2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
1HTWA 5TB5A 2OCPA 4NHOA 4TL6A 3SFZA 5IHPA 1X86B 2CL7X 2Z6VA 3IBGA 1X8JA 4DIEA 4KO8A 4NCIA 4Q5IA 1G8PA 4RSGA 4PFSA 3ZYCA 4ZV4A 3VKHA 3U7GA 2QY9A 4Q9HA 2QE7D 3L8ZA 4PPFA 2CCKA 2V7QA 1EXMA 1QHYA 3OEEA 3H84A 3QKUA 5FOTA 1SVMA 1CTQA 1CR2A 2QTVB 2RKOA 1NVWQ 1ZRHA 4HDQB 1UPTA 4XWAA 4PC6A 1OH7A 4PQYA 3KZ1E 4IJMA 2FH5B 4W5JA 2RGAA 2JLQA 1MO6A 4JMPA 4ILEA 1G64A 3B1YA 4CYMA 1QBKC 2ZAOA 3LWNA 4KBGA 5E95A 3ZZTA 3MJHA 1KOFA 1R0YA 3BXZA 2FX3A 4IEIA 1ZUIA 1RJ9A 3RHFA 3ZLJA 4DZZA 3WRYC 2B7BA 1CP2A 3RC3A 2J0SA 1QHSA 3OEHD 1VMAA 5KHOC 2OBNA 3K0FA 1DTSA 1IQPA 1VIYA 3QKRB 5EQTA 2ZR7A 1JALA 2W6JD 1CJVC 4BFZA 2C98A 5CJPA 5C4MA 1JJ7A 2W2VA 2W6IA 4UNQA 2BBTA 1RRPA 2JJ8A 1KSGA 5AJVB 2YJTD 3TAUA 1DE0A 2C9CA 2QAGB 4PPGA 4KU4A 1FQJA 4QBFA 4PTLA 1CJTC 4C0BA 4RD1A 2FPLA 1KZGB 1SQ5A 3FHOA 2GXUA 3PQCA 1XTRA 1XJ0A 5HCIA 4A8JA 2OLJA 3ECCA 1AQUA 1Z2CA 1VG1A 4HUQA 2P65A 4I1OA 1FW6A 1YZTA 1VYTA 4HZUA 2AK2A 2C03A 1U0LA 4GT1A 2QNRA 5L3RA 3OAAA 3CNLA 1NMYA 2PZEA 2ZU0C 4LHWA 1KO1A 2J41A 2BJVA 1SXJD 2FMXA 3G82C 3SOPA 4V0NA 2OCBA 4TN1A 5HKKA 3LDAA 3AKYA 1TQDA 4I81A 5LB2A 1EFHA 3EPHA 2ZR9A 4NYIR 4B71A 4GDFA 1GKYA 4RD0A 4P3YA 1OKKD 2F9MA 2ZVQX 5CB6A 4FW9A 4B34A 2BOVA 1FX0B 3WRXC 4KXFB 3NDBB 4TLCA 4YLGA 3QBTA 1LNZA 3MJRA 5K8UA 4JLVA 4Z8YA 4DBLC 2GZHA 3B78A 2YOHA 3TK1A 5BN4A 1II0A 1KSHA 2EYQA 3HPQA 3LO5A 4TMZA 1JPNA 2IYRA 3GJXC 5JECA 2WAYA 5K8IA 1TUEA 1YZNA 4QGAA 1IHUA 4MGYR 4EPXA 1F5NA 4GL2A 3A1WA 1U2RA 5TY0A 1GNPA 4OK6A 3NC1C 1D2MA 2RGEA 1KJYA 3FE2A 4LCBA 2GXAA 2O8BB 1OYYA 4DSNA 1NMZA 1E1QA 1AQYA 3CWQA 4TLAA 3C15C 4IDOA 4TTRA 4DDWA 4RZ2A 1KI9A 2WV9A 5FPYA 5LB4A 3RLFA 4XJXA 4DJTA 3U60B 3K70B 2GTPA 1CRQA 3C8UA 1XTQA 4PC1A 1AA3A 3OFND 3QKSA 5EUMA 2G83A 1G3RA 1SULA 4K8OA 1T8UA 4H1UA 4KYIB 1PV4A 4HLCA 2UZ3A 4ACAA 3KJIA 1QHGA 3ZS9A 5EP1A 1T91A 1GL7A 4OHWA 4ZKDA 1F48A 4DCVA 1A2BA 5EZ6B 3C5HA 3GLIA 3TGPA 4LX0A 1YR6A 3H4MA 4UNSA 1XTJA 2G1KA 1I2MA 1W4BA 4FMDF 2OEPA 1S9HA 4BLOA 1FTNA 1DAFA 3VQTA 4LBVA 4OI1A 2CVHA 1U90A 5L3VA 3FOZA 2ZYVX 1E4YA 1VCMA 1EFRA 2BHRA 2OG2A 1ZD9A 4PANA 3ZZUA 1KDRA 3LLMA 3ZVLA 4EPTA 4HAUA 1ZD1A 4NONA 3REFA 5AR1A 5F9HA 4NP6A 1LB1B 1KJZA 2RAPA 3I32A 4MKGA 3KQNA 1TQ6A 5A5GA 2VSFA 4DDTA 3WY9A 1L8QA 2VQSA 2WWHA 2DFKB 5CIWA 3K0CC 4D4KA 5FTJA 2KE5A 1KO8A 2BKEA 2JJ1A 1NP6A 1UFQA 1OXSC 1Q1EA 4ARZB 3EA0A 1O87A 2IXFA 2P67A 2V54A 3NBFA 4DUGA 2XNSA 2ZYUX 1NKSA 3AQ4A 5AJWA 3KKOA 4I4LA 5EE5B 3F3YA 1N6KA 4HAYA 3WBKA 4LJ5A 3KUDA 4DLYA 1W36D 4LV6A 2F3TA 1OXTA 1MR3F 3CM0A 4FMCB 4QKQA 1KNQA 2CCGA 2Z43A 3K0AA 4GOJA 2GXQA 2JJ2D 2CHVA 3T61A 1FTSA 2BC9A 1TAGA 2C9YA 3RS5A 4G3XA 3GQBA 3PUWA 2IUSA 3FKQA 3ZIAA 3BC1A 3IHWA 5FPTA 1IXRC 1Q12A 2CXXA 4B76A 4EKDA 4KLNA 5G3ZA 3GLHB 5FUWA 1XMVA 1RRFA 1HE1C 4GSYA 5G3YA 3FMFA 3S1AA 2ZVPX 2F55A 3FHCB 3P27A 3LBNA 3T1QA 5DSZA 3NXSA 1WBBA 1KI8A 4Q7LA 3SQWA 4BFSA 1E6CA 4KODA 4F92B 1MRSA 1A4RA 1E9AA 4ZI2A 1Z0JA 3GPLA 2C99A 3AF0A 4PO1A 1WP9A 3NKVA 3P4YA 1T0JB 4RFSB 4DLZA 1XCPA 1G8YA 5D3MA 2KJQA 3C14C 3K1JA 1H8ED 1P61B 4A9AA 2CMKA 4HYYA 4LI0A 3Q3JB 5C2JB 2ZRPA 3NEYA 4LZZA 4QOSA 3R9WA 1UADA 3NBXX 4XD7D 4Q9LA 4FIDA 1E2MA 2DWPA 4XSHA 5FL7D 3SNHA 1HV8A 3L43A 3QPWA 5BN3A 5JFGA 3OE7A 3VFDA 1SKQA 2IYQA 3AF3A 3PEVA 3X1YA 5J4LA 1QHNA 4IDHA 3BB1A 3GEEA 1JQLB 4LYJA 1JR3D 2VP5A 3HU3A 4TLEA 3BRWD 2XOKD 3IIKA 4RKEA 4M1MA 4P32A 4BLPA 1N6PA 3U7HB 4HATA 2QBYB 2XXAB 2LKCA 3EG5A 4IKEA 1G5RA 3FVQA 1S3GA 4US2R 3R9XA 1KAOA 3GLGB 1X1RA 4ZCLA 3BFXA 1Q22A 1CBUA 3ADCA 2GEVA 4IXNA 1AGPA 4P33A 2RMKA 3NH9A 4CRWB 1E9EA 2FJUA 4Q03A 4EQ6A 4FCTA 3SJZA 3KQHA 1BMFD 1FOEB 3QXHA 2W2XA 3IO5A 4A15A 1WA5A 1KI6B 2QSYA 1D9XA 2DPXA 3AVQA 2ZETA 4XVQA 3BBPA 5FL3A 5KSZA 2GJAA 1GSIA 1U0HC 1SXJE 3HWSA 3UMFA 2J9RA 4N0DA 5FUXA 4EAQA 2DBYA 2L0XA 1SGWA 4DC9A 4QHTA 5F98A 4V0OA 2D7CA 2REBA 1Q3TA 1E94E 2IS4A 4TLDA 3QF4B 5JZVA 5CYPA 1T3SA 2F1RA 2IYLD 1E2PA 2ZRDA 2OFXA 2QT0A 1KJWA 2ZJAA 4Q7JB 1KI4A 2XB4A 4UXIA 3V4FA 3W6NA 3QVVA 1T9HA 2KBEA 3QNUA 2F1HA 1S96A 1ZNWA 3NIBA 1SKYB 3NBYC 2VP9A 4A36A 2HLDA 1E2QA 1LS6A 3RRYA 2AN9A 4DSUA 1G3IA 4M1YA 4IDPA 2H5EA 3IQXA 3KFVA 3Q7PA 1Z0FA 1NY5A 3QKTA 1CULC 1TF5A 2Q9AA 4C7OB 1A5TA 5ELXA 1IN8A 3QG1A 2PH1A 1VYUA 3BFKA 3V00A 1E2EA 2FNAA 3QKRA 1OH8A 3SU8A 1UEIA 2FGJA 1G3MA 2IC5A 4O2RA 5FBLB 2OUKA 3BB3A 5EUQB 4IVRA 1P9WA 4HUTA 1YZLA 3RYTC 1W4RA 3CH5A 3N5CA 4M0LA 1FMLA 2ZRLA 4Q21A 2VTKA 2QAGA 2PBRA 4IFBA 1EESA 2B6HA 4C0AC 3FKSA 4GMDA 1Q1BA 1D2NA 2MSDB 3QPVA 4LC1A 1D9ZA 2N46A 2GJSA 3H0KA 3MFYA 1KO5A 1KDOA 4OHXA 5GJWC 4ZDKA 1KY2A 3QY0A 2IHYA 1KKLA 5FBWB 4AKEA 2C9OA 5JCPA 1NN0A 1NG1A 1US8B 3TQFA 4KSBA 1W47A 4D2IA 4URXR 1OJLA 3A8TA 3DOEA 2OFOA 3MAAC 2ZI7A 3FWYA 4B33A 4JYBA 1VHTA 4BEBA 2DR3A 3QXXA 1DAEA 2CHGA 4B73A 2YZ2A 4KSCA 3AM1A 5H8WA 1W5TA 2WHXA 1E2GA 2AXNA 2CNWA 1RRCA 1UAAA 1KO4A 1CU1A 2H8KA 3Q8XB 4JKYA 4LGMA 2HT1A 4HLDA 3RSLA 3UATA 2AX4A 2VHUA 4NCJA 1BKDR 4OQXA 2C5LA 2JATA 1QG4A 2ZUCA 3GJ7A 1FX0A 2QN6A 1G7CA 2V7QD 4XIGS 2B21A 2BBSA 4C0QC 3K0EA 4B47A 1DBSA 221PA 