2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
4N1AA 4UKDA 2ZJZA 2QSYA 1XMVA 1W5SA 3CB4A 4LJ9A 2QBYA 2WSSD 4LGMA 1AJEA 1HV8A 1MKYA 1TUIA 1EG7A 4QGAA 2GJKA 3X1XA 2G1KA 3QUSA 5M04A 4IOLA 3BORA 1B0UA 1U99A 2FOLA 1I2DA 2ZI5A 3AVXA 2NPIA 2IF0A 2L0XA 2G1JA 3PR1A 4US1R 4RD3A 1OF1A 2AFHE 1E9SA 1CKEA 2C8VA 3CWQA 2RGAA 1G8YA 5DI3A 4DDWA 2WKRA 1DBSA 1W0KD 3IO3A 3CNOA 1ZM7A 3GLHB 2AWNA 4PHTA 2QRZA 3QE0A 4QGHA 5FOTA 3PUVA 1WMSA 3P20A 1XPUA 3AVUA 4AG6A 4OYHA 2HEIA 4YLGA 4TQUS 4PSKA 5FUXA 2CL6X 1KNXA 1GRQA 3MSXA 3QF7A 5KPDA 3NH6A 1P6XA 4AK9A 3O8RA 2ZRFA 2FF7A 2EFEB 4LJAA 4NBSA 2Q0HA 4BEJA 4EPTA 2J41A 1S8FA 4DSOA 1X1RA 2FJUA 2BCGY 4TLDA 3K8YA 3HDTA 2DB3A 3Q85A 2BMFA 3C7KA 2CCGA 2G0NA 5AJWA 5KTYA 4KHZA 1IHUA 3SYNA 2H8KA 1E99A 2FU5C 3ND9A 3RWMB 3HYTA 2JJ1D 3WNCA 4A82A 1D9XA 3EX7C 1VCMA 4HB2A 3BB1A 1R6BX 1N6KA 4AKHA 2EW1A 4PPFA 4Q1CA 2NPFA 1LNZA 5HKKA 4CW7A 1H65A 2IW3A 1AQYA 2IYUA 1J2JA 2YOGA 2XZPA 1CXZA 2FZ4A 1U8ZA 5HZHA 3KJHA 4JL6A 4OHVA 1XZPA 2YV5A 3HU2A 4LZZA 4FWIB 3QKRA 4B73A 2XGJA 4HUQA 4ZI3A 1FMLA 2B8WA 2D3WA 2W6ID 4JSTA 2BV3A 1E2JA 1FPMA 5KSZA 4NCJA 4Q9KA 2E9SA 3CRW1 2R8RA 4FCTA 1E2HA 2AHOA 3GLGA 1IY0A 1AQUA 1SVWA 4ERNA 4BRWA 1W7AA 3K53A 4AYTA 4BLPA 5KDLA 3ZZUA 3NHBA 4IFEA 2BDTA 4C0SA 2X2FA 2ZREA 5KUTA 4C7OA 2JCSA 4XJXA 5JLJA 1XMIA 4V0LA 1DAFA 1M74A 4XWOA 1Z6GA 4JT2A 4P31A 1COWA 2ZUBA 1S2MA 1FMJA 3KKQA 4EKDA 2NMVA 3Q5EA 1XP8A 2ZUDA 2J45A 3U6KA 4PO9A 1G7TA 3OESA 2FN4A 4N0EA 3B8HA 1OH5A 2WAXA 2AN9A 2GXSA 3JZMA 2ZRKA 3KKNA 1OB2A 1XTSA 1CIPA 2BEKA 3LLUA 1FX0B 3QVUA 4YXWD 1ZW6A 4YMWA 3GJ5A 4NYMQ 5FBWB 3I5XA 4EJSC 4E07A 2XJ9A 4WA7A 4MYHA 4RFSB 1RKBA 5H8WA 1MR3F 1XDBA 4KBFA 4CEJB 1ZCBA 4NYIR 2ZRJA 3O8DA 4FIDA 2HYIC 3RDPA 3TW4A 3LLMA 2JLYA 4JZKA 3VU9B 3QOFA 2O8CA 1X86B 2PZEA 2KSQA 4M0LA 4IJMA 4II7A 4LYJA 2J3EA 3SEAA 2J87A 3U44A 3EPHA 1CJUC 2XZOA 1ZAKA 4DB2A 1M34E 4ACBA 1KKLA 3TLXA 5JEEA 2PT5A 2A3RA 2PBRA 3ICEA 3R9WA 5BWMA 3W90A 3AVYA 4QFMA 3TUJC 4G1UC 3MAAC 5KHOC 4OHZA 4WXRA 1IJFA 1Z47A 2ZEJA 2ZETA 2ZXUA 3BOSA 2XB2A 4MGKR 1KJZA 2BBTA 3NWJA 5JWRA 1Z2AA 2I4IA 5KNCA 1LTQA 4NCKA 1E9BA 1LF0A 1N6PA 1Q57A 2GXAA 4DHEA 2VH5R 1P62B 2ZJ2A 4Q66C 5IRCD 1W47A 2IXEA 4LOAA 4A8JC 2AD1A 4GMDA 4Q4HB 1CEEA 4Z8XA 4B6EA 2ZRLA 1ZBDA 2WKPA 1F3OA 4Q4JA 4D4KA 1KKMA 3U7FB 1VDZA 4LJYA 2YOHA 2JLWA 1GKIA 2OFWA 3AV0B 4DIDA 1ZU5A 2F1HA 4QC2A 4B3XA 1HY3A 3G0HA 3CZPA 3UWKA 1G8FA 3AUXA 3IPXA 3A4NA 4XVRA 3TVTA 4L16A 3EC1A 4ASUA 4A2PA 1JNYA 1Z22A 2WIAA 1Z2CA 3U3MA 1SHKA 4RZ2A 3ICQB 5HZKA 2FZLA 3LX8A 5JJKA 4BRUA 1KMQA 2GESA 4KVAA 3W34A 3RRYA 3GFPA 1JJ7A 4GBMA 2GF0A 2ZVQX 2FEMA 3F5FA 2AKYA 3AF2A 3OEHA 5KOYA 1F2TA 3DO6A 4DLUA 6Q21A 4Q03A 1N0UA 3EPLA 1NY5A 2GJSA 2WJYA 4MRPA 4Q21A 5BN4A 2YWEA 2RMKA 2FSIA 3C41J 3L0IB 4LHWA 3I8XA 4B33A 1YKSA 4OQMA 2ZS8A 1JAHA 4JLPA 1QF9A 3QKRB 3MJRA 3GEEA 4B3GA 3DKVA 1KO8A 2OBMA 4YDHB 3GP8A 1EFHA 1I4DD 2YZ2A 4B3BA 4L9WA 4GI7A 3T1OA 3SNHA 3B1WA 4TZ0A 3ZJYA 2ZRHA 1Q1QA 5TXGA 3QNUA 2H5EA 4RD6A 4D6PA 1Z0AA 4EFNA 4C7OB 4DIEA 1G17A 4JLDA 2GK6A 2IYVA 3PUXA 3KKOA 4M21A 3M0EA 4R2HA 4QJ4A 3FYHA 1G5TA 2P0EA 3SFZA 2J0SA 2UZ3A 2Z4RA 4Q7LA 3FMPB 5H1YA 4LV8B 1Z06A 4XOIA 4AC9A 4BLSA 1X6VA 3ASYA 4C0LA 1R0ZA 1J8MF 3SDZA 1N2CE 1II8A 3EIEA 4Q00A 2PL3A 3JZAA 3F0TA 3SYKA 1AN0A 1SVMA 1Z0DA 5JI3E 1I2MA 4HI0E 5CDFA 2ZI3A 2FFHA 3FFAA 3OEED 4G5QA 3RS3A 1DAGA 2O0KA 4MGZR 2RGCA 4Q5IA 2J0UA 1A5TA 2XXAB 1VCIA 1KNQA 2E1RA 1X8JA 1Q44A 2QNRA 4V0NA 1MO5A 3CRVA 3RYTC 2JDIA 2W6JD 1PZNA 1LF5A 1IBRA 1ZVQA 1QHXA 1YVDA 3GD7A 5CITA 1KO5A 4G01B 1TF7A 2QMEA 1U98A 2H57A 1VIAA 5G40A 1QHYA 5FBRB 5B2ZA 3OAAD 4Z1MA 4LHYA 1FTNA 2VBCA 3VR3A 3K70C 1GVNB 2C03A 3U44B 4XIGS 1XZQA 4IDHA 4B44A 5EXSA 4A2WA 4HAWA 1JB1A 3L43A 3TQCA 2IBMA 1UBCA 2AK2A 4V03A 1XTRA 4C9BA 2ZJAA 221PA 2WJHA 4PC3A 2CCKA 4B43A 5DH9A 4D4JA 4PHFA 1ZUHA 1O3YA 3EZ2A 3ONWA 3DPUA 5JS7A 2OLKA 1AZTA 1H8EA 4LK2A 1E9RA 4N3NA 2DPXA 1NG1A 4GOXA 1RPZA 4ZV4A 1Z63A 1HH4A 3MWKA 1E2MA 4EJSA 3DZ8A 2XTNA 4R98A 1W0JA 3N2IA 4Z54A 2P6UA 2P65A 3MLEA 3IEVA 2P6RA 3B1VA 1OH7A 2XSZD 1V5WA 3Q8XB 5E7MA 1OHHD 4NYMR 1KAGA 1WF3A 3QF4B 4KSBA 1NL3A 2D2FA 3ND8A 5CK5A 2ZTSA 3UWOA 1P2UA 1BYUA 2D4HA 4LJ8A 4Q9JA 4Q1FA 3BS4A 5AJYA 4AD8A 2N46A 3J81k 4ZCMA 1TPZA 3VHXA 1N3BA 1FL9A 3A4LA 5FUVA 1KSHA 1R8SA 2HDNB 1WBDA 1WP9A 1Y63A 2MMGA 3BFVA 2FSFA 1NLFA 2OCYC 2ORWA 1GM5A 4OI1A 2GVDC 2R9VA 2AXNA 2EYQA 2DR3A 2NZJA 4OK6A 5A5GA 2IUUA 1TQ4A 2JLZA 2QQ0A 5HCNA 3SFVA 1L2TA 5KSOA 2ODBA 1SZPA 4A2QA 4D82A 3I62A 2RKOA 1XPOA 3IQXA 1VTKA 2KE5A 2ZRIA 5HCIA 2HJGA 2RGNC 4TYNA 4W5WA 1XD2A 1N6RA 4ON9A 1VPLA 3OIWA 4KAXA 3WBKA 2QENA 1T3HA 1LVGA 1T8UA 2IYXA 2PEZA 4FW9A 1QHHA 4CT4B 4DDUA 3NEJA 3KXIA 3LXXA 1Z6TA 4X8HA 4TN1A 3WMFA 5DE3A 3B1XA 4DLSA 4FD2A 4EPXA 4BWYA 3N5CA 2AX4A 5J4KA 2A78A 4M2LA 1AZSC 1XJ0A 2JLSA 4PC1A 4XH9B 5IDVA 3KQHA 4C2TA 2V7QD 3IQWA 2EQBA 3A1TA 4IRUB 4LWZA 4RVCA 3TQFA 1TNDA 4M1OA 2C98A 1MABB 2WPDD 5E7IA 1CRQA 1BOFA 4OQXA 1N5JA 1S4QA 2QMOA 3FKSA 5EE1A 3U3RA 1S9HA 3M6AA 1DAMA 2FFAA 4PXAA 4EFLA 3IBGA 2V6JA 1GFIA 5KDDA 