2ZRCA

Msreca q196n form iv
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 89
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrcA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrcA01
2EFGA 1GOTA 3T1OA 1C4OA 1VIYA 1OFHA 1Z6XA 3TR0A 2J87A 3E2IA 3LWNA 4ACBA 3SQWA 2BM0A 3SI7A 3U61B 4G1UC 2OO7A 2SHKA 1UEJA 2QQ0A 1KAOA 5JLJA 4JJZA 2J0SA 4M9ZA 2ANCA 1F6BA 2ZUDA 3AKYA 2V6JA 1Z08A 1KY2A 2YWGA 1DS6A 1YRAA 3BB1A 4A2WA 5L3SA 5AJWA 2ATXA 2OZEA 2ZUCA 3RABA 3BFVA 3GLHE 1II8A 4BZXA 3U3OA 5JCZA 4C0SA 2KB0A 2Q9BA 2QE7D 3VR6A 4JLVA 1VYUA 1AJEA 2BBSA 3HDTA 4JLNA 1D2NA 1KJYA 5GJBA 5AR1A 3KQLA 5FPKA 1FP7A 3K0CA 1FX0A 1E2NA 3W90A 2V9PA 4I1UA 3QOFA 4WIAA 4R71A 1S4QA 1VCIA 1Q44A 3K0AB 2J3EA 3BB4A 1M7GA 3MMPA 5FOXA 4L9SA 3WXMA 1E4YA 1GRQA 1FNMA 1OFIA 2PT7A 1QF9A 1WCV1 1U0JA 4BRUA 4XTCS 5J4KA 1ZUIA 1YR7A 3AGQA 3TBKA 5H70A 4TMVA 3TNFA 2DWOA 3MAAC 4L16A 3LD9A 3A4MA 2VA8A 3J81k 1J90A 3U7GA 4EJSA 1Q12A 2YOHA 4ZKEA 4NH0A 3QKSA 4CIDA 3AF1A 3W3ZB 4MGKR 2QT1A 1XJ0A 1JQLB 4L5BA 4NYIR 1XNJA 1OFUX 3X1DA 1H8EA 4OJKA 1GVNB 3ZJYA 3V4RA 4CEHB 4JLPA 2HF9A 4HLCA 3I3SR 4Q47A 1IXZA 3C5HA 2CXXA 1PUIA 3GEEA 3FMOB 2F3TA 2IXGA 2ODEA 2WOOA 1VHLA 1TX4B 2CNWA 2WJVA 4KLNA 4CT4B 2W58A 3KXLA 4TMZA 1SVMA 2R6AA 1G6OA 4L15A 4LJ9A 4TYWA 2GEUA 3BH0A 3TK1A 1SKQA 1E4VA 4QBHA 3IEVA 1E2QA 4Q9KA 2WSSD 3QPUA 1MRSA 3IGFA 3MJHA 5CITA 5CDFE 3R9IA 3FFBA 3REFA 2OT3B 1G8YA 3A36A 4BE7B 4URYR 3OEHA 2R65A 5DN6A 3SJZA 1X3SA 1JJVA 2R62A 3VNUA 4RY2A 2VH5R 3FB4A 4WA7A 2J9RA 3VKWA 5K8TA 3T15A 4D82A 1ZU5A 2F9MA 2KBFA 3I5YA 2ZSDA 1CR4A 3CBQA 5DISB 4A9AA 4POAA 5FOTA 4PHGA 1CR2A 4XWKA 1GWNA 3REGA 2WIAA 2G88A 4JLJA 2HDNB 5FI1B 3WBJA 5TB5A 4LV6A 2E1RA 2QP3A 1G291 5BN5A 3CWQA 2WM9B 3IBYA 3C16C 4JSYA 4DEXA 2AK2A 1EESA 1LFDB 1CKEA 1XD2B 2GJSA 4HDCA 4RJLA 4US1R 5FTKA 5L3VA 5KO2A 2NMVA 1Z2CA 4EPXA 4HB3A 2D74A 5FPYA 5JRJA 4URVR 4B2LA 4Z1MD 5FOVA 3DZ8A 1P4SA 4D25A 3I8SA 4GI7A 1E6CA 3THYA 1N6RA 4DDVA 1JEEA 1KI1A 4Q7KA 1NVVR 2RGXA 1TMKA 2BMFA 5CLQA 4KU4A 4OQXA 5BXQC 1G7RA 2D7DA 3TSOA 4M1TA 1W2GA 3CRRA 2CVFA 2NTYC 4JYBA 1GP2A 3TH5A 1BMFD 3EZ6A 3IQXA 4RD3A 5B57C 2VYFA 4QBIA 3T34A 2ZJAA 3ND9A 4JKIA 1QHHB 1RRFA 4B74A 3SC3A 2I3BA 1E9FA 1N6OA 1OE0A 1GG2A 3IIKA 4TYQA 3KKQA 3ICQB 2X19A 2ZI9A 2QGNA 1W0JD 2WWIA 4RVCA 4B3XA 3L2OB 4QG7A 4QHYA 1E79A 4NONA 4TTPA 5HE8A 1G8HA 4YXWA 4Z8YA 4L8GA 1GFIA 1D9ZA 4BLTA 1XMJA 2A5DA 4KHZA 4H9GA 4IXNA 1I4TD 3UG6A 5J4YA 3WNBA 5KDDA 3I62A 3B1YA 2DFNA 4YDHB 5GVRA 2DPXA 5KSPA 2GZAA 3EPHA 4RFSA 3OFNA 1KY3A 1AQUA 5L8VA 4C4PA 4URXR 3JZAA 4EPYA 2F3RA 2GCPA 2ODWA 2PLFA 4WXRA 2GK6A 3VR3A 2BMDA 4BFUA 1WQ1R 1RJ9B 3BERA 5EE5B 3BH7A 2VP9A 2GF0A 3FWYA 3PV0A 4LRWA 5E4FA 3RS3A 3THXB 4FMCB 2IBMA 1VG8A 3B1VA 4A4DA 2WV9A 2ZXUA 4FMDF 3OAAD 3H2YA 4P31A 1II9A 3D6TB 4I81A 3UK6A 3U3MA 3U6KA 2Z0MA 5CB6A 2QBYB 3SE0A 4ACAA 5A4JA 3R9XA 1YJ5A 2JLRA 1W36D 3SQXA 2AD5A 2CEAA 2QL6A 3DKVA 5B2ZA 3H86A 3MGCA 5CM8B 2V1XA 5JWOA 4UNPA 4C3ZA 5HR5A 1SVOA 2JJ1A 3GPLA 3FHOA 3U4QB 2IYUA 4MDEA 2AHOA 4HAYA 4FW9A 4MYTA 2OBMA 3AP2A 3CO5A 2P65A 2VSOA 4NCNA 3TIFA 1ZD8A 2GBLC 2ZVPX 2W6IA 4OK6A 4CW7A 2WTUA 2F9LA 3IHLA 3T1TA 3WYAA 4TZ0A 1MH1A 1GL9B 1R0WA 1A5TA 3K9NA 1Y3AA 1U8YA 4ON9A 4DC9A 5C46F 3ZVNA 3SOPA 2ORIA 1U8AA 3K9GA 3CONA 1E96A 5BQ5A 1G4AE 2FNAA 3C41J 4MA4A 5C4GB 5FBWB 2C9CA 2FFHA 3P20A 1CJTC 4GOXA 1NLYA 3P1JA 3P4XA 3F3YA 3KDSE 1LW7A 3MWJA 3B6EA 3ZIAD 4ZDWA 4Q19A 5KDLA 2F6RA 1Q1EA 3AUXA 1FW6A 5HKKA 4E22A 1E3MA 4HI0E 4QRHA 3QSYA 3QF4B 3U5ZB 5IRCD 4A92A 2ZJ8A 5KNDA 1DAFA 4R9UC 3CH5A 4DLVA 3AEZA 3FVQA 4PANA 5LB4A 4Q9IA 5EP2A 1KDTA 1KJZA 1W4AA 3HYRA 121PA 1FMJA 3MWYW 1OIXA 2QUZA 3KB2A 4CVNA 5FOUA 2XSZA 3QXCA 1E2KA 1MABA 4KLZA 5DI9A 4PQFA 2CHVA 2FPLA 3EZ2A 5FTJA 2J46A 1SKYB 2C04A 3T1QA 1HH4A 1E9SA 1XCGB 2PL3A 2X2EA 4W5JA 5JS8A 1DPFA 3C14C 1N3BA 1W5TA 3DKPA 2RKOA 1Z28A 2ZRKA 3SBDA 1YZQA 3BBPA 3PUWA 2J7KA 4DLTA 1OXXK 4CGZA 5HTKA 4OL0A 2BKUA 3Q85A 5F9HA 4N1AA 4WZBE 3ADBA 4KBFA 2PX0A 5EP3A 1KI4A 3RWOA 1T6NA 5FL3A 3FE2A 4CEHA 4B3BA 2J0UB 4O0MA 4ZV4A 3KZ1E 1NMZA 5EZ5A 3RLFA 1U99A 1E9RA 1EGAA 2R6GA 4A6XA 1XWIA 1VHTA 5TVKA 2RGAA 4LYHA 3EZ7A 3AVXA 2OXRA 3VKGA 1N5JA 2CNWD 4AIIA 1OIWA 4AI6A 2O5VA 2BV3A 4Q9LA 3RHFA 4B33A 3LX8A 1YZNA 2ZRGA 2GWHA 1NKSA 1OV4A 2GJAA 2D06A 4KFRA 2N46A 2V7QA 5J4LA 1P3JA 4TL7A 1AM4D 1FZQA 1U9IC 2VP5A 4JVLA 3Q9LA 5DN6D 3EIHA 5AUQA 2J41A 3GLIA 1Z47A 4Q18A 3CLVA 1R5OA 2QQEA 3IO3A 3TW4A 1TU3A 2F1IA 4LJ4A 4X8HA 5KSYA 2A3RA 2WKRA 3K53A 4HUQA 3WYFA 3QXHA 3GP8A 3VU9B 1IN6A 1UKZA 1SVIA 1RRPA 1EG7A 2CLSA 4C9BA 2O8CB 4S2EA 4YLGA 1UAAA 1CRQA 5FBRB 1M2OB 1G9XA 1G8GA 2PBRA 2GAOA 2ZI3A 3GEIA 5AUNB 3AGPA 5HCIA 2PLRA 2UZIR 1XMIA 2XOKD 3LQRA 4HATA 3VHXA 1XD8A 1T9HA 2WOJA 3QENA 4G5SA 1NIPA 1DAHA 3VR4A 4Q1DA 4TYYA 4V0MA 3LH5A 2IYZA 2WJGA 4O2LA 2IL1A 2ZAOA 4GMDA 1OT3A 5CIQA 2R44A 3CF6R 4Q1FA 2CE2X 2QTFA 1T0JB 2I1QA 4PZLA 3W6PA 3ZZUA 4QFMA 2PEZA 5JWRA 3NDBB 4B3GA 2O8BB 5JJLA 2P3SA 1J99A 4IDPA 1IHUA 1S96A 2ZU6A 3HU2A 4QGGA 2PCJA 3E1SA 3TSWA 1MV5A 3T35A 4F91B 3SHWA 2UZ3A 4RD2A 3B60A 4B76A 1GL6A 