2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
2QORA 4JLVA 1WQ1R 3ND8A 2WHXA 1ZYUA 3N2EA 2REBA 1OYWA 1ZC3A 2EQBA 3B9QA 2O8DA 5JWRA 3D31A 3LVRE 3RWMB 1NLZA 4ZPXA 4YXWA 4C7OB 1SVMA 4H9GA 4JYBA 2VA8A 4PQYA 3WNCA 4I1SA 2QTFA 2CNWD 3LH5A 4PC1A 3V4RA 2RGGA 5KYKA 2ZPTX 4KU4A 3QKSA 3PVSA 3I92A 2J59A 4RJLA 3VU9A 3DOEA 3P20A 1E9FA 1VG1A 3K53A 1DO0A 4FI3C 4LJYA 1IY2A 3ZIAA 3A58B 1CBUA 3KZ1E 3WMEA 3WRXC 2GDJA 2JJ2A 5JCPA 3TAUA 3DM9B 5KO2A 3PENA 4Q4JA 2JJ2D 5TB5A 5C18A 1VG9B 4EJSB 3ZQJA 1YRBA 3B8HA 1YR6A 2J7PD 3K0CC 4Z8XA 2PEZA 1AGPA 3ZDQA 4RKFA 2ZRIA 3PIRA 2PMKA 1YR7A 2GTPA 1GIAA 4PQFA 5IK2D 3BB4A 4D82A 1ZM9A 2WKQA 4QGGA 4M1KA 3I4LA 2VEDA 4WVFA 1RJ9B 2YNMA 3BFKA 2ZRHA 4DJTA 4MRNA 1NMZA 4A6XA 4ACBA 4C0HA 1OE0A 3X1WA 2RHMA 1C4OA 4FW9A 4M1SA 4B75A 1CRQA 2HEIA 4M1TA 1EWQA 2RKOA 4FWTA 1H65A 4IVRA 1GTVA 2WIBA 4NYJQ 2QNRA 2QROA 1SZPA 1W44A 2ZRLA 1JECA 3SJAA 4XWKA 4CVNA 1WB9A 3K0FB 4I99A 5J47A 1OLOA 4A1FA 4GP6A 3JZMA 1W48A 1J8MF 4Q00A 521PA 1RPZA 1G17A 1X8LA 2EFHB 2FEMA 2ZYUX 4JLKA 3UK6A 3WYFA 4B47A 4U7DA 3R8FA 3BIFA 4OJQA 2CJWA 2KSQA 3TSWA 3O8CA 2EFGA 1EG7A 1O87A 4WBSA 3QXJA 221PA 4PHFA 5M04A 1HE8B 4MGIR 4YDHB 5FTJA 2ORIA 4X8LA 3NEYA 3LQRA 1GKUB 4UNSA 1NVXQ 4B48A 2PZFA 3L0OA 4ZCMA 2EFEB 1HY3A 2A30A 1N0WA 5E3HA 3MRSA 1N25A 5EP2A 3D6TB 1W5SA 1E99A 3GPLA 1TAGA 5DI3A 5JI2E 2XXAB 3IBYA 3J81k 2IS2A 3NG1A 1E9AA 4A0FA 1CJUC 1U8AA 2JLRA 1G3RA 2FPKA 4L4UA 2CHVA 3CB4A 2JIZA 5FI0B 4CEIA 4AD8A 3LVQE 4KV9A 4TYWA 1OT3A 3FYHA 3FHOA 2ASEA 1XEFA 3QI2A 1P2UA 2R44A 4E22A 5GJCA 6Q21A 5LB4A 4QRHA 1DBSA 3H1TA 2DFTA 2WBLC 2ZJ2A 2Y8EA 4B3DA 1OB2A 5CLQA 1IJEA 1N3BA 1E1QD 3L0SA 3GJ0A 1E2HA 2IYXA 2WMOB 3P1JA 4Q4AA 1XRJA 4B33A 1LY1A 4YLGA 4TLEA 2GXUA 4ZV4A 4CEJB 5JJLA 1KTVA 1BMFA 4TQUS 2QM7A 5JBQA 1TF5A 3QEOA 2PLFA 2HYDA 4GFDA 4A8JA 3BORA 1UM8A 5FTMA 5B30A 1M34E 1Z0JA 1R5OA 3BB3A 5BW8A 2WICA 1FPMA 4AY2A 5EP4A 4B6EA 2IX3A 4NP6A 1LNZA 5FR1A 1W36B 2G88A 2QEQA 2WJIA 4K46A 3GP8A 4X8MA 4IOKA 3GD7A 2AK2A 1NVVR 4Q5IA 1XEWX 4BECA 5FPKA 3GLIE 1COWD 4GOKA 4LBWA 2O8BB 4DDWA 2PEYA 2BWJA 2CE7A 5HE8A 1UBGA 3ADKA 4NCIA 3A36A 1J70A 4RZ3A 1AKYA 3QSYA 2C8VA 3Q3JB 2O8CA 4PO9A 3KQLA 3GJXC 2FGKA 2FPLA 4DLUA 1H8ED 2VHQA 3QVUA 1TF7A 1XP8A 4KFSA 4P4UA 4TMZA 1RRFA 1VG0B 2FV8A 4QGAA 5IHPA 3MMPA 2H16A 4P4SA 2FFBA 1X6VA 4HSEA 3TJZA 1XEWY 2YC4C 3NBXX 1T8UA 2DWPA 1KHTA 2CK3A 2Q3FA 2F1HA 3P4XA 4DUGD 4D6PA 2D2FA 3RS3A 4GOJA 4LI0A 4TMTA 2GZHA 4LYFA 2ZRFA 3MJRA 2GZAA 3GLGE 1TQ4A 4IOLA 4W9MC 1EFHA 1W2HA 2D3WA 2VP2A 1E9DA 3VKGA 4BLRA 4H1VA 2OM2A 1KNXA 3KKNA 2J7KA 4JVNA 4JBXA 2DBYA 3VR1A 1CXZA 4Q48A 5L3QB 3THXA 1VTKA 5JS7A 4OK6A 2WOJA 3BH7A 3T34A 3R9WA 3SJZA 4AWXA 3AVOA 4E5UA 2R2AA 2RGNA 4HUTA 5DN6D 2IXFA 4KODA 3WP1B 2ZRMA 2OBLA 3UATA 3PR1A 4L9SA 1ZNYA 3UWOA 4B2PA 4N1AA 5DIFA 3NKVA 2QG6A 4IEEA 1GKIA 5CDFE 4KSBA 2AWOA 2CCGA 4I1OA 2N46A 4J0QA 2WAXA 4OHXA 5KDLA 4A2QA 4PO8A 1NLFA 2Q21A 2O0HA 1KJZA 3UPUA 1JEDA 1SXJB 3LFUA 5JRZA 1E0SA 1W4BA 4L9WA 1N6OA 1QHHB 3JVVA 2I4IA 2EW1A 2V54A 3QKSB 5JRJA 1FQJA 2HUPA 5B58C 1OHHA 3EC1A 3RRMA 3W90A 5JECA 1YU9A 3MLEA 4D80A 1UKVY 1U90A 1KI9A 5EXTA 2CCKA 1Z0IA 3CR7A 4AC9A 1VCMA 5J40A 3VR2A 1Q57A 1Q1QA 2CDNA 3FFBA 1XU4A 3K1JA 4TL9A 3CWZA 5FUYA 1UEJA 1ZBDA 2ZJOA 3MSXA 2ZRCA 2EYQA 1CR0A 1ZAKA 3MWYW 4M9QA 2FF7A 3SS8A 1KJYA 1JR3E 4GRAA 1HT2E 3D8BA 2ZEJA 3CRQA 4HEJA 1T0HB 1YVDA 4JBWA 3ZVNA 4L5BA 3B9PA 1DAGA 1JNYA 3FOZA 1R5BA 1X8KA 1Z8FA 3QKRA 1OFUX 5CJ2A 2WWXA 5A4JA 4F93B 3NIBA 2ORWA 4OI0A 1CKEA 2BCGY 2QE7D 1Z3IX 3KX2A 1EESA 2IL1A 3TLXA 4BFTA 1QVAA 3GEHA 1VHTA 1L4YA 4G3XA 4LJ5A 4BFUA 3WY9A 1E2IA 5H70A 1Y63A 1UDXA 1S4QA 1D9XA 1FX0A 1II9A 2BJWA 2GILA 3U3KA 3SEAA 1G8HA 3HPRA 4RFSA 1YRAA 1N5JA 2YZ2A 2ZSBA 4TMKA 1RYHA 1NN0A 3I73A 1W7AA 1UJ2A 1M7HA 4HDCA 2Q9CA 5DO9A 4HLUA 1II0A 5KNDA 1X1SA 1ZD9A 4TYNA 3L2OB 1AQUA 2JDID 5FOXA 5H68A 1R7RA 2IEZA 2P0EA 2Q9AA 3GLFB 1VYUA 2I1VB 3TMKA 3GJ7A 2X1VA 3KQHA 5G3ZA 2P6RA 1ESMA 3ZGXA 3KQUA 1R0YA 1GP2A 2HXYA 1Z63A 2ODWA 2CJWB 1JJ7A 1N0UA 1X1RA 1ZUHA 4HDOB 4NMMA 1M7BA 3RS0A 1SVWA 1E98A 1ZM3A 4CZ2A 2AD1A 4LDJA 5K8TA 4DB2A 1TUEA 4QBFA 3NC0C 3B2EA 2OSBA 1FL9A 3LW8A 1MO4A 4AYWA 2G0TA 4CF7A 4WIAA 1XTRA 2ZJBA 1P5ZB 1G7SA 2BBSA 4XVQA 1MR3F 2Q0HA 2GF0A 2OESA 3A37A 4IOJA 5EZ5A 1Q21A 421PA 4CGZA 4LC0A 2FA9A 4B35A 2QMEA 3LWNA 3OFNA 2YHSA 2ODEA 1CF4A 3X1ZA 5JS8A 3OFND 2WWWA 4D4JA 4MYCA 5C46F 1J2JA 2HT6A 3B1YA 1G8GA 1P60A 3FPAA 1R4AA 2ZJ5A 3K8YA 5SZJA 3G0HA 4DVGA 2GWHA 3VR3A 2ODNA 3RNLA 4Q4AB 5KPJA 4M1YA 4C9BA 2B92A 1PUJA 3W3AA 3AVXA 1KI7A 5JZVA 2X19A 3NBYC 1AIPA 2PLRA 4FINA 2NPIA 4XVUA 3HJNA 5EE1A 4X8HA 3OE7D 4ABYA 2Z4SA 4B6FA 1QVRA 4JLDA 1Q12A 1I2DA 1NVVQ 2BMJA 3ADBA 2IWHA 1YJ5A 2ZE7A 4TZ0A 1E79A 5FBVB 2RGBA 3LV8A 4NYIQ 1XXHA 1HTWA 4DHEA 1UKYA 4II7A 4RFVA 5A0FA 1NN5A 4DSOA 1SKYB 4R2HA 4US2R 4AYTA 4KCGA 4R7ZA 1MKYA 2GAAA 2FFAA 4DCUA 4XJXA 4CT4B 5AWFC 4TYYA 2IUUA 2VHTA 2E87A 1KAGA 1LF5A 1YKSA 5DNYB 2D7DA 4DSNA 4M1OA 1M1YE 4IDHA 4EFLA 2VLIA 2V55B 2ZANA 4PX9A 1HUQA 1ODFA 2NQ2C 4QXAA 4MGZR 1UF9A 1KMHB 4QHSA 