2ZR7A

Msreca native form ii'
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
307
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 71
structure length 307
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr7A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr7A01
2IYWA 4AG6A 1WB9A 2QTVB 1EESA 3K8YA 2XB4A 2ZAOA 4B3CA 4DCNA 2BC9A 1ETUA 1W4RA 4NPHA 2J0UA 3FE2A 1X8JA 1LS6A 3VR2A 3QOFA 1J8YF 3Q85A 1XXHB 3UK6A 4DKXA 3ASZA 4C2TA 2AHOA 4CGZA 1QHXA 3NHAA 4URXR 3K0AB 4WXRA 3FMOB 2VPPA 5EP4A 3U2QA 3SR0A 2JAQA 1GL7A 2RH5A 4DLYA 1MRSA 2W2TA 4W5HA 5ANRB 4FMCB 3LLUA 4NYJR 5DHAA 4Q4AB 3LVQE 5JFGA 3I8XA 2BKEA 4MUBA 2B6HA 4LV8B 121PA 1W47A 2YWHA 2WJHA 3EIQA 1SVWA 5EXSA 4EPWA 1OH6A 3SEAA 4KBGA 3OAAD 3D31A 1P2SA 3AKDA 2WM9B 3WBKA 4CEJA 3EXAA 3VX4A 2D3WA 3B8HA 4A9AA 3HU2A 4PANA 1WQ1R 1XD8A 3D7MA 2H18A 2EYQA 2W6IA 4R7ZA 2Z5FA 2YWEA 2JJ1D 4P4SB 3PEYA 4M1SA 2QUZA 1R8SA 5B57C 2O8FA 1E69A 1G5TA 1BO6A 4MYCA 2JEOA 3ASYA 2P65A 1VCOA 2GEDA 4M1OA 1NIJA 1NN3A 3TRFA 2G0TA 3T1OA 3RWOA 5TV2A 3NTUA 5EZ5A 3SJCA 3HDTA 2QP9X 3L0IB 2DB3A 3U3KA 2GBLC 1F2TB 1CLUA 5H70A 3QUSA 2X19A 2UVQA 1MH1A 3TBKA 2VQSA 1NN1A 1W2GA 4YXWD 2D7CA 2WWIA 4EPVA 2ANBA 3DOEA 1Z6GA 4N3NA 1Z0DA 4BFYA 3SJBA 2ZM5A 3L0OA 4JLVA 4B43A 1UBEA 5EXTA 3G0HA 1J2JA 1PVOA 1NVVQ 3N2EA 2VH5R 4A2WA 1KDRA 2OBMA 2YVUA 4BPBA 4L16A 2R6DA 4D2IA 3NH6A 4Q7KA 5DN6D 2VHJA 3IUYA 2YKGA 3ZVRA 4BLOA 5J4KA 5CDFE 1GIAA 3AH8A 5KSYA 1YKSA 2ZYVX 3AF3A 1N25A 3A1SA 4EQ6B 5JJLA 1L7VC 2W6ID 3CO5A 4ZV4A 4BFTA 1M1YE 4L5BA 5CDFA 5B30A 1X86B 5AK0A 1CS4C 4LWZA 3ZYCA 1D2NA 4ARZA 2IS4A 2GCNA 5EP1A 2GCOB 1ZNYA 3WXMA 2W0MA 2AFIE 2PZGA 4KSCA 1F60A 2FGJA 2IYVA 1AGPA 4QJ4A 1E4YA 4TMZA 3A4LA 5JCZA 4C0QC 3ETLA 5KUTA 2VP6A 2IC5A 2F9MA 1BS1A 2W83A 2YWFA 2ZI3A 3ECCA 4GT1A 1W0KD 1YQTA 2WVJA 4L9SA 4AC9A 4O25A 3KFVA 4CT5A 621PA 2REBA 4NH0A 1TX4B 4RD4A 4F7WA 5EE5B 1N6LA 2IYXA 3TSOA 2QPOA 3UMFA 2UZIR 3RRYA 2DWQA 4EIWA 4Q4HA 3QXJA 5F98A 1ZNXA 2WSSD 3AVPA 4M22A 5JRZA 2D4HA 2WJGA 4W5JA 1G3RA 5C18A 4C3ZA 1XXHE 4Q02A 1DO0A 5FI0B 4WAUA 2X77A 1HURA 4NP6A 5DLQC 2BEKA 3A8TA 3REGA 3KXLA 5G3ZA 1R7RA 2W0SA 4ZI2A 1CR4A 3EIEA 2CK3D 4NU0A 5A0FA 3EZ9A 3CUEF 2XGJA 5JJKA 3Q72A 1CRQA 5H68A 4Q1DA 1E96A 3N70A 4KYUA 4DCUA 4EJSC 2IF2A 4IDOA 4ERNA 4IVRA 1QVAA 4JBXA 2F1JA 3N5CA 4P4SA 4TN1A 1S1CA 1DPFA 4EAQA 3RS5A 5H1YA 1U94A 2VHCA 3IIJA 4UNSA 3AVYA 3QXHA 5BN4A 5DHFA 1JEEA 4JYBA 5E7MA 1ONBA 2A5YB 1W5SA 3MWKA 1E6CA 5KPDA 3QIAA 1AKYA 2V55B 4HEJA 4NTZA 5HTKA 2IWHA 4BLRA 3VNUA 1XU4A 5TARA 3TW8B 3Q7PA 1JPNA 3EWSA 2WWXA 3ND9A 4DEYA 3B1ZA 2RHMA 4LYJA 1KZGB 1E79D 1YZKA 1GNRA 1XF9A 4BFSA 3VKWA 4DB4A 1G41A 3SNHA 5L3QB 1BOFA 4GZLA 3PITA 4MQBA 1GZSA 3CM0A 2Q3FA 4Q9IA 1H8EA 1UPTA 2FWRA 3BH0A 4X8LA 4FD2A 4BEJA 3AVTA 1OW3B 3PUWA 1E9FA 4QG7A 1W2HA 3AP1A 1KO7A 2PCLA 2JLUA 2Q3MA 3DVLA 1I2MA 2V7QA 5JECA 3VX3A 1ZVQA 3OZXA 4GMXA 1T3LA 4ILEA 5BN5A 1ZW6A 2I1QA 1E1QA 1E98A 2ZRFA 1UBCA 1D2EA 3SQWA 3KB2A 5AJWA 2R2AA 3U7HB 3QXSA 4LJ4A 3I72A 4XH9B 2B21A 3QEJA 3JZMA 3K53A 4MRPA 3L82B 3TQCA 2A9KA 4MYUA 4PTLA 1CTQA 3PR1A 2AXPA 1G291 3MGCA 1OH5A 3SQXA 4B3FX 1JQJC 2FZLA 1V5WA 4UXJA 3FFAA 1E2MA 3IKJA 4DDWA 4JVSB 4Q1EA 4ZDWA 2C04A 1ZUIA 3IILA 3RANA 3TR0A 5AJXA 4B76A 2FPMA 1XJQA 2CEAA 3T1TA 2FDCA 2VHUA 3SJZA 2QA5A 1UEJA 1IONA 2B8TA 4F92B 1TQDA 2RGDA 4RZXA 2AK3A 4FIDA 5FTNA 1XTJA 3HU1A 1UAAA 1EFUA 5FH9A 4GI7A 3BJIC 4TTPA 5SZHB 2QROA 3A1VA 3W6NA 5KNDA 1EK0A 1XXHA 4EKDA 5KTYA 4PSVA 2J5XA 5JEEA 4PQFA 3AP2A 2RMKA 3MWLA 1JEDA 1VHTA 4EPTA 3FYHA 4DT1B 3GJXC 4NMMA 4C0AC 3DM9B 4KU4A 1VG8A 2GILA 2J7KA 1TEVA 3KKNA 4LUCA 1VCIA 3W8NA 4B3GA 3VNVA 1XD2B 3W6PA 2HT1A 1P4SA 1E2KA 2FFQA 2ZYWX 4DJTA 1TAGA 4AY2A 2W6JA 3P26A 4F93B 3VHXA 1KKLA 4XTRA 2F1IA 1NI3A 4Z8XA 3FMIA 4WXPA 3BB1A 4Q4JB 2FJUA 2ERXA 2EFCB 4JZKA 1ZYUA 1AQYA 1XEFA 2VIIA 1ZM7A 4HB0A 1W44A 2WWWA 4CEHA 3EPHA 4L4UA 1ZUNB 1XX6A 4KXFB 1NL3A 4AKIA 2ZE8A 5B64A 4CYMA 2PZEA 3CONA 4A0RA 3I8SA 3B6EA 2P0EA 2X2EA 1ODFA 2PEZA 3KX2A 4PC7A 3SU8A 4HLUA 1RRGA 3CLVA 2ZE7A 4JSYA 4GBMA 1TF7A 1XCMA 2I4IA 3F5FA 4FWIB 2W00A 4GL2A 3LDAA 5JHHB 3W3ZB 2F9LA 4B6EA 2SHKA 3BFXA 3ICEA 3RSOA 3LAWA 1EWRA 3CF0A 3L8ZA 3CX7A 521PA 1ELOA 3ND8A 1N5LA 1Y63A 5FPHA 4MKGA 1RFLA 1GAJA 2J41A 4LY6A 3UKDA 4HYYA 4NCNA 3WMFA 1P7CA 4HDOB 1OIXA 4HATA 4TLBA 1Z6TA 3IQWA 2BJWA 2F43A 2R6FA 4D0LB 4TZ0A 2OFXA 1D9XA 3V4FA 1SXJD 4MA4A 3U4QB 4ZKDA 4ZO4A 5JLJA 2XZLA 1YVDA 3VR6A 3VR4A 5BN3A 5C1BA 4B44A 3IEUA 2ZS7A 4TMVA 2QM7A 2QE7D 1KZ7B 2RKOA 4I81A 1D6JA 1OLOA 4PO1A 1JJ7A 4BGDA 4Q19A 2JDID 1G8FA 2IBMA 2C2HA 1AIPA 1N6IA 4IDQA 4M1KA 5TXGA 1T3SA 2NOAA 1GL9B 3TAHA 2XJ4A 2F1RA 3WP1B 2GK6A 4WIAA 2PCJA 5CK5A 1IXRC 4XWAA 4Q1CA 2QN6A 5L3RA 2AK2A 5HKKD 1QDEA 2IYQA 2C77A 4KV9A 2FSIA 3SZRA 2YYZA 1X1SA 4C0JA 4QBIA 3CRQA 3K0FB 4Q5IA 1LF5A 3EW9A 3KB1A 1JBKA 1RRCA 1UEIA 1KO1A 5DN6A 4KLZA 2VLIA 2WAYA 4EDHA 1IM2A 2QAGC 2WOOA 3VMFA 3VU9A 3RRMA 3DOFA 4LBVA 3BAFA 3K0CC 3TGPA 2FFAA 1KI7A 3BH7A 4M9XA 2J0UB 1G7SA 1RJ9B 1P61B 3TH5A 1D9ZA 1M6NA 4B2LA 4FXPA 2ZXUA 2QTHA 1HV8A 2ERYA 1SQ5A 5FOTA 3OF5A 4CZ2A 