3SYLA 4ABYA 1XTIA 4JT4A 2EWWA 4O3MA 2K5UA 1ZUHA 2GKSA 2OBLA 1W4BA 3L8YA 4ZO4A 3ASYA 2A78A 4A0GA 1Z83A 3HWSA 3PG5A 5JSZA 4MUAA 5CIWA 4OHWA 2YOGA 2Q9CA 2AX4A 4M9SA 2DCUA 4F38A 2OHFA 3MWKA 4HDOB 3NH9A 4BLOA 2B6HA 4C0LA 4EQ6A 3WNCA 2JJ2A 3X1ZA 3SEAA 3RWMB 2OCPA 4BFZA 4MKFA 3MD0A 2QAGB 2H57A 1L4UA 2AXNA 1SQ5A 3PENA 3CF0A 3VTKA 1E94E 3KTAB 4BFTA 3FPAA 3AVVA 1UBGA 2NO7A 2O8DA 1E1QA 3LDAA 1ZNYA 5JMTA 4BFSA 1H8HD 2A5YB 1F60A 2KI5A 4FXPA 4ASUA 2IUUA 2PMDA 3WHLA 3R20A 4U02A 2HEIA 1D6JA 3PR1A 2CMKA 3KX2A 2QI9C 3SJBA 1FFHA 3PEVA 4QHTA 5CLLA 1ODFA 3AKEA 3OFND 4LBZA 4Q48A 1ZBDA 2E9SA 3ICEA 2FFAA 1XBTA 4AY2A 4KJZA 2C03A 1WB9A 4HYYA 5KUTA 1XXHB 3I1FA 1GZSA 4BZPA 1RJ9A 2PCLA 1NLFA 4QKQA 3LA6A 3GLFA 4C7OB 2P0EA 1OXTA 2IUSA 2AR7A 3BWDD 4Q66C 4C0KA 3A6PC 3GJXC 4WZAE 4IDOA 3JVUA 3TVDA 4DSTA 4C0BA 2YINC 4PXAA 1DTSA 4BWYA 4E5UA 1OPXA 1T3LA 1HY3A 3LLMA 1A7JA 2BCJQ 1R0YA 2R2AA 1PLJA 3K9HA 4RKEA 2QBYA 1LF5A 5BYKA 4BLPA 3R7WA 2ZJ5A 3B9QA 3GFOA 1I2MA 1KZ7B 4PHHA 4TLDA 2CE7A 1PLKA 2QU8A 2VL7A 2ZE8A 2AK3A 3Q5EA 1P61B 3SFVA 1KAGA 2Y8EA 1OKKA 3LY5A 3IBGA 4OHYA 5DSZA 1WBDA 2ZRNA 1HQCA 3QEJA 1F2UB 2BM1A 1GDDA 3NDPA 4PC1A 5EE1A 4YC7A 1LF0A 4XD7D 2EWVA 1M6NA 1UM8A 2GESA 3LO5A 3QI2A 2GXSA 4NTZA 3I61A 2QRNA 2W0SA 4EFNA 2IYSA 3GJ3A 4CT5A 5B30A 2YWEA 2ZVQX 2ZYTX 4U00A 2RHMA 4QNMA 2AWOA 4DLSA 4DLYA 2C9OA 1Z0FA 1W46A 4TMTA 2FDCA 1Q22A 5FL7A 3KXKA 4HSEA 2ONJA 4M8NE 1ESMA 1KSFX 1DEKA 1ZM4A 3OIYA 2ZRMA 3A1SA 2RGNC 5JEDA 1KK1A 1UF9A 3OIVA 4LZZA 3WNDA 1FUUA 4FMDB 4BZQA 4BUJA 1T8TA 2QT0A 1IBRA 1Q1ZA 3EZ9A 4IOLA 4EPTA 3QG5A 3QKTA 4LJ8A 5DHFA 8OHMA 1JR3A 2IWHA 3E70C 5FOSA 1EFHA 1N6KA 4ZPXA 1ZM7A 2P67A 3LXRA 521PA 3PJRA 1G64A 2ZRBA 2ZRHA 1SKYE 2QPAA 3QVVA 4QJ4A 3V9PA 4MKHA 4BASA 3D8BA 3ZVMA 1KSHA 3U2QA 2QENA 4LC1A 3AVOA 1KZGB 3LBNA 2NPFA 4B47A 4UJ5A 1NP6A 4FD2A 4EKDA 1QG2A 4NYMQ 4AKEA 2B21A 4ZI3A 3U44B 5EE0A 1H65A 5F2EA 5AJXA 1G1MA 3LBIA 3SU8A 3WBKA 4IRUB 3ZVRA 1OF1A 2EW1A 2VRWA 2W0MA 1Z0AA 1QHIA 4OKSA 5KNBA 4AC9A 3RC8A 1NSTA 2OG2A 1QBKC 5IT5A 4Q4JB 1NL3A 2J0UA 2NZ8A 1GTVA 2QZ4A 1R5BA 3FMPB 2OLKA 1UDWA 2FU5C 1FNNA 3VNVA 2RGBA 3DDCA 2VO1A 3EA0A 1E9AA 3FMIA 3KKMA 5EXSA 4JLBA 4HAUA 1E99A 5KDOA 2GTPA 4Q7JB 3NXSA 5FPSA 4WOPA 2YYZA 1KDOA 2GJ9A 4M53A 4RKFA 2RAPA 2NO6A 1WE2A 2QPTA 3QF7A 1ZU4A 2HCJB 2BJWA 4TTRA 3AVUA 1KO7A 1MO4A 2ZI6A 1TQ2A 5M04A 4QNRA 2IYRA 3PEYA 2WJHA 4XSHA 1OYYA 1PJRA 1TQ6A 4ERNA 4B3CA 4Z54A 2RB4A 5J5CA 4KFUA 1NN0A 3RRMA 1P2UA 2IXFA 1W48A 4FN5A 4LBVA 4P32A 4M1WA 2VF8A 4IEIA 4C0QC 2JLUA 2F43B 2NPIA 3EW9A 1XPOA 3TSZA 2GAAA 5H8WA 3O8DA 1KSJA 1Z0IA 3VU9A 4MRNA 4AYTA 3KKOA 3A4NA 4DHEA 4LGMA 2ZS8A 1VYVA 1KMHB 3ZZTA 1XF9A 2J59A 2W2VA 1RZ3A 4LPKA 1DARA 1UDXA 3GJ4A 2C95A 3PQCA 4HDQB 2OCAA 1GNRA 3RSOA 4Q4AA 3C5CA 1TEXA 4JVSB 1EFRA 1E32A 4TT3A 1HE1C 1N6LA 1T5LA 4O25A 5DNYB 5G53C 3FGNA 4PSKA 2IA5A 3D7MA 4Q03A 5CK5A 3SYKA 1CJKC 1XFAA 2R6DA 1E0KA 4D4MA 4RZUA 2GRJA 4KCGA 1JB1A 1D9XA 1KTVA 3THOA 3GLGB 1E2GA 2EQBA 1M74A 4EUNA 4HLUC 3CNOA 1W2HA 3DO6A 2ZRCA 4W5WA 1G3QA 3I8XA 2WWYA 1KO5A 3K8YA 3ETLA 1L7VC 1GILA 4IVPA 2X1VA 1JI0A 1DG3A 3CNLA 2PJRA 1UEIA 3QPWA 4KYIB 2WJJA 2F7SA 4Q7LA 2IEYA 1GNQA 2FX3A 3AVPA 3FDIA 3GLHA 1DO0A 2FF7A 1J8MF 3W34A 3H4MA 3K70D 3BAFA 3CZQA 3ECCA 3KQHA 1AS0A 1N5KA 1K8RA 1N0WA 2XXAA 1XX6A 2HUPA 1ZJ6A 3OE7A 1Z6YA 2DWQA 4LK2A 1AIPA 2C77A 1E2DA 1Q3TA 1W0KD 3PUXA 3VHLB 4B6FA 1E1QD 3IILA 721PA 5D3MA 1NI3A 1ZM2A 3B85A 3B9PA 4A36A 4ITRC 3S1AB 1AA9A 5EP4A 1E2FA 2KJQA 2FEOA 4HZUB 4IVQA 3CX8A 1XXHE 1KDPA 3O8BA 4MYUA 2GXQA 2Z6VA 4PC2A 5CK4A 4K46A 1J2JA 3IUYA 2BEKA 3QKRA 4DEYA 1QG4A 2O0KA 5LDDC 2FWRA 4TL6A 3SBEA 1OFTA 4KAXA 1KK3A 3VR5A 5L3QB 4C7OA 5DI3B 2W2TA 1CF4A 3TLXA 4NBSA 2BJVA 2XZOA 2GBLA 4KXFB 5IHPA 2IX3A 2RCNA 3PEUA 1OLOA 4LSGA 3OIUA 4TL9A 5ELXA 1Z2AA 3QXJA 3T1VA 2D2EA 3O8CA 3OHMA 1CR0A 2IYXA 3MJRA 4OQLA 2RGEA 1XEFA 4LHVA 2NO1A 5UKDA 3HR8A 4QBGB 1XJCA 3AKDA 4UJ3A 4V02A 4TN1A 1M7BA 1TF2A 4Q1BA 5AK0A 1N25A 1IY2A 3VMFA 4V03A 1SXJA 5JJKA 2IYYA 1P75A 2A5FA 2YVUA 2ZREA 3JZMA 2JATA 2CLDX 2PT5A 3HPQA 4HLDA 3UWKA 4US0R 3X1YA 2GZDA 4HAZA 2YWFA 4PZZA 2ZAMA 4DT1A 1DAKA 1NVXQ 4OI0A 4DDWA 3CIOA 5CDFA 2IW3A 3A58B 1XZPA 2GZHA 2VHUA 1Q3HA 4CEIB 1YR6A 4X8MA 1QRAA 1VDZA 1R10A 1BOFA 2AFIE 2ORWA 4NU0A 1VPLA 4QM6A 4NKRA 3UXMA 1JR3D 1Q57A 3HJNA 1OH8A 2CHQA 2RGCA 1OXVA 1E2HA 1P5ZB 3N2IA 5B58C 2A2ZA 1MRNA 2I1VB 4M1KA 4XVRA 4AYWA 2RMKA 3P26A 2ZRJA 2QROA 1EXMA 3NEYA 2IK8A 1FTSA 1NKTA 2V8OA 2CL6X 3BIFA 1VG1A 2CDNA 3C15C 3MSXA 2XITA 3SJAA 1M7HA 2Z43A 3PUVA 4P4SA 1Z8FA 4B43A 1XEXB 1UKYA 2VHCA 2WIBA 2GEVA 3C4JA 3NWJA 3HPRA 3Q3JB 4AYXA 2WMNB 1G3MA 5FH9A 2QY9A 2ODNA 2FE4A 3P4YA 1JBKA 3RRZA 3L0OA 4R98A 5DH9A 3FFAA 4IJMA 1VIAA 1HYQA 3EXAA 1RPZA 2D2FA 1P2TA 4BLRA 2YOFA 3K0EA 2ZS7A 5IF9A 2X8AA 1IAQA 1QZXA 2CJWA 2H16A 4PPNA 2IS4A 1UBEA 2JAQA 2FSHA 3KJIA 4FCWA 5JHHB 4PAQA 1EWRA 5EE9A 2OCBA 1Z0JA 3L0IB 1HURA 1P2VA 1X86B 4RZ2A 3A1UA 1XTKA 1E9DA 5HZKA 2VPPA 4DUGA 1JALA 2H92A 2RH5A 4D6PA 4U5XA 1W36C 1ZC3A 2GVZC 1WP9A 2HXSA 2JIZD 4TYNA 2MSEB 2HLDD 1N0UA 2ZJYA 1W7AA 4PC7A 