2ZRCA

Msreca q196n form iv
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 89
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrcA01
5KDDA 5FPKA 2XTZA 2J9RA 2QTHA 1VCIA 5DI9A 5JSZB 2HF9A 3AF1A 2ZYVX 2ZIAA 3GEHA 3I8XA 1OIVA 3DEFA 1US8B 4TYNA 2GBLC 1XPOA 4G5RA 2FH5B 1R0YA 3RHFA 5JEDA 2DR3A 4MITA 1IOZA 3RWOA 4MYTA 5CK5A 1ELOA 2R6GA 2F1IA 1XZQA 2ZVPX 5FUWA 2O8DB 1JJVA 1N6OA 2NPIA 5JHHB 4L8GA 4IDHA 4OK3A 4C0BA 2O8FB 3NC0C 4MUBA 4Q4HB 2GK6A 3M6AA 4GT1A 3LNCA 3X1ZA 2CCKA 2Z6VA 1DPFA 1HA3A 1L8QA 2VIIA 3A1VA 4MKGA 3HR7A 2FEOA 3AF0A 2WKPA 3OFNA 5FR2A 4D80A 2ZI6A 2BIFA 4JJKA 4IFEA 4BWYA 5CLQA 3LX5A 2A9KA 1G5PA 2RGCA 2H1LA 4QGFA 5AUQA 4Q7JB 2FWRA 2J0UB 1AQUA 1DE0A 1MRNA 4QXAA 1YZGA 3U60B 3FFAA 4IVPA 4OHWA 2UZIR 4HAUA 2AX4A 3U3RA 5K8TA 1F60A 1T6NA 3KZ1E 3DPUA 4HAWA 1SHKA 4CT4B 2VPPA 1NRJB 1Z6GA 1OPXA 3IHLA 2F3RA 4KAXA 2Z4SA 5FPSA 4PPQA 2ZEJA 3AKCA 1D2MA 1W36B 3WBKA 5FPYA 3U3KA 5JS8A 1XJ0A 4C0QC 1PUJA 4MUAA 1Q22A 2RH5A 4QOSA 2F43A 1W4BA 3BOSA 4FMBB 1OFTA 4CEHA 1I2MA 3CX7A 3ZQJA 2V7QA 1J90A 2XOKA 4DBLC 1UBEA 3ND8A 1NKSA 1KNXA 2IF2A 3TR5A 2H17A 1X86B 2BC9A 3EZ7A 4BE7B 2ZRJA 2WJYA 2AFIE 2PZGA 3DL0A 4B35A 4CEJB 3NH6A 2HXSA 3C15C 3CR8A 3FMPB 3L82B 1X6VA 3EWSA 4P4SB 3ND9A 4LBZA 4JT2A 1CIPA 4I1VA 1SVIA 2ZI4A 3QOFA 4M53A 1N5LA 2O8BB 4DLZA 5ELXA 2IA5A 5DYIA 1UJ2A 5F9HA 4PO9A 3W3ZB 1NN0A 1DAGA 2RMKA 4EDHA 3EPKA 3MD0A 1L7VC 1W36C 4MA4A 1MO4A 1RJ9B 1U2RA 3K53A 2WWGA 1JAIA 3FDIA 1YJ5A 1G7SA 1OYWA 1NY5A 2HUPA 3LD9A 2OLJA 5EXSA 3SBEA 4OI0A 2IXFA 5LBIA 1AIPA 1WCV1 1Z2AA 1CS4C 1E9FA 2IYLD 1CJTC 1UKZA 3VU9B 4DWJA 4A9AA 4F93B 5J47A 5KPDA 4DSTA 4OJKA 2QT1A 2JLZA 3BB1A 2O8CB 4OJQA 3I3SR 1XRJA 5AJWA 3HYRA 3T12A 1E9CA 4JLKA 1JECA 2ZJ5A 1NVWQ 5J4LA 3SOPA 1R4AA 3PUWA 3B13B 3PIRA 5KSYA 3CONA 1IY2A 1KJYA 4AYTA 3VAAA 2CVFA 3GFTA 1ZNXA 3FPAA 4LOAA 4AI6A 4PPNA 2QSYA 4TMXA 4DKXA 1ZBDA 1Z28A 1FFHA 1P62B 3NKVA 5HCNA 4UNRA 5FOTA 3GLFE 3UWKA 4EJSA 2IL1A 2SHKA 3CKLA 4JSYA 3R9XA 3TBKA 2JDIA 4JYBA 4I1SA 1VHLA 3LQRA 3CO5A 4PAQA 2J46A 3OIUA 5BYJA 2FEMA 3GLIE 1P9NA 1TQ6A 5EZ6B 1EWRA 1TQ4A 3EG5A 4JLAA 4PFSA 1QHGA 4B48A 3ASYA 1SKYE 1GKIA 2F7SA 3PXGA 4BLTA 4CF7A 2IS4A 3THWB 4TZ6A 1JPJA 2O5VA 4V0OA 4FXPA 221PA 2CHGA 4HB4A 1A1VA 3E5HA 3UPUA 1U81A 4EAQA 2ZJOA 1P2SA 1Z22A 4GOJA 4UNQA 4NDZA 3K0SA 2PCLA 4C0SA 1SXJD 5KSOA 1KI9A 2ZYTX 1LF0A 2ZPTX 1A2BA 4PZYA 4AC9A 1GAJA 1JR3E 1GL6A 2IS1A 4JS0A 1XCGB 5JI2E 1A2KC 2QEQA 4RD4A 2BDTA 1YE8A 1XTIA 2OBMA 4BZQA 1ZCAA 3LVQE 5JWHA 3PUZA 4TMZA 4C2UA 4M9XA 1G291 1R6BX 2WOOA 2RB4A 3MUFA 4B3GA 3AGQA 1KI6B 1G21E 1UDWA 2OEPA 2ZR9A 1NSFA 2OV2A 3NHBA 4M8NE 4TN1A 1FTNA 3VKHA 1CU1A 1SXJE 1W2HA 3UXMA 3WHLA 2DWOA 3KTAA 2A5GA 1G6HA 2OG2A 3M1IA 5H8WA 2ZUCA 1XU4A 4Q5IA 3LW7A 1CR2A 4TL7A 4M4SA 4LJAA 3TKLA 2ZJ8A 1G41A 4HAYA 2PJRA 3EW9A 4A0HA 3WY9A 3W8RA 1NJGA 2Z0MA 1VCOA 1XWIA 1Z47A 2D62A 1KSJA 3BWDD 1YR7A 3RRZA 1M2OB 1E1RD 3H1TA 3X1DA 2YNMA 1U94A 3PUVA 5FFMA 2BMEA 1QG4A 3CIOA 4Q4JB 3ZS8A 1QHYA 4PHTA 2GAAA 1UKEA 2WBLC 4ESVA 1IBRA 2J7KA 1ZVQA 3P1JA 4FD2A 4D4KA 2DPXA 2BBTA 4LYAA 3DMDA 2VP2A 3IEUA 3KKMA 1OFUX 3OEHA 3Q3JB 2MMGA 3W9YA 3DO6A 4EPYA 1PJRA 2WIAA 2FZ4A 2GCNA 2C03A 1G19A 2Q3FA 2ZE5A 4O0MA 1ZNYA 4M0LA 4RZ2A 1VYUA 3IIKA 4BUJA 2FJUA 1BIFA 4PO1A 2MMCA 3F5FA 1SGWA 5B2ZA 1NN3A 1SULA 5B64A 4B2LA 3T5GA 4BQSA 2A7QA 3PV0A 3LDAA 4ZCIA 1DAIA 3SFVA 3QNUA 3ZS9A 1DO2A 2XJ9A 1H8HD 4G5QA 5G40A 2D2FA 2ZRGA 3DZ8A 3IO5A 4URWR 1W5TA 2J59A 3PEUA 4LI0A 5CLLA 1RC8A 5SZHB 1JALA 4HLDA 4JLOA 2IHBA 5FPHA 1QHHB 2IYTA 2PBRA 3T1TA 1TQDA 3TSZA 3CH5A 4WZ6A 5LB2A 3IIMA 1Z6YA 2D7CA 4IVQA 2QMUA 1X8LA 3GPLA 2VSOA 1T5IA 2AKYA 2G1KA 4A8JA 2VF8A 2IF0A 1RIFA 3RS2A 1JR3A 2H7VA 1D6JA 2RGNA 1BS1A 1JB1A 1COWD 1GTVA 5AJZA 2OO7A 4GL2A 4I4LA 3SI7A 3VR2A 4NP6A 4GPTA 2WMOB 4RJLA 2HF8A 1KO4A 3T1QA 1E2DA 2OCPA 1OE0A 2AD1A 4NE2A 1S9DA 5CYOA 4PQYA 3I4LA 4Q4LA 5TB5A 4NL4H 3NVAA 4LYFA 3ZDQA 2PEYA 4B6EA 2ZU6A 1XEXA 4BFWA 1CP2A 1OH7A 5BXQC 4A8JC 3K09A 1SXJA 1ZD8A 1II8A 3RRMA 4F91B 4PZLA 2W58A 3OESA 1E1QA 5IF9A 2WAXA 4L4UA 1JQJC 2KBFA 3SNHA 3KKOA 3PENA 1T4GA 3T61A 2W83A 4BZPA 2D06A 4ESHA 2O8EA 1G17A 1KKMA 3MCAA 3KQLA 3ICQB 2XGJA 3NBZC 1IONA 1F6BA 2ZRHA 3ZLJA 1P72A 2VQSA 4EPRA 1RRFA 4DSOA 4Z54A 4FN5A 2RAPA 1GFIA 1ZW6A 2OXCA 4DZZA 4IDNA 4D26A 4P4TA 4ITRC 2XEXA 5DN6D 2FSHA 4DXAA 4F7WA 5LDDC 1YVDA 3U7EB 1VYVA 3ZD6A 1OKKD 2W6ID 2C9CA 2PLFA 2IYUA 1Q3HA 1GIAA 2CCGA 3C7KA 3GLIB 4MGYR 2XB4A 1D5CA 1G8GA 2ZUBA 3QKSB 1SKYB 4O3MA 1MKYA 4OHYA 5CJ2A 1YHNA 4MYUA 1XMSA 2PT7A 4XTCS 2CE7A 2VRWA 1P5ZB 2A3RA 1XZPA 3D6TB 5DSZA 2AHOA 5DE3A 2I1QA 1ZM3A 3MAAC 2EFGA 3QPUA 3KQHA 1Z63A 2ANCA 1G3IA 1G3RA 2WSMA 1T5LA 4G5GA 3GJ0A 2WJIA 3IIJA 3ZIAA 4HLQB 1G20E 1NNEA 3U3MA 4KO8A 4RKEA 3LW8A 1G64A 1R10A 2ZS9A 4TYWA 1OW3B 2IYVA 4Q7MB 4QL3A 1Z0AA 1F2TA 1NSTA 1EFHA 2QL6A 3GFOA 3ZGXA 1ETUA 1W44A 4A0GA 3IPYA 1ZUNB 1W0KD 4OKSA 3THYA 4M9QA 4TYPA 4U7DA 1XNJA 2ZR7A 2PZEA 4FI3C 1OXXK 3CX8A 4FIDA 4O25A 2C77A 2OBNA 3QIAA 2GEDA 2OAQ1 2WJJA 1WF3A 4ILEA 4JLJA 5EP1A 3AVTA 1P9RA 2QY9A 1FX0A 4ON9A 4YC7A 3JVVA 