P9WA 2IUSA 4I99A 1HURA 3LD9A 3LY5A 3LBNA 4QBIA 2XNSA 4G5GA 1P6XA 1FMJA 3PEWA 1GFIA 3QKSA 4WW0A 3AP2A 1D9XA 1TQ6A 4RFSB 1IJFA 2NZJA 2UVQA 2GJ9A 2FV8A 1JECA 1T0HB 1KI9A 2ZJOA 2FSFA 1VDZA 4DKXA 3R9WA 4PHGA 2CMKA 3NEJA 3B85A 6Q21A 3U7EB 2RCNA 4A4DA 4L5BA 4PHFA 1EESA 2WWWA 4LSGA 2F9LA 3VX4A 1SXJD 3K70C 5DYIA 4NZYA 4MRRA 3WMEA 4AKHA 3CBQA 2ZTSA 1RPZA 2HF9A 2J46A 3OEHA 4OK5A 4S2EA 2AXNA 2GXQA 2A78A 3PV0A 3KJGA 4AWXA 2VP6A 4DJTA 1E2HA 2DR3A 2JIZD 2DFNA 1G7TA 2WKRA 4UXHA 2DPXA 3T1TA 1E9RA 5AJWA 1CJKC 1W0JA 5K8LA 3K0CA 1F2TB 1ZUIA 3N2IA 1MABA 1XTRA 4WZ6A 5E95A 1CP2A 3AB3A 1Z2CA 3UK6A 3WNDA 2KBFA 4KO8A 1U98A 1OKKD 3W6NA 5BN4A 3B7GA 1Z47A 5FUVA 3ADDA 1NVUQ 2ZANA 4PZZA 5JHGB 3PVSA 2HJGA 1KSGA 1W4RA 4II7A 4V0MA 3R7WA 5G40A 3AVYA 1RRPA 5AUQA 3TW8B 4JLNA 3P1JA 4E5UA 1CR0A 4PO8A 4LZZA 2RGGA 2ZI6A 3QE0A 2ZUDA 2CDNA 1NLFA 2Z6VA 2KWIA 3BB3A 2F3RA 2HF8A 3NBZC 4BLQA 4MKGA 1N6PA 4EUNA 2ZSEA 1AQUA 1DAHA 3RWMB 4AKGA 1EFCA 1GDDA 2BKEA 2OLJA 5EP3A 2CCGA 4P4SB 1G5PA 4BLOA 4EPYA 1N5JA 1P5ZB 4DLVA 3FKSD 3ZS9A 4EQ6A 2I1QA 3MJHA 2C9CA 4GOXA 3THYB 2D62A 5DNYB 3TQFA 2CLDX 3IIMA 4A15A 4NL4H 2XXAB 2J45A 2NMVA 2IK8A 4JLKA 3U3RA 2J0UA 3I72A 4TTRA 3VX3A 3IKJA 2R2AA 1TF2A 3AEZA 5D3MB 4DT1A 3FTQA 2J87A 1IM2A 2FMXA 1JEDA 1U90A 2WWGA 1E2PA 4XOIA 5AJXA 2AHOA 2KBEA 2VHUA 2F43A 4BLPA 1E0SA 2EQBA 1E6CA 3SYNA 4AK9A 2VIIA 2V6JA 3E70C 4EPTA 2ZE7A 4UNPA 2DHRA 4TQ9A 1DAKA 2C9OA 3RHFA 1E9EA 3B5JA 4CYMA 3VKHA 2EFHB 3ONWA 2OSBA 4B3XA 5LDDC 1U2RA 4Z8YA 3WP1B 1NNEA 1WDTA 2CK3A 3SQXA 5SZKB 2C98A 1E2NA 1F6BA 4D4LA 3Q5DA 2Z5FA 5AK0A 3A1UA 3BJIC 3UXMA 3L0SA 1DPFA 4CDGA 4KXFB 3ZZTA 3OE7D 2A2ZA 1R5BA 1KTVA 2ZRHA 1E1RD 4V02A 2YNMA 2GJKA 4ZPXA 3A4LA 4PAOA 3UWKA 3OEHD 4Q1DA 4GL2A 3QKTA 4HI0E 3KKOA 1S3GA 3JZMA 1DAGA 3LXXA 2XNDD 3HPRA 1D2EA 3OEEA 1Z28A 2B7BA 3K8YA 3BWDD 3CW2A 2XZLA 2ZI3A 1U9IC 2NTYC 4IOJA 4XSGA 3NH9A 4JLPA 1QHNA 2JLVA 1SXJA 4Q18A 5M04A 3AVTA 1JALA 1FUUA 3GFTA 5UKDA 3ZS8A 5J4KA 2YHSA 1W2GA 1XD8A 4PSKA 3IIJA 4M2LA 1NMXA 1DAMA 4W5WA 4L9WA 4ZKEA 5KPJA 2A5FA 1ZD1A 721PA 5B64A 2OILA 3U3JA 2DWPA 3CNOA 4BLRA 5J4LA 2FFBA 4Q47A 4CEHA 2J0VA 5G3YA 4D82A 1M7HA 4B35A 1NIJA 1Z0FA 1KI2A 2WPDA 5DYGA 4IRUB 5EXXA 4M9XA 1CBUA 1VCIA 3BAFA 4UQOA 3K70B 4BZXA 5FOWA 5JBQA 2A3RA 4NCKA 1U8ZA 2ZI5A 2GZAA 4MITA 5HCNA 4DLSA 2REXB 4E09A 1TQDA 2PH1A 3CH4B 3QXJA 4TLBA 3PUVA 4NCHA 4R9UC 4UNSA 2W0SA 5GVSA 4TTPA 4D6PA 2C5LA 1K5GA 1BYUA 1MT0A 4M1KA 4EJSB 3BIFA 4DC9A 4C7OA 4BRWA 4DVGA 4NYMR 2IEYA 5D3MA 4KODA 2V4ZA 4A8JC 5C18A 2QSZA 3T12A 2W6JD 3PEVA 2R44A 4IVPA 1NP6A 4Q9HA 4WZAE 3IO3A 5LB4A 2IS2A 3SEAA 2FNAA 3LBHA 4TMTA 1IBRA 2NQ2C 3DOFA 3QXHA 5CK5A 3CH5A 4EQ6B 1FMLA 4FCTA 3C15C 1GRNA 4TL7A 2J5XA 3ZIAA 4BFUA 3IUYA 2CL0X 2XTNA 1AS2A 4FI3C 4KV9A 4C7OB 4NCJA 5FOVA 2IHBA 1R2QA 3K0AA 1UM8A 4ZCIA 1N6HA 4H9GA 2DWQA 4US2R 1KDPA 2R6CA 3EARA 2JJ1A 1TAGA 4RD0A 2UKDA 4BQSA 1Z06A 2ZROA 1RIFA 4DZZA 4MYHA 5HKKA 2IYWA 3HU2A 3QF4B 4E22A 3BC1A 1NBME 2I4IA 2HCBA 4B73A 3QI2A 4K8OA 4HAUA 3RLFA 5JS7A 1P72A 3UWOA 4JYBA 1WB9A 2H57A 2ZRMA 4OJKA 1Z6YA 4N1AA 5DI9A 4B6FA 4D2IA 1OH5A 2ZRCA 2K5UA 4X8LA 2QM7A 1E79D 1MR3F 4B3FX 1N0VC 4FMCF 4URWR 4G5QA 4NP6A 4MUBA 2ORWA 3JVVA 2R8RA 1IQPA 3S1AB 4M21A 1XEXA 4LC1A 4AURA 1C1YA 1HE1C 4JYCA 1OFHA 1Q1ZA 2GCOB 2MSCB 4MDFA 2YINC 1JPNA 1ZNZA 4ESVA 1IXSB 4KVAA 3U61B 1P9RA 2D74A 1Z0JA 1TEVA 2ZRBA 3CF6R 1QBKC 2YKGA 2P67A 1G7RA 5C1BA 2Q3HA 2ZE6A 5FOTA 1OJLA 2DFLA 1ZNWA 1TUEA 2OBNA 4TT3A 1G17A 3IHLA 2ZR7A 1S2MA 1Q1QA 4EKDA 4TYYA 2XEXA 4GBMA 4GOKA 3LH5A 4YMUA 5AJYA 1I4TD 4V0ME 5E7JA 3BOSA 1TEXA 1Z8FA 4I1OA 1H65A 2CVFA 3THXA 4TLEA 4GZMA 1YRBA 3T61A 3FVQA 1GOTA 3QXCA 3SI7A 1GWNA 3FMIA 3PG5A 2GNOA 3ND9A 3Q7QA 4U5XA 2XXAA 3MAAC 4Q4AB 3GEHA 2HT1A 1R10A 1HE8B 2ATXA 3A4MA 2FSHA 3CRRA 5FUWA 3N70A 3T06B 4BPBA 4PC7A 2P5SA 4LJ5A 1YRAA 3EZ9A 1X8JA 4URZR 