2IF0A 2V9PA 3D6TB 5M04A 3TVDA 2A5GA 1Z3IX 1HH4A 1ZIPA 1PLKA 3BB4A 3ZQ6A 2ZRCA 4PO8A 3KFXA 4RZ3A 1YZKA 3DEFA 1XD8A 1R7RA 4PC3A 3LRPA 3W5JA 3H1TA 3MWYW 4LJAA 4Q9IA 2J7PA 1E98A 1UF9A 4LYFA 5FI1B 5EJEA 4M53A 1G6HA 1VG9B 2O8BA 1AKYA 4DSOA 4TYYA 3CF6R 1IAQA 3PJRA 5JBQA 3PENA 3UKDA 2WPDA 1RYHA 2QGNA 5KNCA 2Q9BA 3LXRA 3AP3A 3QG5A 1FP7A 1M34E 2F7SA 2ZYTX 4AC9A 4LV5B 5UKDA 2W6ID 3SBDA 1R6BX 4A1FA 2GKSA 4LPSA 1SVIA 2RH5A 3EC1A 3NC0C 4GPTA 4BZQA 4N3NA 2YV5A 3AKCA 3THWB 1G41A 2YOGA 4BASA 1T4GA 1MRNA 1P72A 3I8SA 1IOZA 1GL9B 4XTRA 4MUAA 4DT1B 1E2IA 2GCPA 2JGNA 4D0GA 1KNXA 3EWSA 3PCRB 1FUUA 1KYIA 3F8TA 4F38A 2G77B 3CPJB 2YC4C 4FN5A 2IW3A 3E2IA 2BBWA 1NF3A 3CZPA 2AFHE 3K09A 4JLBA 1NVVQ 2R9VA 4C0LA 4LHXA 4RKFA 421PA 2JLYA 3SHWA 3CX6A 5G41A 3P1JA 3B82A 5JSZB 3AF1A 2VP0A 2JLZA 1G21E 4OI2A 2FN4A 1P7CA 1JR3E 3A36A 3BE4A 4KVGA 3RS4A 3TAHA 4LJ4A 5J4VA 1CR0A 3RS2A 1TF7A 3T5GA 1HEIA 3EZ7A 4FMCF 4TL7A 3QOFA 4BFUA 5EXXA 1XPRA 3LXXA 5K8TA 3T1TA 2HJVA 3BJIC 5FBVB 4YMUA 1NSTA 1Q1QA 5CDFE 3THOA 4B3DA 3NG1A 2OBLA 2X1VA 1PUJA 3IQWA 2WWFA 3U3KA 1ZM4A 2RCNA 4FWIB 5JMTA 5CITA 5JS7A 3GJ4A 2WWYA 2FFQA 2VLIA 3DKVA 1N6NA 2YINC 4UNPA 2ZI5A 5FTMA 4HEJA 4ARZA 1BH2A 3UIEA 3FTQA 2DFLA 4YXWD 2PZFA 1YVDA 4DLSA 5SZJA 4PXAA 2ZROA 1S8FA 1M7BA 1U8ZA 2IUTA 3M0EA 5IK2A 2ZJ8A 4NYJQ 1OYWA 1PLLA 2FZLA 2GESA 5FR2A 4DWJA 2BIFA 1DOAA 1E1QD 2WIAA 3GMTA 4LV8B 2N1BA 2HUPA 4Q9KA 1GNQA 2QA5A 1DO2A 4MRRA 4RCYA 4PZYA 2EFHB 2QU8A 3O8DA 3RS0A 2PT5A 1U99A 2W2TA 2KWIA 3TVTA 2QP4A 2ZSBA 1KAGA 5P21A 4ACBA 4BLSA 2ANBA 3K53A 3GLHA 3MG9A 1RIFA 3ZDQA 2CE7A 2HJGA 3P32A 4TMWA 3U6KA 2AKYA 2QAGC 4C2TA 3VR1A 2ZS9A 1DVRA 4L8GA 4Q1AA 1JXOA 3ZZ0A 4R2HA 1N6LA 3MWKA 3EPLA 4QHYA 3SEAA 5HZHA 1M7HA 4BLQA 4RFSA 5DN6A 5FBRB 4CGZA 5F2EA 4HDCA 1EWQA 1JXMA 5BYKA 5BN5A 2J0UB 1KDTA 3IBYA 4WOPA 4MDEA 4TQAA 2OZEA 5BXQC 4IRUB 2BMFA 5EP3A 1KK1A 1XD9A 3PR1A 3TW4A 4BRUA 1BYUA 4TYQA 3B1WA 4HZIA 2ZR0A 5DHFA 4LC0A 1GRQA 3ICEA 1EFUA 2YKGA 1R0ZA 3VMFA 3U5ZB 2A2ZA 4CDGA 5C46F 1SVKA 1XXHB 2WTUA 3VR2A 5DISB 3GLGA 1R5OA 3CX7A 4KV9A 4BLRA 3HR7A 3JVVA 4QM7A 1NJGA 2ATXA 2JJ1D 1N6OA 3N2EA 2XZPA 5IT5A 4EJSC 1JNYA 5H1YA 1KSJA 2QPOA 2IK8A 5KSOA 3T12A 5JLJA 2VHQA 1H65A 4YMSA 2BCGY 4XVRA 1HUQA 1XJCA 4IOKA 1D8TA 2QZ4A 1KI6A 3TMKA 1II9A 3VX3A 2VHCA 2WM9B 5C1BA 4M1WA 3VNUA 1D6JA 1U9IC 4O25A 4AK9A 4B2PA 3JZAA 3W8RA 1VCOA 3BGWA 3OIVA 3I61A 4V0KA 3CRRA 3PUVA 3ZIAD 1NRJB 2QPAA 1Z06A 3K70C 1CF4A 2F3RA 1LF0A 2HXSA 3BWDD 4MGIR 4A2QA 2ZXUA 3L82B 2GBLA 2DFTA 2FOLA 2R6CA 4N1AA 2ZRGA 3EC2A 3QF4A 2C04A 1EWRA 2KB0A 3ZS8A 3ICQB 4TMXA 3A4MA 2PEZA 4HAZA 3WHLA 2ZSEA 3SZRA 4Q1FA 4RD6A 4US1R 2R44A 1UKEA 1E2FA 2B8TA 4DRZA 4D0NA 1PZNA 3OHMA 3ASYA 521PA 2QENA 3A58B 4JT2A 2IYXA 3KTAA 1E0KA 4B74A 2ZRMA 5FH9A 3L0OA 2X2FA 5DO9A 1W1WA 3W3AA 1XRJA 3OZXA 2XITA 3BH6A 3SS8A 3EPJA 3OE7D 3HJNA 1YZGA 4MGZR 1ZUNB 4HLUC 1GM5A 2XB2A 4PX9A 4C7OA 2ZJ5A 3DZDA 1GOTA 4IEEA 1E9RA 4A2PA 1XFAA 3WYFA 2O8DB 4NBSA 4TMKA 2A5FA 1N6HA 1Z6TA 1WQ1R 3LD9A 1IJFA 3TR0A 1FMJA 3B1ZA 1Q21A 1GTVA 3HR8A 2ZJ2A 4PR0A 1DO0A 3GJ6A 3R20A 4MUBA 4MYTA 3Q9LA 2GF0A 3UWKA 2JLUA 1TQ2A 2PX0A 4E03A 5SZKB 2UZIR 4BZPA 2XZOA 1ZIOA 1FZQA 3T35A 1JBKA 3LX5A 5TVKA 2C2HA 4C9BA 1GRRA 4X8MA 3C7KA 3F5FA 4A0RA 2E9SA 4WZ6A 3KB2A 4OHZA 5B58C 4QJ4A 1AN0A 2VYFA 2DB3A 1JPJA 4XWOA 3GFPA 4BFTA 2G9NA 1K5GA 4EPVA 1KY3A 1PVOA 2AKAB 2HYIC 1US8A 2NO7A 3IIMA 4DSTA 3TUZC 2ZU6A 1CEEA 1NJFA 4OQLA 2ZRBA 1N5LA 1GG2A 4Q66C 4RD2A 3HPRA 1G8HA 5HE9A 5LD2B 4MYHA 1M74A 1W2GA 4YMVA 5KU1A 1ZW6A 4UXHA 4O2LA 2HYDA 1NN3A 3HDTA 2CLSA 4LJ9A 4TT3D 4WBSA 1CIPA 4II7A 3SYLA 2VO1A 4DB4A 5DIFA 1FP6A 4XOIA 1XTKA 2TMKA 1RVDA 4JL5A 1Z6XA 1S9DA 5LPNA 3R8CA 3KJEA 1ETUA 1P6XA 3Q72A 1Z0KA 4UNRA 5CJ2A 3SQXA 2QUZA 2C78A 3EZ6A 5FUVA 1S1CA 3BS4A 4RFVA 2CDNA 2HLDD 4HB2A 4KHZA 2IYUA 5CK5A 2P0EA 3JZMA 1NVXQ 4AG5A 1S3SA 1HY3A 1NKTA 2ATVA 3GCGA 1XEXB 1SHKA 1FPMA 4OK3A 4NCHA 1AZSC 1S0UA 1P62B 1XCGB 1Z6YA 4Q7MB 3CF0A 3F0TA 1N5JA 4IHQA 3GJ3A 2CJWB 4A4DA 3PIRA 2EQBA 3IUYA 3GD7A 3FGNA 1JB1A 2V55B 2QMOA 1I4TD 1G19A 3SFVA 2F43B 3MRSA 4JLKA 4B6EA 3AV0B 2FEMA 3CNOA 4QBGB 1LS1A 3DHWC 2NGRA 2EFCB 3C41J 2J46A 3THWA 4JJKA 3AVXA 5SZHB 4UJ3A 3FKSD 3SI7A 4MRVA 1ZINA 2P2LA 3Q85A 2PEYA 2IS2A 4D82A 4DT1A 1W36B 1LTQA 3WNBA 1HE8B 2YC2C 4ERNA 4R7ZA 1ZNXA 4E5UA 3J81k 3FMOB 3KB1A 3O8BA 4Q47A 2ZE5A 1G8GA 2IWRA 4OHVA 4BRWA 2R6AA 1EFCA 4PSVA 2WSSA 4LHYA 2QG6A 5DNYB 5JEDA 1NBMA 1T0HB 2N42A 3CBQA 1NSFA 2QMUA 5JSZA 1X8LA 2XSZA 3SJCA 1XPUA 1S1MA 4PZZA 5KDLA 3RNLA 4B3FX 3AKEA 2J59A 1ZAKA 4N0EA 1PJRA 1W46A 4NE2A 4R98A 2ZEJA 1E2LA 4DXAA 1CJUC 3B9PA 1P2UA 1SZPA 4ZDJA 5JRZA 3PG5A 3KJGA 3MUFA 5JI2E 1DPFA 2XJ9A 1U98A 2GK7A 3DOFA 4LJ6A 3WYAA 4D4MA 3CR7A 3D31A 1E2DA 2BV3A 3PFIA 1NG9A 3TR5A 5DI3B 2XAUA 2XX3A 3VNVA 4YMTA 3SJAA 3CPEA 4KITB 1CXZA 5HCNA 1OXXK 1UKYA 3B8HA 4DCNA 2GJ8A 3D8BA 2J7PD 2VSOA 1M7GA 4C2UA 2QMHA 4JYCA 3UMRA 3A37A 1OHHA 1GP2A 2GEUA 3BAFA 1E9FA 2RGNA 3CRMA 4G0NA 4QHSA 4DCUA 3IEVA 2HF8A 4QRHA 3K9NA 3C4JA 2SHKA 4G01B 2WPDD 2QPTA 4LRWA 1F3OA 3K70D 4Q19A 