4PQRA 2D3WA 4B71A 3W8NA 4DJTA 2ZSAA 5AJYA 3K70B 1NY5A 4PO9A 1P72A 2F43A 2XTNA 1CJMA 2VEDA 2FEMA 1E1RA 3SDZA 3TW8B 4JL6A 4A2PA 2QAGC 1S9HA 2XAUA 1T0HB 5JI3E 1G19A 2JEOA 1BH2A 3K1JA 3P32A 4DCNA 3FKQA 1JQJC 3ADCA 2IS6A 1BO6A 1DAIA 2GVDC 1ZIOA 3CPJB 5E7MA 4PFSA 3CNNA 4Y0VA 3OZXA 4LPSA 5FI0B 1AK2A 5GVSA 1TF5A 5FUYA 2BIFA 5JI2E 4IKEA 1KI6A 4H1VA 2JLQA 1CJVC 3D3QA 3IKJA 1EFRD 3TUZC 1TUIA 1Z3IX 1JAIA 3D31A 3TE6A 2ZR7A 2NZJA 5JECA 2G1JA 5B64A 4WAUA 4TQAA 3QBTA 1KO4A 3NKVA 2IWRA 2ZU0C 2QNRA 4II7A 4I1OA 4LHWA 3GLGE 1W44A 2OXCA 3EARA 2NQ2C 5E7JA 3THWB 5AJZA 1GKYA 4IDQA 5C4MA 1VG9B 4B2IA 3RS0A 4EAQA 2DBYA 4PR0A 2R9VA 3IIMA 4KYUA 3DOEA 1AZTA 3N70A 3EZFA 1CJUC 1YVDA 3UIEA 2CL7X 2NOAA 3QIAA 4FWTA 4GL2A 4E07A 5KYKA 5SZKB 2AD1A 1IN5A 3SHFA 3A8TA 2QRZA 3NH6A 3F0TA 2C5LA 3I5XA 3GCGA 1KO1A 4EPRA 1IJEA 3VR1A 1SHZA 1U90A 5J40A 2XX3A 1KO8A 3U60B 1Z0DA 4X8OA 5H68A 4KITB 1KI3A 1HTWA 3KB1A 4A8JB 2ZJ2A 2ZE7A 3GFPA 2C78A 1MT0A 1VKJA 2F1RA 3DVLA 1GM5A 1E9BA 3UKDA 3CRQA 3K0FB 4JT2A 4DSUA 3V4FA 3RDPA 3W8RA 5KHOC 3Q5DA 2KSQA 2XZLA 5EUQB 1J8YF 3EASA 2P6UA 1IY1A 1AN0A 1DAMA 1W47A 3DZDA 4WZ6A 1G41A 1T4GA 1OB2A 2JLXA 3A1TA 1QDEA 3K0AA 4HAVA 4J0QA 2XNDA 2JLVA 2B92A 4GOKA 3AB3A 3BC1A 4PPQA 1KGDA 4Y0AA 1JPNA 4FMBB 1MR3F 2FPMA 1GAJA 2AN9A 2ZPTX 5DHAA 1OHHA 1ZNXA 4OHZA 4TWZA 5H1YA 2IUTA 5DI3A 2QM8A 3BB3A 2YJTD 1KYIA 3MCAA 1S2MA 1E2JA 3EWAA 4YQFA 3BORA 3VQTA 1KI9A 2AKAB 1RYFA 4UQOA 1ANKA 4ESVA 3AVQA 1JNYA 1XB2A 1KI7A 1F2TB 1H8ED 3KUCA 4G5QA 1R2QA 3A1VA 5P21A 4BFXA 5A5GA 2VP4A 2FA9A 3RAPR 2W6JA 2XZPA 2OSBA 1TAGA 3MLEA 5LBIA 4LJYA 4UKDA 2O8EB 1NN1A 2C99A 4ZIRB 3ADDA 2O8FB 2E87A 1SXJD 2RGNA 1N2CE 1NY6A 2VQSA 4NYJQ 4C30A 3RSLA 3RANA 4RSGA 3FKSA 3MWLA 5FTLA 1MKYA 3IO5A 4M4SA 1HEIA 5DYGA 1G7SA 2LKDA 4IDNA 1KMQA 3NC1C 5FPTA 4XVUA 1AGRA 5AUPB 2DB3A 3NG1A 1CIPA 4ARZB 1LTQA 3OEHD 5KTYA 2R6FA 2DFTA 4D80A 3FHCB 1RKBA 3HU3A 5FFMA 2GCOB 4XOIA 5HCNA 5IDVA 3DPUA 3K9LA 1US8B 1E69A 2VF7A 3DMDA 4BECA 4B73A 1NMXA 1NG9A 2D62A 3M6AA 3K0SA 3KQUA 1Q0UA 5BW8A 3NBXX 3KJHA 2ZJBA 3QPVA 3AKCA 4MGYR 4ZCMA 1GNPA 3E5HA 3QJYA 1NVWQ 2EU8A 2JJ8A 3BOSA 4IVRA 1AKYA 3O47A 4PHFA 2ZI5A 2VHJA 1S8FA 2Q6TA 4DRZA 4QL3A 3TUIC 3GJ0A 1YZLA 1XD2A 4NDZA 4TTQA 3SN6A 1JEDA 1T5IA 1G5TA 3LQQA 4OI4A 4JLOA 3W5JA 1GIAA 2B7BA 3NVAA 2NO9A 4MITA 5TMPA 1ETUA 3BH6A 4URZR 2D4HA 4JLAA 2QTVB 2EYUA 2V1UA 1P62B 3QEOA 3G82C 2O0JA 2JASA 4JL8A 2PMKA 3ZQJA 3ZVLA 4JLKA 4I1VA 3QY0A 1ZW6A 4DBLC 2LWIA 4DCVA 3NBZC 3SR0A 1B23P 5EXXA 4BQSA 3LNCA 1AA3A 2QTHA 3HP1A 4MRRA 4XTRA 5E7IA 2WKQA 1W36B 3RS7A 1OSNA 2FZ4A 3T06B 1WMSA 4TLEA 1QHHA 1NBMA 4D0GA 4ILEA 3LBHA 2QPOA 4RCZA 1P6XA 1Y63A 2ZR0A 4GOJA 4DDUA 4Q1EA 1RVDA 1YQTA 3PFIA 4IFEA 3WYGA 4Q9JA 1G3RA 1E79D 1XTRA 3QBVA 4MH0R 1EK0A 3AVWA 4D0NA 4YXWD 4FI3C 3ZS9A 4D4KA 3M1IA 2H7VA 5L3SB 4TYPA 5EE3A 3LW8A 2OFXA 4FIDA 2ZRAA 2WPDA 3L82B 3ZZ0A 1FTNA 1KJWA 1UBCA 4AKHA 4Z51A 2A7QA 3CZPA 3F8TA 4M9QA 1WRBA 3CF2A 4N0DA 3WMEA 1DELA 3VX3A 3NBFA 1JR6A 1RRCA 1O3YA 1FOEB 5G41A 2WAXA 4WBSA 2ZE6A 3IQWA 3TUJC 4YONB 1A82A 4PO8A 1YZKA 3RS4A 1JXMA 1S3SA 2EFDB 4N3NA 1DG1G 2EVWX 1FX0B 1ZVQA 3GFTA 3ZD6A 4LJ7A 1Z6GA 4AD8A 1QVRA 2Q0HA 1WDTA 2AKYA 2FPKA 3THXA 4HLUA 4JLMA 1CLUA 5FTNA 4BFWA 5E95A 621PA 3DHWC 4KFSA 4LDJA 2G6BA 1P7CA 1EFCA 2Z5FA 3QQ5A 4PQYA 4M1YA 3KL4A 3UPUA 4NMMA 1G7TA 4RD1A 4XWAA 1FQJA 4YMUA 2PEYA 2JJ1D 2HV8A 1S1CA 3U4QA 1OB5A 2H1LA 4QGAA 4EJSB 3EAQA 2O52A 5SZIA 1TQDA 3THWA 3QKSB 1X8LA 2WWGA 4RD4A 2PZFA 1QHGA 2OCYC 3DMNA 2W6ID 4L4UA 3CX6A 1HT2E 3AP3A 3BJIC 5L3RA 1KNXA 5F98A 2OILA 1OIVA 4B44A 1E2LA 2YHSA 4CEJB 2O0HA 2CHGA 2G1KA 4JZKA 2BEJA 1YKSA 5TARA 2B7CA 4NCHA 2P2LA 2C98A 1HT1E 3ZD7A 2OEPA 3T5GA 1ZD1A 1MO3A 2AWNA 1TTTA 1K6MA 2OUKA 4NCKA 2BMJA 2NO0A 3KFVA 5HKKD 1ELOA 3TR5A 5TDHA 1ZM3A 3HR7A 4MYHA 2WSSA 3QF4A 4A6PA 3AM1A 4MRSA 4M1OA 2WJYA 4OI1A 1K5GA 1V5WA 2AL7A 4JLDA 1Z5ZA 4PAMA 2FH5B 1YE8A 1N6HA 2XSZD 3NEJA 4GDFA 3MG9A 1IM2A 4LI0A 4RFVA 1XJQA 2W2XA 4LV5B 1KKMA 1BKDR 3OIWA 2XJ4A 5GJVC 4G5OA 1JR3E 2CLCX 3BGWA 5HPYB 1XMVA 1ZUNB 1SVKA 4DZZA 5DIFA 4BEJA 1R0ZA 1QHYA 1CS4C 3AF2A 4ESHA 4NCJA 1T8UA 1E9CA 4PZYA 4BRWA 2ONKA 4DXAA 4GZMA 3QE0A 4GT1A 5GJWC 3KKPA 3W6NA 4LWZA 3LFUA 1F2TA 4ZDIA 4DWJA 1AZSC 1AS2A 4Q21A 5AUOB 4OQMA 4YMVA 4IEEA 3W9YA 3WRYC 4QM7A 1XMSA 2W6JD 3MFYA 4KFTA 3ASZA 2IS1A 4HZIA 4GZLA 3R9WA 4GSYA 3BXZA 4V0OA 3SS8A 1IXSB 2XB2A 1CP2A 4NYJR 2QG6A 4HAXA 2BBOA 1UADA 3IEUA 4D81A 1KSGA 2FSGA 2ATVA 1KNQA 1BMFA 2JCSA 2YV5A 1G3UA 1YR8A 3BS4A 4BLSA 3SZRA 2HJVA 5J4HA 2V7QD 4Q00A 3UG7A 4UXHA 3RRYA 4K81B 1RFLA 421PA 1TPZA 4B32A 1R8SA 2FZLA 1D8TA 4P3YA 3UMSA 5GJCA 2GHIA 4C0AC 3FYHA 2Z4SA 4F93B 1M34E 3A1WA 1W0JA 4WXPA 2GCOA 1D5CA 3LW7A 4HB4A 4KSCA 4C2TA 2G9NA 4CF7A 1VMAA 1YHNA 1US8A 5G40A 3T12A 2FFQA 5EUMA 2WJIA 5CB8A 1PLLA 3NIBA 5JEEA 2O8CA 1TNDA 5DO9A 2BCGY 1QHXA 4B3FX 2HF8A 5GADl 4DSNA 1E2EA 1U81A 1TQ4A 5K8UA 1W5SA 3C8UA 1PUJA 2BKEA 4B35A 2PJZA 2UVQA 1GL7A 1MO6A 3PCRB 3Q72A 4JBYA 1IJFA 1YU9A 4DB4A 2QAJA 4B34A 4MRPA 3A37A 4RFSB 5AWFC 4MUBA 1D2MA 1XTJA 1T3HA 4XSGA 3SFZA 3K70C 