1U8ZA 4QNRA 3KX2A 3QY0A 3K1JA 4XIGS 3IILA 1EX7A 5CIWA 2J41A 2JAQA 2P2LA 3GEEA 4PSVA 2WV9A 3K0CA 4G1UC 4M1TA 3SC3A 1IXSB 3KXIA 4Z8XA 2QRZA 1E2EA 1N6PA 4GMDA 1E0KA 4PXAA 4F4JA 2UKDA 3RRYA 4URYR 1DARA 3IQXA 1S1MA 2AFHE 2D2EA 4RVCA 3ZZTA 1S4QA 2DFNA 2IYZA 1LTQA 2ZAMA 2Q0HA 5EE3A 2EYUA 2GF9A 1BMFD 1XEWY 4C7OA 2ERYA 4MRRA 3KKQA 2JJ1A 1KI3A 1P61B 4HLUA 1MV5A 1GNQA 2VHTA 4TL8A 4KFRA 4V0NA 2OT3B 3T35A 3B85A 3D31A 1CJMA 1NG1A 3S1AA 4QJ4A 1KJWA 2JLWA 5FOUA 4NCJA 3EC1A 1X1SA 4IDQA 4F92B 3NG1A 2CJWA 1T3HA 1W4RA 4HAVA 3EZ6A 1OHHA 4KBFA 4YMTA 4GFDA 2BJWA 4RZ3A 4Q1AA 4TTRA 4X8MA 2GXQA 2EFEB 4NCHA 2XNSA 3AVOA 3IBGA 1KAGA 4M1YA 4A6PA 1GL7A 3R9WA 3K0FB 4UNNA 1HT2E 2OXRA 1Q1BA 1CJKC 4A6XA 1NF3A 4TMKA 2BHRA 3ADKA 4TMTA 5BN4A 3RC3A 4PQRA 1GITA 5J5CA 2FN4A 2AK3A 2FX3A 4TLDA 1KMHA 4Z1MA 4GI7A 4FMCB 4URXR 1E0JA 3TVDA 1TUIA 3P20A 1U0LA 3B1VA 4DCVA 3AP1A 1NMXA 1KO8A 3OHMA 5EP2A 1SHZA 4WA7A 3ZZ0A 4H9GA 1Q20A 5AR1A 2NZ8A 2F1JA 4D2IA 2ODWA 1HY3A 4G01B 2H18A 5J4VA 2W6IA 1NVVQ 5B58C 1YZUA 2OFXA 4TT3D 4QKQA 3CPHA 3SQXA 1ESNA 3OFND 2FNAA 2PEZA 3A4NA 3BAFA 3O8BA 1G8HA 1CR0A 1SZPA 1MO3A 1OIWA 5JCPA 1HE1C 5D3MA 1KDTA 5DHFA 2GJAA 2XZPA 5AK0A 3QXXA 2BWJA 1FQKA 1AJEA 1J99A 1C4OA 1E3MA 1Z2CA 3GJ4A 4LJ8A 1M6NA 3QXHA 1VG0B 1U98A 3SE0A 3AH8A 3U6KA 2IHYA 5LB4A 3R7WA 5AJXA 1NP6A 2VBCA 1GSIA 2WJGA 2PLRA 1ZU4A 4CVNA 3CRW1 2VH5R 4DRZA 1XD2B 4ZDWA 4WAUA 4LY6A 2ZRAA 2RCNA 1RW4A 2V7QD 2GZAA 1WMSA 4QM7A 1WA5A 2QM8A 1I4TD 5EXTA 5H1YA 3SU8A 1NMYA 4GOKA 4QNMA 1J7KA 4FMDB 2RHDA 1G18A 4YDSA 2J0SA 1RRCA 4O2RA 2WWIA 1XEFA 1AQYA 1MOZA 4PX9A 2VP6A 3U44A 2IYRA 2L0XA 3EARA 1XEWX 1VIAA 5IRCD 1Z8FA 4MDEA 2ZRBA 1NG9A 3PCRB 3TLXA 3F8TA 2NO9A 5FL7D 3FB4A 3BE4A 4R9UC 4C30A 3SYNA 3GJ8A 1E9EA 2VEDA 4JMPA 1EXMA 2DCUA 3KB2A 4HSEA 1W4AA 2ZUDA 1KOFA 4IEIA 1R5BA 2BJVA 3FTQA 3K9GA 1G5TA 1ZD1A 4B3XA 4US2R 4LCBA 4HUQB 1LW7A 4TSFA 5JSZA 2BMFA 2YWFA 3QF4A 5EE9A 4TL6A 1V5WA 721PA 5E7MA 1JBKA 1GOTA 4QHTA 4RCYA 1XDBA 3WYFA 1U9IA 4HZUB 2KE5A 2YINC 3RWMB 3MWJA 2HYDA 2PT5A 5GJCA 1J8YF 3MSXA 4WZAE 2IYYA 3LH5A 4MRPA 5F3WB 2O8DA 4BFSA 2QUZA 5E7JA 2BM0A 2O8FA 1H8EA 2IUTA 4L9WA 2P3SA 1IQPA 4DEYA 3KXKA 4MKIA 2ZAOA 1FTSA 2VHUA 4XOIA 4YONB 2MSCB 3AB3A 3WNCA 1ZCBA 4EPVA 4QJ3A 1LY1A 2FA9A 3MFYA 5HKKA 5KOYA 3TVTA 3C14C 1TF2A 2AWOA 4IJMA 4P4UA 4HUTA 4DDTA 2ONJA 1UPTA 3ETLA 2J0UA 3G0HA 2NOAA 2GXUA 4MRVA 4Q03A 4E22A 4AKIA 4EPTA 2V6IA 3AQ4A 1SVWA 4MRNA 1FP7A 4KI0A 3DKPA 4OQMA 1UBCA 2A5DA 2ZITA 4EFMA 2OHFA 2R6FA 4IEEA 4URZR 3GMTA 3FGNA 1KJZA 5H70A 2IWRA 1KI8A 5FI0B 3VR4A 4V03A 5EZ5A 2B8WA 2PZFA 3AEZA 1V43A 5DYGA 1DTSA 5FPTA 1FZQA 1ONBA 2GZDA 4FW9A 1HYQA 1D2NA 1UKYA 2RGGA 1F48A 4B2IA 1OH8A 2FG5A 3KQNA 1LFDB 4NH0A 1TU4A 4RD1A 1UKVY 2QRNA 2ODNA 3AF3A 2REOA 3KXLA 1OH5A 3QXSA 4AG6A 2ORIA 1AKEA 1TX4B 2XAUA 2GJ9A 4NYJQ 1EFRA 4G5OA 4AKHA 1IXRC 1CULC 1SVOA 1UM8A 3QKRA 4JBWA 4KV9A 4DT1B 2FFQA 1P60A 4OYHA 4XSGA 2IXGA 1E2GA 2E9SA 4ZO4A 1WE2A 4F4CA 1N6HA 1M34E 2R44A 4C0AC 3RVBA 1TL7C 4TT3A 1LV7A 4K8OA 2JLUA 3GD7A 1FUUA 1P2VA 3SYLA 2V8OA 1DAMA 2QMHA 4D4LA 4MYHA 2PL3A 4TQAA 5FBWB 4DIDA 1CLUA 3U7HB 3L0SA 1Y3AA 3ICEA 3LLMA 3Q5EA 4Q9IA 2YOFA 4RKFA 3VHXA 3SJCA 1E96A 2ZRCA 2CEAA 3UWOA 2WIBA 4ZIRB 1AZSC 1QG2A 1AGPA 1KDOA 4LC1A 1KDPA 1XX6A 3CF2A 3Q9LA 3LX8A 4PQFA 3GP8A 5EE5B 3T34A 821PA 1E0SA 3VU9A 1S9HA 1OB5A 2N46A 4KHZA 1HURA 4WZBE 2VL7A 2A30A 1P6XA 1E69A 1ZNZA 3F3YA 4X8HA 4ABYA 1T9HA 5E3HA 2ZROA 1BO6A 3IUYA 3N70A 3TSOA 3VR1A 3T15A 3RABA 4NCIA 3VR6A 1F2UB 1VCMA 2XX3A 4NHOA 2JJ2A 1SVSA 3I8SA 4DCSA 2CL7X 5J40A 4RY2A 1XCMA 3KB1A 4MQBA 1OH6A 2QPOA 1G4UR 3KJHA 1II9A 4HDOB 1OIXA 3OEHD 1KTVA 2ZRNA 4BFXA 2CHQA 1EFUA 5FL7A 3VHLB 1DVRA 4D81A 2F1RA 3L8ZA 3B8HA 2Y8EA 4M2LA 2PMDA 4KVGA 4NKRA 2F3TA 3U3JA 2IW3A 4C0KA 1KO5A 4MGIR 5HCIA 1YU9A 2CLSA 4DJTA 3L43A 4ACBA 2VF7A 1A82A 3CX6A 4MKHA 2ONKA 1XJQA 2JJ8A 2LKDA 1MRSA 3TUZC 3BERA 4NCKA 5C4GB 4NYMR 2OSBA 3T5DA 5BYKA 3THXB 2JLQA 1N3BA 1E9SA 2WTUA 1SQ5A 4L16A 5JJKA 1NJFA 3BB4A 2BM1A 2GILA 2FGKA 1DAHA 1P73A 1HQCA 3GFPA 5JI3E 4TLCA 1E2QA 2W0MA 3CW2A 1RKBA 3VNVA 4NPHA 2OFOA 1RYHA 3LY5A 3TW8B 4KFSA 4OHZA 1KK1A 1VTKA 2BMJA 2BKEA 4C4PA 4LBYA 3WNDA 4JLNA 4QJ5A 4D6PA 3FKSA 3AUYA 2QBYA 2ODEA 3MRSA 2PJZA 4FCWA 1K8RA 5CDFA 5JMTA 1BKDR 2WICA 5L3RA 3WMFA 1JR3D 5SZJA 1Z6XA 4D4MA 1LVGA 1ZYUA 4B3CA 4CEHB 1R8SA 2YV5A 2IC5A 2YZ2A 4M1KA 4RD6A 1U0HC 2QQ0A 2OFWA 3K9LA 4L5BA 1P2UA 1KNQA 2IBMA 5EJEA 4UNSA 3UMRA 4NZYA 1KSFX 1DEKA 1KI2A 1JXOA 1X3SA 3L0IB 1QVRA 5KNDA 2FGJA 4K46A 3EPHA 3W3AA 3I5XA 4OI4A 1IJEA 4AYXA 5KDOA 2QE7A 1WBDA 1XB2A 1W49A 3PEVA 4YXWA 3K70B 4BECA 6Q21A 4BFZA 1ZUHA 1E1QD 3CNLA 2BCGY 2GJSA 1XXHA 5DHAA 4Q4AB 3ZYCA 5GJVC 3GLHB 1QRAA 4Q9LA 2IYXA 3AGPA 2AR7A 4Q9JA 3GLGE 2NZJA 4TLEA 3NBYC 5D3QA 4E09A 5JHGB 4TTQA 1AS3A 1AS0A 3JVUA 3OEEA 4NYIR 4DIEA 3A1UA 2JA1A 3NWJA 3NEJA 4JBYA 1UFQA 4JLMA 2R6DA 4UKDA 3PVSA 4M22A 4TL9A 3OIVA 2GEVA 3VKGA 1NL3A 3CWQA 3K70C 2D74A 4N0DA 2VYFA 3EWAA 4II7A 4C2TA 1GZSA 3TQFA 3CWZA 1E2PA 1CTQA 4OK6A 2BEJA 1ZP6A 2NTYC 4LJYA 5TV2A 3SJBA 1WRBA 2ZI9A 2RHMA 3MJRA 