1TEXA 4TTQA 3IKJA 5E7MA 3QENA 1G291 4JZKA 5EE1A 2ONJA 5JWHA 2VBCA 1OFIA 3MD0A 1G17A 2V6JA 3I1FA 1VTKA 1W2HA 1XZQA 3WBJA 3MSXA 2JDID 4QXAA 3FFBA 1X3SA 3IPXA 1KI2A 1H8HA 3ND8A 4A8JC 4POAA 2F6RA 2D2FA 3PUZA 2DCUA 5TMPA 1Z83A 4BLTA 3KKMA 3L8YA 1MKYA 1ZBDA 2HCBA 4M2LA 5EXSA 1AJEA 1HYQA 3TSZA 2J0UA 1II8B 2NO1A 3MMPA 1SHZA 4QFMA 2GETA 3DKPA 4OL0A 2GJKA 3H2YA 4Q1BA 4F93B 3CNNA 1C9KA 3BD9A 1OB5A 1LVGA 2VHTA 3AGQA 1RFLA 4JL6A 4C4PA 1U94A 1OXUA 5EXTA 2GVZC 1E4VA 1LF5A 5KNDA 3GLFE 1IONA 3BOSA 3CONA 2ZUDA 3DM5A 1L7VC 2Z4RA 4AY2A 1JECA 1CR1A 2ORIA 4LJYA 5AJXA 2VEDA 1W0JD 4Y0VA 1QVRA 2BMDA 1CJKC 1XXHA 1I4LD 4QNRA 3BK7A 5FPHA 1IM2A 4W5WA 4BE7B 3QEOA 4URUR 1Y63A 4CT4B 1KK3A 4E22A 4AYWA 1N25A 1JEEA 2PMDA 5CLLA 4CEJB 5J40A 3LBHA 1IXZA 3DM9B 2WAXA 3N2IA 3PUYA 4YONB 2NPFA 1XBTA 4JJZA 5B57C 2XEXA 2WJIA 1U81A 3VR4A 2W58A 2E87A 1MH1A 5KTYA 1ZVQA 4MRPA 1KO7A 3TIFA 3ADBA 1W7AA 3AH8A 4TQ9A 3SDZA 2ASEA 5IK2D 1TNDA 3AF4A 2HXYA 1LY1A 4F4JA 2ODBA 3AEZA 1B23P 4IXMA 1F2TB 2WWXA 4X8LA 3T15A 2WJHA 5JWRA 1R4AA 3DL0A 1XX6A 2XJ4A 3K9LA 1W49A 3I8XA 1YR8A 4NMMA 2NMVA 4M1TA 3QE0A 2FWRA 4D0LB 4ZKEA 2CL0X 3BH7A 3ZGXA 1GILA 4NDZA 1E3MA 4M9SA 4Q4JB 1OW3B 5HTKA 1KTVA 3FDIA 5L3QB 4DKXA 3X1DA 4OQFA 2A9KA 3QF7A 1WDTA 2ZRFA 2A30A 4Y0AA 1TL7C 4DDVA 4QL3A 1UBCA 2PJZA 5DN6D 4M1KA 2Q3MA 2YWGA 4TMVA 2XZLA 2A5DA 1ZNZA 1OFTA 1AS3A 1XB2A 5FOUA 5HE8A 3UPUA 3EX7C 4XH9B 2VL7A 4U02A 1XPOA 2ZM5A 2I4IA 2MMCA 4JL8A 4CZ2A 4LUCA 3LW7A 1J2JA 4PHFA 3K0SA 4LOAA 1G4UR 3AVWA 2KBFA 2ZJOA 5A4JA 4NKRA 1RKBA 2PCLA 1R0WA 2R8RA 4MKIA 2O8DA 4RY2A 3PXGA 1N0UA 3QVUA 4WA7A 1G7SA 1KHTA 2H18A 2D06A 3QXSA 3ONWA 1WCV1 3C16C 3PUXA 1E9SA 2LKDA 5FFMA 5EXPA 1GDDA 2W0SA 4LY6A 4MITA 3DMNA 5A0FA 2BEKA 2QL6A 4HLQB 4DEXA 2W0MA 1KMHB 1TX4B 2AWOA 4W7SA 2ZRHA 1OT3A 1RE0A 1G3UA 2GEDA 2VPPA 4TL8A 5K8LA 1AK2A 2FPKA 3KL4A 3PITA 4B3BA 4EFNA 3A1SA 1AKEA 4R2IA 3AVUA 1P75A 1OXVA 2JIZD 1XMJA 1YQTA 1YHNA 1FNMA 2H16A 1N0VC 3MLEA 1VCIA 1E32A 1N6RA 3QXJA 4Q4LA 4Q1CA 5H70A 3RRNA 2CVFA 1Z63A 1OSNA 2QMEA 3KDSE 4OQNA 1WE2A 1SVOA 2P3SA 5J4HA 1Q44A 2NPIA 4CEHB 1HT2E 1TEVA 1XEWX 2JLVA 2V1XA 3B7GA 1OFUX 3RRZA 3HU1A 5KDOA 2CLDX 4HUQB 4CT5A 4AI6A 4HB4A 1MABB 2G0TA 4WZAE 5KO2A 4KCGA 2DHRA 2REOA 3OEED 2FDCA 4D6PA 3I92A 3NHAA 1ZU5A 2OHFA 3WYGA 4DCTA 5TDHA 4KFTA 5AUPB 3EW9A 1XEXA 2GRJA 1GIAA 2Y8EA 2LWIA 2VP4A 3I73A 2IEYA 1J7KA 2Z83A 4R71A 4QNMA 4L9WA 1X1SA 3FPAA 1ANKA 1NVVR 2EFEB 3L2OB 4BFYA 2AK3A 2HF9A 2J1LA 2YVUA 2ZRIA 1IN6A 3QI2A 3QIAA 4DIDA 4F4IA 1QHXA 4ZCMA 3L0PA 1T6NA 1LFDB 4JLMA 4JKIA 4KLZA 2F43A 3CRVA 3TUIC 4BUJA 3EIQA 4ASUA 1NLZA 4GOKA 3ZVRA 3AVTA 1R2QA 8OHMA 4BWYA 1G8FA 3RANA 1ZCAA 3TRFA 2AD1A 2BCJQ 4QM6A 1GVNB 4US0R 1HQCA 2PX3A 3NVAA 1YZQA 3LVRE 4WZBE 3T1VA 1CKEA 5LDDC 2BVNA 4Z1MA 1XMIA 1RPZA 3DDCA 2O8FB 2QTFA 4A92A 5KPJA 4V0MA 2X19A 2QM7A 3THXB 4GI7A 3THYB 2I1QA 2OT3B 2QROA 1Z2AA 2G6BA 2ZI6A 3VAAA 5JJIA 4Q7KA 4A82A 2FU5C 2RGXA 3OF5A 3KQLA 1E2HA 3SBEA 3OAAD 2EWWA 1UKVY 4I99A 2NQ2C 3DVLA 3SE0A 3EPKA 1SVWA 4MYCA 2ZRKA 2WKRA 4NYJR 3LH5A 2NO9A 4Q4HB 3LV8A 3RAPR 4M9XA 4NYMR 3QKSB 5HKKD 4NL4H 3K8YA 1F2UB 5BWMA 1YR7A 2QP3A 4YDHB 2CK3A 2NZJA 1Z6AA 4LHVA 2GVDC 5SZIA 2D3WA 1G7RA 5CLQA 2OILA 3LQRA 2IYTA 3LLUA 2D74A 4UXJA 4OI4A 3LFUA 1FUKA 3OIUA 4LYHA 4U00A 5D3QA 3VKWA 3O8RA 5DI3A 1E2JA 2P5SA 1O3YA 1VG0B 4PC2A 1W4AA 3TNFA 2D7DA 3AUXA 3QEJA 4UKDA 4URYR 4XD7A 1Z07A 1YKSA 3OIYA 3UG6A 1XP8A 1Z6GA 2Q21A 1N5IA 4OBEA 4LWZA 3CUEF 4X8OA 2YWHA 1OLOA 2YHSA 5G53C 4AWXA 2DWQA 4H1VA 1XNJA 1NVUQ 1P9RA 4HSEA 4Z51A 3U7EB 2XNDA 3BFVA 4EPRA 2CHQA 1P3JA 1YE8A 3KUCA 2HV8A 5KUTA 2PLFA 2XGJA 5HZKA 2ZSFA 4PZLA 1L2TA 1W5SA 2LCFA 2ZIAA 4LHZA 1WBDA 3ZVMA 2ZAMA 3GLHE 2FV8A 4DHEA 4DLVA 3N70A 5J5CA 2GZDA 5IF9A 2PL3A 3EXAA 3VR5A 2GXSA 2IYZA 2AD5A 5F3WB 3KXLA 4QBIA 1G7TA 1GL6A 2W83A 1XD2B 2HT6A 1BO6A 2ZUBA 4IDNA 4L15A 4OKSA 3PEWA 1QZXA 2JLRA 1ZUHA 5KNBA 1NI3A 1IBRA 4Q00A 1BOFA 3UANA 4D80A 3HP1A 4I1VA 4QJ5A 1II8A 2F9LA 2VIIA 3L0IB 1P60A 4DEYA 1Q1ZA 4JLJA 2WSSD 2I1VB 4FI3C 3UWOA 1UKZA 2DYKA 1NBMD 4X8HA 3CRQA 4E07A 1GRNA 4LBZA 4DLTA 2O52A 1VIAA 4IOLA 5E7IA 1E1RA 4ZIRB 4G1UC 4D4JA 2GAOA 1PLJA 1DAGA 1EFRD 1P9NA 2NG1A 2ZTSA 3Q5EA 3KXKA 5FOSA 3W34A 2G0NA 4EPYA 2QBYA 2XXAA 3GLGE 4B43A 1V5WA 3X1XA 3GFOA 4PAMA 3GJ0A 4QJ3A 2QM8A 1E2NA 3AVOA 3B85A 5DH9A 1AZTA 4PSAA 4JVNA 5TARA 1GAJA 3ZH9B 5DE3A 1X8KA 2IXEA 1FNNA 4CEJA 4LBWA 1Z08A 2QORA 2Q6TA 3EWAA 4JLOA 1KI3A 1EG7A 2JEOA 4Q02A 1OV4A 4DUGD 3P4XA 2H1LA 1ZD8A 3A4LA 2AXPA 2Z4SA 2R6GA 2QTHA 1QHIA 1D5CA 1EGAA 3LQQA 2IYYA 2REXB 3WMGA 3GLFB 4BECA 4L4UA 3TSOA 3WXMA 1DG3A 5H68A 4ITRC 3DO6A 3REGA 1F2TA 2VSXA 3L0SA 4YQFA 4OJQA 4GZMA 4TTPA 5J4YA 2QAJA 4XSGA 3HYTA 1UBFA 3EAQA 1E99A 3QUSA 2H92A 2NTYC 4Q48A 3W5IA 4AKIA 1NNEA 1ZP6A 1ZU4A 5IDVA 4TL9A 5JWOA 3U3RA 1GNRA 4JIMA 3T06B 3Q5DA 2IL1A 3E5HA 5EE9A 4V03A 1N3BA 3BORA 4Q4JA 1KKMA 2MSEB 3CB4A 5L3QA 2WWWA 3FFAA 4FD2A 4EQ6B 2BWJA 1GWNA 4B3GA 5BW8A 5FTNA 1P2TA 1YR9A 1IN4A 4L9SA 3FMIA 1FFHA 4JLPA 3TLXA 5FTKA 4A0FA 5FOWA 1OE0A 3PEUA 3ZVNA 2OE2A 1RW4A 