1R8QA 4KCGA 2FPLA 1H8HD 4V0NA 2X1VA 4Q66C 3REFA 4D4KA 3GLGB 3WP0A 2Q9CA 4W7SA 1ESMA 3LFUA 4CW7A 4EQ6A 5KU1A 1DG1G 1TU3A 1E2FA 5CLLA 1P9NA 4TYPA 1PLLA 2XJ9A 3GLIE 4DLUA 3NEYA 1WE2A 4NBSA 2P5TB 3QE0A 4QL3A 3QI2A 1MOZA 1LNZA 4GZMA 4B35A 1KK3A 1P9RA 3LQQA 2NGRA 3QKTA 5LB2A 2N42A 5L3SA 5LDDC 2R6GA 2PLFA 2QG6A 1NG9A 1K8RA 1E9DA 1VMAA 1HQCA 1A82A 1XNJA 1G64A 1PLKA 4ZIRB 3KKPA 2GEVA 2IS6A 2O8DA 4A8JC 1OH8A 1T9HA 3BD9A 4G5SA 2F43B 1XTQA 2BWJA 5GJBA 2JDIA 5J4HA 4B2IA 4TWZA 5C2JB 4P32A 2GDJA 2QE7A 4X8OA 3GEEA 2G9NA 4EUNA 4TYYA 3GCGA 2VF7A 2ONKA 4AYXA 4B2PA 1SHKA 1U0JA 3I3SR 3A1TA 2O8EA 2C8VA 3SYLA 3QPWA 2JIZD 3QKSB 1T8TA 5EZ6B 4TT3D 3RS7A 1XZQA 3K0FA 4BUJA 4US2R 3PUXA 4BE7B 5EQTA 3A58B 1A2KC 1NKSA 1A4RA 4LJ8A 5G3YA 1W36B 4DCVA 3LRPA 3OIWA 3I92A 1KI9A 4JIMA 5BW8A 4PPQA 1TADA 3A36A 1E32A 3LVRE 4OK6A 4JSTA 1ZIPA 3LXXA 2A78A 2IYLD 3GJ8A 2H7VA 4DLWA 4LJAA 4QNMA 5FOXA 3TJZA 1IN8A 2QY9A 1J7KA 2FFHA 3FKQA 2FEMA 4NHOA 4MRRA 3A6PC 3I62A 1J8MF 4LPSA 1YU9A 2C5LA 1NLYA 4F4JA 3NBFA 4Z51A 3I5XA 3JZAA 4JVNA 1S96A 3KKOA 4V0MA 1II8A 1FPMA 4MUAA 2B8WA 3PEUA 2GAOA 1Q57A 2GXSA 3NG1A 2ZR7A 2ZETA 1XPUA 2JJ2A 1A7JA 1FFHA 2E1RA 1VKJA 2GXAA 1UF9A 3UG7A 4IXNA 3KDSE 2OAQ1 4KSBA 3PV0A 3X1YA 2CJWB 1HEIA 3QF4A 1TF2A 4XVUA 2PEYA 4MYHA 821PA 2XXAB 5FFMA 3TNFA 5IRCD 4DRZA 4RD3A 3BRWD 2HDNB 2GBLA 2WKQA 3MRSA 2G6BA 1JALA 5JMTA 1Q20A 2IEZA 3GD7A 5GJCA 1VG0B 4BWYA 1OFIA 2HF8A 3EZ6A 1FUUA 1XJ0A 4MH0R 2GF0A 3AVQA 2FH5B 3GLGA 1JR3A 2DCUA 3K0EA 2O8CA 4JLBA 5DSZA 2CMKA 2NTYC 2GAAA 4JT4A 5KO2A 1FW6A 1U99A 4BLQA 3CWQA 1K5GA 3CX6A 1KDTA 2WSMA 1OSNA 1T4GA 5SZKB 4QRHA 1DAGA 3B60A 4UJ3A 1JXMA 1XWIA 4MITA 1KI6A 1GTVA 4IJMA 1Q21A 2VHQA 5KSOA 4HDQB 4DLZA 5KDDA 4Q7JB 1JAHA 2QBYB 1EX7A 1KJZA 3P20A 4KVAA 1F2UB 1WDTA 3AKYA 3DKVA 4ON9A 2IXEA 2A5FA 4IOJA 1JJVA 4G5QA 2OCAA 1U9IC 2IA5A 4G5GA 1W1WA 3THXB 1CP2A 1SXJE 2QPTA 4V02A 1SVLA 1JB1A 1KK2A 1CF4A 4GOKA 1AK2A 1G7TA 2ZRKA 2CL0X 2MMCA 2FSHA 4IOKA 4PPGA 4CDGA 1G7RA 2Z83A 3GLFB 4TQ9A 4XVRA 2QGZA 2IYYA 4M8NE 2DWPA 2ORIA 5E7IA 2Q0HA 4ABYA 2ORVA 4BLPA 5TDHA 3IDQA 2O8EB 1DVRA 4A0FA 2VSXA 4NCIA 4PZLA 3KJGA 4DB2A 3AEZA 4BZXA 1QG4A 3HPRA 3SOPA 5HR5A 5JI2E 4JBYA 3QBTA 3ZS8A 3U61B 5F9FA 3FMFA 4QOSA 2ECKA 4DLVA 1E2PA 4UJ5A 2JLXA 1GKUB 1NMZA 1SVMA 2D62A 4HSEA 5D3QA 3R7WA 1Q1ZA 1K6MA 1HTWA 1OYWA 3LH5A 3C7KA 1MO4A 4OHZA 2IS1A 2PH1A 1EGAA 1TQ4A 2ZSBA 4OI2A 4A82A 3K9LA 3ZJYA 3NC1C 2CDNA 4TYQA 1CJVC 2Z0MA 4FCWA 4BZPA 2FA9A 2R65A 3ADKA 2JCSA 2PJZA 2JLQA 1Z5ZA 2C78A 2Q9BA 1E0SA 5KSPA 2H5EA 5FTLA 3IBYA 2Y8EA 3C16C 3U3JA 3NXSA 5AUQA 2ZRBA 1SKYE 4QM6A 2REXB 3NVAA 4XD7A 2BBTA 3U7EB 4Q48A 3AVOA 2J7PD 5C4MA 1NVWQ 1MABA 5KYKA 3F8TA 4MGZR 4W5WA 4PAQA 1QHIA 3EARA 2XTNA 5K8LA 5JI3E 1W4BA 3PXGA 1RW4A 1NVVR 2A7QA 4PFSA 4XJXA 1N5IA 3K70B 5CJPA 2L0XA 4D82A 2BVNA 2HJVA 3C41J 1KKMA 1RJ9A 2P6UA 2WBLC 4DSUA 1KIMA 3IGFA 3E70C 2ZVPX 1T6NA 3OE7A 1GRRA 4RZUA 2Q3HA 4DBLC 3EG5A 1FNMA 1G7CA 1L4UA 1TUEA 2QGNA 2ZVQX 5FL7D 3CNOA 5FR1A 4LHZA 5JCPA 4NYIQ 4YONB 1NBME 2GJKA 1YHNA 3TMKA 1IOZA 1CJMA 1MRNA 3TVDA 3T12A 3O8RA 5CB8A 3GLHB 4Q47A 1E4VA 3SC3A 4C0LA 5GVSA 1E9BA 3AF4A 3H4MA 5FBLB 3KKQA 2EW1A 5AUPB 1YR9A 2WWGA 3DHWC 4M1WA 5LBIA 5E95A 4A6PA 5EP3A 3EC1A 4MDEA 4M1MA 3THWA 4O2LA 2GZHA 4PZYA 2OCBA 2DYKA 4E07A 1ZU5A 3CRVA 2V54A 5B58C 1KI6B 4NYMR 1VYUA 1ZM9A 3B13B 3WHKA 4PAOA 2C9CA 1S8FA 1ZD1A 2WJYA 2FPKA 3BERA 2ZANA 3ADBA 2ZI6A 3AUYA 4QFMA 5JWRA 5A4JA 2GWHA 2NO7A 2J45A 2FU5C 4Q1BA 1W4AA 1I4DD 1TL7C 2O0JA 4A8JA 1XFAA 1Z6AA 1JECA 4X8MA 4D80A 2IWRA 4EFMA 3K0CA 4OI1A 1FTNA 3AKEA 4IDNA 3PJRA 1ZC4A 4FCTA 3IHWA 3EC2A 2ZUCA 3LW8A 2BOVA 4CEJB 1FQKA 1S4QA 1T0HB 4V0LA 4ZI3A 3LV8A 1KK1A 3BS4A 3QG5A 3IO5A 3BE4A 4DZZA 3DPUA 4PAMA 1N0WA 4HDCA 4QKQA 2CJWA 3K70D 1YZQA 4Q21A 5CYOA 3Q5EA 2O8FB 3B7GA 2ZRJA 3EA5A 4D0NA 1G3UA 1KNQA 3FFBA 4A36A 2D7DA 1Z0IA 2ATVA 3GLIB 4LX0A 5AJYA 1NBMD 3RRZA 4PR0A 4C0SA 3FOZA 4BRWA 1LTQA 2KB0A 3FVQA 5JWHA 5TVKA 4C2UA 1U8ZA 4RSGA 1XDBA 2IHBA 2ODNA 3M0EA 4FCVA 5DYGA 2UKDA 4LBYA 2XX3A 3P1JA 1GWNA 3H1TA 4A2QA 2HUPA 1QZXA 2W58A 2OM2A 1H65A 2VP4A 3AF2A 3HPQA 1G16A 4ESVA 1G8YA 1Z06A 3PUZA 5HPYB 3R7WB 3W6OA 3SYNA 1OJLA 2ZE5A 5LD2B 1TQ2A 5FBVB 1N6NA 2J46A 3DMDA 3WMEA 3T1QA 1KI8A 2RGGA 5JRJA 2AWOA 4F4CA 4NONA 3RLFA 2AKYA 1G3MA 2E9SA 1E2JA 2D06A 2ZRDA 1E2HA 3B78A 2BMDA 3M1IA 4NCJA 2OILA 1M74A 3ZQJA 2DBYA 2KSQA 4P3YA 2QNRA 3AVWA 1JR3D 5KNBA 1E3MA 1AKEA 2YJTD 4XSHA 5BXQC 1AQUA 2DHRA 1UKEA 3X1DA 3EZ7A 1NLFA 2ZS9A 5TB5A 2IF0A 2IW3A 1OXTA 3CWZA 3VTKA 2G1JA 5SZIA 3QQ5A 2XXAA 2QU8A 4E5UA 1LFDB 4LC1A 5DISB 2EFDB 3GJ3A 4Q9LA 2H8KA 3K0AA 5JHGB 2BM1A 1GRQA 3BFKA 4O2RA 5FPTA 1F48A 3DL0A 4HLCA 1AS2A 1FP6A 3H84A 3KZ1E 2GXUA 1WBDA 3B1YA 5L3VA 3OESA 1E1QD 2V1UA 2CXXA 1G6HA 3TAUA 3CR7A 1DE0A 2I1VB 2QTFA 4JLPA 3WY9A 2JLYA 5B2ZA 1XZPA 1S1MA 2OE2A 3DKPA 4JS0A 4HUQA 1UKZA 1FZQA 3TIFA 1XCPA 1Z6XA 4LYAA 1QHYA 1AS0A 3BB3A 4N0DA 3CF2A 1BIFA 2MMGA 2CHVA 2NIPA 5FBRB 3E5HA 2CLCX 2QMUA 3M6AA 3Q9LA 1G9XA 4YMSA 3FKSA 3C5HA 2ZRGA 1XEXB 2KBFA 4CIDA 4OQFA 1J90A 3MWYW 2R9VA 1YJ5A 2WV9A 2WWHA 2XZPA 