4PPGA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-br
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
329
structure length
311
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 96
structure length 311
sequence length 329
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppgA01
4MKFA 1FUKA 2RGGA 3QBVA 4ACBA 2QGNA 3GEIA 3KJEA 3TQCA 3LA6A 2PZEA 1KJZA 1EFUA 1MT0A 4HYYA 1W7AA 2F3RA 3CM0A 2QUZA 3TGPA 4QM6A 5JWOA 4ZDWA 2XB2A 3QI2A 4LOAA 5C4MA 4JLVA 2QY9A 3NIBA 2Z6VA 5LPNA 1PV4A 1OIXA 1IOZA 4L15A 2J46A 2ODEA 4LPKA 2IXFA 2D3WA 4URYR 3T1QA 4UNRA 1VCMA 3B2EA 2IK8A 5KOYA 3ZQ6A 2CHQA 1CR1A 1S8FA 3EXAA 1E3MA 2PL3A 3NBZC 3PUZA 2O8CA 1ZAKA 4JLPA 1HT1E 3I61A 4LWZA 1J99A 1AM4D 2ZYUX 3AVTA 1ZVQA 5G40A 1P4SA 2R6DA 2IYTA 5CM8B 2ZRPA 1W36C 2UZ3A 4ZIRB 4KCGA 1NN0A 2P5SA 2ZS8A 1X1RA 1XX6A 4DC9A 1IXZA 2NIPA 4QM7A 3U7GA 1US8A 4X8MA 4PSAA 3RS2A 2J41A 4Q7JB 1SVMA 2GXSA 4PXAA 5DYIA 2NO7A 4E09A 1R5BA 2ZJ2A 1HYQA 5BXQC 3GD7A 1YJ5A 4E03A 3VNUA 4I1OA 1UKVY 2F1HA 1JEDA 1E2GA 3A4LA 4ZI2A 4LJ5A 1P2TA 2XTNA 3QXJA 4MYTA 1VKJA 4XSGA 4W5HA 2ZR7A 1V43A 3KQKA 3B82A 4B3BA 4EPXA 1OLOA 3L43A 4DLYA 3N70A 4LUCA 2C78A 4BE7B 1NIJA 2Q6TA 2A78A 5HKKD 1DAKA 5GJVC 2ZETA 4BZXA 1T5LA 2GXAA 3QKUA 5G3YA 5IRCD 2Q3MA 1F6BA 2AXPA 3K0SA 1RVDA 1ZYUA 2XJ4A 1ETUA 5JJLA 1E79A 3BH7A 2ZI6A 3DVLA 4NCJA 5DYGA 1L4YA 2OFXA 4KAXA 4Q1DA 2ZRLA 3EA5A 5BQ5A 4BPBA 1P6XA 2XZLA 4JLDA 4HAWA 1S0UA 1FPMA 2ZITA 2BJWA 5G53C 1Q1BA 4D4KA 5HE8A 3W6PA 2UZIR 5K8TA 4Q5IA 3B6EA 3PXGA 2JJ8A 3A1TA 3WHKA 4EFMA 2WSSD 2OT3B 3SN6A 4AD8A 3SJBA 1TTTA 1T3LA 3LBNA 5ANRB 3GLFE 1F5NA 2HT1A 3PEYA 2FN4A 1DE0A 1A4RA 2AK3A 4L5BA 1JXMA 2ZANA 4GMXA 4D4JA 1G5PA 3AB3A 2XZOA 4MH0R 2V54A 1R8SA 5EE9A 5C46F 4FWIB 3H0KA 1R10A 1XXHA 2VSFA 1AJEA 1RZ3A 1T3SA 4A0RA 4OI4A 4Y0VA 2VYFA 3FTQA 1EXMA 2ZPTX 4MGZR 4RVCA 2IHBA 3HJNA 5AUPB 2FF7A 4JVNA 4P4UA 2ZUBA 3PENA 4RKFA 3D3QA 4LGMA 2QTHA 2WOJA 4Q48A 2QRNA 5L8VA 1WP9A 3I8SA 1QHHB 4GZLA 5J47A 1FNNA 3I73A 4NYJQ 4DWJA 1AS0A 1S1CA 2EFDB 3A1SA 4PANA 4JIMA 4LJ9A 4G5SA 1COWA 2H5EA 3H84A 4M1YA 5CK5A 5FTKA 3THWB 1S3GA 2X19A 2ZI7A 1NMXA 2OBLA 4R9UC 3K53A 4XVQA 3X1DA 3DPUA 3C16C 1N5KA 2DWOA 1P62B 2OLKA 3DOFA 5JHGB 3MGCA 3RS5A 2FEMA 1P73A 1U90A 3AP2A 5EP3A 2QBYA 1OFTA 1RE0A 4RZ2A 1QVAA 1EWRA 4DVGA 4GP7A 4DZZA 5A5GA 5F9FA 1VIAA 1CS4C 1ZC4A 2ONJA 3WNBA 1N25A 4K8OA 2FG5A 3UXMA 1O3YA 3CRVA 4DKXA 4RD2A 2DR3A 5EZ6B 2BCJQ 4IJMA 5EJEA 2PMKA 2OEPA 2QU8A 2CDNA 1KNXA 1T9HA 4TT3A 1UDXA 1Q22A 4RD3A 3UK6A 4ABYA 3U6BA 3SJAA 3ZVRA 5JS8A 1ODFA 3KTAA 2V6JA 2QQ0A 3AVPA 1AS3A 2EWWA 1IN6A 2FFHA 4HI0E 4QL3A 5AJVB 4GL2A 4RD0A 3W6NA 4C7OB 4BUJA 5AUNB 1CIPA 1XZPA 3AUXA 1Z6AA 4YXWA 1M8PA 2AWOA 3EIHA 1P75A 3IPYA 3NVAA 4A1FA 4S35A 4A9AA 1E69A 4F4CA 2QT0A 1Z2CA 2OHFA 2ZYVX 1F2TB 3SBDA 4JSYA 3L0PA 4C30A 3QPVA 1W0KD 2NO6A 3GJ0A 4CEHB 1CJUC 1IY1A 3OESA 2JLUA 1KI2A 1D2NA 1CXZA 2CNWD 1QHXA 4M1SA 1RRGA 4XTCS 4JVMA 4EPTA 5LB2A 2C04A 3SFZA 2A7QA 3PV0A 4PPFA 2GJ9A 1NVVQ 2GF9A 4K81B 2GESA 5IT5A 4UJ5A 2HT6A 4MUAA 5CYPA 5TVKA 4JYBA 1NKSA 2N1BA 2Q9AA 2A5JA 4GP6A 4QGAA 1QG2A 2VO1A 3RWOA 3SNHA 5GADl 4QJ4A 1MRSA 2WSMA 2OLJA 4O0MA 4ZDJA 1HA3A 4CZ2A 2OCPA 3SHWA 4DLUA 3BE4A 4Q9KA 5HZHA 3WRXC 4RD6A 1KJWA 2DFNA 3KKNA 3TW8B 3UWOA 3GLIE 1DG1G 1VPLA 3CX6A 3UMRA 1NG1A 2BBSA 1LTQA 2NPFA 2IYUA 2VHQA 1XTSA 3O8RA 4F4IA 1RKBA 4Q21A 3REGA 4KO8A 2F43B 2HJVA 4E5UA 1CLUA 3OE7D 4MGIR 2AKYA 1T8UA 4UKDA 1EK0A 3THYA 5GJBA 4H1VA 1OKKD 4M9ZA 2GCNA 5FL3A 5J40A 4CEHA 5HE9A 4WIAA 2O8CB 1G5RA 2RGCA 2ZE7A 3I8XA 4Q1FA 3FMFA 3HPRA 1S1MA 4BRWA 3AUYA 1G291 2QTVB 2F1IA 2V8OA 5EE1A 3ZD6A 2AFHE 1A2BA 1OYYA 2QP3A 3JZMA 4PC2A 3L8YA 1ZIOA 1A7JA 2O0JA 2ZAMA 1CU1A 1AGPA 2BM0A 1QDEA 521PA 2ZQ5A 3IIMA 4B3XA 3CBQA 2JLWA 1NNEA 1JNYA 4XH9B 2GTPA 3RYTC 2A9KA 1IONA 3OZXA 4KODA 4D82A 3K0CC 3NEYA 5FUXA 4DLSA 2QQEA 3MWLA 5FOUA 5CM9C 4KFRA 4DSOA 1SXJC 2W58A 3BERA 2WWIA 2KI5A 2VBCA 3IEUA 4C9BA 4UNNA 1CR0A 2B8TA 4AI6A 3M0EA 4CT5A 1G17A 4XJXA 1UEIA 3NDPA 2IS2A 5L3RA 4GNKA 1FZQA 5DN6A 5A0FA 3U3KA 5F2EA 3TW4A 4BLSA 2HXSA 1LF5A 1I4LD 2NZ8A 1OFHA 4WBSA 2RGDA 2JLYA 2GDJA 2REOA 3F5FA 1OFIA 4C0LA 4D0GA 3LLUA 3RNLA 3OFNA 3AGPA 1KAGA 1ZM2A 3C15C 1XTJA 2PEZA 2ZSBA 1KI1A 1K8RA 3BOSA 2CLCX 1ZW6A 3QVUA 1FQJA 3PUXA 4H1UA 1ESMA 2GJAA 4KFSA 3TUIC 2Q9CA 3U4QB 3LO5A 4LDJA 2Z83A 3GJXC 4P3YA 2V1XA 2VA8A 1VG8A 2O8BA 3GFTA 4DSUA 3E1SA 3VU9B 3BFXA 4US0R 3EG5A 3PFIA 1VG9B 2X2FA 1DEKA 3GLFB 2P67A 3PUVA 3P26A 2YNMA 1UADA 3L82B 2RKOA 1UDWA 4EDHA 2VQSA 2Z43A 1PJRA 2JATA 1QHHA 1SXJD 4X8OA 1KO4A 3U61B 1GKUB 3LD9A 2IUSA 1NN3A 2Z5FA 4FMCF 2ORVA 1LFDB 1LW7A 4QBIA 3WP0A 1F2UA 3P1JA 3FFAA 1MO4A 1YR8A 1FX0A 4RY2A 3RC8A 1EX7A 2J59A 4Q01A 2F1JA 5EXXA 1QZXA 2XTMA 4RFSB 2WOOA 1AQYA 1GKIA 1WE2A 1JEEA 1R0WA 3OF5A 3ADBA 2OCAA 2AHOA 2ZYTX 2VSOA 1CJMA 4QHSA 4V0MA 3T12A 3HU1A 4F7WA 2O8FB 4AG6A 2JGNA 3WMFA 4KVGA 1HURA 2ZS7A 3D31A 5KO2A 4P32A 1EFRD 3GLGE 2KWIA 5K8UA 3EW9A 2V1UA 1D2EA 1II0A 3VFDA 4B2PA 3THOA 4PC1A 1CJKC 4JT2A 5SZKB 4Z1MD 2JLRA 4D0NA 3A6PC 1ZUNB 4ZDIA 1M1YE 2YHSA 3AVXA 4NCKA 2I1QA 2F3TA 1XZQA 