4NP6A 1Z6XA 3ASZA 2I1QA 1ZNXA 1T3LA 3LVRE 1BYIA 2R6CA 3FHCB 2ANCA 4C0AC 3QEJA 3REFA 1KAOA 5G53C 4B48A 3ETLA 3SR0A 3IUYA 3RANA 4PPGA 1E1QD 1II8B 2YWFA 4JJKA 1W36C 5DLQC 5B57C 3QPUA 5BN3A 3P4XA 4D0LB 1W5TA 4KFRA 1VG9B 5D3QA 2WTUA 3BH7A 3U3OA 1KYIA 5LD2B 1T0HB 1WRBA 1DELA 4IVPA 4RZ3A 1OB5A 1SVLA 4XSGA 1TF2A 3S1AA 1S9DA 4Q02A 4QBFA 3EAQA 5KNDA 4U5XA 1NI3A 1FP7A 4JLOA 3ZS9A 2DFKB 3H0KA 4LBYA 4OHYA 3THYA 2Z5FA 3DVLA 4XTRA 3U2QA 1GKYA 3EZFA 4H1UA 1GSIA 4AKEA 4TL8A 4F4JA 4Q1AA 3BBPA 1ZCAA 4DSNA 1P9WA 1ZNWA 1ZM4A 4CEIB 2GXUA 5DI9A 1BMFD 4PZZA 1E3MA 2JA1A 3UATA 2GAAA 1Z6YA 3GFTA 1HTWA 2WWGA 5F9FA 1S1CA 3GLFA 3TH5A 1CR4A 2QT0A 2ZVPX 2Y8EA 2J7KA 2ZYVX 2XNDA 1J90A 1OFIA 1KY3A 2ZJBA 3UANA 4I1VA 4GMXA 1XMJA 2C9YA 4DUGD 1R5OA 1E9FA 2Q3MA 3T5GA 1ZYUA 4G5SA 3KQKA 2CJWA 1G41A 1TU4A 2BEJA 5IK2A 4TYQA 3MMPA 2R6GA 3L82B 3O47A 1E32A 1J7KA 4W5HA 2CK3D 4A1FA 5BXQC 1LY1A 3D6TB 4MGYR 4KFUA 1ODFA 2ZJ5A 3AQ4A 5IF9A 1FFHA 3ZVMA 3WHKA 4TMTA 4B35A 2W2XA 2Q9CA 1GDDA 4P33A 4FI3C 5FPSA 3L8YA 3VR1A 3NIBA 4NE2A 1IONA 2HJVA 3I92A 1IN5A 2RGDA 2R6DA 2OM2A 2F1JA 3CF0A 1T0JB 3ADBA 4K81B 2OXRA 2GKSA 2QGZA 1E1RD 3BH6A 1XTIA 3DL0A 3OZXA 2CL0X 1T5LA 2QU8A 2QAGA 4D26A 5GVSA 4GP7A 1ETUA 3P4YA 3TNFA 5DIFA 1P61B 3CIOA 2IYYA 4JVLA 2QA5A 4DLYA 1DO2A 2HLDA 4DLTA 5FBLB 2ZJYA 1VG8A 1W1WA 1RIFA 1UKZA 3P1JA 2IS2A 1YR6A 2CL7X 2V9PA 4QHYA 4D80A 3TJZA 5CYOA 2V8OA 4BE7B 1BO6A 1SULA 4DKXA 4TWZA 1QBKC 1GIAA 1JEEA 2QM8A 2FFQA 2C04A 3QI2A 1OIXA 3SYLA 2V3CC 2P5TB 1XD2B 4V0ME 1QHHB 3EIQA 2V1XA 3RAPR 4NCNA 4DWJA 4QM6A 1FW6A 1PLJA 3EPJA 4RD2A 2OHFA 3DDCA 1TEXA 2ERXA 3WXMA 2J5XA 4MYCA 1J70A 4TLEA 3AKEA 2VA8A 3OIVA 3EA0A 3FHTA 4BFSA 4EPVA 1S3GA 1WE2A 4JBXA 2Q9AA 5TV2A 1G8GA 2GTPA 2HXSA 2V54A 4Q18A 2WMNB 2ANBA 5KSPA 2DCUA 2O5VA 2WJIA 3SE0A 3AKDA 3OFNA 4LRWA 1IY1A 1XXHA 2IL1A 1IJEA 1N5KA 4A4DA 4DDTA 2PZFA 3X1YA 5FBVB 5F3WB 2NG1A 5C4GB 1JR3D 2OESA 2ORVA 3H2YA 4P4UA 4J0QA 5P21A 4YQFA 4MRVA 2VQSA 1SHZA 3CRRA 3FE2A 4MKIA 4ARZB 3PV0A 2BCJQ 3LDAA 5DHFA 5K8IA 2O0HA 4FINA 4P32A 5BQ5A 1ZC4A 1MRNA 3C4JA 1IM2A 1GL7A 1YRAA 2N42A 2NTYC 2IWRA 5BN5A 3ZVRA 1OFHA 4C2UA 3U7EB 3SI7A 2ZYUX 4LHZA 2WWIA 1X1SA 3PEVA 1TEVA 3VQTA 1SXJA 1VYUA 1S3SA 2REBA 4KYIB 3FVQA 4A6PA 2GDJA 2OO7A 1YHNA 1PVOA 2JLRA 2J7PA 1K8RA 1NVWQ 3RRZA 3D31A 3WRXC 4OQLA 1E2LA 3AF0A 4HUTA 3GLFB 2ORIA 4IOKA 1AKEA 1NKSA 2B6HA 4E09A 1KO1A 4JYBA 3TVDA 3ZZTA 3DZDA 5KYKA 4V02A 2WM9B 2JGNA 1CS4C 1C9KA 1QG4A 1TAGA 4H9GA 1U94A 1US8A 1Z29A 4CZ2A 3WY9A 3ZVNA 1CP2A 2CJWB 2VO1A 1OPXA 2ZQ5A 3K9NA 1OE0A 1C1YA 2QQEA 4H1VA 1UDWA 1RJ9A 3BB4A 3UKDA 4B75A 3VAAA 2IS4A 1OYWA 2PJZA 1NBMA 4ESHA 3SQXA 3JVVA 3GJ3A 4YDSA 4ABYA 4PSVA 5K8UA 2YC4C 1JBKA 5HKKD 2NZ8A 1U0HC 3IIMA 4LJ6A 1SKQA 4IW3B 2NO0A 1MO4A 4KV9A 1ZNYA 4UNPA 2QTFA 1GRNA 1HYQA 1ZU4A 3AH8A 3VR5A 2RAPA 5DO9A 1EWRA 2CVHA 5EJEA 1YZUA 3LH5A 5F2EA 2JASA 2FX3A 5JRZA 2OE2A 4KCGA 2QN6A 4JYCA 4TQAA 1P73A 1G8HA 1E0SA 1L4UA 2IYWA 4IHQA 4OK3A 2CLCX 5SZHB 4PZYA 1KDTA 2QAGB 3QXSA 3C16C 3REGA 3ZYCA 1HT1E 2NIPA 4XSHA 4PC2A 5L3SB 1JXMA 1OKKA 4G0NA 4RSGA 4B2IA 4JLVA 1G3QA 3T35A 4QXAA 2O8FA 1T91A 1CLUA 3BB3A 4HLCA 3H1TA 4NDZA 3HU3A 2ASEA 1TTTA 4YONB 2PH1A 1COWD 3L0SA 2R65A 4Q01A 3U5ZB 4O3MA 2GZDA 3CNNA 4DEYA 5JHHB 2JAQA 5UKDA 3B60A 1YQTA 1JXOA 1U90A 1SVSA 2XTMA 2OCPA 2JATA 4MRSA 3T5DA 1IXSB 4M1KA 5C18A 2W00A 4B47A 3ADKA 1R2QA 4JT4A 2IX3A 4MRRA 1AS2A 2Z4SA 4ZDJA 3PEUA 1ONBA 2ECKA 2R44A 4D81A 5EP3A 2ODWA 1VG0B 1UKEA 2ZSDA 3L0PA 4OI2A 1L8QA 1OXVA 3CPJB 3NBXX 5TB5A 4AKGA 3K1JA 3QKSA 3PITA 3UMSA 2IEYA 2BJVA 3THXB 3MG9A 4KU4A 3AP1A 1D2NA 4Q7MB 5FUYA 5C4MA 3IPYA 2OFXA 4CDGA 2BIFA 2VYFA 2ZR9A 1QHIA 4KITB 2OCAA 2DWQA 1XB2A 1DG1G 4GPTA 3D7MA 4IXNA 4TMKA 3SHWA 3QPVA 4FWTA 2Z6VA 5J4VA 4DLVA 2GAOA 5FOSA 2VF8A 4MKFA 4DRZA 4M8NE 3KUCA 2GBLC 1UEJA 2CHVA 3QBVA 4V0OA 1A2BA 1Z28A 2WWHA 1XWIA 3MCAA 4M9SA 3FWYA 3QVVA 1YR9A 3GLHE 3NBFA 5FOXA 2AKAB 2NQ2C 5J4LA 3QXJA 2RHMA 1GAJA 3VX4A 3DOEA 4ZIRA 5CYPA 4PHGA 1U8AA 1DAEA 1JPJA 2ZRPA 1RFLA 4QNRA 2DWPA 4BFXA 1XEWX 5FPHA 121PA 5FPYA 1Z07A 1E96A 4TL9A 1JECA 1F5NA 1VYTA 3KB1A 4MA4A 4HDCA 1JJVA 3AEZA 3ZVLA 1CBUA 1G7CA 4RD4A 2OV2A 3PCRB 2GEDA 2QE7A 4RD0A 4ZCLA 1EFCA 5FH9A 4I81A 4RD1A 3T1TA 4MRNA 4Q7JB 2QBYB 2B7BA 5JI2E 2CDNA 4Q9HA 2ZJOA 4QGGA 1G4AE 2P2LA 3UMRA 1HE8B 1YZQA 1E9AA 4ASUD 1AGRA 1M2OB 3GEIA 3SBDA 3VMFA 3CR7A 4DZZA 1NSFA 4CEHA 4MITA 4BFWA 3BC1A 1X8KA 4BFZA 1FUUA 2ODNA 3LBHA 2PCJA 3RVBA 3SOPA 3U4QA 2G3YA 2AXPA 4LBWA 4PQRA 1EESA 2BOVA 3BERA 2ZSFA 2FMXA 1NIPA 2EVWX 1R4AA 1RJ9B 3LW7A 5DI3B 4TYWA 1E2KA 1KK1A 4DLWA 1PV4A 4HZIA 3K0AA 1N6OA 3OEHD 4KI0A 4L8GA 2IYRA 3K0FA 4QHTA 1RVDA 4HB4A 4DCNA 4WW0A 2DBYA 5IT5A 3RS7A 3NHAA 1KIMA 2C2HA 2FEOA 1UBEA 4GZMA 2QRNA 5FI0B 5LB2A 2PMKA 3SJZA 1KI3A 1XPRA 2ZI6A 2O52A 3KJGA 5C46F 5K8LA 2J0QA 3I3SR 5FL7A 1PLKA 2LKDA 1TU3A 5L3QA 4HLUC 1KDPA 3NBZC 2D2EA 4Z8YA 3CWZA 1ZUNB 3PUWA 1KK2A 1FTSA 2ATVA 4TQ9A 4URUR 1RW4A 3CR8A 4G5RA 2FH5B 4LBZA 4M9QA 5JRJA 1E2EA 1KJWA 4C0JA 3T61A 4TTRA 4M1WA 4CT5A 5J4YA 1KO7A 1DO0A 5JECA 5ANRB 2GILA 