3B1VA 1Z6AA 2RH5A 3TR0A 2RGEA 4WZ6A 1VMAA 2XJ9A 4GOXA 2ZSFA 4LY6A 2FFHA 3HYRA 2V6IA 1IONA 1L2TA 3MG9A 4BFSA 4DEYA 4C2TA 2NO7A 1ZVQA 2XZPA 4Q19A 2HJGA 1HYQA 2Z5FA 3LQQA 4OI1A 3SJBA 1E69A 3U3OA 4P4SB 4WAUA 3VMFA 1KSGA 1AA3A 3GLHE 5H8WA 5JFGA 3TW4A 3EA0A 3IEVA 1IXRC 3A1UA 1CR4A 1M7GA 5JSZB 4C0KA 1YZTA 2X2FA 1R6BX 3LX5A 1M8PA 1HQCA 1TUIA 5P21A 3DDCA 1OB5A 3BAFA 4OQFA 2F7SA 2ANBA 3QF4B 3QY0A 1F2UA 3NHBA 1NI3A 2V3CC 2UVQA 2VHUA 2GCPA 4HLQB 2H17A 1QF9A 5CM8B 2W6JA 4DDTA 4Q03A 1JALA 1P9WA 2W6JD 1SVKA 4OJKA 4MQBA 3AF2A 2HLDA 3ASZA 1AM4D 1EX7A 4HB2A 2A5JA 3MWKA 2HLDD 3VQTA 5HPYB 3FGNA 3A1VA 1E3MA 3NTUA 5FBWB 1G19A 4JSYA 4MDEA 2REXB 3KXIA 3ZS8A 1W0JA 1MABA 5DYIA 4PZYA 5DH9A 4RZUA 4E07A 4OI2A 1KAOA 1E2PA 3OESA 1QG4A 1N6HA 1MRSA 4LJ8A 1OV4A 3T1QA 2W83A 3CRMA 5FL3A 3UMSA 2GNOA 2B6HA 2R6DA 1II8A 4RD1A 4OL0A 1G7TA 1WCV1 4M0LA 3U7HB 2OBNA 3L43A 2H8KA 3W8RA 5GVSA 3WMFA 1G4AE 3HYTA 1U9IA 3ICEA 3C15C 1IN4A 3CZPA 5F9FA 3DHWC 5DISB 3T1TA 3Q85A 3NDBB 3VTKA 4MKFA 5AUOB 1NLYA 3U4QA 4URXR 2ZI4A 1ZCBA 3TVTA 2C78A 1E2FA 4Q1EA 3SHWA 4B2LA 5J4HA 3OEHA 2FNAA 1BOFA 1OXVA 3AUYA 4M4SA 3R9IA 2JLYA 3OEHD 1Z28A 1OH7A 3F3YA 4K81B 3ZH9B 5BWMA 4PPNA 2NOAA 3TK1A 2XTZA 1KI2A 1W4CA 1G21E 1XEXA 3I5XA 1GRQA 5KUTA 1I4DD 1S1MA 3BD9A 2WJGA 4HATA 4KBGA 2NTYC 4OHWA 3SFVA 1R8QA 3IIKA 1U81A 4DWJA 3K0AB 1IJFA 3W34A 3O8RA 1Q1BA 1US8A 1Z83A 1QHYA 4KFTA 3X1XA 3GLIA 1QHNA 4QBHA 2WWIA 3FKSD 2VSFA 1OIVA 4DLWA 2JLVA 3TQFA 3W8NA 1FTSA 2VH5R 2QM8A 2F43B 4EIWA 2DWOA 3VR5A 2XJ4A 3PEYA 2H1LA 2D2EA 1XB2A 4QG7A 1E0AA 4PAOA 2BDTA 4Q9HA 3C7KA 4M53A 4PAMA 5FL7A 1C1YA 5F3WB 3X1YA 2P2LA 1YZNA 1A82A 2GKSA 4UNNA 1GDDA 2QN6A 3GFOA 1SVLA 2QL6A 2ZYVX 1GILA 1YZGA 1RYFA 3MAAC 4UJ3A 4WOPA 2HV8A 4XWOA 3KKMA 2QQ0A 1GWNA 4AK9A 5UKDA 3E2IA 1Q3HA 4NYMR 3TIFA 4IDOA 4UXIA 1OF1A 3GLGA 2R8RA 1NSFA 1M6NA 4O0MA 4M1WA 2XX3A 4KJZA 2KJQA 2BKEA 3O8BA 2EWVA 2R6GA 4HAZA 1ZNWA 4W5HA 3TE6A 3U44B 4MYUA 1SVOA 2FX3A 5AUNB 2CE2X 4RCYA 2VP4A 1Z29A 4DB4A 2ATVA 1WA5A 5CDFA 1UDWA 2N1BA 4IOMA 5FR2A 4DDVA 1GRNA 4UNQA 1E1RD 4BZPA 3EZ2A 3DKVA 3QXSA 5IT5A 4WZBE 2A3RA 3B82A 1IOZA 4BEBA 1W36D 3LBIA 4KXFB 1MOZA 4Q1BA 4MA4A 1JR6A 1GOTA 5B57C 4TT3A 2QBYA 4JIMA 3QEJA 2LKDA 4C0LA 1BIFA 2XTNA 5SZKB 1RZ3A 4F4IA 2JA1A 2OCYC 3T5DA 4Q18A 4TWZA 1GZSA 2VF7A 3KTAA 4B76A 2GEVA 4W5WA 4ZCIA 4JL8A 3KUCA 3OEEA 1YHNA 2PBRA 4HB4A 2WIAA 3SDZA 2D06A 4OK3A 3OIWA 2I3BA 2AN9A 4M1MA 1XXHB 4M22A 1JR3A 4FMDB 1FP7A 5EXPA 1PJRA 1JR3D 4FCWA 3AP2A 2ORVA 1TADA 5BYKA 3ONWA 1HA3A 4XOIA 1KKLA 3BERA 5CK5A 3VR6A 3TUJC 1YZKA 2MSDB 3EASA 2LKCA 4TZ6A 4NHOA 5AK0A 4ZIRB 1LFDB 3AP3A 4PC7A 1UFQA 3W5IA 1N5LA 3DZDA 3ZJYA 2H18A 4LHZA 1Z06A 4Q4HB 621PA 2CNWA 4NH0A 4DT1B 3RC3A 1D2MA 1GRRA 5HCNA 3NEJA 1AS2A 5HE9A 1W0KD 5AUPB 5BN5A 5CIQA 1ZD8A 2OLJA 2IF0A 2ZS9A 4NCHA 3FVQA 2NZJA 3TRFA 3OHMA 1XDBA 2QP9X 3QXCA 4B2IA 3QKTA 1SVSA 1ZD1A 3FB4A 2OILA 3BWDD 1KO4A 4ZO4A 3B78A 4DLTA 2J7PA 3IHLA 1F2UB 1QZXA 5LD2C 3SE0A 2BIFA 4QBIA 5L3RA 5LPNA 3AVUA 3A6PC 2CL7X 1SXJD 4IFBA 4LJ7A 2IS1A 1VPLA 5IK2A 3ASYA 5KDOA 1EFRD 2YV5A 5CYPA 4YMUA 3THYB 1NSTA 1XF9A 4LV6A 2OAQ1 3AEZA 1E2KA 1Z0KA 4LV8B 4WW0A 3ZVLA 3K0SA 1NKSA 3KKQA 1KDTA 5DGXA 3TUIC 1GAJA 4XVRA 1VECA 2ZI7A 4MKHA 4BPBA 2FZ4A 2JLZA 4DSUA 2YVUA 1FUUA 1OJLA 1ZRHA 4CYMA 3Q5EA 3RLFA 1KI6A 4A8JC 4JL6A 2ZSAA 2FSIA 4GL2A 2KWIA 1ZP6A 3N2IA 1ZM4A 1LF0A 1L4UA 1N6KA 5GJBA 2YKGA 2VSOA 2NMVA 5KOYA 1XMSA 4D0GA 1E2EA 4KLZA 5AJYA 4TL6A 1PZNA 5JJIA 3KUDA 3HPQA 1OXSC 4JVLA 4RD4A 4MGYR 4N0DA 2I1QA 3RS7A 4DBLC 2XB2A 3CX6A 2VHJA 1P61B 3FE2A 1ZW6A 1E2LA 3PEVA 4LHVA 3P27A 2J0UA 2WPDD 1B23P 5KPDA 4D2IA 1GUAA 1DS6A 2O8EB 2XOKD 3KXLA 1IXZA 4V0ME 3THWA 2A5GA 3REFA 2P67A 1W49A 1W5TA 2B7BA 4EPRA 1V5WA 2OG2A 3AVVA 5CLLA 3C14C 4LK2A 4BFXA 4UNRA 1IBRA 4Q1DA 1XJCA 2AFHE 5EP1A 2ZUBA 3FMOB 4EQ6B 5KSZA 2CVHA 4IRUB 3GQBA 1LS6A 1D8TA 3CR8A 4TLDA 2HDNB 3DL0A 2IYZA 1MO3A 2J0SA 3FDIA 1WBBA 3CKLA 3GJ5A 2BV3A 2P6UA 3LLUA 3M0EA 4PZZA 2J0QA 4Q4LA 4P31A 2KB0A 1NMXA 1E2JA 2J1LA 5JHGB 2QT1A 3JZAA 4NBSA 1GVNB 4A6PA 4F4CA 3DPUA 2YOHA 4DCVA 4DLSA 5EXSA 1TQDA 4DIDA 2DR3A 3CRVA 4AKIA 1NBMD 3VX3A 4GT1A 2XSZD 2JLXA 2KE5A 2ANCA 2RGNC 3UKDA 3AP1A 1DO2A 1E1QA 4Q9KA 5L3SA 4DLVA 2PX3A 4M2LA 4OKSA 4NYMQ 4EFMA 2QPAA 1T91A 4GNKA 4P4TA 2B21A 5E95A 3ETLA 4URVR 1ZM7A 4HUQB 2WTUA 3GLHA 2V1XA 3HU1A 2JAQA 2LCFA 4JT2A 4GMXA 2GXAA 2D74A 4WA7A 3THOA 2JJ1D 1GM5A 2O8FA 4YMWA 2K5UA 1IQPA 5SZHB 4B3BA 1F60A 4JT4A 1P4SA 1OH6A 3TKLA 4HAWA 5FUVA 2YWFA 1COWA 3DEFA 3W6NA 1GNRA 1TF2A 4IEIA 4NYIR 3CZQA 4MRPA 5LB2A 4K8OA 1XCGB 2F1JA 4AIIA 2ZS8A 5EZ6B 1J99A 3MCAA 2C2HA 4A2PA 5DYGA 1H8EA 1ZMXA 1NNEA 4BUJA 2CEAA 1NG1A 1KDOA 3AF3A 4Q01A 3PFIA 1E94E 3PJRA 4PO1A 2GVZC 2QP3A 4LSGA 4V0LA 2PCJA 2R9VA 1E0JA 3LDAA 4U00A 5HZKA 2CVFA 5TARA 1K8RA 2ZE6A 3A1SA 3CRRA 1NF3A 1SVIA 4LPKA 3ZLJA 2H7VA 1D2EA 4ARZB 3PXGA 4Q9LA 4UKDA 4US1R 2B8WA 2ONKA 4DUGA 1UBEA 2P6NA 3BE4A 3G82C 3CNOA 1L7VC 3KJIA 5FUWA 3K0EA 4EAQA 4L16A 4BEJA 4NCNA 1NRJB 1WXQA 1NVWQ 3B1WA 3RRNA 4B43A 2FSFA 4HLUC 1CTQA 1ZU4A 4B3XA 4F38A 