1G5PA 2B8WA 1W1WA 5FBQB 3ZYCA 3EPLA 4GP6A 4R7ZA 2C9YA 2O8BA 1SVSA 2QP4A 3CPEA 2MSDB 2J7PA 4ZCLA 1NNEA 1N6PA 3CR8A 3CKLA 5CYOA 4CYMA 4KI0A 5KSOA 3G5UA 1WXQA 2XB4A 5C18A 4D2IA 4DIEA 221PA 1G18A 1IOZA 3M4YA 4G5GA 4Q5IA 1KI8A 1U0HC 1ZNZA 4LCBA 3AP1A 3GJ6A 4W7SA 2JA1A 2ZRLA 1NIJA 4HAWA 2OLJA 5G3ZA 4E03A 3QNUA 4LYJA 1JPJA 4F7WA 3LX5A 1NBMD 2KWIA 1ZP6A 2OV2A 2XTMA 1M8PA 2JJ2D 3R8CA 1IN8A 4EPWA 1F3OA 1NVUQ 1VG0B 2QAGA 2C2HA 3V00A 3BRWD 4FCTA 3KTAA 3M0EA 2Q3MA 4GNKA 3T5DA 4NZYA 3VKHA 5EXTA 5BN4A 4LYAA 1AKEA 4ASUD 2WPDD 2BVNA 2IHBA 4W5HA 3TAHA 4G0NA 3JVVA 3ZIAA 5HE9A 3LV8A 2CCKA 4EFMA 1G8FA 1D2EA 1U94A 1NMYA 1IONA 4NP6A 2ZITA 3UMRA 2HT1A 4Q9HA 4A8JC 3KJGA 4FWIB 1XXHA 2RGDA 1P2SA 3ND8A 3CRW1 1U0LA 3KUDA 4IOJA 4M22A 5DGXA 1LS6A 1HV8A 4KVGA 3NHAA 4Q1CA 5EP1A 2G0NA 2DFKB 3BK7A 4MGZR 3LRPA 1E2PA 1X1RA 1KI2A 3TKLA 4URUR 5F3WB 3K09C 1X6VA 1VECA 4XIGS 1F48A 1MABB 5J47A 4G01B 3UWOA 4BPBA 2FV8A 1CEEA 1Q21A 2ZETA 4TQUS 2REXB 3OEEA 4HB2A 4IHQA 3R8FA 2GXUA 3W3AA 4TLCA 4YDSA 2YNMA 4JBWA 1LV7A 3LAWA 3AVYA 5F9FA 1OKKD 3B1ZA 1LNZA 5JFGA 2VP0A 2ZSFA 1G6HA 1F2UA 2DHRA 5DLQC 2PZEA 4V0NA 1P60A 1COWA 3AQ4A 3BFXA 1TL7C 3F5FA 5JZVA 4CEJA 2WBLC 2BOVA 5KOYA 4GBMA 3ADKA 1XD9A 4WW0A 5JBQA 3CR7A 1FL9A 2QA5A 5JCPA 4AKGA 4LBWA 4A0HA 1HE8B 2QM7A 1SXJE 3TJZA 4I4LA 2EFCB 3ZH9B 2HYIC 1KHTA 5FL7D 1L8QA 1R7RA 2ZQ5A 3LVRE 4TL8A 4TMKA 2OFOA 2GK7A 2ZYUX 4QHSA 2REBA 1G21E 3Q7QA 3MUFA 3B82A 3O8RA 1Z6TA 4AWXA 1TEVA 2IF0A 1JECA 4ZCIA 1ZIPA 1Z6AA 4DB2A 3DM5A 3RS5A 1NRJB 4JS0A 4OJQA 3GLIB 1C9KA 1A1VA 2GDJA 2ZE5A 5SZJA 3WP1B 4ZI2A 2V3CC 3BD9A 1IQPA 1Q20A 4HUQB 1RYHA 4NYMR 1TF7A 3TAUA 1P9NA 4PO1A 2QSYA 3EPJA 3HU1A 2GCNA 2JDIA 2ZI7A 1OYWA 3SNHA 3U44A 3EA5A 1RIFA 3N2EA 3DM9B 2OAP1 4AK9A 1KIMA 1LY1A 2GEDA 5FBLB 2MSCB 4JKYA 1XEWY 3T61A 2LCFA 4PHTA 5JHGB 2XOKA 1NN3A 1YZTA 2L0XA 3EC1A 4B6EA 1DAEA 2VP6A 3PVSA 1WA5A 4S35A 1GKIA 5LD2C 4FCVA 4WVFA 4Q4JA 1W4RA 3RS2A 3AF0A 4B75A 1U9IA 2DY1A 2ZS9A 2NG1A 4AKIA 1XP8A 4TSFA 3EPKA 1XZQA 4P4TA 4LJAA 2GJ8A 5G3YA 1GUAA 1QHNA 2VHQA 3X1XA 2BBWA 4JBXA 3DL0A 3I32A 2H5EA 4URWR 1I4DD 4V0LA 4YMSA 2G83A 4DVGA 2HXYA 4M21A 2IXEA 2FSFA 4DLWA 4W9MC 4XWOA 2J0VA 3TGPA 3VX4A 2CCJA 1IXRC 2GILA 1W49A 3TQCA 1DAGA 4M1SA 2H8KA 1R8QA 1P9WA 1JAHA 4US2R 5JSZB 1CXZA 1OH7A 1GRNA 4M9XA 1E9EA 3P27A 4QBFA 1A2BA 2ZRFA 5JS7A 2NIPA 4BLQA 1M1YE 2Q9AA 3CX7A 4EQ6B 1ZRHA 2W83A 1S9DA 4DLXA 3DEFA 1S1MA 2P6RA 3QG1A 2MMGA 2ZJOA 3BFKA 1SVWA 4OI2A 2JLWA 4PTLA 4P4UA 5KNCA 2Z83A 3TRFA 5LPNA 1B0UA 3QVUA 4MKIA 5SZHB 2O8DB 3TVTA 2BC9A 3GJ7A 4IOMA 2NGRA 1KMHA 1H8HA 821PA 4GMXA 4TLBA 5C2JB 2R6CA 1ONBA 1FP6A 1XCMA 2D7CA 3NTUA 4NHOA 2QGZA 4I99A 6Q21A 3A4LA 5D3QA 1XEWX 4DCUA 3PIRA 2AXPA 4TT3D 4UNQA 3WMGA 1U8ZA 1ZMXA 2JLSA 4KBGA 2DWPA 2ZANA 2G77B 1CRPA 2XJ9A 1S3GA 4EFLA 4OBEA 4V0KA 3B13B 3I92A 4YMWA 3GLFB 3K0CC 2QMUA 2A5JA 4JIMA 1TUEA 2BDTA 1F5NA 2J7PD 4LHXA 1UPTA 2F1JA 4LY6A 2ASEA 3GLGA 1WBBA 4XVQA 2ZRPA 1XTSA 2GNOA 3B8HA 4DCSA 1Z63A 3H1TA 4GFDA 3AVTA 1XPRA 3ZS8A 4CRWB 4PC6A 4RD6A 3CPHA 3R7WB 4PSAA 3VR2A 4YMTA 1DVRA 1XPUA 2WVJA 2PH1A 1VYTA 2MMCA 4UNNA 3N5CA 4PAOA 3GJ8A 4LHZA 4OK3A 2JLZA 4EJSC 1JJ7A 2ZSEA 2YZ2A 4GRAA 4JL5A 1DOAA 3KJEA 4LUCA 1HA3A 2OBNA 2X77A 1DE0A 3C7KA 1T91A 3KKNA 4XD7A 2OM2A 4Q01A 1S0UA 3OE7D 4IDHA 3IPXA 4GP7A 2Q3HA 3LVQE 4L9WA 5FUWA 1TU4A 1TADA 2IT1A 3VFDA 3UANA 2A5GA 3NHBA 1U2RA 2QMHA 5TXGA 2JLYA 2G3YA 2P5SA 3S1AA 2X2FA 3WP0A 2WMOB 3RVBA 1R5NA 2AFHE 4LBYA 4HZUA 4A0FA 1EFTA 4EIWA 3Q8XB 2IHYA 2F1HA 1N6IA 2B8TA 2FMXA 3IHWA 4G3XA 4LX0A 3U3KA 1I4LD 1SXJC 1ZINA 2XGJA 3GMTA 1SULA 2A30A 4MYCA 3TMKA 4QGFA 5L3QA 1OJLA 4QC2A 5K8IA 4AURA 4A0RA 4TZ6A 2V54A 5JRZA 5BYJA 4NE2A 3PUYA 2ZROA 1UJ2A 1FUKA 1NF3A 2ZYWX 4Q4HB 3QKUA 1BIFA 4R2IA 4F4JA 1G4UR 2DFLA 1A4RA 1XU4A 2OE2A 1L2TA 1YZGA 4Q7MB 2H17A 1NSFA 1Z07A 4ZDJA 4IW3B 5KPDA 3U6BA 3B78A 5TY0A 1ZNWA 3OEED 1CR1A 1FQKA 4PX9A 1A2KC 2OAQ1 1SHKA 3CH4B 5IK2A 3CWZA 2V55B 2N42A 4UXIA 3FTQA 4LJ5A 4QXAA 4LV8B 1Z29A 3Q7PA 2QMEA 4EPVA 2FSIA 4KODA 3QUSA 1ZCBA 3RNLA 4Z8XA 2J0QA 3FOZA 5EQTA 1COWD 4DKXA 2RHDA 4RCYA 1QVAA 2PZGA 4DLUA 4ZDKA 1PV4A 2CK3A 1E2MA 4KVAA 2ERYA 1T3SA 3QXXA 2ZRIA 4LJ6A 4A2QA 2EFEB 1BYIA 3IIJA 5K8LA 2ZYVX 4CEIA 3H0KA 2HT6A 2QP9X 1IN7A 1C1YA 4BEBA 1KKLA 1NLZA 2WICA 2BHRA 2CL0X 2DYKA 3CB4A 2FGJA 4TLAA 3AF4A 3NC0C 2ZM5A 1EWQA 3GLIE 3KXIA 1II0A 3KQKA 4JYCA 3X2SA 3L8ZA 1N5IA 5LD2B 2EFHB 4GPTA 3AF3A 1MO5A 4TMXA 1WF3A 2IYTA 4MDFA 2YC2C 1GITA 3LXXA 4DIDA 4Q02A 1E0AA 1XCPA 1RRGA 1UBFA 2JDID 1EX7A 2WWXA 1R0XA 1XEXA 4V0ME 1CBUA 3PXGA 2QEQA 1LVGA 4A15A 3FMFA 1G3IA 1ZM9A 4DCTA 4ZKDA 2OFWA 1XRJA 4Q4AB 2REOA 2FGKA 5DYIA 1FPMA 1NN5A 4IFBA 1KDRA 4I1SA 3GQBA 3ZDQA 1G17A 1MOZA 2OESA 4P33A 1OXSC 3CW2A 3UMFA 3SYNA 1NG1A 1R4AA 2CVHA 5KU1A 3KQNA 2CCGA 1GRRA 1N0VC 2IYQA 4XH9B 5JWHA 4A82A 4TSFD 2FG5A 3U7HB 2IYVA 5CJ2A 3U7FB 1LS1A 1P9RA 3CRMA 4UNSA 3U7EB 1L4YA 1NJFA 2P5TB 5DE3A 3BE4A 1I2DA 2ODBA 2ORVA 1PZNA 2FFBA 4KV9A 4CZ2A 2HJGA 2YC4C 1NBME 2FN4A 3IDQA 4OHXA 4Q4LA 5CYPA 4DUGD 5EXPA 1II8B 2R8RA 4MQBA 4F4IA 3B1XA 2GETA 3WY9A 