2C95A 2YC2C 3C14C 2ZR0A 3RS7A 3AM1A 1N5IA 4A0GA 5JCZA 1XJ0A 3KKMA 4O2RA 4LJYA 2V4ZA 4BWYA 2CHVA 2CLSA 4DCSA 2ZRMA 4DCNA 5FBWB 2F55A 2XEXA 1NVVR 2R6FA 2ZRBA 1ZCBA 3CONA 3EPJA 2GNOA 2EW1A 4HLUA 3G0HA 2FX3A 2W6IA 3DDCA 3EX7C 1O87A 1DAEA 4PPQA 1GIAA 4TYYA 3IEVA 2P6RA 1Q20A 2EYUA 2OESA 1DS6A 1P7CA 3ZH9B 4NONA 4TQAA 3K0AB 2YYZA 3QF4B 1II8A 2WICA 4D80A 4AC9A 3A58B 4FCWA 1SULA 1J90A 2BC9A 2VH5R 2O8EB 3UKDA 3KJIA 2QSYA 1RW4A 3CH4B 1U9IC 5H68A 1GDDA 2J0QA 3KTAB 2IUTA 4OL0A 4HDCA 1GL7A 1GTVA 2ZJAA 3IIKA 4NBSA 1E9CA 4PO1A 2ERYA 2ZRFA 2WV9A 3NBYC 3NEJA 5DIFA 4MRPA 3BB3A 3MJRA 2ORWA 2FSGA 1OV4A 4LJAA 4LV8B 4V0LA 5KSPA 1X1SA 4US2R 5AJYA 1P2UA 4A0FA 5KYKA 4M9SA 4MGYR 3Q7PA 2FMXA 2CJWA 4J0QA 5DO9A 5HZKA 4TYWA 4B33A 1T8TA 5FPTA 4KJZA 1KK3A 5FI1B 5M04A 3AKYA 2EWVA 2EFHB 3CIOA 2C8VA 2GAAA 2CVHA 2B7CA 3O8BA 1OT3A 2ZXUA 4BLOA 4HZUB 1U0LA 2EQBA 4MA4A 2CL0X 5FL7D 3FFBA 4P4SB 3H2YA 3VKWA 8OHMA 4OJKA 1T3HA 2ATXA 4BFTA 3B1YA 2WWWA 3GJ3A 3BFKA 2PZGA 2OAP1 2QENA 1JQJC 3KQHA 3CF6R 4IDQA 4TTRA 4EJSB 1CP2A 1DTSA 2QP9X 1XPUA 1W46A 1U9IA 3QPUA 3NXSA 1U8ZA 4LJ6A 5JRZA 4KSCA 2YZ2A 2FFQA 1JB1A 1E1RA 1YR9A 1KI4A 2HEIA 2J5XA 2NO1A 2IX3A 2JEOA 1CF4A 2BKUA 2MSEB 1B0UA 3KX2A 4M1KA 4DDVA 1XTRA 3K70B 2GVZC 3VHLB 4XOIA 1L8QA 3VR5A 4IKEA 1NRJB 5JWRA 1ESNA 1C4OA 2BOVA 5ELXA 4M1OA 3Q7QA 1ZU5A 3EZ9A 4Q1AA 3NBXX 3SJCA 4LSGA 2W83A 1AKEA 1CR4A 4AKEA 1SVKA 4LC1A 1TQDA 1WQ1R 2OFWA 4K46A 4PAMA 4BZPA 2RAPA 2NTYC 3EZ6A 4HEJA 2ZUCA 2G0NA 1BS1A 3KFVA 4V0KA 1ONBA 3R8FA 1XTQA 1KY2A 4ASUD 4DIEA 1G64A 3MRSA 4URWR 3MMPA 1OXTA 1YZGA 1N0UA 4G1UC 5B58C 1ZUIA 1D9XA 4B3FX 5DI3B 4N1AA 3IO3A 1G3QA 2R8RA 4NE2A 4PHFA 3TE6A 4BLRA 4ZCIA 2A5FA 2GJ8A 5KTYA 2BBTA 221PA 2GJSA 3O8CA 4B44A 2D4HA 4B47A 3RC3A 2WKRA 3TVDA 1YZNA 4B3DA 1E1RD 4B3CA 2NQ2C 3BK7A 4DB4A 3VR1A 4KLNA 3BJIC 1G8HA 4CT4B 4N0DA 3TH5A 3DMNA 2RH5A 1AA3A 2BMEA 1IAQA 4B6FA 3VR3A 1E0KA 1JPNA 4C0AC 1W2GA 2MSDB 2WJJA 3TIFA 3GJ6A 4IEEA 4DRZA 3IUYA 4RZXA 1XP8A 2NMVA 5DISB 2CCGA 2PH1A 2D62A 4M9QA 1OH5A 1US8B 3LLMA 1E9BA 3GQBA 1NMYA 3BBPA 1KO7A 1RRFA 4KI0A 3GLGB 2J0VA 3GCGA 2BDTA 3P4XA 4M9XA 4HB2A 1XMJA 2MMGA 4PSKA 2CNWA 5FPYA 3A4NA 2ANCA 1NP6A 3V9PA 2DWQA 3A1VA 2ZS9A 3AKCA 3U4QA 3CX8A 2XXAA 1H8HD 3JZAA 4JZKA 4ZKDA 3PVSA 3TQFA 4BASA 3RANA 1Z07A 1CTQA 1HH4A 1YR7A 1LF0A 1KK1A 3BB4A 3KL4A 2XOKA 3K09C 4LV5B 1YRBA 4BFWA 1EFRA 2AK2A 3MJHA 4D4MA 4CEIA 4X8HA 2W00A 3T06B 1M7BA 3WMEA 2QN6A 3B1ZA 3ZZ0A 3K0CA 1T5IA 1T4GA 3EIQA 3LXRA 5SZIA 2FSFA 5JEEA 3UWKA 1FOEB 4PHHA 4TZ6A 1KMHB 3LRPA 1NSTA 3L2OB 1FX0B 1VECA 4Q1BA 2VHCA 1GRRA 4LJ7A 4AKGA 1OPXA 2DWPA 3H4MA 3BH0A 3SYKA 2BJVA 2GF0A 2HLDD 2GBLC 3B8HA 3G5UA 1W0JA 4V03A 3RS0A 2QMOA 3HR7A 5DNYB 2I1VB 2W6ID 3I32A 3B9QA 5DHAA 1E98A 4NCIA 4TMZA 1J70A 1CULC 4LHZA 4HB4A 4A15A 3QE0A 1YZQA 4AYXA 1KY3A 3SR0A 1D2MA 3K0AA 2V3CC 5E3HA 5HCNA 1D6JA 2UKDA 4AYWA 3AP1A 1ZNZA 1SQ5A 5FTJA 4MRSA 3DHWC 1BKDR 2FGKA 1FW6A 3P27A 4AYTA 1Z6YA 4OQLA 4ILEA 3T34A 4JKIA 4KYUA 4TL7A 1E9SA 1XEXB 2XB4A 4GOKA 4Z1MA 1QF9A 4JLMA 1XMSA 1U0JA 2R6GA 4W7SA 3ZZTA 2RGNA 3GLGA 1SGWA 421PA 621PA 1U81A 1TUIA 2BCGY 3MWJA 4PZZA 2R9VA 4Q7LA 1UBEA 5KPJA 2BV3A 2IXEA 5KSZA 1KI6B 1G9XA 2V6IA 1Z08A 4LHWA 4OI0A 2K5UA 5EP2A 3QVVA 3U7FB 2JJ1D 1OW3B 1E6CA 4UQOA 1FUUA 4JVSB 2ODNA 3X1YA 1R5OA 2BBOA 4B2IA 1P5ZB 1Z5ZA 2JAQA 1MO6A 4URXR 5CDFE 1JR3D 3IHWA 4QGFA 3Q3JB 2XSZD 3DL0A 1Z47A 2A5YB 2CVFA 1GILA 3VX3A 4DLXA 2OUKA 3QEOA 2BEJA 3NTUA 2FJUA 2HDNB 1S9DA 3TK1A 1BH2A 3UANA 2G1JA 1N6HA 2BKEA 4A36A 2RCNA 3C41J 4LRWA 4MDFA 4M1TA 1SVLA 1DO2A 2GK7A 3A8TA 1XTKA 4YMSA 3THXB 2GZAA 3HP1A 2HLDA 3L8ZA 4ZV4A 1KI7A 4PPGA 1ZCAA 4POAA 1MKYA 2ASEA 1I4DD 3H1TA 3VX4A 2D7CA 2OAQ1 2PBRA 4JLOA 3HU2A 4W5JA 3ONWA 3HYTA 5L3QA 3GLIB 2LKCA 2XNDA 3U7EB 1OH6A 1G8PA 1NVUQ 3N5CA 1KO1A 2IYRA 4C0KA 1Q57A 3MLEA 3FWYA 3QF7A 4PO9A 3UPUA 1UF9A 1DAGA 2IYZA 3BFVA 3KXLA 4NZYA 1BMFA 1J8YF 3TNFA 3KUDA 4YMTA 4MRNA 4II7A 1WF3A 4E22A 1TQ2A 3LFUA 4CDGA 5K8IA 4BEJA 2ECKA 5JCPA 1TF7A 1U8AA 2ZRAA 3L0SA 4JLNA 1E9FA 1OH7A 2VP6A 4LYJA 5FPSA 1DG3A 4ERNA 4MRVA 4BFZA 3EPLA 3DZ8A 2C98A 4HSEA 4IDHA 1RIFA 5D3MB 5FUVA 4NYMQ 4CW7A 1FMLA 3ADKA 3CRW1 1KMQA 1G3MA 4LV6A 1JAIA 2IL1A 1K5DA 1RJ9B 1KI6A 5KDOA 2VF7A 3BC1A 4I1SA 2YOFA 4TYPA 2ZU0C 3GLFA 4MYCA 1YVDA 5CIQA 4O3MA 1E9RA 1AGRA 2ANBA 2NG1A 1Z6XA 2IXGA 4B75A 3TUZC 1IN4A 1XEXA 1R7RA 1CRPA 1MABB 2D74A 1VMAA 1KAOA 1XPOA 4JS0A 4G5QA 3CPHA 3NG1A 1VIYA 4FIDA 4HZIA 3S1AA 1K6MA 1GSIA 4YDSA 2ZSAA 1CRQA 3ADDA 5HKKA 3CF0A 3OEHA 4Q18A 4WOPA 5J4LA 2PT7A 2WWXA 3CW2A 1SVOA 5FPHA 1FFHA 1AKYA 3TRFA 5JEDA 3M6AA 4BFVA 2CL7X 2F43A 1T0HB 3WBKA 3ZDQA 1GOTA 3QG1A 4DEYA 1DELA 2NOAA 4MRRA 5EXPA 2D06A 2H57A 2W0SA 3CPEA 1JQLB 4ON9A 2F7SA 4V02A 3SEAA 3VNVA 2KBFA 3ADCA 3EPHA 2O0HA 1E1QD 6Q21A 2JDIA 5FTNA 4CIDA 4DLZA 3VQTA 4H9GA 4P4TA 1OFUX 3LWNA 4A2QA 2QMEA 2HUPA 3SE0A 4BLPA 4JVLA 2C9OA 4JL5A 4AWXA 2DY1A 2BIFA 2VHJA 2ZSEA 4GOJA 4KXFB 4KU4A 4ZI3A 1IJFA 2C2HA 4Q03A 1TX4B 2PJZA 1NJGA 4CF7A 1E2QA 1U8YA 1N6NA 4NH0A 2WJIA 1TU3A 2OE2A 3DM9B 3TVTA 3TJZA 2ZJ8A 2PLFA 2IS4A 2ZJYA 4EPYA 4PHTA 5HPYB 