2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
b'PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
3ZVMA 4MYUA 2J5XA 1W0JA 3UXMA 3KQHA 4TYNA 1OXSC 5J4HA 2ZJZA 3QPWA 4FMCF 3IPYA 2ZR9A 4JLMA 5JCZA 2IYTA 1P2VA 4NH0A 1Z28A 1ZCBA 1S9DA 1GNRA 5C2JB 4L8GA 5DH9A 2CNWA 2RH5A 3F5FA 5FUVA 3ND8A 4DJTA 1R5NA 1DAGA 4OJQA 1E2NA 3LVRE 1M2OB 4E03A 4Q4AA 3O47A 4BECA 4XD7D 4JKIA 2BBOA 3THYB 3FGNA 1NJFA 5LD2B 4B3DA 1H8ED 1G5RA 5E95A 4TYYA 1GUAA 1SKQA 1WQ1R 1ZD9A 4C0LA 1IM2A 2ZVQX 1U0JA 3TSOA 4MKIA 1B0UA 1GKYA 4TMKA 1UM8A 4JSYA 4BEJA 1FMLA 4P4SA 3ECCA 4FWIB 2R44A 1MR3F 3LXXA 1KI6B 5JSZA 2QENA 3KKOA 2J0UB 4S35A 4B43A 2VA8A 4URZR 2ZSEA 1HTWA 2Q9AA 2I1VB 1WP9A 1AN0A 2VP2A 3K09A 4Q7LA 4LYHA 2ORVA 2XJ4A 1RJ9A 2PL3A 1JXMA 1P5ZB 2CK3A 3QJYA 1B23P 1XCPA 3CW2A 1P72A 2I3BA 2YINC 1TUIA 1DOAA 4A0HA 1KI9A 2VLIA 4GP6A 1E1RD 1KMHA 3EPLA 4M9SA 3L2OB 2D62A 5CK5A 2JIZD 4V0MA 1US8B 3KQUA 4GDFA 2EFCB 4DRZA 4DLSA 1AZTA 2GEVA 2N1BA 4C3ZA 3AVUA 1VHLA 3REGA 1X86B 1VG1A 1VPLA 1MKYA 3AP3A 3I32A 2PCLA 2B8WA 3A37A 3A1WA 3WRYC 3W8RA 1AM4D 1VCNA 4PPGA 1YZLA 2KBEA 5CYOA 1FQKA 2ZAMA 4MRRA 3O8BA 4MDFA 1KY2A 1VG0B 2VHCA 3I8XA 1XMJA 3C5CA 4CW7A 4M1WA 3THWB 4B3GA 4B44A 1SKYB 5CM9C 2NO9A 4LYFA 4ITRC 3AH8A 2MSCB 1NG1A 1U2RA 2OV2A 2P6UA 2GZHA 2UZ3A 3CR7A 4G5RA 5JBQA 3KUCA 4JVNA 1TTTA 3IBYA 3QVUA 5CJ2A 3B82A 5EXXA 1OH7A 1A5TA 4QG7A 4XJXA 3U44B 2GCNA 1ZCAA 1BYUA 1DADA 2OCAA 3Q5EA 4OK5A 1W36D 1DVRA 2BVNA 2ZUDA 4PQYA 4NMMA 5FTJA 1RW4A 2FZ4A 1OHHD 4WXPA 2EYQA 4BASA 5DI3A 3NHAA 5KO2A 3AVXA 2GVDC 4I99A 4LC1A 4PZLA 4CT4B 4AY2A 4M9XA 5AJXA 2FOLA 5C46F 3PFIA 5HR5A 5JWOA 1YZKA 1GOTA 4OQXA 3TJZA 1JR3D 1CP2A 3BD9A 2AKYA 1KSGA 2Q9BA 1OYYA 1QRAA 2QG6A 1V43A 4NCJA 2EW1A 4WAUA 1DARA 3T5DA 3QSYA 1L4UA 2JJ8A 2I4IA 2QQ0A 4P4TA 4UJ3A 2W00A 3U61B 5EE0A 2ZI4A 4QL3A 2GXAA 3GLHA 4MYTA 5A0FA 2REBA 2HLDA 2G83A 3U6KA 2FSFA 2N46A 5B57C 2GAAA 2F7SA 2GBLC 2JEOA 1X1SA 1UKZA 4ASUA 2IEZA 1W2HA 2DFTA 2P5TB 4EPRA 1G19A 5J40A 2HYDA 1IXSB 4NCHA 2WJHA 4KODA 1E94E 1N6IA 1E79D 1U98A 1RFLA 3D31A 3D3QA 4W5WA 3V9PA 4PPFA 2QBYB 2UKDA 3X1WA 4DSUA 3D6TB 3CX8A 3QXHA 1ELOA 2QAGB 2E87A 1XD9A 2XTZA 1AIPA 4G01B 5FL3A 2FX3A 3DKVA 2J59A 2WPDA 5AJVB 2WBLC 4PAQA 4OI0A 5FTLA 2CVFA 3U4QB 1IN4A 2GAOA 2VP5A 4PPNA 3A1SA 2VSXA 1E9AA 1QZXA 1X1RA 3U7HB 3W6PA 1FMJA 4C4PA 3AVVA 3PR1A 3W3ZB 2UZIR 1SHKA 4TYPA 3K0CA 3SS8A 2OFWA 2GILA 1ZRHA 5FI0B 1M7BA 3T1OA 2FV8A 5JEEA 3I62A 1P3JA 1UKVY 1ZYUA 2GZAA 4UNSA 1XMSA 4LHZA 3D8BA 1XJ0A 4A4DA 3B9QA 3AQ4A 1G3UA 4A8JC 1G291 1E6CA 2GJKA 2OXCA 3C15C 2BEJA 3K9LA 1NLZA 2YJTD 1NKTA 2QU8A 3FHOA 3P4XA 5CIQA 4HEJA 4JLVA 3W34A 2C95A 2IL1A 4BUJA 1G3MA 1D9XA 2WWHA 4MGYR 2QP4A 2FMXA 2AL7A 1HYQA 1W1WA 4A0GA 1J8YF 1WCV1 3AUYA 3TE6A 2P5SA 4C0JA 2BOVA 4EFLA 2XOKD 4IXMA 2JLSA 3CPJB 1N0VC 4M1TA 2Q3HA 3EZ9A 1SZPA 3QUSA 4Q19A 4B2IA 1W0KD 4LJ8A 4LYAA 4RD6A 5TVKA 1EFRA 5BXQC 1UEIA 4E22A 1OKKD 3KQKA 2BC9A 1CULC 1R2QA 3TUIC 3WHLA 1Q3TA 4OQNA 3GLFB 1GNPA 4NE2A 4LY6A 1EFTA 2ZJBA 4UQOA 6Q21A 4TTPA 5KNDA 4OQFA 2CXXA 2BMFA 1XXHB 4L9SA 4I1OA 2N42A 1KKLA 4EJSA 1SXJB 1N5IA 3ZVRA 4LJ5A 4B3BA 3RYTC 4OHZA 1U9IC 2JJ1D 4A0RA 1YRAA 3K70D 5C18A 4QOSA 3FKSA 4Q5IA 5DHAA 121PA 421PA 2IS4A 1S8FA 4AIIA 1Q1QA 4M1MA 1II8B 2IYWA 1OLOA 3WP1B 4KSBA 4NL4H 4O2RA 4MUAA 4Y0AA 2IXGA 3PEYA 3LWNA 4QC2A 2OO7A 3B1VA 2ZUBA 2H17A 1N6HA 4EAQA 3VU9B 3KL4A 5FPSA 1J7KA 1E4VA 1IONA 5SZIA 3IDQA 4DKXA 4X8MA 5CITA 2OM2A 4LZZA 4O25A 2ZI3A 1A4RA 2V3CC 4G1UC 5D3QA 3LFUA 2JLRA 1KK1A 1SVSA 1UPTA 2ZYUX 3UKDA 3MUFA 3B1ZA 1XEXA 5DE3A 2O8EA 2KJQA 4QJ4A 3FB4A 1XJCA 5FBRB 1BO6A 1W36C 4BLPA 1CU1A 2YWGA 3QKUA 2Z6VA 4LK2A 4ZKEA 1MO5A 3FHTA 2RGXA 2HJVA 1YJ5A 1JPNA 3REFA 1D5CA 1WA5A 1MOZA 2WWXA 1R0XA 1LV7A 2IUTA 1YQTA 1KK0A 3MRSA 4HZUA 1IN6A 4PPQA 1P9WA 1KDOA 1Z0FA 2EU8A 1T4GA 4OK3A 1SVIA 1BMFD 1KOFA 4RZ3A 4CT5A 4GOXA 4P31A 2QGZA 4DLXA 5DI9A 4DLVA 2QEQA 4B3CA 4L5BA 3FMOB 3MSXA 3U6BA 1XD8A 4LBWA 5GJCA 3GLGE 2V6IA 3LVQE 1L7VC 4CGZA 1GSIA 2D4HA 1M74A 2X77A 2W2TA 3ZIAD 4JZKA 3VR4A 4MGZR 2KE5A 2VF8A 4IDPA 4PAMA 4QRHA 5KHOC 3PJRA 4B2PA 4PSAA 4Q7MB 2G0NA 2VIIA 5FTKA 4IEEA 5JECA 1O3YA 2HT6A 2FEOA 4I1VA 3SR0A 1DELA 4MRSA 3VTKA 2DFKB 2FE4A 1D2NA 3FVQA 4K8OA 2GCOB 3GP8A 1MO4A 1KKMA 1SVLA 2ZRHA 4GOKA 4KJZA 2CVHA 2VTKA 1KI1A 3BB3A 4ACAA 1FP6A 3RRYA 1KY3A 1G9XA 2RGGA 1SVWA 3VFDA 4DCVA 5K8TA 3M0EA 4XSHA 1PZNA 3AF1A 1R0YA 3HPQA 4A2PA 1COWA 3VKHA 5KUTA 4R98A 1KI7A 1G8PA 1KI4A 3TNFA 1P62B 1RE0A 2RGBA 4V02A 5FPYA 1TMKA 1G1MA 2HEIA 4LPSA 3A4MA 3LLUA 3PCRB 4HAZA 2C77A 2ZRJA 1ZC3A 3RS0A 4Q4AB 3ASZA 5GJWC 1J90A 5AR1A 2WM9B 1FTSA 2PEZA 3W3AA 3DM9B 4C2UA 4DXAA 1HE1C 4B76A 4GPTA 3CPEA 4LV5B 1D2EA 1AS0A 4H9GA 3A36A 2DWOA 4FMBB 4GI7A 4HAXA 5EP3A 5AUOB 1E2FA 5L3SA 4Q9IA 4DEYA 2PLFA 4OHYA 5KU1A 3HU1A 8OHMA 1G64A 3U44A 5JSZB 4L15A 4G5OA 1VCIA 1IHUA 3AKCA 3CNNA 1G4UR 5DNYB 2QQEA 2OFXA 3LBNA 4FN5A 4EPWA 1M7GA 1A2KC 3KJIA 5DIFA 4B48A 4D0GA 5JRZA 1PLKA 1LF5A 2OILA 4OHVA 1XFAA 3BH0A 3QF7A 1G18A 1RJ9B 1NVVQ 2OSBA 2XB4A 4M2LA 1CLUA 3SQWA 1UBEA 1HQYE 3UWOA 1KMHB 2SHKA 