3D3QA 1GL9B 1RKBA 4LGMA 1R0WA 2ZSDA 1Z6TA 3EZ6A 3EPHA 4PFSA 2BM1A 2GBLA 3WYAA 3IO5A 4BASA 5ANRB 5DN6A 4LYHA 1R5NA 4KLNA 3LW7A 3ZZUA 3AUXA 3CUEF 4AURA 2ZUCA 2Z4RA 2BM0A 4M8NE 2OE2A 2DFKB 2WJJA 1ANKA 2O8DB 4E09A 4JJKA 1A4RA 1XPRA 2CL6X 4R71A 3RSOA 4F92B 1G18A 2WM9B 1DAFA 1A2BA 4PXAA 3ZZTA 2D7CA 4IJMA 1OXUA 2ZI6A 3GMTA 1RRCA 2FE4A 2JLSA 3OIUA 2DY1A 4EDHA 2IYWA 4L8GA 1VCOA 3VU9B 4G01B 2FGJA 1SGWA 4B71A 3V9PA 3DOFA 5CB8A 1E4VA 3BK7A 2ZUDA 1AA9A 2DFNA 1YR9A 2J87A 3DZ8A 4Q4JB 4U02A 4D0LB 1OIWA 2RGAA 3CBQA 3CPEA 4FMBB 2GK7A 2V6JA 1FZQA 4B74A 3VNVA 3K70C 3KFVA 3KKOA 4URWR 1BKDR 4PANA 4PQRA 2GF9A 1YR8A 4F91B 1T6NA 1HQYE 1S3GA 4Q7MB 1ZIPA 3REGA 1E2GA 4EPTA 5EUMA 1XTQA 4QC2A 4NDZA 3FMFA 3QQ5A 1BS1A 5TV2A 3W6PA 4CIDA 5EJEA 2QE7A 3NDPA 4CEHA 1VG8A 1E0KA 1XJ0A 2GETA 4KFUA 4W7SA 1TU4A 2KBFA 5L3VA 4POAA 3PV0A 3VNUA 1KO7A 3SOPA 1P75A 2AKYA 1JAHA 1AZSC 2W2VA 1UBCA 1XD2A 1N6IA 3MD0A 2FJUA 1JXOA 2IWRA 4XTRA 2F3TA 5D3MA 4JZKA 2RCNA 5GJWC 3UWKA 1ZJ6A 2JDIA 4JLPA 4KYUA 3FMPB 3C16C 4WXPA 1VKJA 2BHRA 1I2MA 2WWGA 2ZROA 1W47A 2FN4A 2MSEB 4XTCS 5AJWA 3EX7C 4B3CA 2QENA 5A5GA 1L8QA 1SXJE 3IO3A 1XTIA 1E2NA 3O8DA 2V4ZA 1IHUA 1P62B 1A2KC 2J46A 3THWB 4F4JA 2Q3HA 2HJVA 2ODBA 3SQWA 2Q3MA 2REOA 4A4DA 2G3YA 2VO1A 4QL3A 1W1WA 1Z0AA 4HDQB 2UZ3A 1DARA 4Q7LA 4B44A 5FUXA 2O52A 5DHFA 3EPKA 2IA5A 3AF4A 4LV5B 2CBZA 4O3MA 1S1CA 3CONA 2IHYA 4NTZA 4P0TA 4RZXA 2PT5A 3CRW1 2FZLA 5DI3B 1KSJA 3U3JA 5JJKA 5JWOA 1G3UA 5HKKA 3SFZA 3T12A 1BO6A 4HZIA 2EFDB 1UBFA 1IN6A 5HKKD 1KK0A 4MYHA 1GFIA 4G5OA 4OQNA 2CLDX 3EARA 4CEIB 2P3SA 3BXZA 3TVDA 3V4FA 3AGPA 2IYLD 2WVJA 2EWWA 3OF5A 3A1TA 4OQLA 5LD2B 1E9BA 3EIEA 1U8YA 5C1BA 2OCBA 2O5VA 1KO8A 2VIIA 2ZQ5A 1P6XA 4HI0E 3WNDA 4C0SA 3UXMA 1EK0A 4MYTA 3R7WA 2J3EA 4XIGS 3KJGA 1YQTA 4TTPA 2FWRA 1OFHA 3C41J 2QMUA 4ZDKA 2WJVA 4TYQA 3ZVMA 4V0KA 1IY1A 2HF8A 3FHCB 1N6NA 3AB3A 3OE7A 4KITB 4FXPA 2QUZA 2XNSA 4A8JB 3K9LA 3RRYA 4WZAE 3A4LA 3QF7A 4EPXA 3GJ6A 2O8FB 1QHGA 4ESHA 3GLFE 2PZEA 5FPTA 1CJVC 4JLOA 2JJ8A 2ZETA 3PEUA 3E1SA 1LB1B 2BMEA 2GJKA 1U9IC 4A36A 1N0VC 3BS4A 5BYJA 2MSCB 3CWQA 2FPMA 1G64A 3DMDA 3DVLA 3RAPR 2FU5C 2ZYTX 2OXCA 3PG5A 4RD0A 4RD6A 3IBGA 2F9LA 1DAKA 1T9HA 1IY0A 2CHQA 2J5XA 1QHSA 2O8CB 1NBME 1R10A 1D2NA 1G7RA 3S1AA 3QOFA 3C4JA 3AH8A 1FP6A 2IYVA 2ZE8A 3HDTA 4ASUD 1UKEA 3L0PA 4LJ6A 4NONA 2ONJA 5G40A 3SJCA 5F98A 4FMCF 3U5ZB 4PC2A 1F5NA 3EIHA 4E03A 2ZRDA 4JKIA 1N6RA 2QT0A 1PLLA 2WMNB 3PUZA 1KDRA 4X8OA 1RIFA 4LJ4A 1JI0A 1Z5ZA 3T61A 1R2QA 2ZVQX 3Q72A 1YZQA 1EFUA 4XD7D 1GNPA 1Z6GA 2QAGC 3FHTA 3LRPA 2OHFA 3AVPA 1I4TD 2G83A 2Q9BA 2WSSD 2CLCX 4C7OA 4Q66C 2ZTSA 4TMVA 3IQWA 2HT1A 1ZNXA 3SI7A 3SYKA 5J4LA 1H8HD 5J4KA 4V0MA 1JXMA 4NKRA 4TQ9A 3Q8XB 2PH1A 3THXB 2XZLA 4TSFD 1IAQA 5FI1B 4GPTA 2CHGA 1HURA 4KFRA 1XNJA 4OK5A 2BMFA 4TTQA 1SULA 4I81A 3LD9A 2J41A 4YONB 4D25A 1KY2A 4MITA 2QMHA 3N70A 2AXNA 4EJSA 1ZU5A 1RRPA 3K9GA 4EPWA 4LPSA 1W2GA 2WKPA 4R2IA 2GEUA 1ZC4A 1SKYE 4IXNA 1XTKA 4JL5A 2ZITA 2JASA 3B6EA 3RDPA 4AKHA 5EE9A 1TX4B 4B73A 3FMIA 1VYVA 2XZOA 4LBVA 3G5UA 4KSCA 1LV7A 4XH9B 5E4FA 1G6HA 1GL7A 4GZMA 3SYNA 1OH5A 5DHAA 1CS4C 3E70C 2ZU0C 4OQMA 2IYQA 2EYUA 3UMRA 3IKJA 4Q1AA 2CLSA 2OT3B 2ZAMA 3RWOA 5JCZA 4O2RA 4PPGA 4S2EA 2IYRA 5B2ZA 1U99A 4GP7A 3B85A 3KDSE 3WHLA 2HCBA 2OFOA 4NZYA 1G3QA 1NY6A 1TPZA 2VP0A 4NCKA 3NH6A 5KNBA 1UPTA 3BC1A 4TL7A 3GJ3A 5EE5B 4JVSB 1T3SA 2VL7A 3KFXA 3HR7A 3RYTC 2P5SA 3QKRB 1ONBA 1JAIA 2VPPA 4I1VA 4QJ4A 4CEHB 4Q7KA 1N5KA 2YOFA 1K5GA 1XPOA 2G6BA 4QM7A 1MRNA 2YWEA 5C2JB 5AJVB 5K8UA 3QE0A 3QKUA 1TQ6A 2A78A 1FX0B 3SZRA 3FKSA 2QAGA 2QPOA 2ZRNA 4RFSB 4DC9A 1XD2B 3MUFA 1FNMA 5GADl 4FMDF 2BOVA 5TY0A 1KK2A 4LBZA 4NL4H 2C95A 3C8UA 3U7EB 1Q44A 1CJMA 1G8YA 1RVDA 1FMLA 5TVKA 2QTVB 2DYKA 2KI5A 3PUYA 4QNMA 1KKMA 2XXAA 4URZR 4PC6A 4TLCA 2BBOA 4ON9A 2VP9A 2J9RA 2ZJ8A 1B0UA 5KDDA 1TEVA 1KDPA 2IW3A 2Q6TA 1LW7A 2R6FA 4CDGA 5CB6A 3H86A 2FG5A 2W00A 1MH1A 4IDQA 1RRGA 4BFZA 1DAMA 4ERNA 2WWHA 2AD5A 3DMNA 5IDVA 5KSPA 1MO6A 3SBDA 4BLQA 4F7WA 4QKQA 4P33A 4PC3A 1DVRA 4ZI2A 1NKTA 3DO6A 2D62A 4Z1MD 2G1JA 3TSZA 3CW2A 4FCTA 2BBTA 5FFMA 4LOAA 2AHOA 4HLDA 2XEXA 4CEJA 1D9ZA 4RCZA 2HXSA 4BLPA 1NJGA 5G41A 5C4GB 4YMVA 1TMKA 1E9SA 4MKIA 3UG7A 2NPFA 4B3FX 1VIYA 4YMTA 1E1RA 4R98A 3K70B 2JATA 2GCNA 2ZREA 3QBTA 3R8CA 3LX8A 2OBMA 1AJEA 4PSKA 3T35A 3DKPA 3X1DA 4AKEA 4V0OA 4NPHA 2QPTA 3O47A 3QPUA 1ESNA 1WF3A 3IEUA 5FOWA 3GJ8A 4C2UA 4Q02A 4GZLA 1QG2A 2IYTA 4DIEA 2ZRAA 1XD9A 4ZDJA 1KZGB 4LHYA 4G5SA 3QPVA 2CXXA 3W6OA 3CF6R 1FQKA 2JCSA 2VF8A 4AG5A 3B1ZA 2R6CA 3A4NA 3TSOA 4ZI3A 3ADCA 1AQYA 3TQCA 1NP6A 1G3IA 2ZI5A 3EWSA 1CP2A 1UKZA 1P2VA 4D4MA 3F0TA 1OYYA 1O3YA 4IDNA 3CPHA 1P7CA 3OAAD 4D26A 2N42A 4JLBA 3SYLA 3Q5DA 1KJWA 2IUTA 3QUSA 4LCBA 3S1AB 4Q1FA 3Q7PA 2OAP1 4DDUA 2DB3A 3ZS9A 4TN1A 5JWHA 2W0MA 3H0KA 4DCNA 3V00A 1F48A 4BLTA 1PVOA 3BH0A 5L3QA 1DG3A 1GG2A 1OIXA 1AN0A 1OXTA 1W0KA 2H5EA 1SQ5A 3K09A 1P9RA 4N3NA 4LRWA 2XB4A 2BEJA 3BH6A 1KK3A 4W5JA 3NXSA 2ZVPX 4I1UA 1KOFA 4TQAA 1CIPA 3LBHA 3NH9A 4JLJA 1MT0A 3VHXA 2YC2C 3WRYC 2PZGA 