4RZ2A 2FF7A 3ZVMA 3X1XA 4V03A 3U7HB 3N5CA 4BZQA 3RS4A 1GRQA 1OIVA 2VO1A 1L4UA 3AUXA 2HCJB 1MABB 4TQAA 4JBXA 3WNCA 1GP2A 3CNLA 4ZO4A 3L8ZA 4V0KA 2W00A 1DBSA 4P32A 2NPIA 2FEMA 2V7QD 4LPSA 2QMUA 1N5KA 4Q4AA 4CT5A 3HR7A 3UG6A 1U8AA 2ERXA 1KK2A 1VCOA 4BFWA 2AK2A 1KI8A 4DEXA 2H5EA 2EFDB 2N42A 2VHCA 1UJ2A 4N3NA 4Z54A 2IYTA 1LY1A 2FPMA 2OAQ1 1D5CA 3GEIA 3FFAA 2Z43A 1P7CA 2HT6A 4LY6A 1DADA 2WWFA 1GG2A 2V3CC 4ZKDA 1FNMA 3GP8A 1IN4A 5AR1A 1OXTA 1F2TA 3AF4A 1RRFA 4C4PA 2J0SA 3AVOA 1C9KA 4R98A 1XBTA 3IEUA 3BFVA 3QVUA 1J8YF 3QIAA 3OFND 5KYKA 1HUQA 5LD2C 2FZ4A 2VSFA 2QPTA 2QM8A 2A7QA 3MWYW 1ZUHA 3NWJA 2H17A 3PUZA 4RFSA 4JLOA 4QRHA 2ZJ8A 4IXNA 3CPEA 4M22A 4QKQA 4Q1EA 1OXUA 5JJLA 1CF4A 1AA3A 1NF3A 3PXGA 4N0DA 5HKKD 1FP6A 1SHZA 3EW9A 5C46F 3H1TA 2NG1A 4LJ4A 3SOPA 3QG1A 1E69A 1YKSA 2AL7A 1UADA 1G3MA 3VHLB 3FE2A 4IXMA 3GEEA 4HDCA 3C41J 1Z22A 2RGCA 2PZEA 3IO5A 1KK1A 2QEQA 4TTQA 1VKJA 3GJXC 1XXHB 1E9DA 2QMOA 4Q4HB 1QHHB 2Q6TA 3LXRA 2PT7A 2O0JA 3SHWA 3V00A 1GSIA 3PENA 1NN5A 1LV7A 1HYQA 3LFUA 4M9SA 4L16A 4YMSA 4OHWA 3RABA 1UBEA 1WA5A 1U9IA 4F7WA 1W4BA 4DUGA 2HEIA 2ZRGA 2IUTA 2DBYA 3B2EA 2G1KA 3LLMA 1BH2A 2XITA 2FFHA 4DLUA 1PUIA 2FFAA 5FBQB 2EYUA 3MG9A 3GMTA 4BASA 1KMHA 3PIRA 4EPVA 1T91A 2YOHA 3HU1A 2GK7A 2VHTA 3EWSA 3VR5A 2JLYA 3TRFA 1WF3A 2A30A 1H8ED 3MRSA 5FL3A 4MYTA 5J40A 3VR3A 4NYJR 3EPLA 3NHBA 5TV2A 5H70A 2YOGA 3AVWA 5HPYB 1AK2A 4G5RA 1NBMD 1QG4A 2JLQA 4ZDJA 2YZ2A 2GRJA 2H8KA 3W6OA 1E94E 2VP9A 3OEED 2PCJA 2UZIR 4IKEA 1A2BA 2NOAA 1IN7A 4A2WA 1TQ2A 2AKAB 3TE6A 4HATA 4Q4HA 5CLLA 1SVMA 3GLHB 4KFUA 3GLGB 3SJAA 1G18A 1E9SA 1NJGA 3CB4A 2F43B 1IN8A 1A82A 4PZLA 2WSSA 1OYYA 1FOEB 3HWSA 2VP0A 5JJKA 4AKIA 4B3GA 1A1VA 2O8BB 2BJVA 5H8WA 4Q48A 5EE1A 3EWAA 2V9PA 821PA 1UKEA 1W47A 4KFSA 5JLJA 1IONA 5J5CA 1AZSC 1T5IA 1AA9A 1CLUA 4KCGA 4MKHA 4B3BA 2J3EA 2ZREA 1KI3A 1Z0DA 1HT1E 2D7DA 1GNQA 1XCPA 4WZBE 5KOYA 3K9HA 5EXTA 3WXMA 2QP9X 1AGPA 1N6OA 4IOKA 1EK0A 3PUWA 4HZUA 1R5OA 2CE7A 3DDCA 3PUYA 3SJBA 4DCUA 1IN6A 4MUAA 2OCBA 3UPUA 1COWD 1HV8A 2ZETA 1CXZA 5JWOA 4JL8A 1VHTA 4RFVA 1IJEA 1PZNA 1NN3A 2G0NA 2HV8A 1X8KA 4EJSC 2GK6A 4FCVA 4A6XA 3D8BA 1E4YA 1MO5A 4CT4B 2ZRNA 1W46A 2HLDA 3EIQA 1W49A 1JQLB 2V54A 3QKRB 1KAOA 1HA3A 3OIWA 3PUXA 4LK2A 1T3SA 3SZRA 3ZLJA 5EQTA 2ZYUX 4GP7A 1ZM2A 5KU1A 3OESA 4Q7JB 4A0RA 1FW6A 1EFHA 4JVLA 3KTAA 1XMJA 3CR8A 4RKEA 4EAQA 1ZC3A 4BECA 1FUKA 1N2CE 2P5TB 4FXPA 2BBSA 4MRPA 3B1XA 3MJRA 4IDQA 4DSUA 4XWKA 1XTIA 3KJEA 2BWJA 2JLRA 3E2IA 4S35A 1NVVR 5J47A 3U6KA 5FTKA 4PHTA 1E2JA 4GDFA 5F98A 4OHYA 3QPUA 3SYKA 4PSVA 1UEIA 2QAGB 4A82A 1E32A 1F2UA 2RB4A 4XD7A 2ODNA 4BFTA 3TK1A 1B23P 2QTVB 1G3UA 5DHAA 3TSZA 3GLFA 2FG5A 2Q3MA 5JWRA 4D26A 3CIOA 2QI9C 3U4QA 2GEDA 1VECA 5HZHA 4WBSA 4A92A 1QVAA 2PX0A 1S1MA 4B3CA 4HLQB 4KHZA 4PC2A 4PAMA 4KSCA 1YE8A 1RJ9B 1SZPA 2IA5A 5L3SB 1O3YA 1ZJ6A 2ZPTX 4NHOA 2C99A 3K0FB 4M53A 1A7JA 4CEJA 4MGZR 4LGMA 2WHXA 2RHDA 4IVQA 1NN0A 1M7BA 4CEHB 4JIMA 2GBLA 1DO2A 1EG7A 1NL3A 1VPLA 1X1SA 2WTUA 4KI0A 1OE0A 5JEDA 3K0FA 521PA 1FL9A 1LTQA 4NH0A 2NPFA 4DIDA 3T5DA 4LBVA 1IY0A 3C5CA 4DT1B 3CNNA 1XTJA 1XPOA 2CHVA 3K0SA 2ZI4A 4LC0A 4OQMA 2FZLA 2ODEA 2PJZA 2P0EA 2GBLC 3ZJYA 5F3WB 2ZJZA 1YZNA 4LI0A 1U81A 4KSBA 1Z08A 2B8WA 4Q1BA 3W3AA 3PEUA 4RKFA 3BB1A 4W9MC 3KKQA 3N2EA 2CBZA 3QG5A 1ZW6A 4P4SA 2F1RA 2XSZD 2D7CA 3PCRB 2VQSA 2OBLA 4XWOA 3L0OA 4AIIA 1QHGA 3TMKA 2IS1A 5KSOA 3QNUA 4JLAA 3W8NA 1GKYA 2F1JA 4JMPA 1T0JB 2P2LA 4O0MA 5TDHA 2R6GA 5G3ZA 3TH5A 1ZD8A 3H2YA 4W5JA 2R6FA 1DG1G 1OXVA 5BN5A 2VHQA 3TVDA 5BYJA 2WBLC 1P2UA 4BEBA 1ZP6A 3RWOA 5IT5A 2FPKA 4B76A 5JSZB 4FMBB 3K0AB 1XCMA 1NVXQ 2WJYA 2YJTD 4FMDF 1ZUNB 4ESHA 3DOEA 2YWFA 3RS3A 3MLEA 4B32A 2IYXA 2A5DA 4B3DA 3QF7A 3TUJC 2FJUA 5L3SA 1WE2A 1O87A 2G0TA 1W0JD 5CJPA 1M1YE 2VA8A 1EFUA 1G19A 2JLSA 2FFQA 1XPRA 4IEIA 2GESA 4PANA 4KAXA 1P75A 