2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
1KSGA 1U98A 1X1SA 1UDXA 3TR0A 2OAQ1 3EWAA 4PO9A 4R2IA 2C2HA 5AJVB 4ZPXA 4B3BA 4HLUA 2DY1A 1NBMA 1W0KA 2ORIA 4TYWA 3ZLJA 1VDZA 2OCBA 3PUWA 4XTCS 4NCIA 1X1RA 1UKYA 3QF7A 1BOFA 1FMJA 1BH2A 2CK3D 4MKHA 5AJXA 2O8BB 1JR3A 1P9WA 3ND8A 5KDDA 2ZUCA 4TWZA 3IO3A 4P4SB 3D7MA 3BERA 2OG2A 5LBIA 3MWYW 4PZLA 2OBLA 2BJWA 2IXFA 2ZI6A 3BOSA 1QG4A 4AYTA 1EX6A 4PAOA 3QEOA 5B2ZA 3D6TB 2JLWA 1G7RA 3JZAA 3DOEA 2PMKA 3K0EA 3MLEA 1DG3A 2A3RA 3QKUA 4KVGA 2VL7A 4NCNA 5JS8A 3DZDA 4KHZA 5AJYA 1Z06A 4C0KA 3BH0A 3VX4A 4C0BA 5D3MA 3LLMA 1KI7A 1VKJA 3PQCA 2G0NA 4DLZA 4MKIA 5G53C 1XU4A 3P20A 4TYYA 1OXSC 3KKPA 3OF5A 4TZ0A 1R10A 3NC1C 2W6JA 3A4LA 4D2IA 1OXVA 2XNDD 2DFNA 1W0JA 2FX3A 2ODEA 4TMXA 1L7VC 4V0NA 4A8JB 4EQ6A 5JJIA 2RAPA 1KZ7B 1ZNXA 1NKTA 4ZIRA 2IS6A 2V54A 3KJIA 5F9HA 3DHWC 5EP4A 5JJLA 4A82A 2ZI5A 1T0HB 3MCAA 4DT1A 4IDOA 4M1OA 1XPOA 4NYMR 1GRQA 2Q3MA 1XTQA 4NCKA 4JLMA 3ASZA 2ZS7A 3RRYA 4AWXA 2OAP1 3LV8A 1IN4A 1UKEA 3AUXA 1E2JA 3F8TA 4P32A 4DUGA 1E2NA 2ZRKA 4Z1MD 1GVNB 5HE9A 2G3YA 4F38A 1TX4B 3GJ4A 2GDJA 5JRZA 4W7SA 3THWB 2V7QA 2IEZA 4MITA 2Z5FA 3GLHE 4DLWA 1US8A 5FPYA 5FUVA 3HYTA 3B7GA 3OFNA 3NDBB 3CRMA 4HUQB 3B1XA 5LDDC 2QORA 3J81k 5IF9A 3FVQA 4TLEA 3UANA 1BMFA 1TF2A 3UG7A 5DN6D 2IYQA 2DB3A 4KITB 1DAKA 2J0UB 2YHSA 2IS1A 1ZU5A 4QBHA 2H17A 1U9IA 1EFRA 4X8MA 4XVUA 1OV4A 4YC7A 4HDOB 4DZZA 5LD2C 5E7JA 2ZJYA 1XXHE 2WWIA 4IOMA 4WA7A 1BO6A 4JBWA 1VECA 3SR0A 3CF6R 4KO8A 4DHEA 1JXMA 4JLBA 2O8CA 2WWXA 4LPSA 3OEEA 3OIYA 3KTAB 4ZDWA 4IVRA 4ZIRB 4FXPA 4NKRA 3R9XA 1ZCAA 2WMNB 1IJFA 1SHZA 3CX7A 1XXHA 5A4JA 2DFTA 1SKQA 4KFSA 3RRZA 1T4GA 1XTJA 4ZCMA 5HR5A 4CRWB 4D4JA 2XGJA 2V1UA 3TNFA 4BFWA 3ECCA 2NO1A 1XP8A 2NZ8A 2OZEA 2W2XA 2J7PA 4BLTA 2CJWB 2KI5A 4KVAA 1PLKA 2VPPA 3HU3A 3SS8A 4A2QA 2ZVPX 4LZZA 5DNYB 5FBQB 4TL7A 2P3SA 4DVGA 1IOZA 1A1VA 4LJ9A 3SBEA 1Z22A 1JJVA 3I5XA 3LBHA 3K9NA 4BGDA 5FOSA 3SJBA 3GP8A 3QVVA 2R44A 4Q18A 4OI1A 3IILA 4AKIA 2QT0A 2JLQA 3AKYA 2J0SA 2ERXA 2GXSA 3FFAA 1N5LA 5SZKB 3C41J 1AKEA 4B43A 4HZIA 4ACBA 1AM4D 5GVSA 1PUIA 2YOFA 1W36C 3IO5A 1G8GA 1X8LA 2R6CA 5JLJA 2ZSBA 4TLBA 1Q21A 1XMIA 2V8OA 4GSYA 1T5LA 3GFOA 4FWIB 2OXRA 1LTQA 2Z0MA 4D80A 2DFLA 1G1MA 1KO4A 4OI2A 2J46A 3LA6A 2ZIAA 3ONWA 4LY6A 2CCGA 1Q1EA 4MRVA 5L3RA 121PA 2GA8A 4D81A 2IF0A 3CW2A 1RVDA 3TSZA 5EE1A 1E2MA 2QQ0A 2IK8A 2WPDD 1E99A 2ZSFA 5JZVA 4B35A 2QENA 5KDOA 2YV5A 4F4IA 3D31A 4NCJA 1II8B 2A2ZA 3OZXA 1NN1A 4BFVA 3TJZA 1MOZA 4YDHB 4ABYA 2QTHA 4Z1MA 3TVTA 5J4VA 1S4QA 1Q1BA 2ZE6A 1NL3A 2QPAA 4A2WA 3VHLB 3MWJA 3D8BA 3QF4B 1R7RA 4TMTA 2O8EA 5DE3A 5L8VA 1Z0AA 4UNNA 2G6BA 5L3QB 1HYQA 2JEOA 3TQFA 2P5SA 4OQXA 2WZQA 1E98A 4GOJA 2IHBA 4HLCA 1LVGA 1P72A 2O8FB 4EPVA 1DO0A 1KIMA 1KGDA 2PZFA 1ANKA 1JXOA 3HU2A 4YMTA 4CEHB 2P6NA 4JIMA 3VU9B 4OI0A 3ZS8A 1NVVQ 5DHFA 3RC8A 2QGZA 3K53A 1VYVA 1SZPA 3QPVA 5K8IA 4Q1CA 3TW8B 5TARA 5J5CA 2CK3A 1U81A 2KWIA 1DS6A 4DDUA 4MRPA 2ECKA 2V55B 4OKSA 5H8WA 2IWHA 3F0TA 4KAXA 4FCTA 3U5ZB 1DBSA 3CPHA 1RE0A 5FOTA 4EJSC 4I81A 4LJ4A 3H0KA 2VLIA 3EIHA 2BWJA 3CR8A 1N0VC 3GEEA 3M6AA 5L3SA 5F98A 2HJGA 3JVVA 1WE2A 4O3MA 1VG0B 5FBWB 3BH7A 3QXXA 3NH9A 3IDQA 2GVDC 2BEJA 4R9UC 4MGZR 5JWHA 3HPQA 1P9RA 3A1WA 3LW8A 4AG6A 4HYYA 4DLYA 2AKYA 4OHYA 2C03A 5EE0A 2XB4A 5C18A 3GPLA 1KO5A 1IN6A 5KSZA 3NXSA 3BBPA 2IUTA 3GLHB 1XTRA 3UK6A 2XXAB 1QHNA 4FIDA 3GLIA 3PJRA 3WYFA 4XJXA 3MUFA 1RIFA 3AF4A 3K09C 2P6UA 3EIQA 1DAMA 3MMPA 4GI7A 3K0SA 3CX8A 3NHAA 2ZSEA 1GAJA 4B74A 1HURA 1W5TA 3UMRA 1NSTA 1QBKC 3U44B 1S8FA 1AGPA 4V0ME 1YZKA 3L0SA 2ZRHA 3IIKA 3ZQ6A 1GM5A 1ESMA 1OE0A 3BK7A 3KJEA 4G5GA 3RHFA 1N0UA 2F1RA 2O52A 4DUGD 4PHTA 4WZBE 1GL6A 3GJXC 1DG1G 1MRNA 1WBBA 4RD6A 1XXHB 4CEIA 2X2EA 2D2FA 4Q7LA 1U0LA 4XIGS 3K0CC 2WSSD 1IXZA 4MRSA 1DAHA 3T1VA 2AL7A 5JCZA 2ZXUA 1NBME 2EYUA 3E1SA 3KTAA 1E2QA 1XCGB 2IL1A 4MGKR 4RD3A 1EGAA 4PQFA 3RS5A 5EUMA 1NMXA 2OLJA 1OF1A 4ZCLA 3Q3JB 4JZKA 2VSOA 2UKDA 2OBMA 1I4DD 1QHYA 4JLKA 1TQ4A 2GZHA 5HZKA 2GCOA 4P33A 2A30A 3NC0C 4KSBA 2GXUA 3WRYC 5KSYA 2QMHA 2QROA 3EZ6A 2HEIA 5F2EA 4G0NA 2FFBA 2VP2A 2BM1A 1EWRA 4D82A 4POAA 4PC3A 2YOHA 1JR3D 1SXJC 4TSFD 4Y0VA 3KXLA 4N0DA 4OK3A 1BS1A 2WIBA 4C0AC 4M9ZA 5F9FA 2FMXA 2J59A 3RS3A 5CK4A 3ZVRA 3KB2A 4ESVA 4HZUA 4YMWA 2BIFA 1M74A 3AKEA 4PHHA 1UF9A 1US8B 1AA3A 2C96A 3WNBA 5FI0B 1ETUA 4BLPA 1E2FA 4R71A 4QHYA 4FCVA 3NH6A 1M6NA 4B47A 3GJ3A 3SJCA 2ZJBA 2AKAB 4FWTA 3THXB 3C7KA 2ZU6A 3CZPA 3EASA 4MYUA 1XD2A 4E03A 1H8ED 2Q9CA 4JLVA 4TLDA 5E7MA 1ZM2A 3U7GA 4LBVA 4L5BA 4C9BA 3PV0A 3FOZA 2VO1A 1G4AE 2EYQA 3NG1A 1FX0A 4E5UA 2ORVA 2W6JD 4HLUC 4OK6A 4RVCA 8OHMA 4XH9B 4BEJA 4M1YA 1KTVA 4ZDJA 1M8PA 2ANBA 3TGPA 2GEDA 3Q5EA 1AJEA 1Q3TA 2PX0A 4OHZA 1IM2A 2QT1A 1P2VA 3B9PA 4O0MA 5CJ2A 3VR2A 4RD2A 2VEDA 4FN5A 2KB0A 3EZ7A 1OIWA 2R62A 4F93B 2UZIR 4D4KA 4KFTA 1YZUA 2WJVA 4DDTA 4JLOA 4R98A 1A4RA 1VMAA 5D3MB 2GCPA 1SXJB 3PR1A 4P4TA 2IX3A 2EFDB 4B6FA 2HYDA 5TDHA 2NO9A 4HB4A 4X8OA 5FUYA 3QPUA 3AVYA 5SZHB 5EXTA 4XWKA 2ZRBA 2RMKA 1U90A 2QL6A 3ZD7A 4GFDA 4N3NA 4TTPA 