1QBKC 1AM4D 2Q3HA 3QEOA 4EJSB 4Q1FA 1NLYA 3T1VA 4A82A 4W5HA 4LJ9A 4E03A 3HU2A 3ZIAD 2CLCX 3IQWA 2G88A 3C4JA 5IT5A 1L4UA 5HPYB 1YRBA 1R5OA 2IUSA 3GJ5A 5JS7A 1HE8B 1VHTA 1EFTA 2J7PA 3TUIC 3NDPA 5FTJA 3HU3A 4HI0E 4R2HA 4Q19A 3QXCA 5GVRA 2XXAA 3A1WA 3OZXA 2QG6A 4XSHA 1R5NA 2D4HA 4WW0A 1G8PA 4LC0A 4S35A 2OILA 2YWEA 1E2KA 2CL6X 4H1UA 4POAA 1T8TA 2IX3A 5UKDA 3VTKA 4BLOA 3GEIA 2NO7A 1CRPA 3Q8XB 5L8VA 4EJSC 2CNWA 2RGEA 1VMAA 1GG2A 2ATXA 2N42A 3LBNA 4TYYA 3UANA 1QHNA 3VQTA 1BYUA 4RD0A 3GJ6A 3CB4A 4MH0R 4OQNA 3CZQA 4OK5A 2K5UA 5AUNB 1UF9A 2R2AA 3BS4A 1AA3A 1E4VA 2C96A 3AP2A 2EFDB 3CZPA 3L0PA 3KTAB 4Z8YA 1N5IA 4OQLA 4C0HA 4Q21A 1GUAA 4N3NA 4ZDKA 4BGDA 1ZMXA 2GF0A 3CBQA 1GILA 5H68A 2X2FA 2WVJA 3PEWA 4YMUA 3TW4A 2VHCA 4B3DA 1KIMA 4DB2A 3W8NA 1CR4A 4IOJA 2ZI3A 3FVQA 3AVYA 1DO0A 1R7RA 3HYTA 2ORWA 2VP4A 2X19A 3OE7A 4JLVA 2JJ1D 4UJ3A 2WKRA 1U90A 1IAQA 3QKSA 1WP9A 2ZM5A 4AY2A 1Q1QA 2YKGA 2DB3A 3IKJA 3GLGA 4BPBA 4M1OA 2X77A 4D0NA 5JRJA 2A2ZA 2A5FA 1A5TA 2YYZA 1R2QA 3QQ5A 3W5JA 3X1XA 4AURA 1E0AA 3HWSA 1IN7A 5LPNA 2H8KA 2YOGA 3H86A 1OHHD 4GZLA 1ZM9A 4A15A 2MSDB 5G3YA 4B74A 2CCJA 2FSIA 4D0LB 2ZRMA 4LK2A 4JBXA 2B6HA 3BXZA 3I32A 4UXHA 4ARZB 2C9YA 3AM1A 1RPZA 3FMOB 2HV8A 3RYTC 3KFXA 3PFIA 2ORVA 2QA5A 3GJXC 2C95A 4PHGA 4ACAA 4BASA 1GWNA 2P6UA 4Z1MD 5IHPA 5DI3A 3BRWD 3FFBA 1P7CA 3NC1C 2WWHA 2XSZA 2QORA 4ZCMA 4IXNA 4L9SA 3ADCA 3GLFB 3KDSE 4WOPA 1XD8A 2P5TB 4DUGA 2FMXA 2I4IA 4TYQA 3DM5A 4LHVA 1Q1ZA 4B44A 1MR3F 3KFVA 2KI5A 3KKPA 4KODA 2O0KA 2I3BA 3QVUA 3SJZA 4OHVA 4KBGA 1AS2A 5GJWC 2FZLA 4QG7A 2QSZA 1OLOA 5KDLA 2PCJA 2XZLA 3V4FA 2EU8A 1VG9B 2VTKA 3RRNA 2E1RA 1NN1A 4A8JB 3FYHA 4NMMA 3NBXX 2Q9AA 3UMSA 4C9BA 1TEXA 5FUYA 3DHWC 1K5GA 3QF7A 3LRPA 4OI1A 1NIJA 3I5YA 1SVLA 1X1RA 3RNLA 1EESA 3QBTA 4HAZA 4RFVA 2NO1A 1ZNWA 1M7HA 2REXB 2JLYA 4HDQB 1RZ3A 1XF9A 3B9QA 1YZKA 5HZKA 1XEXB 2OLKA 4I1UA 3TMKA 3ONWA 3RDPA 2AK2A 1SXJB 3QG5A 1BH2A 2I1VB 4ZPXA 3SDZA 2AWNA 5BWMA 1TAGA 4KVAA 4YMWA 2QAJA 2LWIA 4UNPA 4JL6A 5L3QA 4CRWB 1D8TA 3LFUA 3IDQA 2O8EB 1Q3TA 2P0EA 1G1MA 2Q6TA 1YZNA 3IBYA 1NLZA 1K5DA 2ZSFA 1EG7A 2CVHA 1JEEA 4L15A 3BGWA 4TMVA 1B0UA 4DLTA 1OFHA 2IYWA 1Z08A 2KJQA 1R0XA 4PAOA 3RSLA 5CB6A 4YMVA 3D7MA 3T06B 5GJBA 2MSEB 5EQTA 2BBWA 3R20A 2VP9A 3KL4A 4Q1EA 5FI1B 2ZU0C 1DAKA 4XVRA 3EC2A 3W6PA 2REBA 4TSFD 1ZM2A 2WJVA 2QQEA 3UG7A 3PUYA 2ZS7A 1E9RA 4DDVA 3MMPA 5JECA 3IHWA 1VCNA 2ZYWX 5EUMA 1SXJC 1KI4A 2QGZA 4BFVA 5G53C 5JLJA 2FDCA 1UBGA 2GVZC 4TZ0A 3QKUA 1G3UA 1S8FA 1YRAA 2CL0X 3B2EA 3CF0A 1H8ED 4LPSA 4GSYA 4J0QA 5BN3A 2ZXUA 5FH9A 2Q9CA 3N5CA 5BQ5A 4PO8A 2WJHA 1W4CA 3F0TA 1Z0FA 3A58B 4EQ6A 4PC2A 5HKKD 2WSSA 3BK7A 4CW7A 2G3YA 2YOHA 3MGCA 5FTLA 3H2YA 2IEZA 2XJ4A 4LHWA 5KNBA 3BFKA 3QPWA 4V0KA 5F9FA 5JBQA 4CEIB 1YZTA 2HLDD 4B75A 2NIPA 3O8DA 3QXJA 4QHYA 1TUEA 4OBEA 2JLXA 3VX3A 1X8JA 2NO6A 3QEJA 2CK3D 1DG1G 1XMVA 1F2TB 1VPLA 2C04A 2Z43A 3K0EA 4JSTA 3THYB 4RD3A 3TAHA 1GL9B 3N2IA 2WAYA 4DCUA 2QU8A 3C16C 3LLUA 1I4LD 3ZVNA 4B32A 1W36D 4A92A 3NDBB 1KMQA 2BV3A 3QPVA 1T3SA 1UADA 2XNDA 5P21A 2OCBA 4WXPA 3K9HA 2RGBA 4FMCF 4F4IA 4V0LA 2NG1A 3P32A 1LB1B 2QAGB 3GJ7A 3A36A 1EFRD 5LD2B 2W6JA 2PX3A 2GESA 2ZSAA 1Z0DA 5C2JB 1FX0B 3TQCA 3MJHA 4AWXA 3CRRA 3QE0A 2IYQA 1S3SA 3KJIA 4M9ZA 2NGRA 4HZIA 3MWLA 4D4JA 2V1XA 1Z29A 5EUQB 4CYMA 1YR8A 2WWYA 1SKQA 1Q1EA 5HR5A 4KSBA 3DMNA 3SS8A 2ZI5A 1VDZA 4QBHA 1IN5A 4A2QA 4IOMA 2ZR0A 1E32A 1TPZA 3SBDA 3UMFA 2G0TA 4DSUA 3U4QB 3B1XA 2FPKA 1KZGB 2GXSA 5CM9C 5FBRB 5CB8A 3WRYC 4C7OB 4D82A 1T0HB 1MO5A 4HUQA 4LZZA 1Z0JA 1IJFA 4ZI2A 2QTVB 2X2EA 2QZ4A 4HB0A 4RFSA 2QAGC 5FTMA 4MGKR 4TMWA 1P4SA 5LD2C 4BFYA 3UATA 3A8TA 1XMJA 5KTYA 1G3MA 2OESA 3WP1B 4YDHB 1XP8A 3BIFA 1HUQA 5C18A 5J4HA 1KY2A 4QGGA 3VFDA 2W0SA 1E2JA 1YZQA 2FOLA 3QG1A 1W46A 4Q1DA 2CJWB 4B43A 3K0CC 1UAAA 2PH1A 4JL8A 2NMVA 2GBLA 3WBJA 2IYSA 4KITB 4P33A 3A1SA 3C5HA 4FMDF 1PV4A 2JGNA 1I2DA 2FV8A 2JJ2D 1YR9A 2GCOB 2OM2A 4HEJA 2NQ2C 4PSKA 2P65A 1OT3A 1N0UA 4LWZA 1CXZA 2GDJA 2JLRA 4RSGA 2EFCB 3CF6R 3TSWA 4AK9A 2QP4A 1PLJA 4FWIB 1D9ZA 1KMHB 3J81k 2EYQA 4QM6A 4H1VA 2H16A 3LBHA 2VSXA 3RS3A 4I99A 3R9IA 3H84A 5F2EA 4WVFA 1M74A 2JCSA 3K0AA 3Q7PA 4IVRA 1M8PA 4Q7LA 5TDHA 1HTWA 2V4ZA 1Q44A 1M7BA 4JVLA 4PPFA 4Z51A 4ZKDA 1F5NA 3REGA 3K8YA 3C41J 5KYKA 1US8A 1OF1A 3CRVA 3AVPA 3WYAA 5AUOB 4M9SA 1VIYA 1Z83A 3U5ZB 4IDPA 3HR8A 3KKNA 3BJIC 3T1OA 1E79A 4DT1A 5D3MB 3EZ2A 1PLKA 2UZ3A 4RCZA 5E4FA 2DY1A 1MABB 1DOAA 1SVMA 4GP6A 4Q4HA 2G9NA 3U3OA 4XWOA 3CNOA 5JFGA 2ZANA 2HCBA 3UKDA 3FWYA 3IPXA 4HAXA 3ASZA 1QHIA 2P67A 1B23P 4LSGA 4A2WA 1GP2A 1WXQA 3FKQA 4RZXA 3QUSA 4JZKA 4B2PA 3AVXA 3R7WB 5L3SB 4XH9B 3EIEA 2HYIC 1HT1E 3D8BA 3FKSD 2QGNA 2C98A 2HLDA 4XTRA 5DO9A 4ZIRA 1P9WA 3W5IA 1KHTA 3I1FA 3VR5A 5K8LA 1IM2A 3CPEA 3EASA 3G82C 1G9XA 1VG1A 2CK3A 3DVLA 4BEBA 4EFNA 4DLVA 5EXPA 3HU1A 2Z83A 2P5SA 1XMIA 2GWHA 2ZRLA 1O87A 1P75A 1Z0KA 1SVKA 2DFLA 1Q21A 4P3YA 1GNPA 4QGHA 4KU4A 3W6NA 2WPDA 4PTLA 1DG3A 3W90A 2AXNA 3BORA 4QBGB 3U44B 2LKCA 2ZSBA 5FOSA 1KSGA 5JJIA 2Q3MA 5E95A 2O0HA 2QE7D 3REFA 3TIFA 1EWQA 4ZDIA 