3EC2A 3GLGA 1KGDA 3NHBA 1E4YA 2EYUA 2OLJA 2YOGA 3WRXC 1P7CA 4C0BA 1GZSA 1TU3A 3AVWA 2R65A 2C04A 1AS2A 2B92A 5JRJA 4M1YA 2QTVB 2XTNA 4FWTA 2VSFA 4BPBA 5J4VA 1Z0DA 2HDNB 4TSFD 1JI0A 3I72A 4QGFA 3K70C 3RSOA 4AWXA 2K5UA 3ETLA 4AYXA 4FXPA 4PQRA 5BYJA 2RCNA 1JALA 1H8HA 1JNYA 4BQSA 4DDVA 2MSDB 5A5GA 2W6JA 821PA 4EPXA 1PVOA 4KFTA 4M9ZA 3B1WA 4RD1A 2QRNA 3EIQA 2ZM5A 3UIEA 2DHRA 5BW8A 4KXFB 1N0UA 1F60A 2QT0A 3UG7A 3KB2A 3OEHA 4U7DA 3RDPA 1YVDA 2IYQA 3WYFA 4Q1AA 5GVRA 2H8KA 2YC2C 2ZE5A 3L0SA 5B2ZA 1OH5A 3SQXA 1TEVA 3DVLA 3SEAA 1Z6YA 4BLSA 1QVAA 4IJMA 4FD2A 4YMVA 2HXYA 3DPUA 5DI3B 1F2UA 2NO1A 3GJ8A 3K0SA 2GTPA 5E7IA 4TMXA 3R9IA 3A8TA 4PTLA 1LNZA 1O87A 4QM7A 1OF1A 1MO6A 2IHYA 3KX2A 5HCNA 3PUXA 2CLDX 1JBKA 1EGAA 2ZS9A 5F2EA 1OPXA 2NOAA 2ODNA 5SZJA 1VG9B 1FQJA 2FNAA 2QAJA 1XRJA 1NY5A 3I92A 5CIWA 1HE8B 3T5GA 3SFZA 5JCPA 1GM5A 1CJMA 4JMPA 3VR2A 1Q44A 1OFIA 5IRCD 4EPYA 4OK6A 1BS1A 4DB2A 3HYRA 5KDLA 2A2ZA 1G6HA 3O8DA 2B21A 1N3BA 2BMJA 2EWWA 5C4GB 2G6BA 3RVBA 4YQFA 1KIMA 3FMPB 2PCJA 2G1KA 1GP2A 1UDXA 3DMDA 3ADBA 4FINA 1IJFA 4JBWA 3IQXA 4LBZA 3B78A 4V03A 1IQPA 3PEWA 2O8DB 4EKDA 2ZR0A 4QHSA 1G7SA 1P2SA 1W44A 2ZE8A 2BMDA 4OL0A 4Q02A 4DB4A 3EAQA 3EG5A 3R7WA 4PZYA 4XVQA 4A2QA 1SXJA 1OFTA 4CYMA 1HT2E 2JJ2D 1XTSA 1Z08A 2IWHA 4TL9A 2IXEA 5SZHB 5SZKB 2ZRFA 2A3RA 3IKJA 3CRQA 1LVGA 1ZP6A 3TGPA 3DL0A 2QY9A 2F3TA 1E0SA 4KYUA 4ARZA 1N2CE 5F98A 4XVUA 3BE4A 2IS1A 4C7OB 5FUWA 1KYIA 1OIWA 3MAAC 3U3OA 3MFYA 4DSNA 3LW8A 2YC4C 2PEYA 1AK2A 1KO8A 2QMEA 2YOHA 1UAAA 4BWYA 2DB3A 4DDUA 4NCNA 4M21A 2ZIAA 4M1SA 1CXZA 4AG5A 3BFXA 3MWYW 4LWZA 1IN5A 1E32A 4TZ0A 1NN0A 2L0XA 2RGAA 5FOVA 5CDFE 1VMAA 3ZDQA 1T0HB 2AFIE 1I4TD 2A5DA 3O8RA 1NVVR 2UVQA 1G17A 1W4BA 1KMQA 2D3WA 3L0PA 1K8RA 1UEJA 1G7TA 4FMDB 1MV5A 4BLQA 1OB2A 1HV8A 2WSMA 3TBKA 4D4MA 2WKRA 1VHTA 1ESNA 2GESA 4KFRA 2BJVA 2QPAA 4QKQA 2D74A 3FHCB 1U0LA 2EVWX 2RHMA 2IEYA 2YWFA 4U5XA 2WJGA 2QZ4A 2AN9A 1XD2A 4TQAA 5HKKA 2OBMA 1F48A 4TZ6A 2V9PA 3MWKA 2P6NA 3QKTA 2W2VA 4EJSB 1A1VA 5BWMA 2NZJA 3AGPA 3DEFA 5CB8A 2OG2A 1MRSA 2P2LA 3AVQA 2Z43A 3X1YA 3VR5A 4JLDA 3IO5A 2ZRKA 4LDJA 1GRRA 1ETUA 1N0WA 4PFSA 5K8UA 1FL9A 1N5KA 1MH1A 1IY1A 3C4JA 4Q9HA 1RRFA 1XNJA 1G7RA 1XX6A 4ZCIA 3T1TA 1ZIPA 2AKAB 4WIAA 5ANRB 1KDRA 5TV2A 3K9GA 4C0QC 5FBWB 1WE2A 4F4JA 2CMKA 5K8IA 2IK8A 4C2TA 3A4LA 4JVLA 4TN1A 4BFSA 2AX4A 5EE3A 2FFBA 2QTHA 1K6MA 2JGNA 4MGIR 1UBFA 1HEIA 2XAUA 1YZUA 4HAYA 3P27A 4KHZA 1ANKA 2B6HA 1E9FA 5D3MA 3T1QA 3ICEA 2AXNA 2VBCA 3EXAA 3KKQA 1GIAA 3SJBA 2NIPA 1XEXB 4GL2A 2O8EB 2ZJ8A 2G1JA 1Z6TA 3LAWA 4DUGA 5AUNB 4Q7JB 4KLNA 1W2GA 1IN7A 2Z4RA 2FWRA 3QPVA 4JLOA 4KFUA 3R20A 1KO4A 1XBTA 5IF9A 1VTKA 1Z6XA 3KJGA 4CDGA 2FU5C 2J3EA 3GJ3A 1CJKC 3IPXA 2F1HA 4PC6A 4KAXA 3B2EA 2J46A 4HZUB 5EP4A 3EC1A 4URXR 2AHOA 1UBGA 3KDSE 1XCGB 1XTQA 1BYIA 4BFVA 2J7PD 1P2UA 4TMWA 5KDOA 2OE2A 3N2EA 1CR0A 4HUQA 2WJIA 4W9MC 3CR8A 1L4YA 4URVR 2ORIA 3TQCA 1OXUA 4TMZA 5EE9A 4Q47A 2DY1A 2Q0HA 2WZQA 2IHBA 3U3JA 4YMWA 2RGNA 3W6NA 2FSHA 1II0A 4BRUA 2WWGA 3CH4B 3L82B 4JS0A 1U8ZA 1W46A 2OCBA 3LQQA 1OH6A 3EIEA 4Q1FA 4EIWA 2BCGY 2GRJA 2DWPA 1E2JA 1G8FA 1FPMA 5FFMA 2XTMA 1H65A 3LW7A 2VO1A 4DLWA 2FJUA 2OHFA 3PITA 2ZRAA 2GZDA 4TYQA 4YMSA 4N1AA 1J8MF 4NU0A 3ZD7A 1LB1B 1E1QA 1T8TA 4DVGA 3L43A 3B6EA 2V55B 4RY2A 1GRNA 1D9ZA 2Q3FA 5AJZA 5FL7D 4LJAA 4EFMA 3DO6A 3QXSA 1FUKA 3SYLA 1EFUA 3PVSA 4F7WA 2GK6A 3KKPA 1XMIA 1E2LA 5G41A 2ZI6A 1Z83A 2WIAA 3CONA 3CF6R 2IYXA 3QI2A 4FCTA 4HATA 4LJYA 4DCUA 2WHXA 2XX3A 4LC0A 3KKMA 4OI2A 5E7MA 3WMGA 2W6ID 5CLQA 3BGWA 2H16A 4RZXA 5CJPA 2IUSA 4HDQB 1SGWA 4UXHA 3VR6A 3AVOA 3W5IA 1Z47A 3AGQA 1G7CA 3NVAA 5KPDA 2V7QA 3Q72A 3TVTA 4Z1MD 2V54A 1XPUA 1N6PA 1XCMA 2Q21A 4D0LB 1ZD8A 1XDBA 3GEHA 4QBHA 4ZIRB 4URUR 5L3SB 3I3SR 5EJEA 2ZEJA 4DLTA 4YMUA 2XGJA 3QXJA 1D2MA 4PC2A 1Q3HA 4F92B 2VL7A 1G16A 2Q3MA 4LGMA 4ZCMA 5TMPA 3QVVA 1YR9A 1S9HA 1W4CA 1OB5A 1T0JB 3X1ZA 4MRNA 2REOA 3KJEA 3I73A 3RRNA 4QGHA 5FUYA 1DAEA 2GHIA 1JECA 2XNDD 2B8TA 2WICA 4PO1A 2NQ2C 1ZINA 1RYHA 1Q1BA 3JZAA 2DFNA 4FCVA 2ZRBA 4LJ7A 3QG5A 4A9AA 721PA 4D80A 3GLGB 4JLBA 2FH5B 4PHTA 1KHTA 2XSZD 1L8QA 3BH7A 2WV9A 3IO3A 4XVRA 1Q12A 5JS7A 3NBXX 1NRJB 5BQ5A 1NVXQ 2WSSA 4FIDA 5FTNA 4TMTA 3UPUA 4CEHA 3E5HA 2R6CA 4UNNA 1T5IA 3GEEA 2HCJB 2NPIA 2J45A 3OIYA 4ZDWA 2YNMA 5EUMA 3U3RA 5GVSA 1RRCA 1NY6A 3CRMA 1Z2AA 2EFGA 4BFTA 1JPJA 1QG2A 5P21A 4G5GA 3SI7A 4DDTA 4ACBA 2IYLD 4V0NA 1S2MA 3U3KA 2I1QA 1HQCA 3DHWC 5EZ5A 4HLDA 3QG1A 3F0TA 1GL9B 3R9XA 4B6FA 1TAGA 3CBQA 2ANCA 5FOUA 4C0AC 2O8DA 3OE7D 4OI1A 1C1YA 2JLZA 3GLIE 2GXUA 3SHWA 1TL7C 2CDNA 5LDDC 4QJ3A 2QTFA 3KUDA 1N6LA 2BBSA 3P32A 3DKPA 1E2EA 2BIFA 1E2GA 4WOPA 4NYIQ 2Y8EA 1GFIA 4GMDA 5H70A 3ONWA 4N0DA 5JI2E 3KXIA 5IK2A 1F2UB 4EDHA 1F3OA 4QBFA 2HXSA 4PZZA 521PA 4KYIB 2JDID 3CNLA 3SHFA 4LUCA 2A5FA 4TT3D 1RPZA 2FZLA 1P61B 2X8AA 4PO9A 1Q1ZA 4G3XA 2FSGA 5CLLA 5C4MA 4LI0A 3EX7C 2GBLA 1I4LD 3AF0A 4IVRA 3ZJYA 4C7OA 3QBVA 3MCAA 3T12A 2CE2X 3H2YA 2W0MA 1GNQA 1P60A 3QKRA 1YHNA 2FDCA 4X8OA 1SVKA 2YKGA 5AUPB 3CX6A 3A1VA 2XXAA 1F2TA 1TF7A 4A6XA 