4B32A 2W83A 2H16A 3B2EA 4D25A 3KTAA 5AR1A 5CIWA 4OJQA 5L3RA 1ZC3A 4NYJQ 1EX6A 2VL7A 3HPQA 4CRWB 3I72A 1XEXA 3B1ZA 3SZRA 3NC1C 3AKCA 5DGXA 4HUQB 2OEPA 2EWWA 4Y0AA 4DVGA 5DSZA 2IK8A 1MRSA 2KJQA 5JSZA 3NH9A 2CNWD 3MD0A 1E2NA 1E0JA 3EZ7A 3GLGB 3KZ1E 4P0TA 3UXMA 3CF2A 3B82A 3AVQA 1OH8A 1JR3E 2P5SA 3NBYC 4OL0A 1GG2A 1VMAA 3QKSB 4HAUA 5SZKB 3PXGA 2JDID 3GFOA 1XTJA 2WV9A 3OHMA 2Q21A 4P4TA 1FNNA 4WZ6A 5GJWC 1QHSA 4KXFB 521PA 4MUBA 3LBNA 1E98A 5DN6A 4Z1MD 4AURA 1QG2A 3WP1B 2ONJA 3GPLA 1D2EA 2VHJA 3F8TA 2NOAA 3O8CA 4JLNA 2PJRA 3V9PA 3EPKA 1F6BA 3KQLA 2CNWA 4PC7A 4AYXA 2IYQA 5BYJA 1XRJA 4TLAA 1W44A 1IOZA 4CF7A 2CMKA 2C95A 4PZLA 4QJ5A 3X1WA 2AL7A 1Z6AA 2GVZC 2LWIA 1BKDR 1W4AA 4MKGA 4RCZA 2VP0A 3GLIA 5LB4A 4XD7A 2KBFA 1H8ED 3B13B 3W3ZB 4ZIRB 1QZXA 1JI0A 1VKJA 4DBLC 1KTVA 2GJ8A 3THWA 4JVNA 1Q20A 2FSGA 2PX0A 2OILA 1F48A 2VLIA 3W9YA 1W0JD 2VSXA 5KDOA 2ZAMA 1N0WA 3PEWA 3WP0A 2O8CB 3W6PA 3W3AA 3SBEA 4TLBA 1NN5A 3DHWC 3Q7QA 1DS6A 2ZJ8A 2A5JA 4IDOA 1P7CA 4BLOA 1ZNZA 4HSEA 3WNDA 4YMVA 4BGDA 5EP2A 3EW9A 5J4HA 4D0GA 3CPHA 5FPKA 2GBLA 3I73A 1KDRA 1GILA 1Z0FA 4BASA 3WHLA 2JLVA 4U02A 5E95A 1U9IC 2PZGA 4M1TA 3BGWA 2ZR0A 4X8OA 2O8EA 2B21A 4PO1A 4TT3A 1ZIOA 3IBYA 4BLTA 1EGAA 4ZKDA 3U4QB 4W5JA 4C0HA 2F9MA 1GKUB 1XX6A 3TAUA 2GJAA 2WJGA 3FMIA 2BWJA 3R7WA 4CYMA 5JJIA 1N6IA 1JR6A 3U7GA 2V6IA 2WIBA 2ZI4A 3PJRA 4Q4JB 4A0RA 2IEZA 4PPQA 4B6FA 2CEAA 1TUEA 2A2ZA 2ZSEA 4WZBE 2J9RA 3GLGE 1KI6A 1HUQA 1TQ2A 2JJ2A 4HYYA 4NHOA 4R2IA 2OLJA 4JIMA 4XWAA 2FPLA 5EP4A 3K0FB 2KB0A 1QHNA 3PIRA 4AG5A 2VP9A 1K6MA 4O2LA 4EPRA 2IUSA 2N1BA 3M1IA 1KSFX 3WBJA 2XB4A 3FMOB 1ZP6A 2G0TA 2VP4A 4WIAA 2PLFA 4QHSA 4OI0A 5L3QB 3C14C 3PUZA 4Q4AA 2ZR7A 5B30A 5EZ6B 2QP3A 3CRMA 4JMPA 4RKEA 4Q48A 2V4ZA 5SZJA 3GJ8A 1G7RA 1G20E 1K5GA 3IHLA 3VKWA 1EFRA 3FKSD 3R20A 5AUOB 3Q3JB 4A8JA 1F2TB 1P72A 1H8HA 1HQYE 3AVOA 721PA 4D0NA 4PPNA 1ELOA 2CE2X 3A36A 1KDOA 5G3ZA 2V55B 3KTAB 3SJAA 2WOOA 1KSJA 3EXAA 1TQDA 4KJZA 3ADDA 1SKYB 4HDQB 5FBQB 1U81A 2W0SA 1XEXB 1KO4A 3D8BA 2MSEB 3C5HA 4KFSA 4LV5B 4Q1EA 1W4CA 4PAOA 3RC3A 1M7GA 1AS0A 2J46A 2DFLA 3IEUA 1XD9A 5JSZB 3HWSA 2D7CA 3RABA 2XTZA 4AKIA 2P67A 2X8AA 3TGPA 1E0KA 3KQUA 4TZ6A 1DARA 3FFBA 2JLQA 1GL6A 1OIVA 1NN1A 3PENA 1AS3A 1V43A 1WDTA 2F43A 3DKPA 2HCJB 3VX3A 2XAUA 2HF8A 5DYIA 4GRAA 4IOJA 1C4OA 5CK4A 2QP9X 2QEQA 1AGPA 3CX6A 2XJ4A 3CF6R 2WOJA 3EC2A 4LYAA 2R6AA 2G88A 3IDQA 3CO5A 1Z8FA 2YJTD 1HQCA 2WWFA 2ZPTX 4P4SA 3VHLB 3SJBA 1NKTA 1QVRA 3HU1A 2XNDD 3GEHA 4L9SA 5JCPA 2WWWA 3E5HA 4HEJA 1DE0A 2YWHA 3OE7A 2J0UB 3LQQA 2ZRCA 5CJPA 2H1LA 2QTHA 2A9KA 2QAJA 1DPFA 4GOJA 3GMTA 5IK2D 4NYJR 3I61A 4C3ZA 3QBTA 2ZUCA 3ZH9B 1G3UA 4G3XA 1E6CA 5IHPA 3THWB 1W2GA 4Q4LA 421PA 2ZSAA 4RJLA 3U60B 3A6PC 2OXCA 5AJVB 1Z5ZA 3AGPA 1T8TA 1Z0JA 3CX7A 4LJ4A 1OW3B 3CH5A 2F9LA 3LA6A 5FI1B 4JLJA 3W8RA 2C77A 4TLCA 3ZD7A 4G5GA 1RYFA 5FTKA 2YWGA 1VHTA 1D6JA 5CM9C 5F98A 1K5DA 2OBNA 3B9QA 3K70D 3HJNA 2GHIA 2LKCA 1HEIA 3KQNA 1ZD1A 4M53A 4M1YA 2CVFA 4L15A 3LBIA 3A58B 2IYTA 4C4PA 4F7WA 2IYSA 1N5LA 1ESNA 4BFUA 2GZHA 1J99A 1LW7A 3M4YA 4PANA 3P27A 2O8EB 1RC8A 1G3MA 1DAKA 4HZUA 1T4GA 4IVQA 4UJ5A 4EJSB 1SKYE 2GCPA 5EUQB 1KI7A 1P2VA 1IN8A 5EE3A 2HLDD 2PCLA 3R7WB 4PX9A 3LD9A 4DT1A 2RGEA 2A5YB 2QROA 1W48A 1G18A 4UNRA 2HV8A 4TL7A 3FMFA 5CLQA 3IILA 1KI6B 1E79A 1G8PA 3HP1A 2O8BA 5FOWA 4LHXA 2HUPA 3DEFA 4CVNA 2W2VA 2JJ8A 4MDFA 2B7CA 1E0AA 3HPRA 1P4SA 4C0QC 2FE4A 5TMPA 2ZSBA 4LSGA 2ZRGA 3ZS8A 5JHGB 1OJLA 2X19A 1OFTA 1UBGA 1AA3A 5ELXA 1NP6A 1R0WA 3X1DA 3PVSA 3OF5A 4PAQA 5FR2A 1A7JA 1FUKA 2AR7A 4JKYA 3UG6A 4PFSA 1PJRA 4JLKA 5LBIA 2HT1A 4B3DA 2X77A 3W6NA 3JVUA 3MWLA 1DAHA 1OSNA 1SGWA 1E9CA 2SHKA 5CDFE 5K8TA 5J5CA 4JBYA 5AJZA 4A8JB 4DSUA 1YZNA 2A7QA 3OFND 5FOVA 4N0DA 4DB4A 2EFGA 1ZMXA 2C96A 2WICA 1KK3A 1KZ7B 1XJQA 4WOPA 5EZ5A 5LPNA 4KVGA 4M1SA 1LS6A 3NDPA 1EXMA 1Q1BA 5KU1A 4O2RA 3R9IA 4EAQA 2DWOA 5H68A 3I1FA 4JVSB 5FTMA 1D2MA 2OBLA 3I32A 2NO1A 4EPWA 5JWHA 1CJTC 3AF4A 1GNPA 3IHWA 3VNVA 3BFXA 4LJ5A 2CE7A 3TSZA 1GL9B 2CHQA 1A1VA 1UM8A 4FMCF 4UJ3A 3AP2A 5SZIA 2KBEA 2GF9A 2GRJA 3KXKA 1KI1A 1TADA 4IDPA 2IT1A 4FMDF 4TMVA 1P5ZB 3CNLA 1OIWA 1Z0KA 3P26A 2IYLD 2GETA 3KKMA 3KKPA 3ZIAA 1SXJD 2AWOA 1UJ2A 3GCGA 1T6NA 3LVQE 1PLLA 4JKIA 2GCOA 4LI0A 1OXTA 1A2KC 3RS0A 4XWKA 1NLZA 2NGRA 4TYPA 5F9HA 5B58C 3GJ4A 2J7PD 2RGNA 1O87A 3RC8A 4P4SB 1Q12A 4E5UA 2F1RA 4ACAA 2OCBA 3QXCA 2HYDA 4L4UA 4IVRA 2QY9A 1KHTA 2XEXA 3S1AB 1KGDA 1W36D 2FWRA 1G7SA 1BIFA 4LYHA 3TR5A 1IN7A 4JLMA 3LQRA 3THYB 4A0FA 1ZM9A 5EXXA 5HTKA 2I3BA 4ESVA 4TYYA 2ZU0C 1Y3AA 1LS1A 3AGQA 1OLOA 4EDHA 2CHGA 4X8MA 2DFTA 4EFMA 3ZQJA 3KB2A 1NBMD 3EZ6A 4NCHA 4A0HA 4DLZA 2D7DA 4FCWA 1DEKA 2BBWA 1Q22A 5C2JB 4OBEA 2WHXA 2DY1A 3UG7A 5A4JA 2R2AA 4ITRC 2EWVA 1GWNA 3RRMA 1TX4B 3B85A 4WAUA 2QPAA 3OIUA 5C1BA 2MMCA 2UZIR 3NKVA 1AA9A 2OG2A 3Q5DA 5TARA 1D8TA 3FTQA 3IGFA 3BIFA 1RE0A 1ZINA 4HDOB 2REXB 4GOKA 2VEDA 4PC6A 2O8DA 4AIIA 1RZ3A 3WMGA 1UFQA 2YOFA 3H86A 3AUYA 4OQFA 3QEOA 2WBLC 1R5NA 4HZUB 2JIZA 4IEEA 4M9ZA 4C0KA 4AYWA 2BM1A 1OKKD 2ZAOA 3C15C 