3EIHA 1G3IA 1JQJC 2CL7X 3QQ5A 4DSTA 1JAIA 5AJZA 5HZKA 1L2TA 4G1UC 1D6JA 2WWXA 1Z6GA 2OT3B 1R0YA 5FR1A 3QENA 4OQFA 2ZYVX 3KB2A 2LCFA 3E5HA 4Q9JA 2ZXUA 2IXFA 3EA5A 1ANKA 2ATVA 2W2VA 1W4CA 1JB1A 1C4OA 2EWVA 4YMVA 2GZDA 2ZVPX 4G3XA 1D9ZA 4O25A 2BC9A 2XTMA 3OFNA 3W5IA 4TMVA 2CVHA 1KJWA 2C8VA 3GD7A 3QY0A 2AD5A 2ZRKA 4MQBA 1VG8A 4XIGS 1KSFX 3EIEA 2C95A 1WBBA 3QVVA 5KNCA 3CPJB 2MMGA 2EYQA 1T8TA 4LBZA 5FH9A 2V8OA 2W0MA 1UDXA 3I5XA 3BD9A 3UMFA 1KIMA 2FSGA 1KY2A 1RKBA 4Q1FA 3AP3A 2D06A 4QHYA 3NBXX 4QG7A 5DE3A 3VR4A 1N0UA 4JVNA 3NEYA 4FMDB 1QZXA 4JL5A 1IY1A 5IF9A 3GLHA 4Q02A 4IOLA 1OH6A 2ZI9A 4HAXA 1SXJB 2BMFA 4RZXA 2XTZA 4BZPA 4QL3A 3A1WA 4CRWB 1JR6A 2VHJA 1GL9B 3I3SR 3LV8A 5AUNB 1E98A 1I2DA 1M7GA 3UIEA 5B58C 2ZRPA 2ZYTX 4CGZA 3BS4A 4RSGA 2QU8A 4TYPA 1E3MA 2FA9A 4OK3A 1XNJA 5SZHB 621PA 5C4GB 1YZUA 4ILEA 4B2LA 3BH7A 1G20E 2JGNA 1W36D 3K0CC 3X1YA 3EZ7A 4TN1A 4GMXA 5L3QA 4Q5IA 1WCV1 1G6OA 1AN0A 3SDZA 2QMEA 4LJ8A 1KMHB 5KDOA 1YVDA 2G83A 4NPHA 2ZE8A 4LYAA 5JS8A 1S3SA 1SKYE 5TXGA 1Y63A 4ARZB 3PEYA 2IYQA 4KBGA 3GJ3A 5FTMA 4M1MA 1RVDA 2BDTA 4PX9A 2PBRA 2BV3A 2NZ8A 5TVKA 3RSOA 2G3YA 5JMTA 3EZFA 1Q3TA 2NO7A 4JJKA 5GJVC 3REFA 1R5NA 3ETLA 1Z63A 2VEDA 4M1SA 5JI3E 2ODBA 1G6HA 1UBFA 2GF9A 5KSYA 2L0XA 2YVUA 2FGJA 3CO5A 1YR9A 3P4XA 121PA 3E1SA 2G9NA 3OAAD 3U5ZB 3BRWD 1G291 2X2EA 2SHKA 1ZIOA 5DIFA 4IW3B 2ZJ2A 2BHRA 4JLBA 4BFSA 5JFGA 5GJBA 2D2FA 1RRGA 3EG5A 4A0FA 2ZJAA 2WJJA 1JEEA 4FMCB 1N25A 3H4MA 4AD8A 1E2IA 1VIAA 4KVGA 3AKYA 3NBFA 3H84A 1S4QA 5DISB 4HLCA 2HXSA 2YWHA 2FGKA 2AN9A 1HT2E 5C4MA 4Q66C 4D0LB 3KZ1E 5DGXA 4CEIA 1E2LA 2QY9A 1XXHE 3K70D 3EPHA 3RRNA 1KZ7B 2HDNB 1AGRA 2WPDD 4C0JA 1HQCA 1GVNB 4QGAA 4O3MA 4GRAA 3ADCA 2NIPA 4OQNA 4C0SA 5HTKA 3I5YA 3T1OA 1ZC4A 1OXSC 4QHTA 1N5IA 1Q57A 2ZS7A 4TMWA 2FWRA 3OF5A 3HR8A 1GUAA 1YJ5A 4TLDA 4QJ4A 3VQTA 4RD6A 4EPXA 1L8QA 3HYTA 5FR2A 4WAUA 1OH7A 2IS4A 1P2SA 5KDDA 1G8FA 1E4VA 4MDEA 3CRQA 1XD2A 3A36A 3A1SA 3NDBB 4NCIA 4HB4A 1N5LA 1E1QD 3MSXA 4UJ3A 3Q5EA 1XPUA 1E2MA 4HDOB 1ZNXA 3NXSA 3HYRA 4JLDA 4Q4LA 4Z1MD 5JI2E 4TZ6A 4JS0A 2JJ1D 2Q3FA 3MD0A 1NVVQ 4Q7MB 1VTKA 1E9BA 4DDTA 5DLQC 1SVLA 2BMDA 3GFPA 1W1WA 1T6NA 1P62B 3OIYA 2CCKA 4NYIQ 2CXXA 4C0HA 3WY9A 3O47A 2FDCA 5LD2B 3RC8A 1K8RA 5FTJA 2ZE5A 2N1BA 4QNMA 2UZ3A 1Z2AA 2DFTA 2AWOA 3IPYA 2HYIC 1YZGA 4LJYA 2BMEA 2REOA 3AVQA 3BERA 4D4JA 4JLJA 1J8MF 4QBGB 4ZI3A 1LB1B 2NGRA 1KK3A 4CW7A 1GZSA 3KFVA 5JRJA 3IGFA 3QKUA 1XTQA 1BIFA 3CM0A 2GILA 1ZVQA 3VAAA 2EU8A 1VCMA 3LQRA 1KGDA 3I8XA 2W6IA 1DOAA 4LHXA 3SS8A 2RGXA 1GILA 2ANBA 4RVCA 2GA8A 1KO5A 2ZUCA 3S1AA 1IXRC 4H1UA 3W8RA 1E9FA 1DAEA 2Z4RA 4IDPA 3MMPA 5FI0B 1PVOA 3Q85A 3M0EA 1E0JA 3DM5A 5CK4A 2Q9AA 3KKNA 3SJCA 3TSOA 3X2SA 2ZSDA 1A5TA 4LHYA 1KYIA 4B34A 2F55A 1UF9A 4P31A 5L3RA 3AF0A 4R7ZA 4Q1CA 4DCSA 2FN4A 1MO6A 1E2FA 2ZRAA 1FPMA 1LNZA 3NDPA 4F91B 4JZKA 2W83A 1MH1A 5CDFA 4Z51A 1Z07A 1KDRA 4B6EA 3OAAA 1ZRHA 3ZQ6A 1SGWA 3ECCA 5A0FA 1OHHD 4MGKR 3TBKA 1LF5A 3SNHA 2HXYA 1XWIA 4ZV4A 3WRXC 4DLXA 2GVDC 4A8JB 2MSDB 4OHZA 4OI2A 2XNDA 2Z4SA 4L15A 1S8FA 5EE0A 2ZU6A 2QN6A 1E96A 3SR0A 4WXPA 2IS6A 2RKOA 3W3ZB 1YHNA 5SZIA 3GJ4A 3ICEA 2RGBA 3H0KA 2WJIA 1EFRA 3D6TB 1Z29A 4DB2A 2ORIA 4P3YA 1OSNA 2GCOA 1CR4A 1E2GA 1RW4A 3QF4A 2ZAMA 4M4SA 4Z8XA 4RD3A 2J41A 5H68A 2PL3A 2QUZA 2VSOA 2PEYA 2WSMA 3GLIE 1MKYA 5EXSA 1M8PA 1P73A 4IDOA 2G1JA 1QF9A 4PZYA 5DI3A 2W58A 5JEEA 1T3LA 1II9A 1EWQA 1N6IA 3SU8A 1A2KC 3IHWA 1E2KA 3M4YA 5CIQA 2GXSA 4AI6A 2CNWA 1DELA 3FKSA 4LUCA 1OT3A 3AF3A 3GFOA 1II8A 2ZJBA 1WBDA 4JSTA 2F9MA 4YC7A 4PFSA 2Q9CA 3CF2A 4HUQB 5GJCA 2OM2A 1GL7A 3TUIC 1PJRA 1SHKA 3GJ0A 4LJ6A 1Q1BA 5B30A 3LVQE 5JHHB 1EWRA 4K46A 1XZQA 1W36B 1CU1A 2B8TA 5FL7D 1G3RA 1OW3B 2WAYA 4N0EA 2VLIA 3B1YA 5F9HA 5EZ5A 3SBDA 4ZIRA 2XB2A 3VR1A 5E4FA 3GJ8A 5KHOC 1AS3A 2EFCB 3HU3A 2BBTA 4MYCA 1E1RA 3U6BA 1CIPA 4AG5A 