3EIQA 3RC3A 2QE7A 1K5DA 2BMEA 3GLHB 3AH8A 3TQFA 1RW4A 2VHTA 5FBVB 1IN4A 4OHVA 2ZR9A 1G8PA 4UXJA 4D4JA 1E1RD 2XXAB 3KFXA 2ZJZA 1J70A 4PSVA 2IEZA 2BWJA 1W0KA 2VP2A 4MKGA 4OK5A 2FJUA 5BWMA 5CM9C 2I4IA 5FR2A 4H1UA 4K8OA 2C8VA 5D3MB 1G16A 5FOWA 3ZQ6A 2EYQA 1KK0A 3I72A 5J4VA 2A9KA 4PC3A 4KO8A 4R2HA 1UKVY 2TMKA 2WKPA 5FTMA 5BN3A 3MRSA 1R6BX 1GKUB 4TMWA 4D0LB 2IYLD 3EX7C 4BFYA 2QSZA 4B48A 3EC2A 3GLFE 1CULC 3RRNA 3QKRB 1YR9A 4C0HA 2WWWA 2VTKA 2P6NA 1UFQA 2VSFA 4HB0A 4JVMA 3CUEF 4UNRA 2ZEJA 2FOLA 1AQYA 3UATA 5E3HA 1GSIA 1E98A 4DLRA 1Q1BA 2N1BA 2ZI4A 3I4LA 2ZTSA 2IC5A 2F55A 1BYUA 1HUQA 2WZQA 4KSBA 3CRVA 4A1FA 1P73A 2CBZA 4F92B 4NL4H 4NYIQ 1LB1B 1UKEA 3QXSA 4M2LA 2QMOA 2IYWA 5ANRB 4BGDA 3G0HA 4FINA 2XTZA 4JVNA 2W00A 1W4CA 3U3RA 2LKCA 1JXOA 4OQNA 1CU1A 1VCMA 2RGGA 1ZCAA 3NBYC 5TV2A 5KPJA 3AUYA 4QGHA 2J1LA 4A8JA 1SXJB 2V6IA 1OW3B 2WAYA 2WSMA 3WMFA 1ZYUA 4IOKA 1DO2A 2ECKA 3K0FA 3WHKA 4C2UA 2VBCA 4PPFA 4NPHA 5LB2A 1J7KA 3W5IA 2VSXA 4JJKA 1VTKA 2WWFA 5FPHA 1G5RA 3K09A 4DT1B 3FHTA 1N5LA 4AG5A 2QORA 2YWHA 3CM0A 4LC0A 2XNDD 2YKGA 4D26A 2HCBA 5C1BA 4DLZA 1OH5A 4RD0A 4LHYA 1FMLA 4NCIA 2KBEA 1OH6A 1E2IA 4QJ3A 4RZXA 4LYFA 1OHHD 3EG5A 3B5JA 1ZAKA 4HLQB 4OYHA 1CTQA 1ZD9A 3W6OA 2WHXA 3HYTA 3H84A 2IS2A 3U3JA 3WRXC 1DBSA 1G7CA 4IXMA 4Q4HA 4BFVA 3GJ5A 3PUZA 4X8LA 2ANBA 3GEHA 1AGPA 1SGWA 4PPGA 1VCNA 3EIEA 3VAAA 1EFUA 2JGNA 4Z1MA 5HZHA 4MGIR 1E0JA 1SZPA 3X1WA 4TQ9A 2PX3A 3ZLJA 3SJCA 3THYB 1OXUA 3B7GA 4OQFA 5IK2D 2O8EA 5JJIA 4P4SB 4DDTA 1VCOA 4ZIRA 2O8FA 1SVLA 2QN6A 5EJEA 1X8JA 2UKDA 4M1MA 1NVVQ 3LLUA 2Q21A 3EWSA 4N0EA 4DSOA 1YZUA 3PEWA 2Z4RA 3FKSD 3PITA 4FMCF 2HYDA 2GF9A 3B2EA 3ZGXA 2IF2A 4AG6A 2ZIAA 2BBTA 2CK3D 3B1WA 4ARZA 2CJWB 4O2RA 2J45A 3L0PA 5AJVB 1BS1A 4QJ5A 2XNSA 5FUVA 1XTQA 5CJPA 3ONWA 2VLIA 2H18A 2ZSBA 2G0TA 1HQYE 1XDBA 3GD7A 5FUXA 4E09A 2DR3A 5EZ6B 1QHSA 5FR1A 1YRBA 4XJXA 2VIIA 1KK2A 3DOFA 4U7DA 3OF5A 1O87A 4HEJA 2JIZA 4P0TA 2HLDA 1E0SA 1N6NA 3RYTC 3L0SA 1X8KA 1V43A 4M0LA 4EDHA 4G5RA 1DADA 2ERXA 1RE0A 2C96A 2J5XA 2WWHA 5A0FA 4B3DA 2ZUBA 1G20E 1Z22A 4D4LA 1X1SA 2KE5A 1ZC4A 3L43A 1IY0A 3OESA 4Q1AA 3IPYA 4RZ3A 1ESNA 4CDGA 1AS3A 4LOAA 4HUTA 1PVOA 1NJGA 4F4CA 2GJKA 3I73A 4C0JA 4JSTA 2XEXA 1RC8A 1U98A 1Z06A 4QOSA 1Q1QA 3OAAA 1KOFA 4B2PA 1EX6A 4JMPA 1Z0KA 1KI6B 2Q3FA 2V4ZA 2GXAA 4MRVA 2GA8A 2ZRDA 5KSZA 3AV0B
chains in the Genus database with same CATH superfamily
4D97A 1Q1NA 2Q5EA 2Y0PA 2RG1A 1C4OA 4NMHA 3UH1A 5GIOE 1JIUA 3FDJA 3LPLA 4OXYA 1CYEA 1XLTA 4YJ2A 1AV7A 2OCKA 3DBVO 3DDHA 3HRIA 5G0WA 2BFBA 4ACBA 2C9DA 3VM6A 3SQWA 2BM0A 4ZT4A 3T7EA 2OO7A 1OBCA 2SHKA 3MQFA 1UBRS 3T7SA 4HJXA 5F2KA 4RDXA 1UEJA 1ZGAA 2QQ0A 4GL4A 3DJFA 3PRJA 1PEAA 1K6XA 1QYXA 1L7QA 1YH3A 3PKZA 2HA7A 3AI7A 1QR6A 4M9ZA 1CQPA 3WKAA 2ANCA 3SEZA 1G8KA 1KY2A 2XF2A 3FYTA 1VE5A 4C7KA 1RAEA 1PT7A 5L4SA 4MW2A 1U7DA 1CUZA 1U7ZA 4H2DA 3BGDA 3D8RA 1DBQA 3ZY5A 3U3OA 4JC4A 3EEBA 4C0SA 2VVTA 3RTDA 2Q9BA 1CETA 4KXMA 1LD3A 4M8IA 1U3DA 1WS6A 3TFQA 3ESXA 1J5XA 4JLVA 4EA7A 5LMCA 1AJEA 3HDTA 2PAFA 1D2NA 1KJYA 1KR5A 2P9EA 1WF6A 2I78A 3ADOA 3HUFA 4IIVA 4MWEA 5BWLA 5J3JA 5GJBA 2COUA 1U28C 4ONEA 4NU8X 4PGHA 5FPKA 1FP7A 4HUJA 3KQLA 1ZK4A 1E2NA 1KQPA 5KTOA 2J9XB 4C2BA 4I1UA 5EJ9A 3F5DA 1WXDA 4MVXA 3MM4A 5G0TA 1E3IA 1UXGA 3SD7A 1N2BA 3B2NA 1Q44A 5HK8A 1DBWA 5CNKA 1MOQA 1J0AA 1OMOA 1OWMA 5CA0F 4DOMA 2GYYA 1EQ2A 1W52X 1GRQA 1FNMA 2PA0A 3I0ZA 2VZEA 4OFBA 2PT7A 1G55A 2IPOA 2I2FA 2XVZA 3TRIA 4BRUA 4XTCS 3NGLA 4RIIA 1YCDA 4OKNA 3TBHA 3AGQA 1HEYA 1IHDA 4IUCS 2DWOA 1C30B 3TNFA 5BQ3A 3B1JA 3EUFA 1JS1X 5I5EA 3A4MA 4CKWA 3NP7A 4EJSA 1PVVA 3PNBA 5ECWA 4NH0A 1JHMA 4O4JF 2UVDA 4DZTA 2HPAA 2NTEA 2OAEA 3ICWA 4MGKR 4KNYA 2Y1XA 2PFGA 4L5BA 3PXBA 2G8LA 1WL8A 2FHPA 2H2DA 2QYTA 2WJAA 3NIDB 1H8EA 4WLNA 3X1DA 1IHPA 2ZUFA 3FLAA 4KIJA 2HF9A 4HLCA 1XKTA 5J63A 4GQAA 1CQJB 4XUEA 3VSCA 1RQXA 3EAFA 2IXGA 5EVJA 3IOEA 2O6HA 1KVRA 2XE8A 1VKHA 1TX4B 1YCHA 2Z1MA 3D3KA 3DQZA 4P82A 2WJVA 4KLNA 5BNFA 3KXLA 3VVMA 1TGYA 3Q3GE 1YQUA 2OC9A 1G6OA 5LQAA 2VDKB 4N76A 3EDOA 1FXSA 2GEUA 4I6EA 2PKYX 3TK1A 1JHOA 1SKQA 2NO4A 4CLEA 4PLTA 3HJCA 4UCWA 2IOQA 3SSMA 2PBZA 1P33A 3HJAA 4Z6KA 4XIIA 4WX2B 3K94A 3QPUA 4GR4A 3RUIA 3IGFA 2RE8A 1WVIA 5CITA 1UK8A 5LL6P 3FFBA 3T9DA 1T1IA 3ZWBA 2OT3B 1F14A 1JJAA 3ITNA 5HZMA 5T8KA 3OH8A 3ZV4A 4QOIA 4QREA 1MLDA 1WUYA 1JQEA 1JJVA 2R62A 4EMUA 3SQDA 3FB4A 1AKWA 2AVNA 3H4TA 1MJHA 2D8AA 4RVDA 2ZYDA 4U8GA 4RJJA 3GG2A 3UMYA 2I2BA 3HR4A 3LDGA 4NPCA 5TVGA 3HKCA 5BMOA 3CBQA 4GF5A 5DISB 2OWDA 1T5DX 1B0AA 4WESA 4CN8A 1YS2X 2WIAA 2VWHA 1PK8A 1ZUNA 4UBLA 2HDNB 4EY5A 4KIGA 5FI1B 1N9ZA 3WBJA 2O9JA 2QX6A 5HBRA 3SC4A 1WMDA 1V71A 2P2GA 4C08A 3VU8A 3OBBA 1ZI8A 3O3NB 2AK2A 5FTKA 4J94A 4CKEB 5JS6A 2NMVA 4HB3A 5IN5A 3SCZA 3J7AC 1IZ0A 3OM9A 4I55F 2ACEA 1GU7A 1L4FA 4OP2A 4AZWA 5LXTB 4RNDB 3WV5A 1YVUA 2DH5A 1BHQ1 1EHIA 1WMFA 2ZWVA 3PTAA 4GI7A 2ONYA 2PWPA 4ECAA 4B6PA 3SEQA 3AXSA 1KI1A 1A4UA 1NVVR 2RGXA 1JLLA 1H66A 2I5PO 2FK8A 4MQ6A 1ODIA 1P7WA 1PKEA 4KU4A 1PV1A 3GIDA 4HGRA 4LJLA 5BXQC 5HUQA 2RAUA 1W2GA 2W2KA 2PGJA 1BMFD 