2PLRA 3UMFA 4BLRA 1DEKA 4Q48A 1QBKC 2IYSA 5C1BA 1P9NA 3NH9A 2F1RA 2QE7D 3OFNA 4NP6A 3RS3A 1YKSA 3EASA 1F6BA 3TRFA 2HCBA 1LFDB 5BN5A 2JLXA 3OEED 4FI3C 5TARA 4HI0E 4OQLA 4ZI3A 3ZVNA 4BEBA 1DAHA 1MABA 2WKQA 2QP3A 2ECKA 1E2QA 4PX9A 2EFDB 4RCZA 2IXFA 5FOWA 4Q18A 1NG9A 2B7CA 2O8FA 3VAAA 4ZPXA 5JHHB 2RHDA 1GITA 5JEDA 2YV5A 2VP0A 4QM6A 3SZRA 2V1XA 1JJ7A 3WBKA 3GEIA 4XD7A 1QHHA 3R7WB 2PMDA 5DGXA 4A8JA 1YE8A 1H8EA 4TL7A 5G40A 1W7AA 2NTYC 1ZUIA 4FW9A 3THXA 1T91A 1TF5A 1GAJA 1ZM2A 1GRQA 2IT1A 4L16A 2DCUA 1E9RA 2IBMA 2ZI7A 3NXSA 1KO7A 3QEJA 1JR3E 2ZRMA 2HJGA 4GT1A 1CTQA 1G41A 3AKDA 4IDOA 4ARZB 2XZLA 1XEFA 3HU3A 2ZS7A 2OCPA 3H84A 3GLIA 3T34A 2KSQA 4B6EA 3QNUA 1NJGA 2O8BA 1SVMA 2GNOA 3K0FA 1NMXA 2WJYA 5FOTA 4A92A 2CLCX 2GVZC 3X2SA 4IDNA 3UG6A 1EFCA 4X8HA 3PV0A 2J87A 5LD2C 4NYMQ 5FBQB 4N0EA 1XTKA 4TL6A 1UFQA 5L3VA 2RGDA 4LBYA 4ZDKA 4DSOA 2FEMA 4Q9LA 5FPTA 4ZDJA 2F43B 2NGRA 2FPKA 1E1RA 2WWWA 3IHLA 4TLDA 1R8QA 1XF9A 2IYZA 2JIZA 3BFVA 2J41A 2JASA 1R5BA 2C9OA 3WHKA 4IKEA 1XPOA 3NBZC 3GFTA 4EUNA 1C4OA 3E1SA 1UKEA 4F38A 5E7JA 1XTRA 2EFEB 3K1JA 4CF7A 2QSYA 3A6PC 1KI8A 2IS2A 2OAQ1 4WW0A 5HCIA 1IY2A 1R0WA 4IHQA 2VH5R 1VIAA 3JZMA 4QNMA 1XD2B 2O52A 5FH9A 2WWIA 1HY3A 4PHFA 1I2MA 2FGJA 3RLFA 4C0HA 3Q5DA 4B3XA 1AQYA 4PC1A 2Z4SA 4KO8A 3ND9A 2ZVPX 1EX7A 2PX3A 5JZVA 2ZXUA 5HTKA 3N2IA 2JLYA 1Y63A 1CEEA 2CL0X 3SBEA 2PH1A 4I1SA 1AJEA 1E9SA 1NMYA 4MH0R 2C5LA 2ONJA 1Z0IA 4DIEA 1OHHA 4CEIB 3T1VA 2A5JA 3RWOA 5JJKA 1J70A 3MWJA 4NYIR 4D4JA 1Y3AA 3TW4A 3C5HA 3LLMA 3CRW1 2QMHA 3SDZA 5D3MB 3KXLA 1GILA 1X8JA 3QXXA 3OAAD 4JT2A 3VHLB 4YXWD 3FOZA 4URYR 3N5CA 2PZFA 1JR3A 1ODFA 2G0TA 5F9FA 4IW3B 2BEKA 1OXVA 4R71A 3ADDA 4HDOB 4KVAA 4R2IA 1IXRC 4B35A 5JMTA 2VF7A 4JYCA 4KLZA 1GDDA 4R2HA 1ZIOA 1W47A 3TUJC 1LF0A 5A4JA 4HAVA 3TLXA 4TYWA 4HUQB 4BZPA 3HJNA 4M1OA 2OXRA 2KB0A 3SJCA 5HE9A 1TUEA 3U5ZB 1E79A 3CLVA 1K5GA 1G20E 4I81A 4ZIRA 3SNHA 1T3HA 1AS3A 2VRWA 4ZV4A 1BKDR 4PHGA 4O3MA 1KSFX 2ZJAA 1W48A 1U81A 1TADA 4GMXA 2CHQA 2G3YA 2VSOA 4ZDIA 3QKSB 2JLUA 4CIDA 3KQLA 5FPKA 2BV3A 2X19A 2OAP1 3NBFA 221PA 4BLTA 1KNXA 3MD0A 3O8CA 1LS1A 2ZRCA 3ZH9B 4LRWA 4B33A 4TQUS 4FCWA 1NBMD 4B32A 4GOJA 2AWNA 2BKUA 1KSHA 1TQ4A 3GJ0A 4P32A 4WVFA 5DN6D 3KQNA 1NN1A 2QAGC 2ZI9A 5GADl 1Z0JA 4IOLA 1R6BX 5KSZA 1LS6A 1KI3A 1QF9A 3SN6A 3WY9A 4DCSA 4LHVA 4OJKA 4C9BA 1NF3A 4ZCLA 3WYGA 1W0JD 3EW9A 1KI2A 3AF4A 5J5CA 5KTYA 2ZTSA 1JAHA 3NIBA 4JSTA 5FBVB 4DCTA 2WOOA 1N5LA 3A58B 1A7JA 1NSFA 3DOEA 3QF4A 5JJLA 3HWSA 2CNWD 3FMIA 1MT0A 3RAPR 2P3SA 4NYMR 3TR0A 3S1AA 1GWNA 1UADA 3AKYA 4IFEA 2XOKA 2ZE7A 5G53C 5L3QB 3GLFE 4POAA 3GJ7A 4ZI2A 1E96A 2BBTA 1KZGB 1W0KA 2ZRLA 4UJ5A 5KNBA 3ZQ6A 1E69A 3HPRA 2CHVA 2H1LA 3CRVA 4DLRA 1OKKA 3FTQA 3ZLJA 2O8CA 2VP9A 3BXZA 3FWYA 3WNBA 4TL8A 4LV8B 4TLAA 2LCFA 4L4UA 3LXRA 4HB2A 2ZITA 1GL6A 4Q1EA 2OLKA 2IS6A 2NG1A 4QHTA 2WWFA 3BOSA 4B71A 4AI6A 2ODEA 2CCKA 3BERA 5DHFA 5DLQC 1NIJA 2JJ1A 3A1UA 3X1XA 3BWDD 2C98A 3AV0B 4OKSA 4GP7A 4HUTA 3LY5A 3TAHA 1CKEA 1E0JA 5BN3A 1U0HC 1XTIA 2CK3D 3NG1A 4JBXA 4H1VA 2FSIA 4M9QA 4Q4JA 2ZJ5A 4Q1DA 4CEHB 3IEVA 2YYZA 4OHWA 2J1LA 3N70A 4P4UA 1YR8A 5F3WB 4B75A 2Q6TA 1DAIA 3GFOA 2GXSA 3VKGA 4DWJA 4UXIA 3B1XA 4GZLA 4K46A 1GTVA 5EE1A 621PA 1AZSC 1HT1E 1OT3A 1SXJC 3E70C 5HPYB 1ZM3A 1KDTA 2X2FA 4ESHA 4IFBA 3NBYC 3B60A 4XTCS 2VHQA 1Z63A 2GF0A 3QEOA 4UXJA 4DIDA 4JIMA 1OXXK 4P3YA 1DG1G 4EPVA 1IOZA 5FI1B 5LB2A 1GL7A 1XJQA 2XZPA 1E0KA 3GPLA 3MGCA 1M6NA 5BN4A 5ELXA 1Q21A 1KNQA 1YR6A 4Q9KA 3I61A 1BMFA 4BFZA 4MRVA 2H92A 3VX4A 3I5YA 3FDIA 4JLNA 3PIRA 3ZZTA 1KJYA 1FOEB 4I1UA 4K81B 2W2XA 4V0OA 1TU4A 1L2TA 3LNCA 1P75A 3R8FA 1ZAKA 1SQ5A 1NBME 1Q0UA 1Z8FA 2FPLA 4NZYA 4N3NA 3ASYA 4DT1A 4DLUA 3ZIAA 5FR2A 3KTAB 4D4KA 3TIFA 1Z0KA 4MYCA 4MGKR 1UDWA 1AGPA 1W5TA 3QKRB 3SBDA 4JLAA 1RIFA 4MDEA 2XXAB 5FPHA 1F2TB 4NHOA 1TQ6A 2QI9C 4P33A 3L8ZA 2NO6A 3JVUA 2WAXA 4M4SA 3SC3A 4MYHA 2D7DA 3GCGA 3KXKA 3VMFA 4BGDA 2RKOA 3WXMA 4UNRA 2V8OA 1OW3B 2QORA 2F43A 4LCBA 5JS8A 2FFHA 1TEXA 3V4FA 1VECA 2HLDD 4HB3A 2OUKA 2QUZA 5UKDA 1QHSA 1QHNA 4PC7A 4ASUD 1MABB 4DC9A 3IHWA 3AF3A 1RRGA 3IGFA 4EQ6A 2CJWA 2IWRA 2C03A 2A5YB 2AWOA 2ZJ2A 1LY1A 3SJAA 2O8FB 2IYUA 5IT5A 4XSGA 1W49A 5KNCA 1XZQA 1Z6AA 3E2IA 4XWOA 4QXAA 1QHYA 1KZ7B 1QHHB 1R7RA 3B8HA 4GRAA 4M8NE 4A8JB 4DCNA 1KO5A 5HZHA 3THXB 3TH5A 1FX0A 3WMEA 1Q1EA 4A82A 2WPDD 2RB4A 4HDCA 2ONKA 5AJYA 3T06B 1P2TA 2R6AA 3P20A 2LWIA 3UMRA 4A0FA 2PT5A 4NPHA 5M04A 2J0SA 2CCGA 4MITA 3ZQJA 4BFWA 2HT1A 1ZU5A 1FUUA 4B74A 1NVWQ 2NPFA 3H4MA 4Q03A 1IY0A 3GLIB 3OIVA 4HYYA 2IYYA 3K0AA 2FN4A 2O8BB 3HU2A 3PENA 5F9HA 3K0FB 2P67A 4CEIA 2QPTA 5FUXA 3FFAA 1Z29A 2ZJOA 3RS7A 4ERNA 4PANA 4RD4A 2NO0A 3TSZA 3I8SA 3Q8XB 1G8YA 4IOKA 4Q01A 5DO9A 1N5JA 3DOFA 2IYRA 4II7A 1P4SA 3G82C 3Q7PA 2PJZA 4H1UA 2ZSAA 3MMPA 2RGEA 5H68A 2QRZA 1R8SA 1E98A 3B85A 1GKIA 1SULA 1VYVA 5EP2A 5TDHA 4KVGA 3CWZA 4TMVA 1LTQA 1P6XA 1M8PA 1A2BA 2QMUA 3OF5A 2IUUA 5J47A 5AK0A 4TSFA 1LW7A 2LKDA 4DDWA 5DYIA 2Q9CA 2PZEA 3GJXC 4LJ9A 2ZJYA 3K09C 1R4AA 4PC3A 1EFRD 1A82A 5CDFA 1RKBA 2BWJA 2JA1A 