1TPZA 3QOFA 4GP6A 3DZ8A 5K8UA 3P4YA 1RJ9A 2WWHA 3RANA 1I4LD 1S96A 4JT2A 5KO2A 2O8FA 3G0HA 5EE9A 1UBGA 3LX8A 3LLUA 3U4QB 1E0AA 3B9PA 5FBLB 2WKPA 1JJ7A 4JLMA 3O8RA 2PCLA 1G4AE 1Z0IA 2CL6X 5CJ2A 3K9LA 1OFTA 3UMRA 2WOOA 1OH8A 3AVUA 5BWMA 2O8BA 1KOFA 3KFXA 3KQNA 4F4CA 3I73A 1MRSA 5E7IA 1OF1A 2ZAOA 2GCPA 2OCYC 4PPQA 4L4UA 2C9YA 2JDID 4IFEA 5F9FA 5AUOB 4EFLA 3U2QA 2GEUA 3B1ZA 5SZJA 4ACBA 2A5GA 3K53A 2D3WA 1TX4B 4CZ2A 4DCVA 2IWRA 3TKLA 4PO1A 3DO6A 3HP1A 2XJ4A 4PPFA 4XVRA 3OIVA 1DAIA 4C0QC 4TL9A 1BYIA 1G1MA 4FW9A 4U00A 4YMWA 4C0BA 2CJWA 2H16A 4DRZA 2QMHA 3AGPA 1CKEA 4B44A 2J7KA 2HYDA 1FQJA 5LB2A 2QQ0A 3NKVA 2TMKA 3I4LA 3H86A 3TR0A 2JLXA 2EVWX 4AYXA 3NHAA 4DLZA 1DG3A 1DAFA 4YMTA 4TYNA 3AVVA 3DMNA 3PITA 4PHHA 4BFXA 3DVLA 4LYHA 3B13B 3TAHA 4L8GA 1F2UB 2QG6A 3K09A 4X8OA 5AJVB 4Q03A 1TTTA 4CEIB 2XJ9A 1SVWA 1SVIA 3LQQA 2GAAA 3U3OA 1GL6A 3M1IA 1B0UA 1IOZA 2JA1A 2ZU0C 4OI1A 4BLSA 2QGZA 3OHMA 4D0GA 1P4SA 4I1SA 1AS0A 2OCPA 3DZDA 1NY5A 4LV6A 4D81A 1EX6A 1XMIA 4IDNA 3A6PC 3JVUA 4OHVA 1R8QA 2GHIA 4NTZA 4PQRA 1XMSA 1K6MA 2E9SA 4RJLA 3W6PA 4P4UA 1ETUA 2LWIA 3AKCA 3C16C 3GLGA 1RC8A 2W6JA 3PR1A 4TLAA 4F4IA 1EFRD 3W34A 1W7AA 4MGYR 3W9YA 2ZRJA 3GJ5A 3LW8A 5TY0A 4ABYA 3FYHA 1TMKA 1J99A 4PC3A 3RYTC 4LHWA 4HAYA 4LJ7A 5EE3A 4YDSA 1VMAA 1Q3HA 1XP8A 2ZUBA
chains in the Genus database with same CATH superfamily
4F9FA 3U37A 3GGJA 3JRXA 1WB5A 4M0DA 1KAEA 3ABIA 2LKCA 1LVGA 3L1IA 2JIQA 5CIYA 1NNUA 2HSZA 2FRVA 3KXLA 4HGQA 4P08A 3UWMA 4XX0B 1IAQA 1T1EA 2IYVA 4TUYF 3O2NA 3RJMA 3AESB 4D0SA 1NP7A 1OREA 3UB4A 3OSUA 2XVZA 3O9MA 1SWWA 5JPIA 3Q3GE 4WRRA 3CE9A 2AB0A 5K4AA 1CZOA 2WAMA 1O0CA 2IP4A 2OB2A 2EKPA 2C31A 2NV0A 2VJOA 1XLWA 4ZI7A 5JZVA 5LLDA 1QU2A 2CJFA 4B0OA 2HRRA 3RSLA 4ZT5A 1RRVA 1V11A 2G4CA 1CUBA 4KP7A 2QJTA 3K71B 1LLUA 1AUXA 3LUDA 3OPYA 3ND7A 2TMDA 3C70A 2O2SA 3DHYA 3DXFA 2O1XA 2Z04A 1Z36A 2QN1A 4YNBA 5FPHA 3L0IB 3NGLA 1RYNA 1RYHA 4QOEA 1CVLA 1R6AA 2XLBA 4REQA 1BVUA 2YFQA 4CNQA 1XDBA 3FCUB 2C03A 5EI5A 1KEZA 1TQ4A 3VU9B 1IBMB 5JDCA 4KR9A 4DA8A 3QGMA 3BRCA 4PGFA 5E38A 4DF3A 3KVNA 3RRJA 3KWJA 1C50A 2G6BA 4JDPA 4BMNA 4ZI2A 3I1YA 4F72A 5LQRA 2DC1A 1KQPA 1XVAA 4YQYA 3I9V1 3STVA 3T35A 3VPFA 1ZA1A 2K87A 2NACA 3HCEA 3Q0TA 5TGTA 1GNSA 3WX0A 3DNPA 5G0WA 2WMNB 3N0RA 2AR7A 2DFPA 2P2YA 3FROA 4TWBA 3BILA 2Y93A 3L8EA 4HH4A 1PSDA 2BUAA 3KT3A 4ZT2A 4GGPA 3WL6A 2O8EB 4GLFA 2ZS8A 5EIEA 3E4CA 3KAJA 3U9SA 2DT5A 3ZGXA 2OQIA 3RS5A 5CLQA 4BVGA 4ZCMA 1FP4A 4L6IA 1T0IA 1V8DA 2NSLA 1QNLA 1IN5A 3B6KA 4IIHA 3BF8A 4MICA 1Z2DA 2PRSA 4QDZA 5DX0A 5H3LA 3RF6A 4DMRA 1CY7A 4LXXA 4G5OA 3N1UA 4ZC8A 3VTFA 1OBFO 3GPDG 2V7QA 2WJVA 4MQUA 2Q2WA 1Z6XA 3CURA 1J1ZA 1MX1A 4FFLA 2HA7A 3ZCPA 1X94A 5BXQC 3IUSA 1X70A 2O07A 4A2PA 2FR1A 3GUHA 4IH9A 2NU8A 2CVOA 4LF5B 3OPYB 1N6KA 4YP9A 5C8YA 2VDWB 1E2EA 3W3AD 1J97A 2H59A 4Z3KA 2WIAA 1EXMA 2D2XA 2X9LA 1ESNA 2XGSA 4CLDA 5CB4F 2O5VA 4NABA 1DDGA 4AY2A 3HI4A 5B1EA 3U7JA 2FQWA 3I4FA 4RJ2A 4TGLA 3H19A 3FHOA 1CJTC 1JQ3A 3UJHA 5HQTA 5E2BA 5LMCA 3PQ2A 3H2BA 1DFHA 3FH0A 2DR2A 4E2YA 2POCA 4BTEA 1ECGA 1TGVA 4KZKA 4URVR 4R7TA 1MW9X 4TQUS 3O0DA 2AX4A 3BL8A 4LPKA 1KZ6A 4MKFA 1RBYA 2WJPA 1NVGA 3RAFC 5D3KA 3CBGA 3LRPA 1F0NA 3CG4A 1DXOA 2JCSA 3WGHA 4UM7A 4BQNA 3JZAA 3FOBA 3UHJA 4AZ0B 5A0TA 1HY3A 1DKQA 3BA1A 4US0R 4UHCA 2ZVQX 5COBA 5ELMA 1Y6FA 1UKZA 2V1UA 1UBSB 1OZHA 5CB8A 3P9YA 1KYTA 2AF4C 3NRBA 4KR2A 1K5HA 2FWPA 4Y30A 2RGNA 5JSZA 2QD1A 5JYDA 2GCIA 2I0FA 5IXSA 3VO8A 5L3VA 1CEEA 1IPEA 4RD1A 4G0NA 2ZJYA 3MFQA 4N40A 1KFBB 1C29B 1E58A 1JP7A 2P3OA 4RZ3A 3H18A 3S4YA 3IDQA 4ZDWA 2E37A 2W43A 2DECA 4P34A 5K8TA 221PA 2JFGA 3QVGA 4YK7A 2JAQA 1COZA 1F14A 2EGUA 5FIUA 5CB4B 3WTBA 2YJ3A 3AO0B 3FG9A 4JUBA 1HR0B 3KJIA 2PAFA 3OQIA 4N12A 4KKVA 1NXOA 3B70A 2GT1A 1CG6A 2GRAA 3AGQA 5I7HA 2JRCA 2DUWA 1S2IA 2CVZA 2Y1OA 1XXLA 4O8CA 3D8RA 