3AKDA 1QHGA 4HB3A 3TSWA 1ZM7A 4DDUA 3MAAC 4JL8A 4HAZA 5AJXA 2Q21A 1N6PA 1M2OB 4UXJA 1R0ZA 4RD4A 3N2IA 3X1ZA 2UVQA 2OBMA 4Q47A 1DVRA 1JI0A 2YJTD 2PEYA 2RGNC 3EZ2A 3GJ5A 2ZI9A 2J0SA 1SHZA 3LAWA 2YWFA 5AR1A 3EARA 3CR7A 1GZSA 4HLDA 4PZYA 1U98A 2DHRA 1W36B 5CK4A 1NI3A 4O2LA 2QNRA 3AVOA 4DCUA 2GZDA 4RZUA 4CGZA 2IC5A 2VSXA 2QMUA 3KDSE 1E2JA 2W2XA 5FUYA 1G41A 4AKIA 1NY6A 2FA9A 2RHDA 1YR6A 5LD2B 2P5TB 1TAGA 4HAXA 2L0XA 2AKAB 5JLJA 5KHOC 2ZI5A 1I2MA 5AUQA 4S2EA 5L3VA 5B64A 4Q9LA 1OHHA 4D6PA 1II9A 5IK2A 4A8JB 2DPXA 2NPIA 4FI3C 2P3SA 1JR3E 2VRWA 1XFAA 3KB2A 1N2CE 2VP2A 1GITA 4XWAA 3W8RA 2G77B 1DO0A 1SVWA 2GWHA 2H7VA 2WPDA 4LBZA 5EE3A 3RHFA 4BECA 1E96A 4IFEA 1E2EA 3ZVMA 3PJRA 1LV7A 4ARZA 2IYXA 4P31A 2ZROA 4IHQA 4FD2A 4IOJA 4JLBA 4AKHA 2MMCA 3EAQA 2ZI3A 4HAYA 2R2AA 4HDOB 2JLQA 2ZJOA 2V9PA 1P72A 3TAHA 1DAMA 3FVQA 3B78A 2V7QA 1Z06A 4TWZA 3MD0A 1W0KA 1CEEA 4IDOA 3A37A 4A0HA 2AFIE 4HB0A 3PEWA 2CXXA 2R44A 3DKPA 2DFKB 2KB0A 4LJ4A 1UEJA 1ZIPA 4TSFD 2GBLA 5F9HA 4AIIA 1IXSB 1E79D 4Q00A 3IQXA 1NJFA 3SS8A 4LCBA 1XCMA 5EXTA 2QGZA 2HV8A 2J0UB 3NH6A 2FFBA 3GJ8A 4R2IA 4G5RA 3QOFA 4I1VA 4TZ0A 1WBDA 2QORA 4HATA 3HDTA 1NN1A 2JIZD 2G1KA 4OQNA 1GKYA 2YOGA 1M7HA 2VTKA 5C1BA 3CKLA 1OKKA 1S4QA 3FPAA 3MG9A 2OV2A 1M6NA 4HUQA 2RGXA 3MSXA 2EFEB 3RS4A 1N3BA 4JSTA 1WXQA 3SYLA 3ZS8A 4LY6A 2AN9A 2IYSA 1GNQA 1ZJ6A 4OBEA 2JASA 5KPDA 1G18A 1S2MA 2C5LA 1E32A 2OM2A 4TLBA 4HDQB 4NU0A 2IYQA 2IYYA 3GEHA 5FUWA 4OK6A 1IM2A 3P32A 1QBKC 2GHIA 1N6LA 2FDCA 4LHXA 2XXAB 3W3ZB 2ZRNA 1Z28A 2HYDA 3WHLA 2DBYA 5IF9A 3LW7A 3FHTA 3AVUA 3KQNA 2G9NA 1GP2A 3K1JA 4M1WA 3QXHA 3L0IB 4QGHA 3F3YA 4JMPA 3U60B 4TL8A 3NKVA 4OI2A 1IN5A 2EU8A 4ZCMA 1W4RA 3K70C 1DAHA 1E2KA 1XD2A 2J7PA 1CR2A 3NHAA 3B13B 3DOEA 3QKSA 3QPWA 4QC2A 4ESHA 4MQBA 4KITB 4NTZA 3LX8A 5D3QA 5KNBA 5F98A 2VP4A 2QT1A 3V00A 1AZTA 2X77A 3ECCA 5DN6D 3O47A 2XGJA 2BM1A 4LPSA 3U3JA 1MO5A 2ATVA 2J9RA 1XEWY 2X2EA 1XB2A 4I1UA 4WZBE 1Z0FA 4LYHA 1KOFA 2ZJ5A 3A1UA 1XTIA 3LVQE 3LX5A 2YINC 1FMJA 4X8LA 5BWMA 1WB9A 1GWNA 5UKDA 4FMDB 1NBMD 1D8TA 4JBWA 1SXJE 2PLRA 1KTVA 1OXUA 3IQWA 4TQUS 2IWRA 4CRWB 1UBGA 1E2LA 1NN5A 3GP8A 4CVNA 1NLYA 2Q3HA 4URZR 3WXMA 4ASUA 1SKQA 5CYOA 1YZUA 5KNDA 4F92B 4QXAA 2ZYWX 1LS6A 1SXJA 4QJ3A 3TAUA 1Q3TA 4Z8YA 1A2KC 1CJVC 2CLDX 2QP4A 1FL9A 2DFLA 1WCV1 2GZHA 3AF3A 5EUQB 1VYTA 2N42A 1X8LA 3W8NA 5HTKA 3GFOA 4LJ8A 4XWOA 4RSGA 4QHYA 3TR5A 4PAOA 2J45A 3GLHB 1Q12A 4OHYA 1AQUA 1NLFA 4TMVA 1UKEA 2XSZA 1FQKA 2IHYA 2ZE5A 3P4YA 2H1LA 1HQYE 3OIYA 3SBEA 4L9WA 2XAUA 3U3RA 4ZCLA 4I81A 1ZINA 3R8CA 4Q4JB 3TSOA 1TQ6A 1E0AA 4U00A 1X86B 3ICQB 1EG7A 2BWJA 1NLZA 3CO5A 3SC3A 4TYNA 2A30A 4L9SA 3QUSA 3SDZA 3Q9LA 4B34A 1E2IA 4JJZA 3PEVA 4Q02A 5A4JA 1W48A 3OIVA 121PA 3T15A 2ZRGA 4DJTA 2NO9A 3KJHA 4I4LA 5G41A 4JBYA 4BFSA 3QY0A 2HYIC 1S96A 2YOHA 3ZIAA 3B5JA 3U3OA 4B43A 2VHTA 4Z51A 3J81k 3VKGA 1L4UA 2CMKA 1HEIA 1NL3A 2BMFA 2ZRIA 3DEFA 1SVSA 4O25A 1R0YA 3ZQJA 4A92A 1KDTA 2J87A 4JLAA 3ZZUA 1E2HA 5TARA 3THYB 1Z2AA 1KSJA 3ASYA 4PX9A 4WZ6A 1A1VA 3B1VA 821PA 1L7VC 5FBLB 4DT1A 1ZBDA 1YKSA 4TTQA 3W6OA 2OFOA 4PHGA 3IBYA 2DFTA 3OE7A 4M22A 1E2DA 4YDHB 4BEBA 3X1XA 1NSFA 1G16A 1XD9A 2WSSA 4PPNA 2WJYA 1P61B 3C5HA 4Q66C 5FOSA 4BGDA 1UKYA 1KZ7B 4F93B 5EXSA 1G4AE 1Y63A 2GXUA 2E87A 2LWIA 2WPDD 2CBZA 2H17A 2QEQA 3K9NA 1X8KA 2ZM5A 4QFMA 2QPOA 2GCOB 1W5SA 3KXIA 3NC1C 3S1AB 1WA5A 2WKQA 1BIFA 5IK2D 2FSIA 5J4KA 5EQTA 2ZRJA 3G82C 5H1YA 1AIPA 3I1FA 3WNDA 4FMDF 2QAJA 1TU4A 3C5CA 3C7KA 2CJWB 3QJYA 2W2VA 3GLHA 1IBRA 1GL6A 3V4FA 3GEEA 3CZQA 1OJLA 2QAGC 3OAAA 1I2DA 1XMIA 4C0HA 1EX6A 2W6JD 3LNCA 3CF2A 2ZUDA 2O8BB 1S3SA 2IYLD 1GL9B 4B74A 3FKSD 1BOFA 1DBSA 3PR1A 2CK3D 4LBVA 1GG2A 2QMHA 4LYAA 5J4VA 3IBGA 3A4MA 4QBFA 4JBXA 4WAUA 4B73A 3NWJA 2ZRDA 1KHTA 4EJSA 1NVWQ 1N6KA 3SOPA 5JZVA 1MRNA 2J3EA 4GI7A 3BS4A 2B92A 2E9SA 4DLTA 2ZJBA 3IPXA 2CL6X 3VMFA 1D9ZA 2XTZA 1Z0IA 4NL4H 1Z63A 3QEJA 4FN5A 4R7ZA 4QNRA 4RFSA 4PC7A 1U94A 2QSZA 3KUCA 4DIDA 2WTUA 1N5LA 2KBEA 2FPMA 4QKQA 2R62A 3QKTA 2ZSFA 2WMNB 4B6EA 3I3SR 5CITA 3UG6A 5EE0A 4LBWA 3VR6A 2WZQA 2Q9BA 2QM7A 5DI9A 1XU4A 5FR2A 5B57C 4AK9A 4DLVA 3WYAA 4EAQA 3E5HA 2HF8A 2RGEA 3BWDD 4MYHA 3CPJB 5HR5A 3CH5A 2IF0A 1IN7A 5TV2A 1AA9A 1G8FA 4F4JA 4R71A 4QBGB 2CCKA 5IDVA 3AEZA 4B48A 4C7OA 2CK3A 1SZPA 1DAFA 3EIEA 4G3XA 4MYUA 3ZLJA 1G19A 4CYMA 2YWEA 1P3JA 4NCNA 4FMBB 1BYUA 1VG0B 4Q7KA 3QIAA 4TL9A 4GMDA 3Q8XB 1F2TA 5HCIA 1GNRA 1IJEA 4C0BA 5TDHA 3RABA 4RCZA 2AX4A 5GVSA 3R9XA 3LVRE 2J7KA 4LK2A 2B6HA 1P2VA 4G5GA 2B8WA 2WWGA 2JLZA 1DOAA 1LY1A 3FKQA 1LS1A 1G20E 1HE8B 5EUMA 3JVVA 2OSBA 4W5WA 5AUOB 2YVUA 4KFUA 1KSGA 4HAVA 1HY3A 2ZSDA 1M34E 2YWHA 4ZO4A 1Z3IX 3V4RA 2CCJA 1W4BA 1YZKA 3CRRA 3ZVLA 4PQRA 1FNMA 5EZ5A 4PTLA 3VHXA 5FBQB 5LDDC 1T0JB 1LB1B 1NVXQ 4QGGA 4Q9JA 5CDFA 3SQXA 2G83A 1Q1ZA 3ICEA 3LBHA 2IUUA 2O5VA 2H16A 3FMOB 3P20A 3BRWD 1TNDA 5CLQA 3AP3A 1E2FA 1U2RA 3WBJA 4ACAA 1WBBA 2IS1A 1JXOA 4OYHA 2N46A 3ND9A 3QKRB 4JLJA 1G8GA 1PZNA 3Q5EA 1XCPA 4N3NA 5KNCA 2R6AA 1OIWA 2GRJA 3DM5A 2V7QD 1ZU4A 4F38A 3EWSA 4NYIR 4XD7A 4WW0A 2IYWA 4TTPA 3U5ZB 3KKQA 5AJZA 