4OQMA 3WBJA 3FFBA 3BJIC 3LRPA 1ZUHA 2QMOA 1EXMA 3QBTA 1D6JA 2G88A 2KWIA 4HSEA 4HLUA 3EZ2A 4PR0A 2VHTA 5AJWA 4EFNA 2NMVA 1ZD1A 2GA8A 1CJUC 2ANBA 3ADKA 3QKSA 4BFXA 1JB1A 2MMCA 1ZNYA 4LYJA 4QBIA 4ZKDA 3NDBB 5LPNA 3KJHA 1XPRA 2C2HA 2WJVA 3TMKA 4I4LA 4AKGA 1OSNA 1R5OA 2PBRA 3FKSD 2A7QA 3U7EB 2AFHE 2ZRGA 5JHGB 3ZVLA 1W36B 2ODWA 2OBLA 4Q4HA 1HUQA 4NDZA 1N6NA 4US2R 3NC1C 3G5UA 1PLLA 1KO1A 3LD9A 2REXB 1I2DA 2J7KA 4D6PA 5KPJA 3GLHE 1WMSA 2YHSA 2OCYC 5KYKA 2YZ2A 3TKLA 3NEJA 4RD0A 3NEYA 1N25A 2IF2A 2IC5A 2H5EA 2AK3A 4PQFA 1YU9A 1DG3A 5G3YA 1WXQA 1XB2A 3QIAA 4A15A 4GFDA 1R0ZA 4WZBE 1OYWA 3VHXA 4LJ4A 3EWAA 3LV8A 2DWQA 1X8KA 4KI0A 4JLJA 1KAOA 3B1YA 3BH6A 4BLOA 5L3QA 1UF9A 4IRUB 1E2IA 1FFHA 4B34A 4KFSA 3MWLA 4A2WA 4KBGA 3HR7A 1T8UA 2JCSA 3IUYA 4XTRA 5JWHA 1E2MA 3J81k 3CWQA 1BIFA 5FBLB 3V4RA 5DISB 3WNDA 1E2PA 4HZIA 4Q1BA 2ZSDA 5B58C 2F1IA 4AK9A 2V1UA 1Z6GA 3LBIA 2G77B 3I1FA 3SYKA 1AKEA 1JQLB 3A4NA 4B2LA 1PLJA 3M1IA 1OIXA 3C16C 3TSWA 3EARA 3MJRA 3VX3A 4PO8A 3C7KA 1KAGA 3CUEF 5B30A 2R6GA 4L9WA 1NN5A 4IDHA 2JJ2A 3QY0A 2DFLA 4RZUA 3CZQA 5FTMA 3QXCA 2FFAA 1E9BA 3LO5A 3VKWA 1WRBA 2WIBA 3AVPA 3LX8A 4JVSB 1MO3A 3L0OA 2XB2A 4V0LA 2QM7A 2AD5A 1AA3A 4PSVA 3FKQA 4JLPA 5CYPA 3QOFA 1CRPA 2XJ9A 4KBFA 4LHXA 2GK7A 4IDQA 2J9RA 4AKHA 2PJRA 4KV9A 2DR3A 5KSPA 4P0TA 3GJ5A 3ZZ0A 4MRPA 4AKEA 1NN3A 1COWD 2EFHB 3RC8A 2AK2A 3QF4B 2O0HA 4QFMA 5EP1A 3K0CC 1OXTA 4LX0A 4ESVA 2XITA 4PAOA 4LBVA 1W5SA 3S1AB 3SJZA 1EWQA 3BFKA 4FMCB 3W8NA 1ZW6A 3CM0A 1VG8A 1DPFA 1IN8A 4PHHA 4CEJB 4ILEA 5FR1A 4Q7KA 3SFVA 4JL6A 5IDVA 4G5QA 4UNPA 4NTZA 1SVOA 2O8CB 1QHGA 4JL8A 2ERYA 3AVTA 5JJIA 3RS4A 4Q21A 2H7VA 2R8RA 3SOPA 1EG7A 4AURA 2Z0MA 2ZYWX 5FOXA 3AUXA 1PUJA 4X8LA 3SYNA 5EXPA 1YRBA 2YWHA 1DE0A 1R10A 2WMNB 3IEUA 5EZ6B 4B47A 2EWVA 2HF8A 1DS6A 2FG5A 3H86A 3U3MA 2WMOB 2A5GA 5TB5A 3AVYA 1Q20A 2ASEA 2C78A 3GMTA 3KTAA 4F4IA 3BIFA 3AP2A 3K70B 2Z5FA 3M6AA 3C8UA 2C96A 1M34E 2ZROA 4PSKA 1RRPA 2V6JA 2AD1A 3WP0A 5EXTA 4Z8XA 4Q1CA 1NLYA 4Q4JB 1PJRA 3H0KA 1U94A 1EX6A 5IHPA 3K0EA 5EXSA 2QA5A 4TTRA 4B3FX 3NH6A 2YVUA 2RAPA 3GD7A 2G9NA 3VR3A 1SHZA 5KOYA 1KJZA 1OFHA 3CIOA 1QDEA 3L0IB 5TY0A 1ZUNB 2R9VA 2VHJA 4US0R 4EJSC 1XZPA 2WTUA 1G3IA 3BB4A 5FOSA 2PMKA 2GJAA 4XIGS 3ZS9A 1AGRA 1H8HD 3P1JA 2ERXA 2DBYA 4U00A 4D0NA 5B64A 1P73A 2BBWA 1YZGA 2W6JD 2F3RA 4M0LA 3CX7A 2ZYVX 4RKEA 1VKJA 4AYTA 2BJWA 2D06A 4QGAA 4WA7A 1WB9A 4OI4A 1G3QA 2AR7A 1E9DA 1X8LA 2J7PA 3OEHD 1E9EA 3LA6A 4DLYA 4LV6A 2R2AA 3AEZA 1Z0AA 3K9HA 4CRWB 1BH2A 2E9SA 1ZM9A 3BBPA 2QGNA 1KK3A 1IAQA 2GCPA 4WZ6A 5JLJA 2BKEA 3EIHA 3LBHA 1ZU4A 4JVMA 5GJBA 3CNOA 2ATXA 2MSEB 1OJLA 1CR2A 4O0MA 3RC3A 4DT1B 4E5UA 2GJ9A 2PX0A 4TQ9A 4D4LA 1DO2A 4IVPA 2IA5A 2CHGA 2CE7A 1M7HA 4JLKA 4AYWA 3P4YA 3AF2A 1KDPA 3MJHA 4IOMA 4R9UC 3A1TA 4GNKA 3MLEA 1GVNB 2JATA 1P9RA 1S1CA 4BRWA 4AD8A 2OEPA 1XEWX 1ZBDA 3G0HA 5L3RA 2YOFA 2GETA 2V4ZA 1BOFA 3FYHA 4LHWA 1VCMA 4F91B 1QHXA 3TR5A 1S3GA 2D2FA 1S4QA 3DZ8A 2F6RA 3Q7QA 3NTUA 1YZNA 3EZ7A 3ZD6A 3DM5A 5FL7A 4KSCA 1G3RA 4EQ6B 2CJWB 1VCOA 1VYUA 4RFSA 1NP6A 1SKYE 1U9IA 4LSGA 4RFVA 1J2JA 1JR6A 3B9PA 1ZNZA 2QP9X 4CZ2A 1OE0A 2IW3A 2VEDA 2C99A 1EK0A 2ZU0C 4G0NA 1VYTA 3CH5A 2HUPA 4YDSA 3PUYA 4BZXA 2W6IA 1T6NA 4OBEA 3LH5A 1NNEA 1E0AA 1ZNWA 3UK6A 1TQDA 2JLQA 3PUWA 5HE8A 2F1JA 5J4KA 1FX0B 1OV4A 1TX4B 1W4AA 2CL7X 4Z1MA 2BCJQ 4C0SA 5H1YA 2FA9A 4IEIA 3B5JA 4NCIA 4JJZA 4AG6A 4GZMA 2ZPTX 1ZC4A 1CJTC 1Z22A 3THYA 3AB3A 4JBYA 4QBGB 1SXJD 3RS5A 3CB4A 2X2EA 3LX5A 2ZR7A 2WVJA 4HLCA 1FTNA 4G5SA 4O2LA 2CL6X 4EPTA 1XU4A 4CVNA 3K0AB 1XTJA 4JKYA 1S1MA 2A30A 1DAFA 3H1TA 4Q66C 3UMSA 3K53A 3AKEA 3X1DA 3VQTA 3NC0C 2QNRA 1KI6A 2XNDA 2WOJA 1ZVQA 5J4YA 3HDTA 5JWRA 2H57A 2J0UA 1VIYA 3GJ4A 5EUQB 1NLFA 4Q4LA 1RC8A 3U2QA 2PZGA 1N6OA 2BHRA 3D7MA 2XSZA 3M4YA 2GEDA 3CKLA 1G21E 2LKCA 2X1VA 3EPHA 1U99A 4LHYA 2W0SA 3DZDA 4RD3A 2ZUCA 1FZQA 3CO5A 1N6RA 1S3SA 2R62A 3KB1A 2O0JA 1CRQA 3OHMA 2BM1A 4KCGA 3WMFA 1NIPA 1US8A 3THOA 5DSZA 5KDDA 4HAWA 5JI3E 3TW8B 2KI5A 1U8YA 2FF7A 2W83A 4TTQA 3RABA 2EQBA 3CF2A 1YZQA 1IBRA 3KFVA 4NCKA 3EZFA 4HB0A 2J0VA 3IQWA 4RCYA 4RZ2A 3IIJA 4A6PA 1RVDA 5TXGA 1CS4C 1N6KA 1TPZA 3W6OA 1T9HA 3HR8A 1AQUA 5LBIA 2ZANA 3BB1A 5HKKD 3THWA 3TQFA 1NL3A 3BS4A 1KJWA 1EWRA 2C8VA 2ZSBA 4ZO4A 3GJ6A 3R9WA 2GJ8A 2VQSA 2QSZA 3OE7A 4YONB 4D25A 3PQCA 4A1FA 3RRMA 1Q22A 3T61A 2RGCA 1FW6A 5EE5B 2DPXA 3QE0A 4R7ZA 3RS2A 1W4RA 4YMTA 2FPMA 1YZTA 2D2EA 4Q4HB 4UKDA 4C30A 3QQ5A 1AA9A 4P4SB 4XWKA 1T3LA 3LDAA 2GJSA 4WZAE 2JDIA 3R8CA 4RVCA 4D26A 2OBNA 3RWMB 4TT3A 3TAUA 1Z2CA 2CCJA 5CM8B 3EPJA 3CZPA 4Z51A 4UNQA 1DBSA 1GKUB 3EA5A 2VPPA 1XP8A 3IILA 1TF2A 1JEDA 4RSGA 3UWKA 4S2EA 3KFXA 1NI3A 3TVDA 4GBMA 1M1YE 2NZ8A 1FNMA 1JAIA 3CF0A 4MKGA 4DUGD 4FMDF 2GXQA 4OYHA 4YDHB 1UJ2A 2QE7A 3BRWD 3U60B 4W5JA 3I5XA 2QM8A 4F93B 3NWJA 3Q3JB 3OEEA 3ADCA 3T15A 3K9NA 2BDTA 2P0EA 3CPHA 1E2KA 3I4LA 5E4FA 2A9KA 2ZAOA 4V0KA 2BMEA 4BFUA 4E07A 2WAYA 5L8VA 1EFHA 4Q00A 4XWAA 1XXHE 4KU4A 4CEJA 3ZZUA 2H18A 3DMNA 3IIKA 1SXJE 2JLWA 4NYJQ 1G4AE 5K8LA 4AC9A 4TLCA 1ZNXA 4W7SA 2QBYA 1G5TA 