4IYJA 4XGNA 4IG4A 5I6DA 3M6AA 1UXIA 1Z0SA 2W4IA 1MQ8B 1EWKA 3PNMA 4AKTA 4NR0A 3I42A 5FUYA 1AX9A 2QN9A 1Q83A 2GKGA 3I9NA 2DY1A 4RV4A 2Z9DA 3VUEA 5JROA 2AOUA 2GAOA 1DNPA 2NLOA 3AY0A 3VDRA 3WFJA 1JBKA 1I0LA 5F7XA 4NIMA 3IBCA 3DKVA 2FH5B 2IXGA 3FF1A 4WFKA 5D87A 5L7WA 1DIAA 4AZ0A 1PJ2A 3LA6A 1Q1AA 1BCRA 1CDEA 2YXPX 2FZ5A 3G9TA 2QR2A 4HLDA 4B48A 4KXVA 2JI9A 1T25A 4IO1A 1VMIA 2NZUG 2DLDA 3ONFA 4BQRA 3VKVA 5BUZA 3NH6A 5F5LA 2HQSA 1A27A 3L82B 4DM4A 2XE4A 1T1IA 1LLDA 4PNZA 2QJRA 4E0BA 1R0BA 3AVPA 1VYHA 3H5OA 4PCAA 5DGDA 3ASZA 1QQ6A 4F4UA 3VNUA 3Q7EA 3JQ8A 2WUEA 4RTMA 3BMXA 3KX2A 1INLA 1JYSA 3S70A 1QANA 2X77A 2SNIE 2ZYAA 2VPPA 3K0HA 4UMFA 4WOJA 3L2OB 3KOUA 4OHCA 4DXHA 4N48A 4AMZA 2Z2JA 2AFHE 4X84A 3OMLA 2AV6A 1L5GB 2P7HA 2PA3A 3HFSA 4B3HA 5JC1A 4IPTA 4D3SA 1H4SA 1RQLA 1UMKA 1W8DA 2BFBB 1JT2A 4LXQA 2QVZX 4LZNA 4MR9A 2FCAA 4RS3A 3QBDA 1U0RA 5G0VA 5T41A 3OQHA 3BE5A 3BGVA 3DD5A 4JCCA 2H2WA 3L5KA 4NQZA 5AO9A 5KNDH 2UZ0A 2XXBA 2I03A 3A6GA 3ONEA 4Y6QA 3UGJA 3CHYA 4QXMA 5TF0A 2AOWA 1ZVKA 4Y9RA 4S0XA 2FSUA 2Y1XA 3OIUA 4MMZB 4TYMA 4ZTBA 4E70A 4KVZA 3KPUA 5GINE 2P9HA 1JT9A 1V8PA 3WJ2A 5A4MS 1IB6A 4IJMA 4OP3A 2R79A 2P9FA 4CFSA 5DTMA 3LF2A 1WDMA 4LWZA 2I62A 3UKDA 2ZB7A 1X1DA 4FU0A 5EP4A 2QI9F 3V8NA 4DLLA 4JXZA 1U7WA 2ALJA 4RO0A 1FQKA 1OFUX 3OWOA 1H69A 4JKYA 3HSYA 4RD2A 5KX5B 4EEXA 2QX8A 3K05A 1G16A 4R4JA 4KOAA 5D7BA 5JSKA 5CGQB 1CJUC 2RGYA 4Z0PA 4DY6A 5KNCH 1Y3BE 4FFOA 1GTRA 5J5VA 3LVRE 5DXJA 2IHUA 5EJIA 1GZDA 4HQKA 3V4RA 3RS0A 3AFMA 1MQ9A 4ZXPA 3ZC3A 3OEYA 4Z0HO 1K6IA 3B78A 4KNYA 3KKMA 3WQBA 3K6RA 1L1FA 4E13A 5LMUB 3OPXA 1NX6A 4NDAA 5TMBA 3JSAA 1LPNA 2VDJA 4UAJA 3RM3A 2JLUA 4FCWA 2YJGA 3Q0EA 4KQHA 1SOVA 2C7OA 2PL5A 4PSAA 5K45A 3VA7A 4ZI7B 2QENA 4LYJA 2PKRA 1TUGA 4PX3A 4P4NA 1XX6A 4I9HA 5BW4A 3CPHA 3OMXA 1TK9A 4EBFA 1NMZA 1TU3A 4H1HA 1BD3A 3MS7A 1QG2A 3OQ6A 4PHCA 1KTIA 2QZ4A 1LPMA 2XY4A 3QJ5A 4LMPA 5YASA 1MD9A 1ZCJA 2ZXEA 2RC6A 3DFKA 3PGXA 1E2QA 4HWPA 4ZT4A 3JQ8B 4CQNA 2OHFA 1M0SA 2BZGA 3KV1A 5EP2A 5HIJA 4U2CA 2G0AA 2ZI7A 1VYTA 3K8QA 5SYNA 4BX3A 1HC7A 1KQGA 3T7EA 3WRWA 3ZVLA 4Y7DA 4FJ0A 4GQIA 1C7QA 4BMSA 4TM8A 1UT6A 4C3OB 5FUBA 1Y6RA 2QUIA 2SECE 1N0WA 2VDQB 3NBAA 1Z2NX 3SY8A 2OG2A 3DEAA 5FAXA 4FWIB 4YRKA 1T6ZA 2YXNA 2B34A 1EBUA 3CCFA 5KPDA 1I2CA 4URHA 1KIFA 3EC7A 4TVOA 3Q0IA 1ZEJA 2LDYA 3F3YA 5EKTA 3KZVA 1OXBB 1MX5A 4ND8A 2GARA 4B3TB 2XCIA 4YP0A 3R9XB 4YP6A 5IP5A 5JMOA 2EG9A 1DJMA 2QRZA 3V4SA 4AMBA 2ZSFA 4H7EA 3AW8A 4GSKA 4YRIA 4TZ0A 3QMWA 1UDCA 2H9AA 1ULBA 3MUFA 4CG0A 2QK4A 2WA1A 3A6ZA 2QWXA 4LFAB 4E07A 4B9EA 1NG1A 1Y0BA 3FWYA 2PZJA 3FZNA 4W8HA 5F51A 1S7CA 2H1IA 2FPXA 4TMFA 1FFEA 2PRJA 4M7WA 2YKOA 1U0HC 3KSUA 5HZMA 1GARA 2QORA 4IGFA 2B1RA 2HIMA 1JJVA 3BXHA 4M8NE 4MKIA 4PN7A 1Y8ZA 1FVFA 4LV8B 3R9IA 5CDGA 4H7JA 4OIFA 3SJUA 1E8NA 5LYJA 1U1CA 2HO4A 1H2ZA 3KALA 4MARA 3AKDA 1UPCA 2BCJQ 2B25A 3L84A 1W44A 2K4MA 3ECAA 3RROA 4YMGA 3IJPA 1S2NA 4NWIA 2A9QA 3IP8A 1LPSA 4MLDA 1QVRA 2ZS9A 5A62A 2WZQA 4YRTA 1PUJA 5HJEA 3QYJA 2REBA 4UVDA 1MAUA 1RKQA 3K1JA 3UMFA 1JAZA 3WS7A 5EWMA 4OHMA 4JASB 4HDKA 1V1MB 5A4FS 1FFSA 2ENUA 1KYWA 1BKSB 2E89A 1V41E 4MR9B 1EHYA 3CRNA 4UUNA 4O59O 2JASA 2OGUA 3TLZA 4ER0A 5KNBH 1II8B 3WP0A 1KO4A 4MVXA 3OE4A 5BSWA 4DTIA 1FXSA 3RVBA 1W0KD 3G9XA 4F86A 3NAGA 3R0VA 2Q5OA 1U3FA 2PXXA 4JB0A 3EULA 1O4WA 3MTEA 1RIIA 4P5PA 3A70A 4Y2GA 1P8JA 1CQIA 3HJAA 4K0RA 1HZZA 1Z0ZA 1PR9A 1R9JA 3L4BA 5LA6B 3AHCA 2Y9PB 3HJNA 4C22A 4R0NA 2HWKA 4C4OA 5EOVA 5EMKA 4M83A 1NBEA 2ZDHA 3Q8XB 5H3HA 2IEZA 3R0JA 1NPYA 2Z5LA 3S8MA 2YWCA 2KQUA 3JAMA 1OWNA 3IA2A 3TLGA 1I6KA 1UXGA 2X76A 2OFWA 1QH0A 2Y1GA 3I12A 1D09A 4KN6A 2AG1A 2P6OA 4LOJA 2JHGA 3P2YA 4HVLA 4NFYA 2GJ8A 4X8HA 2GAFA 3USCS 3W7VA 3GLFB 2VJYA 3BUSA 3G8CA 1KZHA 2P6NA 4KDEA 5KUTA 1NJFA 1CR2A 4RYDA 2XSZA 1AKTA 1YIOA 2B8JA 4OHFA 2WWYA 2C2YA 5E7MA 2HF7A 