2R6FA 1NLFA 4A0GA 2VF7A 2WJYA 2FSFA 5AWFC 3H86A 2ZSDA 3W3ZB 5GVSA 1XTIA 3CR8A 2WICA 2IXGA 3K09C 1SXJB 4Q1EA 4JVMA 3TW8B 1C4OA 4JLNA 1P2SA 2ZE8A 2J5XA 2B92A 4BEJA 4OHYA 3O8CA 4P4UA 2JASA 3I62A 3R8FA 4JLDA 2AWNA 1G16A 5CB8A 2G88A 1R0XA 4MKHA 4GZLA 1VKJA 4LJ8A 4PQFA 4A6PA 2ZPTX 4XTCS 5CYOA 2Q3FA 2OCYC 4DVGA 2CL6X 3K0CA 4PO9A 5KYKA 2XTZA 2G1JA 1R5NA 2IA5A 2FSIA 2RGBA 1NLYA 2Q9CA 4G5SA 3I4LA 5B30A 2J7KA 4MQBA 2ZYWX 4B2IA 1MOZA 4QGHA 5LBIA 4NH0A 2NZ8A 3W6PA 1KMHA 1HURA 1OIWA 1ZM9A 2RGCA 1RRGA 3IHLA 2GZAA 4OYHA 3WMEA 3W8NA 1TTTA 2BDTA 1QHHB 5B64A 1ESMA 4EDHA 2O0JA 4RD4A 3SYNA 2AL7A 5CM8B 3KX2A 3NDPA 3HYRA 1GZSA 3A1TA 4IVPA 3PV0A 2QT1A 2FZ4A 2O8EB 1Z5ZA 2ZS7A 3T1OA 1TU4A 1KK2A 1P2VA 1SVLA 4Q01A 2QQEA 2WMOB 4TYWA 2FA9A 2C96A 3ADKA 5JJLA 2FFBA 4W5HA 121PA 1IN7A 3QJYA 4URVR 4ZDIA 2V6IA 2D62A 3IO3A 4PAOA 3I3SR 4K81B 4PSKA 3ZQJA 2DY1A 4MKFA 4U7DA 3FHTA 3EASA 4WVFA 3GEHA 1B0UA 2P5TB 5L3SB 1M1YE 4KFRA 5AUQA 4ESVA 4CEHA 2A7QA 4MH0R 1IY2A 4ESHA 1LV7A 2KSQA 1MABA 4UJ5A 3B13B 3Q7QA 2ZE6A 3A1UA 1J8MF 2R65A 2GF9A 3U4QB 4AD8A 4B44A 3EZ2A 2WWGA 4DCSA 2ZI3A 3LY5A 4MYUA 4C0KA 3ADDA 4NCNA 4DB2A 3UG7A 1DAHA 3UXMA 1JAHA 4G5OA 1NIPA 4G5QA 1A1VA 4EFLA 1M8PA 1ZC3A 4B2LA 1JR6A 2HDNB 5KPDA 4MRNA 3LW8A 1COWA 1TF2A 1JI0A 3KKQA 2B8WA 3KQUA 5FBQB 4ABYA 1Q0UA 3E1SA 2R2AA 1UDXA 4OI0A 4CIDA 1ZYUA 5HR5A 2GCOB 4S35A 4A6XA 2J3EA 3QBVA 4DDUA 3DMDA 4GP7A 4BGDA 1M2OB 4MDFA 4FMBB 1OIVA 4EJSB 3RVBA 1W4CA 1MV5A 3RWOA 1DAIA 3ASZA 1W0KA 2GA8A 2O5VA 4QGFA 5B2ZA 4YXWA 3ZJYA 1QRAA 2H7VA 2O8CB 5JRJA 2V3CC 2NO6A 3A1VA 3P20A 3GJ5A 4Q4AB 2ODWA 4WXPA 5E3HA 3W90A 1UJ2A 2X77A 2RHDA 3P26A 2O8FA 2FF7A 4D81A 4GBMA 4CF7A 2QRNA 5AJYA 4C3ZA 3THXA 1ZM7A 2R62A 3CKLA 4PHTA 4CW7A 3GLIE 3THYA 1I4DD 3GP8A 1VCNA 4IOJA 2CEAA 3OESA 3I5XA 3PEYA 1GKUB 2BEJA 4LBYA 3KQKA 4NYIQ 2GJ9A 3DPUA 5JHHB 1NBME 1VG8A 2YNMA 3IDQA 4Q4HA 1TPZA 1E79A 1Z0DA 1A7JA 2F1IA 3TQCA 4K46A 2EVWX 5FI0B 1F2UA 1AA9A 2CNWD 2EFGA 3AGPA 5GVRA 1F6BA 4JS0A 4I1UA 2GBLC 1TQ4A 3IEUA 1XJQA 3UMSA 3AVVA 1GFIA 4C0JA 2JCSA 1Z28A 3K9HA 2QP9X 3M4YA 4TYPA 2WOOA 4L16A 3LVQE 1KSFX 2IS6A 3U61B 4HDOB 1NN5A 3CO5A 2FSGA 2VP6A 3VU9B 1G4AE 4M8NE 2ECKA 5GADl 2QEQA 2H57A 4NPHA 4LK2A 3CX8A 3VHLB 2ERXA 4KI0A 2KI5A 1UDWA 4Q18A 1XCMA 4NCKA 1CJMA 4UNNA 3R7WB 5E4FA 3CZQA 2CE2X 1Y3AA 2MMGA 2QI9C 1DEKA 2P6UA 3AP2A 5DHAA 5DYIA 3KJHA 3EA5A 4J0QA 5EP4A 1C1YA 4JSYA 4ZI3A 821PA 1N2CE 4RD3A 1WRBA 1Z0AA 4ASUD 5JJKA 3TSWA 3D7MA 4AKGA 2ZRJA 3X1ZA 4M9ZA 4Q1DA 3WNCA 1OH6A 1XU4A 4HI0E 3W9YA 3FYHA 3MGCA 5FPKA 2IYSA 2GILA 4TSFA 4M21A 5JEEA 1IXSB 1KMQA 1XD2A 1DS6A 4Z1MD 4RZUA 1JJVA 4Z54A 1G6OA 3O47A 1E9BA 1ZJ6A 2ZSAA 3PVSA 3QSYA 4Z8XA 5C18A 3EIEA 4A2WA 1K8RA 2D2EA 2A78A 1ZMXA 4H9GA 1CRPA 2ZI4A 4O0MA 1VDZA 2WZQA 5AUOB 2DWOA 4U5XA 1T3HA 4LSGA 4B48A 1Z0IA 2J45A 4WAUA 3X2SA 4PC7A 5ANRB 1E9CA 4QG7A 2AHOA 5J4KA 3VR6A 4HB3A 2A5YB 4QBHA 4JLAA 3V4RA 4ZIRA 2V8OA 1ODFA 4AURA 1R5BA 1XWIA 2O0KA 4P4SB 2CK3D 2R6DA 1WF3A 1N5KA 2Q0HA 2D4HA 1EFTA 1XXHE 2QE7A 4ZPXA 1JAIA 1E96A 4JSTA 1RYFA 4IW3B 1FL9A 4JBWA 5TV2A 2UKDA 4HAWA 3D3QA 3LAWA 3AVYA 2WIBA 2E1RA 3BIFA 4XWKA 2J0VA 3AVPA 5GJCA 4M1SA 1OH5A 1NMXA 4EUNA 2VF8A 2F1JA 3LX8A 4P31A 3WP1B 1DAMA 1G5TA 1YZUA 2ZQ5A 2NOAA 3SJBA 5AK0A 4CEIB 2CCJA 5AJZA 1QF9A 3GLFA 4ON9A 1E0SA 621PA 2Z0MA 1CR4A 1YRBA 1DARA 4DLWA 4G5GA 4IDQA 2XNDD 1T5IA 4W9MC 1Z8FA 2ZE7A 3OEHA 3CLVA 3DZ8A 1FQKA 2V4ZA 2BKUA 2PT7A 2XTNA 3EZ9A 2W6JA 1OFHA 2ZI9A 3V9PA 1DG1G 1KI7A 3U44B 3RRMA 1YRAA 4M4SA 3SYKA 2OESA 2PZGA 2ZREA 5FR1A 2GCNA 4DLUA 2OFWA 4HAVA 2J87A 2O0HA 4IOMA 2EWVA 2IUUA 3NHBA 3TE6A 2QSZA 1MT0A 1UEJA 4RZXA 4LYAA 4BFWA 721PA 2NO0A 2QGZA 3I72A 4IVQA 3CW2A 4AG6A 4F7WA 4P4TA 1K6MA 2GDJA 2K5UA 4FWTA 3WNDA 1GUAA 3MWLA 4PHHA 2IBMA 4YDSA 2WVJA 1EX6A 3FMPB 1YJ5A 4EFMA 1IY1A 3CF2A 3EIHA 3NBZC 2ZJYA 3G5UA 4B35A 4EPWA 1SXJA 1A82A 2EW1A 1HT1E 1QG2A 4TT3A 5EE3A 1E1RD 1AIPA 4NZYA 2GNOA 1P73A 3EZFA 5DYGA 2NIPA 4KJZA 2JA1A 4TWZA 1OKKA 1ZM3A 1D2EA 1UBEA 2WJVA 2BM0A 1J70A 1CS4C 3VHXA 2IWHA 3U3JA 2FFAA 1ELOA 3KTAB 1G20E 2ORWA 1QDEA 2YYZA 3E70C 3MCAA 5CIQA 1WB9A 3AP1A 4YC7A 3NEJA 4FXPA 2BM1A 2VA8A 4LDJA 1QHHA 4B3CA 1XZPA 3QQ5A 2GK6A 2OXRA 1RJ9B 4WXRA 1KGDA 2JAQA 3TJZA 3A4NA 1G5PA 3BH0A 3I5YA 1DADA 4HAXA 2RGDA 3K9GA 5JS8A 2O8EA 1AS2A 2C95A 2RGNC 2QQ0A 1AM4D 3K0FB 1R8QA 4KFUA 3EARA 3OIWA 1K5DA 1P5ZB 3B2EA 1E69A 2EFDB 4DLRA 2P6RA 1HA3A 4JT4A 4GNKA 4Q9JA 1MO4A 4C30A 4BZXA 1IN5A 3VX4A 4OK5A 5EE0A 3ZD7A 3OFNA 3ZD6A 1U8AA 5L3SA 4LPKA 2Q3HA 1NIJA 2IT1A 5E7JA 1ZNYA 2IYWA 1VECA 4A8JB 1E0JA 1T3LA 2A3RA 2WMNB 4P0TA 2J0QA 1VPLA 1Q57A 4NU0A 4TZ0A 4HZUB 4MGKR 3U4QA 1KI1A 3AF2A 3U3OA 3RS3A 3VKGA 3B9QA 1N6IA 2BMJA 2MSCB 4B32A 5HPYB 3W6OA 1TMKA 4HB0A 2IX3A 4KBFA 3NH6A 1T8TA 1G3QA 1TADA 1I2DA 2Z5FA 4TYNA 2VHJA 2FG5A 4G5RA 5KSYA 5CK4A 2FPMA 4KAXA 4OJKA 2ZRNA 2ZJZA 1XTSA 5G40A 2CJWA 1V43A 3NTUA 2GCOA 2OAP1 4R9UC 5BQ5A 2OV2A 2H17A 2P6NA 2WWIA 5JI3E 1U8YA 2AFIE 1DAKA 3B6EA 3WHKA 4JBXA 2ANCA 2BJWA 3B1VA 4EJSA 3RS7A 2ZANA 4M9QA 3KXIA 4EIWA 4FCWA 1ONBA 2ZS8A 3GJ8A 