5LZ8A 1FLDA 3IXMA 1J5PA 3IQXA 4IHJF 1N2ZA 2IS4A 3NHKA 4MZDA 1PIWA 2H6EA 4HNAA 4JX9A 3C3AA 5GPBA 2VYFA 3IAEA 3GARA 4HLNA 4MIEA 2J5KA 4JKIA 1QHHB 4DV5B 2C59A 1SU4A 5F7JA 3SC3A 3TZBA 1E9FA 3IHKA 1OE0A 1S8NA 1X15A 4LYEA 1O9HA 2ZAGA 4ID3A 5EQJB 4AULA 3DVSX 3DXYA 4RHXA 1W0JD 1Z25A 2WG1A 2YS6A 3C5WP 4RVCA 4W1SA 3U0VA 5AJTA 4O29A 4BP9A 4LRQA 3L2OB 3GT4A 3OZVA 4QG7A 4QHYA 4NONA 4TTPA 3NWBA 1P0MA 2WNHA 3PX2A 3ROKA 4QXOA 4Z8YA 4J2HA 1O89A 1J8DA 3EWNA 5DCYA 1GFIA 1QB7A 3X44A 5DM2A 1D9ZA 4HDAA 4OQEA 4MB6A 4R8LA 3PC8A 4H9GA 4I5EA 1WZNA 1P1JA 5J4YA 1RADA 3H99A 4MUIA 3AEUB 3HI6A 2C8JA 3HVHA 3V42A 3T7KA 1H1LB 2GZAA 4YUWA 2WDZA 3DLHA 2IIPA 4LZWA 3B53X 5IW8A 1I3NA 2LR0A 1YVEI 4EPYA 2DGDA 4HKTA 4HL6A 2ODWA 4J76A 4WXRA 1TO6A 2FMIA 3O9ZA 2BMDA 1QQTA 1YA6A 2DHQA 3RVRA 3P0HA 3BERA 2D5LA 1QFMA 1QFJA 4RVNA 5K3BA 1I4EB 5ITSA 1H93A 5JQGA 3MELA 4P7GA 4B7CA 4NARA 1PK7A 3DE4X 4UAVA 1VG8A 3B1VA 4XASA 4UM9B 1XDDA 3DAGA 1ZNQO 2HPHA 4FMDF 1O0BA 3V5NA 4WZAB 3FYUC 4IILA 4JASB 5JIBA 1REQB 3RC7A 1K6JA 5K3EA 3U6KA 2QBYB 5CB6A 1FRFS 3S8MA 2HSWA 1C3JA 4DVJA 2ZKLA 1BD3A 4BKOA 4EUEA 4JJFA 3R9XA 1YJ5A 2JLRA 4GZ6A 2YRXA 4QECA 3EDMA 1QO0A 1XAHA 2X0JA 4C1NA 2CEAA 1UK7A 3MGCA 4UNPA 4MCIA 5HR5A 3GPLA 2JJ1A 2D1YA 3CLTC 2R1VB 3FHOA 3KDAA 1GPLA 1A27A 1GQ2A 3F6YA 1R6XA 3A6ZA 3K35A 2XDQB 4GZ3A 5FQNA 4MDEA 5HYVA 1AO3A 1FW8A 1T8PA 4HNGA 3A3PA 3D2LA 3TIFA 2R25B 1SBZA 2QUAA 2W6IA 2GBFA 2ZVPX 3H9UA 3K9CA 3IHLA 4JGGA 5JO9A 3RB8A 3TIIA 4HNQA 1R0WA 2W2PA 3OZDA 1MX5A 4JNKA 1IE3A 5C46F 2Y0EA 6LDHA 1RAAA 1XF1A 3KALA 1XVIA 2HRCA 2FNAA 1O9BA 1XRLA 2R5NA 3Q98A 4MA4A 5EJFA 2ZAYA 2C9CA 2FFHA 2Q4EA 1NBOA 3CNBA 3LG2A 5FBWB 1NLYA 3QZUA 5EJ6A 2IGTA 3AFGA 4XIYA 3S81A 3MWJA 4QFCA 3B6EA 4MV4A 4ZDWA 1A71A 1FFGA 4NY1A 1IPEA 4Q19A 3ZGVA 4CNBA 3AJAA 1X7YB 1SR8A 1TLTA 4HC4A 2ZDGA 5KJ1A 3U5ZB 2C58A 5AVQA 1BE1A 3K6RA 4FR0A 1BA3A 1WXGA 4MVCA 4X9XA 3D5QA 4M0PA 1QRRA 3T7JA 4BHTA 1U0BB 1K63A 4MCAA 4P6VF 1KJZA 1L7RA 3IEKA 121PA 1RMQA 2YUIA 4E5YA 3KB2A 1X1TA 2Q6LA 3PWSA 4F46A 4LXHA 3A70A 2HA5A 4H6XA 4RMGA 2CHVA 2FPLA 2RHLA 4L7VA 2A0YA 4P36A 2CSXA 1SKYB 2C04A 4U2CA 5B58T 2ZJ1A 1TUGA 1XCGB 1QPGA 1QUFA 3F78A 1DPFA 3IB3A 2NTJA 3C14C 3L8CA 3OPVA 2BRUA 3GY0A 3JYOA 3V34A 3VTFA 2MWMA 3NU1A 4E70A 1WP4A 5B1IA 3PLNA 4POOA 2P9CA 3ETJA 3STVA 2QX8A 4YJKA 3CSSA 2ZRKA 3M6UA 4DMKA 3BBPA 3V7YA 1K06A 4DR6B 2FW1A 3VPHA 4F38A 1PZEA 3Q1LA 3ORQA 3Q85A 3DTVA 4ZVUA 4B0PA 5IKPA 3WNQA 5JXJA 1Y1KE 3IVRA 3L4SO 1KI4A 3KYJB 3LBAA 3U37A 1Q17A 2JFWA 3RWOA 1N1MA 3D1VA 3GZTB 3UHJA 3KTDA 3NPMA 4B3BA 4CEHA 1FQWA 3GUUA 4YEDA 4ZV4A 4Y2SA 5EXDA 5A6SA 3NWEA 4FB5A 1PJLA 3OA0A 4YRTA 3CUWA 1F9EA 1HDGO 1VHTA 1XWIA 4X92A 5COAA 5E0OA 3VPFA 4ERXA 1G5HA 1OA0A 3VI3B 4EABA 5KTPA 2CNWD 3FSRA 1YMVA 1OIWA 3NMUF 4AI6A 4O3FA 2IDKA 3NVMB 4B33A 4WFJA 2R751 2BFAA 2DKNA 4CI9A 1A9TA 1NKSA 3ONFA 5ALIA 4D9EA 4J4TA 1H2WA 4MQEA 1NQAO 1WV0A 2O2HA 2NUTB 3AI1A 3Q6MA 4AJPA 1NQOA 1P3JA 2DR0A 2G7ZA 2XYHA 1NYLA 4FC7A 2XRFA 4FI3F 4JXKA 4NF2A 1RI4A 3PFKA 2A5LA 3PF8A 1DDOA 3OIFA 4NBLA 1MFZA 3QFTA 3Q9LA 3EIHA 1DC6A 2BCEA 4DCMA 5KJCA 5AJHA 3KT0A 3HCAA 4Q18A 2PUCA 1T3GA 3CLVA 1R5OA 2BFFB 2E18A 1KIFA 1TU3A 1T4MA 3IKLA 4OY3A 5KSYA 2WKRA 4MW1A 4EG5A 2JFYA 1QV6A 3Q5GA 3FROA 1IN6A 4ZOBA 4DV7B 3D5EA 2CLSA 3VR5H 4ZOCA 2EKZA 1G20B 1CRQA 4G89A 4NNPA 2DRIA 4M7RA 1I10A 4ZCPA 5IP5A 2ZI3A 1Y33E 2GM3A 4GE0A 1JFFB 2SCUB 5C31A 1LNSA 2FEKA 4JB2A 3HGMA 3LQRA 2VXYA 1UCFA 1B1CA 1XD8A 2QRQA 3QENA 1NIPA 1DAHA 3L06A 4JMLA 4Q1DA 4V0MA 4WA7A 2WVGA 3LH5A 4BBZA 1I7PA 1SH7A 2ZIGA 4GMDA 1E7RA 1OT3A 2B25A 2QTBA 3QVWA 2VT7A 3E9EA 4N0MA 4U2BA 1H1TA 2II6A 3PICA 1NF2A 4Q1FA 4AJ9A 5CEEA 4AQYB 1DLJA 2XUAA 3BCUA 3I83A 1T0JB 4HMPA 5JS2A 4PZLA 3W6PA 5JWRA 2PEZA 1LDNA 3SFTA 2P4EA 1MN6A 1HTTA 1GGVA 1J99A 2BI8A 2P3SA 3B51X 3HACA 2EZ9A 3N8NA 1EWYA 2R6R1 3PFWO 2ZU6A 2FZWA 4IDPA 4CTNA 5IXSA 2PCJA 3SHWA 3AFOA 2C84A 4TWBA 2O20A 5L6LB 5C37A 4OLHA 3KPJA 3NNNA 3SYLA 4BVJA 1XTIA 2FR8C 2Z2YA 3WGZA 4O3MA 1R16A 2FPUA 5HTOA 3N2ZB 2FPOA 2K5UA 4H08A 4GYWA 1EB9A 1YB4A 2B99A 4X1IA 4Z7NB 1WTCA 3PHJA 1T9ZA 2OK8A 1Z83A 5JSZA 3ZWMA 5CIWA 2RSLA 4CQMA 5IM5A 2OHFA 3MWKA 2XMCA 3H2ZA 3NH9A 2X4DA 4O4IA 3ETHA 1IIRA 1BTOA 1XRPA 4INAA 2P0YA 2JIBA 3GJRA 1OD6A 3X1ZA 1WW2A 2AVDA 4BTLA 4FGSA 1L7XA 1E20A 3GDHA 4PS0A 1PJSA 4Y2HA 3RWMB 4BFZA 3ETCA 3DTYA 1XU7A 2QNBA 2EZ8A 1BH6A 3MD0A 4U2KA 3W9BA 2H57A 5AFSA 2PUVA 3BUSA 1SQ5A 3PENA 3KSDO 4FEGA 1E94E 4HDMA 4MEBA 1I80A 2WT9A 4BFTA 1E2UA 2WW8A 1UBGA 2NO7A 2JCBA 1YAJA 3QE2A 5GONF 1U7PA 1OFVA 1T1GA 2A5YB 3WHLA 2FWAA 2Z95A 3P9PA 3JRXA 3C24A 3RRFA 2W8BB 2MYPA 2QI9C 3HRKA 4XCXA 3SJBA 1DQYA 4PBTA 4KC0A 2JFVA 4KQ9A 1V3TA 1OZFA 2WTBA 3ICEA 4TRJA 4KJZA 4GYYA 3SZLA 4HYYA 2ZXFA 1WB9A 5KUTA 2KMLA 5KJ6A 3IL2A 4KR2A 1FY2A 1SWWA 3JTEA 1RWQA 3GLFA 2HMAA 3LA6A 3EXHB 4WERA 1C7QA 5LYJA 1CZOA 2IUSA 3JTMA 3TQTA 2PZBA 4C0KA 3ZWPA 3HA7A 4UAJA 3JVUA 4FZVA 2F1KA 5BYAA 1DL5A 4XFJA 1G38A 1ZD5A 2JHCA 3A9VA 3UZUA 2OAGA 2WLSA 5TJHA 3RSHA 2DG2A 3WLRA 2OGZA 3K32A 1H2HA 4JYZA 4HNVA 2OLEA 2R2AA 3JU3A 1OTHA 3NGXA 