2DYKA 2P65A 1II9A 3BC1A 3PG5A 3ZS8A 4J0QA 1Z06A 2QAGA 4BZQA 4B73A 2HV8A 1DO0A 1CF4A 2Z83A 4DHEA 2P6RA 3MG9A 4RKFA 2ZYTX 4IVQA 1MRNA 2CLSA 3PEUA 1J99A 1RZ3A 1KSJA 2ZRNA 1HURA 4Y0VA 2R6DA 3U4QA 2F55A 1AKYA 1ZM7A 2JLVA 3EA0A 5EQTA 2OFOA 1NSTA 1OFUX 1G8HA 3OIUA 1G5PA 4LOAA 4JT4A 5J4LA 3PXGA 3ZGXA 1OH8A 1IXZA 4C0KA 1E1QD 4BE7B 1CBUA 3KKNA 1GG2A 2FFQA 2ORWA 3SU8A 3UANA 5BYKA 5JFGA 1OIVA 1DAMA 3WNCA 2W58A 5H8WA 5GJVC 1Z07A 2PT7A 2TMKA 1CJVC 3WYAA 5E3HA 1WBBA 2J0QA 2F9LA 3FE2A 2E1RA 2ZRIA 3FMFA 4XOIA 1WDTA 1F5NA 2KBFA 2ZS8A 3AP1A 1WF3A 4DLZA 1UBCA 3GLHB 3OESA 1XEWY 4MA4A 1NMZA 1XWIA 4MKHA 1HH4A 3AM1A 2RMKA 1PUIA 4LPKA 4MUBA 4XH9B 4NKRA 4D2IA 1TQ2A 2C9CA 3F3YA 4US1R 1QVRA 3BAFA 2V7QD 3CRRA 2XZOA 2WWYA 2ZI5A 2XEXA 4MQBA 4JJKA 1ZM4A 3W90A 5KSYA 1U90A 4QHYA 2IX3A 1UKYA 2O5VA 2GF9A 3JVVA 4DBLC 4HLQB 2CEAA 3W9YA 4DEXA 4QJ5A 1E9CA 1VDZA 1FNNA 4M22A 3GLFA 3RHFA 5CK4A 3VR1A 1Z3IX 4E09A 1ZJ6A 5AWFC 2OT3B 3ICQB 1C9KA 4D81A 4QNRA 1JQJC 1WBDA 1XXHA 3L8YA 1ZMXA 1QHIA 3SE0A 4Q9JA 3QENA 2GDJA 1QG4A 3B7GA 2VP6A 3RRZA 2QPOA 1EESA 2AXPA 2HYIC 4ON9A 4AKIA 1S0UA 1V5WA 3PUZA 1K5DA 1D8TA 3EWSA 4YC7A 1KTVA 2QT1A 2ATVA 1TNDA 1II8A 1IJEA 4JL5A 4D82A 2C9YA 2WSSD 3BORA 4WBSA 2IYVA 2O0KA 2R6FA 1NVUQ 2VYFA 3RANA 2GKSA 2WJJA 1CIPA 3U7GA 4GSYA 3OAAA 3KZ1E 3VU9A 4YXWA 3NKVA 2IF0A 3K8YA 5AUQA 5DYGA 4PXAA 1I4DD 1NKSA 5HZKA 3UATA 2ZRPA 4TLBA 3TUZC 3HP1A 3RNLA 2JAQA 3T35A 3VNUA 3U7FB 2F9MA 2QL6A 3P26A 3OZXA 4RJLA 3F8TA 3GQBA 1RYFA 3Q85A 4QGGA 3V00A 1E99A 2ZETA 4Z8YA 4TLEA 3EPKA 5LB4A 3GFPA 2D7CA 3DDCA 1ONBA 2ZSFA 4M53A 4YLGA 1ESMA 1DTSA 3OIWA 2ODBA 3BK7A 1T5LA 3RSLA 4ABYA 4DSTA 1Z5ZA 4HB4A 3ZYCA 3B13B 1T3SA 2QN6A 2ZREA 1E2DA 3FPAA 1KK2A 2BM0A 2YWEA 4M1KA 3TK1A 2ZE6A 3C41J 1JJVA 4NONA 2VHUA 3QPUA 5IK2D 2FGKA 4W5HA 1Q57A 3EZ6A 2GEUA 2ZQ5A 4OHXA 1X3SA 4HAUA 2CBZA 2QROA 1G6OA 3C14C 4V0ME 4WXRA 2NO7A 4NBSA 4URWR 3W5JA 2VP4A 4KITB 1CR1A 4NYJR 4F4CA 2B7BA 3PEVA 3Q9LA 1CR4A 4JYBA 2ZRDA 2WKPA 1S96A 2HF9A 5G3ZA 2GWHA 4IXNA 4DZZA 4MKFA 4Z54A 3VNVA 2XNSA 3IIMA 4BFYA 3IBGA 3LQRA 4LJ6A 1NBMA 2OZEA 4U02A 4TWZA 3NDPA 1FP7A 1E3MA 1U8AA 5CB6A 3OFND 4IOJA 1HA3A 5DN6A 1JEEA 2A78A 2RGNC 4A36A 4HLUC 1E2HA 3HYTA 3PUVA 1XMVA 1JXOA 1G8GA 2OESA 2GCOA 2ZU6A 4RD2A 1PV4A 2MMGA 4RFSB 5KSOA 1X6VA 1DAKA 1YR7A
chains in the Genus database with same CATH superfamily
3ZVMA 3DE2X 4MYUA 4OH1A 4GE0A 1W0JA 4R6XA 3HCOA 5EIEA 3L1UA 1Y3DE 1C3JA 1T29A 2NYVA 1OXSC 3ZK8A 5J4HA 1DOZA 1YJAA 4GKAA 1C41A 3VTAA 4KNYA 3IPYA 3D6AA 3DAHA 3Q3EA 4BNGA 1P2VA 2BF7A 4KQWA 1D4OA 4UM8B 5LQAA 1BU8A 4WNCA 3HBLA 4L5JA 3UYLA 5C2JB 3C24A 5LDHA 3ZNOA 3H7IA 2CNWA 3GROA 3HTXA 1MB0A 1SB8A 1X19A 4OJQA 1DQNA 4PRYA 1CD5A 5SYNA 3MEQA 3ZHRA 2PVCA 3O47A 1NVDA 4JKIA 1CUIA 2V97A 4YAJA 1NJFA 1TW2A 5JSKA 3LKZA 4IFTA 5FWAA 1DBPA 1X80B 5HFAA 2O0LA 1N7HA 1F0PA 1U0JA 3H87A 1WO8A 1B0UA 3U13A 4N8DA 3ZTTA 4FNOA 4D6YA 6REQB 4Z9AA 1O77A 1SBYA 5KBYA 1P4AA 4IMPA 3GYGA 4TROA 2IPMA 2R44A 3K6KA 2RHWA 3M8KA 4MLPA 3SQOA 3U62A 5JSZA 3KAPA 1EUQA 2I71A 2J0UB 5E9JA 2ZAGA 2FOIA 4MV3A 1TQHA 4B43A 4ZI5A 2ZSEA 2ZVDA 2Q9AA 4S2UA 2C3PA 5FBHA 1T9DA 1AN0A 1WP9A 4XLZA 5D7NA 3RIXA 3KPJA 4LYHA 3K8OE 4AJ4A 1JXMA 1X9IA 5F7OA 1P72A 3W4KA 2EZ9A 1TUIA 1DOAA 1KI9A 1UQRA 2VLIA 1E1RD 1SCKA 1LEHA 1ECCA 1M2VA 1U7WA 2GYVA 4M9SA 4NV1A 4R8KA 2Q4OA 4TTIA 4DRXB 1US8B 4KUGA 1QMGA 4GDFA 2XCUA 3ESRA 1X92A 2R5NA 5EPOA 2FMFA 2JI8A 2HU7A 2N1BA 2VOEA 2SKEA 3Q3GE 4BVLA 3C6YA 2QTVA 1VPLA 1MKYA 2M6RA 1NQVA 1UM9B 2B8WA 2HRQA 2O3SA 1HZJA 3AP3A 3C7DB 1LCIA 3W8RA 1R3DA 3WLRA 1H3EA 1QDUA 1IEXA 1GNSA 4OG2A 5J2TF 1AK9A 3EVBA 3EZLA 3Q98A 4FFBA 4OMFG 1FQKA 4MRRA 4AJLA 4C5AA 4CIXA 3WTBA 2VHCA 1AQLA 1XMJA 2J31A 4BCBA 4FIZA 3GFFA 3THWB 4JXZA 2IDKA 2JIDA 3SFTA 5CM9C 1H9BA 3TPCA 1NJ5A 2AYXA 4KO2S 4IX9A 1NG1A 2Q8NA 3I5MA 3PXCX 1P4RA 1LDMA 1RBQA 2GZHA 2UZ3A 3BWMA 3CR7A 3LBFA 5CVUA 4ZVVA 4BVAA 4YCDA 3L3BA 2WQZA 3VI4B 3HA3A 5A1JA 5EN4A 3KPUA 3NAGA 3RC1A 2P9CA 3QVUA 1K6EA 3KPYA 1DBIA 2WINI 3I9MA 5DFAA 2B1GA 1OH7A 4JGIA 4XJXA 3K2IA 1YQDA 5HUQA 2GEJA 2B4RO 2B37A 3ADPA 3IAS6 1DKRA 2BVNA 1NJ6A 2C8KA 4NMMA 4QUJA 3FCCA 1NZFA 1ZW1A 2FZ4A 1RKXA 2XD9A 4QUBA 4WXPA 5AT1A 4YRKA 3SF0A 4Z7NB 5KO2A 4CI9A 5EHZA 1ICEA 2P9YA 4KWCA 4YN3A 2DC1A 4IYJA 5IVKA 1H4SA 2FOLA 3K0BA 1BHQ1 3P2IA 3SJUA 3IDSA 2RH9B 4UCQA 2XAAA 1YZKA 3AHFA 3MGKA 4EELA 4OQXA 2AFHA 2O8VA 4DKJA 2JZCA 2C0CA 4G5YA 2UU9B 1ZMTA 3QVSA 2VQ3A 5IAEA 4TKUA 2FSSA 1CP2A 3AY7A 3BN3A 1KSGA 2Q9BA 4F8EA 1AE1A 1V43A 3ORYA 5K0EA 1OY1A 1DARA 1DX6A 4E08A 3QSYA 3LCMA 2P9EA 2I4IA 2QQ0A 2VSNA 4P4TA 4BO9A 5K4AA 1N0IA 2GXAA 3KSAC 1V4BA 2ZTLA 4MYTA 2E85A 2FSFA 4RTOA 2H52A 5B57C 3E81A 1YS6A 1HTBA 2GAAA 3ZWCA 3IELA 2F7SA 4N3CA 3U3DA 1ESZA 2FP3A 4ASUA 1TEZA 1CYEA 3JR7A 2PLAA 2G5CA 1EGVB 1K2WA 1RI3A 1T24A 2DFTA 2I3DA 1FYFA 1G19A 2P5TB 2R8PA 3C6MA 1Y80A 3FDFA 1IXSB 3I01M 4G4SP 1TK2A 2F48A 4MV9A 2WJHA 4NCHA 5DCUA 3ZIUA 1N6IA 1E79D 4OLJA 1ARZA 2XE8A 3PP8A 4PG5A 1Z7EA 4PPFA 2QBYB 2UKDA 3L7BA 2FMKA 4CUKA 4BPRA 4DM7A 5REQA 3TI7A 1RJWA 5DP2A 3UMVA 1HLFA 