3QENA 1GRQA 3EXAA 1U8AA 4RZUA 4YXWD 1W5SA 2GVDC 4LPKA 4YLGA 5CDFE 1F2UA 4TLBA 2GTPA 1RRGA 4FCTA 4MYCA 2J3EA 4CEJA 4F38A 1IN4A 4EIWA 5FUXA 2FU5C 2ZE7A 1EGAA 5TVKA 4P4SA 4Q9HA 1Z07A 5CITA 4KCGA 2FFAA 1NI3A 1OFIA 2H57A 3TE6A 3QF4B 3AKEA 3B78A 3ZVMA 4LYHA 2O8BA 3A4MA 4B34A 4BEJA 3W6OA 2AL7A 1DAEA 1TEVA 2CHVA 1KI1A 1D2EA 2O52A 3OEED 3SQWA 2EFHB 4JVSB 1NIPA 1KO7A 2QNRA 1W48A 5EP4A 1RJ9A 2VSFA 1XTRA 4FINA 1PUIA 4KJZA 3B1ZA 1P2TA 4TQ9A 1EFCA 1XXHE 4KLNA 5EP3A 4PR0A 1ZAKA 3FHOA 1RE0A 2XB2A 1JI0A 1OXSC 3RAPR 4MKFA 4LV5B 3PJRA 2O8CA 1NKTA 4PC6A 4Q48A 3THXA 3EPLA 5JCZA 1D9XA 1JQLB 1LS1A 4LBWA 1FNNA 2BOVA 1T91A 2CXXA 4PHFA 1R8QA 2F9MA 5HE9A 3AUXA 2JLSA 4Q9KA 3W34A 3EZFA 3DDCA 1NN5A 1E4YA 2YHSA 1YKSA 3O8RA 1U9IC 4BLPA 3OIWA 2D7DA 1Z3IX 1ZU5A 3AF2A 1TNDA 1J2JA 3Q5DA 1UEIA 3EA0A 5M04A 2VHQA 3PEYA 3GQBA 1N6KA 2OCAA 1T0JB 2J7PD 2ZE6A 4BRUA 621PA 2G6BA 4IOKA 5K8UA 3BH7A 2XZOA 2FSFA 1M7GA 5KPJA 5AJYA 3NHAA 1EX6A 3QKRB 1XCPA 4DHEA 4R2IA 2PMKA 3THWA 3BC1A 1CEEA 2IS6A 2GHIA 4IFBA 3I92A 1N0VC 3SN6A 4BLSA 3Q85A 3X1YA 3AVVA 1W0JA 1HV8A 2CNWD 2QTFA 3TJZA 2EWVA 1S0UA 1RRPA 5A4JA 2VO1A 1XTJA 3E1SA 1XTQA 5C46F 1FW6A 5SZKB 2TMKA 5IK2D 2GRJA 3RSOA 4DDWA 4A2PA 5B57C 1N6LA 3WP0A 4LYJA 1OJLA 4Q4AA 1GRNA 2YWGA 3AVQA 3LV8A 3GLHA 2RGXA 4QFMA 2JATA 3V9PA 4NYMQ 4G3XA 1G7CA 3BD9A 1OB2A 1KI6A 4Q47A 5JZVA 4E5UA 1T8UA 2AD5A 4DLUA 1KAOA 2R9VA 3EAQA 4HB3A 2JIZA 2NO0A 1MO6A 4P32A 1W2GA 2DFTA 4V02A 3U2QA 1G6OA 1UDXA 4PC7A 1G4AE 2F43B 1NBMD 1FOEB 3LO5A 2BVNA 4UXJA 3CPJB 5FL3A 1J8MF 4B73A 3OE7D 2BEKA 1OSNA 1IXZA 1MH1A 2ZI7A 3FHCB 2ZRKA 1ZD9A 5FOVA 3SEAA 1HEIA 4XVUA 4XWKA 2JLVA 5TXGA 2BMDA 3OAAA 3VR3A 3ZVLA 1E2HA 1XJCA 5J4YA 2IT1A 3RS7A 4D25A 4WIAA 4AYWA 3WMGA 3L0OA 1HQYE 4JKYA 4QBIA 4ZDJA 2DFKB 4YQFA 1E2FA 3RS4A 1OV4A 1KY3A 3IEVA 5TARA 1R0WA 4Q4JA 4Y0AA 421PA 1NBME 1WB9A 2R6AA 1G8FA 5L3VA 2QROA 1NY6A 2HDNB 1QHXA 1DADA 5KUTA 2ZETA 4M1WA 3MG9A 2WKQA 2WWXA 3FMIA 4KSCA 3NIBA 1E9DA 3HPQA 4QC2A 4GDFA 2H5EA 1JXMA 4NTZA 4LV8B 3WXMA 3V4RA 2BBOA 2ERXA 1Q12A 4KLZA 2XSZD 4BFTA 4EFLA 2J87A 3CH4B 3LVRE 4NCNA 4DUGD 3CUEF 1G7TA 1E2IA 1WDTA 2BBSA 1G8YA 2FF7A 2Z4RA 3UIEA 4DB4A 4DCTA 1A4RA 4JL5A 1FPMA 2PX0A 3HDTA 3BBPA 3TUJC 1IN6A 1JAHA 5FOXA 4NYIQ 4CIDA 1RFLA 1A7JA 3WYGA 4E07A 1U8YA 3SR0A 2J0QA 3BB3A 2GKSA 2GK7A 3M4YA 4R71A 1JR6A 4W5WA 4OL0A 4GNKA 3FE2A 2JASA 4EPXA 2DWPA 4DCNA 4US1R 2ZSEA 3CRQA 4JVMA 4LX0A 3ZH9B 2QBYB 5FTNA 4U02A 4P0TA 5CJPA 2QI9C 3TNFA 1NVXQ 3NBFA 3OIYA 1R0ZA 1QHHA 3VNUA 2WM9B 3A1TA 3I73A 3JZMA 1KDRA 2ZRPA 2FSGA 521PA 2IEYA 5AWFC 2RGDA 5DNYB 3DM9B 3X1WA 3LXXA 1GM5A 3NXSA 3DZDA 1AZTA 4RD2A 4AKEA 1IY0A 2CLDX 1N5JA 4QHSA 2IWHA 1FP6A 1TF5A 2YC2C 2ZQ5A 2G83A 4IXMA 2DBYA 1IHUA 2G1JA 4BLRA 2B7CA 4B6FA 2YJTD 2HJGA 2ZJYA 1AGRA 4ZCLA 1AK2A 3PUXA 4EKDA 4C0LA 4ZKEA 1XXHB 2RGAA 3UK6A 2V54A 2F6RA 3R8FA 3ADDA 4Q00A 1I4DD 3ZZUA 5C4MA 4N1AA 2ZJ2A 1AA9A 4D0GA 2HJVA 4ASUD 1TMKA 4M1MA 5K8IA 2G0NA 4S2EA 3MLEA 5IK2A 3GCGA 4A4DA 2GJ8A 4DLSA 1JJ7A 1N0WA 4ARZA 4B47A 1GKYA 1Q0UA 1RYFA 1W47A 1J70A 2QP3A 3B6EA 2HXYA 2V6JA 1L2TA 4KFTA 3B1WA 4W9MC 2GETA 1QHSA 1PVOA 2A5YB 1YQTA 4JLPA 1OYYA 4DDUA 3B9PA 1E6CA 1KKLA 3HP1A 2XTMA 4CDGA 2CBZA 1P3JA 3CM0A 2JEOA 2DHRA 4JIMA 3K9NA 4YMSA 1DS6A 2R62A 4GBMA 2FPMA 3GLFA 2ZREA 3A37A 4MGZR 5BW8A 1TF7A 2QP9X 3AVUA 3TGPA 3SHWA 2ZSDA 2R65A 1NBMA 1Y63A 1FL9A 4LHZA 3Q72A 5FBVB 3GLIA 5FOWA 1CR1A 3QVVA 2R6CA 2V1UA 5JWOA 1ZM4A 2BCJQ 3IO3A 4Y0VA 2QENA 3BH0A 4V0ME 2WSSD 1AN0A 1F3OA 4PPGA 1NLFA 2Q21A 4G5SA 2D3WA 5TY0A 3EA5A 2EVWX 1JEDA 8OHMA 1G3QA 4DLXA 1CRQA 3AVWA 2YC4C 3G5UA 2QN6A 1GKUB 5EXXA 3MWYW 1T3LA 4BFUA 1GNRA 3PITA 3QKTA 3I61A 3KQKA 4KFUA 2J0VA 1KI7A 2P6RA 3TRFA 3TK1A 3RS0A 4DEXA 1FQJA 2EQBA 1GDDA 2XXAB 1G5RA 1XTKA 5G3ZA 3EIQA 2XITA 3QI2A 2QMEA 1E9AA 4IHQA 5HZHA 1C9KA 3B1YA 4PZZA 4KYIB 2XNDD 5FUVA 3EX7C 2QPAA 5E7IA 1ZINA 4I81A 4P31A 4C0JA 1YR6A 2B7BA 5KNCA 1KGDA 1KYIA 1VYTA 1ZIOA 2W6JD 3P4YA 2ASEA 4OQXA 2HT1A 4MRSA 2ANBA 1E2MA 1M1YE 1DELA 2KB0A 2VHJA 2YVUA 2OUKA 1CJUC 1GVNB 3I72A 3LAWA 4DVGA 1BYIA 5FR1A 1KK2A 2DYKA 1KSHA 3C8UA 3I62A 3BFVA 1XPUA 3U7FB 4IKEA 2FPLA 4TQUS 4EPWA 2Z5FA 3GJ3A 1XBTA 3KUDA 2IXEA 5BN5A 1UBFA 4LRWA 4R7ZA 1ESMA 2B92A 1QDEA 4OHXA 1E9BA 1LF5A 3E2IA 2ZVQX 3NTUA 2AKAB 2AN9A 2WHXA 1VKJA 2HCJB 4BLQA 4ERNA 5GVSA 2OBLA 3V00A 1GRRA 4PSAA 2RKOA 1IN8A 1CBUA 3VMFA 4JT4A 1N25A 2J45A 5CIQA 4LJ4A 2GZHA 1Z6AA 4XD7D 3GLGB 4Q1BA 4I1OA 3EPJA 3VKWA 5G41A 3WNBA 4DLRA 1WBBA 2E87A 2QM7A 3ECCA 4B3BA 4XVQA 1S2MA 3NEYA 5DGXA 4LJ7A 2GEUA 1X8KA 1U0JA 1ZIPA 4LHXA 4LJ5A 3WRXC 1E1RA 2W2VA 5AJVB 1ANKA 4GOXA 4PC3A 4CZ2A 1II8B 4K81B 1C1YA 4TTPA 1Z0IA 4Q7KA 3IGFA 4B71A 5DH9A 4HDCA 5FBQB 4UQOA 2C99A 4IDOA 3UG6A 4AKGA 1WQ1R 4CEIA 2ZJZA 2R8RA 4KXFB 4CGZA 1FMJA 4G0NA 5KSPA 3L2OB 1E98A 2J1LA 2RGNC 2VP5A 4ASUA 4ZI3A 1XTSA 2N1BA 2ZTSA 5DI3B 3PG5A 1N5KA 1Q57A 1NMZA 4W5JA 4XJXA 1FUKA 4US0R 3K0FA 3DOFA 3HJNA 3RLFA 3KQUA 2YWHA 3NH9A 4V0MA 4EUNA 3N2EA 4LDJA 4PHHA 1AKYA 4FWTA 1ZUIA 2FFHA 3K09C 3SYKA 3AKYA 2QAGA 2QPTA 4U5XA 5SZIA 121PA 4M21A 1E79D 