4CEIB 1BMFD 3RRYA 1GAJA 4OHVA 1W4CA 2PZFA 1JALA 4YMVA 1JBKA 2FPKA 3EZFA 5SZHB 4MKIA 5EP1A 5LD2C 3FB4A 4IDPA 2XNSA 5H8WA 1MV5A 2YV5A 3FHOA 3UMSA 3K8YA 2OG2A 4XWKA 2VHUA 3M1IA 1MOZA 5TY0A 1B23P 3T1TA 3AVYA 4PR0A 4KFTA 1VCNA 3CLVA 1HV8A 5C18A 2P0EA 1KSHA 3CWZA 3KXKA 3QG5A 4Z8XA 4IOKA 5JFGA 3L0OA 1W2HA 1KO5A 4YMUA 4D0LB 4IDNA 4Q1CA 2QAGA 3W34A 3E70C 3X2SA 721PA 2C77A 4PZLA 4Q4HB 3CNNA 3KB1A 2BMJA 4KHZA 5K8LA 3BGWA 1NY5A 5JJKA 4G5OA 1TL7C 2LCFA 1SKYE 4IOLA 1MABA 3K9LA 1ZD1A 2JDID 2WHXA 5B30A 2FWRA 2JLSA 3CRQA 4PC6A 2NO0A 3A36A 2ORIA 4D2IA 2GVDC 4LBYA 1J8MF 4FCVA 5JECA 2P6NA 4AG5A 3RS3A 3I72A 2ZREA 5CJPA 4KBGA 3RWMB 2IBMA 1KYIA 1I4TD 2WJGA 4TSFA 3U6KA 4EPWA 4KYIB 1XJCA 1Z6GA 5GVRA 1OIVA 3EC2A 5FH9A 1JR6A 2ERXA 2Z4RA 3SQWA 3RSLA 5JI2E 1CBUA 2CE7A 1TEXA 2IYVA 4EFLA 1G5TA 2QTFA 4M2LA 3T5GA 1U99A 2P65A 1VHTA 5E7MA 3TLXA 1E94E 1RYFA 4BLQA 1W4AA 1AK2A 3LV8A 4EFNA 1OXVA 1ZC3A 1KK0A 4IOMA 1TADA 1HQCA 2IEYA 3F8TA 3NBFA 4XD7D 1XCGB 4B3GA 2ZRKA 2ZE8A 1N6OA 3PUYA 4BQSA 4RJLA 3OEED 5JBQA 4MITA 3R7WA 2QRZA 2D2FA 4MKHA 4M0LA 4XTRA 5TXGA 3TSZA 1NBME 1ZD8A 1FP7A 1FTSA 4GPTA 1KI8A 2WWHA 1Z0AA 2H18A 4NHOA 1NMZA 2REXB 3LXXA 1X3SA 5EP4A 4C4PA 5J4YA 3IGFA 4AY2A 2ZI4A 3THXA 1J7KA 4FCTA 3DKVA 4TL6A 3ND8A 3UMFA 2VP0A 3Q72A 3SYNA 3Q85A 2H8KA 4TLAA 3FMPB 1RC8A 1HTWA 4TMTA 1R5NA 4Q4HA 1D5CA 2I4IA 4LYFA 4RZ3A 5DGXA 2ZVQX 1ZD9A 3LY5A 4OK5A 5E95A 4DBLC 1OYWA 3U44A 1Q1QA 3AV0B 2AR7A 1H8EA 1ZNYA 2AWNA 4JYCA 2JCSA 3OAAD 3T35A 1KDPA 2HCBA 5CIWA 5AJWA 4FXPA 4EIWA 2QPTA 2J7PD 1G7TA 4R2HA 1ZNWA 4IXNA 1XMVA 3WYFA 3IILA 4QHTA 2XNDD 4TN1A 4A2WA 5P21A 3E2IA 1WDTA 2GJKA 4ZPXA 4G0NA 1KMHA 5CJ2A 4XSHA 2F6RA 4UXHA 3R7WB 4EKDA 5BN3A 4D25A 4XVUA 1RYHA 3T5DA 1TEVA 1KK2A 1TMKA 2E1RA 1Z29A 3D8BA 2C96A 1ELOA 1RJ9A 4FMCB 4B32A 1QHIA 1E2MA 4Q4LA 3VR2A 3SI7A 2PCJA 1G6OA 4GRAA 3BB1A 2PMDA 1YZLA 4DCVA 1PVOA 1N0WA 3I62A 2RGBA 2B21A 1GRNA 4DSNA 3AVVA 2RB4A 5FBRB 2GAOA 4KV9A 5E7IA 4OHWA 4L4UA 3NHBA 3MCAA 2BEKA 1G3IA 3BH6A 3CX7A 2AL7A 2AD1A 3SFVA 5FPKA 1A5TA 1VYUA 3PITA 3QQ5A 4YC7A 5BW8A 3AVWA 1JJVA 5DLQC 4OK3A 4ZIRA 2PJRA 2J0UA 4B71A 2OZEA 1XD8A 2FPLA 4M21A 2PT5A 4DDTA 3KZ1E 1Q44A 4RD1A 4G01B 3B9PA 3PG5A 4KLZA 1E1QA 2IF2A 4FWTA 1X8JA 3U3MA 1KDRA 2OXCA 2WIBA 4A6PA 1A82A 2SHKA 2WAXA 2O8DB 1PLJA 1EFHA 2OBNA 4KBFA 3I5XA 3HPQA 2RHMA 1Z8FA 5BN4A 2A5GA 2P6UA 1NIPA 3ZVNA 1G1MA 2WJVA 4ITRC 5BN5A 3U44B 4DDWA 1KI3A 2JJ2D 5FFMA 1OSNA 3AVQA 1W47A 1ANKA 2NZJA 3K09A 5FL7A 2VIIA 3NDBB 4R98A 1PLLA 4YLGA 4DUGD 4CEJA 2ZRHA 2G88A 3GLHE 3KKPA 4OHXA 4LC0A 1K5GA 1Y3AA 4Y0AA 1P2SA 4LHYA 4OHZA 4IW3B 5IHPA 2F1RA 4Z54A 1G3RA 1E99A 1GNPA 1PUJA 4IXMA 3AF0A 3RRNA 2VLIA 4HUTA 4IRUB 2IWHA 1P9RA 1KKMA 3RRMA 3UIEA 2XX3A 2R6CA 5TB5A 3GJ4A 3EASA 3KFXA 1F3OA 1KNQA 3FOZA 2ODWA 2ZRCA 4U02A 1XF9A 1YU9A 1YRAA 1HUQA 3N2EA 4B35A 1ZRHA 4C2UA 1X6VA 4UJ3A 5FOVA 2EFGA 1M74A 1OF1A 4GOXA 1R6BX 1ZUHA 1GVNB 3T61A 3TKLA 4TMWA 5FOWA 4MUBA 5E7JA 1T6NA 1Q3HA 4W9MC 4OI1A 1FTNA 1XRJA 1ZP6A 2TMKA 1KDOA 1E4YA 1E0JA 3LBIA 4GDFA 2FV8A 4CEJB 3PIRA 3W3AA 4EPRA 2JLVA 1C1YA 3WRYC 2QE7A 1Q21A 2ZU6A 3IKJA 2W2TA 2ZEJA 3RRZA 4OKSA 2IA5A 5J4HA 5KUTA 5FTMA 2G6BA 3LH5A 2YKGA 2IW3A 2WKPA 4ZKEA 4NDZA 4KVAA 3TUJC 3ZJYA 2AD5A 3QXSA 4Q19A 3RDPA 3AF2A 1W5TA 2D7DA 1G4UR 2O8DA 2GKSA 1Z83A 3AH8A 3UATA 3M4YA 5C2JB 1JAHA 4PSVA 1NBMA 3VAAA 1XEFA 4GBMA 5KU1A 2J1LA 2ZAOA 4MDEA 2CE2X 2FE4A 1KKLA 4NP6A 1UFQA 1IXRC 2VF8A 2XOKD 1COWD 3B1XA 2ZIAA 3D6TB 4LZZA 2GCPA 1E4VA 2WWFA 4RFVA 1KJYA 2DCUA 2OCYC 1OB2A 3K9GA 3HYRA 4U7DA 1MH1A 5BYKA 1N0VC 3WY9A 1G7SA 4C0JA 2ZE6A 1II8B 5FI0B 2PCLA 1ZM3A 1AZSC 3H86A 3C8UA 5JI3E 2O8EA 1OH8A 2O0KA 1VYVA 4AURA 4Q4AA 4JLKA 3PCRB 3QXCA 3X1WA 3ETLA 3QBTA 4JL6A 3FGNA 4TMXA 2QE7D 3BAFA 3OIWA 5LB4A 2HCJB 1NG9A 2WAYA 1UJ2A 4EQ6B 4DEXA 1Q1EA 4UXIA 2WIAA 1VDZA 4B76A 4RKEA 4XVRA 1N6RA 2EFCB 2NGRA 1BYIA 2C9YA 2OILA 4WVFA 2Q0HA 4QOSA 5F3WB 1WMSA 3OIUA 1IY2A 4WXRA 4L8GA 4C3ZA 3GMTA 1DPFA 2FGJA 3BXZA 1KO8A 3IIJA 3ZGXA 1N6IA 3GFPA 4JJKA 1G6HA 3UG7A 3EZ7A 4M53A 1E2NA 4HLUC 4JKYA 4TLCA 2A3RA 1UM8A 4ZDKA 3T1VA 4KSBA 4E07A 4DLWA 2QA5A 3FMIA 3F0TA 1R2QA 3BD9A 4TQ9A 2VPPA 3AKEA 4NCHA 4URUR 3GPLA 3MWYW 1BO6A 1RRPA 3R20A 3BIFA 3SZRA 4M8NE 1SVIA 4BRUA 2DB3A 1Q0UA 5GJWC 4HAUA 1F48A 4QRHA 3C4JA 2OXRA 4WXPA 3TBKA 4PAQA 3LQRA 5LBIA 1JR3A 2VEDA 3NC0C 4XIGS 5GJCA 5SZJA 4F91B 4Q7MB 5CB6A 2F9MA 4P33A 1VTKA 2BMDA 1Z0DA 2IEZA 1OXXK 2ZVPX 5G3ZA 4D81A 2XJ9A 4A6XA 3CZPA 5JMTA 1YE8A 3K70D 2ZJZA 2FZLA 4HLQB 4PO8A 2JJ2A 1DADA 1EFTA 3AGQA 3Q5DA 1G21E 4DSTA 3TR0A 1CJTC 4TYQA 3IDQA 1QVRA 4UNSA 3OHMA 3EC1A 1VG1A 2GCOA 4BFXA 4EPVA 2REBA 1V5WA 4A8JA 5FTLA 1NKTA 2FNAA 4BFUA 2P2LA 4M1MA 4DCTA 4M4SA 4B2LA 1P60A 3U7HB 1E9AA 3PUWA 1OHHD 1GUAA 1KI9A 2QAGB 2ONKA 1E9EA 3KJGA 3RLFA 2IS6A 5B2ZA 5CLLA 5DE3A 1TUEA 1XD2B 3QKSB 5KDDA 3WMGA 1UAAA 3VKHA 4YQFA 2WMOB 5AK0A 1TF2A 1MO3A 1IQPA 2VP5A 5JRJA 4Q1EA 1XDBA 3CWQA 3QSYA 2ZTSA 3SHFA 4DHEA 5TMPA 3SU8A 1SXJB 4TMKA 4FW9A 3RSOA 3AQ4A 4UNQA 1W44A 1T91A 1N5JA 5H70A 2OO7A 4HZUA 1VHLA 2VP9A 3FDIA 3THWA 2X8AA 2C99A 2G3YA 3CR8A 1F60A 3KQUA 4OQFA 