2QAGB 2OBFA 2RBGA 5DXJA 2XTZA 2NUPB 3EEYA 2FX3A 4XFKA 5IPFA 1NMSA 1CUDA 4HGQA 4RADA 3PRKE 1AO0A 4QUGA 4JY7A 4XJTA 5BUZA 4YJHB 4JXXA 1RAHA 1YS2X 1TUBB 2CVFA 4OI0A 1IN4A 1UBRS 3COVA 5KJEA 2K6GA 5GGYA 4C0XA 4PPNA 3V2UA 1XTVA 2VSXA 3QOYA 1UDCA 1CC1S 3W5HA 1UC9A 5MN5A 2Q5LA 3W3ZB 1QIFA 1YVUA 3A6LA 4TYPA 2O3UA 4ZARA 3E9MA 3ELYA 1GZVA 2REQB 3T7EA 4I4TB 5HQ3A 3AXSA 2HBZA 3HFRA 5IJ0A 4EQ6B 2QWXA 3I62A 1ZYUA 3RUDA 4A4DA 4PCUA 3AJRA 3D8BA 5SV2A 3LE8A 4OTZA 4DFDA 3B9QA 1G3UA 4A8JC 2GJKA 4AQDA 3K9LA 3ZDEA 1CP3A 2WF9A 2YJTD 1EFPB 1NKTA 3FHOA 2HMYB 3EVCA 3HUUA 3KSDO 4NFLA 4OHRA 4UW9A 2HO5A 5K0LA 3WGLA 5A2GA 1EDZA 2IL1A 1UMDB 1WTAA 3ZWPA 2WWHA 2GTHA 1JZQA 1P9LA 2O0MA 3GDHA 5BVHA 1TJYA 1I0LA 1A8PA 4EM6A 4JI2B 4Y7CA 1ZR4A 1HYQA 2UZ0A 2XODA 4J1SA 2UYQA 4NBKA 4A0GA 1J8YF 3Q6IA 3D4LA 1UBTS 1GNVA 1ZLXA 2O7NA 3CO0S 1UK6A 5C8DA 1R4MB 2FQXA 5GTDA 5JYBA 2BOVA 3VHLB 5IRCD 1N0VC 3UJ9A 1WZEA 1V1RA 2V5UA 3HCRA 5G2OA 3EZ9A 3N0VA 4ZAXA 1SZPA 3BK1A 3DVSX 1K89A 3UC5A 1V7PC 4LJ8A 1LBIA 3BBLA 4IDAA 4LYAA 3PVZA 3HDGA 3IYLW 3JZDA 4MUHA 4RD6A 5TVKA 1Q0QA 2P68A 5H5JA 5LL6P 2BKXA 4AXBA 4J90A 4FKZA 4E22A 4EY6A 1CULC 1SQGA 3WHLA 2Q3EA 3ZHOA 4JR2A 1GNPA 2FRXA 2OHJA 2W8BA 1XT6A 1SBTA 4TTPA 4G41A 4EKEA 1URPA 2FHPA 4FILA 1KQGA 2PXAA 1Y6JA 3PFBA 1RWOA 5A6SA 3O5AA 1GJRA 1GAXA 2AE2A 3IKTA 1KQ3A 2GUWA 4HQLA 1H1LB 4D41A 1B8VA 1SXJB 5D2CA 3P9XA 4JT9A 1H2YA 4WNAB 5A06A 2O54A 1K9VF 3RTCA 3BIXA 3Q8LA 4A0RA 2P6MA 1WBJB 2I87A 3UFXA 5C18A 1JHDA 1LNQA 3FKSA 2HZ7A 3O1JC 3PPVA 421PA 2OWDA 1XMOB 4ZRDA 4ILKA 1ZHHA 2PMWB 5KQMA 1DP4A 4JDPA 2F59A 4FN4A 3H5OA 3OKPA 3O26A 4MUAA 4EFNA 1V8OA 4IZ6A 3PEYA 1M0WA 2OO7A 3ZXUB 3C4VA 2ZUBA 3U49A 4DJFC 1SOMA 4ENSA 1J7KA 2QD3A 5K0CA 1PK8A 1KZ6A 4MS4A 1QFSA 5CITA 2VUHB 3ZJTA 1JHVA 3L06A 5ALFA 2WJ6A 4NAVA 2V3CC 1L5KA 2GN2A 1KK1A 1SVSA 1Y1KE 2JPDA 2QMZA 2QRVA 4I4IA 4XASA 1QP0A 3M33A 3B1ZA 5JO0A 4QFDA 1G2IA 2O57A 2JGEA 2MSNA 3FB4A 3WLLA 2O8EA 3HYCA 4FGJA 5FBRB 1BO6A 1ZGBA 5GV7A 4AN1A 5K20A 2YWGA 3QKUA 4YIHA 3PDCA 4RJIA 5NLLA 2CUKA 3IUEA 5BSGA 2RGXA 3D02A 1T5HX 4LQCA 4X1KB 2RH4A 3EXEA 2HJVA 3DV0A 3E84A 1WA5A 1MOZA 2WWXA 4N41A 1LV7A 3OQBA 4MVXA 1VYHA 1GPH1 1YQTA 2FPOA 4QDJA 4TKMA 1NDHA 1P9WA 4OK3A 1Z0FA 3FNHA 2GNPA 5CA0B 2H11A 4M55A 4P35A 4CT5A 2PUAA 2ENWA 4RXMA 3T7KA 4EITA 5E3IA 2VPXA 4H4EA 4L95C 3PXUA 1LQUA 1I5EA 3UOWA 2E4ZA 4CMKA 4B3CA 4DLVA 3MSXA 4XM0A 3CH6A 3TBHA 5EZYB 1T8SA 3LVQE 5IUJC 2D4HA 1M74A 2X77A 5F4ZA 2W2TA 3QEMB 1M6WA 1S2IA 4R41A 3VR4A 3ZIAD 1UKAA 4GYKA 3LYUA 2BT4A 2Y0CA 1DT5A 3JVEA 4NS1A 4BX8A 4LQ4A 4PAMA 5KHOC 2GBFA 3JYQA 4DY4A 3PFGA 5K01A 1D0VA 2GZ3A 4PAGA 4CMIA 4TS4A 4Z9YA 1PUXA 1CRLA 3QNWA 1P8JA 2HT6A 1PYOA 3A25A 2CC2A 2FEOA 3D4NA 4I1VA 1X15A 4H7KA 3FDJA 1QLWA 4BWGA 4OHKA 4LDZA 4EF4A 4P0PB 1EDEA 1QIGA 3KG2A 5MFZA 1D2NA 2DU8A 3ANMA 1C7FA 4BVGA 1K8ZB 1MO4A 2JBWA 1SBNE 1U4NA 1ZVMA 2B98A 4UD2A 3UQZA 2VTKA 4ACAA 1Y9ZA 7REQB 1H5NA 5FORA 1FMFA 1KY3A 3VOAA 1Z26A 1G9XA 1ADYA 2DM6A 5JAHA 4CMHA 1TJPB 5K8TA 4JFRA 2ZYDA 1HEUA 2NZUG 5AI5A 1S3FA 4CETA 1SMKA 2VPYA 3VYUB 1WHTA 3ZVLA 1G8PA 3CT6A 4W82A 1RQRA 1VA5A 2VUTA 4C88A 1P62B 4G2TA 1RE0A 1YJXA 3QWAA 1N7JA 5KNDH 2RAFA 2HEGA 4QX6A 5KNCD 3RWBA 2HSWA 1G1MA 2HEIA 4CL2A 5AVUA 4HAZA 3DFZA 3R7BA 1ODSA 3WNZA 5A05A 5BNWA 1EG2A 3ENWA 2B69A 1MU0A 1DQZA 1L5VA 4WEQA 4EECA 5IULC 1MVOA 4C2UA 4PY2A 1H9CA 3Q7TA 1KIAA 4OAOA 3W8EA 5IUNC 2YMPA 2OQVA 4LV5B 1D2EA 2JD2A 2DWOA 2HRRA 4ND2A 1CUBA 2R7NA 2JFFA 1E3EA 3HU1A 1QFJA 1LI5A 3E9YA 3U19A 2LIPA 5A2QA 3U44A 5A9TA 5CG2A 5JSZB 1N78A 1VCIA 4MQEA 1DC6A 1Y7PA 4PF1A 5HJEA 3HNPA 1G4UR 4TZKA 3LBNA 3LUAA 2BFFB 3IQIX 4HN2A 4B48A 3KJIA 4D0GA 3KXDA 2VS1A 3REQB 2KW5A 9ABPA 1TMYA 3EXG2 2OILA 1PVDA 5H02A 1SIWA 4OHVA 3RHSA 1YWGO 3BDIA 2XB4A 3FSGA 4M2LA 2YFHA 1TC2A 3MERA 3SQWA 1J56A 1HQYE 1NATA 1KGDA 1M2VB 4DMLA 4P0QB 1SXPA 2BHLA 2PUEA 3WRXC 2WW8A 4Z4FA 3HYNA 1GZSA 4ZAWA 2R65A 4MW1A 1TECE 1P44A 4EATA 3G8DA 2C04A 3RVJA 1AS2A 4JGBA 2A9JA 3DAYA 2Q7XA 2QTVB 1F51E 2W2LA 1YR1A 3EPPA 1RQNA 4K9MA 3QELA 1Z0DA 2HDNB 2WYIA 2JGIA 4I9HA 4TSFD 3UJBA 1U7DA 4CMGA 2UUAB 3OZDA 4FFBB 2EJTA 1G21A 4KQGA 4QSHA 1DRKA 1M10A 1FEZA 1T2EA 2OR3A 5EG5A 4ZC1A 5JG7A 4AYXA 4DR5B 2BGGA 2RCNA 4P83A 1FS4A 1NZJA 4H7FA 4BQSA 3D81A 2MSDB 3N6VA 1Y1LA 3CMMA 3IEXA 3LKDA 5A5GA 3FR8A 2A6PA 4XDZA 3LCJA 4IEFB 3IHKA 1OAAA 1V45E 2QT0A 1USGA 3UG7A 2VTBB 3KB2A 3OEHA 3RDPA 1SNYA 4QOIA 4ZYTA 2IYQA 2ZFUA 2ZE5A 5FWNA 3RVNA 4OBXA 2Q4EA 3JPYA 1YXMA 2AMLA 4B46A 2HWUA 5FFNA 4JWTA 3SEAA 1P5JA 3VPHA 1QVAA 1YJQA 2ZW9A 4YMVA 3CN7A 5JNVA 4I55F 4MV5A 4UAGA 4E46A 4YI3A 2GTPA 5A9RA 4MMYB 1USWA 2EQAA 1HNWB 4TMXA 1U3DA 3R9IA 3QOXA 2RD2A 1UBNA 4MCHA 1ZL0A 3BD8A 4D8XA 5EAIA 4PV7A 3OMXA 3OTQA 1OF1A 4LY0A 4EHAA 3VPDA 1VB3A 2CLDX 3D8UA 4TKUB 4RUKA 2QRHA 2ZS9A 1MORA 5F2EA 5AVTA 5IT9A 2NOAA 1K98A 3AZPA 1VG9B 2X76A 2FNAA 2QAJA 1XRJA 4RLHA 3I92A 2H7YA 3ROXA 4BP3A 4OKIA 3H3FA 4DA9A 4RTJA 3LZ6A 1CJMA 4JMPA 3VR2A 4B7CA 4BQQA 1OFIA 2YXLA 4NZZA 1ZOLA 4PLHA 3CSDA 4TV8F 3PHGA 4EARA 4DB2A 5FV4A 1WDWB 1UBUS 2PJUA 3EBPA 3S68A 