2O8CA 1OIXA 4PAQA 1J99A 1ZC4A 2A5JA 4Q4AA 3TKLA 5CM9C 2ZJBA 4LJ7A 4D25A 1BYIA 4GFDA 4V0ME 2ODEA 4S2EA 4MRSA 1U9IA 1T5LA 3NWJA 2EU8A 2IHBA 1XF9A 4PHGA 4WW0A 2YWFA 2X8AA 2JJ2A 3IGFA 3M1IA 2XTMA 4AYXA 1G18A 2BBOA 3B1XA 1KZ7B 1OF1A 2OBMA 1R8SA 4GRAA 3RSOA 1W44A 1P4SA 2ONKA 4ZDWA 2FGKA 1UM8A 1Z22A 1IJEA 3GEIA 1EX7A 2ZITA 2ERYA 5F9FA 1Z47A 2FSHA 1AS0A 1N0WA 1J90A 2JDIA 3IILA 3LBIA 3QXCA 4KFSA 2ODNA 1BIFA 5FUYA 3ND9A 2JLXA 1JEDA 2WJJA 3SC3A 2BMEA 5DLQC 3LNCA 3UK6A 5DI9A 2GHIA 4XVUA 1L4YA 3VU9A 2I3BA 3IIJA 3GLIB 3U2QA 4O3MA 4I1SA 4V0LA 2PMKA 3CH4B 2X2EA 1S4QA 1H8EA 2RGGA 5J47A 3TUJC 1EK0A 4F4CA 4HLUA 3C5CA 4GP6A 4JVSB 5KOYA 4BQSA 1SXJC 5KDDA 2OCAA 5FL7A 1RZ3A 2WKPA 3ETLA 2UVQA 1F60A 5EZ5A 3R7WA 1VYVA 1G9XA 2VH5R 1ZCBA 1RC8A 1COWD 1Z29A 1JR3A 2C77A 4TLBA 1W0JA 2XOKA 3T34A 3R9IA 4B3XA 1ZM2A 1WXQA 4RVCA 2IEZA 3VTKA 2AR7A 2YWEA 4AIIA 4E09A 4BPBA 5CDFA 4M22A 2YOFA 4BFXA 1IY0A 2GWHA 1DELA 1LW7A 4FMDB 5FOVA 1NL3A 1W0KD 4MA4A 2EYUA 2IS1A 2OXCA 1Q3HA 1S2MA 3U3MA 3U7FB 3G0HA 3FB4A 1E0AA 2DFNA 2RB4A 4QGGA 2JLWA 3SR0A 1XMSA 4D4LA 5JCZA 4IFEA 5GJVC 1CLUA 1BMFA 1TUIA 2VP2A 4URZR 2PLRA 4TZ6A 3T5DA 4NYMQ 4A0HA 4CVNA 1G1MA 3K0AB 4KVAA 1E9DA 3U6BA 1TU3A 2HCJB 3B5JA 5FPSA 4L5BA 4GOXA 1AGRA 3AB3A 4QC2A 1L4UA 1E79D 2CLCX 3JVUA 3B60A 5LD2C 1HQYE 5GJBA 4AKHA 3CRW1 5L8VA 4PPQA 1GKIA 1NN1A 1U0JA 2XSZD 4P4SA 3TBKA 4B75A 2QRZA 4F91B 3S1AB 2WJGA 1KK0A 4TQUS 4YMWA 1KDPA 2G3YA 5BYJA 1WMSA 3HU2A 2WOJA 4C0HA 1UBGA 3RC8A 1R10A 3CPHA 4PQRA 2ORVA 1M6NA 3KKNA 3SN6A 4ZCIA 5TXGA 5D3MB 3KKPA 5FOXA 1YU9A 2FEOA 4M1OA 3SHFA 2W00A 4FINA 4UQOA 5DGXA 3WMFA 2VRWA 5FTLA 2FE4A 4C0SA 2B7CA 4BFVA 5JHGB 2OO7A 4CEIA 1GITA 2RHMA 3X1WA 1OHHD 2GAAA 4JVLA 4PPNA 1XEWY 1VHLA 4ZO4A 4AYTA 3VR3A 1X6VA 5KSPA 1QVAA 1XEFA 4V02A 2HEIA 3A6PC 5EP2A 1E2KA 2PCJA 4RCZA 2OSBA 5AUNB 3MWJA 1MO3A 3U44A 3QPUA 1JQJC 1BS1A 1Q20A 2JLSA 2WKQA 1MO5A 2FFHA 3AUYA 3CIOA 6Q21A 5IRCD 1OB2A 1W48A 2ZRAA 3LA6A 5C4GB 3RDPA 2OLKA 3IPYA 4TSFD 4KYUA 3RABA 1KIMA 4TMTA 4OQMA 4DLXA 1ESNA 4RJLA 1J8YF 3CWZA 1OPXA 4GMXA 3TH5A 2CBZA 4WIAA 1H8HD 4URWR 1NY6A 2PJRA 3WP0A 1W36C 1SKYE 2C8VA 3GFTA 4B6FA 3AKDA 2V1UA 2IF2A 2OM2A 1SVSA 2JIZA 3RWMB 1XDBA 1PUIA 3BERA 3M6AA 4FCVA 2WSMA 4JBYA 4D26A 4NTZA 1A2KC 2OAQ1 2WBLC 2IYVA
chains in the Genus database with same CATH superfamily
1IBLB 3IDAA 3OZSA 1LTKA 2OCPA 3I9KA 4R51A 5TB5A 3LECA 3SFZA 5IHPA 5A62A 1YWGO 4X64B 3CTMA 2NUAA 5KNDD 1X8JA 4NZMA 4ES6A 5C5IA 4LF5B 1G8PA 1IHYA 2VAMA 5E8JA 3O75A 3VKHA 3U7GA 3CRNA 4I99A 5G2OA 2PT9A 2VR1A 2VDKB 2QE7D 2QDXA 1IPEA 2DKOA 1E3TA 4P86A 4ER3A 2V7QA 1T34A 3JRNA 4V2UA 5CFMA 3EIOA 3HCDA 1LKZA 1GU1A 2XDWA 5I7VA 3OQBA 3UUFA 1J0DA 1RRMA 4R69A 1NVWQ 1ZRHA 2G5CA 1NUSA 2GPSA 2OHVA 3ZWKA 5C8XA 2D2XA 3KZ1E 2D1SA 4L02A 1IY8A 3I0ZA 2FH5B 3BA6A 3EEBA 5JSQA 1UZUA 2VCEA 3D3NA 4QLAA 2HKIA 2XCQA 2ZK7A 1G64A 5EJ2A 3GRAA 1BXGA 3TRIA 2GBFA 2V97A 1R8JA 2GPJA 2QUJA 3LWNA 5E95A 2OFFA 3ZZTA 5K6AC 3DAFA 2OYRA 5IJXA 3NOQA 3PX3A 1GHTA 1R0YA 1UBTS 1RXCA 3RHFA 1AXGA 2BT4A 5FEUA 1CQIA 2FJ0A 2PVCA 4CTKA 3ETJA 2NYAA 3R7FA 2J0SA 4FHEA 1MAHA 1U5AA 4AZVA 1VMAA 3ILYA 4E13A 2OBNA 5BV2P 4XGKA 2PMCA 5DTEA 4WFQA 3EEYA 2C98A 2PMWB 2QUKA 3FPFA 4KEAA 1XCJA 1T36A 1CQXA 1LJ8A 3K6SA 2J9YB 4CI9A 1BVYF 2B3DA 2ZPAA 4NJMA 4JJ7A 1RRPA 3LNTA 4OB7A 2C9CA 3AR6A 3QU4A 1FQJA 4PTLA 3TEFA 1CJTC 4C0BA 4PGGA 1Q0ZA 2FPLA 2I22A 3B52X 4QPPA 3MTBA 3UB2A 9LDBA 1XJ0A 1D4AA 2WABA 1ZMRA 2YQ5A 4IINA 4O4HB 5DBEX 4OBBA 1AQUA 1EVQA 4ENSA 2P65A 2GCEA 1FW6A 1YZTA 3PC4A 1Q7BA 3SDBA 1QMGA 2P6OA 1P1JA 2IQIA 1AF4A 4KLAA 3U80A 1M76A 1NMYA 4PX3A 2PZEA 3W7AA 2GZSA 4LHWA 2VRCD 1R8XA 2BJVA 5DIZA 3S55A 2FTKE 4Q15A 2C7QA 4KGDA 2P4QA 4LWQA 1J1IA 4JDUA 4AJHA 4M9RA 2FPPA 4H6WA 3LBFA 5JR3A 3RVNA 3GNQA 1WS6A 3SE7A 2GH1A 1NRWA 1OLXB 2H4ZA 2WNIA 4BBZA 4XEHA 2BE9A 4B71A 3WDSA 3EWIA 4P3YA 3HJHA 1K4KA 1RI5A 5BQXA 3U09A 4EY6A 3PNVA 1YTUA 4B34A 4LX8A 3WRXC 1ZONA 4MKXA 3W2EA 1EH5A 3G79A 2VT3A 4OAPA 1E3QA 4NBWA 1QNLA 4XX1A 3HUEA 5AVKA 4CM3A 1NR7A 4AN1A 1EM8B 3P2KA 4I6GA 3KKKA 1QR6A 1MAAA 1USKA 4D8VA 5BURA 4DMUB 4Q82A 5BSFA 2AQIA 4DQVA 1KSHA 2EYQA 2GPWA 3TKAA 1JPNA 2IYRA 2WAYA 5K99A 1TUEA 1HDOA 4PV7A 1UXOA 3BEDA 5B2EA 3GFGA 5K1ZA 4GL2A 1F5NA 3QPAA 1P5JA 4BATA 3A1WA 3ANMA 5K3FA 4LN1A 2HEGA 4RLQA 5KHAA 2UUBB 4LDNA 4G8DA 4QU8A 2C5EA 3FVTA 1JU4A 4R2LA 5BNIA 1LCIA 2QYTA 1O97C 3DLAA 3FE2A 3OM0A 3N1UA 4LCBA 4NQRA 4WKGA 5HVNA 2GXAA 1MIOB 4Q6WA 1NFFA 3BE5A 3I42A 5THXA 3EWNA 4LNUA 5CFPA 1BSVA 3OU2A 2C8JA 4JUFA 6ADHA 3C15C 4IDOA 1PJAA 1SU8A 3U60B 4OIFA 5LB4A 1JH8A 3IELA 4XJXA 4DJTA 3GPIA 4LJLA 3BTSA 5ALEA 1V3QE 1C29B 3FJYA 1SUWA 1LFAA 4P54A 4PC1A 3OFND 5LQRA 4OBXA 2OHJA 3FGOA 3QX8A 4K8OA 4DE5A 4JQOA 2BRUA 4JI6B 4H1UA 4C06A 2UZ3A 3TZQA 3I1YA 2DG2A 3AEKB 1HE2A 3H5TA 4BWFB 1YDHA 1NXPA 1F48A 3JARA 1O6ZA 1SD2A 5EZ6B 3W9SA 2F64A 3LQ4A 3ZY5A 1O0CA 2O19A 1HG1A 4BQEA 4X5OA 3ZDBA 1YR2A 3I6IA 2NXJA 4LRXA 1KJQA 1W73A 3WSTA 1DTWB 2WZBA 4FMDF 1E58A 4RJJA 4Y6OA 3S29A 3VH2A 4BO4A 1PYGA 1O1YA 3SSOA 2G67A 2G82A 3VQTA 2WQ7A 1REQB 