3X1XA 1FX0B 3P27A 5C46F 2ZJ8A 2ZEJA 4B34A 5FTKA 1ZNWA 4QGFA 1IQPA 4TQUS 3UWKA 3GLHA 4R71A 4D26A 3AVXA 1SGWA 4I1UA 3K0SA 1G17A 1G8HA 2CL6X 2YWGA 4AKGA 1AZSC 3OAAA 3F3YA 4CEIA 3MD0A 1N0UA 3DZDA 2XITA 2WKPA 2N46A 5HZKA 4P4TA 3AP3A 4US1R 4K81B 2MSCB 4X8HA 2IXFA 1G6OA 2G3YA 3LX5A 4RKFA 1XMSA 5AWFC 1AS3A 4B48A 4M4SA 1PV4A 1OE0A 2ZRMA 4JVLA 1XPOA 1N6KA 1OXVA 2BHRA 2WJIA 2WPDD 2VSFA 4YDHB 1CKEA 1G20E 1ZP6A 4XIGS 1EWQA 1NIPA 4URWR 5F9HA 2YC2C 1M7GA 2HCJB 5DE3A 3I1FA 3A4NA 1HE1C 1UFQA 2YHSA 1XD9A 3WYGA 2R6CA 1A1VA 1FMLA 1SVKA 4LV5B 1CR0A 1RE0A 3QNUA 4HAVA 4PQRA 2CHGA 4QC2A 5HCIA 3R20A 2EWVA 2A5DA 4FMCF 3LO5A 3WRYC 2BBOA 4RFSA 4CVNA 4I1SA 3W8RA 3PG5A 4LJ7A 2OESA 2XNDA 3QG1A 2HCBA 2QP4A 4A15A 2GHIA 1VIYA 2AX4A 4HAXA 3TW4A 2DFTA 3B1VA 1KGDA 1R0YA 3WBJA 1KAGA 4UNNA 4JMPA 2R44A 1FUKA 3EPJA 4ZCIA 4PC6A 4IW3B 1JNYA 1NNEA 2GKSA 3D6TB 5FBQB 3DO6A 1E1RD 4XSGA 4DWJA 1S9DA 4P4UA 1JI0A 5SZJA 4DSTA 3ZVLA 3GMTA 5J47A 2R8RA 2QRNA 2G77B 2MSEB 4YMTA 1B23P 1LW7A 1P6XA 3U3OA 4PSAA 3NDPA 4HUQB 4OQNA 3QVVA 1US8A 2CHQA 4BLTA 1CU1A 4QXAA 2ZJ5A 1MO3A 4JKYA 4D4LA 1W46A 4MYTA 4C0BA 1TUIA 5AUNB 4IDHA 5HE8A 2E87A 4URUR 5DIFA 1Q12A 2GNOA 3RS3A 3TVTA 3VQTA 4O3MA 1M2OB 5FOWA 4S35A 1G19A 1G5RA 2WKRA 2C9OA 1N6PA 5JZVA 3HR8A 2ZRPA 1NSFA 2V1XA 4OYHA 2A5GA 2J1LA 3SN6A 4AK9A 4ZIRA 5LPNA 2O8DB 2ZRAA 1NJFA 3Q8XB 2WJVA 4KFSA 1YZTA 1QHGA 1R0XA 2GJAA 1QBKC 4GDFA 4JLMA 4W9MC 2IX3A 4MRSA 1M34E 3G5UA 4M21A 2D74A 1GILA 3K9NA 1ZU4A 4G1UC 1FOEB 1HH4A 1GG2A 4YXWA 2ZI9A 3D3QA 3P32A 5EXPA 4U00A 2IS2A 4QGAA 3QPVA 3FHOA 3FPAA 1UKYA 2IXGA 2QP3A 3QF4B 4NYMQ 4TQAA 2GZDA 1H8ED 2FN4A 2C03A 4IOMA 3WRXC 1DADA 3BGWA 3JVVA 4Z54A 5AUOB 1NVUQ 2FNAA 4C4PA 1Z2CA 3JVUA 2G1KA 3AB3A 3QVUA 5FI1B 3LA6A 4Z1MA 1WBBA 1ZNZA 4IXMA 5BWMA 4LCBA 3KQNA 3KTAA 1KJWA 2Z43A 2VP0A 3EWAA 1DELA 3OEHA 2FEOA 1O3YA 3QEOA 4ACBA 5FR2A 4BEBA 2C98A 3KUCA 1OIVA 3CNNA 1T5IA 1UJ2A 2NO9A 3CZQA 4TTRA 1AM4D 1TEXA 1U81A 1W36C 3CPHA 2OFWA 4UNPA 2F3TA 5AJVB 4Z8YA 3ZLJA 2NQ2C 1OHHA 4F91B 1YZGA 2XSZD 1R2QA 5FTJA 4TYNA 2F6RA 4BASA 2P5SA 3VKGA 3IEVA 2CLSA 1II8B 1F3OA 2DFKB 2VL7A 1C4OA 4JJZA 2WMOB 5GJWC 4P33A 4I4LA 3I4LA 2GVZC 2XOKA 2CVHA 1KAOA 1X8KA 4TL9A 2CNWA 4DC9A 3BB4A 4P0TA 3QENA 3R9XA 1T8UA 4OK3A 1E2LA 4URYR 1SXJC 2WAXA 5JS7A 4G0NA 2JATA 3HYTA 2HXYA 2CCKA 5CM9C 1Z0JA 2QT0A 5FL7A 2V9PA 3AM1A 4GNKA 3C5CA 3QKSA 1N6OA 2O52A 1KMHA 2BV3A 1KYIA 2EFEB 3GLFA 2QPAA 1XPRA 2FG5A 4FMBB 4RZ3A 1XTRA 1W0JD 1CIPA 4QGGA 4IHQA 3ZGXA 1W4CA 5J40A 3X1WA 4EJSA 2AR7A 5JJIA 1EFHA 4L9WA 1KO8A 3IQXA 3NC0C 3W5IA 2ZIAA 2Q21A 4JLDA 4M0LA 1R5BA 1NN5A 2BMEA 2YOFA 1J99A 2Q6TA 3O8CA 2ZQ5A 1UDXA 3ZZTA 5CITA 3RS4A 1SZPA 2ANCA 2HYIC 2VEDA 2XSZA 2EQBA 3T5GA 2QRZA 4AYTA 1U98A 4JLKA 3C14C 3MUFA 3VR1A 2HEIA 1Q0UA 5JS8A 1OKKD 4S2EA 3MMPA 3BWDD 4NCKA 3LW7A 1WA5A 4G01B 5EE9A 1G3QA 1HQYE 4HZUA 3QSYA 2IYUA 1CEEA 1NY5A 4HLUC 3CNLA 2ZJOA 2IYZA 4PC2A 3SE0A 3WNCA 3OEHD 2D2EA 2ZU0C 1GNPA 3BFVA 4UXHA 4TT3A 2JIZA 3EZFA 4KYIB 3PQCA 4FMDF 5IK2A 4POAA 1SHZA 4EFLA 1BH2A 3VAAA 2BBWA 1A5TA 1XD2A 5CK4A 4R2IA 3S1AA 4R98A 1KMQA 1TF5A 1Z0AA 2BEJA 2ZUDA 4ARZB 4FI3C 1TPZA 1XEWY 1N5KA 3B1WA 2ZPTX 3KQUA 4B71A 4TLAA 2RGCA 4LJYA 2F1HA 4RJLA 1Z2AA 3GFOA 5M04A 1E0JA 1P3JA 1TTTA 1CXZA 1GKYA 1XBTA 1N6HA 2HLDA 3SI7A 1WP9A 1VHLA 4LJ6A 1FP7A 3IIMA 3TLXA 1CR2A 3CRW1 4ESHA 4PHGA 2EFGA 2J7PA 4GP7A 4V0ME 1VTKA 3OFNA 4OBEA 1SVOA 1OPXA 3FWYA 1HUQA 2RB4A 1RRPA 3P4XA 1X8LA 1KJYA 1ZM4A 4MRVA 4Q18A 3KJHA 2IHYA 2ZSAA 1NF3A 2LKCA 1DAEA 2ZRHA 1E2NA 3AQ4A 5D3MA 1A2BA 2Z6VA 5LD2C 2ZJYA 3W9YA 2RHDA 3EIHA 4M1YA 3L2OB 3CH5A 4PO9A 221PA 5AJZA 1LV7A 2B92A 4ITRC 3LY5A 4PC1A 2NPIA 4BFXA 4BECA 3U5ZB 1TMKA 2LCFA 1K5DA 1DBSA 1H8HA 1WMSA 4DLSA 2ZI4A 3K1JA 3C4JA 5FOUA 2RAPA 1NY6A 4HAYA 4JYCA 2QAGA 4HAUA 1W48A 4TL8A 4Q7MB 3B5JA 1UDWA 2OBNA 3U4QA 2HXSA 3MG9A 4E09A 3EPKA 4JLNA 4DUGD 1SULA 4QJ3A 5CYPA 4IVQA 3TK1A 3QJYA 2FSFA 2B7CA 3SHWA 2OUKA 4IRUB 1GKIA 4PX9A 2NPFA 1S0UA 2FMXA 4GSYA 2FE4A 5GJVC 1JR3E 2ZI5A 4OQLA 3U3MA 1F6BA 3SDZA 1TNDA 1F2UA 2QORA 4RD6A 4BQSA 4WOPA 4PPNA 3UMRA 5HZHA 2A2ZA 4OJQA 4R9UC 3MCAA 4KLNA 4Q4AA 4Q7LA 4FN5A 4IKEA 3LBNA 3A4MA 3T34A 2PZFA 3RSLA 2IYSA 3KQHA 1FQJA 1DAHA 3SFZA 2W2XA 4YMWA 4U7DA 4NE2A 5K8IA 4B3XA 1NMYA 4P31A 1NLZA 1QHHB 4BZQA 2QMOA 3NEJA 3Q5DA 3UANA 4QHSA 4N1AA 2CE2X 3FHCB 3L43A 4KHZA 1YE8A 3GJ0A 1I2DA 2O5VA 2VP5A 1X6VA 1YZNA 2R62A 3RHFA 3UIEA 3ADCA 2GRJA 1QRAA 2H17A 1WRBA 2JLRA 3CR8A 4URVR 1QHSA 3ZZ0A 1N5JA 2AKAB 3U44B 1OF1A 2K5UA 2XNDD 4F4IA 4H1UA 1CBUA 4U5XA 4TMXA 5K8TA 1EG7A 3Q3JB 3B1XA 4RZ2A 3SJAA 2G83A 4AURA 5CIQA 2RCNA 4MGKR 5FPSA 4QBHA 1ZCAA 2DFNA 2PLRA 4UNRA 3B82A 1II9A 3K09A 5IDVA 5CLQA 3B9QA 1E1RA 4C30A 3EPLA 1IBRA 3PEWA 1KO4A 2AFHE 2GJ9A 3AF1A 5G41A 2JLVA 1ZBDA 3RC3A 3AV0B 1RVDA 3L8YA 4KO8A 3OIUA 2J3EA 2VHTA 3K70C 1EFTA 4JLAA 1S3SA 4UXIA 3ZDQA 2OEPA 3FTQA 4HAZA 1B0UA 4D81A 1R5OA 1WCV1 2JLWA 3QPUA 1VCMA 3EAQA 2IL1A 2V6IA 3QY0A 2GCPA 2OAP1 2ZYUX 3VKHA 2OHFA 4Q9HA 1X3SA 3LLMA 4Q00A 4KITB 2IT1A 2IEYA 1NMXA 3T1VA 2RGEA 4UKDA 1XJCA 1CULC 2D2FA 4EPXA 3R9IA 2VA8A 1PLJA 2P2LA 