2DWQA 3MWJA 4HAUA 1E9CA 2QGZA 1T3LA 3BRWD 4C0BA 2ZXUA 2C9YA 2IF2A 2J45A 4IVQA 4YXWD 3X2SA 3ZD6A 1SXJA 1R8SA 2WAYA 3HU2A 1QHHA 1EFRA 4MRVA 1Z2AA 3L8YA 4ZKDA 4HB3A 2IHBA 5CITA 2IT1A 2VRWA 2QI9C 5DE3A 2VBCA 5DSZA 2ZE5A 1PLKA 1DADA 1JEEA 2WJHA 1KMQA 4IDPA 2H92A 1OH8A 4JYCA 2C9CA 5E7MA 3ZIAD 2GK6A 3NBFA 4HYYA 2AFIE 1U0JA 2ZYWX 1S3SA 4L15A 4BWYA 1PV4A 1EFTA 4C30A 2VQSA 1EXMA 1MABB 4C0QC 4OHZA 5J4YA 5LDDC 5EP3A 3GFTA 1QHIA 4BGDA 4CW7A 1XXHE 4Y0VA 4D0NA 4A82A 1J8YF 3CIOA 1W4AA 3UIEA 2HCJB 2VTKA 3PITA 4ZCLA 3KKPA 2ZM5A 2C9OA 4LZZA 2ZRPA 2NO0A 1KIMA 2KBEA 3HWSA 1QBKC 3P4YA 1A5TA 4C0JA 1II8B 1WRBA 2YJTD 3AM1A 5GJVC 4O2LA 3LO5A 5BXQC 3I1FA 3WHKA 4BZQA 2OFWA 3DM5A 2L0XA 3LBNA 1XCPA 4KBFA 2QAJA 2WPDA 2JLQA 2SHKA 2QU8A 3LAWA 5CJPA 1Z0FA 2XOKA 2C96A 3U7FB 1GNQA 2C5LA 3U4QB 4RZ2A 1P9NA 4BFWA 2IYSA 4BFVA 4D4LA 4A0HA 3L0IB 1P72A 4PZLA 1ELOA 2J0VA 2C99A 3P26A 4C4PA 4A0GA 1NG9A 4GI7A 4Q21A 4GBMA 4NU0A 5FH9A 4LC1A 3SR0A 4LHXA 1BH2A 2BCJQ 3NBZC 5HZHA 3GLFA 4RSGA 1XEXB 2UKDA 3GEIA 4ZKEA 3K9NA 4HB0A 2EFCB 4AI6A 2PJZA 2A2ZA 2OO7A 2DFLA 5FPSA 3I62A 3CH4B 2C04A 1UAAA 3OIVA 1US8B 1EGAA 1G20E 2QAGB 1D5CA 3FKQA 3MFYA 5B64A 3GLIB 2X77A 3LNCA 121PA 2PCLA 1GSIA 1T0JB 1NBMA 2GBLC 1NL3A 2XSZA 2ZRKA 3QXXA 2GCOA 4TMXA 1R0XA 2Z6VA 4JBYA 4LYAA 3P32A 1I4LD 2DPXA 3Q7QA 2Z0MA 4KO8A 5CIWA 2IBMA 1QDEA 3TR5A 1T3HA 4PHHA 2ZS7A 2ZJYA 1G7CA 3AVWA 3BB1A 3AF0A 2WWYA 1WDTA 2BBWA 3SC3A 2BEKA 4G1UC 2R6AA 1HV8A 4OYHA 3EG5A 1W4RA 5CK4A 1Q0UA 2ZRBA 4D81A 2JIZD 2QTHA 1AGRA 2JJ1A 3CX7A 1E2QA 1CEEA 2QGNA 1Z07A 2MMGA 3K0CA 4PSAA 3GLGB 5GVRA 1CJKC 1GL6A 1NMYA 4DEXA 1XBTA 1TTTA 3VKHA 4QJ5A 2V9PA 4IXMA 3HR8A 1S2MA 1G3MA 1WE2A 2IK8A 1R0ZA 3KB1A 1XZPA 1C9KA 3K9HA 4LJAA 3EZ9A 1Q3TA 4RVCA 3T06B 1KK1A 2F3RA 4EPYA 1P2TA 2AL7A 2RGDA 3U60B 1K5DA 3CF0A 3SN6A 3RS4A 4QOSA 1JPJA 3QVVA 3BFXA 4MGKR 1VHLA 4UNPA 1BMFD 3D7MA 1Z6XA 5F2EA 3RS5A 2V7QA 3U7GA 2V7QD 2G1KA 3ECCA 5FPYA 1G16A 2D4HA 3I5YA 1DAEA 4JSTA 1DELA 1F2TA 2WZQA 4DLRA 2QA5A 3TH5A 3ZD7A 1N5IA 2AX4A 1WP9A 1WMSA 4LUCA 2WWFA 2YINC 1IM2A 1E96A 3AF1A 3GCGA 2F1RA 2FSHA 2BJVA 3T15A 1S9HA 4YMSA 4UJ5A 2WSMA 2A5DA 1W46A 2GAOA 3B1XA 4N0EA 2XGJA 4M9SA 4LX0A 5TMPA 1DTSA 4U5XA 2QBYB 3SNHA 1AS3A 4OHVA 3VX4A 3L8ZA 2VP5A 2QSYA 1KMHA 4Q7JB 4JVMA 2YWGA 1S8FA 3KTAB 2FOLA 1T8TA 3U6KA 3PEWA 4CT5A 5FOTA 4Q47A 1J90A 1NN3A 1PUIA 2CCJA 4IW3B 1N6LA 3U3MA 5E7JA 2IS4A 5AJZA 2R65A 5KHOC 2E9SA 4ITRC 1DAHA 3SHFA 2QY9A 5JEDA 1TQ2A 5JSZA 4XSHA 2CK3D 3ZQ6A 1TEXA 2AKAB 3EXAA 3KB2A 5DI9A 4HZUA 2FMXA 2NO1A 4FN5A 3EZ7A 4RKEA 1XD8A 3RC8A 1VDZA 1OFIA 1ZCAA 2A7QA 3QF4A 3QNUA 4MRRA 4DSTA 5IRCD 2QRNA 5HTKA 3GFPA 3NWJA 4QM6A 2UZIR 1FFHA 3ZVRA 1S0UA 2GXQA 1XJQA 1XFAA 2NO9A 5AR1A 3PCRB 1E2DA 4BRUA 4EFNA 1V43A 3KJEA 1WBDA 2GJSA 3I3SR 4TYPA 5HR5A 1K6MA 1G5RA 821PA 1TL7C 4QBGB 2ERYA 5JHHB 2QP4A 2WOOA 2VYFA 4A0RA 2ZIAA 3WMGA 1A1VA 2F1IA 1MO5A 2OXRA 1SHKA 3VR4A 4DZZA 4A15A 1KI1A 1ZINA 5G53C 4MUBA 4QNRA 3EPJA 2ZI3A 5ELXA 1ETUA 3E5HA 3PUXA 1PLJA 2ECKA 4BFYA 5FTKA 4LBYA 3UANA 4UQOA 5K8LA 4H1UA 1G1MA 1HEIA 2G0NA 1G9XA 4DXAA 3QENA 3U3RA 1G41A 2JLUA 4G5RA 4Z54A 3MWLA 1U94A 4Q9IA 3NVAA 1E4YA 4MDFA 3QG1A 3RSLA 2RAPA 3TGPA 1OHHD 1T4GA 1M2OB 1VIAA 1KY3A 2W6IA 4OQXA 3T5GA 3AVYA 3UG6A 2W6ID 2GJ9A 3H2YA 1IXSB 3L82B 5FPHA 4I4LA 4B3GA 3B7GA 4GMDA 2A5FA 4G5GA 1KI6B 5KSOA 4ZDWA 4ILEA 3EAQA 3I8XA 1U8ZA 5KSYA 2H57A 3VAAA 4DLZA 3I61A 3UMFA 1Q22A 1SHZA 1ZUIA 3EA5A 1LVGA 5CM9C 4PPQA 2YWHA 3M6AA 1OSNA 1VCNA 4HAXA 4MUAA 2QSZA 1KSHA 2NGRA 5CYOA 2FEOA 1NN1A 4P3YA 2J0UB 3MGCA 3K0AA 3TNFA 3BFVA 3EIQA 1X3SA 2Z83A 2F6RA 3CH5A 5BN3A 2IYYA 1CLUA 2GESA 4LJ9A 2FH5B 5G3YA 3AQ4A 4PHGA 3CPJB 1G8FA 2BMDA 1XMIA 2AK3A 2WJYA 5EQTA 2F43A 2W2TA 1X86B 3SU8A 2NO6A 2B7CA 1G291 3HU3A 3ADDA 2ZR0A 1ZM2A 3LLMA 3AGQA 3U6BA 4TLAA 1DOAA 1JQLB 5FTNA 3CNLA 4G0NA 1XMVA 2GEDA 2RGCA 1LS1A 4Q9JA 2HYIC 1Z2CA 2F9MA 4C0AC 1CR2A 4IHQA 2GCOB 1YE8A 3BGWA 1Z47A 3FFAA 2ZSEA 3MJHA 4R9UC 3F8TA 4OBEA 2BC9A 5K8IA 2PX0A 5H1YA 1Z0DA 1AZTA 3EW9A 5L3SB 3EZFA 3ZZ0A 2CMKA 3RANA 1FW6A 4EJSC 3VKWA 4M9ZA 3KXKA 3EWAA 2WV9A 3BJIC 3C5HA 3QG5A 4FWIB 4DLXA 2ZJAA 3R9XA 3U44A 1DAIA 3GLHB 4JKYA 1CRPA 4JLNA 3W9YA 2X8AA 4BQSA 4Z8YA 3K70D 2A9KA 2OZEA 4EUNA 2LWIA 5E7IA 5J5CA 2PMDA 3I8SA 4YQFA 3QXHA 3H4MA 3LY5A 3A8TA 1XCMA 1LTQA 4KI0A 1N6PA 4BRWA 4PHTA 4DCSA 2OCPA 2YOGA 1U98A 3ZYCA 3NC1C 3IILA 2XNDA 4A9AA 4PPFA 4QGFA 3AV0B 3CO5A 2XNDD 1OFTA 2VSXA 3AVQA 1NJFA 2V8OA 2ZU6A 4V03A 1DE0A 3ND9A 3A1WA 4ASUA 3PUWA 3H84A 4TTRA 1Q1EA 1E9EA 1F2TB 1XX6A 4US0R 4DLYA 2GA8A 3BBPA 1OXXK 4FCVA 5D3QA 4MRSA 1E79D 3RS2A 3SQXA 2IEYA 5IF9A 2OLKA 5AJXA 4IFEA 5FOSA 4XD7A 1G6OA 5AUQA 1QRAA 4AKGA 1AKEA 1DEKA 4CRWB 4ZIRA 2WSSA 4YC7A 5HCIA 3IPYA 4TL8A 2XITA 4BLOA 2IXEA 5JEEA 4HAYA 1RFLA 2OEPA 2IS6A 3C5CA 3QIAA 1T5IA 4PAQA 3SBEA 4Z51A 1KYIA 4PSVA 1H8HA 4Q4HA 4LWZA 4PTLA 4DT1A 1IN5A 1Z08A 1KNQA 3W5JA 2G77B 2A5YB 2HF9A 2OCAA 2ZRGA 4TSFA 3A4MA 4QHTA 4MKGA 4URYR 2IUSA 3PQCA 4JLAA 1U0LA 4DKXA 5JI3E 2ZI9A 3TUZC 3AKCA 4GDFA 4OI4A 5KTYA 1Q1ZA 1S9DA 1TU3A 1P73A 