4URUR 5JJLA 2IUUA 1H8HA 4LUCA 4JYCA 3BFXA 1FMLA 3AF4A 5F98A 1W1WA 2B8TA 4DSNA 3FHTA 4HLCA 1KO1A 2ZRDA 1YZLA 2A5JA 2VA8A 4A1FA 4PANA 4FCVA 5ANRB 2IS2A 2OE2A 5GADl 2GA8A 1QVAA 1KK0A 2BKUA 2HT6A 2IK8A 2UVQA 1PZNA 4BRWA 3U4QA 2XTNA 4Q66C 4QRHA 4Q18A 1U99A 4Q1CA 3H0KA 4UJ5A 2QMOA 4X8OA 1N2CE 4UXIA 2OZEA 1COWA 2C78A 5CYPA 2ZRFA 4X8LA 2GJKA 3THOA 3DOEA 1XD9A 3ZVRA 2Q9BA 4OQFA 1KZ7B 2KSQA 3U6BA 4GRAA 2FFBA 3VX4A 1CF4A 4AIIA 1XD2A 5L3QB 2WOJA 2HEIA 2WPDD 2ZS8A 4O2LA 2GXAA 5JRZA 3QJYA 2EW1A 1NVUQ 2OCYC 4PC1A 5JEEA 2CDNA 5J4KA 4TWZA 2W00A 1TADA 2CMKA 3CRMA 3D3QA 3LWNA 1ZJ6A 3B82A 3KUCA 4QBFA 5KO2A 4GMXA 3PR1A 3MWKA 3AP3A 2DWQA 3LBIA 2W2TA 2GCOA 3P26A 2C5LA 1E94E 1KK3A 2ZE8A 3H4MA 3LA6A 1XPRA 2WMNB 2ZJBA 3R8CA 3B7GA 3B5JA 3OF5A 4A0FA 4Q01A 3U61B 3TH5A 1NVVR 1FNMA 1RVDA 1Z6TA 2C8VA 5KU1A 3EZ9A 4A36A 3B60A 4BZXA 1OXTA 4JJZA 3CLVA 1TQ2A 2CE2X 4B33A 2ATVA 2C2HA 2X8AA 5DN6A 3DKVA 1ZRHA 3A4LA 4JVNA 1PLLA 2NPFA 5FTKA 1OKKA 3SFZA 4PAMA 3FOZA 5EE0A 4HZUA 4A0RA 5IDVA 3RC8A 4EQ6B 2B21A 2V55B 4XD7A 1JNYA 3L8YA 1CJVC 4LBVA 1ZC3A 3S1AB 3QSYA 3U7GA 2KBEA 5AUPB 1G16A 1MABA 1N6IA 2ODBA 4DLYA 4NONA 1N6NA 3QBVA 1S96A 5DISB 1LNZA 1Z06A 2G77B 2C9OA 2W2XA 4URVR 3E70C 4AD8A 3P4XA 5A5GA 1E2LA 3JZAA 5L3SA 5DLQC 1H65A 2H92A 1QZXA 5TMPA 4AG5A 2VP0A 4N0EA 4B76A 3EIHA 4Q02A 1N6RA 1ZM7A 4JLBA 4HLUC 2WWWA 4KYUA 1IY1A 4C3ZA 2QT0A 5CK4A 4CT5A 2XOKD 3FMFA 4MDFA 4R98A 2KWIA 1S1CA 2ZYUX 2OAP1 1W0KA 1UEJA 1OXVA 2O0JA 5CM8B 2F55A 1XFAA 4WBSA 3SZRA 1DBSA 1L4YA 2GNOA 3AKDA 3ZJYA 1E99A 1E2NA 1BOFA 4LV6A 1W0JD 3WHKA 4LJ6A 2EWWA 1ODFA 2X1VA 3SJAA 4IRUB 4ZV4A 2V9PA 1HH4A 3RANA 4WXRA 3K70D 5KHOC 2P6NA 5EE1A 4JKIA 4GP7A 4IW3B 3LQQA 1QF9A 1ZC4A 2AXPA 1VECA 3M0EA 3KJGA 3O47A 5DIFA 5B30A 4IOLA 3C5CA 3ADBA 2ZJAA 1MT0A 1S3GA 2VLIA 2A78A 4RFSB 2F9LA 1II0A 4HB2A 5C1BA 1LS6A 1Z5ZA 4W7SA 3O8CA 3CNNA 2WZQA 3TR0A 5A0FA 2JIZD 3A6PC 3KJEA 1CKEA 4LGMA 3PQCA 1VG8A 1BMFA 3CR7A 5HTKA 1OXUA 3X2SA 4GZMA 3SHFA 1JPNA 2LCFA 4LHYA 4HATA 2J5XA 2WWFA 1EK0A 4M1SA 3RS5A 1W7AA 4HYYA 3GLHE 1G7RA 5JWRA 4U00A 5KSZA 3P27A 1DAFA 2V3CC 4JLDA 4QGAA 1O3YA 2GCPA 2ZRIA 3OAAD 2FE4A 3AV0B 4DC9A 3ZQ6A 2GAOA 2ECKA 3LXRA 4TLAA 1TU3A 1K6MA 4NBSA 4NU0A 3Q7QA 4XWAA 3BH6A 1TTTA 5HE8A 4DLWA 2JDID 3WMEA 3HPRA 3TAUA 3ZD7A 3K0AB 2F1HA 4NYJR 4OI2A 5FBLB 4B3FX
chains in the Genus database with same CATH superfamily
4G4GA 1RWVA 1CEQA 4LJKA 4CN9A 3FNRA 2J9RA 2PXAA 1LK0A 1VCIA 1EUDA 3LLCA 3VDNB 1A1SA 2UYGA 4QU5A 2MT9A 4FHGA 2QZSA 2WM2A 2IOYA 3I8XA 1EWVA 3DEFA 1US8B 2VHZA 1XPOA 2LUOA 4RTSA 1N7GA 2J6CA 1QGOA 1I7PA 2PVPA 3DE4X 4JVOA 4Z0NA 3RHFA 2QDKA 3KVYA 2FN3A 4BQPA 1IOZA 3H5VA 5CK5A 3RW9A 1ELOA 4G24A 4MVCA 1XDWA 1Y1RA 1XZQA 5FUWA 3EXHC 4BJ3A 1EXVA 3D1LA 4CTKA 4ZOLB 4X1IA 1JFRA 3ZIUA 4B4UA 4L1KA 3ZDAA 3LA8A 3L5OA 4MPJA 3W4IA 1L5ZA 1XSEA 2WP0A 4Q3BA 3SDSA 4EGSA 1DPFA 1HA3A 1QDLB 3A1VA 5JUWA 3PE6A 4NCAA 3UMMA 1X92A 5B6PA 2Z08A 5FR2A 4AO8A 1G9SA 2CXQA 4JJKA 4Z9XA 3WL4A 5CLQA 3RU2A 6ABPA 4Y3UA 1G55A 3C87A 4QDXA 2H1LA 2WAMA 4OGKA 2VT7A 4WCVA 3QUQA 2J0UB 4NNJA 3DSRA 5IEBA 3GRUA 1LKZA 4BBZA 4HGRA 3U60B 4FHCA 1ZN7A 4R0NA 2UZIR 3E7DA 5HTOA 1FP2A 2FWAA 1N8TA 1SZCA 5K8TA 3R7FA 4ILKA 4HBGA 1XROA 3GDWA 2BF4A 2RGWA 1XN4A 1ZESA 4ATNA 1V8ZA 5K3OA 2AW5A 3L0BA 1FDUA 2DT5A 2ZDHA 5IAGA 4PPQA 1JI3A 1PV1A 2CXPA 2D8AA 2RBKA 4YDQA 2BP7A 2HA4A 5FPYA 3U3KA 1F3LA 3NWOA 1IZ0A 3CN9A 2OHGA 4LNAA 5LSAA 2J4FA 4MYSA 1Q22A 4QOSA 3UTCA 3JQ9C 3BK1A 2F43A 4OAQA 3R9KA 1SC6A 3UC9A 1I2MA 4PZPA 3E5MA 1POXA 3R3JA 3ZQJA 2XOKA 5FP0A 1H2RS 1O89A 3PKJA 2E0IA 3KQMA 4S3MA 5JATA 2H2IA 3AFIA 3JAKA 4O63O 3RARA 3O83A 4I3FA 2ZRJA 4DRXA 2APJA 2F59A 3DL0A 2VJLA 4OBXA 4NABA 1MX5A 2OHOA 3T1HB 2GASA 1B1AA 1F4VA 2XV1A 2Y6VA 3IMFA 4KO3S 4RC9A 2W7TA 1VXRA 4DWOA 2RG1A 3ND9A 4HNGA 3U19A 2CSUA 1CIPA 3SJ7A 1MC1A 4X7BA 1XG5A 2G06A 2HNKA 1N5LA 5C34B 5AKLA 5B1YA 3E9RA 4RHEA 4RA6A 1VRCA 1WZCA 2IA5A 3N7TA 3TR6A 5GINE 3AETB 2O07A 4PO9A 3MTEA 3L6OO 1NN0A 3VHXB 5YASA 3EPKA 2E2WA 3IQZA 4MA4A 5TJ9A 3DWIA 3LQFA 2EX0A 3VO1A 3G0BA 3MB8A 1ECCA 4Q6BA 5D6NA 4OI0A 2OLJA 1YTUA 3L8HA 3P97A 4K5QA 3FETA 5FWXA 3UAVA 1WCV1 1Z2AA 1OX4B 2Y1GA 4F46A 1E9FA 2IYLD 1ZI8A 4GOOD 3T7SA 2P9CA 3M5DA 4F93B 5I5EA 2YN0A 4DSTA 4OJKA 1SVUA 4OJQA 3T12A 5AOVA 3IMGA 4TTJA 5IBPA 3UT5A 1Q17A 3B6KA 4JLKA 1E0DA 3ZU4A 4RDXA 4AX4A 1AX9A 3VYRB 1QONA 3YASA 4C20A 4Z1OA 1D2RA 5H9WA 1R4AA 3B53X 3NT5A 2HA7A 1ZGZA 3PIRA 4TVSA 5KSYA 2OCDA 1LJLA 1SC3A 3OQVA 4NNOA 4PZDA 5ELLA 3DZKA 5HBRA 5IFLA 3VAAA 1NA5A 1Y7LA 1C2TA 3GFTA 2CKDA 4D45A 4TWAA 4YASA 1LQTA 2D1SA 2JFXA 4GLOA 1V11B 4KNWA 4LJLA 4XE5A 1WUHS 4DKXA 3BT7A 3O4HA 1X1CA 3NKVA 2DHEA 3NO4A 4UNRA 2IL1A 2YZ7A 2JDIA 1TA4A 4JYBA 5JCJA 4I1SA 2RC5A 1C3OA 1VHLA 3MS4A 3CO5A 3HMKA 4O4IA 1NXWA 4PAQA 1GTSA 1EWRA 1M34A 4PFSA 4RVOA 2QS9A 3T7TA 5KNCH 4LF9B 1QHGA 1C4WA 3I53A 2H3HA 3ASYA 3JZDA 4B48A 4UPEA 5C7YA 3ZK8A 3LTNC 2XBUA 5EIAA 3U0VA 3THWB 3GNLA 2IU3A 1AGNA 4JEUA 1WSWA 2Y93A 1KYQA 2CHGA 2NTEA 2QMZA 1OLSA 3KT8A 4BO4A 3V34A 1VBMA 5CDHA 4RV4A 1U81A 2XRYA 4KLRA 4EAQA 4IIDA 