1H2BA 3PGMA 1FVFA 3S5UA 3V4SA 2GEBA 1BKYA 3NNSA 4Y2UA 5C4GB 3RVBA 1PS9A 4JBGA 3NP7A 3WQRA 3ER9A 1LBEA 2C4MA 1HO3A 3TAXA 3DBVO 4RTNA 3QJ5A 4D02A 3UHPA 2IIVA 2WU0A 5E38A 5REQB 1HG0A 4KE7A 1TYAE 3VHQA 1XYVA 4FYIA 1H22A 4BMPB 2YHIA 4V03A 2UYOA 3X2FA 1CRWG 4OY3A 4N0MA 2QZSA 2HXGA 4HVTA 4DBVO 2D13A 2WABA 4QHSA 1G7SA 1P2SA 3I76A 4JEHA 2BMDA 3UXEA 4BV8A 4EYGA 5DHPA 2FPSA 2MYPA 2BM8A 2H1FA 1U9YA 3DEYX 3OEYA 2O5EA 1R0RE 3TIVA 5MGNA 3JQ9C 3VJKA 4A0SA 1GPAA 2O9JA 5IZCC 3KZOA 4A2QA 4ND8A 1E6EA 3MYRA 3VPFA 1KETA 1M8JA 1HT2E 1OFTA 1XMXA 2V7VA 4BO1A 4TVSA 4TL9A 1FDRA 2IXEA 1BA3A 3I5UA 4PYQA 1Z4KA 2ZRFA 4GSLA 2PKCA 3ILSA 5SZHB 1GGVA 2O2SA 1C0PA 1LVGA 5HQ3B 2XY4A 3RTEA 1I1NA 3N74A 5IJ0B 4YMIA 4KOEC 1ADFA 1X7GA 2C00A 4WOBA 4ZOAA 2FHSA 3HLYA 4UTVA 4XVUA 3BE4A 3B20A 5F98A 4C7OB 2AH5A 1OIWA 3MAAC 5FUQA 4DYHA 2YC4C 2PEYA 2YOHA 1BWPA 1MT3A 1PDVA 1X1AA 3U9TA 1Y6FA 1UAAA 1QUFA 1JG3A 1Y8RA 3R3UA 4NV3A 4O5AA 4AY5A 3CWCA 4E5DA 4KE8A 4BU0A 4AG5A 3TG2A 3SG0A 1MPXA 2ROQA 1HDRA 4HEA6 3RF6A 2C4WA 1PZHA 1NN0A 1U0EA 1OJ7A 1V71A 3JQBC 3BJEA 3KCQA 4PHCA 4IF6A 5DW3A 4HFNA 1OWOA 3U16A 1EIWA 1PL8A 1QV7A 2HLHA 4C7KA 2QN1A 3N0RA 4E2FA 1DC3A 2HMWA 2Y92A 7ADHA 3LSTA 5G0SA 1V1RB 5CT6A 5T6MA 3ZH2A 2O7VA 4LX8A 1G7TA 4FMDB 1XNQB 3JQ7A 1ML3A 4S3MA 3ANXA 1Y6ZA 1ABFA 1THMA 2BE9A 3D6UA 5D51S 2WKRA 4YAUA 2GESA 3LT1A 3LQYA 4EMBA 5EXDA 2QPAA 4KAFA 4RQBA 2EVWX 2PUDA 2A67A 1SFRA 4BNYA 1L7EA 3ZHYA 2W8BB 3T7DA 3PQ7A 4G9GA 1P2FA 3OZEA 4O3FA 1DIOB 2JVIA 2Y3IA 2AN9A 1ESEA 1GCUA 3CV3A 4FHCA 1A9SA 3PC7A 4A6DA 4C7XA 3MB8A 5A6SB 5HKKA 1I3MA 5DNCA 5A4IS 1W36B 2V7EA 4N18A 3STUA 2XCRB 1V3QE 3AXTA 3L05A 3WKAA 1RD4A 1UJBA 2NZJA 2CLOB 4RPKA 4DIMA 1U8EA 1RACA 1FLNA 2OG2A 5JAOA 2UAGA 1T1JA 4E7OA 4ZT6A 3H5RA 2GWRA 3ZDCA 5FAKA 1TU0A 4R84A 5ITVA 1AKTA 3RIMA 1C81A 1JWBB 1G7RA 1RRFA 1XNJA 2GB4A 1ZIPA 3JQPA 3PQ8A 4PXSA 3SX4A 5LP1A 3WAKA 3F6CA 5IMBA 3GY0A 5JC8A 1UBLS 3ZWMA 3F1LA 5BURA 5JCOC 1PHPA 1GEEA 4OUDB 1QG6A 5I9NA 5EHQA 2I54A 4NF2A 1PFVA 2IEGA 5IG2A 3ZU5A 1SZJG 5IAJA 1DEOA 3MJCA 2R6ZA 1V5FA 2C3UA 1K68A 4LWQA 5EJ8A 4RK1A 4BMSA 6LDHA 2CMFA 3MMXA 3RTBA 5K05A 4HOYA 1CZUA 3D1JA 3ORRA 4LMPA 2QRVB 2AXNA 3NW9A 2VBCA 3TI9A 1GIAA 1UP6A 3SJBA 1N0HA 2O8EB 3D5EA 2AGVA 4YECA 4DSAA 1FE8A 4Q7JB 1W2GA 2Z4RA 4QQFA 1T9GR 2FWRA 2NV6A 4FU0A 3WLKX 2P4EA 1KO4A 3F3KA 1XIVA 2P2ZA 3SIXA 5IF9A 3H4VA 2CFCA 3EXEB 3GGDA 3KVVA 3WZ2A 1NTOA 3BPSA 4PLZA 4GXNA 4BX9A 3V42A 1SCAA 3ZCXA 3H13A 4MGHA 4I1RA 4HNRA 1X39A 1R0SA 1O94C 4URXR 2AHOA 3KDSE 1XTQA 1M2HA 2J7PD 3QE3A 4YJGB 5HG0A 2RGYA 4HUQA 3GZNA 4W9MC 1L4YA 1LTKA 1OXUA 1YRYE 4Y2RA 4X97A 4TMZA 5DX1A 1ECGA 2GK4A 3Q9SA 3DMPA 5ICFA 2LDYA 2HF2A 3LZDA 2NSDA 5I3ZA 4YVFA 4G24A 4UBNA 5GGXA 1R16A 5EFZA 3U3JA 1ZD3A 2PH7A 3FSEA 1PT7A 2WWGA 3VSDA 4JS0A 5EMMA 1XLTA 5L6MB 2O20A 1GPMA 1GZDA 2VJAA 5KTSA 2R7AA 2CBGA 3ILXA 5LLTA 3TM4A 4L0DA 2Z6UA 3AO0B 3ETDA 3ROTA 1FPMA 1L1FA 1IAVA 2XTMA 4CMIB 3FOAA 1OR8A 3REQA 1U3UA 2J3JA 5BSFA 3HVIA 1T2NA 2X1LA 3H97A 3UKOA 1ZRSA 2ZYAA 1HMPA 2WRZA 4N1AA 4J76A 4UM9D 1ST3A 1T8TA 3L4BA 3F3MA 5CVEA 3L43A 1BEUB 2V55B 3N0TA 4AKTA 1JIXA 5AW0A 5M7EA 4KWEA 1F4LA 1JXQA 3LL4A 4YALA 4CKCB 2PUJA 2P91A 3IUSA 4HHEA 4LSZA 4LJAA 1CQZA 4YI5A 4EG3A 3L92A 3QXSA 1WHTB 3IH5A 4WNYA 1D1TA 1XMIA 1X0VA 3BXOA 4KW7A 3WWPA 1E2LA 3CVXA 1DXQA 1KOJA 2ZI6A 3DE6X 4Y3UA 2WIAA 3CF6R 3MJSA 4LJYA 2MT9A 3IOYA 3G88A 1E5QA 3S6JA 3KE9A 3W1VA 4MRAA 3DCJA 3HACA 1QC5A 5A4MS 1XTBA 5CLQA 1K4KA 4LDQA 1NWCA 1VQ1A 4BRSA 4DOMA 2EARA 1V4NA 3AHDA 3NFYA 1YR3A 3HB9A 2XIJA 1E7MA 3T5CA 1T6XA 4H2DA 4CL0A 3FNIA 1CJCA 1NBAA 3C1UA 5I3CA 5LKRA 3FOFC 3OHPA 1XPUA 1XCMA 2Q21A 4WN9A 2C5EA 3RVMA 4D0LB 2VXBA 4G9BA 4N9QA 1NRIA 3OM9A 1ZD8A 3VPGA 5IAAA 1E4OA 1GGEA 5JLAA 5J43A 1NW9B 2H7CA 2IDMA 3I3SR 5EJEA 2PU7A 4DLTA 5KINB 3QXJA 1ZXBA 2QD4A 1NXQA 3HCAA 1Q3HA 4F92B 4J4BA 3EUEA 4NBRA 1AKUA 3B53X 1PQWA 3RRFA 4MQEB 2OZLA 3EODA 4LGMA 1K06A 3UK7A 4ZCMA 3QVVA 2EL9A 4MVJF 4PZ0A 3ASUA 4RM3A 1UT6A 4FFNA 1MOPA 4F8JA 4KHPB 4XIIA 4M9CA 1IY9A 2CYBA 4LEIA 2BSQA 5FUYA 3SC4A 1NX6A 3G68A 2RE8A 3OLCX 2H08A 4UC0A 2B8TA 2WQ6A 4QU0A 3K5WA 3ZCSA 1ZINA 1RYHA 4LJ7A 2W70A 3UPTA 4TRMA 4UEQA 2I6TA 2IHVA 4GG1A 4H17A 3VDXA 2D1RA 3E15A 3OZAA 1KHTA 3EDQA 3MPOA 3KT0A 8ABPA 4JB8A 4LXHA 5IKXA 1P0MA 1U4OA 2Z3WA 2AMJA 2BCEA 5JS7A 2IXAA 1NRJB 4Y2XA 4TWAA 5BSKA 2WSSA 1KEVA 1HGXA 4TMTA 3EDRA 1EEHA 2R6CA 5BSTA 1GQYA 3SM3A 3QELB 1JMVA 1BWQA 3C0KA 2HJHA 4IJUA 2GPNA 2QVCA 1ZICA 3EGCA 4M86A 4C2TA 1VDMA 1QTRA 1RWPA 3TRHA 3PFFA 1FJ2A 1G21B 5HOQA 4ZDWA 5GVSA 5EUMA 4YYZA 4RPIA 5AVRA 3TIXB 1C50A 4RORA 1KARA 5TEWA 5P21A 4WFKA 1BFUA 2RHLA 1J09A 4G5GA 3SI7A 4DDTA 1AXGA 1X7WA 5BVGA 4AMVA 1S2MA 4R7GA 2QI9F 3P94A 3TFOA 3TLGA 2I8CA 4I66A 1E8DA 3NUGA 4M0FA 3F0TA 4CHTA 1Z15A 4F4DA 3R9XA 2F1KA 4HQFA 3GUUA 4X6YA 2UYHA 4G37A 4MWBA 2WTAA 1WPQA 3AY0A 4N7BA 5F5NA 1I9CA 2H51A 3Q7EA 2JLZA 4O4HF 1YSCA 2HPZA 3U1TA 3QLEA 1V11A 5J23A 1HE3A 4J4HA 3SHWA 3F49S 1I4EB 3JAMA 5LDDC 4RMNA 3PT5A 2EG5A 1LZLA 2CB0A 1N6LA 3P32A 3UJPA 3DKPA 3KQYA 4OP3A 1GFIA 3PHLA 