2G6BA 3RLFA 3LV8A 4LBVA 1R0YA 3KJEA 3I8SA 4CIDA 3CKLA 1TMKA 2QM7A 4NZYA 4DT1B 3T1VA 2XOKA 3D3QA 4UNQA 1CJVC 5B64A 3CW2A 1M8PA 1T5IA 2GZAA 1QHGA 4Q4HA 4RCYA 3TBKA 4JSYA 3K70B 1E2FA 4ZI2A 2O8BB 3K9GA 3AVWA 4NTZA 2F3RA 1OV4A 2BKUA 4LJ7A 4KO8A 2RHDA 4LPSA 3EASA 4YMTA 3TE6A 1VECA 3B6EA 5FTJA 4KFTA 2ZM5A 3A1SA 3VFDA 4D4LA 1NSTA 2UKDA 2WSSA 4LC0A 4NONA 2YKGA 1VYVA 2WKQA 4GZLA 3BFKA 5L8VA 1RYHA 1G5PA 4OI4A 2R62A 4BFVA 2BVNA 4B2PA 4B2LA 3BJIC 2BMEA 4HB3A 1E2IA 2GEVA 5L3VA 4ZDWA 1XEFA 3K9HA 2Z43A 1BH2A 1W46A 3QPWA 1FOEB 1S0UA 5JS8A 4U00A 1QDEA 3QIAA 2D74A 1W0KA 3TRFA 2VHCA 1KI2A 1AKYA 1YZLA 2QG6A 4QJ3A 4OHWA 3AM1A 5BYKA 4NPHA 4V0KA 2PMDA 2QPOA 4LC1A 1UKVY 2BBSA 3QQ5A 4ZDKA 3CX8A 2IF2A 1G21E 1L4YA 5LD2C 1NF3A 2GA8A 4AY2A 1ZD8A 3K0CC 1ZD9A 3KJIA 3GLFE 1OXUA 4BFYA 1ANKA 3LWNA 2WZQA 1KMHA 2DHRA 2ZE7A 1A4RA 1WA5A 2BBOA 4PQFA 5A0FA 3X1ZA 1ZIPA 2LCFA 3WYGA 1NVUQ 1XCPA 2WMOB 1W4BA 1XXHB 1GUAA 1YZTA 5JEDA 1TQ6A 3U7HB 2QE7D 2JJ1A 2ZYWX 2H17A 3VTKA 1LFDB 3MWYW 4PSAA 2GCOB 2BM0A 1X8LA 3EWSA 4YC7A 1CR1A 5JMTA 1E69A 4MH0R 2KI5A 4I1OA 2A5FA 4DCTA 2Z0MA 3I4LA 2FPKA 3FB4A 4E22A 5GADl 1DADA 3A37A 3EZ9A 4DCUA 4QBHA 5JJLA 4OHXA 5CM8B 2W6IA 1E2QA 1I4LD 3FOZA 1KJYA 5DYGA 3RSOA 1NN3A 4I1SA 4BLQA 1UEIA 2ZE6A 4C30A 2XXAA 1Z3IX 2CCJA 4X8LA 2XITA 3CPEA 1SXJB 1KK0A 3ADCA 2R6FA 4FMCB 1AIPA 1CTQA 1HURA 3CUEF 3EG5A 2IWHA 3L0OA 3SC3A 4F92B 1RRFA 1L7VC 1Q1ZA 4XVQA 4ZO4A 2DYKA 2P3SA 4FMDB 3TIFA 1EX7A 5FTNA 3UIEA 4DLRA 5G3YA 4IEIA 4PQYA 1T9HA 3K0SA 1MO6A 3MWJA 3QY0A 4HB0A 5AWFC 1RRCA 4PR0A 1IN6A 3BE4A 2Q3HA 3KFXA 4NMMA 1US8B 2F7SA 1W36B 1DTSA 3CZQA 3BXZA 5FL7D 3RWOA 4MQBA 2IS6A 1R10A 2GWHA 5GVRA 1NMYA 2ZROA 3B78A 3Q72A 4YXWA 3AVTA 2O8DB 1KY2A 1G19A 3U3JA 1VCOA 5FL3A 1ZM3A 3R8FA 3L2OB 3GJ0A 4DLXA 4A9AA 2WSMA 3PUYA 5GJVC 4GSYA 1P2TA 3DMDA 3GJ7A 3QKUA 1ZM2A 2RGGA 2RH5A 2WJVA 1U0JA 4MKHA 4DEXA 1S96A 3LY5A 3PG5A 2X2EA 5HE9A 2XNSA 4I4LA 4MDEA 3DM5A 2C9OA 2C9CA 2OSBA 2H18A 2AD5A 1P75A 2G77B 2O0JA 4NL4H 3C5CA 4ZKEA 2QMHA 3B5JA 4PTLA 3QF4A 2QTVB 1CULC 3SN6A 4TMWA 1SVKA 1XXHE 1NVVQ 5EE5B 1JQLB 4EIWA 4OK5A 2CLDX 4JL8A 2ZRDA 2GJ9A 2RGXA 3E2IA 4UNSA 2VHTA 4F93B 3X2SA 1UF9A 3T12A 1EFUA 4QBGB 1Q0UA 1E4YA 2J0VA 4LYFA 2O8FB 2ZE8A 4FMBB 4LDJA 5E4FA 1E94E 2J1LA 5KNBA 2ZS9A 3WYAA 3K9LA 1KI8A 3A1WA 2FNAA 5DN6D 2K5UA 2I1VB 1N5IA 2JLUA 3ECCA 2IA5A 2JLXA 2QL6A 2YNMA 4WVFA 5EE9A 2X1VA 4POAA 4Y0VA 1FNMA 2F1IA 4KLNA 4UXJA 4DSTA 2BHRA 1E2PA 4LCBA 2VSOA 3CONA 4UXHA 4OJKA 1LB1B 2V1UA 3QKTA 1RRPA 2FGJA 5FPTA 1Q21A 1S1MA 3HR7A 3BD9A 3T06B 4Z51A 1N6LA 1SXJE 4URVR 5AUPB 1GNQA 5CJ2A 4XD7D 3MRSA 4KLZA 1XBTA 4MYTA 2NO6A 4GP6A 4RZUA 4DXAA 5KPJA 2IHYA 1IXRC 2Q9BA 1JPNA 2D62A 5EQTA 2VPPA 1GP2A 2ZRMA 2GK7A 4LUCA 5JZVA 3VKHA 1G5RA 1GNRA 1KMHB 5EP1A 1P2SA 1FZQA 3EA5A 1NVXQ 2CBZA 1F2UA 1R5BA 2C78A 3VNUA 2ZU6A 4BZXA 3LFUA 5CB8A 4F4CA 1MABA 3AP3A 1E2GA 4AI6A 4O0MA 1XNJA 3QENA 2C99A 1W4RA 3VR6A 4W9MC 1DG3A 1II0A 5AJXA 1Q3HA 5TVKA 4JLBA 2E87A 2FFBA 2QPTA 4I99A 3UPUA 1PUJA 1NBME 2C5LA 2VIIA 1NY6A 1N6NA 3Q9LA 2B8TA 4QNMA 3RRNA 3TKLA 4BLRA 4C0BA 1F60A 3FHOA 2QUZA 1VG1A 4GDFA 1LV7A 2G83A 5AUNB 2QP4A 3NG1A 2YC2C 4RFVA 1XCGB 2IUTA 2RGBA 5FR1A 3A1UA 4TT3D 4B71A 4RZXA 2GEUA 4B74A 3U6BA 3KXLA 4A92A 2VP6A 4E03A 5KO2A 4FCVA 3K0CA 1XF9A 3BRWD 3VR4A 3IIJA 4OKSA 4ZCIA 1UKYA 2F3TA 4I1UA 1XTQA 1M7HA 3MGCA 3I5YA 1YZGA 2VHQA 3CH4B 4V0MA 4WZAE 2EFCB 3R9XA 2HT6A 4BEBA 1MT0A 5EUMA 2JJ2D 3EARA 3AF1A 4LX0A 2VP2A 2J59A 5TY0A 1XD8A 4CEIA 2TMKA 5AUQA 4DCVA 4ZPXA 3SQWA 1FQJA 3A4MA 4Q47A 3K09C 4BPBA 4CEHB 1CR0A 2EU8A 4Q9IA 3MJHA 4M22A 3QSYA 1B23P 1CRPA 2QSZA 1IY2A 3ZZ0A 3BWDD 1MV5A 3ZD6A 1NRJB 5D3MA 3OEEA 1UPTA 1I4TD 1N0VC 3PQCA 2IC5A 2ZANA 2QAGC 1D9ZA 4GFDA 1WXQA 3A8TA 2OFOA 4OQNA 1EFRD 2QZ4A 4TL6A 4K8OA 3K0AB 1E2DA 2W6JA 4Q1BA 4JLAA 2VP5A 4ZDIA 3LRPA 1H8HD 4URWR 5DISB 1W49A 4JJZA 2CLSA 3WRYC 3UMFA 4MGIR 2F55A 1NLYA 2B92A 2ZIAA 3OAAA 4DDVA 2AK3A 3GJ6A 4WBSA 4LY6A 4KYUA 3IKJA 3RS4A 2PLRA 4DJTA 2EYUA 3T15A 1MH1A 2QT1A 4LV6A 2WWXA 3AVPA 3KL4A 3U61B 2KWIA 4HAYA 4FXPA 2FGKA 1IXZA 2FSHA 2OAP1 4QOSA 1D5CA 3G82C 3IIKA 4R71A 1NG9A 4A6XA 4A36A 1NN0A 2REOA 4F4IA 5BW8A 1R8QA 5G41A 3TR0A 1P3JA 1KI9A 3T34A 4US2R 1G9XA 1EFTA 1G16A 3G5UA 2GNOA 2ZE5A 2OT3B 1NIJA 1WCV1 2QMUA 3V00A 4BFTA 5DNYB 4L5BA 1E9DA 2BJWA 5J40A 3KDSE 3E70C 1GTVA 3L8ZA 4GNKA 1Z08A 3Q7PA 4MYUA 2IHBA 4IXMA 1JEDA 2XSZA 1E9EA 3LW8A 3QG5A 4HLDA 621PA 5FTLA 2IS1A 1OHHA 1OT3A 5GJBA 1G6HA 1YJ5A 2YVUA 3GJXC 2FDCA 3KX2A 3AKYA 3RS5A 1HT2E 1XCMA 4QRHA 3W5IA 4NCIA 2FPMA 1HA3A 2BKEA 3E1SA 1ESMA 3OE7D 1YRBA 2XZLA 4B76A 2F6RA 2HXYA 4HLUA 1G291 4XVUA 1G3IA 1VHLA 1XEWY 1R0XA 2WWYA 2ODEA 1WQ1R 4M4SA 4HLQB 1M7BA 3SU8A 4AWXA 2D06A 2HF9A 1QVAA 1F2UB 2ZRAA 1U8YA 1G1MA 2W2TA 2ZS7A 3B7GA 8OHMA 3MUFA 3ZLJA 1NVVR 3TSOA 2FV8A 5J47A 1SXJC 5CLLA 3SHFA 1E4VA 1YR7A 1XFAA 4BUJA 3FDIA 2ZRBA 1KZGB 1XU4A 3CBQA 4KODA 2QI9C 4WXPA 1XMSA 3LXRA 3GLIB 2W58A 4BZQA 2UVQA 4PAMA 1P60A 1UDXA 2PX3A 2WJJA 2Q3FA 4US0R 1YZKA 1SVOA 4G5OA 4HAVA 5EE0A 2NO7A 3EWAA 4GT1A 4EUNA 2Z83A 