2W2NA 4OI1A 2CVHA 3SR4A 1LPMA 5IEBA 3B53X 2GQ0A 4B81A 3OVMA 1JVNA 3ICPA 2BHRA 3Q9NA 1HLFA 3QLJA 1VE9A 2NU7B 1OCEA 1HBJA 3SHOA 1B7GO 3EVGA 4EMUA 3UUWA 4HAUA 1AKNA 1GR0A 1O5TA 4NOJA 5AR1A 5F9HA 2GPAA 2WFAA 1LB1B 4NP6A 4EELA 3ZHBA 4MKGA 3REQB 3L0ZA 2REQA 4NECA 2VQSA 1PZXA 4RVGA 4KSYA 4L4ZA 1Y6ZA 2KE5A 4NG5A 1EK6A 1KO8A 3LHKA 2BKEA 4PLHA 2HLHA 1MORA 2CYAA 1WKBA 4IJQA 1EVLA 4LGCA 2FWMX 4ND1A 3ZUGA 4EOGA 3NBFA 2JH3A 1GAEO 3C6QA 3HGQA 2ZYUX 1NKSA 3AHJA 5IUNC 5K0EA 3Q7TA 1O6GA 3TTSA 1DT3A 4EKEA 1N6KA 1W36D 4GECA 1DQPA 5LQMA 2F3TA 1VBFA 4L5AA 1VL2A 3QGMA 2WUGA 4QUJA 1ETHA 2HLPA 3CVVA 5K0ZA 2GXQA 3T61A 2BC9A 1QFMA 4YN3A 5COAA 1M9NA 4MHTA 1FVOA 1TJPB 3O03A 1NQAO 3GQBA 4G3XA 2IUSA 4C7XA 1OA0A 4DIBA 3PFKA 2YFQA 3BC1A 5LIPA 1ZWLA 4MS4A 1EFLA 3I9OA 1Q12A 1NE2A 1SQ0A 1VXRA 1Y98A 2CXXA 3PZBA 2F3QA 4Y7DA 5HDQA 5ICGA 3TTYA 1PCXA 2G80A 5IVPA 4D0SA 1XMVA 5TLSA 1RRFA 3NHUA 4GSYA 4QUKA 5G3YA 3ZDFA 1JEJA 3QWBA 3WR5A 4RTMA 4J90A 1UJNA 1ADGA 1KA9H 4HH4A 4QPCA 5BP7A 3ZV4A 4HQ0A 4WY8A 1E6CA 3H2HA 1A04A 4LZPA 4OXQA 1FP4B 4BP3A 3OZUA 4Q7QA 3GPLA 4ZTUB 1VGRA 3H4IA 4DLZA 3H2BA 3NKVA 1JR2A 2JVIA 3KR0A 2E5WA 2PSFA 4UQLA 1PJZA 4N8DA 2KJQA 1QPBA 4WV3A 1KF0A 2L82A 4PTYA 1T3GA 2CMKA 3R5TA 3EGXA 3RYCB 3EVFA 2XKKA 2ZRPA 2O1XA 4NV0A 3BSWA 4QOSA 1NBIA 4Q9LA 1E2MA 5DGCA 5FL7D 3TNYA 3M70A 4CL8A 3M3PA 2AR9A 3IURA 1YNSA 1MJ5A 2YXPX 1UODA 3TE7A 1M1ZA 3K4HA 4OLBA 4WESA 3GEEA 1GQ2A 4LYJA 3HU3A 4H4DA 4E12A 5JS6A 3IIKA 1RXEA 4JQCA 3LOQA 4LE0A 1XAJA 3U7HB 3STWA 3I01M 2XXAB 3HJGA 2LKCA 1DBWA 3SXJA 5ULLA 1S3GA 3AFIA 2JGJA 3OPYA 4IIXA 4Y1RA 3R9XA 1KVSA 3KLNA 3L7CA 3I83A 3P9IA 1X1RA 4ZCLA 4P5PA 4LY0A 1CUZA 3ZBQA 3ZWDA 4YAIA 3IL2A 1A0OA 1BROA 4JQYA 1JEOA 1ZQ1A 4KAFA 5HQJA 1Q22A 2Q2NA 3FPJA 4D56A 1X94A 2O3SA 5F5NA 3D4PA 1H3NA 2CSUA 4IXNA 2EX0A 1C3JA 4FGUA 5BRNA 2XHZA 2JZCA 2OQVA 1E9EA 1R3UA 2FJUA 3P0EA 5CT4A 4CFSA 2XA2A 4FCTA 4PWYA 2IYEA 3QXHA 1T9CA 5DHQA 4A15A 2R84A 2QSYA 5BWOA 4MRAA 2PRJA 3OLWA 1P17A 3D0QA 5EHZA 2BGJA 3GBSA 1SXPA 5FL3A 2BTOA 2E4UA 5KSZA 4I4NA 1V8FA 3NNSA 2Q50A 1U0HC 4E94A 4EAQA 3QPCA 5FUXA 2DBYA 4EHFA 5ED0A 2L0XA 2LIVA 3GRKA 4EX7A 3D2CA 5LN1A 1NBHA 2QTAA 3ICWA 3TXAA 4EF5A 3O1HB 5F98A 1K7YA 3K3PA 3NGXA 3U13A 1S8NA 2WKWA 1PD1A 4UE3S 5JS2A 2IS4A 1T3SA 1YVRA 2NXEA 2ZRDA 2ZJAA 2QT0A 1Y42X 1AOXA 3AHGA 1KI4A 1RAGA 3CURA 3W6NA 2JCGA 5CAEA 2QVBA 2X42A 3RIXA 4BNYA 2PANA 3QNUA 4CBVA 1ADJA 2DLDA 1NBOA 1SRQA 1PEAA 2QR2A 1TT7A 3QMVA 4FLMA 4LQ4A 3ENKA 4I5EA 3A6LA 3EK2A 1SKYB 1QPGA 2IYFA 3NBYC 1C50A 5CPFA 2VP9A 3WGGA 4AZ0B 4C07A 4A36A 1QE0A 1RJGA 2H9AA 3IV9A 4ZCSA 1E2QA 1YZYA 2C59A 2TSYB 5ESXA 4BRZA 4DSUA 3PBKA 4M1YA 3ROMA 4KXMA 3IQXA 1XZGA 3H1AA 4KO1S 5AVOA 1ORVA 5F4ZA 1NY5A 2A9JA 2BELA 4EA8A 3L05A 4MCHA 2CNLA 4MIEA 5KWIA 2OKGA 3QKTA 2Y0DA 3A9TA 1Q77A 4O4HF 1D2HA 2RJNA 3QG1A 1T43A 1LVUA 2PH1A 3AIOA 4YECA 1IN1A 3BFKA 1TJNA 4MVJM 3VR3D 3DHEA 2A58A 3PUIA 4X6XA 3C6XA 3UMVA 4CM5A 3QKRA 2Q41A 1UEIA 3RYHA 1CEYA 1WUJS 4O2RA 2XCLA 4AS2A 4HOYA 1E0DA 5FWDA 3P94A 2D0OB 3IAEA 3ZHTA 1YZLA 2PWAA 3KAKA 1UFKA 3ZJUA 4MQFB 3SF8B 3OCWA 5KTRA 3Q11A 4KNYA 2RH9B 3MD9A 2B6HA 4PFKA 4EABA 5A0VA 1WU8A 1BFKA 1I51A 1LPBB 3EA4A 4AWAA 4F85A 4BMOB 9ABPA 2H0RA 4YV1A 1EIZA 5GJWC 4ZDKA 5ISMA 5LL6P 2IHYA 3MWEA 1DIBA 4C7KA 1DNPA 1GSOA 1NG1A 1NN0A 1PJ8A 1VZ3A 2H7XA 4IIHA 5BOVA 5J59A 4EYOA 1J2UA 5AIBA 1OJLA 1LZLA 2GB4A 4RTPA 3CGWA 5L4NA 1NI5A 3QE9Y 2XWSA 2ZI7A 3C8MA 5LYJB 4FYHA 2FZEA 4B33A 3LC1O 2FP3A 2B9EA 1UP7A 2CFRA 2AUNA 2YZ2A 4KSCA 4XUEA 3HM9A 3AM1A 3FYUB 3KQOA 3Q9SA 3JAKB 5KYUA 3L9XA 1SKMA 2OECA 2Y1CA 1RRCA 4M8IA 3NBKA 1O7JA 4BQFA 1CU1A 2PJUA 3Q8XB 1AO3A 4LCEA 4OQXA 1OI7A 2C5LA 2WQZA 3CUVA 3BAZA 2CKDA 2V7QD 2XRMA 2QOEA 3OE4A 4YTEA 2VH2A 3E18A 1ORHA 1SIBE 4U9UA 4C0QC 4B47A 2A1UA 4LC9A 1L5FA 3D6TB 5ETJA 3TVDA 3HY6A 2OCLA 2ONZA 1Z3IX 5KVVA 1HH4A 3RU3A 1M2OA 1RXYA 1YQQA 2Y93A 1ZBQA 1QJCA 1KH1A 5EOVA 3HI4A 5CDUA 2PZLA 3CSSA 3JZDA 2FR1A 3CU5A 1V7QA 3QYFA 3KFXA 3R0ZA 3ZQ6A 5HJ5A 5IJ0B 2UYOA 3PJEA 1YZKA 3DEFA 1Y5MA 4J7XA 4PICA 3NTRA 3ZHRA 1QCZA 4R2MA 5B4UA 4PYRA 4WSOA 4BKMA 1XAHA 3H13A 4YCAA 4MYDA 3VPSA 1S3IA 1SCIA 5EJEA 2QD5A 1G6HA 1VG9B 2O8BA 4NE9A 1TM4E 4DSOA 1GAWA 4TYYA 3SOOA 3PJRA 1KQPA 5KNDH 4IXWA 3PENA 4FSHA 4JIGA 2QGNA 1BC5A 2MSNA 1Z35A 3N07A 2Q9BA 2ZBUA 3AP3A 1N5DA 1JLRA 1M34E 1OASA 1VL5A 1Y89A 3UHJA 2FUG6 3EZGA 2F7SA 1HYHA 2W6ZA 3K9WA 1HRDA 3CE6A 3KOYA 5UKDA 1NR5A 1EX9A 5IC5A 3SLGA 4G0OA 3HU5A 2JANA 1EAMA 1SVIA 4GPTA 5NULA 4UDNA 1UMDB 4IF6A 3HO6A 4EITA 2Z3VA 3L4BA 1XTZA 1F4PA 4IH1A 4BASA 3TPZA 1D6SA 1YS1X 1P72A 5JLAA 3I8SA 2EKPA 4J76A 4BNDA 4HNVA 5HSGA 4RTSA 3HV0A 2A0YA 4MUAA 4B87A 3LRTA 1KNXA 3VR4H 3JATB 3G2KA 1KMNA 3H8JA 1KYIA 3VKVA 3QWFA 2G77B 3CPJB 2BBWA 3HV2A 1G1AA 3CZPA 4FE4A 4ICIA 1I0LA 5C1IA 2R9VA 3R9KA 3KVYA 1XN1A 4OQ4A 4QWWA 1QX3A 1UBKS 421PA 4DMGA 3OZFA 2O06A 3DJYA 2Z9CA 4AUNA 3OKCA 3AR7A 1QTIA 3N28A 3F90A 1Z56C 3OZVA 3P2OA 1NW3A 1WLYA 1DUSA 2O7RA 3KR2A 5BYAA 3Q4GA 4AMYA 5JSZB 2VP0A 2JLZA 1V6SA 2CWWA 3IHTA 4DMHA 1KBZA 1C7JA 3A36A 6PFKA 