4C4ZA 1PNOA 3NBYC 3EUFA 3THWB 1K8QA 2BM1A 1DIBA 3WLJA 2EWMA 2H1LA 3M33A 2TS1A 2P0AA 3FPKA 1G3QA 1B6GA 3CLKA 4US1R 3RK1A 3PGA1 2YOFA 4QPCA 1WMEA 1BROA 1YD7A 2XOEA 1EWTA 3LT0A 5AW4A 2IF2A 2LR0A 5K8IA 2UYCA 4UVGA 8OHMA 1J1UA 4HFMA 4EI8A 2IZ6A 1E66A 4FM9A 4BLTA 1VKRA 1H6DA 4S24A 4RZUA 2FXIA 1N4DA 3FGNA 2XHZA 4YTEA 1FFGA 2D4HA 1WO8A 3ETJA 1O7JA 4DCNA 5IKOA 3EA0A 5JSUA 3OI7A 1DBRA 4E14A 4F12A 4QFCA 2HJWA 3V4ZA 1US8A 2B2XA 1GNVA 3K72B 3OQIB 1C4KA 3RS2A 2G8NA 2C57A 2OZLB 3DKKA 2YH2A 1Z39A 3PRJA 2IKQA 3AH8A 5KOHA 1OFIA 3I9V6 4RTLA 2RK4A 3ZZUA 3FETA 2FLVA 4IDAA 4BQOA 1X7YA 4KOEC 1Z8NA 7MDHA 1Q21A 4Q4DA 4JT4A 4GSYA 2QPAA 1MO4A 1WY5A 3TGLA 5CEJA 5BT8A 4KUGA 1U5AA 4OAPA 1RQPA 3ASYA 1WQ1R 1QHYA 2PUWA 1XROA 4TSFD 4BAGA 3RSSA 4LQLA 3RWBA 1KHTA 3OZSA 2YW2A 1EE2A 4BNYA 4HAVA 3K9GA 3QLUC 4QREA 3HH8A 2WWIA 5IMBA 3VR4H 2Z2YA 3RARA 4HRYA 4KYIB 3P9XA 4MIOA 1LFDB 4JNCA 1KDTA 1SCUA 1XN4A 3WDMA 4IJ6A 1M6NA 2JI6A 4AP5A 4EG5A 1WSWA 3VKFA 5DYNA 5B5SA 4I3GA 1F0KA 4C0KA 2W9XA 4LZOA 2B4AA 3GAZA 1VKOA 3GCDA 4QDXA 1UEJA 1YB1A 3OCVA 2GI4A 3C3WA 1T3HA 2C59A 3LX6A 2A9OA 2YV1A 1FYWA 3L77A 1YSCA 2DHDA 4HO1X 2X15A 4JYZA 4C0XA 5LOVB 2C82A 1AN9A 1GT91 1KKMA 5BSEA 3A8TA 4IUCS 4C21A 4PZCA 3P8ZA 1RZUA 1OI3A 3G49A 3II6X 4ZAYA 3WMFA 1B16A 1WHTB 4PZDA 1D6NA 1NSTA 3ZZ0A 4DKJA 4EHLA 1DWPA 3GFVA 1FTNA 1FFXA 2PZMA 4AMYA 4BNUA 1Z2OX 1USUA 2WIFA 2UAGA 4G1FA 4GKVA 1AB5A 3I8SA 1QHHA 2ZIZA 5I9TA 4I3FA 4TQGA 1CP3A 4CR7A 1BA3A 2YRXA 4W7IA 4ZEOA 1VJCA 1RLTA 1ABEA 1BKYA 1U2ZA 1M0WA 5B2ZA 2I1WA 3O82A 4ZGWA 2WKSA 1NQXA 3FFXA 3G7UA 3SX2A 2B94A 1Q7BA 1RJDA 1UBNA 1WCIA 2RIRA 3A11A 4Q6BA 1L5MA 1L1RA 4M7PA 4EHIA 1JA1A 3OZCA 4FSXA 3TB4A 4RZHA 4W4TA 4LBWA 4MRVA 3IBYA 5DCLA 3FYSA 3OCJA 2CCJA 1U2GA 5E4TA 3UCFA 4YDQA 1CUUA 4QWMA 1B14A 1W0KA 1XALA 2JZCA 5LXTA 3IP9A 4YXFA 1Q0ZA 3WYDA 2DETA 2Y1KA 1JLLB 5EPUA 3ONDA 2HC9A 1NDQA 4FE7A 4PC1A 2O7VA 3CGGA 3FYUB 2BELA 3NGMA 2EFYA 3FDFA 1THMA 2JGIA 2ZIFA 2WVAA 3H8JA 1RQ7A 1JKIA 2Y1WA 3LPDA 3DFUA 4URYR 2QZJA 1PUXA 4ZU1X 3SEQA 4KR3A 1BE1A 4DIEA 1KAHA 1QX4A 2AWNA 2HK7A 2RMKA 2H18A 4YAKA 2GTPA 4BVJA 3RU9A 3CZPA 3RC2A 2ZYGA 4L9AA 2GD0A 4ARZA 2UZ4A 1GKLA 1RVV1 1WOYA 1C2TA 1ZM3A 2XT6A 3GEDA 3CT6A 3QMVA 4WOBA 5IUNC 3G59A 1RABA 3EOBI 4Y9UA 5KSPA 3ZWXA 2P77A 4N6NA 4UNRA 3FUWA 4OLHA 3LP8A 2YVAA 4UDOA 3TI7A 2IU6A 3AYZB 4YV2A 3MN1A 3CX7A 2VK8A 3M1YA 2QE6A 3D6UA 3MSCA 4OKSA 4UKDA 2QLNA 5CG1A 3P9SA 1GQRA 2GZSA 3F0TA 5KX5F 2RGNC 3HJBA 3SCZA 5LQNA 3ND8A 2PMDA 1C4XA 4O08A 1L6IA 3R0ZA 2LKDA 1ICIA 3TNLA 2WM9B 2HU7A 4LX0A 4M9ZA 3O4IA 4URUR 1FJGB 2JFZA 3UPDA 3B8HA 4EA8A 2VTEA 3NVAA 1CY4A 4LISA 3T3HA 5FPKA 1VPEA 1PVDA 3K16A 4N6OA 2OY0A 3ETHA 3Q3JB 3HMKA 1AQ6A 1G63A 3ENNA 421PA 1RRCA 3TNJA 3KDPA 1QIIA 2K7FA 1C2YA 2AG6A 1X7HA 3GLVA 1HKHA 1Y4AE 4KO1S 4MA4A 5A6SA 4GOND 3DOUA 2GN9A 4RF4A 3IV9A 3AKEA 1GPMA 1LSOA 4ZYTA 2HD4A 2CHQA 3ET5A 3GLKA 1MEOA 1CQJB 3DBLB 3OZDA 4TL6A 3MWGA 4OIMA 3SIWA 4DMMA 3FPHA 2BLNA 1OGYA 1Y82A 4JBYA 4BJ1A 1JHPA 2OMEA 2XB4A 3R8FA 5K2OA 1U0LA 2I3DA 4GLBA 4L3VA 3VOTA 1SBHA 3VYRB 4X63A 2Q3DA 3QPAA 3A3YA 2WJAA 1U5CA 3CLUC 4IIFA 2LXNA 2QIOA 3C4JA 2O2GA 5L3QB 4FHEA 4CFYA 3Q8MA 3Q9SA 3AC0A 4Y0AA 2FG7C 2A58A 2Q5FA 3GBPA 4XSHA 4CODB 1MVLA 1NOJA 1RNLA 1HMPA 1ZM7A 3SVLA 4WZZA 4C6RA 1GFSA 1P7PA 1GFZA 1S1CA 1YCHA 2XCOA 5MFZA 1R4MB 1YMVA 3EMDA 4FLMA 1PIWA 7GPBA 1GZ5A 4GEKA 1T5LA 1CEXA 1MJ5A 3HO6A 1O08A 4F8EA 1ZYUA 1JHDA 1R15A 1JHYA 1YQXA 1W88B 2QROA 1Q95A 2ZEJA 4AZ3B 3I39X 1GLNA 2ZBPA 3LW7A 1JH8A 1IIBA 1M2GA 2VF7A 4QDUA 5CDYA 4EDFA 1TVEA 4C2UA 1UJBA 2GB4A 4JT9A 2W22A 1D4FA 1N77A 4D44A 4MI1A 1R0ZA 4XGKA 2L82A 3E9ZA 4QE3A 2CXHA 1IEWA 3GPLA 1R66A 4U7DA 3GUVA 2IYUA 1WMFA 2W48A 4QEZA 4XIYA 5AM2A 4PSCA 2CLOB 2QX9A 4JEMA 1XTVA 4IIUA 2HK9A 4WNAB 3WHLA 1YBFA 4MH0R 4RKRA 4B31A 4ETNA 3SQOA 1HSZA 2FQYA 2H11A 4UNIA 4LS3A 