1OXSC 2ZR9A 3W9YA 1AS2A 1TF5A 4ARZB 3KKOA 2BHRA 1R8QA 2WVJA 3DZDA 1IHUA 3EA0A 4UNPA 4V0NA 5DSZA 2Q3FA 4A8JC 3QF4A 5CB8A 1XXHE 2G0TA 5KSOA 1XPRA 4A2PA 3LDAA 2WM9B 4Q4JA 1JJ7A 1HE1C 3IHLA 1W49A 1KIMA 2Z0MA 2GK6A 2FOLA 4V0OA 5EE5B 3AF1A 4GSYA 1TPZA 4P4SA 1XNJA 2QROA 2A2ZA 3OEHD 5DH9A 4P0TA 4V0ME 1QRAA 1H8ED 1W0JD 4QNMA 1UKZA 3HWSA 3K9HA 3SJZA 4FINA 1EWQA 1LVGA 1QHSA 2KJQA 1PUIA 4HLCA 4IFBA 4WA7A 3WP1B 1DARA 3FHCB 3B1WA 1F2UB 4OJQA 3R9WA 2JJ1A 2GILA 4BZQA 4N0EA 2BVNA 2Z4SA 3IO5A 2FH5B 4A82A 2FSHA 4PC3A 1RRCA 5L3SA 2KE5A 3HR8A 2F9LA 3HU3A 3NH9A 1E0SA 3CUEF 4IVRA 2JIZA 1NF3A 1TQ4A 1ZM4A 2B7BA 1U0HC 3DO6A 3WNCA 4IEIA 5DI3A 1XJQA 3CNLA 1OE0A 1H65A 2GXQA 1Z6TA 4JT4A 4BLTA 2O8FA 2C9CA 4C0QC 2FU5C 2JA1A 3B60A 2QM8A 2BBWA 5E4FA 2QG6A 2GETA 4DT1B 1YZTA 4IVPA 1E9DA 1G7CA 3CRMA 4L16A 2D2EA 5JWHA 1E2PA 1RFLA 1KGDA 2O52A 2HF9A 2CEAA 1EESA 2HJGA 1S9HA 2RMKA 3FE2A 3AF4A 5JSZB 4Q9HA 4NYMR 2GEUA 2GEVA 1XBTA 2W0MA 3CB4A 4NKRA 4NYIQ 3QENA 1IN8A 3FKSA 1G3UA 4YXWD 1DAIA 3ZS9A 2AXNA 5C4GB 2JLXA 3T1OA 2QZ4A 1OB5A 2VL7A 4D26A 3QXXA 5FR1A 5FOXA 1G8YA 3CNOA 3QNUA 2IT1A 4NMMA 4Q4AB 3R9IA 3B7GA 4GFDA 2CHGA 1VCOA 1SKYB 3TMKA 1L2TA 3B85A 4GZMA 3WYGA 1C9KA 1QHYA 4WZAE 2WJHA 1XWIA 1JPJA 1WRBA 4OQMA 1IY0A 1P9WA 1Z0KA 4EQ6A 4GT1A 4EUNA 3VR4A 2DYKA 4Q9IA 4LHVA 1M7GA 1XXHB 4DUGA 2C03A 4NPHA 4PQFA 1KZGB 1UPTA 4LX0A 5D3MA 2W6JA 3O8DA 2FZ4A 2H92A 1H8HA 2YC4C 3ZD7A 1QHNA 4MKGA 1CKEA 5L3QB 3GLIA 2QI9C 3EWAA 2QPAA 1Z0JA 5KDLA 4RCYA 4YONB 4DB2A 4US1R 1VCIA 3PQCA 3W5JA 4PQYA 4LI0A 5FBVB 1G7RA 5JJIA 1KSFX 4YMWA 2GA8A 4URVR 2FEOA 3U2QA 1GFIA 5JHHB 1J2JA 1ZNXA 3W5IA 2EVWX 1RPZA 1W1WA 2WWYA 2RGAA 3BORA 4PFSA 5L3SB 4QG7A 1GM5A 1GRQA 4EJSC 4NYJR 1QG4A 2PX3A 4ESVA 1SHKA 1AN0A 4OQXA 1LNZA 2XITA 3ZIAD 4DXAA 1ZMXA 2GEDA 3FYHA 3W90A 1PLKA 3PEUA 1JECA 4IVQA 1Z22A 1R4AA 3K0FA 4C0SA 2QL6A 2WBLC 3I92A 3EPKA 3MWKA 5AWFC 3I5YA 3ZYCA 3VU9A 1FP6A 4TLEA 5BYJA 3OEEA 5FOTA 2MSCB 2HXYA 2R65A 4A4DA 3KQLA 1YQTA 5JSZA 4MGKR 4U5XA 4DLRA 2OCBA 3JVUA 3VTKA 5DHFA 3OFND 2A5DA 3K0EA 3REFA 4D4LA 1MR3F 3RVBA 3DMDA 4BFYA 3QKRA 2ODBA 1EGAA 1R0XA 3LQQA 5JS7A 2QBYB 1HT2E 3GJ7A 3I4LA 3MUFA 3D7MA 2LKDA 1XEWX 3ASZA 3A1WA 5J5CA 2V55B 4QBHA 1UBCA 2I3BA 3RAPR 1ZM9A 2PX0A 1EFCA 2XZPA 5KSYA 2X1VA 4C2TA 3LW8A 1W36D 2KSQA 1YHNA 4TLDA 1UBFA 2Y8EA 4HUQB 4I99A 4QJ5A 4TT3D 2EYQA 1P9NA 3K0FB 3MFYA 2FFAA 2YWGA
chains in the Genus database with same CATH superfamily
4MKFA 3AFIA 1YQWA 1ID1A 2WHYA 2QGNA 1M0SA 2V3VA 1TD1A 3QBVA 4LE2A 4LRYA 3KJEA 3TQCA 2QXUA 3AL3A 3LA6A 5JSQA 2PZEA 1Z5GA 3G2LA 4MS4B 1MT0A 1X0XA 3GB9A 4W1PA 2NPOA 3FJYA 3I2YX 3RC9A 3TXAA 2PTGA 1Y81A 1EXNA 1XVVA 2QUZA 2QUBA 4JHLA 3O7MA 4Y2TA 3MERA 5FO0A 5JWOA 2BSQA 2XB2A 5E9WA 3SSNA 3L6UA 1CUHA 4G1FA 3NIBA 1YULA 3GQVA 2Z6VA 3H9EO 4INJA 4L15A 4FFPA 3DL2A 4E2YA 4RSMA 4URYR 1KDZA 1EFPA 3DA8A 4M38A 2BZSA 4UARA 3L0YA 1CS0A 3ZQ6A 1CR1A 1XCLA 4RO0A 1CY4A 3QEMB 5A9SB 1E3MA 5DP1A 2BGLA 5K0LA 1TVKA 4JLPA 4CDNA 1UXKA 2H06A 2FPXA 1E62A 1VJ1A 1QH1B 3LPNA 4K9RA 5FCDA 4BPRA 5G40A 1LK0A 1OU0A 1UOQA 1R0BA 2IYTA 3QEKA 4RA9B 5CM8B 1L5NA 2JHFA 3AR3A 2VAPA 2FPGB 4IDAA 3SE7A 3GRPA 5F4BA 1JSZA 4KCGA 2ZS8A 2XHZA 4HWPA 2NIPA 3U7GA 4QOHA 1QAOA 2VWQA 5A1TA 4LY3A 2GXSA 4PXAA 5FBHA 2NO7A 4WLNA 3GDHA 1ZXBA 5BXQC 3GD7A 4GKVA 3HH8A 1H94A 3Q6IA 3GRUA 3ZWPA 1E2GA 3KB6A 3ROQA 5ABPA 5BOVA 1P2TA 3PCXA 3W0LB 1IHYA 1YS7A 1XQXA 2XTNA 2BONA 2PZ8A 2V4MA 4CFSA 4CDRA 3BMQA 5EIXA 1IZYA 2XYHA 1V43A 3G89A 4FB4A 4IFIA 3BJZA 1N7JA 1XLWA 3WLAA 5M2QA 1N3LA 1OLOA 3L43A 3ROXA 2Q6TA 4LNUA 2FE1A 2G5CA 3SR3A 2JGIA 3EGDA 3UWDA 1KEEA 1YOVA 4FK8A 5HKKD 1KMMA 4J0EA 4OGFA 3OQPA 5CB4F 2DSNA 3GH3A 2EGUA 2Q5LA 3IEKA 3OM1A 3EGIA 1NVMB 1ZYUA 4FFSA 2DTEA 3TQTA 3MBOA 4EFKA 1OWPA 3KT6A 2XWQA 1DKOA 3GLRA 3ICOA 4J3FA 5J5AA 2PVPA 3LJKA 2ZI6A 4NCJA 2M98A 5DYGA 4BWFB 4FEGA 5JJLA 4F8EA 5LQAA 2P11A 1QZZA 1DBVO 1OREA 1G5HA 2ZRLA 2FUEA 1ZHFA 3E1GA 2XZTA 3EF0A 1KYVA 3D4LA 3JRXA 3PFHA 3FPCA 3EDMA 5FYQA 5WRFA 2Y68A 3ANXA 2B83A 3I28A 4LTNA 1DRKA 4GNRA 5CVCA 2TSYB 2XZLA 4BU0A 4EH1A 4HGPA 5G53C 1ENOA 4D4KA 1OXBB 3RVJA 3W6PA 2HA3A 2RGUA 1EFPB 3KKZA 2ACWA 4YAUA 5K8TA 1H23A 3CLHA 4D3ZA 4S05A 3B6EA 3ZLBA 1V7PC 2BGUA 4E30A 1EI9A 2QRQA 2CF5A 3A1TA 1A4XA 1L4NA 2GO7A 3R0VA 1VKZA 2FUG1 3R3UA 3L1UA 2WZBA 1V45E 3DCYA 1OGIA 2JAWA 1CIJA 3UQYS 2NLOA 4ICIA 4QATA 1FRQA 1T3LA 2FZEA 4X62B 4AB1A 3CG4A 5CCBA 2I2WA 1CQWA 2FN4A 5ALPA 3AKZA 3OZTA 1QK5A 3CSDA 3E0XA 1IEQA 1KDVA 1U8XX 4X20A 4ROSA 3AXTA 3WMRA 2FUKA 4HS4A 4FE7A 4D46A 2XZOA 3LY8A 2V54A 5EE9A 3VH4A 5C46F 3H0KA 1EWTA 1XXHA 2I6QA 2F4VB 1TYAE 1RZ3A 5JY1A 8LDHA 3JQ9A 5B5SA 2HI0A 3SCZA 2VYFA 4IP0A 3STTA 1YL6A 3G79A 4FBLA 3TZ6A 4DNPA 1C30A 1VJCA 1HMPA 2ZIZA 1Y42X 5AUPB 1SU7A 3LCCA 1UZMA 4UU0A 3H05A 3EWNA 3QVMA 5BNFA 1K86A 1J21A 1LSOA 5AOBA 4F4FA 3PENA 3SX0A 3RO7A 4D43A 1FU4A 4PYLA 1PJTA 3I42A 4JGGA 2WOJA 3GI1A 4IEFB 5LOVB 4Q15A 2IZZA 4D5EA 4ND1A 2JH9A 3TI7A 3I8SA 4F84A 1QHHB 1XZDA 4GZLA 4MTCA 1Z4NA 5DX1A 4EZIA 3D4PA 2HRZA 2K7ZA 1WVMA 3L6BA 2WTAA 4XWTA 4ENQA 3R7BA 1T5OA 2PRZA 2EFDB 3A1SA 