3PUVA 1Z22A 1U2RA 2ERXA 1HH4A 4HZUB 5LBIA 5JMTA 2NIPA 4BE7B 1RC8A 2DCUA 5TDHA 1E9RA 4EPVA 3KQNA 1JBKA 5EXXA 2OUKA 2JEOA 4AYXA 2RB4A 3N5CA 3THYA 2BKUA 2ZR9A 1RE0A 5BN4A 1P3JA 1XTJA 1E2MA 2OV2A 4AG6A 4ACAA 1NIJA 2QMOA 1QHXA 1J7KA 2E1RA 1RJ9A 4JLMA 1CJTC 1GKYA 1XWIA 3LA6A 1ZIOA 3RRZA 1KO1A 4BLSA 3QBVA 1W0JD 3WP0A 5DLQC 3GEEA 3VHLB 5EUQB 2ZJZA 2RHDA 2IYUA 5C4MA 5KNCA 1Q20A 3IIMA 1NVUQ 1AS0A 5TXGA 4A2WA 1CR1A 1FMJA 5JLJA 1FNNA 2MMCA 1IN8A 1T5LA 1EWRA 4TMWA 5L8VA 1DPFA 3IQXA 4KYIB 1N2CE 721PA 4NCJA 1W36C 1KSFX 3QPWA 2NG1A 4JS0A 3VFDA 1CULC 1NIPA 1A7JA 2R62A 4S35A 5FBQB 3U2QA 3AKDA 3KL4A 1Z6YA 3K0FA 4XSGA 1BYIA 1UADA 1DG1G 1ZNZA 2C03A 3IPXA 4NYJR 4KVGA 1FOEB 1RW4A 3FWYA 5BQ5A 2WKRA 1FUKA 3LXRA 3KQKA 1AK2A 3TBKA 2O8EA 5KU1A 4C3ZA 8OHMA 2EU8A 1OW3B 4P32A 3IUYA 3LXXA 4A92A 1KZ7B 3GJ4A 2B8TA 3EPLA 1U0HC 4HAVA 2XAUA 1MV5A 4UXHA 4YDSA 5D3MB 3Q9LA 2X2EA 1G5PA 2VHCA 2GJAA 4EQ6A 4FMCB 3NHAA 3OZXA 4V0NA 3RABA 3IIJA 3CNNA 1BYUA 1JQJC 4Q1CA 1NY5A 1G4UR 2QRZA 2JGNA 1KO5A 2FFQA 3IGFA 3CX8A 4TLBA 5FBLB 1KGDA 2XTMA 5J4VA 1F3OA 2RMKA 5FOVA 4O25A 1X8JA 1OKKA 2QZ4A 3IHWA 4PR0A 2W2XA 3K09C 1HE1C 1OKKD 2AR7A 4EKDA 4ZDIA 3WBKA 2DHRA 4B34A 4LYJA 1XMJA 1SKQA 4FD2A 2W58A 1Y3AA 4D4KA 5FTLA 3I32A 1FTNA 4Z1MA 2GHIA 5FL7D 2Z43A 1XTSA 1OPXA 4DCTA 4GSYA 4KVAA 4XWAA 5FOUA 2JLWA 2V1UA 4HUQA 3HP1A 2OFXA 2GXSA 4NE2A 2ZR7A 2ATXA 4JMPA 1YZLA 1SXJC 2CL0X 4KHZA 4BZXA 1JJVA 1VYTA 3CF2A 4QJ3A 3R20A 2C98A 2FDCA 3M1IA 1D6JA 1ZUNB 2GVDC 3B60A 3QJYA 1S96A 4RD2A 1P2SA 3WBJA 2PJRA 3M4YA 1JB1A 2AXPA 1KI8A 1EFCA 4Y0AA 1G8PA 1JPNA 3R7WB 3TW8B 2W0SA 3B5JA 2GJ8A 1F6BA 2O8BA 4RD3A 4FIDA 2GZDA 1KI3A 4KAXA 1XPUA 3F5FA 3WNBA 2VP6A 1KI4A 2G9NA 4IVPA 3KJHA 5EE0A 1YZUA 2F55A 2BVNA 3RVBA 5EE3A 1EX6A 3I72A 3EC2A 2ZAOA 1TNDA 2O0JA 2ZRJA 3W3ZB 5F9HA 4RY2A 4HLCA 3TAHA 2P65A 3CLVA 4QGHA 1E32A 3FTQA 5SZIA 4ARZA 2PT7A 2IC5A 1HT1E 4G5QA 5FBRB 4TT3D 4QFMA 1M74A 2FSGA 2TMKA 3OAAA 2NZ8A 1UEIA 3AKEA 2RGXA 1XZQA 3OIYA 1G5TA 1VCIA 3JVUA 3RHFA 1CU1A 4ESVA 3WYGA 4B32A 1E6CA 3AKYA 4OHYA 2QQEA 2YYZA 1GITA 3BOSA 3CM0A 4WXRA 2O0KA 3OEED 3T1OA 2C77A 3T1VA 2P5TB 4M21A 3IDQA 4IKEA 4V02A 1IN7A 4QHYA 2GRJA 4LHWA 4M9XA 2PL3A 3B13B 4JJZA 4DRZA 3ICQB 3U61B 3AVTA 4UXJA 4URUR 4MH0R 2AWNA 2EVWX 2IXGA 3WXMA
chains in the Genus database with same CATH superfamily
4JYMA 1EP9A 5A0VA 2JAUA 3ND8A 1ZYUA 2B1IA 3PDIB 3CF4G 2REBA 4P84A 2J9FB 3OCUA 4GXRA 3RBVA 3W5CA 5CD1A 4P35A 1ZRNA 5LXTF 4NV0A 3D31A 3WB9A 3H42B 3V4SA 3AY3A 3S1LA 2X0DA 4PQYA 3EVEA 4FP9A 5DJ5A 5JBNA 2UUBB 4I1SA 2FN3A 5JNVA 4U3JB 3LH5A 2RGGA 3HCPA 4MW2A 2PX5A 2C97A 4KU4A 1GR0A 2J59A 4MXDA 3R3ZA 3VU9A 1MB3A 3DOEA 3DG9A 5ITZA 2AEJA 3ZIAA 1DO0A 2E5WA 2GDJA 2JJ2A 3AFHA 1XSEA 4V3CA 1QDUA 1ZITA 5G4KA 5H80A 2WJ6A 1ULSA 5L9AA 3PHIA 3N59A 4CCWA 2AIRA 3DMGA 3B8HA 4YRDA 3AFNA 5ILQA 3QYFA 1S3IA 1IY8A 1XYYA 1BS2A 2WFZA 4FYPA 4N12A 4YCCA 4F46A 3KLPX 3BSYA 3M89A 4RKFA 3PIRA 2WIFA 1TIBA 1KEZA 1YR7A 2GTPA 1TYEB 3D1VA 3PQEA 4I4TA 1KQFA 2Z8XA 1ORVA 3CX3A 5IK2D 4BATA 4EDFA 2IW1A 1KARA 3JALB 1W76A 1V11A 3ZK7A 1YOVA 4B6QA 1AD2A 5BORA 3OMWA 4D4GA 2VEDA 3T1HB 1DBWA 5C35A 3H1BA 2BMVA 2I54A 3UICA 3DVAA 4DJTA 4MRNA 3C3JA 4ACBA 4QPNA 4C0HA 2YIJA 1OE0A 2YDYA 4CCSA 4DWWA 1CZHA 4B75A 1OZHA 3EQ8A 5AH0A 1JDVA 2MOKA 4AJOA 1P1JA 2GAIA 4QUAA 3IL2A 3PE4A 4MMZB 4JBGA 4E6PA 2BGNA 2WIBA 5JZSA 5BQFA 4O1IA 2HA2A 1PQ4A 2LE0A 3A27A 4NYJQ 4F3RA 5IDWA 4PGHA 1C7RA 4A10A 3KUKA 3TSAA 4B7XA 2FWPA 1W44A 2RBKA 2ZRLA 2XMGA 3F4KA 4I6GA 4TMFA 5A3VA 3SJAA 2ADOA 4XWKA 4EJFA 5EJAA 4BE4A 1T8WA 3IAM6 4A1FA 5J1SB 2J9XB 4E6EA 4Q00A 4JBLA 3ENWA 3ZE6A 3EVZA 2EFHB 4JLKA 3WYFA 5I4KA 2VDQB 1W0CA 3FZGA 4WOCA 2JK0A 1QFXA 3TSWA 2QUIA 1YMUA 4WBSA 5EIHA 4MEBA 4RW0A 3VSDA 4F84A 1HMYA 1HE8B 2MJLA 3PUJA 3UM9A 3KTDA 5FTJA 2ORIA 2PBZA 3GVPA 1MENA 3M70A 2FSSA 1E2UA 4UNSA 5CTAA 1HDOA 2IHNA 4JVOA 4UZEA 2H31A 3P9RA 5FYQA 4B48A 4YUXA 5DLEA 2Q1YA 1ZD5A 1DBVO 5E3HA 3K1TA 5LYYA 1MZVA 2ZAYA 3GZTB 4OJNA 3D6TB 3WIUA 1SBQA 1YMQA 2XXAB 2EARA 1L6IA 3NG1A 2GCIA 4FZ3A 4FZVA 1CJUC 3ZG6A 1C7EA 2PZ8A 2UZ1B 3NIDB 3DW3X 3LT2A 5BOVA 3PD7A 4GOLD 2WU3A 4L4UA 4FILA 2CF6A 4CEIA 1YR1A 1JLRA 2ALJA 4KV9A 2I62A 4LK3A 2PYDA 1PV1A 3FYHA 3GLKA 4C7MA 3FHOA 4Q0MA 1FYDA 3IVAA 1XEFA 2VCYA 1P2UA 3BMCB 2OBFA 5COAA 2MYUA 5GJCA 2PH7A 1NNSA 3Q6MA 4G4SP 4YCAA 1H1DA 1E7WA 2RFLA 4C2BA 4XWTA 3HZOA 4D79A 2Y1KA 1FFYA 4UOEA 1K1EA 4GPZA 3V4PB 1HRKA 3EVDA 5EUBA 5CLQA 2LD4A 3M7IA 3GIDA 2AN5A 2LCIA 4Q4AA 3DE7X 3FLEA 1XFDA 2C3MA 3Q2IA 3ZV3A 4B33A 3RU2A 5TGDA 5D86A 3TRKA 4ZV4A 2CLOB 3GB9A 3JX9A 2QM7A 4JOSA 3RTAA 1TF5A 5FBHA 2PLFA 2HYDA 1IK6A 2E89A 2XMSA 4GFDA 4RF3A 5I01A 1ZR2A 4JQYA 1UM8A 2J48A 4XQ0A 1KGSA 1M34E 1PGPA 1VLZA 3DYVA 5CCEA 4E3WA 1HEUA 1XT6A 1A2OA 1R5OA 2EF1A 3BB3A 3C2QA 4IKOA 4FB5A 5BW8A 3IJRA 1DRKA 1NNUA 2H0QA 1FPMA 2WICA 1U3FA 3JU3A 4Y3UA 5EP4A 2C07A 4QAJA 4B6EA 1KTIA 1V6SA 2YASA 3P2OA 4Q3BA 1Q7GA 3KD3A 1JV2B 4MEAA 2QEQA 4MQFB 1SB8A 2D5AA 4QOGA 4TVBA 4IOKA 1HZZC 4FHGA 4YRFA 4BECA 4OH7A 3GLIE 3CZ9A 2Q4EA 4NCIA 1R0CA 1W19A 1QYCA 