5IYZF 4ZHQB 5J2UA 1E63A 3V4VB 4GM1A 1LVHA 3RK0A 2VLBA 2O1SA 2Q4BA 4QOGA 4C0SA 5KSOA 2BGNA 2ZYTX 3I2FA 2HEGA 1H0SA 4AC9A 4D7AA 1VXOA 4JS0A 5E1DA 3HCFA 3IP8A 2MYTA 1T1SA 3OQ1A 4CCYA 3BGVA 1YE8A 3EVBA 4E70A 1ZCAA 4M6WA 1IHDA 1PN3A 3H3XA 1VPWA 3PUZA 3D1VA 4WZBA 2PK3A 2H4JA 5DRTA 3HBLA 3CZ5A 4XDZA 3LNTA 4K6CA 4K6GA 3RI3A 4ZJZA 4JELA 1UDWA 1G21E 2AR9A 2OV2A 3L1IA 2OL4A 2C84A 2EW8A 3N8IA 1EE1A 2Y1EA 3OICA 5IX8A 1ETHA 1LTHR 1FTNA 1UBOS 2M9MA 4MV5A 2YASA 1W2HA 4PTZA 3TCKA 5LJIA 3VKHA 3JQGB 4Z2AA 5DEIA 4ZT7A 1TKAA 4Z9BA 3F2VA 4IUYA 2WR8A 3GT7A 4HDSA 5GGYA 3TG8A 5H8WA 1PR1A 1UZLA 1XU4A 2ZUCA 4Q5IA 3TQQA 5IC4A 4TWJA 3WJ1A 1AT1A 1GAEO 4J9VA 1R0BA 2I34A 4LJAA 3T9CA 5ITWA 1DV2A 4IFTA 1H2YA 4MYDA 2PJRA 3UAGA 4CR8A 3W8RA 2PH5A 4I5IA 3KC2A 1EFPB 1NVAA 4YAWA 3G49A 2AN4A 5AT1A 1RRVA 2P9TA 4EGJA 3F5DA 1OFUA 1R0SA 1TA9A 3UAZA 5DGTA 3PCXA 3D3WA 4Q4JB 5FFMA 3RFFA 1L9XA 4ANFA 3K8ZA 1A72A 1M6EX 2I6XA 4ND8A 4WD3A 1V9LA 2FSVA 2GAAA 4EX7A 1HG1A 2XMQA 2GB4A 3UJDA 1Q6ZA 2YXLA 1GTZA 2DPXA 3IPCA 3PIIA 1WDKA 4RGQA 4UPDA 2VP2A 1XZNA 1ADCA 3WHIA 3PNYA 1RLMA 1YMUA 1SCJA 2MMGA 3HCWA 2PNJA 4ZC1A 1BOOA 1X3LA 1PJRA 3W9YA 3S1LA 3ZXSA 4ZMBA 2GCNA 4CQMB 1PNVA 4BNFA 2AA3A 2ZE5A 2E4UA 4RZ2A 3DQPA 3JWPA 2Q1SA 3EAFA 2A1IA 5THXA 1BIFA 1MZPA 3FNFA 1SGWA 5B2ZA 1NN3A 1QO7A 1UJMA 1YAJA 2K7ZA 2BHLA 1SULA 1UEXC 3WLMA 3KWFA 4FK8A 5B64A 3T5GA 3PXBA 2NU7A 3SYMA 4N9WA 4BFZA 1PQYA 1L7MA 4L85A 3F4BA 3OD5A 5EN4A 1GR0A 1KJ9A 3LDAA 1SXPA 2VC2B 2XBLA 2CL5A 5L7WA 4NEQA 3ONVA 2F8TA 2JS7A 1ZOIA 1ZA2A 2J32A 5EIEA 1FP1D 1BEZA 2XKBA 1OYVA 3FCAA 3JSAA 3WWPA 4E7PA 1PKXA 3IO5A 1QSGA 4R1UA 2AT1A 1YRQA 2JJMA 5KVVA 1WO8A 3F97A 4WOCA 4X95A 3GA7A 2XYQA 3I0NA 3NUQA 4JGIA 2BGGA 3A26A 3EDMA 1PFWA 3ELUA 4J3JA 4K6KA 2IYTA 2IU0A 2M1XA 4MRMA 3T1TA 2WWRA 3TSZA 3UJBA 2X8LA 3QE2A 3IIMA 4WZ6A 4CKCA 1YZHA 2V98A 4DC0A 2D7CA 2F90A 2W5UA 2QMUA 3GPLA 4DV1B 2XQVA 1J0DA 4LYYA 5T6MA 5BMVA 4P3PA 1L3BA 1R5JA 1WB6A 2I2WA 2R79A 1AH2A 2WHPA 3A9WA 1XU9A 3M1YA 2PN1A 2VK2A 3SQLA 3ZBTA 4ED9A 2WFLB 3RGGA 3O2NA 4NRDA 2H7VA 5BPHA 3FTNA 4YJ2F 3STTA 3UOAB 1WV1A 1FLVA 2JLBA 4P9NA 3ER6A 4GL2A 3HRIA 3SI7A 3PQ3A 3SY8A 3VR2A 2WMOB 1ID8A 2C20A 2FMKA 4YPOA 4LDAA 1KMCA 1WLSA 4BC1A 1YK0A 1V71A 2CJYA 4ZT4A 1S9DA 1QLJA 1RXUA 2AQKA 2UZ1A 4Q4LA 5TB5A 4XR9A 1H3FA 3VBEA 5AXAA 1F5SA 2PEYA 3MPUA 3IE2A 4BFWA 1CP2A 1H6AA 4B7ZA 5CD9A 3JQBA 2UDPA 1N0IA 1Y9AA 3K09A 2BGUA 4H18A 5DDIP 3CRZA 1RTTA 3QK7A 4OFXA 2DP4E 4MMYB 4QG3A 2W58A 1NF2A 2FPGB 2POQX 1W9HA 3RVMA 1SXHA 4RZSA 1XQ6A 4HNQA 5KYVA 1W85A 1V5FA 4ESHA 4EKNB 1TKCA 2GTIA 3HJRA 4A27A 3LYAA 3GFFA 5IKOA 4OXXA 3NBZC 2JKYA 3USZA 1P7VA 3T4XA 4DANA 3BTOA 4EPRA 4YXFA 2P2DA 2E37A 5EJMA 1NBAA 2VUTA 4DSOA 4Z54A 4R3NA 3DBHA 1ZW6A 2OXCA 4DZZA 3RV3A 4D26A 2P2NA 3DCNA 4ZVMA 3MMNA 2UXBB 4D9IA 5DN6D 2Y1DA 1BX3A 2FSHA 5HQ3B 2O2IA 2PZJA 3CBGA 3L7CA 5EMHA 1N2ZA 3L04A 3ZD6A 2SECE 4XGRA 1NUPA 3F6CA 3SZ3A 2WUWE 3O03A 4W5RA 2JG3A 2Y92A 5G1NA 4EB6A 2NU6B 4C7VA 3C7TA 3QKSB 1SKYB 2BZ1A 4QJIA 3U7QA 4XUCA 5C8DA 4O3MA 2WNHA 1QGYA 1YHNA 2BFEB 2G1UA 3NM5A 1OI3A 4DIBA 3ZKWB 2PT7A 3BGIA 3BIXA 4R81A 4ZCSA 4EY6A 4Z53A 1I1NA 1YL7A 4GXNA 4AZWA 5CB4A 1NUAA 4K0KB 1P5ZB 4TXHA 3DXYA 3UB4A 4DN6A 5DE3A 1R66A 2I1QA 4OEHA 3IQIX 3LBAA 2VS1A 1VL6A 4WCDA 4RHFA 2ANCA 2WSMA 1Q7EA 2C5BA 2WJIA 3HCEA 5SV2A 5ALYA 5IVKA 1G20E 5I6DA 4XYLA 2Q99A 4B09A 2OQ2A 1KHHA 2EZ4A 3TZBA 3SKYA 2FW8A 3MJVA 4RW0A 4WY2A 4COOA 4MQ6A 2DHCA 2WDPA 4EJFA 3PGLA 2JHCA 2R5FA 1V8OA 4LQLA 5EIXA 2XIJA 1Z0AA 1F2TA 5DHRA 4NMHA 4Z0HO 3THYA 1BSVA 1W0KD 4M9QA 4OXIA 4TYPA 3M6VA 3TXYA 1U80A 1XNJA 1EVIA 1PDVA 2PZEA 3ASUA 1TE2A 4FI3C 4C04A 5IXYA 1HLDA 3STYA 4KQEA 3EZXA 4O2AB 2XXJA 2P2CA 5DXAA 3FGPA 4WNIA 2OPBA 3Q2IA 1L7NA 1P9RA 1SKAA 1D03A 1VHJA 1TM1E 1ZHFA 3TD2A 1DQSA 4CM3A 3TQSA 3DEYX 2PS9A 3UB3A 1YCFA 1QRRA 4ZVNA 3ST7A 1XTTA 4QNRA 1XELA 1CUFA 1HFKA 2Q5IA 2WE8A 1N7JA 3KVNA 4BZWA 3VA7A 2JAQA 2P90A 4KUEA 4ZXPA 4PSVA 3K0CA 3DV0A 3ZJVA 2QM3A 1B8VA 3E4DA 4Z8XA 1ECBA 3VR5H 1A9YA 1QUEA 4PCLA 3I4CA 4HH1A 4HQNA 1TW2A 3VV2A 3KE9A 3PLRA 4F4JA 4YV2A 4C4RA 3RRYA 3TL6A 3P7MA 1O9GA 1DARA 2V5VA 3IQXA 4O4HA 2H7CA 4PSDA 4YRLA 2AFHE 1JIIA 4IXTA 3VVLA 2DFNA 4B5LA 1RQXA 3W77A 2JBAB 5HJ7A 1U5CA 2KQUA 2Q0HA 3PS9A 1S02A 3LE8A 2HREA 4TUYA 4H60A 3D2BA 2ERYA 3SK0A 1WPRA 3W9UA 3S29A 4DTCA 4JC5A 1RYYA 2JJ1A 1PT7A 2O3RA 2YZGA 4K7JA 1EZ1A 3E1KA 1S5PA 1HFWA 4ALKA 2H31A 3B85A 4D9BA 4WPGA 4ZGBA 4M55A 4B79A 1NG1A 1UK7A 2YV1A 4QJ4A 1KJWA 1SC9A 1TJYA 3PJEA 4PIPA 3UK0A 1U8CB 5FX2A 1X1SA 1ZH4A 1M2KA 3NG1A 4C03A 1JDPA 2I7DA 1XYGA 1PJ8A 3GAAA 4MW9A 2P5UA 1PJSA 1DRUA 2HD4A 4GFDA 4X8MA 4L9AA 5JMPA 4XXHA 4D8XA 2C54A 1MQAA 3P2MA 3P96A 3II6X 4ZYUA 1F8UA 2BGTA 4A6PA 1IEXA 1GL7A 3C6ZA 3R9WA 1Y5MA 2YMMA 2OXRA 1X0XA 1YMVA 1CJKC 1P29A 2HLHA 1NF3A 2FMUA 3EPRA 4FJ1A 4HNHA 3TCXB 1YFLA 5BN4A 5JQGB 4YRTA 3PGMA 2C2YA 2JGJA 4WN9A 4FB4A 1BXGB 3BXPA 3CJRA 4Q37A 1KMHA 4RM3A 4RQTA 4TLDA 2JH8A 4FMCB 1E0JA 5IVIA 3P20A 3V1YA 1AF4A 1WXDA 4RXTA 3HBJA 2XOEA 4ZYLA 1NI4B 3L9XA 3ZZ0A 4BQRA 2WYVA 3FKJA 3CMMA 2XF8A 