4B44A 1SXJD 5J4HA 1KDPA 1VIYA 3OE7D 4YXWD 1CF4A 4DC9A 4Z54A 5SZIA 4M9XA 1KOFA 1N6NA 2J45A 4DKXA 5CK5A 5J4YA 1IBRA 2ATXA 2WJIA 1WDTA 3NBXX 2GESA 2ZJ5A 1CIPA 1XD2B 2SHKA 3EAQA 1FTSA 1FL9A 2FG5A 4NYJR 2RGNA 3IPXA 5DHAA 1IY2A 2FJUA 3CBQA 2F55A 2X77A 3CO5A 4DIEA 3SYLA 1N0WA 3VR4A 4PO1A 2Y8EA 3REGA 1XMVA 4URVR 1TL7C 4PPGA 2VTKA 2EVWX 4Q9KA 5HCNA 5KPJA 1WP9A 4QM6A 3JVUA 2JLSA 2AWNA 1Z63A 2BMJA 3Q8XB 1COWA 5J40A 2G9NA 2QE7A 3AP3A 4GOXA 5DO9A 5JEDA 2CE7A 3JZMA 2CDNA 5ELXA 2HXSA 4HLDA 1KDOA 3DM5A 1QF9A 2EFCB 1OSNA 2WIAA 3SU8A 2WSSA 3M0EA 2J87A 4AURA 1A2BA 2H18A 3C15C 4B75A 3EZ9A 5CITA 2GRJA 1VG8A 4DSNA 2ZRCA 2WWGA 2ZRDA 2R9VA 4L9WA 2W0MA 2C8VA 5IT5A 1E0KA 2DWOA 5IHPA 1QZXA 1YR6A 3QKRA 4URWR 3RS7A 3OHMA 2BJVA 2AD5A 1RRPA 4M4SA 2IWRA 3S1AA 1IQPA 1OPXA 3FMIA 4IDHA 2XITA 2V1XA 1E0SA 3KJGA 4AYWA 3E5HA 1KDTA 4W9MC 3QBVA 4NYJQ 1H8HD 2QPOA 1P9NA 1YKSA 5TVKA 1E2PA 1J99A 2ZRNA 4NYIR 1KY3A 1GG2A 1GKUB 2IYZA 2ONKA 2O0HA 3AF0A 4A0HA 1NNEA 2Q3FA 4B6EA 1NN5A 3EZFA 1YHNA 4BWYA 4QNMA 4TSFA 4E07A 3FMPB 1DEKA 5HPYB 3CPJB 1XCPA 1AK2A 3NBFA 3GLGB 3H84A 1MR3F 2VH5R 5CM8B 4RFVA 2ZRFA 1JI0A 1L4YA 1R4AA 4D26A 2BBWA 2PLRA 2QRNA 4L9SA 4B2PA 4PHFA 3GEIA 1O87A 5A0FA 2OT3B 3NHBA 5AK0A 1OH5A 4IKEA 1YR8A 2B92A 2D7CA 1GTVA 1NIJA 1HQYE 2ZQ5A 4PXAA 2XSZA 5H70A 2WJGA 4BLSA 3ADBA 2XX3A 2D4HA 4LHZA 1YZLA 3O8CA 1D2EA 5FR2A 2RGEA 2GWHA 2IC5A 4NYIQ 5KSPA 1R2QA 2IYXA 2V4ZA 3IPYA 2FPKA 2ZM5A 5BN4A 2JLYA 3PEYA 1JPJA 1FFHA 1GITA 1Z47A 1GL9B 1G8PA 2F1JA 2CCJA 1KK1A 2GAOA 3RLFA 2QN6A 4M1WA 1MKYA 1AS2A 2WICA 2PEYA 5E7IA 4EAQA 3UPUA 1CEEA 1E9RA 1KI1A 1OT3A 4US1R 3AVWA 4TQ9A 1T0JB 4BPBA 1CJMA 1O3YA 1U9IC 2IHYA 5JCPA 2C5LA 3ZJYA 3GEHA 3PUVA 4YMVA 2ZRGA 3IUYA 3EX7C 2YZ2A 1A82A 1HEIA 1WBDA 4HSEA 3B1ZA 1NG1A 3B78A 1FPMA 3R7WB 4LRWA 1CJTC 5FUWA 1R8SA 3TUJC 3VR3A 2A7QA 2MSDB 4PZYA 2JDIA 1R0YA 1ZAKA 3DOFA 1QVAA 4M9QA 3T34A 1SVKA 1AQUA 1L4UA 4JMPA 4YDSA 1F2TA 2VQSA 1V5WA 4I1UA 3FGNA 1P62B 2KBFA 3B9QA 4Q7KA 3AVOA 3U2QA 3QKSA 3M1IA 1P2TA 1R0ZA 3FB4A 4FMCF 4BFYA 2AWOA 1W4RA 4D4MA 3B60A 2FN4A 4F4CA 2K5UA 1OYYA 1T3SA 3KKMA 1SXJE 3A6PC 1ZYUA 5FTJA 2JA1A 2ZYTX 5BN3A 4F92B 2IYRA 3LDAA 2PLFA 1IAQA 1NF3A 1ZUIA 2ZAMA 3HR7A 4ASUD 3U4QB 4IDQA 1KO8A 2XZLA 2OE2A 3L0PA 3IIJA 4PSKA 1ZNWA 3A1UA 4OJQA 2GXQA 5GADl 4Q66C 2A5FA 5HKKD 5G41A 3SOPA 3WHLA 3OIUA 1FOEB 1ODFA 4TL6A 5FPSA 4LJ5A 4KV9A 2CLDX 2FE4A 4LJ6A 3AB3A 4BLRA 4P4UA 1ZD1A 1QHIA 1SGWA 3OE7A 2Z4RA 4OL0A 2CLCX 2C98A 3FE2A 4FW9A 1W4AA 2VHJA 3WRXC 1SVWA 1SVLA 2IS4A 3VNVA 3AGQA 3CF0A 4TT3A 4BZPA 2Q3HA 2FFHA 2VYFA 4MGYR 221PA 2ZROA 1NI3A 3Q72A 4H1VA 4ON9A 4LC0A 4QC2A 1G18A 5KDLA 2UVQA 2GHIA 3WP0A 4B76A 2ODNA 1TUIA 2R6FA 1XFAA 3DO6A 5FFMA 3EPJA 2CNWA 1F2UB 2CJWA 3ADDA 5L3QA 1PVOA 4Q1AA 4B3FX 1KDRA 3FDIA 4DCSA 5C4GB 3CNLA 1MO6A 3IIMA 3U60B 4LJAA 1VCMA 1XZPA 4Q7JB 5FBLB 3U3OA 4L4UA 4Q4LA 1LW7A 1U94A 1SVIA 3LW7A 1GFIA 3T1TA 1CRQA 1E1QA 1G64A 2ZYUX 4HAWA 5TV2A 3ICQB 3I92A 4D6PA 1KK3A 1DELA 3EXAA 1J90A 4FMDB 1GRNA 3PIRA 5AJZA 1Z0JA 4CGZA 2DR3A 4AG5A 1G6OA 3K8YA 3L82B 1YZGA 2WOJA 4LYHA 3CWZA 3WNCA 3EPLA 1ZINA 1Z0DA 3W90A 3NWJA 1XD9A 3ZYCA 1TF5A 1IN8A 1DO2A 1M34E 5ANRB 1OXTA 2OUKA 3W6NA 3QJYA 4NH0A 4Q47A 4IDPA 2EQBA 1NMZA 2NPIA 2F9MA 4JVNA 1CLUA 3B82A 1N2CE 2IEYA 2Z83A 5CIWA 4II7A 4HB2A 5IRCD 4JKYA 1LS6A 1ZD9A 3LAWA 4MYTA 2ZETA 4EFNA 4IXNA 5E95A 1MO3A 2WV9A 4QGAA 3B13B 4KCGA 1ZIPA 4G5RA 5E4FA 3PFIA 4EPWA 5EP2A 2MMCA 1DPFA 3ADKA 3LBNA 3LWNA 3KL4A 5CJPA 4HUQA 3U4QA 1TAGA 2ODBA 2ZJOA 3SDZA 3V00A 3QBTA 2ZRLA 3QENA 2QU8A 5AJWA 1U99A 2JIZA 3B1VA 1N25A 2F3TA 2PZEA 2VA8A 1K8RA 2AD1A 3K9GA 1X86B 3BORA 4U02A 4OYHA 1OKKD 3QKSB 5FL7A 2N42A 4A6PA 4Z8XA 5DYIA 2ZI7A 1RRGA 4QNRA 2FNAA 1E9BA 5KNCA 4HAUA 2CL7X 5H68A 1TTTA 3RDPA 2GTPA 3UATA 1G7CA 1AS3A 2Z6VA 3CUEF 1S1CA 2W6IA 3C14C 3FMOB 2BMFA 1NN3A 4DJTA 3L8ZA 3R7WA 3CRQA 3KJHA 4D25A 3QXSA 2WOOA 3KUDA 4B71A 3BFKA 3SHFA 3KB1A 2HJVA 2BOVA 4HUTA 3K0CA 5B58C 1G4UR 4NHOA 2G1KA 5FPHA 4NONA 2AXNA 3TK1A 2WSMA 1W7AA 1G9XA 2VHQA 3BE4A 3LX5A 4ASUA 5LPNA 2B8WA 4V02A 5EXXA 3V4FA 2BC9A 1P60A 4KXFB 3S1AB 3V4RA 2FSIA 3AF2A 5DI3B 1BYUA 2AXPA 2HLDA 1LB1B 3CRW1 4XD7A 4Q4AB 1ZW6A 3WYGA 1SVSA 2XEXA 4JJZA 4GNKA 1FNNA 1YZTA 3TSWA 4JSYA 2JAQA 3QOFA 2FOLA 1G8FA 2H8KA 3Q85A 4F4JA 3K09A 4GZLA 4ZKDA 4RJLA 2R8RA 3DM9B 2GZDA 2QGNA 2B6HA 1EG7A 3ZVNA 2XOKA 3PCRB 5CYPA 4NCHA 1J2JA 2YJTD 4BLQA 3VNUA 1XD8A 2ZRJA 1VHTA 2CE2X 3I3SR 4HI0E 1N6PA 1VIAA 1XRJA 1XEFA 2FDCA 3THWA 1CU1A 5FOUA 3AQ4A 2HYIC 3LVQE 4TMVA 5GVRA 1TMKA 3TKLA 4QKQA 5AR1A 2BCJQ 1LF0A 5AUOB 4C2UA 2H57A 2KBEA 5EP3A 2VF7A 1LY1A 4QBFA 5FTMA 2RHMA 4LHYA 5CLQA 1K6MA 5AWFC 2GJSA 4NPHA 1D8TA 5D3QA 4M1KA 5KHOC 4GZMA 4V0KA 4M53A 2J1LA 1EFRD 1XDBA 3GMTA 3E2IA 3K1JA 4RCZA 1E9SA 4PPQA 1Z2AA 1KK0A 2BEKA 3RS0A 3GLIE 4LSGA 4GOKA 4EQ6B 2PEZA 2FPMA 1OJLA 1XTSA 2O8DB 4KI0A 5KO2A 3RAPR 4AIIA 4Q9HA 2CVHA 4NL4H 1OH8A 3ETLA 3H86A 3TBKA 2LKCA 1KI2A 2X8AA 3L2OB 1TUEA 2QSZA 1XNJA 1ZCBA 4ZI3A 3ASYA 3WP1B 1P5ZB 2J0QA 1C4OA 1AN0A 1ZUHA 5JI3E 3H1TA 4MDEA 2BHRA 2FSHA 4K8OA 2PH1A 