1R0WA 4OHWA 2YZ2A 2GJ8A 4D4JA 3X2SA 1NSTA 2J59A 4CF7A 1KSGA 2VP9A 3L0SA 4NYJQ 4ASUD 4Q9KA 1ZIOA 3U60B 3BK7A 4R2HA 2GESA 3LNCA 5CM8B 4PPFA 4DUGA 2VO1A 4A92A 5GVRA 2PX3A 3SBDA 3KJEA 2ODBA 2A5JA 2O0HA 5FTMA 1QHHA 1VG1A 4LYFA 1HT1E 4FW9A 1DS6A 1AJEA 2BCGY 2ORWA 1OFTA 2Z4SA 3OIVA 2W2VA 3GLIA 3T35A 4RVCA 1U90A 4E03A 1Q3TA 1XMJA 3ZVNA 4MRNA 1LS1A 3LBIA 1G5PA 4CRWB 3NDBB 4V0KA 2DR3A 5AR1A 4KI0A 1KOFA 5IT5A 3RVBA 6Q21A 1Z08A 4RKEA 3OEEA 5ELXA 3WMGA 5IHPA 4CEHB 2QI9C 3SHFA 2GJSA 1ZCBA 4YMVA 4US0R 5HKKA 2V4ZA 4UQOA 2V7QD 2EU8A 1G4AE 4PHTA 1Q22A 3FGNA 1R0ZA 4M9QA 4LJ9A 4Y0AA 2REOA 4DCSA 2VF8A 1OXSC 1P60A 2WTUA 4XWOA 3DZ8A 1GP2A 2OLJA 3KJIA 4HAWA 4OL0A 2NZ8A 5KPJA 4QM7A 3V4RA 5DNYB 3NBXX 2PJRA 4GFDA 3O47A 4B75A 1RC8A 2OXRA 1OIWA 2ZR0A 4Q4HB 2F7SA 1RYFA 1SXJA 4OHYA 1E2IA 5DGXA 2ATXA 3OFND 4AIIA 1OH7A 2FOLA 5KNCA 3QBVA 4BRUA 2OCPA 3T5DA 1IJFA 1N6RA 1IN4A 1ZINA 2WIBA 4I1OA 3GJ4A 1IY1A 4G5RA 5EP2A 1IHUA 4FINA 2ZROA 1R10A 3B9PA 3H86A 1OKKA 3K09C 4ACAA 2OFOA 4QJ5A 1IY2A 3R9WA 2H92A 3BOSA 1O87A 3LD9A 2NG1A 1RYHA 2RGXA 2N1BA 5FUYA 1JAIA 1HT2E 3B2EA 4YC7A 1GUAA 1P73A 4QHTA 1E94E 2ZUBA 1KI4A 4DIDA 2J0QA 1ZC3A 3VU9B 1ESNA 4RD0A 1Z0FA 5IK2D 1OV4A 3ZZUA 1Z22A 5FPKA 1FTSA 2FF7A 2CNWD 4EPYA 2WWYA 1KSFX 1IN7A 4Q1AA 4Q9JA 1TQ6A 1GDDA 4DVGA 4DEXA 1NRJB 3R8FA 1UKVY 3UXMA 3ZIAD 2PBRA 4XVQA 2XNSA 2LKDA 1GSIA 2QSYA 2KBEA 1KTVA 4J0QA 1FL9A 3OE7D 3QKRB 2ONJA 2CCGA 3VHLB 2ODWA 3S1AB 5JSZB 1N2CE 3GP8A 1Q1BA 1HY3A 2CLDX 4V0OA 4A6XA 2W6JD 3CIOA 4LK2A 3GJ5A 3THYB 2KI5A 1SVIA 1XTKA 2P67A 3W34A 4DDUA 2TMKA 4IVPA 3M4YA 1YR8A 3D8BA 1Q1EA 1E9AA 3HR7A 3WNDA 4XOIA 1QVRA 1DAKA 2YOHA 3QXXA 4EJSB 1MV5A 5EUQB 3WHLA 1V43A 1W0JA 5KSZA 3CH4B 5EXXA 1NG1A 2QQ0A 2WHXA 4HB4A 2BMFA 4YDSA 1DAIA 1T3HA 2PMKA 3RS0A 1COWA 2YC4C 4HI0E 1N3BA 1VDZA 3HJNA 1T91A 4IEEA 4D0GA 4LHXA 2G88A 1IXSB 4LYHA 4LRWA 1PZNA 3U7FB 3PUYA 4OQMA 3DDCA 1D5CA 2P3SA 2XOKD 4Q01A 2CBZA 1GNQA 3OEED 5FL3A 3TSWA 1OFUX 1ZRHA 4H1VA 2VRWA 1OXXK 2GA8A 1DOAA 1G8GA 1W7AA 4URZR 4B73A 4KODA 1G4UR 4TLEA 2GK7A 1OHHD 2IYRA 4RCYA 2FZ4A 2YOGA 1Q44A 3IBGA 3NHBA 3O8BA 2QBYA 1C1YA 1G1MA 2ZSFA 1NVXQ 2IUUA 4MGYR 4QBGB 4IFEA 2EWWA 1KI1A 3GFPA 4HUTA 1DO2A 4MKIA 2IUTA 1SKQA 1YZLA 2ZSDA 3CPEA 3PENA 2FSGA 1OYYA 3O8DA 4IDPA 5F3WB 4XD7D 3THXA 3KTAB 1VYVA 4TMWA 5CJ2A 3A1UA 2WJJA 2VSOA 4RFVA 3GLGE 2RGNC 2AL7A 4DIEA 4DSOA 4DDTA 4YMUA 1NP6A 1X1RA 3I61A 4RD2A 5BYJA 4B3BA 3NWJA 2JJ1A 3J81k 4B74A 1XMIA 1ZAKA 4JKIA 4LHWA 4PHHA 1NN0A 2GF9A 2ZAMA 4BFUA 2J87A 3TUZC 1E9RA 4M1TA 1OB5A 4ZCMA 4YLGA 4PXAA 1CJKC 3NBYC 1VIAA 4PC3A 3ONWA 4IEIA 3TE6A 5G53C 2VBCA 1PUIA 1TU4A 3FHTA 3AGPA 3TR5A 5H8WA 3CF6R 1SKYB 1G3IA 3TKLA 1Z83A 1AA9A 2ZSEA 1P2UA 4LBZA 2QMHA 3AKCA 5FOVA 2HJGA 2MSDB 2P6RA 5J4LA 3KFXA 2PL3A 2ZI7A 3BXZA 2GXQA 2ZR9A 2QENA 3BC1A 4JJKA 2XB2A 1ZJ6A 2BCJQ 4Q4LA 1Z28A 4OK5A 4TLDA 1GRNA 2CK3A 4GOXA 3CBQA 4LDJA 3EZ2A 2O0KA 2NMVA 4AG5A 3UPUA 3B85A 4K46A 4G5OA 4HZIA 3CKLA 2LWIA 1D8TA 1MKYA 1MO6A 1LVGA 3MLEA 3UG6A 3GPLA 3GFTA 3AF0A 3LBHA 1KHTA 2C95A 4NZYA 4OJKA 3K9HA 4MKHA 1Q3HA 2AWNA 2YNMA 2XZOA 2CE7A 4OHXA 4PZZA 3V9PA 2X2FA 2ZE6A 2C96A 1I4LD 5L3QA 1BMFD 5KHOC 2OSBA 2XAUA 3GJ7A 5DO9A 1MR3F 1UM8A 2PMDA 3KL4A 3U6BA 5DH9A 5BQ5A 2FX3A 1RPZA 2WWFA 2WICA 1XB2A 1OFHA 2VP2A 3BH6A 4I1VA 4A1FA 2ZRNA 4JL6A 1QF9A 4B6FA 1XEWX 2EVWX 5CIWA 1LB1B 3RWMB 2A30A 4MKFA 1CR1A 4JVMA 4PHFA 1XTSA 3GLHE 1MABB 2ZYTX 1E0KA 2EFHB 2BMJA 2HT6A 2JJ2D 4DHEA 1E9SA 1XMVA 4OHVA 3ICQB 2QEQA 4II7A 1P9WA 2CVFA 1P2TA 3PFIA 2FV8A 1MT0A 2WOJA 2H16A 2DY1A 2I3BA 4JL8A 3NKVA 4RD1A 1HYQA 4LZZA 2H57A 3HYRA 4GRAA 5K8UA 1DEKA 4OI0A 3THYA 1ZUHA 3RABA 3UATA 5G40A 2F3RA 2WPDA 2QMEA 3T61A 5JSZA 5DI9A 1GM5A 3QF7A 4C0HA 2J0SA 1M7BA 4TSFA 2ZTSA 4AYWA 4RCZA 5JEDA 1II0A 1AN0A 2NZJA 3UMSA 5KDOA 2YV5A 3NBZC 3SFVA 1KI3A 2PX0A 4KFRA 2JLZA 4GOJA 2WSSA 3IPYA 5DI3B 1SVSA 2IYTA 1Z3IX 5FUWA 1IXZA 2XEXA 3DM5A 1DG3A 1PUJA 3C15C 4KVGA 3UWOA 2JGNA 1OXUA 5FPYA 4AI6A 2ZJBA 2OO7A 4AD8A 4DSNA 1P75A 2RGNA 3BBPA 3CB4A 1U2RA 2AD5A 5GADl 5L3SB 2OV2A 3H0KA 4CEIB 3N2IA 4IFBA 4TTQA 4V03A 5CB6A 1YR7A 2BDTA 3LWNA 3GJ6A 4PO8A 1G8PA 4ZDKA 3EASA 1W0KA 3THOA 4LHVA 2DFLA 3IIKA 1S3GA 3SYKA 1IJEA 3GLFE 1S2MA 3PVSA 3CW2A 4WVFA 4A4DA 3C8UA 1Z63A 3RRNA 4FMDB 5KOYA 3RYTC 4XTCS 3RNLA 3E1SA 3PIRA 5F2EA 1RZ3A 1KY2A 3KXKA 1I4TD 1NBMA 2AD1A 4LSGA 5E4FA 4TZ6A 3MJRA 3THWB 1SXJB 2F55A 4B33A 1XTIA 1IAQA 1HE8B 3A37A 4ZCLA 5TY0A 1XCGB 3I32A 2ZREA 3KXIA 1D2MA 1U8YA 2WZQA 1P62B 1XEXA 4OI4A 2ZITA 4D6PA 3PEVA 3AGQA 4DLRA 4ZPXA 3HU3A 4C7OA 4KFUA 3T15A 2BKUA 4M53A 3MJHA 3HP1A 1KSJA 4LI0A 3LQRA 4JBWA 3CPJB 3IHLA 1KDOA 2XTZA 4I99A 4WA7A 1KI2A 2PT5A 1UADA 1P2VA 4M9SA 2O8BB 4OQXA 1DTSA 5FOSA 3VFDA 4AWXA 3H2YA 4MGIR 1YRAA 3GEHA 2EYUA 1CJTC 5JWOA 4HZUB 4ZDJA 1F2TA 4HLQB 3MWJA 1CJUC 4UNQA 5HE9A 4U02A 1UBFA 1EXMA 1U0LA 3QKUA 1KNXA 1L2TA 1W36D 3TUIC 5J4YA 3U44A 1IY0A 4LPKA 4L15A 1Q1QA 2GETA 4LOAA 5P21A 1DAFA 1ZD9A 2OBLA 3CZPA 5JBQA 4OKSA 1NJGA 2OLKA 1KMHB 3ZVMA 1Z07A 2QZ4A 2ZJ2A 3E2IA 4DDVA 1EFRD 1BYIA 5J4VA 1W49A 2JA1A 2KWIA 3V00A 4WZBE 3PUVA 4Q03A 