5HPYB 2PT7A 3VKGA 2ATXA 2IYZA 1W2HA 1YU9A 4A0GA 2V7QA 4URYR 4TSFD 2FA9A 2OZEA 4S35A 4GL2A 1UADA 2VRWA 5EXTA 4ARZA 2WPDA 3V4RA 4F38A 4D4MA 1KI4A 2ZITA 1AK2A 4IFBA 2ZI7A 2QORA 4W7SA 5HE8A 5FOUA 3TMKA 4YMUA 5JBQA 4U7DA 2H7VA 4JL5A 2WAYA 1E79D 1A82A 4JBWA 3THOA 1SQ5A 1EK0A 4F91B 1NNEA 4EQ6A 1OYYA 3SJCA 4M9XA 3TUZC 1U2RA 2ZYTX 4Q1DA 3A1VA 1NMXA 2A30A 3K0EA 3W6OA 5HR5A 5KSYA 1E1QA 4MUAA 4ILEA 2ERYA 4Q19A 4PHHA 1VIYA 1XTKA 4TSFA 3C8UA 3LX5A 3VR2A 1NJFA 1CJMA 2YINC 4QGFA 4B34A 5CB6A 4LHVA 2EFDB 3AF3A 3EIHA 4QG7A 5D3MB 4QKQA 3O8BA 1P9NA 4LPKA 1WB9A 1FQKA 1HE1C 1UAAA 1BS1A 2QGNA 3NTUA 1QRAA 2BMDA 3QXXA 4TTPA 2RB4A 4KBGA 1G4UR 2IXFA 4BECA 3WYFA 2YHSA 5TDHA 3R8CA 2FG5A 4URXR 1NMZA 1ZJ6A 4HAXA 2VTKA 1CU1A 3NVAA 1BMFA 3GLHA 3HYRA 3ZQ6A 4DC9A 1JAIA 3NC0C 5JCZA 4TMZA 2YYZA 4QM7A 1CJKC 4O25A 3RS2A 3H4MA 3LNCA 3HR8A 3LAWA 5AK0A 1KOFA 4JVMA 4URZR 1U0LA 1OFUX 1U9IA 4Q4AB 3K09A 4UNNA 3NDBB 2H92A 4DUGA 2VSFA 1IQPA 2GXQA 3GQBA 4FN5A 1G3RA 2HCBA 1EWQA 4PO8A 1TF5A 3WMEA 2DFNA 3W5JA 2BMJA 1N25A 3GLIE 2WVJA 3AVVA 2P6NA 3ZIAD 4XTCS 5L3SA 2CK3A 3N2EA 1Z83A 5FUWA 3DMNA 1WBBA 1ZUIA 2A5GA 2MSDB 3B1YA 3MFYA 1IAQA 1G6OA 1PUIA 3CRQA 4NH0A 1JALA 1MOZA 2NO9A 3B9PA 1CR2A 1AM4D 2EFHB 4HAZA 1YE8A 2VHUA 3IO5A 4IDQA 3LO5A 3TSWA 4IKEA 1JQJC 4NYIQ 3WNBA 3PFIA 5EXPA 3CLVA 3T1QA 3NEYA 5E7JA 5LDDC 1J8YF 1RRGA 3V4FA 1E1RA 5JWOA 5H70A 4QL3A 1GOTA 3NXSA 4UXIA 4DCSA 1MO3A 1YR8A 2F43B 1GRRA 4D2IA 1SVIA 1R7RA 2Q6TA 4RY2A 4JS0A 1T3SA 2MSCB 1GITA 3BH0A 3W8NA 4R9UC 4EPYA 3DM9B 2JEOA 2XX3A 3BK7A 4Q9LA 3UK6A 5DHAA 3THXA 4K46A 1KSGA 2ZRNA 2CXXA 4QBIA 5JFGA 4Q7KA 3N70A 1OH6A 1TL7C 2VF7A 3RSLA 2PEYA 3RHFA 1DVRA 3QXHA 4UQOA 4BZPA 3P32A 4YMSA 1OXSC 1ZRHA 1X3SA 1VCNA 3AB3A 4S2EA 1P9RA 2W0MA 2OUKA 5E3HA 1G64A 821PA 2AFIE 1FP6A 2G9NA 3RNLA 3TW8B 4P3YA 1IN4A 2ONKA 1FX0A 3TAHA 4B3FX 3TK1A 4M1MA 2GCNA 1DAIA 4CGZA 3KFVA 1N6HA 1M1YE 3U3KA 1Z0IA 3FKQA 5GJCA 4TTQA 5CIQA 1OXXK 3ZGXA 2JIZD 1GZSA 3OIYA 3DOFA 1Q1EA 4IDNA 2A5DA 4RFSA 1CF4A 3FGNA 2ZI9A 2OAQ1 4CEJA 3H84A 3SS8A 1DOAA 3QG1A 4NU0A 3CM0A 2BC9A 2RCNA 1UBFA 4NKRA 4R7ZA 4RKFA 3QJYA 2XOKD 3VU9A 1M6NA 3ZDQA 3F3YA 4IOMA 3PEYA 3TUIC 5FFMA 2IXGA 3KUDA 4TMXA 1NJGA 3BAFA 4BQSA 4HATA 4KSCA 1II9A 1XJCA 3FPAA 4A15A 4B3CA 4EQ6B 1Q3TA 1JR3A
chains in the Genus database with same CATH superfamily
3P9SA 1JHAA 4GX5A 1XMVA 4JQZA 2HX1A 5FJJA 2NUBA 2VS1A 4LGMA 3OIDA 3TL6A 4AZ0A 4DQ0A 3VO9A 4WTOA 3AERB 4EAAA 4I5GA 3MPOA 3O74A 5CH8A 4IR7A 2P2CA 5M04A 2IDKA 4X60A 2AEFA 2XE4A 1LJLA 3BORA 4CLOA 5MDHA 4Z4EA 1Z12A 2CF6A 4JOQA 1I3NA 1I2DA 1C1XB 2B20A 2FOLA 3HUUA 3MMZA 3RTCA 3UWDA 5K4GA 1XKQA 2VH1A 3U9LA 5E4JA 3V7FA 2AI2A 2Q6IA 2BKLA 4UOZA 2ZJ6A 2QUIA 4AAYA 1OF1A 1UJMA 4B6QA 4BYMA 1CKEA 3KK0A 3ZZNA 2UZ0A 3IAAA 3ZQ4A 4XEUA 2AV6A 3LP8A 1B1CA 3GA7A 1JTEA 3LC7O 4U2FA 4Y2GA 5A3VA 4GPIB 4DDWA 2DTEA 3IO3A 3UA4A 2JEZA 4C29A 2VCYA 1WJGA 3ZXYA 4DLBA 3QE0A 1A96A 4ISBA 2P90A 4RQUA 2GSWA 2JAPA 4IIJB 1IMJA 2R1UA 2A3NA 1KFCB 5KPDA 4MV1A 1P6XA 3ELUA 3DHNA 5LKAA 4EB3A 1FW8A 1ENOA 1W87A 4K9MA 4BEJA 4EPTA 3PX7A 4DSOA 1S8FA 2C29D 3P9PA 4ILKA 4JC5A 4OYLA 4RIHA 2FJUA 4EHLA 2VH2A 4EJ6A 3HDTA 4MQ6A 5JVDA 2DB3A 3Q85A 3P2MA 1ZUNA 5IJXA 4XIIA 4F2PA 1XQ1A 3T5BA 3T5MA 1GRCA 1AQJA 4Z7OB 3PDHA 2CBGA 3EA4A 2H8KA 3I9MA 4E5PA 1EZ4A 2FF5A 3ND9A 4E1AA 3WNCA 4GHWA 2JJ1D 1D9XA 1P1IA 1VCMA 2GK3A 2VJOA 5LUBA 3EX7C 4AKHA 2H4YA 3OZRA 4Q24A 2NPFA 1NUQA 4Z4HA 1EXNA 3DMTA 4P3KA 3UXEA 2HFJA 5HKKA 1AQYA 1TM5E 4X1IB 5KSOA 4CQNA 1MXHA 2IYUA 2JAXA 3NUZA 3I2GA 3MEQA 3QLTA 3ZY4A 1OQAA 1U8ZA 2RBGA 4ZOLF 5IX8A 2A33A 2OCGA 5AKKA 3HU2A 1SUIA 5M34A 5CDGA 4B73A 1MB4A 4ZI3A 3BXXA 2D3WA 2IYEA 2PSHA 2PR2A 3K8ZA 1JLHA 1A9QA 3KQOA 5AH0A 5FLEX 5KSZA 2E9SA 4FCTA 3LT1A 3COJA 1O6CA 3SYTA 4DMGA 4BC0A 1IY0A 2JGMA 4CM1A 1SVWA 3NHJA 4CMIA 5CYGA 4DAOA 5JIBA 2I7TA 3ZD8A 4C0SA 3ESXA 3T52A 1J23A 3KEMA 2ZREA 3S29A 2PE5A 3C48A 3DYIA 2AB0A 2Q0QA 1DAFA 2O4UX 4HQFA 5JATA 4XWOA 4JT2A 4P31A 1COWA 5AKXA 1EB9A 2IPMA 4RAOA 4LQDA 4BO9A 4X6UA 2G71A 1RCFA 1ABBA 1NWCA 3Q3IA 1MFPA 3VR0A 2G9UA 4L95C 1G7TA 4XWWA 2NUAB 4M46A 2H51A 2O2CA 2Y4NA 3OESA 3O2QB 1D7AA 4LECA 2D8MA 3DQPA 2WAXA 2GXSA 3L79A 1GGKA 4F6RA 5CXUA 2QSUA 2ZRKA 2BFCA 3KB8A 3KKNA 4P8RA 4HNHA 4Y6GB 2BEKA 1CIPA 1OB2A 1D1SA 5KX5F 1D2AA 4O5AA 4YMWA 1IU9A 1FXWF 1P1JA 3GF4A 3I5XA 4J4TA 2GB4A 2Q5FA 3QMWA 1Y3FE 3H8SA 3N2YA 3OQPA 5D6NA 2XJ9A 4WA7A 5IWAB 5EESA 3VNBA 5JZOA 3VJKA 4B8WA 3ROXA 1KRHA 1RKBA 1XDBA 1J5XA 5H8WA 4CEJB 1ZCBA 3L8DA 2ZRJA 2ZIZA 4AUNA 3T7IA 3THSA 3O8DA 4FIDA 2ZJ1A 3OLCX 3OPMA 3L84A 3HBNA 1U1IA 3O4IA 4I4NA 3A2LA 3NC4A 2O4CA 4PWYA 4ZVNA 4CIYA 3QOFA 1EUDA 1PX2A 1X86B 2PZEA 4MWOA 3RVJA 3U44A 4JBLA 1WEKA 2BP7A 1CJUC 1FP4A 1ZAKA 3FRJA 1K6JA 2XZOA 4KO4S 4DB2A 4LXIA 1KKLA 2PT5A 2A3RA 2PBRA 4OHUA 1PK9A 5BWMA 3R9WA 3AVYA 4L74A 2B4TO 1YDEA 1CC1S 2XDAA 4IHJF 4QA9A 4G1UC 1TM4E 4HWPA 3TLAA 1XP5A 1RAHA 3MAAC 4ZHQB 2Y1WA 1IJFA 1EXDA 4W1PA 1VPTA 3R6TA 2E4XA 2VK4A 4PFQA 4TV9A 2SICE 2X1MA 1KJZA 4WLEA 5JWRA 4LFBB 1LPAB 1U3UA 4AVYA 4KDRA 5DXAA 3PDWA 4C03A 