1DAEA 2IBMA 821PA 3DZ8A 3VX3A 2JLRA 4RCYA 3AVVA 4M22A 1KI8A 4N0EA 2C77A 2QBYA 1P3JA 1SQ5A 4EUNA 3LD9A 2H7VA 1J7KA 2X1VA 4WW0A 2R6AA 2IYYA 5DSZA 1C1YA 2NTYC 1JR6A 3AH8A 3PEVA 2CL6X 3SE0A 4M0LA 3BRWD 2O8BA 4ACAA 1CP2A 4PZZA 2XTNA 3P4XA 4PQYA 1MO4A 2VF8A 3MD0A 4NMMA 1XJCA 5BXQC 4TL9A 1T9HA 3SI7A 1OW3B 1YRAA 1W49A 2KSQA 1IY0A 1KO1A 2FGKA 1AZTA 5C4MA 4GMDA 4LJYA 3CRVA 1XTIA 2C95A 1WA5A 4IRUB 4QHSA 1OYWA 3G5UA 1JAHA 2OESA 2B8TA 3IQWA 1Q57A 2ZITA 4HDCA 4JBYA 1B23P 4BRUA 2ANCA 5KSOA 4GRAA 1JEEA 4ITRC 4M1SA 5DGXA 1AGRA 3BAFA 4TN1A 5KYKA 4DSUA 1P61B 1J8MF 1E4YA 1HA3A 2IYLD 1T8TA 3HPRA 4C4PA 4P3YA 1NIPA 1W2HA 1GNQA 1Z2CA 1Z6YA 2BV3A 3NDPA 4JKIA 4X8LA 3T06B 1JEDA 2QM7A 4DLVA 4V0MA 3KQUA 3G82C 4EJSB 2NIPA 4LOAA 5K8TA 1V43A 4G3XA 2JLVA 2WKPA 3I1FA 1P2UA 4GT1A 3MGCA 5DI3A 3CB4A 3AVTA 1SXJA 3GQBA 4IOLA 4UXHA 3MSXA 5EZ5A 1CR1A 2IYSA 4YXWA 3UXMA 3IQXA 4JLJA 3U6BA 2P2LA 1N6LA 4AC9A 2ZVQX 3U7HB 3O8BA 1KSHA 1AIPA 3E70C 4JT4A 4UNSA 4PC7A 4HEJA 4HDQB 3TMKA 1OIXA 1NJFA 2IYWA 3T61A 5BYJA 1OKKA 5FL7D 1G8HA 2H1LA 1I4LD 4DEYA 5CB8A 2HV8A 4JVSB 3TAHA 1WRBA 4PHGA 3DVLA 3H2YA 3SEAA 4YMUA 3P1JA 4JSTA 4WVFA 3KQLA 4TMWA 1QRAA 4QGFA 3X2SA 1E2HA 1RYHA 3IGFA 3AUYA 4TYNA 2EFEB 2ASEA 3THXA 1EK0A 4JVMA 5EE9A 1NLFA 3R8CA 2XZPA 2ZR7A 3KFXA 2DYKA 4MGIR 1GUAA 1F6BA 3W8NA 3AVPA 1F5NA 3LX8A 4LWZA 1KK2A 4A8JC 1NVWQ 2WWHA 2RCNA 1IY1A 2XJ4A 3LVRE 1LFDB 2IS2A 1QHHA 3I4LA 4NYMQ 2DPXA 4CDGA 4Q1FA 1YR9A 2ZI3A 2FF7A 2J7KA 2WBLC 1KYIA 3GJ5A 1EFHA 3DEFA 3BD9A 1COWD 1KJYA 2CXXA 1OHHA 2REXB 4EFMA 1U8YA 2HLDD 1I4TD 2RGCA 2QI9C 2RGBA 4JYBA 2R65A 621PA 2VP9A 2GVZC 3SQXA 4Q4AA 3CKLA 3EPKA 1TEVA 4ERNA 3VR1A 2ZRMA 2FEMA 1ZVQA 4KLNA 2A5DA 4TT3D 1G41A 4LX0A 4RFSA 3WMFA 1NKSA 1P2SA 3EWSA 3KFVA 2W2VA 3MWKA 4JL5A 4RKFA 2BBTA 4MYCA 4JYCA 5DI9A 2FFAA 2EWVA 1HQCA 1E69A 1QHXA 2Q21A 3HU1A 4M21A 5GJWC 2IUSA 3TW4A 3VTKA 2YYZA 1HUQA 4LYFA 4G5OA 1YVDA 1A5TA 2AX4A 2J9RA 4QGGA 3VQTA 4WXRA 2PZGA 2OCPA 2IYVA 4QXAA 3CH5A 3FTQA 3N2EA 4PC2A 4X8HA 1P73A 4ZO4A 4ZCIA 4KSCA 2OFOA 5KPDA 3TVDA 4NBSA 1UBEA 3P4YA 1LS1A 2WAXA 3RVBA 4B3CA 4DSTA 4J0QA 1P75A 1F2UA 3OEHD 3RRNA 1XEXA 2XTZA 1UBGA 3U44A 1CTQA 2C9YA 2VSFA 4O25A 4F91B 3BXZA 5EQTA 2BCGY 1CR2A 1UFQA 1M7HA 3Q5DA 5L3VA 2XXAA 1G17A 4G5QA 3GLHA 3AVQA 3CX6A 4ZKEA 3KX2A 2P6RA 2GBLA 2B7BA 1NRJB 4BE7B 1II8A 5JFGA 2GXAA 2W0SA 1YRBA 4QHTA 1XTKA 5FH9A 3CONA 2ZS9A 4Q19A 2YNMA 3ZH9B 4JJKA 4M2LA 4A0FA 3C16C 2FH5B 4S2EA 2H16A 4Q4JA 2A9KA 2O5VA 1XJ0A 4Q4JB 2HT1A 2ZRPA 1YE8A 2OV2A 4LHVA 4DLXA 3C8UA 5BW8A 4I1VA 1N5JA 3GFPA 1GKIA 1E9DA 1ZBDA 3L43A 1X6VA 2PBRA 1Z0FA 1EESA 3UWKA 2ATVA 2GF9A 1NMYA 3L0IB 1ZC4A 4FMBB 2OFWA 3OIVA 3I8SA 1W36B 5DYGA 3LXXA 4KLZA 4C30A 4LV5B 1UJ2A 4KBFA 2DBYA 1KMHB 1LV7A 1MT0A 4JLAA 1XPRA 2RH5A 1GKYA 3SJAA 2JJ1D 2ZI4A 4A2PA 1YZQA 3R20A 3WNDA 5P21A 4LYAA 4YMSA 4OBEA 1F2TB 4B3XA 3SFVA 4BZQA 4PSAA 4XD7D 1YU9A 2UZ3A 3KKQA 2I4IA 3BFXA 3MRSA 3WXMA 3OEED 5JECA 2ZJ2A 2ZYWX 4DLTA 1VHLA 1UEJA 4MYHA 1QHGA 1HY3A 2YVUA 2NPFA 1JBKA 4KBGA 3DMNA 2QMEA 4I99A 4OQFA 1Q20A 4US2R 3LY5A 2D62A 4IEIA 2GKSA 4A0RA 3W5JA 3GLFE 5FI1B 3A8TA 2XOKD 4BEBA 2OBNA 2VRWA 4V03A 4R7ZA 4AYXA 1M1YE 4O2LA 1KMQA 1KZGB 2EFHB 3SQWA 1B0UA 1BKDR 3QXJA 1T3LA 1ZRHA 2Z4SA 2WWYA 3W34A 1RJ9A 1DTSA 2W58A 1KSFX 2FFQA 5FOWA 4BUJA 1E2KA 1D9ZA 2H92A 2WJJA 3B1WA 4I1SA 4OK5A 2V7QD 5BWMA 1CRPA 2HCBA 2OEPA 4DRZA 4L16A 2J0UA 1GL7A 1II0A 4C0JA 1DADA 1YZNA 4C7OA 1JPNA 5FBRB 1VTKA 1RW4A 3B1YA 4XVQA 3KDSE 2A5GA 3QXCA 1R0WA 5JHHB 3FHTA 4LPKA 3VKHA 4W5WA 1E4VA 3KQHA 3BWDD 3KUCA 2YOGA 1U8AA 3QG5A 1OH6A 2ZR9A 1Q3HA 4IFBA 5G40A 2GAAA 5GJVC 3Q7PA 3ZS9A 1U0JA 1Z83A 4Q9IA 4PANA 5AUQA 1M7BA 4BQSA 2FEOA 5JMTA 1WMSA 2VSXA 1IXRC 1OFIA 3THYA 1E96A 4D0LB 1E0JA 2VIIA 5JS7A 4HAXA 2R6DA 2QY9A 1Z5ZA 2VBCA 2WPDA 3RABA 3RS2A 3UIEA 5DN6A 4B34A 1RC8A 3I32A 3DMDA 3NVAA 4XTRA 4DT1B 1S3SA 1JR3E 2I1QA 2GILA 3M4YA 4IJMA 1OHHD 2R6GA 3O47A 2WWFA 521PA 1GP2A 1NVUQ 4EPYA 1EFCA 2ZRAA 3WYAA 2WVJA 1CJUC 1P4SA 3A1VA 2ZE8A 4UQOA 2ONJA 1TPZA 3CLVA 3TUZC 2O8CB 2MSEB 4CEJB 1XB2A 3DL0A 3FWYA 2QTVB 1XWIA 5AUNB 3QUSA 4KJZA 1PUJA 1AQYA 4WAUA 1Z08A 2NO6A 1SULA 5B64A 1G3QA 4IFEA 3MWLA 4QL3A 5EE5B 3QKRB 2ORWA 1ZM7A 4HAVA 4RKEA 3RSLA 2J41A 4URYR 4LV6A 3SYNA 3AV0B 1UDWA 2ZRIA 2J5XA 3HYRA 3QY0A 4RZ2A 3AP1A 1E1RD 2QA5A 3KQNA 1VYTA 2CMKA 2ZEJA 4DCVA 3EA0A 4MA4A 4P4SA 2CBZA 4HLQB 1R0XA 1XZQA 3WHKA 3DPUA 3X1WA 2IW3A 2HT6A 3ZD6A 2Q6TA 4ZV4A 1C9KA 2ZR0A 4KYUA 4BLOA 4LV8B 4OQLA 4C7OB 1T5IA 1YQTA 2GF0A 1OH7A 2CL0X 3K0FA 5G3YA 4BRWA 3WMGA 1DAFA 2WKQA 3IBYA 2QTFA 3EC2A 4URZR 2NGRA 2Q9AA 3B6EA 1RJ9B 5J4KA 1CR0A 4OJKA 3QNUA 3QE0A 3WBJA 4OHWA 1W48A 5B30A 1VG1A 1H8EA 2XNSA 3FHOA 1G8YA 5A5GA 1D6JA 2X2FA 5KNDA 1KHTA 4UKDA 4V0LA 2JJ8A 1TF7A 2QM8A 4HAYA 4IEEA 4K81B 4MQBA 3TUIC 3NEJA 5BQ5A 1UEIA 1XEWY 2BMEA 1QG2A 1W46A 2P0EA 4B3DA 2QRZA 1RRCA 3FKSD 1A2KC 3TE6A 2QBYB 3QKTA 2QAGB 3GJ0A 4E22A 2DCUA 2RGNC 1CS4C 2E87A 2XNDA 3X1DA 2FA9A 4A6XA 4LUCA 3CF2A 2JJ2D 2P65A 4PTLA 1JQLB 3EA5A 5FOVA 2KE5A 3QSYA 4ESHA 5JI2E 3FFBA 4KU4A 1TNDA 