3I5AA 5TGZA 1T35A 3C45A 1YA8A 3AT1A 2EP7A 1T0UA 2H5EA 2IXAA 2HV9A 1EIWA 1WP4A 5F2NA 3IA7A 3STUA 1FUYB 2NN3C 2DQYA 2ZI7A 3B6KA 1NMXA 3DYIA 1VKOA 2Q2NA 3K53A 4R9UC 4PLFA 1YHZA 4E11A 2B4TO 2HMUA 1P62B 2OLKA 4Z9XA 1L8AA 4TTSA 2JAHA 4OFWA 4EB3A 1IU9A 1HX7A 3B6IA 2RGRA 2QRKA 1P73A 3AP2A 4Y2JA 3ZEIA 5BUZA 2YQ5A 3ANSA 3F6RA 1QHEA 3OURA 4NSNA 4O08A 1K5HA 2IP2A 4OLFA 4P83A 4DVGA 1DPGA 1R4NA 4N54A 3SKVA 5A5GA 3NTQA 1CT9A 1CUFA 4EL5A 3WZLA 2UYCA 3JQEA 1ZC4A 4FYYA 4H08A 1N25A 4XA8A 4PCVA 2JHGA 2JGLA 2A0KA 4JGBA 3ITNA 3HQ4O 2CLFB 5CLHA 5DFAA 4JYAB 1Q0HA 5EZ6B 1WOYA 2I71A 1UZNA 4IH1A 4IJMA 5EJEA 5U4QA 3G49A 4LXHA 2CDNA 1GV1A 4MULA 1Q22A 4E4TA 3MXTA 3C8MA 3SJAA 3Q7EA 4NNPA 2V6JA 1AS3A 2NZWA 4DPKA 4HI0E 3KE8A 4GL2A 5ALEA 5BW6B 1GL3A 1KERA 1XU7A 3IAS6 4RD0A 2GPBA 1XZPA 2HKIA 4CG3A 2XR1A 3OWHA 4PGAA 4AS2A 2FPUA 2DR0A 1E7MA 4QNNA 3NVAA 1E69A 3CVJA 4F4CA 2QT0A 2VNSA 4R81A 3PCTA 5IXJA 2ZYVX 2V6BA 4PNHA 4JSYA 3QVOA 3LT5A 3QPVA 1NYRA 4YAJA 4OCZA 5GY7A 3MGAA 1NJ1A 2IYPA 4YRAA 4DMMA 1WUTA 3BXPA 3I01M 3TDKA 2A9RA 2JLUA 5HQJA 2OSVA 2ZUEA 1Z5WA 5HFJA 1QHXA 3OD5A 4M1SA 4XTCS 3LDUA 3U7QB 7AT1A 3KVVA 4JVMA 4MIYA 4QUHA 2ZWPA 2DERA 4YYZA 1P0CA 1NVVQ 3ZWMA 3K6SA 2WINI 2GESA 2YH2A 2GQ0A 3TCNA 5IT5A 2VAXA 4F56A 4YMGA 3F5DA 3AXSA 4MUAA 3RQSA 3K94A 1Q0SA 2A5JA 2VO1A 2PPLA 3JR7A 3RWOA 2G7MC 4GBGA 5GADl 1MRSA 1NR1A 1OLUB 3PF9A 4O0MA 4ZDJA 1XVTA 4TV9F 3R40A 4H6XA 5JPCA 1VGVA 2ISQA 2GGSA 2R6HA 4UD6A 4WPGA 3ON5A 1PEKE 3BE4A 4FFRA 3AJAA 1WULS 4TUYB 4ZU1X 1Z6PA 3DR5A 2FVYA 3E3MA 4S24A 4YO7A 3UWOA 1AY0A 4ZN6A 2UXBB 1VPLA 2E85A 3HUDA 1EJ0A 1T9BA 2BBSA 2OVFA 4XI9A 2NPFA 1XRNA 1Q1GA 2IYUA 3RUFA 1E1YA 4N5IX 3O8RA 1Z39A 3VHQA 3REGA 1HE2A 4C3UA 4Q3CA 3HJHA 2IP1A 3PNSA 3WGZA 1ZKDA 4C7XA 3TOXA 2WB4A 2HB6A 1CLUA 4IL5A 4G36A 3OE7D 2H31A 1T8UA 2A0WA 1EK0A 3EXHA 4LYYA 5HGXA 3THYA 1V1RA 2WIJA 1RR6A 3BMQB 1T9ZA 4LY0A 1JWBB 2GCNA 3QELB 3R8XA 4EF4A 4A3SA 1D7AA 2ZUWA 1LD3A 3TNYA 3WWOA 1G5RA 1WABA 4M8SA 1FFXB 3QPBA 3OKFA 3MWFA 3FCAA 3A9WA 1HBJA 1U8FO 4IJWA 2OBBA 5C5IA 1NVAA 2B78A 1OYYA 2PL5A 3JZMA 4PC2A 3P9RA 3KLOA 3U7IA 4KN9S 1A7JA 5C7OO 2P41A 1Y7LA 1AGPA 1JN0A 3NAGA 2O59A 3F4KA 5CDHA 2ZQ5A 2B61A 3MILA 4B3XA 3CBQA 1C7IA 2ZYDA 3T7SA 4WVLA 2FG6C 5J1SB 4MZDA 4FNMA 2IV3A 2PIAA 1WY7A 4J29A 4DA8A 5FWYA 2AYZA 2OORC 3MW8A 3EZYA 3IOBA 2QQEA 2N75A 1MAUA 5CJJA 2VKTA 3GRZA 1CQXA 1W88A 3FBTA 4JR0A 4J9VA 3BERA 3M6LA 4KFRA 4NBNA 4QLOA 4XGKA 4B83A 1QRDA 2KI5A 2WWIA 4K2HA 4M99A 1P0QA 4X45A 4Z6KA 1FYEA 4WFQA 1E1DA 2VYQA 3ZCQA 4E7OA 5ALGA 1WUYA 1PG5A 1G17A 1ODCA 3INTA 5CPBA 4V2IA 1L4BA 1WZCA 2ZTVA 2IFTA 3NDPA 5L3RA 2ZSIA 2JB9A 1FZQA 5DN6A 1DJPA 2PH5A 5F2EA 3QHQA 2Q8PA 4K6OA 5EYPA 1E6MA 2X86A 4ZQHA 2JLYA 2RGDA 5F5LA 2GDJA 4O4LA 3DV2A 3RV3A 3TTXA 5F5NA 5AJHA 2AF4C 3MTAA 1THGA 1HT3A 3ETHA 2O54A 1ZR2A 3PLAE 3VR6H 2FY8A 4X24A 4PNPA 1VQ1A 2ZSBA 1KI1A 1T4MA 3CXUA 1WW3A 1THMA 2IPAB 2Q8QA 4JA2A 3JZDA 2I2AA 1A27A 3EYWA 4L8FA 1CUUA 2FUNB 4ZO6A 2LDYA 4HC4A 3DO5A 1YJXA 5DXJA 4I3HA 3HN2A 1TQ8A 4YIKA 3N59A 3OFJA 1DU4A 3GJXC 1JF8A 1QP4A 2VA8A 3FMGA 2ZXFA 1XTTA 4M86A 3SKYA 4AQ7A 4BJ5A 3COVA 3CZRA 3CMMA 4KEAA 2HADA 2SCUB 4NV1A 1H3FA 7REQB 2OK7A 4COOA 3GT7A 1U0FA 1VG9B 1JPUA 1DEKA 2EKPA 2P67A 3QWBA 4FX2A 2NXWA 4CMGA 2PYDA 2YNMA 1J0EA 4E31A 2Z3VA 1UDWA 3V80A 3SICE 2Z43A 2JATA 3DHNA 5I4CA 2I1LA 2PU5A 1GKUB 1OC2A 2X7JA 1ZIYA 2O0MA 4H4CA 3UYKA 1IK4A 4XIJA 4AF8A 4E08A 4EUKA 2Q0XA 1TYCA 2Z5FA 4BKPA 2BR5A 3KVYA 4KQGA 2QNIA 2PGDA 3RC8A 4ND7A 1EX7A 2E82A 3GLKA 1NOKA 2F1JA 4LRUA 3K15A 4P2GA 1N2ZA 1XCJA 1XNGA 2NYUA 3SC2B 5IJ0B 1AQYA 4HGRA 3VDMA 5JDCA 5ALZA 4YJFA 2ECQA 2C4TA 1TTHA 4UBIA 3UJCA 3VDRA 3WL3A 2VYCA 4EMTA 4F7WA 1CJMA 1Z37A 4KQKA 2C4WA 2VJBA 1IBLB 2CUNA 4EECA 3JVDA 1UCFA 2O8FB 4JT9A 3TEFA 4QLBA 3DJYA 1MXHA 2XXBA 3RGWS 4M98A 1QU3A 4GXRA 2ZS7A 3D31A 4EHDA 1EFRD 1D07A 3KVOA 4WKOA 1O5TA 1FTQA 4ZJYA 3CEHA 2YZMA 1ADFA 1TC1A 4QD3A 1II0A 1TT5A 3THOA 4U8HA 1PZXA 1SQSA 2OK8A 3MOSA 4IWYA 3RNOA 2JLRA 2ZFUA 4JX9A 3A6PC 5LIPA 4ZDIA 1N34B 2AE2A 2YHSA 2RH9B 3FUCA 4O2BA 2CJPA 4RETA 3TIXB 3B38A 3RVOA 3EEOA 2C95A 1PDVA 1G20B 3JAWB 4L51A 1PNQA 4DTCA 1FC0A 2NO4A 4UPDA 4A0GA 5K20A 1GAXA 3UJNA 2QZJA 3GBSA 3KKMA 4O2RA 4DCNA 4DCPA 1RWXA 2MTBA 2YXPX 2ZRMA 3AR5A 4J2OA 4AULA 5C1OA 4FHZA 2OZLB 3D4BA 1IEVA 2AMYA 3CLRC 5ECWA 3NHWA 5B3AA 2XEXA 1LGYA 2PIDA 5DYYA 2ZRBA 3SM9A 3CONA 3CUKA 3EVDA 2EG5A 5LBUA 3URMA 4D9MA 2GNAA 5JNUA 3GA5A 3DDCA 1M67A 1O87A 4KMMA 4P54A 4TRNA 2O4UX 1NRWA 5AOCA 3GRCA 4HRAA 2EP5A 2J6HA 1PJ8A 3BUSA 1DS6A 1TM7E 5L9AA 4C22A 3K0AB 2RKWA 2AXQA 2RBGA 1OWOA 2WICA 3QF4B 4BRZA 3CGWA 1SULA 1J90A 3J7TA 1I24A 2K2QB 3HSSA 3Q9UA 5A4AA 4DG8A 1U9IC 1GDDA 1EHYA 3JQQA 2BUBA 3KTAB 4KZPA 5A9TA 4BNJA 1GQFA 1UBLS 4MRMB 4DZRA 2PE5A 4FNGA 1EIZA 1YCGA 2R4UA 4KAAA 2ZR8A 4GWKA 5JATA 4C4OA 1SCJA 3PNQA 3NBYC 2ZRFA 2WV9A 2I2DA 3MWEB 4UVDA 2O2SA 4HBZA 2NVUB 2G70A 4V0LA 4US2R 5EESA 4UPVA 5KHAA 5KYKA 4YRNA 2BGWA 3Q7PA 1UQTA 2CJWA 1KEUA 1POWA 4J0QA 2OQVA 1EBUA 2PBZA 4CM9D 3FLEA 3ZLTA 1XALA 1QX3A 5M04A 3QHPA 2SKDA 3OZSA 4EY6A 1WKVA 1WPGA 1KVQA 