2DSTA 2ODWA 1QTNA 2C7RA 1HY3A 4G01B 4UM8B 5K6RA 1CNFA 4TT3D 3SQXA 3JRNA 1KU6A 5TSDA 3KZOA 2PEZA 4ZAYA 2HWXA 2PLAA 1UJBA 4RJKA 1OIWA 5JCPA 1VKNA 4GI3A 4UD6A 5A5VA 4HY3A 4CKZA 5EQFA 2FSPA 1KJ8A 4FZVA 4IIYA 4UTRA 3O73A 1LK5A 3CLHA 3QHQA 5TIIA 3DYIA 1R74A 3WIBA 2SCUA 1SU8A 3T5PA 5AK0A 3QXXA 4WCFB 1C4OA 4XSVA 1WEHA 3GJ4A 2B4YA 1RABA 2I2XB 3SE0A 1H66A 3AH8A 4EATA 3KHKA 4CFYA 3R7WA 2LCIA 1GSIA 2CGEA 2X0FA 4M36A 3AG6A 3OKCA 1O94A 4I6JA 4KP7A 4LE2A 1PQUA 3DFUA 5JCOA 1XD2B 2CLOB 4ZDWA 1G59A 4XYEA 1XAJA 5T7BA 1W0CA 5CPFA 7ABPA 1C1XA 1DKNA 5IPFA 2X2PA 4KX5A 4Z9AA 5FPPA 2CXOA 1I4TD 4HS4A 5H1YA 4CLRA 4MUGA 4R7GA 1FVHA 4BGVA 1J7KA 3RPEA 2RHDA 2FWMX 3ADOA 3S2FA 1P5HA 5LIRA 1CZHA 4F86A 1V26A 4OAPA 1NTRA 2CNOA 5B55A 5H82A 3KJQA 5A02A 1SA0A 2PH7A 3CA8A 1J2YA 3EARA 4XGNA 3M5WA 1Z8FA 1Z39A 3JQAD 4WLOA 5H59A 5DBHX 2GEBA 4BUCA 2GPJA 4CIWA 1BHJA 1IRIA 2IKQA 3SYNA 3ROFA 2PHZA 4C30A 4RULA 4D92A 2V0GA 1F7UA 2PT9A 1GN8A 2ZTMA 3DNFA 1EXMA 4CLXA 4HSEA 3TSYA 3DW3X 1WETA 4B80A 1IZ8A 4JC0A 3HRHA 2JEZA 1QYIA 3FTQA 4I4TB 4MQEA 1YDHA 1ZD1A 4FFDA 4AROA 2IUFA 5JSZA 4WFIA 3F8WA 4TSFA 4QDUA 3PX3A 2YWFA 1GUZA 2A94A 3EF1A 2NXEA 5EE9A 4F84A 5IN4A 2KM1A 5KTOA 3GLFE 1JBKA 3QMVA 1Z4LA 3IVAA 4QHTA 4H7JA 1XDBA 3WYFA 3FF4A 4YT2A 1GTG1 1JEOA 2OCGA 1IBCA 1UT8A 3NNDA 3IKMB 1EDBA 4WESA 3O8LA 2PT5A 1L5NA 4BXOA 3L6CA 3TI7A 1J8YF 4WZAE 3FF1A 2IYYA 2XVMA 3LH5A 1U0EA 5DASA 4AJKA 4AW9A 2AMVA 2KLHA 5E7JA 1ZX1A 1P6UA 3KR1A 4F5EA 5HG0A 3OY2A 4L9WA 5ENDA 3DL2A 4BO1A 3JQ9A 4PGMA 2AI2A 3V1LA 1E18A 2MSCB 2NSYA 1PZEA 4QJ3A 1YKFA 1LY1A 2OK8A 3OFVA 4BX8A 4AJLA 3INGA 1EK2A 3NORA 1OZGA 2ONJA 3ETLA 3NIDB 3E27A 3C24A 1JLMA 2GXUA 3IEKA 4NS4A 2AEFA 4WRRA 4YUYA 1K89A 4B4OA 2EJWA 1NAIA 3BF7A 1E7MA 3UUFA 1U7UA 1X80A 3AYXB 4MRNA 4KFCA 3L7AA 4JP5A 4MVJG 3DKPA 4OQMA 4QWMA 3UJAA 4JMLA 4CMBA 2R6FA 4URZR 3FGNA 4PLGA 2I4TA 2VAVA 2OPHA 5FI0B 1Y7IA 4V03A 1REQB 3ZV5A 2PZFA 4Z7OB 1V43A 3QNWA 3R6TA 1OD6A 4B83A 5KWEA 3ZNPA 1DTSA 2Y05A 3FJ1A 5FPTA 1FZQA 1F4PA 1MJNA 1ONBA 1BE1A 1YZFA 2GZDA 2RGGA 4XX0B 3SS7X 1OH8A 1JXQA 2FG5A 3ILVA 5ESDA 2C8KA 4CV1A 5IHXA 4NDNE 4ZQFA 1TU4A 3AHIA 4RD1A 1C9DB 2PBLA 3FNEA 1YH3A 3GX1A 2HM7A 3ZWDA 3ZY3A 1RACA 2QRNA 2HW8A 1HQDA 2ODNA 3L7DA 5DM70 3AF3A 4EZIA 2XDQB 2PRSA 3JRXA 1V7PC 4X84A 3LIPA 1AKEA 3NOQA 1TX4B 3AF6A 1M66A 2GJ9A 3FDFA 4DW8A 1IXRC 2GARA 1XJ5A 1XDGA 4DT1B 3G0CA 1RD4A 1GNVA 3TMYA 4OOFA 4OYHA 2FPRA 4ZO4A 1YS1X 3QVLA 3ZV3A 1WE2A 3TLYA 3ENNA 4BV8A 1QS0B 4M7WA 3BDVA 5HW0A 3PYMA 4TT3A 1LV7A 3HHPA 2JLUA 1DMSA 4GD3Q 4LXXA 5JIBA 2Q4TA 4ZARA 3UJ6A 4AJPA 3BD7A 2FMTA 3KOXA 3LK6A 4LG1A 4D4LA 2PL3A 4OFZA 4TQAA 2V4UA 2E6KA 4MTCA 5FBWB 3MTBA 4DIDA 2PT6A 2CWDA 1Y3AA 4RYDA 1C9JA 1SVNA 3LLMA 1KFKB 2YZKA 2YOFA 2IYNA 2O1XA 2RK4A 1E96A 4G36A 4YI5A 5T6BA 3UWOA 1M6VB 1AZSC 1QG2A 1E20A 1TYCA 3EDQA 3INRA 2GMWA 4WK0B 4ZIRB 2AEMA 4KO4S 2X4LA 2AV6A 3CF2A 3VH1A 3DFFA 3LX8A 4M83A 2OTCA 3VSAA 3EUFA 4IKOA 4BO6A 2HTFA 5AVOA 4GEGA 3DZIA 4PLTA 1IH8A 3MM4A 1XVIA 2ZW9A 3ZBPA 5K4GA 3ZOKA 3RSGA 1Z34A 3QU2A 1DT3A 1INLA 2CY0A 2O2EA 1MORA 2A30A 2VL7A 2XUJA 3B5IA 3MPOA 1JR6A 1E69A 1Z0ZA 1ZNZA 2P68A 3ZCPA 3H6KA 3RT9A 1PE0A 1T9HA 1FA9A 2ZROA 1BO6A 1HXHA 2DGDA 3KOMA 1W5EA 3OQBA 3PSHA 5AI9A 1VC2A 4A8PA 1FTGA 1QFYA 5EVJA 3OM1A 3NALA 4NMLA 3AKZA 3M5PA 5DOZA 1F2UB 3FHJA 4R1QA 3ZLTA 2W2KA 4OB8A 1WABA 4L57A 4NHOA 2C94A 3PNMA 2JJ2A 1EGHA 1FS6A 2P4UA 4R1TA 4TV8A 2HPVA 4DCSA 3NTVA 4PINA 1XCMA 1T6XA 3JYOA 4ARVA 1OH6A 2V58A 4DF3A 2QPOA 2VI5A 1Q77A 5JH7A 3ACBA 4DNXA 4QYWA 1JZQA 3UHFA 3D59A 1K27A 1A50B 1KFBB 1L1EA 1I51A 4RV9A 4EW1A 4CI0B 3UH1A 3FYDA 2EL9A 4QUKA 2CHQA 3CUYA 3MT9A 1XUOA 4GVPA 4KN9S 2XE7A 1T1EA 3TINA 5T4FA 1QDUA 2J9XB 4KVGA 2SBTA 4ZZ0A 1NV9A 5ED4A 3ONNA 1WXGA 4N7MA 4YDRA 3AFGA 3K8QA 1B2LA 3LXUX 3DYBA 5HCIA 2GPBA 2PJDA 1YU9A 3H5OA 4FC6A 4QGSA 1ZD5A 2CLSA 2PYIA 4DJTA 3L43A 2X9QA 2VF7A 3CX6A 3IQFA 3K16A 1R9JA 2CZCA 1V2HE 1EXDA 1XJQA 2JJ8A 3DT6A 3Q1LA 3TOXA 2LKDA 3T0IA 3LZDA 3TUZC 5C4GB 4NYMR 1D1TA 4KXQA 4RHCA 3T5DA 4B0OA 4RELA 4BBJA 3W8FA 1CR6A 1TGVA 1UT5A 1A9PA 1NDQA 1Q83A 3WZ2A 5K0FA 2WTUA 2C88A 2GBPA 3GLTA 4O0LA 1NQVA 3KPJA 2XWPA 4KAAA 2GILA 3ZCTA 4B40A 1P73A 3WB0A 3GFPA 2W0MA 2G4CA 1KAMA 3CW2A 5J59A 4AO7A 5EJ2A 1MAHA 4S12A 1RYHA 1W87A 3AERB 5DNCA 1N33B 1XU7A 3LY5A 5EFOA 1GT91 4KFSA 5J1TB 1O9BA 2XD9A 2IZ1A 3FA2A 2ZDQA 3LK7A 1VTKA 2BMJA 3C39A 4LBYA 3PLAE 4NZOA 1C0LA 2FW6A 4QJ5A 2GX6A 3TE7A 3AUYA 2QBYA 2ODEA 3GQBB 3TEJA 1P2DA 3MRSA 1AC5A 3NOVA 3GCDA 1KYVA 3HJTA 4FCWA 5CLHA 3VKUA 5JMTA 3OETA 1I7SB 3NONA 3AEXA 3OP4A 3OQJA 5J3JA 4PLPA 1KYZA 4K6HA 4NQRA 3T5BA 1PR2A 1RHKA 2YV5A 2YZ2A 3BF8A 1U0HC 3LUPA 3PTZA 4RNDB 4CLHA 1ESZA 1A9XB 1BXKA 1W1UA 4GG1A 1DKQA 1KNQA 1T1RA 4MVJA 2BKVA 4UNSA 3UMRA 1FVFA 1DJNA 2NZVG 1X3SA 3L0IB 2OGZA 3U39A 3PDIB 4K46A 4G8BA 2CLFB 1KJQA 3OPYA 3HVKA 1P2BA 2OD9A 1P0CA 1WBDA 3JQAB 1CQJB 5AW0A 3LRXA 4C4ZA 3DEAA 4J0JA 1IATA 4X1YA 1KQ3A 6Q21A 5EZQA 1MF7A 1FDOA 2QN1A 3E7XA 1Y9EA 1VJGA 3CNLA 3PFFA 3GBSA 3PF8A 4F5WA 5DHAA 3RVSA 2F1KA 1QO0D 3JQ8A 2ADMA 3UA4A 4GMFA 1SOMA 