3NEYA 2MMGA 1JAIA 1MRSA 3A1SA 4B48A 4Z51A 5FTLA 5TMPA 3I8XA 3GFTA 4U00A 1N3BA 3A36A 1NVVR 1KMHA 4EDHA 4PC6A 1SVOA 4JS0A 4IVQA 3K70B 4FMCB 1IONA 2XB2A 3W5IA 1OFHA 2NQ2C 4E09A 2J0VA 4C2TA 2PCJA 1FX0B 1G3MA 2REOA 3CIOA 4NU0A 5M04A 2ZPTX 4BZXA 4EPTA 2G83A 3K0AB 2GZAA 3GLFB 2JATA 4TL8A 1UKZA 5H1YA 4A4DA 3EPHA 1E2EA 2F1HA 4I4LA 1OFUX 4MDFA 4H1UA 5CM9C 2TMKA 2JLZA 1E9AA 2ZE5A 2ZJZA 5BN5A 2NO0A 4DB4A 4GBMA 2C9OA 3UG6A 1N6KA 1BMFD 5FPTA 4MKFA 4O2RA 3RRMA 4XOIA 5EP1A 4JBXA 4K46A 5JWRA 1G5PA 1W47A 3C5HA 4B33A 1ZUNB 4HZUB 3CM0A 3QG1A 3W6PA 1FUUA 3SFZA 2OCAA 3HDTA 4IHQA 4QJ4A 2OO7A 1Z8FA 2AHOA 3FYHA 4JL8A 3B5JA 1S3GA 2VHUA 3QVUA 3TRFA 5JSZB 3C4JA 2FPLA 2DHRA 4LBYA 3VAAA 2IXEA 3REFA 4NTZA 5J47A 2PL3A 3EIEA 4DLRA 3HP1A 3VKGA 1XEXB 3QIAA 4QOSA 4ZI2A 1RFLA 3P32A 4P0TA 2CEAA 1E79D 2HXYA 4M1TA 3SZRA 2ZE7A 4HAZA 2QP9X 1IJEA 5JBQA 4GP7A 3WBKA 1UAAA 2YWHA 5J4LA 3ZZTA 2OCYC 4Q00A 1FQKA 4NE2A 1Q0UA 4TQAA 1J70A 4I1OA 1H8HA 4XVRA 3ZZUA 3ZVMA 3CPEA 3OEHA 1U8ZA 1SVMA 1DARA 4Q9JA 1CR4A 4NDZA 5HTKA 5EJEA 4UNQA 1E9CA 1KKMA 1L8QA 5TXGA 1N6IA 2OILA 2V3CC 4JT2A 4Q4HA 3SBDA 2IYUA 3IEUA 4QBGB 4M8NE 2YC4C 4ZDKA 1VPLA 3TH5A 3UKDA 3K9LA 1N6OA 3T1OA 5C2JB 4PQRA 2C99A 3PENA 1TEXA 2PCLA 3PG5A 4B73A 2J3EA 3PITA 4G1UC 3SJZA 3PUZA 1S9HA 3O8RA 2C9CA 3BS4A 1QHHB 2EWWA 3F5FA 2JIZD 3BGWA 2JJ2A 4AKHA 1G3RA 1E3MA 2QE7D 1KAGA 4CW7A 3RS4A 2VP5A 4D0NA 4XSGA 5GJCA 4TMKA 4RZ3A 3THOA 3A58B 3BJIC 1BYIA 3FKSA 2OXCA 5CDFA 4WBSA 2GCOB 1NSFA 1Q1QA 2BVNA 1FP6A 4OQMA 1JJ7A 1GIAA 2QMOA 1K5DA 3T35A 1ONBA 3K0AA 1KI6A 3AP2A 4YLGA 1JB1A 5KOYA 3AM1A 1FMLA 4A92A 2DWQA 2RKOA 2CLSA 3PEUA 3MJRA 1E2IA 1SHKA 3Q9LA 1M2OB 1UBFA 2ZS8A 4LBZA 1ZM4A 3B2EA 4U7DA 1JALA 3QQ5A 4PSVA 3RNLA 3KXKA 4CEIB 4CEHA 2PMDA 1JQJC 2YWGA 3OESA 1OB5A 3IHWA 1GZSA 1ZNZA 3NKVA 2HF9A 2LKDA 4Q9LA 1G5RA 2GJAA 2W6ID 3IKJA 1TQ2A 1F60A 4B2IA 4JLDA 4CZ2A 2IUUA 4DBLC 1W2GA 1T6NA 5KTYA 3RWOA 2O0KA 3U3RA 4C0QC 2F43A 1Z0KA 4PC1A 3TR5A 1GSIA 1QVRA 3X1ZA 3P27A 1FW6A 2DFKB 4KODA 5G3ZA 3ZIAD 1E2GA 1ESNA 4LJ7A 4FMDF 2QAGA 4GMXA 4LDJA 4CT4B 2GK6A 3SN6A 2WTUA 1HE1C 2W83A 1CULC 4IVPA 4URUR 4A15A 1S9DA 421PA 1G291 2ZUBA 2HDNB 1S96A 5JHGB 1FTNA 1R6BX 5HKKA 2NZJA 4IDNA 1JECA 1DAIA 2CHQA 1U0HC 3U3KA 2QEQA 1LNZA 2VHCA 3DDCA 3GJ8A 5SZJA 1Z3IX 3RC3A 2IXGA 1LF5A 2JJ1A 2L0XA 5BYKA 2CCKA 4BFXA 1H65A 1EXMA 1RZ3A 3TAUA 2CHVA 4WXPA 2OFXA 5K8LA 5L3SB 3G0HA 3N2IA 1AZSC 1HT1E 4RZXA 1U2RA 1E9EA 5JWOA 3K0FB 5EUQB 4A36A 2JASA 1EX7A 1NJGA 2FZLA 3U6KA 3PUXA 4TLCA 3SYKA 3GLFA 2Q0HA 1UPTA 4UXIA 4D0GA 1HT2E 5CDFE 3W8RA 4RD4A 4B3GA 5EXPA 2GJKA 2D3WA 4AKEA 4UXJA 1CKEA 2FZ4A 4A0GA 1NP6A 3L8YA 3LNCA 4TTRA 4Q01A 2HUPA 3B8HA 5FPKA 3GLGE 1KNQA 2ERYA 3BIFA 1RYFA 3VFDA 3R9WA 1NLYA 2B7CA 4WIAA 2NO7A 2P67A 2ZANA 2O8FA 6Q21A 1AS0A 2XJ9A 4QJ3A 1EWQA 5B57C 1YR7A 1OFTA 1KO7A 2FGJA 4JVLA 2ZI9A 1GILA 1R5NA 1RRFA 1Q12A 1G3IA 3ND9A 2WWWA 3T15A 3A4MA 2YWFA 3NTUA 5KUTA 5DLQC 2O0JA 2RGAA 3QF4A 5E3HA 4CEJA 4C0HA 3HJNA 1PZNA 3BB3A 4DXAA 4C0SA 1M7GA 1TADA 1W44A 4QG7A 4OQNA 4PPFA 2O8DA 3CNOA 1ZIOA 3I73A 1XCMA 1XF9A 3RANA 3WMEA 1ZM3A 1Z6AA 4Q21A 4DDWA 2JDID 3I61A 3U61B 5HE8A 2OHFA 2QMUA 4LJ8A 2E1RA 1GDDA 4DLUA 2FWRA 1MH1A 5EXSA 3N70A 3QEJA 3ZGXA 1XMSA 2IF2A 1D2NA 1FZQA 4RD1A 2G77B 3MG9A 1UKVY 1KI9A 5FL3A 3TQCA 1HTWA 1W1WA 1R5BA 3BB1A 4N1AA 4QBIA 1ZM9A 1PLJA 4FCWA 3ZZ0A 5KU1A 5EZ6B 1E9FA 3N5CA 1D5CA 1FQJA 4FINA 1S2MA 1S0UA 3AGPA 4QJ5A 4EKDA 2BBSA 2F3RA 2E9SA 2AR7A 3C5CA 1ELOA 5FR1A 1Q22A 1F3OA 3T5GA 1N5IA 1AA9A 4A9AA 4RZUA 4DCTA 2QAGC 4EFLA 2ZSDA 1OLOA 2RHDA 4EIWA 1ZNYA 3A4NA 4TMZA 4A1FA 1SKYB 1IHUA 2IYTA 4IOJA 2YWEA 3VR6A 1N6RA 3EC1A 3LLUA 1QHSA 3RSOA 4WZ6A 3W3ZB 3ZVLA 2NMVA 3I5YA 2V9PA 4ARZA 3PVSA 4XWOA 4Q1EA 2QSYA 4QGHA 4RD0A 4CT5A 2XZOA 4WOPA 1E6CA 3LO5A 2PX3A 4LBWA 5CLLA 1G6HA 1E0AA 4NP6A 1G5TA 2GJ8A 2XTMA 3AKCA 2D74A 3SHWA 1K5GA 2CVFA 3AF3A 3MFYA 3LQQA 4HB0A 4RY2A 3GLGA 1G21E 1AKYA 3AVXA 2ZJAA 4BFTA 1G19A 2BKEA 4KFUA 2NG1A 4PFSA 3U7FB 1J8YF 3LRPA 3LXRA 3OFND 4A8JA 4AK9A 3A1TA 4MUBA 1W5SA 4DDVA 4MUAA 1VCNA 1E1QD 4R2HA 1Z6GA 4Z8YA 2AK3A 1XEWX 3QPWA 1VYUA 1WB9A 2WHXA 2ZSAA 4OHXA 2F6RA 4P31A 1EFTA 3PEWA 4OI4A 2FSFA 721PA 4UJ3A 4GP6A 2G1JA 4OHVA 4B32A 4HB3A 1QDEA 1KI4A 1TU4A 3FHCB 3LBIA 1NY5A 3THYB 1OIVA 3KKOA 4MKGA 2WJYA 3RWMB 1P7CA 3X1XA 2ZTSA 3BH6A 3IHLA 2G88A 4TYPA 1W4CA 5TB5A 1HE8B 2D2EA 4ARZB 4UJ5A 3ICEA 3EARA 2N46A 4Q1BA 1DE0A 2FU5C 1NLZA 1G20E 4D4LA 1G16A 4DLSA 1YJ5A 5IK2D 2GCNA 4Y0AA 3TIFA 3U7EB 1MO5A 5UKDA 2REBA 5JRJA 1N5KA 4EPRA 1JNYA 3HR8A 3VHXA 3U3JA 3CWQA 4UNRA 1MV5A 1P6XA 1XBTA 2RGXA 1IXSB 4DIDA 2W00A 4DB2A 1E79A 1VCIA 3B85A 2OM2A 3DKVA 4W5JA 1FP7A 4CVNA 4ZDIA 4L8GA 2PJZA 3OAAD 2EFGA 1Z0IA 2RGGA 4YONB 2PT7A 4FI3C 4JL6A 4BASA 2QP4A 5F3WB 4YQFA 1XJQA 2AK2A 4QFMA 4DWJA 4Q1DA 3TLXA 1KSJA 2XAUA 5JEEA 4V0OA 5DIFA 4PAQA 2GETA 2G0TA 3LH5A 3GD7A 2EW1A 4XSHA 4DCUA 3NIBA 5HZHA 2GEVA 1Y63A 2ZREA 3NBZC 2LWIA 3T12A 2QQEA 3W6OA 2A5JA 3P26A 4CYMA 4GPTA 1T3HA 3BC1A 1NBMD 1DOAA 1W0KD 2I1VB 3QI2A 2GEUA 2YINC 4WZAE 1CJVC 4Q02A 2VP0A 3AF1A 