4DBZA 3CIFA 1ZCJA 2VZLA 4N0DA 2CF6A 1O7JA 1LPBB 3OU2A 3HWRA 5FBZA 5IK2A 4BMXA 1U65A 3NTLA 3PD0A 4XI9A 4ES6A 3MF4A 3CNLA 4XZ3A 4O5OA 3FLMA 3GT0A 2FZLA 5C4MA 1GAEO 1MBZA 3IAHA 2BGJA 2XHEA 4K9LA 2B1QA 2ZSUA 4IVRA 3ZJYA 2CNLA 1X9HA 2YZ7A 2ZUUA 3MCAA 3N8KA 2CE2X 4WGFA 1NQ5A 5ALUA 3VNQA 3VZSA 4B9AA 3TZQA 3CXRA 1SVKA 2BGIA 2YKGA 3CX6A 1K8YB 3OZBA 1OZ0A 2L42A 4U6SA 3UMCA 2C61A 1F2TA 1TF7A 4P82A 1MUUA 5JTTA 4JI8B 1PYGA 2DJ5A 3W5SA 2HR1A 4W8HA 5C1BA 2JARA 3EIWA 1GLGA 2VYCA 1YKSA 1ZJWA 2C8JA 2GI4A 1CY2A 4FI3C 4FQ5A 1T5BA 3VYTB 5KYXA 4HI0E 3K6RA 2I7CA 4MV0A 4X5OA 3SEZA 3O2JA 4FFLA 1DAHA 3ABIA 2MR6A 2VG8A 1EVYA 1GQ2A 1YAHA 3TINA 4IV0A 4HPXB 4IY1A 4FZJA 4JJGA 5FOWA 1K7YA 5FLKA 4L28A 5EIWA 1UCFA 1CEYA 2VXCA 2QQFA 2O07A 2CWWA 2YHIB 3IV9A 2WYUA 3VAAA 4ZPXA 2B7LA 2RHDA 3ZY2A 4QD3A 2BMVA 2HK6A 1YS7A 4ZQFA 4DMUB 3ZE0B 5JEDA 2Y1XA 5KC9A 4QM6A 2H3HA 1XRMA 3OT1A 4ZYZA 1AQJA 2V1XA 2HQRA 4W8GA 1MTOA 4DQKA 1JJ7A 3WBKA 2JJQA 5CFMA 5DGXA 1S2DA 3THXA 1N3IA 2P9QA 5LZ9A 3ZY3A 1TF5A 1QQBA 2FLWA 1WV1A 2G9QA 3CZ9A 4L16A 3VDNB 3W78A 2GFQA 5LMNB 4E2XA 1OAOC 2IBMA 4E2ZA 4Q6BA 3R4CA 1I32A 3H5VA 3IDFA 3WYBA 1EXNA 4R68A 4E14A 1KGSA 2LCQA 4GT1A 3M2TA 5JZOA 1G9SA 2PPVA 1ZD4A 2FPRA 3CZ5A 2OCPA 5LYYA 4XPIA 3R3HA 1A9OA 5AKHA 3T34A 3OA2A 1ZK1A 3LL7A 4FJ0A 4B6EA 2O8BA 1T6ZA 1TIPA 2BGLA 2DHQA 1NMXA 1Y8RB 2WJYA 1XLUA 4OGGA 4BVKA 2J5RA 1SKUA 3ZZNA 2YDYA 4REOA 5IWAB 4NNOA 2II6A 3TGLA 2N75A 1GUYA 1PS8A 2ON6A 1C3LA 4NYMQ 5FBQB 5TQJA 1XTKA 3O73A 3WLQA 4AFNA 1UFQA 3AC0A 4M7OA 4ZDKA 5CCDA 3NI2A 4OJYA 4ENUA 2FEMA 1CCWA 1GR1A 4Q9LA 5FPTA 1JBQA 2F43B 1U04A 2H2FA 2NGRA 1R8QA 4MLCA 3I28A 2V4MA 1OBVA 2C5BA 1RMTA 1KWKA 3RBZA 3B51X 4ENTA 3JQDA 3OBBA 4CGYA 3JQ7B 1D2HA 2GYYA 1DCMA 3GFBA 3NBZC 1P1IA 1QCCA 3E1SA 4EUNA 4F38A 5C1PA 5KMGA 2EFEB 2YBDA 3JYOA 2GEFA 2QSYA 3ABQB 4OSEA 1KI8A 3AOEA 2X4GA 1YA8A 2I2XB 2OAQ1 4LRTB 5TF0A 2F8MA 2IS2A 1R0WA 1RJGA 2VH5R 1T3TA 3KS9A 5CRIA 3PR2B 1VXOA 5AW7A 3LG2A 2VZ0A 5FH9A 3S2ZA 1JU3A 3DE5X 4B9EA 1U7TA 2FGJA 2PSEA 3ST7A 3HJCA 2F2TA 4IIJA 1D0SA 2Z4SA 4KO8A 3HYSA 5CVDA 4BNXA 2XBUA 4UAVA 2GS9A 3C8HA 1YONA 3TCXB 4ESEA 5B55A 2ALJA 4Z3KA 3UCXA 3D8SA 1BMTA 1EVQA 4O2AF 2ZM6B 1JDTA 3WKEA 3HV0A 1D2GA 2GAFA 3E7XA 3NBMA 5CB4A 4Z0PA 2PH1A 4I1SA 5G0WA 1QH9A 4KKXB 3WQQA 2GAIA 4MVJD 1HRKA 4FXOA 1RTTA 1ZAYA 3G89A 4D96A 5BV0A 4AZSA 2C5LA 4DBLE 1H6DA 1Z0IA 3JARA 4IIUA 1LTHR 1EQ2A 2IYFA 3R3ZA 3IV6A 4UUPA 4A16A 5CBPA 2XGGA 3A6KA 2JCGA 3U4GA 2E4WA 2AQ8A 2YXNA 3EH2A 3SDZA 1THGA 1V39A 3QVKA 1XI2A 3QXXA 2BL4A 1NV8A 3OAAD 3Q0EA 4X1OA 3UHFA 3S0JA 3FOZA 4URYR 3N5CA 1ZOIA 3DE1X 1Z5PA 1XCOA 3VZDA 1CFJA 1JT9A 1T0BA 1AMUA 1JYEA 4R71A 1K7CA 1XALA 4HDOB 4B35A 2VF7A 3O2NA 5DYNA 3QVOA 4FMPA 3DC2A 4MVJM 3IPAA 4DV0B 1XAGA 4IG9A 4LW8A 1EXVA 3TQQA 3QA3E 4HAVA 2OHHA 5IKEA 1TOAA 4TYWA 4HUQB 3G2OA 3GZNB 3A3OA 3LGSA 4LNHA 5G1NA 1T9ZA 4HUJA 4BZPA 4OX9B 4JLSA 4RK4A 4P3KA 1IEWA 1TUEA 4ZAGA 3PS9A 4RHXA 2QR2A 4L5IA 4ZIRA 4GM4A 1CPYA 4L0CA 1T3HA 1ZD2P 4ZV4A 1P2BA 2ZYGA 4J0HA 4DIUA 1NNUA 4JV5B 3U40A 1LI4A 1W48A 2FVYA 3WG9A 5BUQA 4GMXA 3MMNA 1IB0A 2CHQA 3CLRD 2VSOA 3ZTYA 3BL5A 1Z16A 3R0ZA 5FD8A 2JLUA 4P92A 4GLOA 2ODQA 1F14A 5FPKA 2BV3A 3R7FA 2X19A 4NPAA 3GVHA 1AHIA 2QS9A 3G8YA 1SELA 3NBFA 5F7JA 3NUZA 5KIAA 2B5WA 2QSUA 2VI5A 2ZB8A 3U37A 1RI2A 3O8CA 2ZRCA 1J25A 1TO6A 4AMUA 3ZH9B 2BI8A 1SUBA 3AYXB 1LLQA 4KWTA 4ZVMA 4TQUS 5JH7F 3HWX1 4LVOA 1NBMD 3CZMA 3T3EA 2Q4TA 2AW5A 3GFVA 2BKUA 3O6VA 1E3SA 4FDUA 4D0SA 4JB0A 1TQ4A 3D6HA 5ALSA 5BW6B 1UWKA 3MGGA 5GADl 1Z0JA 2JLCA 2DT8A 4LXIA 1KI3A 2BTQB 2RONA 3G0OA 4KGVA 4LHVA 4OJKA 3ZLVA 1NF3A 4ZCLA 5DNEA 3WYGA 1HOXA 4HNQA 1KI2A 5J5CA 3OLWA 5KTYA 1JAHA 1QIHA 4JSTA 4JWKA 5FBVB 4FTWA 1QC5B 3WSVA 3IE1A 3GVXA 3AL0C 2NN3C 3K72B 1GSOA 3K31A 4G9EA 3DJYA 3V7FA 5J63A 3KEGA 4EB6B 1A9RA 3FMIA 2QIOA 4NYMR 2C7QA 3S1AA 1UADA 3OSZA 5I7HA 3HVRA 2XOKA 2ZE7A 4XX0A 2BI4A 4WN9B 1I1OA 3E3AA 1BA2A 1NRWA 1QUEA 3EGWA 3EG9A 3VSEA 1JI3A 1R0LA 1NMQA 2HW8A 1ZJYA 1E96A 2BBTA 2YASA 3R75A 4UUNA 2XWQA 4DMCA 2SCUA 4IS2A 4F9FA 1JSRA 5FDFA 1JBEA 5KNBA 4MWGA 1EK2A 2KM1A 4G4JA 2FJ0A 2ZYIA 3FZGA 1SZCA 3TZKA 3FTQA 3NIFB 4D9MA 1IDOA 2O2JA 5KTTA 2OZLB 4FFMA 3WNBA 3GN2A 2Q5CA 4C4OA 4TLAA 2LCFA 4L4UA 4YP0A 4LXXA 4RW0A 1T0PA 4UDNA 4JJ6A 4RD1A 2EX0A 1RWVA 4L3OA 4QHTA 3GCDA 4N6OA 3WWDA 4CL8A 4B4VA 3K8ZA 2ODEA 3BERA 1QLJA 5DHFA 4ETNA 2P8JA 4EVIA 3A1UA 1LQTA 2QYSA 3R3WA 4OKSA 4GP7A 4R3WA 3LY5A 4TXNA 1E0JA 3SIWA 2CK3D 4WCFB 2PWAA 3HCPA 3LCCA 1JLSA 2NZXA 3L7MA 2QYTA 5B7QA 3KYIB 4GKVA 3DTVD 2YYZA 3PD7A 5C5EA 4OHWA 4EX7A 1Q74A 2W2QA 3AR7A 2NNLD 1Z4JA 4P4UA 4QLOA 4Z4EA 1OYVA 5C8YA 4B75A 2GXSA 3OFSA 3LA8A 1N2GA 4R3UC 2HM7A 3JQ6A 4XVHA 3B1XA 4KMMA 5EMNA 2E5LB 3SPXA 1QQ7A 1PFKA 3CURA 3GQVA 5HPYB 2IPNA 3G79A 3OSUA 2PSFA 1X7WB 4QDOA 4Y1GA 3H2SA 5ALDA 1AD2A 5A5DA 4CCYA 1C0KA 2R47A 2VHQA 3R9XB 2YWCA 3LC0A 1INLA 4R54A 4B8WA 1OXXK 1DG1G 4EPVA 1FU4A 2Q9UA 2BR4A 1WUIS 1T9GS 1UWVA 3JWJA 1V11B 2XZPA 4TRJA 4G4GA 3CVYA 1E0KA 1A5SB 2FN9A 2HMUA 1M6NA 2RIRA 3EBLA 2ILVA 1KNQA 2OOSA 3I61A 3ZU3A 1BMFA