2HLDD 2PT7A 2RGAA 1Z6YA 1BMFA 4TLCA 3CX8A 5EE3A 2WIAA 2QQEA 4G3XA 1YZUA 4TMTA 2ODEA 4TMKA 2ZRCA 2GEUA 1S9HA 4LC0A 3FMPB 4WZ6A 4RY2A 4WZAE 5L8VA 4BFZA 2GVDC 4CT4B 4TYWA 4TSFD 3R8CA 1UBGA 3TUJC 4KFTA 2P6NA 4LGMA 2V6JA 3SS8A 3TQFA 3LXRA 3VR3A 2AXNA 2UZ3A 4O0MA 4Y0VA 4A2PA 1GOTA 1OT3A 1VECA 4NCHA 3WYAA 3ZQ6A 2FFBA 4ZKEA 1U0HC 4A8JB 2CCJA 4Q4JA 1P72A 4PQYA 5UKDA 5FUXA 3RAPR 5EJEA 1COWD 5TMPA 3K9GA 2ZJAA 2R6AA 1ANKA 1Z8FA 2FGKA 2X8AA 5EUMA 2NO0A 4B3DA 1ZM2A 2OG2A 3KQLA 4C7OB 3Q7QA 3I73A 4YQFA 2Z4RA 4JLOA 1KSHA 2WMNB 3RDPA 1F5NA 4N0EA 2ZRLA 2KE5A 3NH9A 3RS2A 3SBEA 2HYDA 3DMNA 1GFIA 3TSZA 1G21E 3KQKA 4Z1MD 2BM0A 5EE0A 1RKBA 1LF0A 1IN6A 2OZEA 3EA0A 3ZD7A 1GVNB 1RIFA 4AKHA 3P4YA 1T5LA 3AUXA 4M2LA 1VCNA 1R5NA 2AN9A 3FB4A 1E9CA 2ASEA 3AVVA 4TL6A 2O8CB 2XTMA 3IO3A 3ADDA 1XP8A 1VYTA 2JASA 3QKRA 5BYKA 1CRPA 3EX7C 4AKEA 1EFCA 3BORA 2OCYC 1GL6A 1L8QA 1E0AA 1JQLB 1G18A 3L0PA 1RRFA 5DYIA 4KBFA 2G0NA 4GMDA 4GPTA 4DCTA 5DI3A 1U8AA 1KY3A 2B7BA 2ZS8A 4LBWA 4C0KA 4NDZA 4NYIR 1DARA 4B32A 4NL4H 4DXAA 4ZDIA 2VYFA 1IN5A 1Z29A 2J0VA 1E9EA 3WNBA 5HCNA 2V8OA 4C9BA 1DAMA 4BFWA 1QHNA 1QG2A 1AGRA 4BFVA 4D4MA 5E3HA 1M7HA 2ZJZA 1LY1A 3CRRA 3X1ZA 4IOLA 3LX8A 3ZS9A 721PA 1YR6A 3ZD6A 4LV6A 1Z0KA 4JLJA 4A0HA 4KAXA 1US8B 1C9KA 2IUSA 3HWSA 5A5GA 4D25A 4DLTA 1FMJA 2RGBA 4EPRA 8OHMA 3RC8A 2QAJA 1E99A 2NO6A 3ZH9B 1ZMXA 1OB2A 1FNNA 4KJZA 2JJ8A 2KJQA 3F0TA 1WF3A 2BIFA 4JT2A 4LHYA 3MFYA 4B47A 3FDIA 421PA 2ZRIA 3NIBA 4F38A 1KDPA 4JL5A 2YINC 1PJRA 2C99A 3VR5A 3U3RA 4Q1FA 1P5ZB 1XRJA 1EX6A 1FX0A 5FUVA 4L8GA 3QXCA 1KO5A 1R4AA 2GTPA 3MAAC 1W5TA 4QBFA 5KDLA 4E22A 2QAGB 1WXQA 1VG9B 3T06B 5FBWB 2QM8A 3WYFA 2O8BA 1L4YA 2NO1A 1J70A 1M8PA 1Z47A 3CRMA 1BKDR 3ZIAA 4HB3A 2DPXA 2ZU6A 4QHYA 4DLXA 4EFNA 2A3RA 2IK8A 3KUDA 5IF9A 4DT1A 1Y3AA 1E79A 4NKRA 4HLDA 3I5YA 4MDFA 3IPXA 1U9IA 2C9YA 3G82C 1AZTA 5D3MB 4A0GA 3KKMA 2QL6A 3AVUA 1YRBA 5C4GB 2HV8A 4RFSB 5LB4A 3BIFA 1KK0A 4QGHA 1E2GA 4WBSA 2BJVA 1BYUA 1E2QA 2GZAA 3MSXA 3OIYA 2DWOA 2H1LA 4K8OA 3OHMA 1VPLA 3GQBA 3U7GA 1NKTA 2JLSA 1AA3A 4PSKA 1JPJA 1N0VC 1T0JB 2CL7X 2GCOA 2HF9A 2QSZA 1ZM3A 3W3AA 4H9GA 4TL7A 1JXOA 4XWKA 3DEFA 4HB2A 3U6KA 4ASUA 2J9RA 3A1WA 1E2DA 3GEIA 2BBSA 1MO5A 1R6BX 4M9ZA 1ZD8A 5E7JA 4BLSA 2Q9AA 1EFRA 2OT3B 4LJ5A 2QT1A 5EE1A 3W90A 4FWTA 3FKSD 1GITA 4WW0A 3W5JA 4GP6A 4QNRA 1JR6A 1E2EA 2OXCA 2VTKA 5J5CA 2V3CC 1HA3A 3PCRB
chains in the Genus database with same CATH superfamily
2IELA 4ZQFA 3EQ6A 4YRAA 3QQPA 3ZJTA 3DAHA 4AUMA 3K8YA 2J3LA 5HRAA 2J9FA 2Q4OA 1GNSA 5DF1A 4YA6A 4MHTA 1EBUA 1ETUA 1PT9A 1BCSB 1W4RA 3VYUB 3ZE2B 5SY9A 1Z6ZA 3FE2A 5JUWA 3LZDA 4Y2GA 1JJIA 1ZMRA 4J29A 1VJGA 5CXUA 1DHRA 3HN6A 4KIWA 3S2ZA 2XCSB 4YJHB 4WLVA 2NU6B 1RNLA 5DCUA 2B1JA 3IBSA 5A71A 2EGGA 4W5TA 3A3PA 3QLJA 2VYVA 2VDQB 4UUQA 3FMOB 2O3TA 1J5EB 5EP4A 5GGXA 3U2QA 1ZRSA 2JAQA 2WSYB 4ARUA 4FMCB 3RVOA 2GCGA 1UBJS 3ONEA 5DHAA 4DCMA 4Q4AB 1VI6A 4ATNA 5HBGA 5EMLA 5DRYA 4E2WA 1USVA 3OJXA 121PA 3GOQA 3N8IA 1Z8HA 5HDQA 2Y0BA 5EXSA 4BDSA 1U80A 3HSYA 5TJ9A 1X13A 4KBGA 1K3UB 2H63A 5DZSA 2XKBA 5LZ8A 4A3SA 1P2SA 5J63A 3WBKA 4CEJA 3TKYA 1K2WA 3VX4A 2D3WA 3WAJA 1P9OA 1MBZA 2PR2A 2Q29A 3B8HA 3NCHA 4K6HA 3MCVA 1Z16A 4PANA 1VLLA 4CR8A 2YZGA 1PS8A 2V4UA 2JFWA 3EISA 4FUTA 5BSVA 4HPXB 4FWBA 4CQLB 1A69A 2C8JA 5BRJA 2Z5FA 5F78A 2JF0A 4P4SB 5HMMA 4OAOA 3PCTA 4MTLA 3RF7A 1R8SA 4LE1A 3ZWVA 1JPVA 4QUAA 2NVUA 2VG8A 3ANNA 3JALB 4P4GA 4MYCA 5JAQA 5F64A 5DX0A 4FDAA 1VCOA 1GG5A 2GEDA 1KP9A 5C32A 5AVZA 3TRFA 4QDXA 1JLKA 3W0LB 1V5EA 5EJ5A 4ZOAA 4ZALA 4LXHA 1F8UA 1QDUA 1ORRA 3NTUA 4FFBB 1PBTA 2ZKIA 4ETWA 1Z73A 5CB4B 1BOOA 3EK2A 4U7HA 3L0IB 3IVGA 4Q9DA 2WFZA 3CHYA 2FKNA 4C4OA 2R68A 3QUSA 1Z4JA 2X19A 3GEDA 1MH1A 4G4JA 4Q16A 1DC4A 3MT7A 3U16A 3TD2A 3EC7A 1LWNA 4D97A 1JQBA 2B4QA 5F52A 2ANBA 3NATA 1Z6GA 2PD6A 5AW2A 4YRCA 4BFYA 3R76A 4CV0A 4B43A 1UBEA 5TPZD 1T9GR 1PVOA 3WGOA 1C9YA 4TKUA 2VH5R 4QQ8A 3C3JA 4LDRA 4MOWA 4L16A 4QPPA 4Q7KA 4YCJA 5DN6D 4MKXA 2LV8A 2Z8ZA 3IUYA 2YKGA 5J4KA 1KPGA 4TWIA 4L2IB 4CDMA 5CDFE 3ODGA 5LDHA 5F7ZA 3B6ZA 1L5GB 1YKSA 3QEMA 3U3DA 3DE3X 3PNVA 2IHNA 4Q9NA 4ZV4A 1M5UA 3VR6H 1LLQA 4E5YA 4ARZA 3W1EA 3PFNA 3FPCA 3H5RA 4M99A 5I51A 2P9QA 3WXMA 1C9JA 3IP3A 1GTSA 5ESWA 2NU8A 2I2WA 3KSBC 5IAGA 2WIGA 1E4YA 1R3UA 4CLDA 3DMGA 3GRCA 2AYYA 3I9LA 2F9MA 2W83A 2XNJA 3ZOKA 1SCUB 2PLWA 1IMOA 2FZWA 2YFKA 1PKEA 5EEHA 3TLGA 3IAM1 1GPNA 1XNRB 1H6CA 1LSUA 3HSSA 2VXYA 3CWCA 2I76A 2IKSA 4JXKA 3DWFA 1RFGE 4L9SA 4PX3A 3HV2A 5AXDA 3LECA 1QZZA 3FG9A 2HJRA 3CJTA 4CMHA 3CTMA 4M83A 2REBA 3I4CA 2Q0XA 3PDUA 4HAOA 4Y2QA 4F7WA 1BKYA 1FDUA 4PQEA 3TSOA 2QOEA 4EIWA 3A11A 3RRYA 1YOBA 1JKJA 1MB3A 3C5EA 3QXJA 4KP7A 4O2BF 3UYLA 1P0PA 2IZ1A 5C81A 2C2GA 3RQIA 4P9NA 1HE3A 2FPPA 2R1UA 1Q1GA 1OLXA 4FT4A 5JXGA 1GUDA 2BRUA 1HOXA 3Q4GA 4X1IA 3EGDA 2ZP1A 2X77A 1HRDA 2BGRA 4NP6A 5D86A 5TC4A 3WBBA 1ESCA 1ADCA 4N5LA 1K86A 4RPIA 1IZ8A 2XQJA 1CZLA 1L7XA 1B1CA 1JU9A 2FEWB 5A0FA 4NR0A 4UUBA 2G4CA 3IS3A 5H68A 3IR6A 4YRNA 3GUHA 3PC8C 3QNMA 5EHXA 1JG1A 4HQ6A 4EHJA 5CEEA 5CVTA 3DXFA 5AIBA 1XRLA 3OTQA 