1MT3A 3I2JA 1ZGGA 2Q6LA 4B8ZA 1Q57A 1ICEA 1KPIA 1WCXA 4PS1A 3QP9A 4PX3A 5EGSA 1W75A 1XA3A 1W47A 2IXEA 4L22A 3H16A 2EJWA 2AD1A 3CRZA 4GMDA 1NKVA 4U2KA 3VZDA 3KTDA 2QDXA 1S2IA 1V9LA 5KS2A 4YMIA 3U7FB 3L7NA 5EI5A 4BNZA 3ORFA 4LOKA 2VPXA 5C5EA 4GWLA 5EQFA 3OSUA 3O5AA 4JHLA 1RZVA 2Q1WA 5A06A 3G0HA 2OBBA 4DM4A 3ZI0A 3LOQA 4L16A 1ZK4A 3EC1A 1L9KA 3SE7A 1ULSA 1E64A 1SHKA 1V1MA 3MQFA 3SX0A 3ML1A 1GUDA 2FZLA 1MVNA 4QU5A 2DERA 3JZFA 1FXSA 3N0WA 3QYPA 5ENVA 3VO1A 2NAPA 1SOUA 2ZYDA 2WVAA 4AFNA 5EN4A 9ABPA 2XBMA 1YQ9A 4BRUA 3PFGA 4KVAA 3W34A 3GFPA 3EEBA 2QX9A 2LGJA 4GBMA 4K03A 5EHXA 2GF0A 3K0KA 1FYVA 3K8QA 5A7HA 4DWVA 3UGKA 1QOQB 3G5LA 2R11A 1N8KA 1H2RS 4QTZA 5H4HA 3U81A 1OMOA 4JWKA 3E03A 1THZA 2ZJFA 3L46A 1GU1A 5A5DA 1EMDA 2R1VA 3GARA 4DLUA 3T4EA 2M6RA 3V32A 3TG2A 5E2AA 1TW2A 2BGLA 1JG3A 2YZNA 1XNRB 5G0WA 5I7SA 3M1AA 1PZEA 1DP4A 3VPSA 4MRPA 3WK4A 4UTOA 3AQIA 3GYBA 5BN4A 2JL1A 2FZVA 4RV5A 4DMKA 4YCLA 3OZ7A 4HCJA 3C41J 3N75A 2PT6A 2E5WA 4TOIA 2O7SA 3DKIA 2Q5CA 3QVLA 4LHWA 5DWDA 3HR4A 2ZPUA 2PY6A 1JAHA 4JLPA 2K4MA 5JZSA 1XNQB 1QORA 3QV2A 4EEXA 4FU0A 2OBMA 1Y98A 3V1TC 1H6CA 2OGUA 4YDHB 1RXCA 4YRPA 4AJLA 3T1OA 2I7DA 4DUPA 2G28A 3VR4D 2W2KB 3P5BA 1YC2A 5BV1A 4XGRA 2BZGA 2H5EA 4UDOA 1B6RA 3M3PA 1NTOA 1S2OA 2GO7A 4UCXA 1Z0AA 3SNKA 1IQUA 1YV9A 3KUXA 3UICA 3ZU3A 4DW8A 4RH3A 1ISFA 3GG9A 4M87A 1G17A 3PUXA 3L8EA 1FFCA 2PD6A 3V3KA 2GD1O 3M0EA 4R2HA 3TFQA 4QJ4A 3SZLA 3EEYA 4F1KA 2MIIA 2ECQA 4G0PA 5H1YA 3W3AH 1Z06A 2WQ7A 2PQMA 3EBPA 1L8XA 2P9GA 1X6VA 4C0LA 1L6IA 3IEPA 4MW1A 4BVBA 1FTGA 1P19A 3RF6A 1N2CE 3VH4A 3DWFA 5JASA 1XAGA 2PL3A 2H7XA 3JZAA 4WERA 1XAIA 2VC2B 1UQUA 1BJRE 3F0TA 4FKMA 4MYDA 4Q16A 3SYKA 2PSEA 5JI3E 1G20B 1I2MA 4HJRA 4WGFA 4AS3A 3SBOA 5KTMA 3KG2A 1K7FB 3C70A 2LUOA 1ND5A 5E7QA 1W2WB 1DAGA 5ALEA 1Y8ZA 2RGCA 3L41A 4RCVA 4D8YA 1LLDA 3TTYA 3G7NA 5I4CA 1I01A 1L5YA 3CNBA 1T10A 1QO0D 1XDZA 4C5AA 2J07A 2QNRA 4HGNA 2JH9A 3CRVA 4QUBA 3NM4A 4UEOA 5BOSB 1CS0A 1QC5B 2OQ2A 2GN8A 3S8EA 1IBRA 2OD7A 3GD7A 3O1JC 1SBZA 2AYXA 4PNPA 5CITA 1KO5A 2ZIVB 3E0XA 4G01B 1E5TA 4GGPA 1QAQA 2H57A 2I4TA 1TCAA 3JCZA 5G40A 1R0RE 3RREA 5B2ZA 2VK2A 3Q8MA 2ORYA 3EXG2 4O29A 3OTOB 4P2GA 3K70C 2PRSA 1GVNB 1U80A 4CM7A 3OFVA 1YONA 2FSUA 1I7SB 1XHFA 4UU7A 1RPNA 3VSDA 1Q7CA 1KOJA 2HJSA 2ZT7A 3NWEA 3OLZA 2WT4A 1EX9A 1GUYA 4AF6A 3L4EA 4YH1A 4QYMA 2C92A 1Z38A 2QLLA 1PTJC 1V1RB 4LXGA 4BV2A 4C9BA 2FRVA 1J2RA 4ZEMA 5JDIC 4B43A 3OZDA 5FLYA 3O4HA 1GCAA 5BV7A 3EZ2A 4HVAA 5F1YA 1EINA 1GPMA 3DPUA 2OLKA 1GFWA 3D1VA 2P3QA 3AZPA 4LK2A 1E9RA 3OY7A 1IYZA 4CG3A 4N3NA 2DPXA 1PDWA 4GOXA 1CZHA 4EW3A 4ZV4A 2J9ZB 1Z35A 2NU7B 1VJDA 3MWKA 1E2MA 5T8KA 1V5GA 2G9RA 3UB3A 4NU6A 4CLRA 2AJLI 2IXBA 2P6UA 3MLEA 4JJFA 1RBZA 3IEVA 3R74A 2FPPA 4X1KB 1C3OA 3H9EO 1RAGA 1VL8A 4LTNA 4C08A 1OH7A 3TZ6A 4MUGA 3LK7A 1BXRB 2VK8A 3GD5A 3IQIX 1KAGA 2QRHA 3QF4B 4PVCA 4Y2PA 1GPBA 3OBBA 1BKSB 4KQWA 3EIWA 1UAYA 5CK5A 3ZKWB 4EY7A 2L17A 4KL8S 4PNEA 2D4HA 4LJ8A 3R7DA 4X3PA 1EI9A 4XM0A 4EWLA 3BS4A 5CA1B 1LI4A 3HU5A 5AJYA 4AD8A 1PD0A 4N49A 1UJ6A 3SY8A 2AUTA 2DR2A 1TPZA 3SD7A 1GFSA 1FL9A 2J09A 3E1KA 3A4LA 3WYDA 1KSHA 4AZTA 2YH2A 4CM9A 2WW8A 4DIKA 2Q49A 4GEGA 4LY3A 1KS9A 2MMGA 4MWBA 5NULA 2HQOA 4GF5A 3KALA 3SSNA 2ZCVA 4H6VA 2FSFA 2OCYC 3OEYA 2AJDA 1K5HA 2CJFA 4R1LA 1GM5A 2ZTMA 5F9MA 4UVEA 2GVDC 1LPSA 1ZJZA 2NZJA 2IV2X 2DR3A 3ESQA 5LYJA 1BDBA 1S8OA 4KQ6A 4LMAA 1DCTA 1TQ4A 3IUPA 4OFXA 3MIZA 4IIFA 2ODBA 4M99A 3L49A 5ESRA 1DAOA 2IHZA 1LK7A 2ODPA 3HBLA 2OXTA 4MCHA 2C3YA 4P86A 1A4IA 2RKOA 1NVTA 4OU4A 1GTSA 2OR3A 1XQXA 3OE1A 3GDWA 5LR6A 3AZQA 1X9GA 5HCUA 1N1GA 4GBED 4CBVA 4LKRA 3GLTA 1VPLA 2X23A 3OIWA 3PWKA 4FJ0A 1T3HA 3O03A 4FW9A 2IYXA 4MWSA 1VBFA 2XH8A 1OX4B 1C30B 1SC6A 3LXXA 4MR8B 5BUZA 4CCYA 4FD2A 1N9GB 2A94A 1AF4A 4RO0A 3N5CA 1R50A 4ZZ1A 3R0IA 4M2LA 4BCCA 1QXSA 1XJ0A 3VO8A 1TEZA 1VYHA 1UBMS 2V7QD 4B09A 5KTSA 3TQFA 2NU9B 5EHQA 5HF9A 5I7VA 3GT0A 5JRDS 4M1OA 5LM3A 4ZYUA 4IUDS 5L51A 1AXRA 1QLJA 3C45A 4Y3UA 1W85A 5FPQA 4C22A 3FKSA 3I6BA 3PNSA 5EE1A 4H0NA 4EFLA 3VPDA 5B1SA 2V6JA 1GFIA 2ZBUA 3O4RA 5KDDA 5DTJA 3V7WA 5J5AA 1YJBA 3ESZA 1BYIA 3LVRE 4O2BF 2HWYA 1VM6A 3OX1A 4GZ3A 2R6CA 5E2IA 1PVDA 1VQ1A 3OJLA 1E8DA 4M55A 2BFFA 4C0AC 4QXRA 4DR1B 5ADVA 1K8XB 4QTXA 3VISA 1DUVG 3OBIA 3VI4B 2VF2A 2YWFA 4GX0A 3D1JA 4WLVA 5ENZA 1KVTA 1NVKA 3QPUA 4FR2A 2HCFA 5D3QA 3MLAA 1IPEA 2W8BB 5E8RA 1CD5A 3U3OA 1E7QA 2WTUA 1FVXA 1T0HB 2RIPA 4TV8F 3WGYA 3LGAA 4MX8A 4YCDA 1DL5A 1TF2A 1S9DA 2OPHA 3S1AA 1J42A 4U5XA 1WDMA 3D64A 3ZCVA 1V3TA 4Z54A 4QREA 2DFKB 4F1WA 3KYJB 3SEQA 3THYA 4OXIA 3P0JA 2DMRA 1GR0A 1J33A 2ROQA 1GKYA 3R9XB 5T4EA 3GR6A 2A59A 2HJ9A 3Q3VA 4H1UA 4XGNA 5D86A 4AKEA 4F4JA 4Q1AA 5HWSA 3Q12A 4UEKA 5JAPA 2XB8A 3QV1A 1ZCAA 2WMDA 1JG1A 3WS7A 4EVQA 5HX7A 1KFEB 3AMVA 3T3NA 2GZ1A 2JA1A 1G21A 3PQ7A 4OQYA 4N3GA 1V39A 2XCQA 1IBSA 1Z4JA 2WHQA 3GLFA 3PGXA 3RYIB 1L1EA 3VSBA 1YFKA 5KQPA 4CHGA 2B8NA 2ILTA 2YDYA 1LRLA 2OHOA 1N4AA 2ZYVX 4K6FA 3EHDA 3KT3A 4F11A 5KNDA 2ZJBA 3HXTA 1PQ4A 1XMJA 1MHPA 4MPRA 4XSVA 3SFTA 3F6BX 