3BWCA 4RZ3A 1AKYA 3FNGA 3HZZA 4WBNA 3WBFA 4ZYTA 3L1VA 2DRIA 3LZDA 5BVHA 4CF5A 2FPLA 3LPCA 1NW5A 1H8ED 1DOZA 2AMFA 3MWEA 3NS7A 4K8RB 3NJRA 3S6JA 1QDLB 2NM0A 2YKPA 4H3VA 5LFAA 1XP8A 3W9SA 3SOOA 1BXRB 4P4UA 3DCJA 3SQMA 1RRFA 1XU7A 2XQIA 4HADA 2QPLA 2YN4A 3AL3A 3VNRA 3WYCA 3MMPA 1I1NA 1RWOA 1XTBA 3ESDA 3IXQA 4IJWA 5IHPA 2H16A 4UHFA 5HKOA 4P4SA 4L8YA 4HSEA 4G37A 3O2QB 1ZH6A 3I2FA 3MUNA 3NBXX 4A8PA 4E14A 4CUJA 1T8UA 5DCWA 4ENQA 2WYOA 5BSTA 2R7MA 2DWPA 1ACJA 2WF7A 1CUYA 2Q3FA 3B70A 3S2GA 1VHWA 4LI0A 3RS3A 3LYUA 4KR9A 3WO1A 3MJRA 3V8PA 1TQ4A 4JI0B 1EFHA 1I0IA 1K7SN 3DWGA 1WUHS 4PV7A 2NAPA 1U7TA 5K0CA 1FIUA 3D59A 5E6SB 5A05A 4MHSA 1CY4A 4RVNA 1KNXA 3EF3A 4DQLA 3PT5A 2Z3ZA 3OPYI 3FY4A 4XJVA 3F47A 1WSAA 5FQNA 4BE9A 1EGQA 4JBXA 4F96A 2DBYA 2JIPA 5L3QB 1E20A 1QK3A 1C81A 4S0XA 4YWJA 1IRXA 3P9CA 4C22A 4IUCS 1Z9BA 1L8OA 1R5JA 2A3NA 2R2AA 4TS9A 5H4HA 4U2BA 2RGNA 1M54A 2NXWA 2IXFA 3HCOA 3SXUA 5DN6D 2OZLB 3KKLA 4KODA 4ZC1A 4R1SA 2ZRMA 2OBLA 5AI0A 3WP1B 3UATA 1E58A 1MUUA 3PR1A 5KX5F 4IEEA 4XASA 1ZNQO 2AWOA 5JS6A 3H75A 1NDUA 1OLUA 4N41A 2N46A 4J0QA 5TVGA 1U0GA 1VLVA 1ZZGA 4PO8A 1KDVA 3L8FA 1SXJB 3JQ8B 2HADA 4DA4A 5HRAA 1E0SA 3HO8A 1CUGA 4BUCA 1N6OA 3F7OA 2PKQO 3JAWB 3IP6A 1XZJA 2P6MA 1OLXB 3NTOA 4J0CA 5ABPA 3AHJA 2HUPA 2YS7A 4K1LA 3W90A 1C4KA 5JECA 5DNUA 4D80A 4B82A 1G8JA 1DAOA 3GL9A 2PUAA 1Z0IA 3DDOA 2AFRA 3DHNA 3LSYA 1TRKA 4TXNA 3VR2A 1TZMA 5AVVA 4WLOA 1D2AA 4ZOEA 2EJBA 2CDNA 5KTMA 1YBAA 3D3JA 3L7CA 3TB4A 4ZJUA 2EG9A 4RIHA 3WYNA 5CXXA 5I8PA 1V2HE 3DLAA 3MSXA 5H82A 1EAYA 1ZAKA 2HWKA 4M9QA 4L78A 1OV6A 1P9OA 2CV2A 1KJYA 4D44A 2H51A 4OQEA 1YVDA 4G5FA 1ZEMA 4CKZA 2IOYA 4N0PA 3ZBQA 3SF8A 3B9PA 2EBWA 3FOZA 3FLMA 4PNEA 2FMUA 3ANXA 3AEXA 3QKRA 1YZ3A 1PG5A 2WWXA 4G8CA 3EYAA 5AKXA 3ER9A 1ZJ4A 4FPXA 3HA2A 2H1RA 1K9SA 3EC7A 2UDPA 4RA6B 3RS7A 3WWDA 1E1LA 2GD6A 4UPEA 3TLXA 1U3GA 3G3EA 1B0PA 5DM2A 3GEHA 4G3XA 4LJ5A 4L51A 4NARA 3UQYS 1JFTA 3QNMA 4B4KA 1PWXA 2NV0A 1RKVA 2LR0A 4R01A 3WY9A 5C4IA 4D41A 1Y63A 5KQLA 1YONA 4BOYA 1FX0A 3EDOA 1C9NA 4KK3A 5J2UB 1YDMA 3E22A 3KQWA 4FLMA 4RFSA 3L8GA 3SLKA 4RHXA 1JJIA 1N5JA 4E5VA 2X5OA 3MJDA 4LWQA 4TROA 2AZ4A 2DQ4A 6AT1A 4QUIA 5LP6F 5DSTA 2QRUA 5B4UA 4CKYA 5ITVA 1SHJA 1EUQA 1U7PA 4GLBA 3GXOA 3V7WA 1X1SA 1ZD9A 3EXG1 4FHFA 4QEKA 4TYNA 1A71A 2IEZA 1CRLA 2Q9AA 3ZNQA 3KYDA 1Q7EA 2NLOA 4NU6A 3WYBA 1RMQA 2G5CA 4Y2RA 3EEOA 1ESMA 3PQ6A 3KQUA 3GFQA 5KTSA 4WCDA 1C7JA 1GP2A 3RBXA 3FIJA 1JXQA 1NXPA 5KYTA 1ML3A 2CJWB 4V3BA 1PZXA 1GZHB 1HYBA 4MJXA 3TM5A 5IXSA 1HTTA 2WILA 4HDOB 1NVKA 3PX3A 1SK8A 4XX0B 1M7BA 3RS0A 3V5NA 4CZ2A 4LDJA 1WD7A 4ZC8A 1Z35A 3QW2A 1P91A 1YS4A 3R3UA 4HXEB 4L4RA 5CXSA 3S1SA 5B1YA 1MDBA 2NTNA 4YV0A 2EG5A 2OSBA 4PXYA 1FL9A 2WFAA 4RV9A 4YQEA 3FR7A 2DUJA 4GUDA 4MP6A 5TF4A 3VOAA 3W2GA 4AXXA 1NYLA 4KV7A 5HKLA 1EUCB 3WQQA 5DK6A 3T3IA 3HNPA 1K68A 2ZJBA 3A3OA 4RMNA 3H2GA 4UTXA 3BRQA 4B6PA 1MR3F 3G49A 1FYVA 2OESA 2FDXA 3A37A 3DHVA 4IAOA 2H1HA 4IOJA 4R40A 4RA9A 4V24A 1CS0A 3AIKA 4REQA 4IWNA 1VL1A 4BCBA 1X0XA 4RXMA 1RAEA 2X13A 1MTOA 4B35A 1JAZA 3OFNA 4BU1A 1MAWA 2YHSA 3KYIB 4XPIA 4N6OA 3G1UA 1Q95A 1JKIA 1T29A 2XDAA 1KQOA 1T9BA 1UPAA 2OLEA 2BFPA 2WWWA 4PGMA 5HIIA 1F2DA 4BVGA 2OK7A 4WKBA 5C32A 1C1DB 1YVRA 1ZHOA 2G0AA 1ECGA 2L42A 5L6MB 2BZ1A 4JY7A 4XDZA 1Z4KA 3L41A 4ZO8A 4KN9S 4M1YA 1DUSA 3QWAA 4LEIA 3FSRA 1PUJA 3NQ41 3VR3D 1A96A 4U2CA 5FI5A 4PTYA 5EEGA 3W1WA 4A23A 3WOVA 3OX2A 5JZVA 2BFCA 2X19A 3ORYA 2OGTA 3RUPA 2PUWA 2PLRA 3M1LA 2BKVA 3MGGA 3U4HA 3MOIA 5EE1A 1K8QA 5TE9A 3ZDYB 2BTEA 1IL0A 2Z4SA 1IWPB 2VJQA 2R79A 1K75A 2JFPA 2FWBA 3FSGD 3ORHA 5EPOA 1NVVQ 1NTOA 1UFKA 3MF4A 5CAEB 4TVKA 7YASA 2PUFA 3FHJA 4BXOA 2ZE7A 3D2LA 4DV6B 2P2DA 4BNZA 2D0PB 5FBVB 3IP1A 3AJ8A 3LV8A 2FWJA 4H2DA 4UEQA 3U0VA 4DHEA 5L6LB 2MIIA 4JSRA 4DSOA 5EQFA 4AYTA 3RC2A 5A4KA 1QCDA 3VO1A 4EG5A 2FN7A 3TXXA 3HCEA 4BP1A 2P40A 2GAAA 2LGJA 4PIPA 2VOEA 3OZAA 3NC4A 1YKSA 1UXHA 1PTJA 1Y34E 1GYQA 1WZUA 3EVFA 4P7BA 2BFFB 4EFLA 1M1YE 3M9XA 1I3CA 1U0EA 1HUQA 5K3AA 3FPGA 1YH3A 1RMTA 4ZCQA 1UF9A 3VR4H 1Z6AA 2RH5A 4R84A 2RGEA 5E6RA 5K3OA 1W25A 1USIA 2PAAA 2J3JA 1X1BA 1T1RA 2FFHA 1Q7RA 2YFYA 3HYRA 1PL0A 1T8RA 1CYDA 1IONA 1JJFA 1L2TA 1X7DA 2YZKA 3BQNB 3C1UA 3F6SA 4HYTA 4TLLB 4YJFB 5E8RA 2IYNA 4C2TA 2ATEA 5IC4A 5EY5B 3P9NA 3U3OA 2GZ1A 2OD9A 4MCJA 5JFGA 1QB7A 3OTWA 4OHOA 1L8AA 3IEVA 2VJPA 2FX2A 1FFDA 2W2KA 1M7GA 3A1UA 1UJMA 4RNCA 1LSJA 4EVSA 3A14A 3IPCA 5MF6A 1M8PA 4HH4A 1FS6A 3Q3IA 3BN3A 3BAFA 4OQFA 4MAMA 5AM4A 2OHVA 2C20A 1F2UA 1I14A 3EXEA 4BV2A 5JAHA 1WB6A 3ER8A 5TEVA 3E3MA 4BKRA 5AHWA 5JATA 4J3JA 4X66B 1F0NA 5BOSB 2H17A 4EK9A 4CV3A 1LDYA 3R23A 4FGWA 4FN4A 5I9MA 1I0ZA 4Z9AA 4V2IA 1JALA 4U7GA 2W6JD 3TEFA 3HHEA 3QKWA 3VJMA 4ER0A 4U2KA 1AM4D 2XIQA 3C7DB 2WA1A 2A5JA 3OC6A 4CM4A 5LQMA 4FNGA 4FBLA 3NTUA 4IHAA 3ZGOA 4JSYA 2GBPA 2IP2A 2IRWA 2REXB 1W0JA 3IEXA 3KXIA 1H3FA 3RYIB 3UXHA 2QQFA 1ZIYA 3P9SA 4Z4EA 2J6CA 5DXJA 4ALJA 1KAOA 2ZULA 3PNLA 5HJ2A 4ZPJA 2YBDA 1MRSA 4LJ8A 5C9ZA 1UXOA 3DW1X 1PJLA 5FL3A 2A1TR 1H94A 2GNOA 5KYWA 4IJUA 