2XTJA 1QLJA 2O1XA 4EAQA 1TM1E 1LBHA 3UGKA 3G5TA 4GKJB 3OTOB 2VHCA 4AX4A 3EA4A 3MINB 5DBOA 3QXHA 1ZSNA 1E3DA 1M3SA 3REQA 1IDOA 3M1YA 2PTHA 4GX0A 4ZMSA 2P8JA 7MDHA 2GK3A 2X2PA 1E6CA 2AG1A 3MWKA 1S02A 3QIAA 4KDFA 3WJ1A 2IWHA 2G4VA 4CCYB 1XCBA 2CFRA 1R9GA 1JTVA 4I5FA 3VNUA 1UCFA 2JVKA 3AF6A 1FUYB 2BKLA 3X1JA 2HMUA 3ND9A 5BR7A 3B1ZA 4X61A 1DJQA 1EDZA 1X8XA 4IAOA 4LYJA 4R1SA 1E79D 3T7AA 1YZKA 1OZFA 2MYUA 1DCKA 3QPCA 1XF9A 4BFSA 1EKXA 3CLKA 4OFXA 5HF5A 5K03A 4F9GA 2EGUA 2O7RA 4GZLA 3P9SA 1ABBA 3H5AA 4CHGA 2CMGA 3QYFA 1PJ8A 2R7MA 4I8XA 4X8LA 2IDMA 4F45A 3PUWA 1E9FA 3GLUA 4D9HA 3HCPA 1KO7A 1U1EA 2F9FA 2BUBA 4RH0A 3DVLA 1FVFA 5DK4A 2V7QA 4C20A 4X60A 4G89A 4ILEA 4AJ4A 1RC1A 3EZNA 2LPMA 2ZRFA 3F47A 3IAXA 4NEQA 2O9JA 1H2HA 1SUFA 2NVOA 1SVUA 5AJWA 3L0DA 2W5UA 3U7HB 3DXZA 3HI6A 1ZN9A 3I72A 4EHFA 1J9ZA 3R5XA 1M6YA 1V45E 5JPCA 2TYSB 1U7PA 1ZOOA 1GQYA 1T9CA 1SBZA 1U7TA 1SBIA 4HN4B 3JZMA 4IGEA 4Q37A 2QJFA 4FD3A 1L8LA 1PFGA 3KYCA 3L82B 1SC3A 1H5UA 1OH5A 3E22A 4GXTA 3VTFA 4G2TA 4FKMA 4B3FX 2PWYA 5LA6A 4LXTA 4Q34A 2O5CA 3ZLTA 1V7PC 3UCFA 4I50F 3FFAA 3G0DA 2GKGA 4H17A 4DDWA 4EITA 4Q1EA 1JL3A 5ECYA 4ER7A 2QXTA 4HOYA 4UTZA 4OX9Y 3ORSA 4R5HA 3M4ZA 2B1RA 2CEAA 1JXAA 3ESXA 4KQIA 3T5CA 3RLIA 4B09A 1R64A 1UEJA 4ADSG 1VP3A 4F92B 1EWVA 2RGDA 3I2YX 1OILA 1FP2A 4Y9SA 5JPIA 1JHYA 1XTJA 3NAGA 1LLDA 5HJ5A 1ZA2A 3U7JA 5FH9A 5L45A 4GI7A 4TTPA 1IQ0A 2ZAYA 1VGQA 4O0LA 4O1IA 2C88A 2YDYA 2JLCA 2WJWA 4A8PA 2HJHA 2N3ZA 1N2IA 4PPYA 4D9GA 5IN4A 3BHJA 1T5DX 3K1AB 1E63A 1LXCA 3V1UA 3ICWA 3BWMA 1SCJA 5HGJA 3WG9A 3N6RA 5KOIA 3HXMA 2J5XA 3IB3A 4FFSA 4WL0A 3UT6A 3K8ZA 2BGIA 3ET5A 1JEDA 5BV2P 4NMMA 1U65A 3DM9B 1VG8A 4GPAA 2OCXA 1W85B 4LUCA 1VCIA 3W8NA 4AO6A 1SC9A 4WN3A 3N05A 5C7LO 3CCCA 3E15A 1M0SA 1TAGA 2AMLA 3UT5B 1O96B 4M54A 4G97A 3RYHB 5JYEA 2OY0A 1GEGA 2CUTA 3FGZA 3P26A 4G4SP 3BSFA 4J9VA 4F93B 1TJ3A 4XTRA 4AWAA 1GY8A 4RVUA 2VJNA 4HFJA 3BMNB 4BQFA 1CUSA 3FCOA 1PJTA 1HI9A 1P3DA 4OQDA 4WXPA 1WD5A 4BLWA 2GVNA 4HP8A 2ERXA 4PICA 3OCVA 4K6GA 3WVNA 4JZKA 4HWPA 1AQYA 1XEFA 2NUTA 3DR5A 3JRXA 4XXHA 3EPHA 1SD1A 2ZGVA 3LCRA 4L4UA 3LUCA 4LDQA 1L5FA 1XX6A 1YNOA 1PUXA 2HA2A 2RB5A 4H27A 4BMSA 1J22A 2A59A 1OI4A 5EWMB 4B83A 2B3DA 2IPLA 3EDMA 4XB1A 1E3TA 3A0UA 3I8SA 3B89A 2JIDA 5HFJA 1CUDA 1U5BA 2X2EA 3MOIA 1XT6A 1V8OA 3IEMA 4BX8A 1G2PA 1TCVA 1TF7A 4YHBA 4EYGA 1LFAA 5ICMA 2IOFK 4GL2A 2H1VA 4LY9A 1DRKA 2C7PA 1NJ2A 1N7HA 5ALYA 4LSMA 4S1NA 3RSOA 2RSLA 1LJ8A 1E92A 1QG6A 4FYJA 5KSWB 5KQRA 1DBPA 4I8IA 4MVXA 4H35A 4UPEA 2Y2VA 1L8OA 4LY6A 4HYYA 1N2BA 4E3WA 2JAXA 4ZQIA 1OLUB 1P7CA 4HDOB 4QUEA 3OTHA 4KC0A 1YJXA 1ZO8A 2HPHA 4TLBA 1Z6TA 1Y1LA 1PBNA 2F43A 2VPXA 2SECE 1NI5A 1VKZA 4BMPB 4TZ0A 1HRKA 1Z13A 3BMQA 5GP1A 5B58T 3V4FA 1WCIB 5HKLA 3QUCA 4MA4A 3ZHBA 4GRIA 1S7GA 4ZKDA 1ZJJA 1YQXA 4RMGA 5B3AA 1YVDA 4MA5A 5JLJA 3P9RA 1D4OA 3IEUA 4GWGA 1OGJA 5BOVA 5K2OA 2RKOA 4UMVA 2ASVA 4BGDA 1H5QA 2BONA 3FIJA 5CXSA 2IBMA 3VU0A 1QPBA 1CHDA 2XKAA 3SM3A 3WAKA 2XMPA 5U4QA 1WUYA 5TXGA 4ZVRA 5CT6A 2WFAA 3WP1B 2F1RA 4E5VA 4S1WA 1EVYA 1UL1X 2DJ5A 2FWJA 4HNTA 4BNWA 4XLLA 5AJHA 2AK2A 5LP6B 3SOOA 3CVUA 4AS3A 4M36A 5JLAA 2FSIA 2IOQA 3UZUA 4CIXA 1X1SA 1GQRA 2PRYA 3CRQA 3C6MA 4KWIA 4UHJA 4YLYA 5E6RB 2HRZA 1JBKA 5CR9A 2J08A 3IE2A 4KMOA 1RRCA 1KO1A 5DN6A 4ARAA 5ILGA 2WAYA 4EDHA 2C9MA 5ALPA 4BO6A 1QQ5A 3TGPA 2FFAA 2WR8A 2WVAA 4PFKA 1KI7A 4FX2A 4M9XA 2J3JA 1G7SA 1RJ9B 2JNWA 4E51A 4YDRA 4FXPA 2QTHA 1D2AA 1HV8A 1SQ5A 4CZ2A 4PNZA 1R8QA 4KCGA 4GYYA 4QDUA 3OU6A 1JN0A 2IHZA 3MF4A 3R5KA 2YBDA 3OKAA 4B80A 2ZYDA 1VSBA 1Z45A 1NUTA 1XRRA 5D6OA 1JS1X 4G23A 5K3AA 1H8HD 4V0NA 1N8KA 2X1VA 3ZD9A 3C1AA 3KJXA 1Q7BA 2RI0A 4CM3A 5B7GA 1TKBA 1RI2A 2G9VA 3ROPA 4IXTA 5ECGC 1ULUA 1DBIA 2Q9CA 4FDMA 3WP0A 1ESMA 3G1TA 1DG1G 2REQB 5JJBA 1HMYA 4JT9A 2XJ9A 3GLIE 2M1XA 5AK4A 2BF7A 4DLUA 3NEYA 5DM1A 1WE2A 5H59A 3G2QA 4FE3A 3QE0A 1UMDA 2BGMA 1B1AA 2H85A 2E18A 3QI2A 3S2SA 1WPXA 3T7RA 4XRRA 1M6WA 2N42A 2OAGA 2A92A 1C30B 2QR3A 1EGMB 3EXIA 3GG2A 4LQDA 1G8KA 4R1UA 4W8HA 3UBMA 3B36A 3W5UA 4UHDA 5CB0A 2IEGA 3R7FA 2E4UA 2H6EA 1K8RA 4EW6A 1QTNA 1ZGJA 2ZFUA 4ZTBA 3VGPA 1H93A 2Q2NA 1HQCA 3KT8A 1A82A 1WZCA 1PV1A 1XNJA 2G17A 2O0LA 2QS9A 2ZVDA 5HIKA 4ZYLA 2JCYA 4ZIRB 4Z2YA 2GEVA 2IS6A 2O8DA 2RI6A 4R51A 1T9GS 4JYMA 4A8JC 1OH8A 2DUMA 2XLCA 3BD9A 2PNFA 1H2ZA 2UUPA 2PV0A 1MN6A 2G6TA 2ACKA 3AL2A 1XTQA 1ECLA 2IZOA 2LDBA 3NHUA 4IH1A 2C54A 3SF8B 4F72A 3TLKA 3IL2A 5CNIA 3TW8A 4O2BA 5J4HA 4B2IA 2IYAA 4TWZA 1U3TA 1PWHA 1QGUA 2GDJA 3H05A 1B3RA 4X8OA 2X9LA 4XGNA 4AZVA 1CJSA 4EUNA 4TYYA 2X23A 4DYHA 1U1IA 4AYXA 1U0JA 2ATEA 3DULA 3QKSB 4TXHA 3ZX4A 4TT3D 1CDEA 3URKA 4CMAA 2W6NA 1RC0A 1ST2A 4JGBA 1Z5WA 4KX3A 3RARA 3PUXA 3LT2A 4DADA 4BE7B 1WO8A 2XYHA 1C7IA 2XCIA 4R8RA 1YASA 2FETA 2OHXA 2VWGA 3M34A 5EGNA 2HIGA 3NRCA 3G9ZA 4IMIB 2CLIB 2DC1A 6GPBA 4G8BA 3CVOA 3H2GA 4LJ8A 1RM5A 5EZYA 1W36B 1ECFA 5EHGA 4U5QA 2OPHA 1FDIA 1OVGA 3DE7X 1KF0A 4JIMA 3V97A 1ZS9A 3QVGA 3AZQA 1SBNE 3LVRE 5AMXA 1VA5A 4CUKA 5HS4A 2ZTMA 1L0BA 4JSTA 3BK2A 4OK6A 1IEVA 3DQPA 1B16A 2A78A 5GZ6A 4BU0A 1UPAA 3O92A 