3Q7EA 3JX9A 3LZDA 3OWXA 3TAHA 1CR0A 1OBOA 1GTL1 3T5GA 4JR2A 3EZ7A 4AJOA 2OMEA 1FTQA 3F5DA 5EXXA 4FGWA 3LQKA 1B2RA 3ZI7A 4LXHA 3H9BA 4UREA 5KSWB 3THOA 2X1VA 2XEDA 3IQWA 1P1FA 1SCAA 2J9FB 3V5NA 1ZM4A 3ADPA 2WW8A 5CITA 3GJ4A 1NKVA 2Y71A 3E61A 3TCKA 1BMDA 1F3LA 3DKVA 5AI9A 2ZI5A 1TAQA 5ILQA 4EA9A 2FW8A 1J2RA 2Q27A 4M8KA 5BXYA 1BN7A 1K1EA 3K94A 3PQDA 4MB6A 4PRLA 5MN6A 3OJEA 1KIAA 2PZFA 2QN3A 4GMFA 4R8SA 5LP6C 3L1JA 4PXAA 3CNEA 3SLKA 1QWOA 5BUZA 3M0EA 5F2KA 2ZJ8A 5IK2A 4ZYUA 3KQQA 4BX3A 1U2ZA 1FK8A 3FJ1A 2NYVA 3GJTA 2DXIA 4DG8A 4EARA 1GNQA 1RI4A 2QA5A 1DO2A 1PW5A 1BVHA 3E1KA 3O8DA 3PFFA 4XAQA 1OLUA 1ULZA 2RGWA 4FBMA 4XFDA 4DIMA 2CNBA 4LDAA 1S2OA 4DJDC 5AM4A 1JYFA 1PR3A 4DYDA 3K53A 3RTEA 2HA5A 3IP1A 1DI0A 3E27A 3GDGA 2Q2VA 1LGYA 3GLHA 4YMIA 3UGKA 3UVEA 2I91A 1LPSA 3LYLA 4GHWA 4Y8VA 4YDRA 3U6KA 1FFXB 3AHHA 3JYHA 5EZYB 3V8PA 3VR1A 1DVRA 3GQVA 2X41A 3QLUC 1RQXA 3B3QA 4MOWA 4L8GA 1Y34E 4Q1AA 4JUIA 3PNOA 3IXQA 3ZZ0A 4R2HA 3LKZA 3OUUA 3DV2A 1V5EA 2G7MC 5HZHA 1FFBA 3B6KA 3RE1A 4RFSA 1JS1X 4DFDA 2D00A 1CERA 2I3ZA 3TLEA 1T0UA 2XTJA 3IQGX 5BYKA 5EXEA 1U8EA 2HA0A 2ZB2A 1KP3A 1QHFA 2HGZA 1YVEI 3VO2A 3SZ3A 4MDEA 1Y1SA 3JQDA 4KIWA 3TF5A 2OZEA 1T10A 1YQUA 3FCAA 2P75A 3HVJA 1V8ZA 3HVKA 2B61A 4Y3UA 5EP3A 1BJRE 3I09A 5BXQC 4L8WB 1XD9A 2R96A 4JWTA 2DBQA 1RS0A 3TW4A 1VE7A 4FFDA 5AJHA 1XZEA 2XIQA 1DFIA 3RYFA 4F4DA 5DHFA 2B1QA 4LC0A 5IAGA 4BNGA 5BNTA 3TJRA 1T4DA 2YKGA 4F8EA 2IHKA 4YRSA 3DQQA 2NN3C 4RANA 4ZVMA 1XXHB 3TIXB 1GGKA 3PHHA 4NPAA 2HBRA 4ARVA 1WCIB 3MJCA 3P0JA 1FJGB 2ATXA 3N2NA 4Y1FA 2O1WA 4OOEA 1O54A 1N1EA 4BMNA 1U3UA 2Y99A 3L49A 5BPFA 1I4OA 1G66A 3BCUA 3E3AA 3KALA 4OB6A 5AXBA 5IT5A 2VAXA 5B7NA 3TGLA 1JNYA 1KSJA 1DJNA 5T6MA 1L5ZA 1ZGBA 1YHYA 4KXXA 4DLNA 5K5EA 3E9DA 5KSOA 3U1TA 4KR3A 1MNQA 2VHQA 4YMSA 5EFZA 4AP6A 1XJCA 4B82A 4P8RA 5LMCA 3F5MA 3N87A 4ITVA 1LNSA 1D8TA 4IOKA 1KI6A 1G59A 2AOVA 1FRZA 3O8OA 5C1BA 1E77A 5B7PA 1BHSA 4TSRA 1VI2A 4M1WA 1CK4A 3I37X 3SZGA 2ESRA 3JZAA 2WHRA 4WX2B 5IPFA 3P0RA 3OIVA 3VOBA 8GPBA 3EXHB 4JYZA 3PUVA 2HUNA 5E3IA 3P52A 4E2FA 2O3UA 4Q37A 1V3UA 1DRVA 2FPIA 1RWVA 2ZCUA 2F3RA 1LF0A 4ZOLB 2GBLA 4UU0A 5IN4A 4WDRA 5IT4A 2PZMA 2R6CA 4ZU3A 4Z0PA 1YAHA 4II2A 4CL2A 3EE6A 4OJNA 4QVGA 4ZO8A 3KTOA 4N5MA 5TQ0A 3HABA 4OGKA 4HAZA 1PFGA 5DGDA 1P8AA 4R83A 2ZSEA 1DKRA 4P58A 5ALTA 2VDVE 1SBTA 2B8TA 3DE7X 5KJ6A 1U7XA 4KK4A 3OQHA 1PZNA 4KR2A 5KJEA 4FC7A 2GD6A 2OWEA 2QENA 4JT2A 4L9RA 2JCVA 3T5PA 3ROQA 3BBLA 3ED5A 3RSHA 3R09A 1JHZA 3O2JA 4P7GA 1CY0A 1VKZA 2X8JB 3MM4A 1RRKA 2B4AA 3QTBA 4O6VA 3W2FA 4NICA 4NLLA 5TNXA 3K30A 3UM9A 4CLOA 2FPGA 2X9VA 2YJNA 2G07A 3D3WA 3WWCA 1GPLA 3JD3A 4PX9A 4C7OA 4DIFA 4RSMA 1SC9A 2OO5A 2IZ1A 3NONA 5LA6B 1NDHA 2EKZA 1O0BA 5JXWA 3EEIA 1E9RA 1T9GS 4A2PA 4ZQEA 1U1DA 4X24A 2O8DB 1KMCA 2A5FA 2YY7A 5A71A 1WQ1R 1U8TA 2JIRA 1OY1A 4HX2A 4UBNA 1Y7HA 3VYUB 3QU2A 1QFXA 1GTVA 4XIJA 3HR8A 5KEIA 1DO0A 2DFDA 3R20A 4JA0A 5LYJF 2H5JA 3LPMA 4RH0A 4DJFC 3HKBA 1K92A 5F1OA 3UWKA 1TQ2A 4RHYA 4GI2A 3TL3A 5SZKB 4MNTA 3H8VA 1U04A 1GZDA 2UZIR 3LSTA 1FZQA 1JBKA 1QFSA 3GUZA 1CFJA 3HKDA 1GRRA 1MO2A 4A0RA 2YZ7A 2E9SA 4WZ6A 5E1MA 5IANA 3G2QA 4QJ4A 5A5EA 2DB3A 1JPJA 3GWGA 4Z7NB 2FWAA 4BU0A 4W5TA 4MP8A 3M33A 5GWXA 3EY4A 3E5MA 5AJUA 5K8CA 1NTOA 2AKAB 3PD7A 1YJXA 4R0MA 2NV6A 1W85B 5JC1A 1QCYA 2D1RA 4R8LA 5HFNA 1Y8QA 3S40A 4KWHA 1HE3A 1RD4A 4Q66C 1WV0A 2HN9A 1T1JA 3CZRA 1Y3BE 3N74A 5A9TA 4C6HA 1GUZA 4OHKA 1GTG1 1M74A 1R4MA 3AOGA 4G36A 4BMPB 4JXXA 3WDMA 3FBGA 1PF7E 4UXHA 3PGLA 1TK2A 1QDLB 3N8KA 2HYDA 2BKVA 2G04A 2CLSA 3HDTA 1J22A 1WSBA 3KZCA 4L3OA 2C88A 5EEHA 4EVQA 4J1NA 3DUFB 1ZIXA 1OVMA 1GGVA 4O08A 5ADVA 4Z4FA 1Z6XA 2P5YA 3R8CA 2CLEB 3L6RA 4XCVA 5HYVA 1N3YA 3MNFA 2PX2A 2FZCA 2X22A 4G4IA 1A8UA 1Z0KA 5BR4A 4N03A 4B7AA 2PWPA 3SQXA 5CLFA 2C78A 2Q5IA 3B12A 2CB0A 2CDNA 4TXJA 4DMRA 2B5WA 1U2TA 1LSUA 2DHDA 1NVXQ 3M9LA 3PDWA 2J3HA 2PIDA 1ZXLA 1JKFA 3QEAZ 2QTTA 3GCGA 1EFPA 1SHKA 4QDOA 3X1KA 5IHXA 3EDMA 1Z7BA 1FPMA 3H2IA 3KZKA 4OK3A 4NCHA 1AZSC 1FYFA 2Y0PA 1SCJA 3S70A 3GMDA 4X63A 1RTTA 3HKCB 3KOUA 1IJKA 4MLPA 2J0EA 2JBAA 2LDYA 2PUTA 2ZOSA 3N58A 4QPZA 4U1RA 4O2AB 3WK5A 1N5JA 4LS3A 3QVGA 4IS2A 2YUTA 5ALMA 1IDN1 3TR6A 4F4UA 4M7PA 4XGNA 4B4VA 3T4PA 1RPTA 4NY1A 3LX4A 3R75A 2A8YA 3HJTA 1BX0A 3V6MA 2V55B 3F8SA 2MHCA 2QMOA 3G7SA 3MMZA 2IH4A 1G19A 3R40A 2B36A 2F43B 2OL4A 2XADA 3FLAA 2I99A 2VAPA 2PVSA 3I05A 3A9CA 3U4GA 1C3XA 1QIEA 4PIPA 4EWLA 3RFVA 4FFWA 1IRXA 3INRA 4CG0A 3RVMA 2JZNA 2NGRA 5I45A 4ZTZB 4GQIA 2J46A 1MCZA 2X58A 3K1AB 5CCDA 4BNWA 3AVXA 1XWFA 4UJ3A 2QQGA 4WINA 4LSWA 3MFQA 2RI1A 2E37A 1GFZA 1HDZA 4Y6RA 1ZINA 2P2LA 1V1MB 3DMTA 3OLQA 3AG6A 3QEKA 3T3EA 4D82A 2CLKB 3ZEAA 4DT1A 5EVCA 1HE8B 4G4SP 3NS7A 4ERNA 1VB3A 1N32B 5I7RA 4H35A 3NHSA 3FMOB 3O8BA 3QUQA 4C21A 1G8GA 2IWRA 1V39A 1FBNA 5DM0A 4UEWA 2Q8NA 2R6AA 1EFCA 4OXIA 4OP3A 2WSSA 4D97A 3KE9A 3AHDA 4EG5A 2OZVA 4AZ3B 1NBMA 3CBQA 5DNYB 1TU0A 1OTYA 2MJLA 2QUBA 2QMUA 3VJLA 4LF8B 2IOQA 2V7WA 3A28A 2XSZA 3SJCA 4Y18A 5A4MS 1XPUA 4I7EA 3RNLA 3QI7A 3VSBA 2O2SA 