4M0KA 4RKEA 1F6DA 1LF5A 2EKBA 4BLPA 5BW6B 2XKKA 3GFOA 3KXDA 3MTJA 1NW8A 1L8LA 3EGIA 1PLKA 4TLDA 3CH6A 5K3FA 4DA0A 3L41A 2AK3A 3ESBA 3WWPA 4P83A 2VRNA 1M54A 4YMIA 2ZRNA 2C9MA 3R3XA 1MHTA 4RQBA 1NI5A 1GDDA 1GQFA 3NDPA 4PC1A 1P5HA 3AUAA 3AL0C 2OL4A 1C1HA 3DBHA 5AK6A 4I3HA 5CVTA 2GESA 1BWSA 1RYNA 3BMNB 1ABEA 3LO5A 3QI2A 4HWTA 4NTZA 1ODTC 5DV9A 5HW0A 3WGIA 1YASA 4MQUA 2ZBQA 3T3OA 5GIPE 1FFDA 2JEYA 3GJ3A 5CA1F 3F9IA 3HB5X 1RWPA 4Y30A 5B30A 1KH1A 4D9CA 1LI5A 4NNJA 4QNMA 4U00A 4XR4A 2AWOA 3SZMA 4DLSA 3BMOA 4DLYA 1Z5OA 1TM1E 4G67A 4UASA 5B7PA 1PSWA 1Q22A 2VNJA 3HKEA 4GM4A 10MHA 2BFEB 5EMHA 1SCAA 3ROFA 3ODGA 1PV2A 1QQ7A 3X1MA 4YR9A 5CD1A 3H5WA 1ZM4A 4J43A 3EVGA 3OIVA 5SY6A 3KZXA 2AFIB 1VE1A 3SQLA 3V3KA 1HFKA 2RD2A 2QT0A 3DV0A 3T0IA 4BOYA 2HWWA 2JI4A 1IH8A 1S4MA 1UANA 4RTMA 4UMFA 1LSOA 5ITZB 2GYWA 2FPGB 3CZ4A 3PJRA 2QPAA 3PC2A 4R1QA 1IPFA 1QKJA 2FWNA 4RK6A 4UM5A 2JGDB 3I58A 3VJLA 4MKHA 1TI7A 3D8BA 1OI7A 1V5EA 1DC3A 3L4BA 4JY7A 3WL8A 3IPRA 1HBJA 3AVOA 2NPFA 4H0NA 4UJ5A 1YOVB 1NP6A 4OHMA 3SX4A 1QG2A 1V47A 3QQPA 4EKDA 3B36A 1F8UA 5F2EA 2UYOA 3HJFA 4HXFB 3LUCA 3LBIA 3I64A 4NJEB 2FR1A 1T0UA 3AZQA 3HADA 3MS7A 5TPWB 1I94B 1C8VB 4UBKA 2H1WA 4OKSA 5KNBA 1T2AA 3L6OO 3W8FA 3FCEA 4F3YA 1W29A 4Q3DA 4L57A 4AC9A 3HCEA 4F06A 2QAIA 5MGBA 3D4PA 2LVBA 1K08A 4RK4A 1QBKC 5HFAA 2J33A 2J0UA 3DUFB 1GG9A 4DA6A 2QZ4A 3FZNA 1UDWA 3VNVA 1N9GB 2XUPA 2V6BA 1EVQA 4I4CA 2OCGA 3IA7A 3PFBA 4ZI7A 2Q5HA 4W5QA 4MW4A 3MB5A 5CP8A 3NXSA 5J2UF 4N8DA 3DBLA 4A5SA 2I65A 2NV2B 4WOPA 2O8VA 3TL3A 2WG2A 2RAPA 2NO6A 1WE2A 1G5IA 2QPTA 1ZU4A 3IAXA 2L19A 4NEQA 2WI8A 1KO7A 4M83A 5AKEA 4UTPA 3H7AA 1TKAA 1N2JA 1TQ2A 2EC5A 2ZI6A 3IESA 3IT1A 2P7IA 1MDBA 2FP4A 2IYRA 4BFLA 4EW1A 1OX4B 1UZNA 3EG9B 3PEYA 1ECLA 1DDIA 1K66A 1K7CA 3TYXA 4RF2A 2QTTA 1ODKA 1UDRA 4GWKA 4XSHA 3QM1A 1ISFA 2OSVA 4O2AB 4URFA 1NTRA 2RB4A 3FH0A 2JGJA 3W0LB 4B3CA 1RLIA 1XK7A 3IPCA 2H85A 3RRMA 1P2UA 2IXFA 4LSZA 4LBVA 2HZBA 1A04A 2MDTA 4KUHA 4OU4A 2HTEA 3H8WA 1T8SA 2WKSA 2F43B 2NPIA 3GQVA 3AU8A 1XPOA 2G4LA 3C3DA 2JFOA 2BEVA 5H8WA 3COJA 1KSJA 1Z0IA 4OHBA 1HG0A 2Z1DA 2WF7A 1WJGA 2A57A 4GDMA 3VGJA 5DXFA 3KKOA 1U8CB 3A4NA 4HAOA 3ZYZA 4BNWA 1NE7A 1YBMA 5ALVA 3KZNA 4LGMA 1Z6QA 4M7WA 5KO2A 3ZZTA 1K4KA 4X6YA 1FNDA 3EMKA 1BXKA 1RZ3A 4LPKA 1DBPA 1E4EB 3CRZA 1LBQA 4P0PB 1LBHA 4UM7A 4BNZA 4Z4CA 1ZD2P 2R7NA 2HGZA 3VH2A 1TEXA 3ONDA 5JMOA 4RC9A 2HU2A 3B38A 5B3JA 4TT3A 1HE1C 3FWHA 1ATZA 4RK5A 3ROPA 1ZVVA 1AXGA 3HBJA 5BOVA 2VWQA 3GFFA 4KR3A 3COSA 5KVVA 1Y8RB 5BR4A 2AMVA 3SYKA 1CJKC 5EJ5A 1NT2A 2YN4A 1ZGZA 3GLGB 2AJ8A 5FB3A 1M74A 3WLHA 3BGIA 1FFXB 4H1HA 4XOUA 5DK4A 3KQYA 2ZRCA 4O4LA 4YVFA 4CUKA 1A9SA 1LPMA 3LP6A 3MAGA 3K8YA 1MT3A 3ETLA 4IVPA 2X1VA 4GR9A 2PJRA 2HA3A 2VPQA 2P75A 4R9VA 1FDSA 4KYIB 4Q3CA 2WJJA 3I1YA 4ND8B 2F7SA 1MAAA 2QRMA 4Q7LA 2FQYA 4IGAA 4NMLA 5CDGA 1JW9B 1V3QE 1PFQA 3GLHA 1OXMA 2XVYA 3DZCA 4NQZA 4IPTA 3ECCA 3AWIA 1RWBA 1M8GA 1AS0A 1N5KA 5EWJB 4F11A 1NXQA 1K8RA 4ISCA 1B41A 5K0GA 3D4BA 3V8VA 1H9CA 1IEQA 1L5YA 2YMLA 4LK2A 2QTMA 2C77A 4FP9A 1W0KD 3JQAB 2Y99A 5G0UA 5T67A 4YT4A 4ZK2A 3QVLA 1J25A 3IALA 3RGGA 4DCCA 3RUHA 2YASA 2YZKA 3HCPA 4DDHA 4TVSA 5EP4A 3LTNC 1LDMA 3RYIB 4CDRA 2C5HA 1DCMA 3P2YA 3RWBA 2J6HA 2EGHA 2UVPB 1IEWA 3MBKA 4IVQA 4P5DA 3CX8A 4FNGA 1XXHE 1J20A 1KDPA 3V1UA 3C48A 4G65A 2YYYA 3GLUA 2B1RA 4PC2A 4TS3A 1J2JA 1HMYA 1N1GA 2E48A 2FB9A 2NV6A 2IJGX 2FVYA 2RONA 2VFAA 2WNSA 3GRCA 3LUBA 4G8JA 4IZ6A 2DUMA 4KAXA 2OQVA 3SBEA 5J1SB 5L3QB 3T7IA 5JCJA 4C7OA 1QRDA 5DI3B 1E5TA 1CF4A 1M72A 4NBSA 2XUQA 2X41A 5KYUA 3RE1A 2BGTA 4QAJA 5IUJC 4F72A 4G0VA 1WXFA 3IXQA 4W8GA 2RCNA 3H8VA 3PEUA 1WUKS 5BV2P 4LF8B 1GEGA 4FONA 2NX2A 3LPNA 1AN9A 4J3FA 4TL9A 3WBFA 3A2KA 5JE8A 3W5DA 4FD3A 3TTTA 1Z2AA 3QXJA 2BGGA 1CY1A 1OGIA 4ZVNA 4HEHA 4X6LA 5ALRA 3O8CA 4DIBA 1CR0A 4P9NA 4KMRA 2IYXA 4ZZ1A 3GJSA 2GOYA 1OLUA 1JEYB 2RGEA 1XEFA 1Z8DA 1YFJA 1XMXA 1TF2A 4QDZA 4OSOA 2SECE 2RH9B 2GN9A 3K0KA 4HH0A 1XTTA 4HQRA 5AK0A 3VMFA 4DQLA 4DNOA 3BQNB 3S44A 4FHZA 1SXJA 5JJKA 4OXKA 4N6GA 5AD1A 3JQQA 4NE9A 1P75A 2IY8A 4KXWA 4BNFA 4PG8A 3G5MA 3WADA 2A0KA 2CLDX 5DKFA 5CEFA 1Q7BA 4BBPA 3N2GA 1LTKA 3OIDA 1CUAA 1UOQA 2GZDA 2P9GA 1LW6E 2ODTX 3HJTA 2ZAMA 4FYPA 4O08A 4DT1A 1EHYA 3DL4A 4IGFA 3CZMA 3FRHA 4UAGA 3ZY4A 4BX0A 3V80A 3MT7A 3FI9A 2NUPB 2VJKA 3QE4A 4N8EA 4OQQA 3S8YA 2IDZA 2HIGA 1Q3HA 3ZE0B 2BEWB 2I7DA 4GGOA 5EJ7A 4CDNA 1DBVO 3EULA 3GGCA 4UU1A 4CT0A 2ORWA 1KRHA 1VPLA 4P3NA 4XUGB 1NV8A 5JPDA 1JDUA 1R27A 3NRBA 1ZITA 1YBHA 3ROMA 4J7XA 4HDNB 4PG7A 3JPWA 3V1YA 5IAOA 3SXUA 1M6YA 3E1KA 5F4ZA 1Q57A 1QHFA 3C6YA 2UU9B 2GZSA 1DKNA 2YVLA 3I6ZA 2CHQA 1WSAA 3OCZA 4ZHSA 1E2HA 2A2ZA 1VKRA 5JQWA 1H0SA 2WJ3A 4PV7A 3EMDA 3I9LA 2GWRA 3GLQA 4M1KA 4R2WA 5FLEX 2W11A 4JT8A 4Y1RA 5DNUA 4O2BA 2ZRJA 2QROA 2DUWA 2GUGA 2EFJA 4KQCA 1FTSA 2V8OA 3HVKA 4LECA 3UHAA 1VG1A 1D1PA 2CDNA 4KV7A 2QHXA 1HX7A 1RYDA 2H00A 4N5LA 4YCJA 1YHZA 1M7HA 4FQ8A 2BKAA 4IJUA 4B43A 1UKYA 1YDHA 2WIBA 2GEVA 1JHZA 3QE9Y 2PU5A 3NWJA 1Y37A 3Q3JB 4KZKA 5FWYA 5LZ7A 2WMNB 4OX9B 1Z7WA 4X84A 1VBKA 