4EJSB 2XE7A 5FEMA 4R1TA 4QIHA 4RSRA 3DT9A 3MXTA 1AF7A 1WW2A 2K2QB 1X7XB 1YRHA 4UOQA 3RSGA 3T94A 5CLJA 1DL5A 3JD0A 3F9RA 3IMKA 3GUVA 1NLYA 4TMYA 4QU0A 4MO9A 3NBFA 5F9MA 3RU3A 1ZR2A 3JRNA 1R6VA 2XXBA 1IHXA 2O1SA 5IAEA 4F3TA 4LXYA 5YASA 1XI2A 2VN8A 4KQWA 1ZUNA 4UE3S 16PKA 2BMVA 1GUBA 2R11A 1RDFA 5AICA 3C3XA 3PEUA 4J43A 4DXDA 3WHIA 5IDXA 3NG1A 4UUNA 1JB9A 4WESB 2ZETA 5EY5B 2H1SA 4HSGA 4Y8VA 5ARDA 2W2OA 5KVQA 4ZOCA 1A7JA 4YCAA 4OGFA 5JW6A 3JQEA 3H83A 5D3ZA 5IXSA 1CSEE 3X1YA 2QG9A 2D1YA 4KSBA 2EKZA 1YRYE 2CJWB 4RK1A 5FBKA 2QRKA 3QF4A 3F9CA 5BMVA 1TF2A 2ZXFA 4LF4B 5ITZB 5KYXA 3PRHA 3ZY5A 2XXAB 3TNFA 2PSDA 3FCYA 3BRWD 4TOIA 3U7QB 1V6SA 4MRMB 1OXMA 9LDTA 2GBLA 4WADA 1B2RA 3IX7A 4DBVO 4Z6KA 1Q20A 1O9BA 5GJCA 2JGMA 2F4VB 1LRLA 1DQYA 1K2VN 3NBUA 3DOJA 2BFAA 1QG0A 3NW9A 1FUUA 4YASA 4MH0R 5IKOA 1AO0A 4QTXA 2OHVA 3FSJX 2FI1A 4H16A 4GEGA 5KJEA 4DIBA 4F6CA 5JASA 5DOVA 4JLBA 2HA7A 5DSZA 3PE4A 4UUMA 3E35A 3STHA 2B4KA 5JSFA 1UT5A 3HB5X 1WDLA 3V7YA 3CX6A 5SZKB 1T4GA 4X24A 5DU2A 1DAGA 3AFNA 4UJ3A 5DNUA 1XWIA 1YVEI 4IJVA 4LEIA 2A9QA 2PU5A 3JCZA 5KSOA 3FHLA 5A9TA 3CLSC 2RHRA 3D4PA 5HQTA 1RXWA 2JFNA 3P20A 4PU0A 3AUSA 2CDCA 3STYA 2W48A 3AKYA 3GYGA 1BRMA 2IXEA 4HNAB 1JJVA 4H18A 1O1YA 1D0IA 1PW5A 2BW0A 4G5QA 1YBMA 2OCAA 4CCSA 1UXHA 5K09A 2DHDA 4DIKA 5MGBA 1U9IC 3IMFA 1R4MA 1I51A 1WKVA 4G1CA 1CP2A 2EARA 2YN0A 4JBNA 2C1ZA 2QW1A 2QTZA 1G7TA 4F6RA 5DP1A 4IOKA 2GO7A 1RMQA 3DFIA 2WE8A 3F74A 1YBAA 3MN1A 3TW6A 3GLFB 4LJRA 2HRDA 2H0AA 4M8NE 2IYYA 5EI5A 2ORIA 5E7IA 3WMWA 1FB5A 1Y6RA 3AM4A 5D2CA 4ZRDA 1L4BA 1KL7A 3QRWA 3R5TA 4AZ0B 2VSXA 4PZLA 3WLSA 3KJGA 4H7FA 3QE9Y 4DB2A 4O63O 1BQ4A 3ZW9A 1EJ0A 3KQOA 4ZREA 3CN7A 3GB9A 2ZIFA 1GLVA 1NPYA 2VSYA 4JBYA 4KWHA 2B7LA 2HBQA 3QBTA 4N8DA 3ZS8A 4MR7B 4MV6A 1TZJA 5TRTA 4PLFA 1T35A 1NMZA 1SVMA 1PL8A 3BFPA 4JYAB 1J8QA 1I94B 1G20A 3E18A 3QJGA 5DOZA 1K6MA 3LH5A 5KB3A 1N34B 3MMXA 2YVLA 2Z5VA 4NBWA 2X3UA 3THSA 3RVJA 1C4WA 2WIJA 4H4DA 4J3FA 1WUIS 1VL2A 2A88A 2IXTA 3ONVA 2P2GA 5C8ZA 1HNNA 2EDCA 3H2IA 1ZH0A 1E8NA 2A0YA 2C5FA 2BI8A 1ISIA 2C2KA 5KC8A 3ADKA 3FOCA 2XIQA 1C30A 3TOZA 2WTEA 4KN8A 3VO1A 1Q83A 3IVMA 5ALVA 3IBYA 1Y3HA 3C16C 2HF7A 2JW5A 3OHPA 4G1MB 3U3JA 3R0IA 3JX9A 2I2XB 5AUQA 2ZRBA 1A3CA 1T6ZA 3D7NA 1IIRA 1SA0B 3CIFA 4FZJA 5EXDA 3DTTA 3WK9A 2UYOA 2REXB 4NHEA 1N33B 4P36A 5JSHA 3VO2A 1XOIA 5C4MA 5JCJA 4S1OA 3REOA 2VUSA 3EARA 3SZGA 1X9GA 2XTNA 4YYZA 3K32A 1XZGA 5AVVA 3EGWA 4WZAB 3ZK8A 4D82A 3QELA 4QTYA 3EUAA 1EAMA 4QLOA 4J3NA 2CKDA 3IGFA 4DSUA 3E70C 3UA3A 1N2EA 2ZVPX 4FUQA 1R5JA 3M3PA 3ZJ5A 1GRRA 2XA1A 1TJ5A 3ZK7A 3T4PA 2RHLA 3P94A 3Q7TA 1FNMA 2YHAA 2ZVQX 1IHYA 1USWA 2OGUA 2R8ZA 5T67A 3C48A 4GPZA 1G38A 4NYIQ 3GZJA 4MWGA 4UMDA 4BY9E 4Z9XA 3IV9A 1QO9A 3GAAA 1IOZA 3SZUA 3TMKA 4ENPA 5CA1A 1NYTA 2CLOB 3KKKA 2YL2A 1MNAA 4RWZA 4BB5A 1E4VA 5ERXA 1VKRA 2Z95A 2X0KA 3AV3A 4AQDA 3DL7A 2CXHA 4XM1A 4JC4A 1IBMB 5DPMA 4LVNA 2UZ4A 1PGPA 1Y4DE 3RTCA 3THWA 4PZYA 1X1EA 2HZBA 3EVFA 3VJMA 2HFKA 3CRVA 2NTVA 2OFPA 5DBGA 4BNKA 4DY4A 9GPBA 3B13B 5FQNA 2WJYA 3TSCA 2VI5A 3PF9A 5J3JA 2ZANA 3ADBA 3HCOA 2ZI6A 3AUYA 1NQUA 1QO0D 1V71A 1SZDA 2B0CA 2HNAA 3EDCA 3D3KA 4MWTA 4XIFA 5I8ZA 1E5XA 4D9NA 1X7ZA 4F8EA 5CTAA 4ZI7A 4I7EA 1IBCA 5D6NA 3PLNA 3DWEX 1TL7C 2AZXA 4L6IA 1SOMA 1PFKA 3PYXA 3AERA 4CQMA 1IQRA 1UOOA 3OJEA 2PUTA 3HBMA 3JZIA 3NHFA 2WV7A 3KUKA 2ZBVA 2P2CA 1QGOA 3PJRA 2R5FA 5JVDF 3MTIA 3ZXXA 4CR7A 1GXSB 1OX6A 3LV8A 4RVSA 3BS4A 2FUNB 3IP6A 3OIFA 1DI0A 1SQSA 2WUDA 3JVEA 3ZBPA 3BE4A 4DZZA 1YQGA 4NNOA 4D9BA 3HJBA 2C58A 5AM2A 5L4LA 3DDSA 1EK6A 2CJWA 4X7RA 1AVTA 3HXLA 4H3KB 3O38A 2O8FB 2A1TS 4DZRA 2DLNA 4D0NA 4O59O 4ECEA 4J9UE 2IQ5A 1JSLA 3O7WA 3ZVKA 4QLBA 4J0KA 4YV1A 4QOIA 1OXBB 3SZMA 4C0SA 1MD9A 4BJHB 5I01A 2AOTB 5ED4A 2AYXA 3JQ9A 1E3WB 3NETA 1U8ZA 4RSGA 3TX2A 1ADJA 4J3JA 2IHBA 3NHMA 4PVDA 5C8DA 3VPBA 3UVEA 4C6TB 2VDRB 2XZTA 1SG0A 1DC8A 3LHDA 5FCDA 3R3SA 4ITUA 3UJHA 5JD5A 3VXKA 3CUYA 1B43A 3WR5A 3L6BA 1IVSA 2Z2YA 3AEQA 1A4UA 4ISCA 4A2QA 3KR1A 1QZXA 2X2OA 1EVKA 3AF2A 3HPQA 3ZWXA 4RIIA 2YQ5A 2IV7A 3PUZA 1Z06A 5JXJA 1RTKA 3BMNA 3HVIA 4GMHA 4M98A 2DR2A 4AS1A 4DMLA 4QUDA 4RTJA 1Y1PA 1B6RA 1TQ2A 5LD2B 1YRWA 5FBVB 3LVFO 2P1DA 2B0JA 1AQLA 2XUKA 4G8CA 4R31A 2WUGA 3GCDA 5TMBA 3D2LA 2AKYA 4PRZA 4IHKA 2E9SA 2MYNA 4YR7A 4FR5A 3AXSA 4LHSA 2XYPA 4KRGA 2ZRDA 1YS2X 3B78A 2BMDA 1K8QA 4NCJA 1C3OB 4XJVA 1BGXT 3KJFA 1AXEA 1QAMA 2V0CA 3C8DA 2DBYA 1UOEA 3FYDA 2VJPA 2CNDA 3G68A 3HY6A 2OFFA 3UKOA 1JR3D 1AZWA 3AI3A 4U2DA 1MT3A 2H54A 2ZSJA 4HV4A 1E3MA 4OSOA 5BXQC 1AQUA 1R66A 1UKEA 2DHRA 4D42A 4PO3X 1WM1A 3PDHA 1M8JA 1SQ0A 2IF0A 3VTKA 5SZIA 1B0PA 4W7IA 1HDIA 2XHEA 2VFAA 3QQ5A 3B48A 1LFDB 3RUAA 1VPEA 2VOJA 3JPWA 5JHGB 4AJ2A 1GRQA 2NAFA 4OM7A 4D79A 2WEKA 1RQ7A 2BEVB 5GIPE 2VOEA 2O2SA 3DL0A 5K3FB 3Q98A 5KYWB 2GYWA 2UVDA 4R7TA 4NCBA 2NTJA 3NYRA 4UVIA 1WBDA 1OR8A 1EK1A 3CO0S 5G0TA 1K98A 5D00A 5HDBB 1K6JA 2NM0A 5IUNC 4XWWA 1NRXA 1O9HA 3PPYA 1LV8A 2HWWA 2VK1A 2X7HA 1CC1S 1RQGA 2V7VA 2VAWA 2C7BA 3OCXA 5B2ZA 2PA0A 6AT1A 5JYDA 4O4IB 3GEBA 3NTQA 1AK9A 4JS0A 4U7GA 2PD3A 