4PGMA 4Z0HO 1PQYA 4N6OA 5M7EA 1YQWA 4N0EA 1FXWA 1JYSA 2ZEJA 5C8YB 2BZSA 2WD7A 5HIMA 1A5SB 5JRZA 3P9YA 1SC6A 2OCIA 2HJWA 3DXXA 1X0VA 3FZEA 3DOFA 4QYSA 4LJ6A 3THSA 3WYAA 4D4MA 2Z6QA 2AMJA 3E2PA 2MYNA 3D31A 5DEIA 1TYDE 2PFSA 3TR5A 4D92A 1NG9A 5DI3B 2F9FA 2XX3A 1TJ5A 4Q3EA 3C5EA 5FPQA 3W6ZA 4KITB 1XXLA 1CXZA 3NHMA 1EUCB 3A1CA 2BUCA 1BGVA 4DJ5X 2G4VA 3FSRA 3B8HA 2X5XA 5A6VA 2X0JA 2YVAA 1GQFA 1OWLA 2IU3A 2YHUA 3D8BA 3JCZA 1Q0PA 1XQ1A 1YXMA 5EZYF 3MZ0A 1O95D 2VSOA 2WEKA 3DG9A 4W63A 2CMDA 3UJ3X 3V6LA 1IG0A 1OHHA 4KG7A 3LPDA 1G8AA 2RGNA 2HF8A 3C4JA 3GRPA 2HNKA 1X8XA 3C7AA 2PU7A 4DW8A 1KJ9A 5HUHA 2OV8A 2HDHA 4LRWA 2XOXA 3HY3A 5LM3A 1TEXA 1UBHS 1Y1TA 3MRVA 4TTQA 3VC7A 1T26A 1WUKS 2BTQB 3QENA 4JZKA 3OSZA 3PR2B 2VBCA 1OFIA 4OHBA 3MD0A 3Q6NA 2A1TS 4IY1A 3T8YA 5DHTA 3VI3B 4BP8A 1K7SN 5I7OA 2GM4A 1U3FA 1B0AA 1NNSA 1QXSA 3ZLVA 1K3TA 2PAFA 4BO8A 1KQNA 2Y27A 3WBJA 3NNDA 3F7OA 3KSDO 3MSXA 4TV9B 5HKAA 1X3SA 2LE0A 1CY4A 3MN1A 4OMFG 4R54A 1KI2A 4ZVSA 3DLBA 4CM8A 4JUAA 3DCIA 3SJ7A 1IH8A 1D04A 5TMPA 5BV1A 1M5RA 3DGEC 3L8YA 1MKYA 3E3OA 3MXTA 5EXSA 1G63A 1AJEA 3IUPA 3TSZA 2J0UA 1II8B 5FYQA 3QMPA 2GJKA 4FFPA 4WBNA 4RENA 5K0SA 1SG9A 1CCWA 2VXBA 4JL6A 1AKWA 3P7MA 2IVZA 5H3HA 1LBIA 5AI0A 2HA2A 1IK6A 3FWHA 3LUKA 4LTDA 1E4VA 1RHRA 2G6TA 4D96A 2JGIA 4RK1A 3WV4A 4LFCB 3BOSA 3CONA 3WA6A 3FM9A 4AF7A 2ZUDA 2DWCA 1FX1A 1JECA 1CR1A 1UC9A 5BYBA 1WHSA 4Y0VA 3D6UA 3LCUA 5F1PA 5BUQA 2BMDA 1CJKC 1UPBA 1YS6A 3JRWA 4QOIA 1P7ZA 3BK7A 2VJLA 1OZFA 4W5WA 4ZAYA 5JSYA 5IKEA 3QEOA 4FFMA 4KXVA 3MT9A 4EZIA 4DUPA 3C8HA 2FR8C 4BNHA 4UTNA 3OPNA 1C1DA 2NU9A 2NX2A 3OJ0A 4NENB 4DEVA 1JEEA 5MHTA 1J5EB 3HK2A 1CS0B 3WJ1A 4ZOLF 2NPFA 3D0RA 3GG2A 1QF7A 1IHPA 1ZHHA 4JJZA 2C82A 3RIMA 4DJJA 2NAFA 3H2JA 1QAQA 3PNLA 2W58A 4N6NA 2X3UA 2NVBA 3OZAA 1BW9A 5IK2D 3MLAA 3AUTA 3PHLA 1TNDA 4MJLA 3WLMA 2CXOA 2HXYA 4F97A 1PNTA 2GBPA 4IF4A 1WTCA 2PS1A 3AEZA 1CUDA 1RWWA 3MBKA 1EUDA 3PE4A 1N7IA 3AR4A 2F62A 3O83A 3M7IA 4FPXA 1RJDA 3HG7A 4ZRDA 3SC4A 3VVBA 1P1KA 5D5HA 4DNFA 4EM6A 4CKWA 3PTLA 1H2HA 3EXFA 2GM3A 4BKPA 3I8XA 2IDJA 3GLQA 2BFCA 4JJFA 3LUBA 4YCSA 4BXOB 1PFVA 2A0KA 5E1DA 1JJIA 3OCXA 4ZI7B 1E4EA 1GILA 3PIIA 5HGXA 3PWZA 4R1SA 1ZK3A 4IWNA 3WKBA 4YEDA 1E3MA 3RWBA 1OW3B 2W6PA 3H2KA 2I03A 1AUOA 1EWYA 1QK3A 3NANA 4X1IA 5LA6F 5L3QB 4CIWA 3DC7A 1S3FA 1WDTA 1QGYA 1HFKA 4XPIB 5AMXA 1TL7C 4B85A 1NNUA 1L5KA 2ZWPA 2A35A 3LY9A 1AA6A 2Q3MA 2YWGA 1JHRA 4TMVA 1PZGA 3UPUA 1Q7GA 1XB2A 1YCFA 2CLIB 3OF3A 4TXHA 5JH7B 5LFAA 2K7FA 1B8VA 3KZOA 4N0QA 1FFCA 1FYDA 3LHIA 1KPIA 3K0BA 3ICCA 4JL8A 4B7CA 3TZLA 4F5ZA 1OI4A 4KPEC 2HMSA 3LW7A 4K9QA 3AUSA 1J2JA 3W2IA 3K0SA 3BGDA 3WYNA 1GXSB 1XJ5A 3CZ5A 3AVWA 5IKMA 3AI1A 4LVNA 1IOLA 3HZRA 3N39C 5JUWA 1RKBA 3H75A 4WOCA 3FYCA 4RY2A 1RXVA 1VJCA 5ALSA 1EQUA 3PXGA 4V24A 4RW0A 4MYSA 4JGIA 4WFJA 4BV9A 2SKCA 4UU1A 1B1CA 4I1RA 4FGKA 5EXPA 1UBUS 4V2IA 2W0SA 2HIGA 2CFIA 5DYWA 5A0FA 5MN5A 4HRXA 2HSJA 2BEKA 3SZMA 3RD5A 2FN9A 4FT4A 2W0MA 3TTUA 4BO7A 1M2EA 1TX4B 4HAIA 4W7SA 2ZRHA 1OT3A 1OZHA 3VDXA 3HCOA 4TL8A 4AROA 2XCIA 3L40A 2NZUG 2VSQA 1X13A 4PCAA 4DR5B 3D8NA 1DC5A 1XU7A 3AONB 1G5HA 1F8YA 1XZFA 5SV2A 5HFJA 1AG9A 1E2UA 2IZOA 3GFVA 4PBSA 1G6Q1 4X6UA 4WVLA 2JIZD 1N75A 3Q15C 3S8YA 4BMYA 3ILXA 1WUIS 2IZ6A 4R8VA 5BR8B 1OV6A 3SM9A 1L3CA 3WYEA 3O94A 2E3JA 3HXOA 3RRNA 4FQ5A 1ZGAA 3VMMA 1FFSA 4L8FA 2JGRA 1OU4A 3G13A 3T7KA 1ZG3A 3BD6A 1C3OB 1X7YA 2P3SA 4MLZA 2IOHA 3WL5A 4PWZA 4OF4A 4XCXA 1D2RA 2Q1XA 4FFBB 2AF3C 3U7RA 4O2AF 3B7GA 1ATZA 3RRZA 1I9CA 3HU1A 1KRXA 2C07A 4HUQB 1HG0A 2CGEA 5CBKA 1MABB 3EZYA 4JI4B 1TECE 4KCGA 4RQTA 2FDCA 5D01A 1KGSA 3BICA 5B3JC 5COQA 4I55B 3TM5A 3DEIA 4C4ZA 1NQXA 2OHFA 1MRZA 2ZVDA 1GA6A 2O1EA 1DBIA 2XE8A 2Q4TA 3TL2A 1H42A 1Y1RA 4G2TA 4ZCPA 4C5AA 3LDFA 2VP4A 3RM3A 3I73A 2IEYA 4R71A 1KH3A 4CN9A 4DV7B 1PGJA 1X1SA 4H6PA 2P4SA 2DBVO 2OPHA 4C04A 2QRVA 3IOYA 4OXXA 3HMKA 2FWIA 1ADYA 1UBMS 1YZFA 2EFEB 4QDJA 2ZJFA 5FNZA 3VV2A 3VA7A 3C5VA 1JHPA 5FBZA 4HS9A 4QYIB 2G8NA 4YDQA 2ZRIA 1IN6A 1L7NA 2VHVA 2QYSA 1Y9AA 2V5UA 4ZRMA 1GCOA 1QHXA 2GA9A 2KX7A 3L0PA 3P9RA 4TS3A 5JMWA 4RM2A 4HP8A 1LEHA 1P5HA 4P34A 4Y2HA 3SJUA 3OZBA 1E62A 1T9DA 3TUIC 4BO5A 5A2GA 1PNQA 4GOKA 1SMKA 3AVTA 1R2QA 2D2IA 3L0CA 3VPGA 1RZVA 2QR5A 3BWEA 3H2SA 4BWYA 2GEFA 1G8FA 2PR2A 4HS4A 4F3CA 3G0BA 4QDZA 1XDZA 2PX6A 4QM6A 3LJKA 3OJFA 1GVNB 1VSBA 2CNOA 4HGNA 4I1IA 1IU9A 2PGLA 3LUJA 4N9WA 4F71A 2XE7A 3TZKA 3UW1A 1CKEA 4EUSA 1GGEA 1SKAA 1JG4A 4BQQA 2XRZA 1DV1A 2A92A 2J4FA 3H5RA 4FFVA 5DNAA 4Z1MA 5C8YF 5BWLA 5KPJA 3MGAA 4RK7A 3AT1A 4J49A 3OC6A 3VAAA 1QRDA 2ZI6A 2VZ8A 2GHQA 3NBQA 5DW0A 4A82A 1I7DA 2BHLA 2C3YA 4Z9AA 3OAAD 1AO0A 4EATA 5IAJA 3QE4A 3H2ZA 1JG2A 1SVWA 4UOEA 2B5VA 3F9CA 1ZGGA 4XWTA 3DBLA 1CZOA 1WPQA 3LH5A 4Q4HB 3LV8A 2O7SA 4XDZA 1TM1E 5G02A 4C4YA 2DKNA 4COOA 3H97A 4HT3B 1D5WA 4NYMR 2B69A 4EB0A 1N9KA 2Z9DA 3K8YA 1DAPA 2R00C 1ZSNA 2R5WA 5BWMA 2HR1A 4MPRA 4ND5A 1M6YA 2V7PA 3L1UA 4LHVA 4XA8A 1XMOB 1E3DA 4D9GA 1RNLA 3TZBA 2OILA 3E6AA 3LQRA 3RTDA 1MC4A 4GPIB 5BNZA 3AKZA 3KKLA 4Q4DA 2D74A