2BFBB 4Q9LA 5JSQA 1U5BA 5JNVA 1HLFA 3L6RA 5JMWA 1CB0A 4II3A 4EF5A 1R00A 4MUYA 1O95C 5CPBA 2YXPX 1HL3A 3H1AA 4ENQA 2VYCA 5D7NA 3WV5A 3JAWA 1S2NA 1CUXA 3AR9A 1AS0A 1MB0A 3OEEA 1FLNA 1JIXA 1ZBQA 3OQNA 1H2XA 4LHSA 3A05A 1NNUA 4JR1A 3NHUA 3I6YA 3R77A 4D8VA 4NXNB 3LO8A 4JBYA 4HGPA 1PCXA 4ROSA 1C7QA 2P9EA 3K35A 3HYLA 1CD5A 4IIJB 4TTTS 1YUNA 3QBDA 5ALMA 4MV3A 5LLTA 1Z4PX 3EB9A 1TB4A 5J5VA 4ESEA 1QYRA 3EY4A 1J8VA 2D74A 1RPJA 2AF4C 3LECA 3NAQA 3NW9A 4II7A 4CVNA 3COVA 2AFRA 1AHHA 2YL2A 3ICVA 3OLZA 1RJFA 3I9LA 3FM9A 4GI5A 1E2PA 3NM6B 2NWQA 1ZP6A 3NZEA 5IJWA 2PA0A 2ZTLA 2VXBA 1ZITA 3K1AB 3DMPA 4GXTA 2RCYA 1M2EA 1QBKC 2Q3HA 2OGSA 3WGYA 4EJSB 2ZAGA 3C8MA 4YQZA 4Z5XA 2Y68A 2CXUA 4F11A 3E5NA 3D4NA 2UUAB 4EI8A 2QV7A 3ISJA 3BREA 3CRNA 4LJ9A 1M2WA 4KWTA 4XARA 5DNDA 2QUKA 1CYEA 2R97A 3U16A 2QX7A 1ZIXA 2CLCX 3NM4A 4JC8A 1D7AA 4UDOA 2CMGA 3A06A 3P9KA 2IUSA 4UDXX 4WKNA 1CE8A 2OZPA 1KZYC 5JZOA 4QE3A 1YIDA 4OPMA 4F06A 3PNSA 2J7PA 3TUIC 1NR1A 4RCVA 4D99A 2RJOA 1NFQA 1JG1A 1E59A 1TJPB 1L9KA 2D54A 3R41A 2H8GA 2VDVE 3D7KA 3PYXA 4NULA 4R2HA 4ZOAA 5KKAA 3QUCA 4E2YA 4L5CA 1W93A 3QXCA 2JLYA 4OHOA 4XFKA 4UVHA 1SNYA 4XSHA 4UHHA 5K3CA 4GRDA 2D4HA 2Y1FA 3GEBA 1G8PA 2WG1A 3WYEA 2I2DA 4XGIA 1HT0A 1T8TA 5UKDA 1VJ5A 1O0BA 1E6MA 2R8BA 1V6AA 2ARKA 1U28A 2CNWA 2PTGA 3ZK9A 3EGOA 1GG2A 3H8SA 4JJ7A 4JEIA 2G9QA 3D6JA 3UANA 1Q0QA 5IAKA 3L05A 1GXSB 3VQTA 1FX1A 3DLIA 3L8MA 1RAGA 4D43A 1BYUA 1T1GA 3GJ6A 2VF4X 3G2MA 4W8GA 2GCIA 4OK5A 3LC0A 2P9YA 3OIFA 1UF9A 1VJRA 1QJ4A 5FD8A 3AP2A 4PCAA 4KQ1A 5AW4A 3L0PA 2PMEA 3QEAZ 1GLGA 1N5IA 2AFIB 3J80A 4K9KA 2R7MA 4C0HA 3HUEA 4FHFA 2E5FA 3CXRA 4PZ0A 1F2VA 4EHNA 1ZMXA 3CBQA 4M1ZA 4K26A 4J2TA 3H1FA 2HQRA 2JHFA 2VR1A 3DA8A 4FILA 4IM7A 3DE6X 3VM6A 4CM4B 3PP8A 3EGEA 2ZI3A 4XB1A 5LZ9A 4R84A 3S8EA 1ODSA 2WUEA 2ORWA 5FT9A 2H54A 3MXTA 5JAHA 4UUOA 4LRSB 3OE7A 1T4BA 1XRNA 2WKRA 5KAPA 1U90A 4B82A 1W5AA 4AG3A 5JQWA 1JIUA 4AY2A 1GV1A 2ZM5A 2CUZA 1DKUA 2YXDA 4EELA 4AZ3A 3CN7A 4I55A 5BVGB 3IKJA 2DB3A 4CODB 4G1FA 4TKMA 5HQTA 4M1OA 3D4IA 1ZH6A 2W71A 1RYMA 3AM4A 3TLMA 4N82A 3QQ5A 1I01A 4E21A 1A8PA 3D7LA 3VH2A 1RWNA 3L7KA 4OJNA 1OHHD 4FOPA 4FNOA 3ITKA 3H4IA 4BAUA 4B74A 2PUCA 3MOIA 3IRUA 1T2CA 1WHSA 4LK2A 2XB8A 4Z4CA 4JBXA 2H1OA 3X1JA 2B6HA 2G63A 2HPAA 5JSFA 4ARZB 4NDAA 1QO0A 2C9YA 2D0PB 4S0XA 5CFPA 4MB2A 5BUQA 1EYZA 2K7FA 4TYMA 3RYTC 3V6LA 1N57A 1PTJC 2YZNA 3WA7A 2H1WA 1Z2NX 3PFIA 1BMQA 2I99A 2C95A 5TNXA 4ZYWA 3PTAA 1GWNA 1EIWA 1L4NA 4Z1MD 2X4GA 2M6KA 3IV7A 3K6RA 4H7KA 5EKUA 5B3AA 2I6UA 5TQJA 4XGQA 3ZV6A 4M9CA 4BHTA 4OQPA 2DQSA 1UBNA 2WDZA 1PL7A 2BDUA 2P1RA 2XSZA 3UJ3X 4EW6A 4ZCMA 1PR3A 4KXXA 1IWPB 1S2IA 2N3ZA 3OJCA 4HQ0A 1O08A 4CMCA 4DUGA 1CQIB 3T54A 3VXKA 4YO8A 2I4IA 3TN7A 3HXLA 3DM5A 1O6FA 4IDEA 4JJAA 5TEVA 3V9AA 5IVPA 1A98A 5LP6B 1BH6A 5AVKA 1G0NA 1XQ1A 3GGDA 1MR3F 1BMDA 1A9TA 3KOWA 4QAQA 4KODA 3L06A 3PT5A 3M33A 2I3BA 3QVUA 5J5AA 4CLOA 1I0LA 2PSEA 4JXXA 4L8WB 2G5CA 2FZLA 1B0AA 1OLOA 2IPXA 4DMHA 3D1JA 2PGLA 1YB6A 3SM9A 5HS6A 3PNKA 1TFRA 1GGMA 3OJLA 1E9VA 5BQPA 2GNAA 1X15A 4WACA 3FYHA 4WTOA 1TCUA 1EHIA 4BP9A 1TEXA 4YB8A 2DETA 5FUYA 3AXTA 4QPJC 4QRDA 3DHWC 3UICA 3ZD9A 1VA4A 1L7AA 2X5NA 3AZPA 3ZU6A 2WTNA 3ZY4A 3RNLA 3S40A 3ZLVA 4COKA 4ID9A 2C5FA 2GEJA 3IB6A 3AILA 3E81A 1S2DA 3IUNA 3NXKA 4CUKA 1ZNWA 3TXAA 1FXSA 3OIDA 4JFAA 3ZVKA 2HKIA 5B6JA 1XF9A 3B9QA 2ZUEA 1GQSA 1VGQA 5CBKA 1ISPA 1MC4A 4PYIA 4Y9SA 4WLVA 3TMKA 4BIIA 3DXFA 5HZKA 4QGBA 4EEXA 1SXJB 4HTFB 3QG5A 2I1VB 3OZAA 4HRYA 1EK6A 4ZPXA 1K88A 3RVNA 1DIHA 2WMDA 5BWMA 4LYDA 3GGPA 1HR0B 3FOFC 2BFNA 3VHQA 3B1JA 4JL6A 3G5AA 1UQRA 5L3QA 1D8TA 3L7LA 4DR1B 1Z8DA 1Q3TA 2VRNA 3HCPA 1JSRA 3IA7A 5ISMA 1K5DA 1UJCA 4UFOA 1NLMA 2LR0A 3NWPA 1B0UA 4ZEVA 2FDRA 3I9JA 5HDBB 4DLTA 4E15A 2EF1A 4F3YA 1SQFA 3RSLA 1R0XA 1TZCA 3BVPA 3D3JA 1WLYA 1ZS9A 1GAQA 3A1NA 3D7MA 2X0EA 3CYFA 3O3OB 3T5CA 3IC5A 5E3IA 3ETCA 4DQKA 5EQTA 3TOCA 1PFKA 2VP9A 5GPBA 2V7VA 2CN1A 2ZU0C 4TV9A 1FRZA 3AHHA 3MQFA 1GNLA 4J29A 3JQEA 4IXWA 3W6PA 4QXOA 2HC9A 5IWAB 2VUUA 4Y7CA 3QU5A 3R3UA 3PUYA 4QOJA 5IDXA 5JECA 1SKBA 3F46A 2CHEA 5IN5A 4CCWA 2QVCA 2YXEA 3OU2A 4MLPA 4HS9A 5G53C 4BFVA 5IH7A 3RG2A 3H9JA 5IUJC 2WW8A 5CVUA 4ZI7B 1NATA 4HWRA 3K0BA 4YCAA 3WC4A 4TZ0A 2BR3A 3QKUA 5B5SA 1S8FA 2Q9UA 3B70A 1H8ED 1KIAA 2DFDA 5BN3A 2ZXUA 1ZZEA 5FH9A 1Q16A 3W7VA 4MVYA 1LH0A 2AEEA 4MV9A 1N1DA 2R2GA 1LDNA 3I2YX 3F0TA 3Q87B 3SHQA 3DB2A 2H1VA 2I6SA 1AKVA 5HKKD 4PGGA 2V3VA 5JNSA 4GYJA 3O90A 4QOEA 3H2YA 3N8NA 1NBHA 3I9V1 3QYPA 5AKHA 1UBUS 4UUBA 2A57A 3QPWA 4V0KA 5MFPA 5F9FA 1TYZA 5CYFA 1YZTA 3RH0A 2HLDD 2GD0A 2ZT8A 1T3TA 1HO3A 2NIPA 2R5NA 3QXJA 4OP1A 1OBHA 3FYCA 4PYMA 3P2YA 3I2JA 3JTEA 4B4VA 1NC3A 1P7WA 1E6KA 1M1YA 5EMNA 4LMRA 1VPLA 3ZZNA 3W9BA 4CTJA 1BVYF 3GDFA 2OBFA 4ZOQI 2Y3IA 2WZCA 3LP5A 3A14A 3NKFA 5DNVA 2RFLA 1RS0A 4DBLE 3NDBB 2VRBA 1NQUA 4WBNF 2VOJA 2BV3A 2XQKA 1T3SA 2JVKA 1JHQA 2HWWA 3OLVA 2P4EA 4J0IA 4PCVA 4WXPA 5DN9A 2RGBA 3BDAA 3MIIA 4ZFNA 5JJCA 4V0LA 2OB2A 2NG1A 1P19A 3RT1A 3RIEA 1UMDA 3PYLA 3UOWA 1EFRD 1GARA 3UZUA 4A03A 1D3AA