4MQFA 2X7HA 5C3UA 3KBOA 2DQSA 4L4SA 2Z8XA 2IXEA 4LDJA 2AEJA 2YR0A 1ECPA 4RABA 3AEQB 3THRA 5M3BA 1XJCA 5COAA 4AF7A 2Q9BA 3ZZNA 2RGRA 2CLCX 5CXUA 4JC8A 1ZU4A 2ZK7A 1OY1A 1M2KA 1XYVA 2PJDA 1E9CA 4CM5A 4PM4A 4AKEA 4YUVA 1XMVA 1JVBA 3GQVA 3L6EA 4HAIA 4XTRA 4AJ4A 4CT0A 4EEKA 1HDXA 3D31A 2FE1A 3G0IA 4I4IA 4RNCA 3UF0A 3D5TA 3UWDA 5B3LA 4JVMA 1XMOB 2RKBA 3AJ9A 4GM1A 1PJ3A 2W6ID 4EK9A 2BR5A 5CDHA 2NXCA 1X8LA 2AOTA 3NTRA 4EMSA 1JLMA 4ZRNA 4Z4FA 3LWDA 4R1PA 2X4LA 1YE5A 3IMEA 1QE0A 4KQWA 3TEFA 3I0NA 1BKDR 1AM4D 5B7QA 1GTVA 4BNZA 4K05A 3R9KA 2H7VA 5DH9A 3BF7A 2AFHA 4HGRA 3RKRA 1VLHA 3WV5A 2VDLB 3BBPA 1RT9A 4UAGA 4HRAA 1GRVA 2HHJA 4TYWA 3CLSC 3L6OO 3HGQA 3V8PA 3BIXA 5JANA 2GXAA 2QHXA 4X6UA 2HADA 2F64A 1HKUA 3PTLA 3L8YA 3NHMA 2FDRA 1FBNA 4YYZA 2C2HA 5KZMB 4MGHA 1FA9A 2R9VA 2CXOA 3E58A 4CR8A 2EERA 1SG6A 2I6FA 1DQZA 1JB9A 1HE3A 4Q7KA 4BATA 3RI3A 4DDUA 1DMRA 1GSHA 1ID8A 5AVVA 3QYAA 3PKJA 4D7AA 3UBMA 3UOGA 3DYVA 5JR3A 2OXFA 3OJXA 2MOKA 5EKDA 4XH9B 2XA2A 4QXQA 3UJ8A 3D2CA 3CZQA 3P27A 3MPOA 1M3SA 5REQB 3B3JA 3S1LA 4F7DA 1Y98A 4JA2A 3WNBA 1BMFA 4RXUA 4EFNA 5BSKA 1KOLA 4MV3A 2O0KA 5IANA 4YHBA 4FKMA 5ELXA 3AV0B 4Y0VA 3M6IA 3ROZA 2FZCA 3E8XA 1EB8A 3SM3A 3CEJA 1T1SA 4WH0A 4YFVA 5JCJA 1HTWA 1YFZA 1Y4ZA 2BW0A 4QM6A 4OSEA 1JN0A 1B74A 2OCAA 3KJZA 3WLOA 1JSXA 3MWLA 5BMVB 3OJFA 4WJKB 5JCZA 1SB9A 1RYFA 2HLDD 1SD2A 1E3LA 1UFRA 2I4RA 2XUKA 3KKLA 5FCDA 1BU5A 1EGHA 1KAGA 2RI1A 3MT7A 1K7EB 4RSMA 3FBTA 1EXVA 4UDXX 2R62A 1VG0B 3EFBA 4FZJA 5FYDA 3GBVA 4FDUA 1M0EA 4J0GA 4M54A 3LPNA 5ALGA 1EFLA 1E2UA 2AJLI 1B00A 4HWOA 5ULLA 1OBCA 1G21A 3B82A 2EWWA 4TWZA 1U04A 2BBWA 2RGEA 3EDCA 3PHIA 4OP2A 3H6KA 4X61A 2VFAA 3KETA 4BB5A 1QZTA 1U28C 3M6MD 1B0AA 3IVCA 4PSDA 1GKIA 4E03A 2IH5A 3HFJA 4DSOA 4KHPB 3NHWA 2C96A 2F00A 4WZBA 5KWIA 3BMQA 3DF7A 3GARA 1W88A 2RH8A 1ZM4A 2JI8A 4W7SA 3WXBA 1IWPB 4XTCS 3L4EA 3SLRA 4F3YA 1K3TA 2I3AA 5DSZA 3FHCB 4G65A 3MYYA 1FLAA 2XBMA 1ZRSA 2J85A 1G5RA 2VQ3A 1ZNQO 2JLZA 1TJYA 1KORA 3NP7A 4BN4A 3TLXA 4FFMA 1VG1A 3D6HA 2ATCA 1A4RA 4X7PA 3VSAA 4O6VA 1QOQB 2HY7A 3CX8A 4J75A 4PBTA 4TMXA 2XWBF 1AMUA 3OZIA 4EYOA 4C2TA 2P9ZA 4AB1A 4G6ZA 4LYYA 3GQBA 3P0IA 2JDIA 1M2OB 3LTNC 2XYVA 1CV2A 1U8YA 4KPUB 2CLHB 1U11A 2VAVA 4B43A 1LBTA 2XD9A 4QSMA 2CEAA 3MAGA 3G7NA 1QHFA 4INAA 2J1LA 1BE0A 3TLAA 5AVKA 5E1BA 1Z5GA 4P0TA 3ZXYA 4F93B 1U0JA 1QP0A 3AETA 3M5WA 4E6EA 3DAPA 2D2EA 3R3JA 4C4SA 1M34E 3NWEA 5A3QA 5MGBA 4JBWA 4LSMA 2ZIVB 1CUSA 1G55A 2FX3A 4KMOA 5DHFA 1HURA 4J29A 3UHOA 3FDZA 5ESDA 4G5GA 1GPLA 2HH9A 5LMNB 2G36A 3KOXA 4O2AB 1TA4A 3AP2A 5HX7A 1JS1X 1PT5A 1YB5A 4RFSB 5K3CA 4P7FA 3D4PA 3HCRA 5EKUA 1IJFA 1PWXA 2VT2A 4RH0A 1DDIA 5DN9A 4R6WA 5B58T 3WL3A 1SUWA 4DRXB 3WKDA 1KI9A 2PBZA 2ZJOA 4DR3B 3ONVA 3ILHA 2HSEA 3MIZA 4XQ0A 1MF7A 2FSFA 1W4LA 2XUFA 3BCSA 4WCVA 1RYDA 3D5QA 3K5HA 3CJTA 2CMKA 3LBAA 2H85A 2GH1A 3O4VA 3PYXA 5GTDA 1EI9A 2M98A 3G9ZA 1FNSA 2AKEA 4TTTS 1DC5A 1SC6A 2A0UA 3ZGYA 4MVJG 4LSGA 4EG1A 3VX4A 3OICA 1XZLA 2HEGA 1T8YA 1X1TA 1N3YA 3OHSX 3RFTA 1L5OA 3K70C 1BRTA 2QYTA 3EDMA 4AKHA 3BAZA 4G8JA 1V5EA 2A92A 3ILYA 4MUEA 3USES 5IULC 5ED4A 1RPZA 3IAFA 3KYCB 2V9ZA 2A78A 4HYEA 4FHGA 3KJGA 1YA4A 1CDOA 4U2KA 4GI2A 1TVMA 1E2HA 1GADO 2DR3A 3NRCA 1ZD5A 3AI7A 1C0IA 3AU8A 3EG9B 3TEMA 1JZSA 4YRSA 1YHZA 2DPXA 2Y99A 1N8TA 1W0JA 4JU8A 5F7JA 3K0CA 5K8LA 3PDIB 1MABA 4DC1A 3IYLW 5E8JA 2JD0A 4WDRA 4KTVE 4RPCA 1Z2CA 1O95D 3WNDA 2ZDGA 3DNFA 5JAPA 3M2TA 2F3PA 3WYBA 4PZZA 1IOVA 1PV1A 3PVSA 1XNQB 2HJGA 1W4RA 3ZGOA 3HDHA 2K2QB 2C2MA 3F1KA 2QV0A 1UUFA 1A0OA 2OBFA 2HPHA 2V7UA 4HEHA 2WINI 3K2EA 2IYFA 2JGJA 4E5UA 4YCJA 4PO8A 1Z2PX 2MYUA 3MMNA 1FLDA 2VCEA 3NT2A 4IJKA 4MQ6A 3DVAB 2KWIA 3C1UA 4ZAZA 2I7VA 1XK7A 2JFNA 4FS3A 1DAHA 1ZMRA 3RWMB 2DHEA 4AKGA 1JSZA 2OLJA 2VAMA 4PBRA 3ZHUA 2LIVA 1PTKA 3P2JA 3AHDA 5E4JA 1W4ZA 4CMKA 3FOFC 3FY4A 4WCDA 