1R8QA 2CHGA 1ZP6A 5C1BA 4KYIB 1L2TA 2D06A 4G5SA 2IT1A 3FMFA 5LB2A 3OAAA 3A37A 2LCFA 4JLNA 2AFIE 5DISB 2HF8A 4BFUA 1XMJA 1E2LA 2AN9A 1GNRA 2WM9B 5HCIA 3HWSA 2DWPA 4U5XA 1N6HA 2VP4A 1RKBA 2JCSA 3D3QA 4LCBA 1KI3A 4BFSA 2B21A 2OLKA 3O8DA 4QRHA 2VP6A 2QG6A 1NVXQ 3I62A 2KJQA 1XX6A 1GOTA 2QUZA 3VR5A 2F7SA 4F7WA 5GJBA 2H5EA 2GJ9A 4W5HA 4EPXA 4C0LA 3H4MA 4GDFA 4IOKA 2RGDA 2GNOA 4B2LA 1XPUA 4TLAA 5FTKA 1Z6XA 1D9XA 3DKPA 3UWOA 3X1YA 1W0JD 4AI6A 1UBCA 1F48A 2FV8A 1CXZA 4LHXA 2PT5A 3F3YA 5FOXA 3CRRA 3RYTC 4G01B 2FSGA 2GK7A 1I2MA 2C78A 3K70C 5FUXA 1E2DA 3U3MA 3KKNA 3NBYC 3EW9A 2ZAOA 2PJRA 3T1QA 2WAYA 2XSZD 5LB4A 1RPZA 3L0OA 2P5TB 1E32A 4LHWA 4LC1A 4TYQA 1KJZA 1TQDA 3SC3A 2GBLC 3CNNA 4CF7A 2WJHA 2ZU0C 4BECA 3VMFA 1T8UA 5C46F 1SKYE 3TSOA 3PUYA 3VKWA 1E94E 1D2MA 2F43B 3KXIA 4AD8A 2V6IA 2BKUA 3LFUA 4Q4HB 3K9HA 2R2AA 3IEVA 4LGMA 1WXQA 1W4BA 1WQ1R 3ZIAA 5LD2B 1NY6A 2ODWA 3BFVA 1IN7A 4AKGA 3UMSA 1IN5A 2JGNA 1Z6TA 1KJWA 5IDVA 3ZQJA 1A7JA 4M9SA 1NN0A 1VG9B 1MABA 4TZ6A 1OXXK 1FUKA 2V6JA 4LK2A 3ZDQA 1MABB 3QXHA 1X8JA 1GNPA 1Q1ZA 3Q7QA 2BMDA 3LQRA 4FD2A 5JJKA 4Q5IA 2A78A 2WKRA 2N1BA 5CIQA 1NG9A 1KI6B 4PX9A 1ZD8A 2X19A 4LYJA 1TU3A 1UADA 4RFSB 3W9YA 2NOAA 2HCJB 1WF3A 4MRNA 5K8UA 2BDTA 2BBOA 4HATA 4L15A 1KNXA 2ZYVX 2EU8A 4JLPA 4AY2A 1PJRA 3BB4A 4EJSA 1KY2A 2QPTA 4LI0A 1G3UA 1VCOA 2AFHE 4IXMA 4DSOA 5JSZA 4PPNA 3GLIB 1ZMXA 3FKQA 3I72A 4DCNA 5FBVB 2QP3A 4PAMA 4MRRA 1OB2A 4PR0A 3EG5A 1PV4A 1DAGA 4Q7MB 4S35A 3AEZA 2BM0A 3CR7A 3IBGA 4TQUS 1DVRA 1S1MA 1GRRA 2QNRA 2ZJ8A 1Q44A 1GWNA 1OXUA 2F1IA 3AVUA 1CJKC 3V9PA 2JLXA 1Z07A 1PLLA 3OIWA 1Y3AA 4KFRA 4QM7A 1ZU4A 1FNMA 4IW3B 3UMFA 1TQ6A 2Z43A 1EFUA 3MAAC 4XWAA 1KKLA 4CIDA 1W36D 3KZ1E 3CH4B 3GCGA 4UNPA 1G7TA 4GL2A 4Q03A 2OSBA 3ADCA 2CNWD 1II9A 3GJ6A 2F9LA 3KQKA 4ILEA 3FPAA 5CYOA 4US0R 1X8KA 3VU9A 3CZQA 4C3ZA 1CBUA 2W2TA 1WCV1 1UM8A 1I2DA 2YC2C 4BFZA 1Z29A 1KAOA 4TTQA 4URXR 5FTNA 5KNBA 5IK2A 1HV8A 2MSCB 2O8EB 2A5YB 1R5OA 2JLUA 4M1MA 3EZ2A 2WMOB 1HH4A 5EE3A 5CB6A 2YKGA 3PXGA 3T5DA 5DH9A 1X3SA 2RB4A 4PO8A 1T91A 1E1RA 3MJHA 2C04A 2VHTA 4MH0R 4Q48A 1Z28A 4RSGA 1G7SA 4DEXA 3K70D 2D7DA 3W3AA 2I3BA 3AKDA 1ZJ6A 3R9IA 5TY0A 3GJ7A 3R8FA 2IA5A 3WY9A 4NZYA 2QAJA 2J7PD 3SNHA 2ZUDA 4H9GA 5AUPB 1ZC3A 1BIFA 2Q9BA 2QZ4A
chains in the Genus database with same CATH superfamily
3PQFA 3EYWA 1EUDB 1U98A 4WLUA 5C5CA 4G9EA 4MS1A 2VDWA 3QY9A 1HL7A 2ZW9A 2W6OA 2HSGA 4ZPXA 2A1UB 3USZA 1P7ZA 3CX3A 2DY1A 4HNAA 2ORIA 3SICE 3VU1A 4A0QA 2O3UA 4MKZA 1FNBA 4TGLA 3OQBA 4TUYA 1VDZA 1RM0A 1UFKA 2BMVA 1QE0A 1BH2A 4ZQIA 5AJXA 1CQIB 1JFVA 3Q3GE 1JR3A 3FZEA 4GYWA 4XQCA 4X24A 1J07A 1XDGA 2Z4TA 2W2NA 3Q1KA 3GWZA 3TQOA 2N3ZA 3DR3A 2WT8A 1T2NA 5THXA 3MWYW 2AR0A 4PZLA 3A6GA 2HLNA 4PAOA 3QEOA 5B2ZA 3WIDA 1LGYA 3P2OA 1VI2A 1P1JA 2X0DA 2IBTA 4GE0A 2PMKA 3K0EA 3MILA 2A3RA 3G89A 3AONB 3O4GA 4KVGA 4M6WA 1E8MA 4NCNA 5IJWA 2GKGA 4JUDX 1TCBA 4KHZA 1Z06A 5CJJA 3VX4A 1YS9A 4JAVC 1KI7A 2BGRA 3CLUD 1NRXA 3MXOA 1A88A 1V26A 1YHYA 4UMDA 4MKIA 1MOQA 3VPXA 3TTXA 4O2AB 3HUFA 2JD2A 1FP1D 3HY6A 1PEKE 3CNBA 2QN7A 1A7AA 3OF5A 2PRYA 2ZB4A 4H6XA 4PHCA 1UEXC 2Y4OA 2XNDD 2Y71A 2ODEA 3EBPA 4LXYA 4ZO8A 1JDVA 2UVPA 3R3WA 5GZ1A 1KIFA 1OWPA 2V54A 1L1FA 5FOQA 3HCNA 2IS6A 5JJLA 2H65A 4H0FA 3SZOA 4A82A 1VRCA 3H9JA 4IDOA 4OFZA 2Q3MA 1TT7A 3T6KA 1ZNQO 2BUAA 3LP5A 1V0JA 4UM7A 3CUTA 2AI1A 3MYYA 1EHYA 5M5BA 4O2BB 1U0RA 1TVEA 3F8TA 3AUXA 3RYFB 4EHAA 5CXQA 2C5EA 1E2NA 2EKLA 3NKLA 2HSZA 4Z1MD 3EQ7A 5MN5A 2PFKA 1EVKA 1LBTA 4ZTUB 3TPCA 3ACDA 1BD3A 1HFKA 2WHEA 3H5VA 2P2SA 4UE2A 1QZZA 1P5JA 3GJ4A 4DQUA 4ZYLA 3KFLA 3ZUPA 2JC3A 3GLHE 4DLWA 4ZN6A 3FPGA 1X70A 3AJ8A 1QVWA 3P9ZA 3D1JA 3NCHA 5FUVA 5FPYA 3RD5A 1BGXT 3IURA 1HMYA 1ZH8A 1R12A 3CRMA 3R0IA 5EZYA 1J2TA 2R7NA 3IJRA 5AKKA 2GZ2A 4XQEA 1SC3A 1UDRA 5ENZA 4ZVUA 1NI4B 3M1YA 4A0SA 3C74A 1T6XA 5IF9A 2H1SA 4YFVA 1U8EA 4TLEA 5K6AA 1QXSA 3F8SA 1OAAA 5BW6B 5DN6D 4LE2A 4WRRA 2J0UB 4R1QA 1HF3A 3D6FA 4U2CA 1K6IA 1MOSA 3SYRA 1M1YB 3D7RA 2V7GA 1YB2A 3QXGA 1EFRA 2HBQA 1WB6A 3HA5A 4RY8A 4X8MA 3KM0A 1ABEA 2O0MA 2Y0EA 4HDOB 4RPHA 5E7JA 4YUAA 3MGGA 3R7SA 1JQAA 3QA3E 3QPBA 4IOMA 4UVEA 1XQ1A 3RK1A 1VECA 4ZT5A 3WE7A 3DEJA 4KO8A 4V0QA 1G8SA 1V96A 3C6ZA 1YDWA 3NHRA 3IB3A 1AUQA 4J0KA 4LPSA 4JFRA 1H66A 2YWXA 4EKGA 3H17A 4JLSA 1ZA1A 3IT0A 1W73A 1HDZA 3LHIA 4IVRA 1GPYA 1WG8A 1OWLA 3RARA 1U9YA 1ZCAA 3R7FA 1IJFA 5IAKA 3GLFB 1AN9A 2FETA 4RF4A 3QVJA 3AEUA 5A4JA 1LJUA 1FFBA 2QRMA 2GYVA 1B8UA 3EVDA 2O07A 3K92A 1K98A 1PSDA 2C61A 3KSZO 1ULSA 3OO0A 4FFBA 4G1BA 3V5NA 3VR5H 4B6RA 2P9JA 4CRWB 5IMSA 2A14A 3C3MA 2XGJA 3M5DA 4MUJA 1SUDA 4OAPA 2W2XA 1KKUA 1RYNA 3O7MA 3ZXYA 1EIWA 1CX9B 2ZCVA 3M70A 3E81A 4KIGA 5LWHA 1F6WA 3GH3A 2D5IA 3Q3IA 3B7WA 5FBQB 2GBCA 4NOMA 4TL7A 5DEIA 3D2LA 2CBGA 3CVJA 3SBEA 3WICA 3RBVA 1Z22A 1LPOA 4BB9A 2YJZA 4L57A 5FOSA 3RGGA 4BGDA 4XYLA 3QVVA 4O4IF 2R44A 4RHFA 2R25B 3FETA 5AHKA 4AKIA 5AIBA 5IHXA 2R4QA 2IYAA 3U3ZA 3FPHA 2D1TA 2O3JA 3K5PA 4Y6RA 4J0HA 1DUSA 2X8LA 3DTVD 1AKEA 1LKZA 1ZD3A 2BH2A 3M9XA 1QQAA 2O23A 2DUWA 4MXDA 4U7TB 