4W1SA 4ZQFA 2XUDA 4OHKA 1ULUA 5F2OA 3KQKA 2PLWA 4G5SA 3AESB 3WJAA 4EF6A 2GEKA 3L7OA 4WFKA 1V6SA 1TU4A 2BEJA 1FEZA 3IALA 3TNYA 1B41A 1B0ZA 1U0SY 1Y0BA 1O5IA 2EW2A 3D6UA 3MMPA 2R6GA 2Y0EA 1VSBA 3EQ7A 2BGIA 3N86A 4GR9A 3V2UA 3VZSA 1RZRA 3RJMA 2CK3D 1U8CB 1GTJ1 1NF8A 1XLWA 4R0MA 4LRXA 7REQA 4HXYA 3RTDA 1FY2A 1FFHA 1G98A 3ZVMA 2H2WA 5ERGB 1G42A 3NP9A 3KBBA 4P33A 1U0TA 4E46A 3FWHA 4E94A 1M1ZA 1P2GA 4RIEA 3CVYA 1IONA 2HJVA 1SZJG 2Y93A 5IPFA 1IN5A 1WUYA 2B5OA 2RGDA 5LZ9A 2ZB3A 1DRVA 3CF0A 3FPHA 1DBRA 3CVOA 3J81A 3W2EA 5GGXA 1YFJA 4C2AA 3V8MA 3AIIA 3N2GA 3CSSA 1MTZA 5E1BA 1NNSA 4A8HA 1L7PA 5ER9A 3OZXA 1USUA 4I4TB 3BCUA 2CL0X 3IAHA 3U1TA 2OECA 4B0PA 4MQEB 1KR2A 4PIVA 1ETUA 1P3DA 4EECA 3TNFA 3NU1A 1LGYA 5F7XA 2KQUA 4UDYX 4DLYA 2HSJA 2QA5A 4GBGA 1WABA 1YVPA 1GAEO 5FBLB 4EELA 3SS7X 5KYYA 3KNZA 3P1JA 3WRYA 4AO7A 4H3KB 3TMAA 3RAJA 3OQNA 2RC5A 3WA7A 4ZTZB 2J32A 5DTQA 5LDGA 4D3ZA 1BO6A 1NDUA 3HZOA 4BTVA 1R0BA 2WR8A 1EVKA 3OQIA 1GIAA 1Q0QA 2C0QA 2CC2A 4G1EB 4JWTA 3U4MA 4HXFB 1JDSA 1K9SA 2GHRA 2Q27A 3M6IA 5CDSA 4YAGA 1LNQA 1WSDA 2XHEA 2VT3A 2XYQA 2QGFA 3MOGA 4Q37A 3HMQA 2JLBA 3WKDA 1LA2A 3TUZC 2DPHA 3FNGA 1JQEA 4BZZA 1NJ6A 1UP6A 4WOKA 3UPDA 4QM6A 3A27A 1BD3A 1RAIA 5T57A 1N7JA 4RD2A 1GUFA 1K7XB 2OHFA 3ASUA 2Z8XA 2BFPA 4Y2YA 1W8DA 4MYCA 5GV7A 3Q8LA 1J70A 2PMCA 3CLTD 1TK3A 1YE5A 1XDSA 3T0GA 3UC9A 3OIVA 3EA0A 1E3WB 2H11A 4H1HA 1Z26A 3DFKA 4AO8A 1FFXB 3FJOA 2IDMA 16PKA 2O2SA 1CW2B 1ZQ1A 2Q9AA 3R24A 2GTPA 1MW9X 2V54A 1YA6A 3LUGA 4L3WA 2WMNB 5JJCA 2O57A 2VTBA 2Z09A 3WB2A 2HSDA 1WM1A 4RHXA 4LRWA 3OCXA 4MUYA 1KFKB 3T9EA 1B1AA 5ESWA 2I2CA 2JGFA 4TVKA 3KR9A 1PR3A 1JR3D 1REQA 2JIOA 1H2EA 1HMPA 3NEAA 4TRJA 4G84A 4CIBA 3GMDA 4RZSA 2FYTA 4HBGA 5T4FA 3H2YA 3R7AA 3TQRA 4HNQA 1SM4A 3MXOA 5KVQA 5I6DA 5BN3B 3UCEA 3HXOA 4YQFA 4HDRB 1Z8DA 2VQSA 5LP6C 2FSVA 4WV3A 1OWMA 1NVEA 1TFRA 2QXUA 4MKIA 7GPBA 4GKJB 3DD5A 1K8ZB 2C4TA 5DHFA 3FSRA 2Q45A 1FPQA 2D54A 2QX8A 3QU4A 5B1DA 5HMMA 4FINA 5B3JA 4O4LF 1GL7A 1YRAA 2N42A 4NABA 2IWRA 2H52A 4MAFA 1AO0A 2JB9A 2OV1A 2PIAA 2ZYUX 1OLUA 4NLLA 4PZDA 5JQGB 2FR8A 2OOKA 3COZA 3VQTA 1UIMA 4I55B 3JYHA 1X7WB 4FYXA 3ZZMA 1C7ZA 2QVXX 3F7OA 4B9EA 1FMCA 2OO7A 3GT3A 2OXEA 3DUWA 1A97A 2C7GA 2CHEA 3JWJA 3LO8A 3TYXA 4FYMA 5KTPA 3D31A 1Z33A 2DZDA 4ZGGA 3QFCA 1MP0A 2WE8A 2X8LA 2Q50A 1NKSA 3G2NA 2GHQA 3T9DA 1YRHA 3N9IA 2WYWA 4JYBA 4Q3EA 4WN9B 4ZI5A 1CZRA 3U9TA 3HO6A 2FEWB 5ALYA 1C9KA 1WZUA 3L8MA 1IXYA 1Z29A 2QJWA 3G6KA 3QGMA 1B6TA 4PV7A 5JZBA 2I87A 4IQ0A 3ZVNA 1CP2A 1KPGA 5IYZA 1YDHA 4JI0B 4LQLA 2ZTLA 1P1BA 3K9NA 4PTYA 1OE0A 1L5SA 2O05A 1K3FA 3RM3A 4N3CA 1UDWA 1GZVA 1VKNA 2GH1A 3BULA 1QB8A 1OYWA 3HJHA 1NBMA 1T0PA 2PX2A 1J6UA 2BJHA 4DYVA 3G8CA 3P2YA 4ESHA 4B3TB 3JVVA 1O8CA 1U31A 1VA4A 4BX9A 3PQDA 3MWEA 5KC9A 1JBKA 1E58A 1LX6A 4OMDA 3IIMA 1J7JA 4DUYB 5HG0A 1HYQA 3AH8A 2ZKLA 1O95A 4FYPA 2EKDA 1YL7A 3CT4A 4RK6A 5DO9A 5IM4A 5EJEA 3HV0A 2JASA 2FX3A 5JRZA 4ZAVA 2OE2A 1GPH1 2H7YA 2IY9A 2HN9A 4KCGA 3O3OB 3GQBB 5CHEA 3FTFA 1G8HA 3IDFA 4RHUA 4O2AF 1W581 2Q0XA 2WNHA 4K0RA 4WZAA 4F9EA 3O91A 4BP8A 3ESDA 1LPPA 4KN5A 3UJNA 1E6EA 2CNBA 3ZYCA 1ENPA 2NIPA 3F98A 4LTMA 1P31A 4PC2A 4Q3OA 1EIZA 3S55A 4RSGA 1SQ0A 4JLVA 1IMOA 3C1AA 3KT8A 4DQDA 1FRZA 1PEKE 1UZNA 3HDVA 1T91A 3G0GA 3OQOA 2ZWVA 5J58A 2ASEA 3N28A 1ADBA 2PH1A 4X84A 3FVWA 4EY4A 1ZVJA 3Q1LA 1Y4DE 4WY2A 3F67A 5UKDA 3B60A 3OETA 2E85A 3LKDA 3HB5X 1NXSA 1QQBA 1SVSA 3T5DA 1KJIA 1XZAA 2W00A 3HXMA 1QZTA 2OORA 1R2QA 3MUOA 5GZ3A 2CVPA 2PK3A 1AS2A 3FUVA 1QH8B 4FSXA 3TZHA 4TT8A 5IG2A 2D5CA 2R44A 3DV2A 1TMGE 4CM5A 1QWSA 5EG5A 5TIIA 3DEIA 3DOIA 5ADWA 3CPJB 5CJJA 3UAWA 4YJDA 4GKKB 4AKGA 4GE0A 4I8DA 4L85A 4PFKA 2ZZNA 2JFYA 1JDBC 3UMSA 3OUTA 2HNKA 1YS9A 4EVRA 4FYHA 4ND8A 2OOSA 4KVFA 1RPAA 1I30A 3AX6A 2ZR9A 1Z56C 5JH7F 1NRXA 1QHIA 4GZMA 2OCAA 3E3AA 3RTAA 4KITB 4MWDA 1YS4A 3ILSA 1DG1G 4IXNA 1R27A 4K9DA 4TMKA 4FWTA 2GOYA 3Q6NA 4DBLE 2FMIA 4P0QB 1WMBA 3O8OB 5ELLA 3NHMA 4CKWA 4K7JA 10MHA 1Y3DE 4HWTA 5AOVA 2GAOA 3DE7X 1Z2PX 4P22A 3ZW7A 4LHEA 2Q3DA 2GSDA 1ND6A 2YRFA 3VV3A 2H5LA 2GBLC 2CHVA 4H7IA 2YXLA 5KJ6A 4I6GA 1A2BA 2CGEA 3HKCA 3R3HA 3NCTA 4GLJA 3P0IA 1I7PA 1YHZA 3MCAA 2DAPA 2IOFK 2REQB 3QEKA 3S8MA 3OM9A 1V35A 2YXEA 1PL8A 4G0XA 3QXJA 2NW6A 2OKCA 3RYHB 4IWXA 5FDFA 1BQEA 4FUTA 2FPIA 5KNCD 4IGAA 3WB1A 4TS3A 1GXSB 1NURA 2QRVA 5JAIA 1JPJA 2ACEA 3FETA 3Q88A 1JEOA 1RFLA 2DWPA 4R1NA 3TMYA 1BN7A 5FPYA 4G8BA 4WCFC 5JC1A 1BW9B 1JECA 1VYTA 3JATA 5DBHX 1N33B 4JELA 3PCRB 2GEDA 3EN0A 4C5CA 1S4MA 3BRSA 5JCXA 1V1JA 4HFJA 4CTOA 4G4JA 2IVFA 4JDUA 2E82A 2WHPB 3T1TA 4Q7JB 5EIOA 2CDNA 1WKVA 5IWCA 2C88A 4QGGA 5KVVA 4GLLA 1T35A 3UWPA 4BNYA 4N40A 4EZEA 3UMRA 4UMVA 3EXIA 1JFVA 3BPSA 2QN9A 1AGRA 2FW0A 1M1UA 3O3CA 3VMFA 1HE5A 1V16A 2WU3A 1NSFA 2YRWA 4EJMA 1VJGA 1VJ0A 2R1TA 1DU4A 1GEEA 3BC1A 4MB2A 5EKSA 4BFZA 1FUUA 3FA2A 1EK6A 1F1JA 2PCJA 3FSGA 3IMFA 3LOUA 1V8FA 3LPLA 3RVBA 1N2XA 4PQRA 1WNFA 3MRVA 4RKYA 3D7LA 2JCXA 3BSFA 2RGYA 1HTBA 5IULC 1NIPA 5B1YA 3OUUA 2BF4A 3BX1A 1CQPA 5DI3B 4G4IA 4Z9YA 1E2KA 1HFEL 