1PEKE 1VRWA 1YFKA 1II8A 2HO4A 3QUCA 4CKCB 5KNDH 1AMOA 4OL0A 3PEFA 5KWSA 1JG2A 3VDXA 3WISA 4CN8A 5TMDA 4QEDA 3PXEA 1WCIB 4H7FA 1G4AE 1J8VA 3ICEA 1NQUA 2QMYA 1I4WA 2R6HA 3E9RA 5DISB 5JTTA 1ZQ9A 4PBSA 4B17A 4MVJF 3NDBB 5F33A 3AL2A 2BMWA 2IOQA 3G2HA 1NLYA 2CLEB 3BF8A 3U4QA 3I04M 3LPAA 4JFRA 4Y2PA 1MH9A 2B8EA 3PUKA 3TVTA 5IBCA 2C78A 3NT4A 3R7LA 3U7QA 3UJAA 4Z1OA 4YREA 3NX4A 1XHLA 1DXYA 1C1HA 4RJIA 5IPFA 1RZRD 3OEHD 1Z28A 4P08A 3WA6A 2H1FA 3F3YA 2VH1A 2I67A 4K81B 3ZH9B 3QEAZ 5BWMA 3OO0A 1T5OA 1Y3DE 4HZGA 3L05A 3T9DA 4RWZA 1JJBA 1GRQA 1JTVA 1WVMA 2GZ3A 4AXBA 2CXTA 5JNLA 4HATA 3K6JA 4NK5A 1L5LA 5LKRA 5CNKA 3UUGA 3R7SA 2P79A 1YS9A 1YQ9A 4M9CA 5I5GA 3HJHA 1IJFA 3K0AB 3W34A 3X1XA 1C3JA 1XZGA 2B4AA 1NI4B 1QHNA 2HDHA 2P75A 4KDEA 4KR2A 1YS2X 4JDUA 3MA0A 2NTJA 4DLWA 4IH1A 2WEKA 3CNEA 1JQ3A 2JLVA 3L0CA 4P7JA 2RJ3A 1DKRA 2QM8A 2VH5R 2F43B 3R75A 4ZD6A 3SQLA 1L4EA 3PEYA 5AKYA 2H1LA 1LH0A 3PE3A 4CLDA 1E0AA 1YFLA 2DX7A 1E5LA 2QZPA 4PAMA 4PGGA 5FL7A 5SICE 1C1YA 3AFOA 4BKQA 2I2AA 3N2KB 3W3AH 5CDHA 3H5RA 1A82A 3WMRA 1W59A 1NM5A 3UXEA 1IHDA 1QP4A 2O4CA 2HB6A 1DT3A 1SVLA 3F6PA 3HY6A 2BTQB 4X5OA 2F17A 3QWFA 3VZQA 4XX1A 1N2OA 4JLSA 3ETGA 4MQMA 5UKDA 4HEA1 3E2IA 2F67A 5B4VA 3TIFA 2RGRA 4F9GA 1L7PA 1ZEJA 2WNIA 3PB3A 4UXIA 5BW4A 4JJAA 3ROKA 1B73A 4NOMA 5IAKA 4YRRA 4DJFC 4QUJA 3GLGA 2RHLA 3EMVA 3GZ4A 1OBVA 4F1JA 4RHCA 5DEOA 5IG2A 4HX5A 4UUNA 3VNSA 1VLLA 4Z4QA 3NTVA 3K5HA 2KJQA 3ELDA 3O4VA 4CIVA 1RLJA 3K5WA 4ZMBA 5JROA 3DZKA 3PFWO 2R96A 4AVYA 5G0WA 4BO3A 4KH0A 4ATNA 1PNRA 2AQKA 3QELA 3CVXA 2I80A 3EDYA 2MHCA 1A9TA 1VE3A 2LCQA 2FX3A 2PGXA 3DMPA 4AX8A 4BIMA 4ZEMA 1P44A 2FP4A 1JG3A 2DT5A 1UDWA 2YWXA 2XMCA 1ODIA 1CE8B 3OWOA 3E82A 4GBGA 1LC0A 4IOMA 4UNQA 4ZO7A 5FR2A 4BZPA 5JDCA 2I2WA 3EZ2A 3N2YA 4EL5A 2Q46A 1XDUA 3DKVA 4J90A 1CDDA 2EAUA 1CQIA 3OY7A 5FULA 5JH7F 1QFZA 3B82A 5HSGA 1AUXA 1IOZA 3PHJA 3WZLA 3ZHZA 4AROA 1MJHA 3IB6A 1VHDA 4F5WA 3KKKA 3F98A 3R40A 4KXFB 4Q1BA 5AKKA 5BRNA 4TTTS 3C0KA 1EXNA 3U4GA 3DTTA 2V6MA 3DE4X 4JIMA 4C0LA 5EWLB 3QX8A 1E6LA 3A2MA 2XTNA 3PR3A 4J75A 1V7PC 3VNBA 2O57A 2OCYC 5A03A 2XUFA 4BNYA 3KTAA 1GPDG 3EMKA 4G1EB 1X3LA 2AFIB 4JL8A 3KUCA 3OEEA 1YHNA 1FEZA 5IZ4A 3PHLA 5CB0A 1Q2XA 2I3BA 2GGSA 3HN6A 2OOSA 3BZUA 3NYQA 4TZTA 2GERA 2XLBA 4FFOA 1OD6A 4FMDB 5EXPA 1PJRA 4JYAB 4QUEA 5KMGB 3AP2A 4JP5A 4UREA 1S8AA 1UFVA 2RGUA 4ZCRA 5BYKA 4N03A 3VH2A 3X3HA 1HA3A 4XOIA 2QN7A 1SBYA 2KHZA 1NQVA 2V0NA 1J07A 5JD3A 4C06A 3NVKI 2QR2A 4FWBA 2AV6A 3AU9A 4OHFA 3WHPA 5DBOA 2JNWA 3EIFA 4WTOA 3OCCA 4ZIRB 4X0EA 4DA7A 4DIOA 2D13A 5IMSA 1N5LA 4O2BA 1NRIA 4C88A 4BQRA 5J59A 2RBGA 3AWDA 3ZJYA 3H9JA 5C31A 5KNCH 3LXMA 5CLGA 2W70A 3SS7X 4CTMA 1F14A 3TX2A 4JN6B 1UBJS 1D2MA 2V97A 5HCNA 3NEJA 3OOHA 5CFOA 4HUJA 4CTNA 5HE9A 5AUPB 2XKBA 1NJ5A 3K1JA 3OE4A 2OLJA 2IF0A 5FNZA 4GNRA 1XMOB 3PNBA 5B1EA 1SELA 1STOA 1SBNE 1Z4JA 1X80B 2ZB3A 1VL5A 1E9VA 2VH2A 1TA9A 4HDSB 1QJCA 3A4VA 1ZD1A 3JYNA 4PQEA 4ZTBA 2CB0A 4TKVA 1I1HA 1B93A 1YNOA 1KO4A 3KOOA 5I7FA 3B78A 2OM6A 1QH1B 3OQIB 3LTEA 3G9XA 1TGVA 2OZVA 3D3WA 3PDHA 4L6AA 5LD2C 5JCOC 3CH6A 5LPNA 4HGZA 1GFSA 5MGNA 2IS1A 2GN9A 1RLMA 4IFBA 4IGEA 3H9UA 1VBNA 3ASYA 5IK2A 2YV5A 4EVQA 2WTBA 4FIZA 5CYPA 1RI1A 4B3JA 1NSTA 1GGKA 4I9FA 1P4HA 4BV8A 1E2KA 1UFRA 3O95A 1EG2A 1C9MA 2HDOA 2PAFA 3M81A 3UT6A 1Z6ZA 1KDTA 4I55A 5DGXA 5ECDA 4NVRA 4CDRA 5LU8A 1RI5A 2ZI7A 4RX1A 5BUQA 4EBBA 2I4MA 4DE5A 1W52X 2YVUA 1ZRHA 2GN2A 4R51A 5ALHA 2PSSA 3HFSA 2IH5A 2FSIA 2X22A 2M6KA 3LM8A 3NORA 4AMBA 3BA1A 3HV2A 3N2IA 1QO0D 1Y6JA 1U0BB 3QLJA 5K8CA 4IHKA 2E82A 4RSRA 2HDWA 4D9HA 1EJBA 3C3MA 3GUHA 2FPSA 4I9GA 1OLSA 4RHYA 3ZCPA 1P1CA 5IN4A 4QTTB 3FDJA 1SH7A 4LSMA 4RS4A 1SUSA 4KLZA 2HQSA 4ZAFA 4UMFA 4DBLC 1PKEA 2I1QA 1LC3A 1P0PA 2Y1FA 3I37X 1C1XA 1P61B 2EQAA 2QTGA 4KWHA 4X20B 5JAIA 1HF3A 1RI4A 3DZBA 2J0UA 2VK2A 2XODA 2V0CA 3GUVA 5KPDA 1FDVA 2E6UX 3A1FA 1XDWA 2VSYA 2XOKD 2YHAA 1QFYA 1IXZA 4I4CA 2VJMA 4V0ME 1IZ0A 1YKGA 3HVHA 4DM3A 3H65A 3MINA 5MN6A 4QUGA 1W49A 4WJKB 4AP9A 4EPRA 2OG2A 5CLLA 2OV4A 3DEYX 4TXJA 3UWPA 3K4QA 4TTJA 3MZ0A 3K6SB 2AFHE 4R0NA 3FMOB 3A1DA 5EP1A 4BMNA 2QK4A 1D8TA 1N9GB 2BP7B 5BN1A 4DCMA 1DX6A 3V8VA 3TUIC 4DN6A 1B8NA 4G41A 3VNAA 5ARBA 2NVUA 1WBBA 1DUIA 2BV3A 3ED5A 4RWEA 5I3CA 4HQKA 4J0JA 4X90A 1RRKA 3KAPA 4Q4LA 3SJ7A 1HDYA 1IQRA 1V5FA 2W2LD 2KB0A 1KEEB 1V5GA 5CDGA 1ENYA 2DHEA 4NBSA 2FEPA 1GVNB 4WNAB 9ATCA 2XNJA 1BAPA 2AMLA 3IMGA 3KOUA 2XQVA 3TNLA 1TCUA 4EMUA 1LK0A 3WGYA 1AKVA 4AKIA 4IEFB 2XSZD 2KE5A 2ANCA 4CHGA 4R41A 3V1YA 4CM5A 3VJRA 1C41A 2IEDA 1XLWA 4Q9KA 2VTVA 4GQBA 1OAKA 2OVFA 2H63A 2W4QA 3HHPA 5FADA 3HL4A 2ECPA 1X0VA 1KZYC 4P4TA 5DGTA 5F23A 1YIAA 3GI1A 4Y2XA 5HBGA 3WLIA 4YUYA 4XM0A 5BT8A 3GLHA 3BWEA 4C5CA 2COKA 3PHCA 2LCFA 4UEWA 3DHEA 2KM1A 1HO3A 1NDQA 1ZXLA 1YI0A 2GXAA 3JSXA 4YAFA 4UTRA 1WR8A 2D74A 4MTLA 4WA7A 5CNMA 3VBEA 3BCRA 4CM3A 2BFOA 3OQNA 2HW8A 1I1OA 2O1WA 5EI5A 2BM8A 4ZCTA 3V42A 2YL2A 5D5PA 3UTDA 2AOUA 4DLLA 1CRZA 4CLEA 4L4ZA 3ZXSA 4EBFA 2GM4A 1JQAA 3JD1A 3V1KA 4HAWA 1QZZA 1XMQB 3AT1A 3I2YX 