1TVMA 1C1XB 1WHSA 1K92A 2IHUA 2XCIA 4IICA 1WY5A 3ZKWA 4FUQA 1WTAA 1Q21A 4GSYA 1XN4A 3BMNB 4IHJF 5A4FS 2XBUA 4FNOA 4D80A 4C6SA 4HNAB 1G1MA 1E3JA 1FE8A 2ZIAA 5IJZA 3ZXUB 2CCGA 1RI5A 3O2JA 4MROA 1Y6FA 4MRVA 2HK7A 121PA 4RLQA 1UBLS 2Z08A 2XMBA 1AQNA 1ZVVA 2IF0A 1GYQA 2OFPA 5BWBA 2Z2XA 1JZQA 1IM8A 1RVDA 4G36A 3HDJA 2E48A 1RHQA 3KZCA 4XUDA 2JBAA 1I94B 4BAZA 4LY0A 4RQAA 4EI8A 2ZIXB 4KYTA 2MR6A 5JZVA 4CV0A 4B35A 5KDOA 3K6SB 1Q7CA 1II8B 1KJNA 2NYAA 4QO7A 4QICA 1NN1A 1PDVA 5JRDS 1TGVA 4MJ7A 3T7CA 1GPH1 1RCFA 3DNFA 3TVTA 3C98A 4X85A 4RQUA 5ILQA 1XZJA 3GIWA 2FUNB 4Y2JA 1T3GA 1Z3CA 5GV7A 1NL3A 4A2WA 2W6CX 1RQ7A 1AUXA 3DWGA 4RLFA 5E0KB 3QF4B 2JGRA 3ZW7A 1UC4B 3ONVA 3UMBA 5L8VA 3E22B 4OA8A 3SC4A 4D8VA 5L3QB 4GW3A 1DINA 2FMHA 3GY0A 1LTKA 1E98A 4L95C 4OQXA 4Z0TA 1AK9A 1RC0A 2VK2A 3P0HA 2OHVA 3SC2B 4E2ZA 1LVGA 2JBHA 5JYDA 1SD2A 1Q83A 5EZSA 5ABPA 3H0EA 3HKCA 1G60A 5A1TA 6CHYA 1BXGB 2CSUA 4EW1A 4WEOA 3N39C 4WKNA 4JIMA 2ACWA 4P2BA 1RWXA 3D4OA 4J4HA 3N8IA 2PX4A 5TIIA 1A95A 1E6KA 3G5MA 4FNGA 3DKIA 1K7YA 1KJ8A 1QOZA 2DTXA 3JATA 3ETDA 1IMJA 3OCVA 1YCHA 5HG0A 2WZDA 3TW8B 2AKEA 5TARA 4WHMA 2CK3A 1DS6A 4XGIA 4UTRA 1E6MA 2ECKA 4OKSA 5FAKA 1G8AA 1P8JA 3LCVB 4FCTA 4ESEA 1RE0A 1S8NA 5FOTA 3M6FA 4QLBA 5D85A 4EJSC 1X7XA 3EMDA 4OHCA 2FPGA 3OQOA 1FDWA 1PFUA 4DMCA 3EIHA 3A06A 2ZQZA 3CR8A 3O75A 2HTEA 3M6AA 4CUJA 3O6VA 3KSUA 3O9MA 1X1QA 3L4KA 4DV6B 4DV1B 3AR7A 1RU3A 1ISRA 1Z5UA 2R7KA 3KTOA 4ODIA 5LQNA 3BQMB 3BH7A 3QXXA 1LQ2A 1HTBA 2RH9B 4R1OA 3KEQA 1IZ7A 2DHDA 3KQTA 1YASA 3CF4A 1L5HA 4DPMA 3LW8A 4DLYA 4A91A 5MFZA 5EE0A 1OA1A 2BEUA 4AJHA 3CSSA 3SP1A 5JCXA 1IN6A 2OVBA 5CCXA 4JHXA 2IUTA 4L0CA 5ALKA 1XTRA 5BQOA 1FYWA 1QHNA 4JJ4A 3GNLA 3OPYB 3PJRA 1Z4OA 1X1DA 4G6ZA 1YD7A 3VVBA 4HDSB 2BP7A 2P6UA 2DFPA 2WJZB 2XKBA 3EIQA 4GI7A 1TKAA 2B37A 3CX8A 3NHAA 4X1IA 1R0SA 4ZTZB 5CB0A 1KFJB 2CZGA 1HURA 2YZMA 3UMRA 5KNBD 3FDZA 1RZRD 2IYOA 1S8FA 1AGPA 2A86A 4ENSA 1DX6A 4TWIA 3VHRA 2HMSA 4LJRA 2ZRHA 1K63A 4HRXA 3FDFA 1F6DA 3IQGX 3F6CA 3GEGA 3KJEA 4G5GA 1XDDA 2F1RA 2O52A 3MUOA 1Y33E 4PHTA 1GL6A 3GJXC 2DT5A 1UDCA 4J2OA 3D6MA 4KWEA 1GTL1 4RD6A 5HF5A 1WBBA 5MF6A 2WIKA 2X2EA 4Q7LA 4UU7A 5HGJA 4K88A 3OCWA 3W3AH 3Q87B 4L8LA 4B3RB 1TT5A 2WSSD 1FP4A 3K0CC 2W6QA 5REQB 1DAHA 1VPTA 3V2IA 1EU1A 3OE5A 4DIKA 3OJ0A 1WOYA 1OVMA 2AL7A 1FFCA 3LBYA 3W9BA 2ZXUA 1E2QA 5FP0A 1SUIA 4AZSA 2QVBA 3MFQA 3M6LA 3T5MA 4QYIA 3AUSA 1B41A 4QX6A 2MSLA 4XKJA 1DJPA 3RODA 3NHZA 5I9SA 4WERA 3OQHA 1WZEA 3VV3A 4G1CA 3KOOA 1VLVA 1HNNA 3HG7A 3TLCA 3O93A 4XUGB 4YT4A 2HMYB 2GCOA 4FX5A 3H5WA 4P33A 1ZK4A 3STYA 3UUWA 3ZWPA 2CY0A 4ICIA 2QROA 1YNSA 3SIWA 1ZMBA 5F2EA 2WQ7A 5KJCA 2FFBA 3OTHA 4K9LA 5CW1A 4EA8A 1FU8A 1GNTA 3E7XA 4KZPA 4POAA 2FTKE 1MQAA 2AZMA 4IP0A 4J0IA 4PG7A 2PMBA 3WLOA 1C4WA 1DV1A 2QQ5A 4IV8A 2YOHA 2Q7OE 4LWQA 4BNZA 4X7MA 2W2OA 3NZEA 1BS1A 3EXIA 1SOWA 2O1SA 4M9ZA 3RU2A 4C0AC 5F9FA 1YQEA 5BWCA 2J59A 3EAFA 4ESVA 4PPYA 1ZUNA 5CX1B 1UF9A 3PC2A 4U9IS 2C96A 4MUYA 3WNBA 1PR0A 5FI0B 3B1JA 1ETUA 1XWWA 3IQEA 4KOEC 2B83A 3X2EA 2R4TA 4WVLA 2BR5A 4BNWA 5DK4A 1H0RA 3KJQA 3ZDXB 4C1NA 5KTSA 2OB1A 1SG6A 4HEA6 1B1AA 2RCYA 4L85A 2ZJBA 3RYHA 4HEA1 2A0KA 2P4QA 4YRRA 5B7PA 5KQRA 4MYUA 2EC5A 4B84A 4E03A 4JLVA 4TLDA 3WGUA 2ZJ1A 2AEEA 3T94A 2EQAA 4C4OA 2VJLA 3HP7A 3K1AB 1G2QA 3PV0A 3R6DA 1G4AE 1NT2A 2AZ4A 3HB1A 2O06A 1YK1A 2ORVA 2C5BA 1ZJYA 2D5CA 2HU8A 2P0YA 5GM2A 2O2CA 2W98A 3IT1A 4ZK6A 4C22A 3RKSA 1LZLA 1GG9A 1LLDA 3I34X 3LCCA 2AI2A 3C6QA 1AJEA 1Q3TA 4OHZA 1ISMA 5FA5A 1P2VA 2EF0A 2WHYA 3Q0IA 4RD2A 5DX0A 3WG9A 3GN1A 1YB5A 2I2AA 2Z9CA 3F6BX 2KB0A 4XYMA 5LOVA 4WKGA 2B4QA 3O82A 2ISCA 1KFEB 1PWYE 1QIIA 4ZJYA 1I2CA 1SK8A 4M7WA 1ZZGA 3FYUA 2XUIA 4NVRA 2AQIA 1Y4ZA 3IUEA 4KQEA 1XZMA 3T99A 1NNLA 4D43A 1ZD2P 2HH9A 2XVZA 3D2AA 2IX3A 3L92A 2HYDA 3QMVA 2RK3A 5KNCH 2NO9A 1MX5A 2Q4BA 5FRDA 2NQ8A 4GP9A 4HVTA 3QPUA 4QSHA 3RUEA 4FKZA 3FPKA 1E3SA 2VAXA 5U9CA 2RMKA 1U2EA 1U90A 2J5QA 4F1JA 1ADCA 3ELBA 2J3HA 3QUTA 4KIWA 4B44A 5J4HA 1KDPA 5JD5A 1NBEA 2NZXA 4JJGA 4NZMA 4YXWD 4DC9A 2BFEB 1DIBA 3OLXA 3V2UA 4EUFA 1ETHA 4Z54A 3TOZA 1N6NA 1DBIA 2J45A 2JVIA 4PGMA 4ND6A 2WJIA 3Q41A 1YQGA 3KKKA 4IDGA 1DFIA 3L79A 3RR2A 2FRXA 1CIPA 5EHNA 1KAEA 2SHKA 4ML3A 3EAQA 2HC9A 1FTSA 3OP4A 4CQNA 2J3DA 3O8OB 1KPIA 3IPXA 4QPJC 2WSIA 1IY2A 1R0RE 3H3FA 4M0EA 4MCAA 5DYNA 3SF0A 4B7CA 2GEKA 2B8NA 4DIEA 1P4JA 3WFJA 4PO1A 1EE2A 2Y8EA 3AR5A 3REGA 4EL5A 4URVR 3NXKA 4BVLA 2WTMA 1OGYA 2HHJA 4I5DA 2VTKA 4KGVA 3KAKA 1TXGA 3DEIA 4L2IA 3RC9A 5HCNA 2VDUE 4DNOA 4F97A 1QB7A 1WP9A 3PX7A 3JW8A 4YP1A 5IMBA 2AWNA 4O5OA 3VGJA 2BMJA 3I04M 1GZUA 2G9NA 3STHA 1EM8A 4GOXA 5DO9A 3T0IA 1GUDA 5JXWA 1VE9A 1BS2A 2EJUA 3WA7A 3PFBA 1YCFA 4X94A 5B4VA 3JRNA 5ED0A 1QH1B 4DDKA 3DM5A 1CCWA 3AQIA 3P9QA 2G0AA 1C8LA 4BTVA 2WIAA 3SU8A 5K3BA 4EELA 5KYYB 5CRIA 2H18A 2ZSJA 1LC3A 5K5EA 2ATEA 3EZ9A 2A4KA 3IV9A 4GKKB 2WWVD 5IT5A 3F96A 3RS7A 1R0BA 1IQPA 2FMUA 3H2IA 5K3FA 3G59A 3HKBB 3E8SA 3FMIA 2XITA 4WGFA 2V1XA 1E0SA 1ODKA 1Y0BA 3E5HA 1KDTA 1TC1A 3GUUA 3LCRA 1TJ5A 3AFNA 3LIPA 