1I6MA 2ODNA 4IM7A 2ZYGA 3MJVA 4PS1A 4R98A 2P62A 3K4QA 4O4HB 2P9BA 1NGSA 4F4HA 1QRSA 1UPAA 4ZCRA 4AW9A 1RPZA 2D2FA 4DM4A 4BLRA 5A2GA 2HF2A 1JFTA 3K0EA 2BFDB 1TRKA 2X8AA 1CX9B 1IAQA 4L8VA 3T5MA 1JIQA 1ZD3A 2CJWA 4H4DA 2H16A 4IGKA 4JC8A 3SC2A 3HMQA 2WY2D 2JAQA 1UBJS 4GICA 1M0SA 3OY2A 4TUYF 2VT3A 2ZB3A 4AMGA 4PAQA 2OCBA 3ESDA 3TFWA 3KQVA 3FTEA 4TXHA 3ZV5A 1P2VA 1P7ZA 2P0AA 5TEWA 2PRYA 4R1SA 3P96A 1XTKA 3BSWA 1QZTA 5FDFA 1E9DA 5HZKA 3AETB 1WDMA 2VPPA 2HDHA 2OYRA 5ESXA 1ND5A 3A4VA 2RH5A 4D6PA 4CHTA 2C29D 3ZWOA 1M33A 2GVZC 1TFUA 5TMDA 2J3QA 1R64A 1QLWA 1WP9A 2WK1A 1DXYA 2MSEB 3KJNA 1U9CA 2ZJYA 3EIFA 4FZ5A 3I2YX 5B3AA 4PQRA 2C8KA 1ZVKA 4B71A 4F84A 1JLKA 1NY5A 2LBPA 4IH9A 4PO9A 4NOJA 2VEDA 3JALA 2FEMA 2QW1A 1IIBA 2QJWA 3SDZA 3TW8B 3QEAZ 2MSLA 2QRLA 2ZKIA 1RQLA 4KEAA 1EXDA 1DG9A 1Z82A 2NXCA 2Q5IA 1NVKA 2E21A 2Z8XA 3QWAA 4RDCA 5GM2A 1L5LA 4F2PA 5G4LA 3ADCA 3M49A 1DAIA 2FPPB 1THGA 4YJGA 5C1OA 3ABQB 1GGHA 1MZPA 1TAUA 4PFSA 2FXVA 3C8ZA 3H5VA 1UXIA 3OZXA 3CUYA 2O1SA 3DXXA 4I5IA 3F6PA 5FUYA 2BIFA 3K5WA 3UF0A 3MQ2A 1M1UA 2ZUVA 1U5AA 4MI3A 1W76A 1JDNA 1TVMA 3QFSA 3R3YA 4H1VA 3L7YA 1WV1A 1X14A 3SHTA 1TUIA 3OQVA 1Z3IX 1JAIA 2WHPA 3R5FA 3TE6A 4HEQA 3W9SA 3OLWA 4QYIB 2G1JA 2MSNA 4DQUA 5B64A 4WAUA 4LMBA 5K3AA 2HRRA 1HYEA 3EN0A 2L69A 2ZU0C 2IWRA 3EARA 2OXCA 2J08A 2NQ2C 2A0WA 2YCBA 5E7JA 1CUGA 1GKYA 2PDAA 4P3XA 5C4MA 3V8MA 4K6MA 4RNCA 5IZCA 4LGCA 4PR0A 4L2IA 3DOEA 1GPJA 1AZTA 4ZMSA 3EOBI 1CJUC 4EAAA 1QCCA 7AT1A 2HUNA 1J06A 4DV3B 1OBHA 3F9CA 1T9BA 2NOAA 3GFGA 4LS3A 2BGKA 3EUWA 1CCWA 4E07A 2G67A 4FWTA 2AD1A 4MV6A 2OGUA 3A8TA 2A9VA 3NH6A 4EKGA 1RDFA 2Y0BA 3PQ5A 4D8TA 4DIFA 1HFWA 3FJOA 3RV4A 2GX6A 4GWLA 5DNDA 3VR1A 4RF3A 1KO8A 1EUQA 1Z0DA 2UXDB 4X8OA 4HYEA 4NHEA 1YBAA 3B20A 5H68A 3VR6D 1M0EA 1KJ9A 2IP1A 5FORA 5FRDA 2ZJ2A 4WBNB 1KMMA 5A9SB 5JXWA 1VKJA 2F1RA 3DVLA 1Y48E 1E9BA 1GM5A 4HNSA 1QK3A 4AY3A 1HE3A 3R0ZA 4TYMA 2XVMA 4CIXA 3I6QA 3OT4A 1XP5A 1JDJA 1XHFA 2KSQA 1VKNA 3IP3A 4MP6A 3CSDA 4Y6RA 4AKSA 1BA2A 3EASA 1IY1A 4RE6A 1R12A 1DJLA 4RYDA 4BO1A 4WZ6A 4WV3A 5K1ZA 2OHOA 2WP0A 4WK0B 2EW8A 4QXRA 5D51S 3GRKA 1DWOA 1EG2A 2FPXA 4R51A 4OXQA 3PCXA 2C83A 1U7UA 2CDAA 2XNDA 2B92A 2ZQZA 2CV1A 3AHEA 2O19A 2ZBVA 2O3UA 5JYEA 3GR6A 1KGDA 1AG9A 1RTKA 5CBPB 1JPNA 3O21A 5G02A 1GNTA 3VC3A 1GAJA 2R85A 3GRAA 2CWWA 5JMWA 2QN9A 2ZYIA 4LTNA 2GEFA 5DHAA 4UOEA 1ZNXA 5CT9A 3WISA 1SQGA 1VE9A 2IUTA 2QM8A 3EY9A 1KI9A 5BV7A 1RYFA 4PZAA 5LYYA 4ZJYA 4WVLA 5EJ2A 2P2CA 1Y6ZA 1XB2A 3L5KA 5DBEX 5SYAA 4X1KA 4DBVO 1FNCA 2QSUA 2EJTA 1L5HA 5P21A 1BS2A 1CUYA 3DOOA 4BFXA 3RAPR 3DT9A 4DANA 1XDSA 2H2IA 2IU4A 2G7MC 3NAQA 4JP8A 2YYAA 4YA6A 1H2ZA 5LBIA 2BY4A 2R1TB 3RAFC 4LJYA 4U39A 1GT6A 2O8EB 4HDKA 4QPNA 4BV2A 5LZ4A 3LDHA 3ADDA 3NX4A 1NVTA 4AZ0B 5C8DA 2RGNA 2PUFA 1NY6A 3RSLA 3S7TA 3AHGA 4B17A 2PR2A 1VZ2A 3GYBA 4DXDA 3LPMA 4NG5A 3RANA 4BIMA 1VPWA 1LCIA 2IQ5A 1J8FA 3FKSA 3HS3A 4IIDA 4D7AA 5FTLA 3DNFA 5K0EA 2CHEA 1DAOA 1QE0A 2OXFA 1C7IA 1FMTA 1M8FA 2VJLA 3LYHA 3PYMA 4XVUA 2HWYA 5C8XA 4J1TA 1XNQB 3DW3X 3OLYA 4XDGA 1G8SA 5DW0A 5GMOA 4ARZB 1QTNA 4CM3A 5IEBA 4KK4A 2R47A 5KTYA 3FHCB 1TYEB 4MW9A 3S3TA 1QGUB 1Y1RA 5HCNA 1QIIA 1RWNA 3DB1A 3F6EX 3JAKA 3N6RA 5IDVA 1X7GA 3SNKA 3UK1A 4B87A 1US8B 3OM0A 3DMDA 4BECA 4B73A 3ZVKA 1KEZA 1IUNA 1OREA 3PS9A 1NG9A 1SD5A 1LA2A 1E2BA 1PO7A 1Y3HA 1C3OB 4ZCMA 4MGYR 2JI8A 3MOSA 3RT1A 1WVGA 2QR3A 3A6HA 5HKLA 5LIPA 2BF7A 4EHFA 4C0XA 3F5QA 4AJKA 2JJ8A 4GC5A 2XCOA 1Z4MA 2HEGA 2HJHA 2Z2KA 3O47A 1NQVA 4RIHA 4DRZA 4QL3A 2FTKE 1OFUA 3EFBA 4V2UA 2AB0A 4MX8A 1KTIA 5KOIA 2CDRA 4CU2A 4AF6A 4E5DA 3DTNA 3LQQA 1ID1A 1QZ3A 4XLLA 4DM7A 3FCUB 4YCSA 4QG3A 1F51E 1NE2A 3AONB 2DQKA 5JARA 1MCZA 1O94A 4MITA 4LNUB 2PXXA 2VK2A 3S2UA 2DTDA 3O3CA 2J9FB 1E66A 3ND5A 5AXDA 5BWOA 5A7HA 1H2YA 1MGOA 3E0XA 2H59A 1VL8A 1PFWA 3ZY2A 5HSGA 3JASB 4JLKA 2W9XA 3IIEA 4KSYA 1RXUA 1SRQA 4RIEA 4Z4IA 5DFAA 1ZW6A 4DBLC 1HSZA 3D7KA 3GP3A 5ICSA 1N3LA 4HYQA 3CLUD 5EXXA 4H27A 5T64A 4Y2GA 1AA3A 2QTHA 5DWDA 3HP1A 4XTRA 3RKUA 1NVDA 3OZTA 3T06B 3HBLA 1WMSA 3RUAA 2PM8A 1T2EA 2GPWA 2JD1A 1P4RA 2WNIA 3ER6A 3IVAA 4D0GA 1WPXA 2UDPA 3LBHA 1U8EA 2BFBB 4ILEA 4KXYA 3UAYA 1WXHA 2GCEA 4PG5A 2Q7OE 4XYLA 1Y63A 2ZR0A 4GOJA 1NDHA 3KLOA 4NS1A 4PLCA 3U9SA 4DDUA 4Q1EA 2MINA 1GZDA 1SQ6A 5H3HA 4QTTB 1J9GA 3W2TA 1G3RA 1GA4A 3BZUA 1HC7A 1JIKA 4N54A 1N0HA 1Z75A 2NW6A 4D0NA 1NMSA 3OM8A 3PNSA 4WLFA 4AS2A 3UJNA 4P0QB 4EFDA 2H7VA 4ZT6A 3UT0A 1KU6A 4YAFA 2FY8A 3SOZA 4MEJA 1U65A 2OFXA 2QL7A 3OU7A 3LC2O 1RACA 2ZRAA 5KWJA 2OXEA 4AKHA 1UBCA 5DIZA 4Z51A 1KEKA 1ZISA 4AN4A 4NDNE 3F8TA 4R69A 3CF2A 5HHTA 3G2IA 4BATA 1PFGA 1TK3A 3GV0A 2BHTA 2OB2A 1O3YA 1ZEMA 3LT4A 3NBFA 4RLSA 5G41A 2OM6A 2WAXA 1RJGA 3TMAA 3H9BA 3WK6A 5LQKA 3FRIA 3TUJC 2W93A 4PO8A 1YZKA 2EBWA 2PZJA 4EZIA 1B8PA 3E9ZA 3KTFA 4K40A 2XIQA 4Q12A 2WD8A 3P9YA 5KB3A 2FJPA 2J3IA 4J6FA 1QVRA 2Q0HA 3BTUA 3KWFA 4WACA 2BGMA 1GCIA 1XZNA 1K8QA 4JENA 2FPKA 4PFQA 5JVDA 3PE4A 3SR3A 1LPBB 2GLUA 3DMPA 1KAMA 3UFBA 4E2YA 1JWLA 1MOSA 4D74A 3DHWC 4LDJA 2VNIA 1OXKB 3I34X 3RC2A 1RLTA 5AI6A 3ZOKA