1XCOA 4NH4A 3N0RA 1R27A 3V1NA 2B36A 1OT3A 2Y1XA 1S89A 1UC4B 4AZ0A 2YKQA 3WB1A 4F86A 8ABPA 1TRHA 2GDZA 1G9TA 5GMOA 2FUG6 1F8GA 2B35A 2W2KB 3BDIA 4NPCA 4BLOA 1RDFA 1VDMA 1U0LA 1VL8A 2EQBA 4GLJA 3VOTA 2R00C 3HZHA 2F8MA 3ECSA 3H2YA 4IIEA 3DUFA 3CNQS 3FUVA 2C42A 3GDWA 4OJNA 4XARA 1EWVA 3IERA 4YCNA 4H17A 1GPLA 3WLLA 2A1UA 1X15A 3GJ3A 3DVAB 5E3JA 1RKUA 1TLTA 2QENA 1JQJC 2OC9A 1M1YB 4MMYB 4IDQA 1CP2A 3RLIA 3NIWA 1OASA 5FJJA 1GYQA 4R9RA 3VOBA 2IRWA 3LRTA 3JYOA 1G5FA 2UZ0A 4TMFA 3ZZMA 2ZBUA 5EUBA 1BQEA 2DTDA 5IASA 1W6UA 4ADSG 1E1RA 2P3QA 1PTJC 2VDWA 3BWXA 3EUWA 1YK0A 3K4QA 1IIRA 1AD2A 1LRKA 2JEOA 4QA9A 1EP1B 3OQIA 3RFCA 3SIXA 4DDVA 2AI2A 2GVZC 3SMQA 4MR9B 4KX5A 3LPLA 4RJJA 4HX5A 3CLSC 4MVYA 1DUVG 4GMFA 4IKEA 3B3AA 4KDCA 3WICA 2A88A 1UMCB 3GAZA 3Q7QA 4XDGA 3EZ9A 1UJBA 3SJCA 4LSGA 2JZCA 4CF5A 2FR1A 4ZODA 5J59A 1CR4A 4LC1A 3TRDA 3Q1LA 5TE9A 3UHPA 5BQPA 5H4GA 4X60A 4R51A 2RAPA 4UZSA 3ABQB 1EM6A 3EZ6A 4HEJA 1JHUA 2ZUCA 1FDRA 2V7VA 4X66B 4MYRA 5A71A 3U1VA 4BQPA 4WJLA 3R8FA 1A76A 1JIKA 3IVGA 4L85A 3TZLA 3T6KA 1WZIA 2XYPA 2GBCA 3AIMA 1OX5A 4U5QA 4WESB 1VJRA 5G1OA 4B81A 1LBSA 1C9MA 3VVCA 5E2BA 5AM2A 5ICSA 3NUZA 1ZUIA 3TJRA 1Y1LA 4DDMA 1PHPA 2EARA 1G3QA 3KPUA 4NE2A 3HVHA 4J43A 1MIOA 3AB7A 2PMEA 4ZCIA 1XZMA 2BBTA 3OZRA 5IDXA 2QGFA 4DR1B 4IQ4A 4B85A 3BRWA 4O63O 4EB8A 2VT7A 2CLMB 3S2IA 3UFBA 3WSTA 2BI7A 5LQCA 2UUOA 1YZNA 3C3KA 1IUNA 2NQ2C 2GZRA 3F9CA 3NM5A 2WUVA 4R2XA 3BJIC 5D7NA 3VR1A 1WZUA 2L2QA 2DUWA 2BMEA 3G1TA 3LCVB 2AQKA 2RARA 4AJLA 2EAUA 1W2GA 1V4NA 1VB5A 2O7SA 4BQFA 3Q2KA 1NI4B 3L7OA 4IEEA 2FAXA 3EW7A 4RZXA 1XP8A 4F60A 5BR1A 1DFHA 2NMVA 1JQAA 2I22A 3M89A 5AW9A 4BMCA 2DBZA 1YNOA 3WC4A 4L08A 2YICA 1ES9A 4UBLA 4NQZA 2QZ9A 1G66A 1KO7A 5E9QA 3HFRA 5DT2A 2O9JA 3ITDA 2GS9A 3ZKWB 1T2DA 3O7WA 4D9GA 4PSKA 2ANCA 2D2XA 5AO9A 5JD5A 1FJ2A 1YT5A 4TVOA 3TVYA 3AKCA 1IM5A 3USCS 3EIWA 3HL4A 4UAJA 4BB0A 2XXAA 1H8HD 3TZCA 3JZAA 5EJIA 3I9FA 2NU7B 3NS7A 4XQEA 1L3CA 2FSUA 4Y98A 1DBWA 3IEIA 4UEOA 1SXQA 1QCDA 2HMWA 4DLLA 1GZ5A 2C5SA 3QYPA 2WQZA 4D9FA 1L3IA 4ND3A 3OSUA 3BB4A 1NF8A 2G9RA 3OCJA 3TPFA 2WIDA 1E5QA 3K09C 2FPGA 2MINA 4RLHA 1EFRA 1J24A 3ROPA 4X8HA 1VPTA 2JANA 1HKUA 1MG0A 2HO5A 2QN6A 3WMEA 1MZPA 1CPYA 4EA9A 1Y33E 2PPVA 4TS3A 1GPUA 1W29A 2HK6A 2WFLA 3AIOA 2JJQA 1RQRA 2FSFA 2P79A 5JEEA 3UWKA 4R5MA 5LQRA 2DFVA 5JU6A 1CQZA 2CC2A 3I0ZA 4HEA6 2WF9A 3T7EA 4TZ6A 4KRGA 1W5EA 1Y82A 3UW1A 1VECA 1D4ZA 2VHCA 3QA9A 1MQAA 1QKKA 1GRRA 4K40A 4LJ7A 5AM5A 1JLHA 2D6FA 4J0CA 3BH0A 3HJTA 1U28A 3NAZA 1XDUA 2BJVA 4V03A 1KU6A 1P1HA 3QU2A 4FR2A 4YJ3B 2H9AA 5ECYA 1EU1A 3AU9A 3HB0A 4ZYUA 3B9QA 5DHAA 5TNXA 1K06A 4RENA 1HM5A 3MA0A 3TTYA 3DBOB 5BSWA 4LHZA 1A9XA 2HSGA 1YZQA 2C54A 3K0AA 1L7EA 4LISA 1T0IA 3NEAA 3GFGA 5A4FS 3FETA 2AR0A 3RYFB 4EYGA 1D6JA 1GAWA 1X70A 5I8PA 2O1XA 3GW8A 1M2JA 2MDTA 3AP1A 3GCZA 3KSAC 2W6QA 3E18A 3JZIA 4AG3A 2QXTA 5DYTA 2Y0PA 3P27A 1Z6YA 3G8BA 3M5PA 1JIJA 9ABPA 4NMXB 1VRVA 2YHBA 4ILEA 3X1JA 3L7DA 4TL7A 3DOOA 2EJVA 2R8YA 1XMSA 1N8TA 1DKPA 2B9EA 1SQ0A 2RGNA 1YJQA 1S4MA 1SGWA 4W9NC 421PA 621PA 1OZHA 1TUIA 2BCGY 1JG2A 1GG9A 2PQ0A 4BAGA 3E9QA 2R9VA 3AETA 4Q7LA 1VE1A 2HWYA 4TKLA 1GZ3A 3OZWA 5E8RA 1KI6B 2V6IA 3UTCA 4BLVA 1KR5A 1V95A 3C98A 4U2BA 1E6CA 3DHYA 2XUDA 1CVIA 3ZTYA 4WCFA 4UQOA 4RS3A 3PA6A 5T8KA 4BMDA 3EE6A 1KETA 1OROA 4E1AA 4XDZA 4IZIA 4LYEA 3IDAA 1R5OA 1K1EA 1WR8A 2BBOA 4KUHA 2UYHA 5HXAA 5LA6A 1CW2B 2BW0A 2PUGA 2IOYA 4URXR 3GGJA 1P81A 4QGFA 3ANLA 3MEQA 3Q3JB 4UTZA 3WAGA 2G9UA 1MEJA 2SNIE 3RYIB 1ZG3A 1ZWKA 3I2FA 3VX3A 1G4HA 4DLXA 2OUKA 3DLHA 2PGLA 4QVIA 4B1FA 4MB0A 1VRWA 2HDNB 1KJ8A 4PBSA 2PSHA 1BH2A 1WS6A 1BX0A 1N6HA 3DSRA 1BFUA 1NDQA 1VHQA 2Y1KA 5FD8A 4WI1A 1ZN9A 1PRYA 1SVLA 3QYFA 4M1TA 2R7NA 2G9VA 2YR0A 1HRDA 3PJEA 4R8MA 1XZKA 3AERB 2Z8XA 2A4KA 4QVKA 1BVHA 1BE1A 1KI7A 4QARA 1ZCAA 2ASEA 1MKYA 2C97A 4RPCA 5IJAA 1I2CA 3VX4A 16PKA 3R44A 3V7UA 4UOEA 2WHEA 2Y1CA 1SKBA 1O1YA 3KQQA 5EMMA 3GO4A 1G0OA 1Z6ZA 4HDSA 1OH6A 4DQVA 3N5CA 1WDLA 3NJRA 5DTIA 4C0KA 1G8MA 1OLXA 3GYBA 4DXHA 4DOMA 2YXDA 4GYKA 3I37X 4RTJA 3UPUA 3BT7A 2GPYA 3FY4A 2IYZA 1DAGA 3KXLA 4LNHA 4TVKA 5K0SA 5ER6A 1BMFA 3LMKA 5A7HA 5K7SA 3TNFA 2Z5VA 3KTDA 4MRNA 1O4WA 1WF3A 4PU0A 4U4AA 2AX3A 5JCPA 1TM2A 1OH7A 1P7WA 2ZRAA 2EJCA 2RK4A 1E9FA 3EGOA 5DU2A 2DG2A 1F9EA 1Q6ZA 1X7WB 4LYJA 4FONA 1ACLA 4KUEA 1KEKA 5J23A 4MRVA 3DZ8A 4HSEA 4IIFA 3DMYA 5JZ9A 1EEXB 2J48A 3HUFA 4OM8A 1Z18A 4TZKA 1MIOB 1JAIA 2C5AA 1TGVA 3VR4H 3ZWCA 2WT9A 4YAKA 2BI8A 2PGXA 1R4MB 1DC8A 2HRCA 3G0IA 5F1KA 4P93A 1U2EA 2YOFA 1Y8CA 1DLIA 5IDWA 4LWOA 1EQ2A 4MYCA 4AT1A 3JQGB 1YVDA 4C3OB 1ZQ9A 1NXQA 1AGRA 1JP7A 2IEAA 2Z2ZA 2XYVA 3LGSA 2F3PA 1YBVA 3QVWA 4JAVC 3WV4A 4B75A 3TKYA 4IO0A 1KVUA 4QU5A 1XTPA 1FU8A 4R0NA 1WKCA 3ONNA 2C7BA 1EFVA 1WVIA 4HDMB 2CZQA 3NG1A 4HZIA 2BI4A 1GSIA 4JJFA 1V5GA 4J9UE 1WF6A 1JU9A 1DBPA 3V7YA 2NUAA 1M2VB 5J4LA 1KHHA 2PT7A 2WWXA 5JEDA 5K6AC 1GA4A 1FFHA 2H48A 2AA3A 4KQEA 4JA0A 3WQSB 5LKAA 1Y9ZA 3WJ7A 3WBKA 1T0HB 2GN2A 2ATIA 4Q3EA 2ZK7A 3VU3A 5BN1A 3RKSA 4RAOA 1EXDA 1DELA 2NOAA 3EGDB 1YQGA 3TTTA 1VLJA 3DQQA 4B80A 