1VBFA 4K9MA 2HQOA 2QVCA 2B3DA 1H8HD 3BN3A 1U5AA 3E61A 5TVKA 2IQIA 2N47A 1E2PA 4R9NA 1J99A 5K9ZA 1KY3A 4GLLA 2O0HA 3AF0A 1H9AA 3WRWA 1VXOA 4V3CA 4EFKA 4QLAA 1FVFA 2NU6A 1NNEA 1F3LA 1G8KA 3OA2A 3SX4A 3EZFA 4B6EA 3VR5D 4E07A 1DEKA 3GAFA 4TTJA 4ZAYA 2ONZA 3LA8A 2VZ9A 5F77A 5ICGA 1ZH6A 4JOSA 4KP7A 2P35A 1R9MA 3H84A 2FVXA 4BQFA 4KXLA 5CM8B 2RHGB 4RFVA 2ACEA 2ZRFA 1JI0A 3SBXA 3ZXXA 3ZV3A 3E18A 5TS3A 4D26A 2QRNA 4GX1A 4KQ6A 2DCMA 4WXMA 4B2PA 3AUJB 4PHFA 3GEIA 1K0FA 3DMRA 2OT3B 1XCOA 2IX9A 4P80A 5KI6A 1SQFA 3PHBE 4HDSA 3K8QA 2I2CA 4YJGB 5AVJA 2NX2A 4DLPA 3PWKA 1EA5A 5FV4A 1YR8A 2B92A 3NHPA 1V25A 1YU6A 2GN0A 2D7CA 3M9WA 3OC6A 3ITEA 1GTVA 1NIJA 1HQYE 3NANA 5CX1A 3R3SA 2HFJA 5PGMA 3ZGYA 3EXFA 4B7AA 3QUQA 4G67A 4MVJD 3UENA 1E7QA 4YCNA 4TKVA 1X9GA 3UJBA 3ADBA 1UUFA 1I51A 3O8CA 1RWOA 1YZLA 4LDRA 4RPLA 2GCEA 3SIPA 3WDMA 5ALSA 4Y98A 2GWHA 3BGSA 4NYIQ 4DNXA 3HMKA 3TZBA 2Z2JA 2IYXA 4U3JA 4BX9A 2FPKA 5SYAA 2JLYA 4IHAA 5GZ6A 1DQPA 5J2TB 2CCJA 3MC1A 1KK1A 1WWKA 1GRCA 3R5SA 1JKJA 3P0JA 5CDSA 2YX1A 1KEEA 1Z7GA 1QGYA 1PV1A 1JDBB 2PEYA 5E7IA 5EVCA 3SZMA 3WWEA 3UPUA 4EUHA 4G8BA 3RK0A 1P3Y1 4AXBA 2WQ6A 5DN9A 3AVWA 5DEOA 3JYHA 4DYHA 1D6NA 2P9FA 1TEHA 2YIMA 1A7KA 4C7BA 1DAOA 2QR2A 4AX8A 2I33A 3A9CA 2ZRGA 1OROA 3EX7C 2YZ2A 1Q6YA 4OFBA 3GFQA 3GP3A 3L7KA 4HSEA 1TOAA 2IY8A 1T36B 4WY5A 3B78A 4MEAA 2ODQA 3DFMA 4DR4B 1CJTC 3ISJA 5BSRA 4OFXA 3C8MA 1LBQA 3P2MA 3VC7A 4NJEA 1AU9A 1L7OA 4OQYA 3DOFA 2NTEA 4QUBA 2L19A 5GPBA 5U1PA 3K73O 1QVAA 3ANTA 4R40A 5HBGA 4L7QA 1U8XX 5B1HA 4C0XA 1VM6A 1ACJA 4R68A 3PZBA 2JKZA 2W4IA 4CFSA 3Q40A 3B9QA 2KBFA 4F5DA 4Q7KA 4MVJI 4QUHA 1FFAA 2IOFA 4DABA 3FVVA 3NHYA 2HKIA 4R1LA 1R0ZA 3WV5A 2IU3A 6AT1A 4KUHA 1SCUA 4D4MA 4DMRA 2A9PA 2FLVA 5J5AA 4AP6A 2FN4A 4TSRA 2B1JA 3E5RA 3TXYA 4EHJA 4RTLA 4LYDA 2WYWA 3KKMA 3VKVA 2HTFA 3MLAA 2F90A 1T0PA 3BEDA 2ZYTX 3VXKA 4L3WA 3ZW8A 2PLFA 1ZL2A 3BDVA 1IAQA 1ZUIA 4R0NA 3HR7A 1IOVA 2J0EA 1IHDA 3IBSA 2BI4A 1UPCA 4NV0A 3E15A 2XZLA 1CUWA 3VYTB 1SXHA 3OJOA 2B1QA 2CJXA 1H2WA 4OJQA 1E1YA 1L7AA 1XR3A 2GXQA 3PFKA 3QRWA 4L4SA 4ZYZA 2I3DA 2J9FA 4FOOA 1YJQA 1H6AA 4KRXA 3BL5A 5LUAA 4XFKA 5FPSA 3T3NA 1XCJA 4X3CA 4LJ6A 5D86A 3AB3A 3ORHA 3SX2A 1XVLA 4RJTA 5A6SA 3OKFA 3ZV5A 1QHIA 1SGWA 1ZCJA 3H5IA 2MWMA 4OL0A 3L9WA 2CLCX 1U8CB 3F7TA 3O73A 4CI9A 2AOVA 5LZ5A 3UAWA 5JBNA 3L5OA 2VHJA 4MINA 3WRXC 4C78A 3FUXA 2QN2A 2QQGA 1VP3A 3HUUA 3PTZA 4URFA 3VNVA 3KYCA 3JQBC 4TT3A 1GTRA 4EYEA 3C1UA 1EHIA 3D5TA 4BZPA 3H8SA 2V58A 3WB2A 4FS8A 3UWDA 3G2JA 1WAMA 2GHIA 5ARDA 3TJMA 3QE9Y 2ODNA 2QNBA 4DANA 1I3NA 3EGEA 2ENUA 4M60A 3EPJA 1F2UB 5BRJA 3ADDA 3P19A 2PU5A 1TECE 3E22A 1AO0A 1ENYA 1MX3A 4IZ6A 4C21A 3U60B 4UBLA 4WUVA 3U80A 5KTKA 4MW4A 5JXHA 5C0OE 2V4UA 3U3OA 2ZBVA 1I0ZA 3IODA 1GXSB 3BCSA 3TNDA 2AB0A 1TK9A 3GAZA 1XU9A 5EQDA 1PGQA 3QLVA 4S0XA 3AUFA 2AR9A 5IDXA 1SVIA 3B7PA 2ET6A 3LW7A 1IUOA 1RQLA 4FFNA 2XNHA 3E3AA 2ZYUX 3GL9A 3WYBA 3ZN2A 4HAWA 3VJMA 1GQQA 3ICQB 1EAYA 3OZRA 3QX7A 2OK7A 1UWLA 1KK3A 1LV8A 1XNHA 4R0VA 1Z0JA 3DO8A 4KQ2A 2JFFA 2FUG1 1M6HA 2ZQYA 3CWZA 3LDGA 2R0QC 3WNCA 1AKQA 1M76A 1OA0A 1ZINA 4JENA 5JD3A 2A57A 1TF5A 1V71A 1IN8A 2LDYA 1DB3A 1REQB 3ABQB 4G25A 1OXTA 1KJ9A 2OUKA 3RC7A 3RAGA 4EBBA 2V6MA 1ILWA 2ZULA 3HCRA 4Q47A 1DBVO 4QPCA 5DHRA 3N8HA 3M4JA 3KSBC 5DHSA 3B82A 2CF6A 4NJMB 4YO7A 2H59A 2Z83A 5CIWA 5FORA 3L46A 4WZAB 1PBTA 1QCZA 4CKWA 4KUGA 4TRNA 3V4SA 1L5YA 3LC1O 4DIMA 3BVPA 2PKWA 4CLDA 1MO3A 1HR0B 4EG4A 3ETCA 1ZIPA 5IUJC 3OLCX 1QTRA 3PXAA 4GLOA 1ZPDA 4H7PA 4YJ3B 3ZBTA 5EP2A 3NUGA 3K2EA 1TAGA 2V7XA 2ZJOA 4KQCA 5EZYB 5K0LA 3WLKX 1A72A 1KBOA 3V00A 2E37A 1VYHA 4Y1EA 3KR1A 3S5JA 5K3CA 1U99A 2V59A 3SCZA 2F3TA 1C3JA 1BMQA 3Q6MA 3QU2A 5G4KB 2PUDA 1U63A 2VA8A 3JD1A 4UHDA 3QVLA 1NE2A 2O8NA 1BXRB 2IUFA 2P11A 4LRYA 4QYSA 4LSMA 3K1YA 5K2OA 1XELA 3AESB 2I7TA 2VXCA 3PUJA 4ME6A 1R8JA 4Z8XA 4LQLA 5DYIA 4YRLA 3UFXB 3L7CA 3FCXA 3JYLA 1XPJA 2DX7A 4QNRA 1RYBA 3I12A 4HAUA 4R1NA 1HSOA 4R8LA 4R2MA 3E0XA 1D7AA 2Q4DA 1Q0TA 3E7WA 4XFJA 2J5BA 2QK4A 2GTPA 1XKXA 1BKSB 1CZRA 4OATA 3RDPA 3TR6A 1T29A 1NXQA 2Z6VA 3F74A 4K1XA 4Q9AA 3C14C 3F78A 1O5TA 3EPRA 4D8TA 2BMFA 3DHEA 3GA7A 4N82A 2VG8A 5JW6A 2O1EA 2B5OA 4KNVA 3R7WA 4TRRA 5AVKA 2SCUB 3CRQA 2Q6VA 1EMDA 1SK9A 2YJ6A 3QXSA 4HH3C 3U9LA 4D25A 1NP3A 1DHRA 1O54A 1TK2A 2VLBA 4RETA 3DTYA 5GMOA 4BNHA 4MUMA 5B58C 3BSFA 4FILA 4KAAA 1UT5A 4NHOA 3KAPA 2G1KA 3HSSA 3HXTA 4KK4A 5DRYA 4HQRA 2AEJA 1W7AA 2DUJA 4ASUA 4RKRA 3AUUA 3GGJA 5EXXA 3UJ7A 4HN2A 1P60A 4C4XA 4CNBA 4ETMA 2DR0A 4KKVA 3ZPXA 2G9UA 3QIVA 2QYSA 3H1FA 1F8YA 1FS5A 1LPMA 3TLKA 4NESA 1LB1B 2DH5A 4E0BA 5EQFA 1SVSA 3WKCA 2VH1A 1Z73A 3N0WA 5KX5F 4XAQA 1M2HA 4QXOA 3HBMA 3Q7SA 5CFLA 3CG0A 1PJ4A 4MSUA 4F4JA 2H8KA 4MV1A 3W9SA 1C8KA 3K09A 3LZCA 4ZKDA 3ZJUA 3M6IA 1VBKA 2GZDA 4M88A 4UTVA 4BNMA 2E3JA 5DYWA 1XU7A 2P2ZA 1WXEA 2G5CA 4K28A 1JMYA 5CYPA 4ZEVA 3ADOA 4K87A 2YJTD 4BWVA 3VNUA 4KRGA 2ZRJA 3NV9A 3DFUA 2I4NA 3GFGA 4HI0E 3D5EA 3WLLA 3A7EA 3HJRA 3N58A 4MV3A 1CU1A 1P1RA 2HYIC 1SEPA 3LVQE 5IC6A 1SC4A 5IAGA 3VDXA 1IZ8A 