4PONA 4OOEA 2WDZA 1PV4A 1Z7YA 3EF1A 3KU1A 2MHCA 1RYDA 1GA6A 3OEHD 3IQEA 3K9CA 1AKVA 3BT7A 3JD2A 4LCJA 4BIIA 4PCVA 2CSXA 2IYRA 2W9XA 2XMQA 3H7AA 1RQPA 4FFDA 3DBHA 3IVMA 3H6KA 3RS7A 3NHAA 4L9RA 5EWLA 1PN3A 2C2HA 2FEOA 2VWQA 4GLOA 1VMIA 2Z04A 1CVLA 3O2JA 1KI3A 2ZI6A 2O52A 3KJGA 5JAUA 3BXHA 3OMLA 1RYMA 2HF2A 4UD6A 4KR2A 2WIFA 4HLUC 1PK8A 1LPMA 3CWZA 1N3IA 3EWNA 4Z8YA 3PUWA 1ZLYA 1YHYA 2AXEA 1RW4A 2ZQYA 3I9NA 2FH5B 1PJ8A 4TQ9A 5E1MA 2VYQA 3RSSA 1M8FA 5IJ0B 1YB5A 1KE2A 1C7RA 5JD4A 4C0JA 2R4UA 3HZHA 2YCBA 1UK7A 1WV0A 1ZH0A 2E3JA 2AG1A 1KQNA 1QGUA 3T61A 3TQOA 3IAUA 4C0WA 2E6KA 4N01A 3EVGA 1SK8A 1VZ2A 5ECYA 3F3KA 2D2XA 5ANRB 1QK3A 2OWEA 1NXQA 4P98A 3O38A 5EYPA 4EG8A 1FFYA 3W2GA 1JHMA 2AH5A 3NYIA 3EY4A 4O4HA 4JEUA 4TKUA 3EPLA 1L5VA 1IY8A 4KQ1A 3KT6A 3RC7A 1V25A 2PX6A 3D02A 3SZRA 3VR6H 2GN9A 1XC7A 3AKCA 1UXOA 3HSSA 3GY0A 2FWIA 1SFRA 3AUSA 3EGXB 2OQRA 2WIKA 3H11A 4L3VA 4Y0AA 4ALNA 1NBOA 4BYGA 4C3VA 3ZLVA 1C0EA 1Y7IA 4INJA 4REQB 2YL2A 1FRNA 3H5NA 1NHWA 1SQSA 3EUWA 4GWKA 4H7PA 5CA0A 1P4JA 3B82A 4QLAA 3ZHCA 3NBYC 2W43A 1QV9A 3ZE1B 1GG2A 1VMAA 1U1GA 1R4NA 2X2PA 5KYTA 3NV9A 3MTBA 1SOAA 1FNNA 2PWBA 4B31A 1QNFA 3QYJA 4Y30A 3WIUA 1UZMA 1MBZA 3LBNA 4UMDA 1E98A 3T8YA 5AI6A 1N92A 5M5BA 4ZTUB 4LF9B 4BGUA 4HDSB 2JI9A 1KF0A 3LKZA 4I3HA 1IB0A 3VR3D 3VUFA 4DGQA 2NOAA 3O8CA 4L7VA 4AJKA 3V9PA 5FLXA 2FMFA 3NT4A 1F6BA 3OU6A 4DXHA 3MIIA 5BYJA 2COKA 1XRJA 4TLAA 1W44A 3S4YA 4K0KB 2CXUA 1ODTC 1FDVA 2X0JA 3CSDA 4UOQA 2AL7A 4AG3A 1Z6AA 2IH4A 2HLPA 2LWIA 1W4AA 2Q2WA 2G1PA 3MTJA 2D5AA 2C3PA 5AM1A 4XD7A 2O1WA 4ZVUA 4B81A 5DGDA 3IFSA 3WXBA 3O2SB 4LZAA 2HWUA 1HE3A 4KDCA 3RFXA 4DZRA 3BKWA 4NBRA 1KTVA 3THWA 1NBWB 2PXAA 1Q20A 2UYHA 4FGSA 2OILA 4OQQA 2JIBA 1W0JD 2VJYA 4CQMB 4EHKA 1S01A 2ZAMA 3IKLA 4ZT5A 3BWCA 3LL4A 3VOAA 4W5TA 2PO7A 3VU0A 3W6PA 2WSBA 3RAGA 1YL5A 3HCRA 2PUEA 3GUUA 2X3YA 2P62A 2JJYA 3UQYS 1HQKA 3TPZA 3WNQA 3RGGA 2J6HA 2B2XA 2BTQA 3AB7A 3IRVA 3STWA 4HLNA 4YMVA 3EW9A 5J4HA 3GRCA 2B4YA 3CB2A 3PICA 2QR3A 2EHJA 4P35A 3QFRA 1Y7HA 1KDRA 4EJFA 1SC9A 3NBUA 4IRMA 3CUTA 1I7DA 3BBLA 3IS3A 2WU8A 1TQHA 1TLLA 4U02A 4QECA 3BGWA 2ZR0A 3JQDA 2P27A 4LRYA 4N6OA 4MR9A 4QOIA 5KYWB 4PO1A 4AWAA 4XPZA 4EDFA 4YJ2F 3JSXA 4EA7A 3PQ6A 5K0TA 1F0NA 1YBHA 1UC8A 2F9MA 1XX6A 3CKYA 3U4QB 5KX5B 1JVNA 1NUPA 2WJGA 2D5BA 3MINB 2BWJA 5JYBA 1QRSA 3GO4A 5K20A 2BGUA 3O90A 3T5CA 4JP5A 1EK2A 1FRFS 1OBFO 1BE6A 5BRJA 4BJ6A 2IOQA 4QDTA 4ZCPA 5M2QA 1SD5A 4DV6B 1GDTA 4CU2A 1BU5A 1TUEA 2ZSEA 4WZBE 3OG9A 2J9RA 4KQXA 3GLGE 1SIWA 5I3ZA 5KOJB 1KI6A 1HUQA 1QIIA 3UAOA 1TQ2A 3PNPA 4HYYA 4NHOA 2PUBA 1QVVA 1U7UA 1XL0A 1JKJB 2FPLA 1PCXA 2H9AA 4GX2A 3LUPA 4MW9A 5EP4A 3R8XA 3WLFA 3WLLA 4AG5A 4ES6A 1O77A 5HUQA 2J5RA 1HKUA 1I1QB 1K6MA 1Z39A 2VP9A 4PINA 5CNJA 3S40A 3UOAB 1TU0A 3GHHA 3IUBA 4E51A 1LWOA 4DWOA 3SVTA 3WBJA 2HY7A 3KYDB 2XB4A 3DEHA 1EWVA 2A0KA 5A6SA 1USKA 1XVIA 2PUVA 4H4DA 3K1TA 2G0TA 4IHJB 1KZYC 4E6PA 3OWOA 4QODA 2X15A 1OAOA 2PIDA 3HCOA 4RABA 4XX0A 3SICE 5BR7A 5L3QB 5ALKA 3BGOS 1A5ZA 3ERCA 1EUCB 4E2WA 4JMPA 3FPSA 4Q48A 3UT0A 5SZJA 3IHLA 2O1XA 4G25A 4B46A 2RHTA 4KUHA 1NQUA 3DBRA 4FUQA 3V4OA 5BUQA 3P96A 4LVCA 3C5WP 2JVJA 3KCNA 1P72A 4GM1A 1IZ8A 1HQYE 1C9EA 4MVJH 1E92A 1RP7A 4PPNA 1ELOA 4PW0A 1AUVA 4MEJA 2JJQA 2IEGA 4EB0A 2O2ZA 3F71A 3KTAB 3QQPA 4IDDA 2UUAB 2ZUTA 5TT1A 3ADDA 1ITZA 3TFOA 4HDQB 3ID6C 5FBQB 2AVDA 1P33A 4D7AA 4PICA 1I5EA 1MG0A 3C5HA 4KFSA 4LV5B 3IODA 3ELDA 1AS0A 1UL1X 1AA6A 2DFLA 3RT7A 2NNWB 3W5VA 5JSZB 3KYCB 1V8BA 3MAJA 4AS1A 3JAWA 2AFHA 3FCCA 3R5TA 5KYUA 1E0KA 4JQOA 4YB8A 5C3MA 2Z30A 2XHZA 3SR4A 5C52B 4TZ6A 3TZQA 3EDQA 5B6PA 5IZ4A 2PTHA 1NF2A 5A9SA 3WYCA 4KGXA 3S1LA 1OIVA 1CJCA 4GMFA 3DL2A 4GM4A 3RO7A 2C2GA 1AMNA 1V43A 2ARKA 4C6TB 1HNWB 4FZRA 4TUYA 4W6QA 1ZN7A 3CX3A 1BS2A 1VLVA 1XZEA 2AZMA 1A2QA 3K20A 4Q3DA 5AKEA 4CL0A 5K0CA 4RVGA 2IYPA 4X65B 4MUIA 2OA0A 3UAGA 2XJ4A 1N5OX 1HEUA 3EC2A 1UUFA 3TEFA 3LOPA 4IHAA 3NWOA 2QTWB 2OB2A 2PS0A 2V7EA 5AJUA 3K6JA 4CDNA 1HQCA 1MJFA 2A9JA 2CDAA 1SXPA 4PG7A 3WJ7A 3DSRA 1JG2A 5EZ6B 4BNVA 4JAVC 3SJBA 3OC0A 3HU1A 3PQ4A 1UCFA 3GEHA 4GPZA 3M5WA 2C3MA 2HO4A 2PVSA 4BMVA 1PKXA 4Z49A 4CQMD 2QF7A 2H1LA 4CV1A 3D6FA 1VA5A 2OV8A 2QAJA 4FS8A 1DPFA 4GOJA 4LNUA 3B38A 2IPOA 5B3KA 5IK2D 3E9CA 4CIAA 3JQAA 1XT6A 4J4HA 4I66A 1CEYA 3IA2A 4KR9A 2NO4A 4FK8A 5FWYA 4RF3A 2ZSAA 4RJLA 4K6HA 2OXCA 3B6KA 3AGPA 4PN7A 1EHYA 1Z0JA 3PB3A 4LWQA 5JAZA 4L4YA 1HYGA 3RYCB 2VT6A 5FI1B 3OQVA 3W8RA 3L1KA 4RVNA 4C21A 1B6GA 4E3WA 3V1LA 3ZD7A 1TKBA 4QU0A 5DXFA 1S02A 1CRWG 1SZDA 5FNVF 4RTLA 1VHTA 1TYDE 3GGPA 5F98A 3B9QA 1PJ4A 2CB0A 2OZLB 3D6JA 2KHZA 3I5MA 5IANA 1ZD1A 2CVFA 5CB4F 1DQNA 1SWVA 1LWNA 2WTAA 4PZUA 2A58A 2IYSA 2ZUEA 1H66A 3OCWA 4YAIA 3W5DA 4BFUA 3NALA 2Q6VA 1AUOA 1K27A 4KRYA 1LW7A 1Y1LA 3IQHX 3VJMA 3QX8A 1G3MA 1A8QA 4IVQA 4UJ5A 3QLUA 4BQRA 1W6UA 4IJVA 4JJAA 2DHEA 2GCPA 5EUQB 5CAEB 1P2VA 4PWZA 4AJ1A 3AEXA 3SJUA 3R7WB 1WTAA 2R7LA 4PX9A 3ESAA 1E2UA 4WECA 4ZOEA 1FBTA 4S04A 2WJAA 1R18A 3C8HA 5AW8A 2I5PO 1AXGA 4JENA 2JD1A 4LKOA 4HDNB 2HV8A 1EAYA 5CLGA