1YE5A 2DPLA 1V48A 3H8VA 2YWFA 1GQSA 3KWMA 4CT0A 3DEFA 3W6NA 1ZOSA 1GNRA 4IEIA 3Q98A 4ICIA 4U6QA 5LB2A 1N1DA 4O4HB 1XCGB 3EOAI 1TIKA 5EZ6B 4EABA 1LNQA 4YJGA 4A2PA 5DYGA 1H8EA 3QMVA 3WLTA 1V7CA 4BUJA 1XDDA 5F7OA 5TT0A 1KDOA 1N0HA 2UUOA 1C9JA 1W35A 3MMXA 2HOQA 4M9UA 4NE7A 3N7UA 4QQKA 5BQOA 3WLFA 4AQYB 3PJRA 4V38A 1I6WA 1TK9A 1P2BA 3CPSA 3N28A 1NI5A 3PD0A 3BE5A 3GEMA 1M2GA 3GUCA 1F4LA 3PWZA 4V0LA 3VI3B 1CQPA 1BDMA 1UM9A 2Q3LA 5DTJA 1R6VA 1SVIA 3G0CA 4LPKA 4QIHA 3HS3A 2OG1A 1NF9A 3HLTA 1XQ1A 4Y7CA 4P1ZA 4Q9LA 5KHAA 3U40A 4ETIA 4ZI7F 2HMUA 2C29D 2ONKA 4D8TA 2IOFA 3V8NA 1ID1A 4QNNA 5B36A 2A7XA 1IEXA 1A98A 2NT3A 3KJIA 2WV7A 4IKPA 3JQAB 5FUWA 2Q8PA 3ZV4A 4BEJA 1KWGA 1KOGA 1F12A 1MB0A 1WXQA 3PRKE 2X3FA 5HBRA 4C43A 3RRNA 1MT3A 1L1EA 3RFXA 4KQWA 3A1NA 3MVEA 1VGQA 4X64B 1KA9H 4JI6B 2NYUA 5I48A 3D3QA 3RYHB 3NT5A 2VQDA 3BA6A 2ZSDA 3EZ6A 3HWWA 3NW9A 4G1VA 4RAQA 1ZLXA 1IM8A 3IO5A 3QVTA 1U02A 1OX6A 3D6FA 3CZMA 1GU0A 2JCYA 2VBGA 3NBKA 3ZX5A 4BASA 5DN6A 1T1JA 1R5NA 1HLGA 2DBZA 3OEYA 1DCMA 3AJ9A 3LW7A 1HDEA 1YK1A 3BMOA 1X1TA 4WJLA 2Z4RA 3CTMA 4AIRA 1T8SA 2BM0A 2OE2A 1OWPA 3GFFA 3WK8A 1JDBC 5DXFA 4E09A 4ND7A 4U7DA 3SDBA 1C0EA 5FO0A 4A2CA 5I9IA 4A6EA 3RSOA 1DKUA 5DTEA 3LQFA 4E2WA 1A2BA 4MWCA 5KYYA 5IEBA 4IJMA 4NG4A 1P7YA 2ATIA 1IULA 3WIDA 3DCIA 2DLCX 3GQVA 2DY1A 4EDHA 2IYWA 1OZFA 3VU9B 2FGJA 3IVCA 1KH3A 1QCZA 4FS3A 1OGIA 4J0DA 5ENZA 3WJAA 1VGRA 1E4VA 5EXEA 3WQBA 3I1JA 5DU2A 1TFUA 2DFNA 2J87A 5BUSA 3DZ8A 2GQ0A 4KMSA 2QV0A 5G4KB 1FFXA 1OIWA 1T4BA 2RGAA 3DE3X 1OU4A 5A4IS 3CPEA 1NVBA 1FZQA 2JCBA 5J5VA 3VNVA 2YFHA 3K70C 4GF5A 3KKOA 4URWR 1BKDR 4OGLA 4E4TA 4PQRA 4DRYA 1YR8A 4F91B 2E4VA 4XWWA 4I4TB 4DG9A 4HDKA 4Q7MB 1GU7A 2HMTA 1WHTA 3EXFA 2FW9A 4WOKA 4EHLA 4NDZA 2PV7A 3QQ5A 4DR4B 1YOVB 5TV2A 4CIDA 1T4CB 1THZA 5GADl 2OXIA 1VG8A 3U9TA 3OQ6A 5GTDA 2F9FA 3FI9A 4JA0A 4YPFA 5JV5A 1JYSA 5ARDA 1YZVA 3DVAB 4FONA 1TU4A 3BSSA 1DTEA 1O89A 4PHCA 3HM9A 3PV0A 4AN4A 5KTPA 3Q5GA 3H5AA 3ZU3A 3OA0A 4DBZA 2D8MA 1PR6A 1VSVA 2YWJA 4D98A 1JAHA 3WGMA 1R27A 4KWIA 1RADA 1WDKA 3Q7EA 3R7BA 2W2VA 2VF5X 3K2QA 1D0IA 4DEVA 2HZBA 1U1IA 3MD0A 3OOJA 4XTRA 4U2FA 2IWRA 4Y2UA 4E33A 1ORRA 4JZKA 2RCNA 3P52A 4G86A 3UWKA 4P3NA 4F9TA 1ZJ6A 3NCHA 4JLPA 3UAZA 1WDWB 3ZZ1A 2AG6A 1I2MA 1TD1A 2WWGA 2FN4A 2MSEB 4XTCS 3FRHA 4WLFA 2O20A 2DBVO 4B3CA 2MSKA 4J91A 4G5YA 2C2BA 2R8YA 1VMIA 4H6PA 2R8XA 5L7TA 1HRDA 3O8DA 2AVDA 4W1SA 5DDIP 3W8EA 9GPBA 2CLIB 3RIHA 3KYBA 5HK9A 2HJVA 3FYUC 3SQWA 5ES4B 2Q3MA 2REOA 1O95A 1RKXA 1SB9A 4LFAB 3VM6A 2H4WA 2C59A 1W1WA 4HDQB 1ZA2A 2UZ3A 1DARA 1UT6A 3F6CA 2AJLI 4H0CA 3TLEA 2C1EA 4AMVA 5FUXA 3JQGA 1VM6A 4B85A 5CA0F 1NJSA 5DHFA 3EPKA 5L7WA 3KE8A 5T6MA 3EGOA 3KD2A 3DLIA 3E0QA 2PT5A 3Q88A 4Z9BA 2PNJA 1VPTA 1YCHA 3U3JA 1PJSA 1U28C 1GGVA 5J1TB 1JFFA 1G3UA 5J43A 3GBPA 1FFGA 5BT9A 4D9EA 6ADHA 3FRJA 3T52A 5HKKD 1U4NA 4EB6B 1EYZA 4OQNA 1YFZA 3CJQA 3DZCA 4CEIB 1FVFA 3W5VA 4BNFA 1YQEA 3L1HA 2EWWA 4H31A 1RACA 1ZUNA 4OQLA 4BFCA 2BTOA 2AJCA 3EIEA 2BEWB 1U8YA 3L4BA 4K1XA 1P6XA 4GC9A 3PFFA 4ZEVA 5HF9A 3WNDA 3BWBA 3UBMA 3CX4A 2HIAA 4LX8A 4XM1A 1EK0A 4DG8A 5LMZA 1EDOA 1R3UA 1TVCA 3KJGA 2BEVA 3RT7A 1YL6A 3LHSA 3SZUA 1OFHA 2QMUA 2WJVA 3MGAA 3D3NA 3FYTA 5KVQA 5ICCA 3ZVMA 2HF8A 4FYJA 3FHCB 1N6NA 1OZGA 4MRMB 2VJKA 1UZLA 4W82A 1QONA 2JKYA 1KVTA 2QUZA 3BFPA 2XNSA 3FSGA 4FLFA 3UW1A 3RRYA 4EFKA 3A4LA 4EPXA 1N5DA 1TZCA 3AHCA 4HMOA 5DT9A 5IANA 3GLFE 1N32B 1CJVC 3T9AA 3UHFA 1N2HA 4H59A 1X7ZA 4II3A 2JJ8A 4NAUA 1O9BA 2REQA 3MIIA 2BMEA 2HJWA 1U9IC 3PI6A 3CSUA 3S44A 1XYVA 3TLBA 3ZDRA 4A36A 2MYTA 4MVJM 1MMFB 2UZ0A 3L4SO 2AJTA 2PSFA 3ZDZB 1JPUA 4JUBA 4YECA 4KDCA 4MB0A 4RD0A 3WIEA 1CT9A 1T9HA 2CHQA 1RPTA 2J5XA 3RGGA 1QFJA 3TZCA 4D97A 4WBNB 1D2NA 5HHTA 2XBUA 3E9NA 3S1AA 3C4JA 1FP6A 2IYVA 5TRTA 2LVBA 2A33A 2ZE8A 4HWOA 3MWEB 3RREA 2N1MA 3A4IA 1N7GA 4OQYA 4G65A 5G40A 2R0QC 2O59A 2PPVA 3SR4A 1NZDA 1XLUA 1IC6A 3MBOA 4D6YA 5C8YB 1XEAA 4K0RA 4H60A 1A8HA 2QT0A 5AI4A 2Q41A 2ZIEA 1LTHR 2WMNB 1KDRA 4NI5A 3VJLA 4LJ4A 2OFPA 2AOTA 3DP7A 2EJTA 5I9BA 4JI3B 4G63A 4RY0A 3SC6A 5ICEA 1BW9B 2Q4RA 1YZQA 1YIDA 2PZLA 1IPEA 3NZEA 4M98A 4XD7D 1Y5LA 1Z6GA 5IM4F 3FHTA 2VXCA 3DMYA 3LRPA 3AVPA 3LBFA 2Q9BA 3UKOA 1R6TA 2F3PA 5I7WA 1L5QA 4MWDA 4C7OA 3KQOA 1IOVA 4DSAA 4UHDA 1L8LA 1YVUA 3QWHA 4IS3A 1Y0BA 1A9PA 1A69A 2FMHA 1SU7A 1F6WA 2VPWA 1I3NA 1ISIA 2I9PA 4O4IB 3CBGA 5K0EA 3IDAA 3Q8XB 3QW4B 5HS6A 3RIEA 5LSAA 1YWGO 4IIXA 2OFFA 1I01A 2CHGA 4XQ9A 2CLHB 4YI5A 3U17A 1YA6A 3NOOA 1T2CA 3W77A 5C7LO 1RWNA 4YMIA 3EZXA 3N70A 3TTUA 1L6RA 1YMVA 2JIMA 4EJSA 4NDNE 1BHSA 1EU1A 2JGEA 5A9TA 4QOIA 3CE9A 4AJ2A 3RVOA 3Q0TA 5HFNA 4DQVA 1YDFA 3Q8KA 1T4MA 3VZDA 4B73A 1BKSB 5FA8A 5KQGA 3GUYA 5E1DA 5E4FA 4XH9B 3TD6A 4GMHA 5DHAA 4RZHA 1BN6A 2IPAB 3TYXA 4HLNA 4IBOA 3AJDA 1VSUA 3LZCA 2CHFA 3T4EA 1VJTA 4WN3A 2IYQA 1RPAA 5JDIA 5KYNA 3O90A 2HKIA 4LJSA 1QHEA 1YDWA 4NZPA 4NECA 3RWOA 1C7IA 2A92A 3BE8A 1UWKA 4GP7A 3B85A 4YLEA 3KDSE 4QPDA 1FNSA 1XVAA 4PRKA 1NQTA 2WF8A 3A3PA 3DBIA 3DFZA 4CDNA 1KYYA 5AKGA 3E2MA 1G3QA 2VP0A 4KUEA