2H57A 2W0SA 3DKIA 2HZ7A 3LG2A 1JQLB 2WTNA 1GA6A 2ZYGA 3ZZ1A 3WB9A 5CVUA 5J2TA 2O8VA 1APBA 1DEXA 2NV6A 1WLSA 3D6JA 2VOJA 5FLEX 1WPRA 4G67A 3QTTA 3RUDA 2IBTA 3EPHA 4J6FA 2DY0A 3OECA 1MOQA 1GG5A 4QVGA 4P4TA 5A3QA 4XX0B 3I2HA 2QMEA 3IFSA 1SCIA 2XE4A 2WYUA 2HUPA 4GMGA 3T9FA 4A2QA 4BLPA 3HJUA 4JL5A 4AWXA 1PEAA 1M5RA 3COYA 1HDYA 3U09A 2V6GA 2VHJA 1FVFA 2ZSEA 1H2WA 4GOJA 2C2HA 4M7PA 4W9NA 4Q03A 3UBMA 1NW5A 3U13A 1FSFA 1U8YA 1IVYA 3BX1A 4NH0A 5DK4A 3TW6A 4LJLA 4PX3A 1J20A 4YJDA 2Y66A 1UFKA 4B7AA 2EZTA 3AKDA 4ONEA 4HB3A 1WW8A 1MXFA 1ZM7A 2A7XA 3LHIA 2H5IA 5F2OA 1RBQA 2HBQA 2QVZX 2QG4A 4KE7A 2WJ4A 1V7CA 2Q21A 1QV6A 2AYYA 3DF9A 4OHMA 4WKNA 1THZA 2GRAA 2W37A 3FFXA 3AY7A 4A8TA 3X1ZA 4Y2UA 3VOAA 4BN0A 2F48A 2J09A 4ZMSA 1RYMA 1U9ZA 2GPNA 4YCLA 4TKZA 4OYRA 4LEIA 4KXUA 3S2YA 4D3DA 3EZ2A 1WHTA 2QOEA 4BFZA 3IBTA 3LCJA 3AUUA 3WK4A 3LK7A 4IF6A 4ZVRA 2V7XA 4HQ0A 4L22A 2JNWA 2QY6A 5JXHA 2WF8A 1QE5A 2YXNA 1IMOA 2DHRA 1U1GA 1ACMA 2P7IA 2CJYA 5C8VA 3AO0B 1EMDA 2IC5A 3PL5A 1LWNA 1AK9A 2Z9BA 3AJ8A 1E2JA 2W2XA 2YQ4A 3QLTA 4LAFA 4MW1A 2FEPA 4HQFA 3H2SA 1LNQA 2FA9A 1AG9A 4EB0A 3EY4A 3FCYA 4L72A 3FYUA 2MJLA 1L5QA 1TAGA 2O07A 2P5TB 4QYMA 2L0XA 2PRIA 3A9VA 3D81A 4TKVB 4ZYVA 2AKAB 1OBOA 5JLJA 1AU9A 3NHRA 3OJCA 1JHPA 1I2MA 3D02A 3OUUA 4GDMA 4C7JA 4DIMA 2JKZA 1OHHA 2HK8A 1FYWA 4WXMA 4D6PA 5LQDA 3A4YA 5IK2A 2FMHA 4KIUA 1JEYB 1DKNA 1L4KA 3GXBA 4QWMA 1YZHA 1JR3E 4FPXA 1PJLA 2FW1A 1H1LB 2CLEB 4XWAA 2WPDA 2GBIA 1IC6A 2E6UX 3KKKA 3LTNC 4RSHA 4EG1A 1E2EA 5AESA 4MUJA 5LP6A 3ZVMA 3F1LA 5E2AA 1Q84A 2C9BA 1GA1A 2XD9A 3QFHA 4RYLA 4TLMB 4ARZA 3RC1A 5I8ZA 3B2QA 4O5OA 5T3YA 2Z2JA 3D3NA 4FD2A 4JEIA 4WDQA 2E7ZA 2SCUA 2AI3A 3D7LA 3EAQA 3Q98A 4TV8F 5AICA 3UC5A 4CU5A 1U7ZA 2JLQA 2O4CA 3NTVA 4U7HA 2ZJOA 3PDWA 1VBMA 1LU9A 2Q5FA 1J22A 4QDOA 1FDIA 4QU0A 4F2WA 1XWWA 3TAHA 3LYAA 5CDGA 1YDGA 3R7DA 2ZTMA 4XGRA 1Z06A 1O58A 1YD7A 2Q1SA 4ETMA 2X6QA 3BREA 3HM9A 1L5VA 1SBCA 5K0FA 2B2NA 3PEWA 1VZ2A 1BMQA 2DBQA 3DKPA 4LJ4A 4LZJA 5G4LA 3SY8A 4E3ZA 2A9FA 1ZK0A 4AO7A 4OBWA 3EQ2A 4BDTA 4ZAGA 2HXGA 1IXSB 4KIGA 1T2CA 4O1MA 3HC7A 4Q00A 3T0IA 3VO1A 5LWHA 1NJFA 2VJDA 4J7UA 2DKFA 2W6NA 2NT3A 3DR3A 4YJFB 3R3YA 2IIVA 2J0UB 3DL7A 3SIPA 2PX5A 4UUMA 3J80A 2WWRA 1U3CA 3QOFA 4I1VA 5FRDA 3OQMA 2LIPA 1FRZA 1UMBA 3JYLA 1KY5A 2ZCVA 3EIOA 1RLMA 4CG0A 2H9IA 3SDSA 3NVKI 2IY9A 4PG5A 1QRUA 5LR6A 2YJGA 1QANA 4YCJA 3WLKX 4A0SA 4YRIA 2YOGA 1M7HA 3OC6A 5C1BA 1R6DA 3F5MA 5H4HA 5BNWA 5KWIA 4I4NA 3WLQA 4ZOLA 3L1IA 3N8GA 4LFAB 3H2HA 3RS4A 1E7YA 2JAPA 4YCDA 3D0KA 3UAGA 1WXQA 4L07A 3ITEA 3L77A 4LY6A 4RX1A 3ESZA 5AI8A 5K3AA 4DY4A 1IUKA 2OHIA 4J1QA 2JASA 4C7VA 1UR5A 4AZTA 2VDPB 5KPDA 3AJEA 1JAXA 1A50B 3B9RA 3NW9A 3T7TA 3V4ZA 3TG2A 2OM2A 3U37A 2HU2A 4NU0A 1HMYA 2IYYA 3HBMA 1MFZA 1YH3A 2Q7DA 5DYWA 2GHIA 3ZYZA 3WYCA 2FDCA 4G1VA 2I2FA 4TTAA 3EEQA 1OY1A 1KU0A 1QYIA 3W3ZB 1E8NA 3AVUA 1PD1A 4IG9A 4LRQA 4R2WA 1WXHA 4GXNA 3K1JA 4PFQA 4B4WA 3K9CA 5EGSA 2ECPA 3U60B 4JMPA 1PSZA 3TLJA 2HJSA 2QTRA 2EU8A 5LQKA 3K70C 1L3BA 2O8NA 1C3EA 4AS1A 3QPWA 4ESHA 3UMMA 1Y1TA 3B13B 4QC2A 3WB0A 1Z4QA 2W6ZA 1BCSB 3STVA 4OX9Y 3MCUA 2J3DA 3LNTA 1ZZEA 1L7NA 3ILVA 3R5FA 2QT1A 4ZVQA 1ILWA 3HR4A 2BKVA 2X77A 3ECCA 1QFSA 1T10A 1FFEA 1YAHA 1Y1SA 4Q3BA 5DBGA 1P0MA 1HFJA 3RBAA 2BAGA 2FN9A 3KZNA 4DQLA 4ZJZA 1XEWY 3ZR4B 3P0JA 3TTWA 1H9BA 1Z0FA 2WE7A 2OGZA 1C1DB 4QXQA 2XDYA 1E64A 4TWJA 3LVQE 3A1UA 1TQHA 2YINC 5B7QA 1UBHS 1FXWA 2WF7A 5BWMA 1WB9A 1GCUA 2RI0A 3PGLA 1P45A 4FMDB 4ALIA 3K71B 1NBMD 4CQLB 5HF8A 4OGLA 2DKOA 1I3LA 3WBFA 4MV8A 4YMHA 3H16A 4BNXA 2PKEA 3M1LA 1MJNA 4Y2YA 5HM6A 1DEHA 2IWRA 4EM6A 1NN5A 2WIKA 3NASA 5HKLA 1I14A 4DNOA 4XVHA 3HCRA 3GP8A 4IUBS 1MQSA 4HNAA 4ZD6A 5KB3A 1N8SA 4NABA 4ASUA 2VYVD 3PR2B 1YI0A 4B7XA 1PK7A 2Z2IA 1W8DA 1NU6A 4H4DA 3TI9A 1Q7GA 4QJ3A 3OKCA 1Q3TA 1M1YA 3KOXA 1I2BA 3Q6NA 2PQMA 3IAM1 2CLDX 3OZBA 4RTRA 3A2MA 2CB0A 3AF3A 4BNFA 4RTLA 4W1RA 1RXSA 2EW8A 1D5WA 1X8LA 4KP7A 5DHQA 1T4DA 2GMWA 3GROA 3QVXA 4MVWA 3HBFA 3BRCA 4OXQA 1O0CA 3PNLA 3GFOA 1BHQ1 1W25A 4XWOA 2AB0A 3BPSA 4Z4IA 1UFVA 2V0CA 3OLXA 4PAOA 4QUGA 1WUHS 4BC0A 1Q12A 3OE5A 1AQUA 3E9NA 1JLMA 1UKEA 3DDWA 3IAHA 4KDRA 2AJLI 1HSOA 1VL5A 1V1JA 3BEDA 4KVZA 2ZE5A 3U39A 1KY4A 4Q3OA 3OIYA 3PYMA 3U3RA 3ZHQA 5K03A 5LLDA 4I81A 2Z5GA 1KAMA 3MS7A 1JV2B 4Q4JB 3R8CA 5LMNB 1UPUA 1N1DA 1YS4A 5JJCA 3FLBA 1CB0A 1V2HE 4I55A 3CO5A 5BOSA 5IBPA 1PFUA 2JF0A 4Z7NB 1W96A 5IFLA 1E2IA 4TTTS 2ATEA 3IAEA 4XIFA 2Q99A 2XGGA 5KMGB 3FOAA 2VHXA 3KJHA 4C6RA 2XUZA 4GUAA 4CKYA 5DM2A 4ZFNA 2AZXA 1RM3A 1YVRA 2CXQA 1HRKA 4IS2A 4KXNA 4ZVTA 4DQUA 4PYJA 3O93A 5JH7B 3NC4A 3QE9Y 1S96A 4O4IB 3ZIAA 2O19A 2VHTA 2AZDA 3QTLA 1BXRA 1HEIA 4XWWA 2GCGA 1NL3A 4MVXA 2ZRIA 4JJGA 5IM4F 2G80A 2BEWA 3HB9A 2IHUA 4GPD1 3ZZUA 1E2HA 2O06A 3THYB 1NR7A 1TDJA 1Z2AA 4IIDA 4EK9A 2YRWA 3ASYA 2V8BA 3G88A 3V3TA 4PN7A 2BGMA 1WEKA 2VPTA 3B1VA 3PQDA 1G2QA 4Q7QA 1L7VC 4KX3A 3WNVA 3RSZA 4Q3AA 3IBYA 1I7DA 3OE7A 3QLVC 3ELWA 4M22A 4YDHB 5K5EA 4ZZ3A 4BO9A 1NSFA 2OZKA 2P91A 2WSSA 4OFZA 4A1OA 4DQXA 1UKYA 1KZ7B 1QOPB 2G9ZA 4RELA 4CMEC 4G0YA 4BIMA 3EZX