3BKWA 2WD8A 2I1QA 1LU9A 1NNSA 2C9CA 3MJHA 3ZY2A 5DNYB 1EXNA 3N7UA 5KJFA 3IIMA 1KC3A 4A15A 4M8IA 3DNMA 1GGMA 2J0UA 2R60A 2OHIA 5DX8A 4PE5B 1ONSA 4QFBA 4CETA 2WG2A 2C4NA 2Q4TA 4D8VA 3IAUA 2OK8A 2R8EA 3IKJA 4OV6B 4ZWNA 3C3BA 4H6PA 2ZJ6A 4DT1A 3FTQA 2WU1A 4N5HX 4UM8B 1M75A 3R7FA 3AR8A 5IVDA 1IIRA 2REQA 1U8TA 1WMDA 2EV9A 1Z6QA 4MCHA 4TTJA 1PJBA 3G0CA 5H16A 2CNDA 3V48A 3F4KA 2C5BA 4FFVA 5F1OA 2Z56A 2JBWA 3G2MA 5EG5A 3PGKA 3R7LA 4AK9A 3WA7A 4EPTA 4BV9A 1L7BA 4PZAA 4DNFA 4W5NA 4UNPA 1U2DA 2E4YA 1OVGA 5AOBA 3KKKA 1RM4A 4QELA 1ML4A 4TUYA 3B5JA 1UJCA 2CN1A 4TOIA 3RHFA 2EFHB 4IGAA 2OSBA 3T5MA 3LDUA 3VKHA 1M6YA 1WB4A 4CCAA 2CXNA 4FFBB 4NZ9A 1RLIA 4Z8YA 2AI2A 1WDTA 2PVPA 4K86A 2C98A 3RU2A 1TM4E 4D97A 1L4BA 1QGUA 1W581 3IQZA 4TKLA 5C8VA 1JJAA 2Z5FA 3IAEA 2O7QA 5FI3A 3UXMA 4DLAA 1NBOA 1V47A 5DK6A 4KPFC 3ZZTA 1FUYB 3RSQA 2I8CA 1DBVO 3ZI0A 3ESDA 4QLAA 5B3KA 3Q4GA 3AJ8A 3DLPX 1P6QA 4GPAA 4ZPXA 4D4GA 1IZ8A 1SVNA 4B17A 5FV4A 1FSZA 5G4KB 2Z4TA 5M2QA 3T4EA 3R0QA 4PAOA 2VHXA 4RGBA 4PCLA 2WKWA 5I51A 2AF3C 4I3HA 1PJ8A 3OG9A 3QKTA 5K0TA 4XPZA 3L1VA 3JZMA 2PT9A 3A9TA 5TRTA 2J9FB 3LXXA 4P82A 2OA0A 1ILEA 4FGZA 1D2EA 3O26A 4KC0A 4R8LA 1R6XA 3VXKA 4KUHA 2HNKA 2X4DA 3BWDD 4LSZA 4O33A 2CLMB 5KAPA 4WBNB 1E7YA 5LJIA 1LLCA 2ZI3A 3DR5A 4IOJA 5EWLA 1RSZA 4JLPA 3L8DA 3D4LA 4B6JA 5TIIA 4B79A 1SXJA 3QLJA 4Q18A 1PL6A 1TYCA 3IL2A 4XR9A 5CLFA 5KYNA 5UKDA 2V96A 4MB2A 2Q50A 4PSKA 2ESRA 4RCVA 1NMXA 2XWQA 4JR0A 4W5WA 1T0PA 2A5FA 2WG0A 3ZCRA 1ZD1A 4G86A 4DKXA 3T99A 3W3AH 1RHJA 3U3JA 3O4GA 2VRBA 4K6OA 3VYUB 5HQ3A 5K0GA 1WUHS 1MB0A 4UVIA 4YUXA 5J4LA 3I52A 1MOQA 1LTKA 3W1EA 1PG2A 1XL1A 1JDVA 1H4QA 4F60A 1VLMA 4N3GA 3FAKA 2P2ZA 3T4UA 2GD2A 5EMHA 3N8IA 2FX5A 4HEA1 1KI2A 2WPDA 5KEIA 1N2EA 1R9MA 1T4CA 3O8LA 3D8SA 3BAFA 3V7YA 3TLEA 5MHTA 2A88A 5FOWA 4JEHA 1CFZA 2A3RA 1L5SA 4NMHA 3TIIA 1U8ZA 4XWYA 2ZI5A 4YJGA 5JVDA 5HCNA 4DLSA 1I33A 4WPGA 4BNNA 4E09A 3CH4B 3DL2A 3QXJA 1B0PA 1REQA 3DL4A 1VC2A 2X6QA 1C9JA 3KIPA 1ESZA 2O9JA 3GU3A 2W0SA 4FN4A 4NCHA 2Y9MB 3F7OA 1K5GA 3PXCX 3PWKA 2GWRA 4MO9A 4DC9A 4C7OA 2FX2A 4BO5A 4NYMR 4BRWA 5DM70 2PQMA 2V4ZA 4KODA 5C18A 2UU9B 1K0FA 3PEVA 4G1BA 4CG3A 3R3SA 4H4CA 2OR3A 2PSSA 3EW7A 4RTPA 3ANSA 1V39A 4HMPA 3IO3A 4RKQA 1JKFA 5T67A 1I0ZA 2J31A 1MPTA 2WM8A 2FNAA 4DJAA 3RVSA 1R0KA 2NXWA 3QXHA 2P35A 4KUEA 5L53A 4X9XA 3IT0A 3C15C 2C2BA 3C6BA 3HB1A 4TL7A 2D5LA 2CL0X 2XTNA 1Y3FE 2EXXA 4HDNB 4RVFA 2C00A 2NTNA 2Y68A 4NCJA 3EXHA 3KV3O 1ZJYA 1WSDA 4H9GA 4R69A 4ZCIA 2DWQA 1KVSA 1TAGA 4Y9SA 5TQ0A 3RKSA 3INYA 1Z06A 2VUIB 3LKBA 5K01A 3H5AA 1UWCA 3HR4A 3NTOA 3SDBA 1GN8A 2W2OA 4C1BA 2IYWA 3HU2A 4M0CA 3QF4B 1S2GA 4E22A 3O4JA 3RK0A 2R47A 4XJSA 2WSIA 1FFXB 4UTRA 4S3MA 4B73A 5M7EA 3BE6A 4HAUA 5JS7A 3OIFA 1YZHA 4JCOA 4JYBA 4ZVKA 5F2NA 1WB9A 1H5NA 1DKOA 2BLLA 2PTGA 3TB6A 1A8QA 3WGLA 3W6UA 4N1AA 3NOXA 4AMVA 5DI9A 3U31A 5TPWB 5I8PA 4FZ5A 4JJ7A 2FR0A 4X8LA 5DBOA 4HNVA 5AKEA 1M5TA 1GV0A 3P9CA 4XQ9A 4FMCF 1SIBE 4G5QA 4NP6A 3VKUA 2OM6A 1RHUA 3JVVA 4BMPB 2R8RA 4B6PA 1RHMA 3S1AB 1KEWA 1XEXA 2JGDB 4M21A 2I33A 2QUHA 3FXAA 1KVUA 2GN8A 2COKA 3EMBA 5KAMA 3A28A 3OX2A 3VC2A 1QO9A 3ZQUA 4UEQA 3IDSA 1ZH6A 4AU1A 3GV0A 5HBGA 3HXOA 1ZNZA 4ESVA 4FNOA 4KVAA 5CVEA 3T7DA 2D74A 5D5HA 2D5BA 1CY0A 6PFKA 5K0FA 3ZV5A 4LDQA 1J4AA 3CF6R 5KJ6A 3HCWA 1MNAA 2Y71A 3COYA 3DXXA 1XUOA 2YKGA 3U4HA 4FE4A 1G7RA 1I1QB 2HLPA 3QOWA 2ZE6A 3MQFA 3UXEA 4RZIA 3PI7A 3HA2A 3WLRA 1GA1A 2HQOA 2AI3A 2DQYA 5DF1A 4J1QA 1VLJA 4I5DA 5CVUA 4MCAA 4GOKA 5AW2A 2QVYX 2IHZA 3M70A 1UQUA 2VG8A 5AJYA 2YZNA 1I4TD 3JR7A 4D8YA 3Q6MA 3PFWO 1TEXA 3EMKA 4UMVA 5EEHA 3FYUA 1QTIA 2CVFA 5C3MA 1YZ3A 3S7ZA 1A5SB 4TLEA 2GGSA 4GZMA 3TTSA 2ZB8A 4INPA 4L5AA 3HCAA 1TM1E 2SICE 4CM1A 1VSUA 2B4RO 4O2AA 2GFIA 2GNOA 3M6UA 1VGQA 1XZJA 3ND9A 3KM0A 2XXAA 3S99A 4R6XA 3K9CA 4FHFA 1GTJ1 3BBLA 3GEHA 1UINA