1TMKA 3I1IA 4ZOAA 5AR1A 1LF0A 4PXSA 3EQ9A 2IRWA 1U65A 4WDRA 5EP3A 4EP1A 4EMSA 3GRVA 5I7OA 1KQGA 4UUBA 4XB6B 3NTQA 2RHMA 1EUDA 4OHMA 4G84A 3HXOA 1QRTA 2K2WA 3O5AA 1GZ4A 5K8CA 1RZRA 1AZLA 3LGXA 5AWFC 5AVYA 4I5GA 1NUQA 4MVWA 5D3QA 1NVTA 4WE3A 1NMQA 1SBIA 3ORRA 5KHOC 1B16A 2PX5A 2ORED 3W2TA 3GFSA 3FDJA 5B58T 5B12A 2YASA 1I7QB 2PKYX 3FGPA 3GMTA 1C2TA 2I6SA 3MRXA 4RCZA 1Z2AA 3RS0A 1CB7A 2OFFA 4GOKA 2Q6OA 2PEZA 3SYMA 1JLHA 2CC2A 4EX7A 1LFAA 2OECA 4BBZA 4FD3A 3TNYA 1N2OA 4K40A 3ZZ1A 3OZGA 2CVHA 5FLKA 1J21A 2QRVA 4LVCA 5BSFA 3TBKA 4HNTA 2OV1A 3NYIA 1COZA 3E48A 1KDVA 1XK6A 3L2OB 2ZCUA 1KE2A 1NFRA 3O3MB 2J0QA 3WTCA 1C4OA 1AN0A 3N3AC 1WKVA 2NP6A 2PH1A 2NT3A 3OJXA 4YUVA 2B4RO 3VX3A 1QOQB 4OP1A 5CM2Z 1EZ1A 1F8GA 4RCYA 1WW2A 3TOVA 1E2BA 5EIBC 4M22A 4F3CA 3U09A 2ZWIA 4LNUB 4D9FA 6PFKA 2A7XA 3TWOA 2P0AA 5I4KA 3HE3A 3BK2A 4FW8A 4KW7A 1ZD4A 1THZA 3KHKA 4N3GA 5IASA 2G1PA 2H7VA 1J7KA 4J03A 4CKBA 2CGEA 3PK0A 2X1VA 3WMXA 5C7YA 1P31A 1JR6A 2NTYC 1OZAA 3M34A 5CEJA 4EGFA 2BZSA 4DNPA 4JYAB 4B4OA 4N8SA 3BRWD 2O8BA 3FOAA 4RXMA 5H0IA 4ACAA 2XLBA 2BZ1A 3HCCA 3ENVA 2V9CA 5IBPA 1JP7A 3TKYA 3JQFA 3W2EA 1YS7A 4D5EA 4K9NA 1T24A 1MO4A 4UBOA 4TUYB 5CYGA 2HW8A 1OW3B 2HV9A 3HEAA 5ALNA 5TX7A 1PQPA 2PGLA 1MVNA 2RHCA 3QNWA 3VZDA 2F8SA 1JZSA 1GPNA 1RXSA 2GARA 3KXPA 3PC8A 2FGKA 3RYHB 1AZTA 1JSXA 1LVUA 2IKSA 2VDWB 2BM8A 1OYWA 3HXPA 4IV0A 1JAHA 1H5QA 3CT6A 3I9NA 2B8TA 4GDMA 3R8XA 1Q57A 2NTVA 1NUPA 3LSYA 1JEJA 4XJVA 3TLAA 2Q5HA 2ANCA 4HDMB 4I4IA 4BLWA 4BQPA 4E5YA 4G81A 4L50A 3TIXB 1N2CB 3JWHA 4IUDS 2FUKA 1O97D 4ZMBA 5EWJA 1P61B 2R96A 1E4YA 4F11A 2VYND 5CDYA 3GRAA 2YS7A 4JWTA 4U9UA 2I2DA 5JY6A 4MS3A 1Z2CA 1Z6YA 5IM5A 3NDPA 4JKIA 4X8LA 4C7KA 3KQUA 1UWCA 2NIPA 4QU8A 5H4HA 2Y1LA 5DNUA 2F8MA 3GXOA 1R4NB 4FFPA 2BUBA 3EVGA 2JLVA 3SXUB 4NMWA 1RYDA 2FWAA 3CLSC 4GT1A 3HM2A 1DWQA 3EVEA 4DCJA 4ZALA 1SXJA 3AJEA 2WP0A 1PK8A 2YY6A 5EZ5A 1CUUA 1A8IA 4DFDA 2F59A 2IYSA 4PO3X 2R3SA 5AW9A 4B8ZA 5LP1A 2J4CA 2P2LA 4YRCA 4AC9A 4CL0A 2BM9A 1GZVA 1UXKA 1L5VA 1UBTS 2I2XB 3F3MA 3HR4A 1SZJG 3ZY4A 1CPYA 2HA7A 1NV9A 1HDXA 4JT4A 4PC7A 4HDQB 4UNSA 1ESDA 1OIXA 4DSZA 4M0FA 2IYWA 1JDSA 4RMHA 5CCBA 2R11A 1XN1A 3S5UA 1EP2B 1A2OA 4UAUA 2O7VA 4ZHQF 1SUEA 5KHLB 3OT5A 1A9QA 4I9NA 1EVIA 1WRBA 4L07A 3QWFA 4MUXA 1D0VA 3P1JA 4JSTA 1YO6A 2QZPA 1YRWA 4TMWA 3HH8A 4Y2VA 3X2SA 3H2KA 1VLQA 4DPKA 4YV2A 1HE2A 3G79A 5J58A 3UFXA 4XIYA 1UAGA 1NBAA 2BUCA 3EW7A 4Q39A 4WXEA 5AKEA 3OMWA 5C8YA 2HD4A 2K6GA 4UARA 3F9IA 1NVDA 3OM1A 5FEUA 3EWNA 1PV2A 3DBLA 3KFXA 4F3KA 1D4AA 4MGIR 1GUAA 3RF6A 3HCBA 5AQ1A 2TMGA 3ZHUA 4MNTA 1PGPA 3BXHA 3OPYA 3HJCA 3TLBA 3W7AA 4CL2A 4G4IA 4LWZA 3EIUA 1T5HX 3T7SA 3LVRE 3P9YA 4FHFA 3S70A 3LGSA 5JZBA 1LFDB 3BXGA 4O2BF 2W42A 2IS2A 3KK0A 3I4LA 5BV1A 2J31A 1OAKA 1XKTA 2GLTA 2GUGA 4MMYB 4ZQEA 4C43A 1SO8A 2WF7A 5K8JB 3GJ5A 1XQ6A 1EFHA 4DG5A 2EL9A 2VCHA 2BI8A 4G09A 2VKQA 2REXB 3Q9SA 4EFMA 4MLCA 1V1RA 2RGCA 1MOPA 1GARA 1QYWA 2QI9C 2RGBA 3HA2A 3BMCB 5IS2A 1AGXA 1UXGA 2QRUA 2W2LA 4OIFA 4Q4AA 2XY4A 4FC6A 3EPKA 4AY6A 4UEKA 4QATA 4YJ2F 5ALEA 1J8FA 3V34A 1NXSA 2A5DA 3V80A 4TT3D 2WLSA 3D6UA 5ULLA 2OC9A 1TB4A 1USWA 4RFSA 2YY7A 1P2SA 5E3JA 1X2EA 2F3PA 4A2CA 1TYDE 4AS3A 3ICCA 3COJA 2OCXA 2JGMA 3KFVA 1LNSA 1RJFA 3KR0A 1KJJA 3I9LA 3KSRA 3PGKA 4OFWA 3Q3VA 1MN6A 1V4NA 3N28A 4BVKA 5IT9A 1HQCA 1TUBA 2AI3A 4PGGA 3ZUGA 5BV8A 2VXYA 3WLPA 3FSRA 3VGPA 1EFPA 1HUQA 2BGMA 1JA1A 1T4DA 4N3BA 3LKDA 5BPHA 2J9RA 3GO4A 1H4TA 4WXRA 1EXDA 3HNPA 2IYVA 1JKIA 5KPDA 5EHGA 3I04A 4X93A 3TVDA 1BJRE 5EIXA 3RTCA 1NVBA 3KZNA 1F2UA 5HKAA 3WC4A 1RQRA 2DEUA 5K51A 1QQTA 2J48A 2C9YA 3C3JA 4F91B 4GL4A 1C7JA 4MCHA 2R1VB 3D8SA 1L7BA 2PO7A 5BNZA 3TVYA 4RNDB 2K7ZA 2HIGA 4M8KA 2XXAA 2X6RA 4NK4A 4R3NA 3F73A 4ZKEA 2CMFA 3X0DA 3AXSA 1II8A 3UGJA 1OOEA 1RFGE 4JX9A 4UNIA 2RIPA 3ZCQA 2W0SA 5CB4F 1YRBA 5FH9A 4IV5A 1VMIA 5C51B 4K6CA 1XZFA 2Q3BA 3D3KA 4D0RA 1QP8A 7MDHA 4JJKA 1KY4A 3C16C 2R85A 1Q95A 2FH5B 2H16A 4WZAA 2R6ZA 3LY8A 1XJ0A 2XMCA 3MJ4A 4Q4JB 2W7TA 3BRSA 2C2YA 4EMUA 4IJ5A 4I1VA 3TGLA 2I6GA 1J1UA 5AFSA 1J23A 3I09A 3OJFA 2OA0A 3S2FA 1GKIA 1E9DA 1C1XA 1K1EA 1R3DA 1WHSB 2Q3CA 3EGWA 2UDPA 3JQ7B 3OIFA 1BSVA 2RC5A 4WNIA 2MYNA 3WL5A 1FS4A 4FMBB 3WVNA 3ZE2B 1XROA 4KJXA 1KU0A 4KLZA 3OLYA 3ZIDA 3OCYA 1KMHB 3MGBA 5BQXA 1LV7A 5BSHA 4D8XA 8MHTA 2UZ4A 5EG5A 2W4MA 4IR7A 4TV8A 5BOVA 2YIVX 2ZI4A 4A2PA 2ZVDA 3RIXA 4YWJA 3R20A 3WNDA 5KC9A 1ZICA 3QWAA 1CB0A 1Y5LA 4MZXA 4N39A 4DDMA 4B3XA 1QFYA 3L6DA 3MJVA 4MA0A 1YU9A 3GGCA 3PGMA 2I4IA 2R8PA 1VJTA 2GA9A 3CVXA 2ZYWX 4DLTA 4M9CA 1CT9A 3DMTA 2YVUA 4GQBA 5DWDA 3BRCA 3DMNA 2B34A 3G0OA 4A5OA 5HP4A 3GNSA 2DBQA 2GKSA 4I4TF 3ACBA 3GLFE 3GC6A 4EYOA 3RYIA 1JEYA 1AV6A 3L05A 2XWSA 2XOKD 4UOQA 2CDBA 2HLHA 3BCRA 2GZRA 5JDCA 1ITZA 3S81A 3UJNA 1ORIA 1KC1A 3Q88A 3WGIA 4O2LA 3HZHA 3IMKA 3I0MA 2XGOA 4LVNA 2CV2A 3RTBA 1RWNA 4GRIA 3SQWA 1N2XA 1B0UA 1WKCA 2WK1A 4YT5A 3QXJA 2X6TA 1ZRHA 1RVV1 2Z4SA 1YL5A 3OA0A 3TDNA 2WWYA 4BMOB 1RJ9A 4Q16A 4ZWNA 2ZR8A 1ZMRA 4KXQA 4WKCA 1C30B 4I46A 5A9SA 3HXQA 4RABA 3KIPA 1KSFX