4JA0A 4HK4A 1NBWB 1Z6XA 1JGTA 1RADA 4LYAA 3VYVA 1RBZA 2OV1A 4I14A 1SUPA 2B8EA 4QFBA 3SGLA 2NNWB 4RANA 3M6AA 2OCLA 1G9XA 1EK5A 3RUPA 3FKSA 1P1RA 1ZXLA 3K20A 1PG0A 3WZ2A 4CIDA 1J90A 3RIHA 3F78A 4BV3A 1DC6A 1T4CA 1P5FA 2XEDA 2Q5JA 2WWHA 4Y2JA 1FX0B 3IIIA 3N0VA 3R7BA 4B34A 5ESRA 4EG6A 5IKXA 3UWKA 5FO0A 1AA6A 1E59A 1A9XA 2FF5A 3NLLA 2I03A 3AJ8A 4UCFA 2FVYA 2V4MA 1KXZA 1VGVA 2QLNA 3OAAA 1N9GB 2JFHA 3F3YA 3AFGA 4MVCA 3RI3A 4ENQA 3MD0A 3DZDA 5FWNA 4DR6B 1JW9B 1ICIA 1JR2A 2O2YA 3NONA 4IZHA 4US1R 2DFPA 2MSCB 2YV3A 3C8ZA 4LW8A 4X8HA 5DWDA 4RVNA 2G3YA 4PLWA 4UVGA 4BO3A 2GQ0A 4M4SA 4WERA 3UMJA 1PV4A 4RV5A 2TS1A 1BU8A 2QLMA 5I5EA 3LPCA 1N6KA 4FMPA 4R8KA 2BHRA 2Q4DA 2WAAA 3JYLA 4REQB 1G20E 1RI3A 2H48A 3P9CA 4HJRA 1GU7A 1SELA 1U3GA 3CLRC 4XIGS 4EYSA 3WXBA 4URWR 4YMLA 3INGA 2D4AA 2VUUA 2YC2C 3A05A 4ZANA 5A9RA 2NPOA 3K9FC 4MV8A 1G8JA 3H3JA 1V16B 3H87A 3IQHX 1BRTA 1MB4A 1NZFA 4JYPA 3ES9A 2YHSA 4NG5A 1J6UA 1XD9A 2QQFA 2JL1A 3S55A 1A1VA 3E53A 4L28A 2XLBA 2W43A 4OO3A 4EW2A 1FFXA 1W34A 1WMDA 5BYAA 4X63A 5IBPA 3QNUA 4HAVA 1SUEA 2CHGA 3DF9A 4QC2A 2A5DA 3LO5A 1JIVA 1UC4B 1EJ6A 4BNXA 4TRRA 3EFEA 2RH9B 1J00A 3C6BA 5AT1A 2BSXA 3GNLA 3ZDRA 1GPYA 2OESA 1VHQA 2GBPA 4G1EB 3N2KA 3VR4D 1KYZA 3H19A 4OLAA 1VIYA 2CVPA 1ZWKA 4OHOA 3TW4A 2YMQA 3NHJA 2ID9A 3LWZA 4HQOA 1KAGA 3HYSA 4UNNA 4JMPA 4L75A 1FUKA 1GGNA 3O7MA 3EPJA 1PCXA 3DAPA 5CGZA 2Q41A 4YRQA 5KTNA 3ABOB 1NNEA 2GKSA 3D6TB 4U39A 5FBQB 5L40A 1I32A 1KVRA 3W2FA 4F06A 5ALNA 1JEQB 2GN9A 3A3OA 3W77A 4DQDA 1MMFB 4MV7A 4YMTA 1NBHA 1KTIA 1P6XA 1B23P 4DIMA 4EEXA 1NFRA 2JCXA 4ZQGA 3KNZA 2IPAB 4HUQB 4OQNA 1JSRA 4C4PA 2V3VA 3IB6A 1CU1A 4QXAA 2ZJ5A 4JKYA 3W5AA 3D6AA 2NXJA 1NWHA 1W9MA 4MYTA 1TJYA 4RH1A 1TUIA 5B6JA 5C8YB 5B3JA 4IDHA 4URUR 2ZIWB 3KUXA 4O3MA 5K0NA 1G5RA 1N6PA 1P31A 1QKKA 3RGWS 3DTYA 4PHCA 2ZBRA 2QLBA 1YS7A 1O4VA 2J1LA 3GFRA 4XYGA 5H02A 3KJZA 4AK9A 4BO0A 4EHIA 1JDJA 3GBSA 1NJFA 1BD3A 4D9EA 3RJZA 3HVJA 1KEUA 1QHGA 1P4AA 1XU9A 4UU1A 1R0XA 3AYXB 2XUAA 1IM5A 4G86A 5ALZA 5I7FA 1V2HE 2IYPA 2JRCA 1QV7A 1VLJA 1QIKA 3KLBA 4QU8A 2O2JA 3G5UA 1OV6A 1PJLA 2DT8A 3A2NA 4MQMA 4WK6A 1ZU4A 4G1UC 2IEIA 1TLFA 2O6HA 3NAQA 2ZI9A 2WF6A 3E84A 3P32A 4RPKA 4RX1A 5EXPA 5AVKA 4LF5B 2YQZA 4U00A 2A9JA 2HO5A 4NJMA 5C1IA 7REQA 4P7KA 1PR9A 4QGAA 5K3FA 3QPVA 4C03A 2HB6A 2W93A 1RBQA 2QP3A 4HQNA 1RQNA 3H0EA 3PYLA 3TZKA 1UZLA 1RRVA 2GZDA 1HC7A 1ORTA 4BX2A 2G7ZA 1CJBA 1MC1A 4F3KA 1GJRA 1JILA 1FDVA 3KVYA 3F3SA 4N01A 4O4IA 1BMDA 1JEOA 1N9GA 2X5XA 1XL0A 1LNSA 4EELA 5BMVB 2E4WA 1QLWA 1NVUQ 1FRVA 2FNAA 1Z2CA 5REQB 2G1KA 2L2QA 3QVUA 5FI1B 1ID8A 3I8OA 4IMPA 1PNRA 3MC1A 3DV9A 1TD9A 2KHZA 4LCBA 4XYEA 5IC4A 1DELA 2EEZA 2PVPA 1O3YA 2GZSA 4HWKA 5F3RA 1U7WA 5FR2A 1VJ0A 1TVEA 1OI7A 1MJNA 3RUCA 1OIVA 5E1OA 3ZGNA 2EEPA 1T5IA 2H52A 2NO9A 3EVBA 2I8CA 3OUZA 3Q3EA 1SUIA 1TEXA 4R9NA 5HUJA 5IJ9B 1QHEA 4ZK2A 5C37A 2AFVA 5DHSA 1YBVA 2KQUA 4OFZA 4RDCA 3ZLJA 3NDJA 3PHGA 2PWPA 1NQAO 1DC5A 2K4MA 1R2QA 1A9QA 5BORA 1MJGA 1G20B 3P0FA 4QPZA 1JV2B 2F6RA 2P5SA 3DL4A 3M9XA 3LHIA 1APBA 2ZTHA 1PSDA 2HHAA 2QYOA 4Y3UA 3TOCA 1FFDA 4JJZA 4LXXA 4M9CA 5IT9A 4IEFB 4P33A 5EIAA 1N2XA 1X8KA 4IMRA 2CNWA 2UXBB 1O8BA 1RI1A 2PS3A 1E2LA 3L18A 1DUVG 5EE3A 13PKA 3FTFA 1SXJC 1FYXA 5JDCA 5JS7A 3FY4A 4G0NA 1GPLA 2X6RA 2CLKB 2CCKA 5A5EA 2V9PA 3PVZA 1XNHA 4RTKA 4GNKA 3C5CA 3T8YA 3DP7A 4EATA 2ZWOA 4WNAB 4YBZA 3TG2A 2ZJ6A 1O97D 4KGVA 2VVTA 4LYYA 5D3KA 3GLFA 3I64A 1O8CA 1POXA 3GBVA 2J0SA 1A9PA 2G8LA 2FG5A 4L4ZA 5HJ7A 4XQCA 3WL4A 1XTRA 4GAEA 2QN3A 4ZVSA 3W4JA 4EY8A 1R15A 1UZMA 3N2KB 2D1SA 4ROTA 3V8EA 4UQLA 3ZGZA 1YONA 4AW9A 5EJ9A 1TJ4A 2IVZA 1CUFA 3PZBA 2QTNA 1NFQA 3IQXA 4PWYA 1UZAA 4BBJA 4FX5A 4LTNA 4LGVA 3CY6A 1BJTA 4C43A 2HSGA 5E7QA 1H1LB 2YOFA 1J99A 2WF9A 3Q8MA 1FTGA 4I55F 2NYAA 1L1FA 4ZYXA 4ZAWA 3ACDA 3H2JA 3RS4A 4HUJA 3ZBUA 1FUIA 2ZUSA 2HHJA 3KPWA 2QRZA 2PUCA 1U98A 3PPWA 1E4EB 1MQ8B 2ONZA 2O4CA 4C6HA 5JIBA 1WV1A 4TUYA 3N3AC 4QBKA 4AUEA 5JNWA 5ALHA 5JS8A 2C57A 3SC2B 2XDWA 3LW7A 3TXXA 1NX6A 2IIQA 3FDZA 4G01B 3D6NB 2DETA 3K6SB 2H59A 1WU8A 3B5EA 3LM8A 1E4OA 4HZUA 4A0QA 4YRIA 2AS0A 3QSYA 4HLUC 5FHQA 2ZJOA 1NUUA 2Z8XA 1W19A 4OP3A 1QQ6A 3DW3X 3I45A 2ZBQA 2D2EA 2ZU0C 2FXVA 2J31A 5J2UB 3M3HA 1GNPA 1ML3A 4UXHA 5AKIA 2J67A 4TT3A 5J1TB 4LXIA 8ABPA 3ZJVA 3CSDA 4KXVA 4HYEA 1JLLB 3F96A 3G5AA 2FDRA 4POAA 1GV1A 3DBLB 2AR0A 2GR9A 4LDZA 5C3UA 1NXWA 3V32A 5K0ZA 4J2OA 3S99A 2BBWA 1XTVA 1XD2A 3S1AA 4R2IA 4EY6A 1VRWA 1KYVA 1Z0AA 2LDXA 3CS3A 4ARZB 4FFDA 1YDGA 3KQUA 4FFOA 4TLAA 2VPYA 5BSFA 4RJLA 1QOZA 2JIOA 4ZA2A 3RV3A 2PX2A 1CIVA 1RWWA 1W0CA 3TQSA 1Z2AA 2OGZA 3GFOA 4TM7A 2VCYA 2FAXA 5M04A 4X95A 1TTTA 1P9LA 1CXZA 2Y77A 4XOUA 1GKYA 2B20A 1KZHA 5I45A 1S2NA 3M8KA 2RFLA 3SI7A 1WP9A 3WIUA 4QXQA 4DLNA 1B2LA 1VC2A 2EFGA 1EHCA 3OFNA 2E1PA 4CXMA 1K7FB 4JP3A 4C0WA 4DJ5X 5E4JA 1JFTA 4OJMX 1KJYA 2AMYA 3K8QA 4XR4A 1Z5PA 3BCSA 3DTVB 1SEVA 3IAAA 1X1AA 2IHYA 1NF3A 2ZSAA 4YRKA 3CZ9A 3AQ4A 1SG9A 4YJ2B 1A2BA 1C1XA 1H0RA 4H0CA 4C89A 2RIRA 4MZDA 2RGWA 4PLCA 4D9FA 2YJ4A 3CH5A 1QNFA 1KVUA 221PA 2XCQA 4D99A 2X9NA 3G9XA