4PPGA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-br
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
329
structure length
311
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 311
sequence length 329
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppgA01
1OV4A 1Z6XA 1GL6A 3ZVMA 4GP6A 5IDVA 4BLTA 2WKRA 5FPHA 4G1UC 3RSLA 3I5YA 4AG6A 4EJSC 5FR1A 1HURA 1E99A 1J2JA 5KDOA 5KSOA 1AK2A 2EU8A 2PZFA 3QG1A 5AJWA 3IBYA 2CVFA 2H17A 4KFTA 2VF8A 2VRWA 2IYRA 3HU2A 1N5LA 2QMEA 2QM7A 4Q19A 4RZ3A 4G0NA 5J40A 4C3ZA 4LJ5A 3K8YA 1NKTA 1VCIA 2BVNA 2GHIA 4Q7MB 4TMTA 5JMTA 3KDSE 3GLHB 1F5NA 3ECCA 4YC7A 4F4CA 4NYMQ 1PZNA 4V0MA 4XWKA 1ZNYA 3IBGA 3NWJA 4M9SA 4XD7A 3FB4A 1D6JA 4KCGA 1IOZA 1Q22A 3W34A 1NNEA 4DDWA 3LNCA 5KYKA 4N0EA 5F98A 2GETA 4UJ3A 3TR5A 2IXFA 1W4CA 1OXVA 1C1YA 1DAIA 4LC0A 4TLBA 4EPXA 3T35A 1W2GA 2G83A 4LJ6A 2E1RA 5BN5A 2BM0A 1HE1C 2XOKA 4ESHA 4US2R 3EPKA 3BB4A 2WV9A 4OQNA 3EPHA 3SS8A 1TUIA 2NO1A 4RY2A 1X6VA 5CLQA 5FTLA 1W2HA 2BHRA 2IS2A 3FGNA 4PC6A 3NKVA 1NN0A 3HU3A 3L0IB 1DO2A 2N42A 4IDQA 4JSYA 1VYUA 4YMUA 4L8GA 2QQEA 1QVRA 1VIYA 3C4JA 3R9WA 3MJHA 1MOZA 3P1JA 4Q4AA 2X19A 1XMSA 4XD7D 2IYLD 1ZM4A 5FL7A 2QQ0A 1AKYA 3OE7A 2ZSBA 2OE2A 4Q9KA 3WHLA 3EZ9A 3KJGA 4KYIB 3F0TA 2EFHB 1E9RA 1RKBA 2W6IA 4Q1AA 2XB2A 4A6PA 4MRRA 3GJ8A 1LS1A 1VECA 2XOKD 3K70D 4IVPA 2BM1A 1T8UA 1BS1A 4M21A 1Z2AA 1FTNA 1Q3HA 1KO5A 1VCOA 2A5YB 1EG7A 2KWIA 1CRQA 2HT1A 3A4NA 5L8VA 4BEJA 1CJKC 2CDNA 4JMPA 1SULA 2F9LA 4A6XA 2ZRLA 1ZP6A 4FCVA 1CIPA 4HLCA 2ZR0A 1LB1B 3EZ2A 3OE7D 4QGGA 2JLSA 4EPYA 1WMSA 4WBSA 1VG9B 1ZC3A 2GDJA 5BQ5A 3SYNA 2W6ID 3NG1A 2EQBA 3O8DA 2LWIA 2B21A 3AQ4A 5AUPB 5KHOC 2ZAMA 4PPFA 5AUQA 3T12A 2EWVA 1XZQA 4K81B 1S0UA 2ZS7A 4M1WA 2J59A 2GXQA 2FE4A 4HB3A 721PA 2KB0A 3C8UA 1W36B 4JLVA 4UNRA 4V0KA 3FOZA 1IBRA 2BMJA 5J5CA 3GP8A 2W2VA 1N0UA 2RGCA 5BYJA 1CF4A 4URVR 5FTMA 2FSGA 1S1CA 1YR8A 1NBMA 2MSDB 5GJBA 3QF7A 5TV2A 5KSYA 3BXZA 4QM7A 3NH6A 3BB1A 1A2BA 3VR2A 5DI3A 4HAUA 3MLEA 1YZGA 4TN1A 4POAA 1GOTA 3ZGXA 1JQLB 1P5ZB 5CJPA 3X1DA 1JEDA 3QENA 1KHTA 3GJXC 1NRJB 3B1WA 3PEWA 1BO6A 3BS4A 4XSGA 5HZHA 3VU9A 2F3RA 4M1MA 3O8RA 2Q9CA 2GXAA 2ZAOA 1DADA 2RGAA 2ZRNA 1CJMA 4B73A 2YWGA 2QE7D 5C18A 3K9LA 3QKSA 1N0WA 4A0RA 1AZSC 4W5WA 1SXJE 1W4RA 2GCNA 4Q18A 1KO8A 2B92A 2RCNA 4G5RA 3I72A 2ZUCA 4XWAA 1TADA 1XEFA 1NP6A 4F38A 1Q0UA 2ATXA 1XBTA 2C99A 2V6JA 4P0TA 4TLCA 3W3AA 4QRHA 4URYR 1MT0A 4MRSA 3C41J 3O8BA 4BZQA 1FP7A 4C2TA 1LF5A 1XNJA 4L16A 2W2XA 1G5RA 2B8WA 4NYIQ 3WNDA 5JRZA 1GITA 2BEKA 4JYCA 4RD6A 4BFYA 5G53C 3VKGA 2WM9B 1S3SA 1YVDA 5EP1A 1EXMA 2C2HA 2ZREA 3B1YA 3K09C 3X1ZA 2FA9A 4CEJA 4PPNA 2HCJB 4ZV4A 4M9ZA 1ZNXA 2R2AA 3LV8A 1S8FA 4GZMA 5KSZA 5P21A 4HYYA 1DTSA 5DO9A 2Q21A 5AJYA 1SVLA 5KDLA 2ATVA 2OFOA 3EG5A 3LXXA 4WXRA 2CVHA 2BKUA 2F1HA 3X1XA 1UBCA 4HAZA 2QNRA 3H86A 5KPDA 1B0UA 1YU9A 4XWOA 3PG5A 4NYJR 4PQRA 1S4QA 3FKSD 5DYIA 1G5PA 3DDCA 2B8TA 3NBZC 4PHFA 3DPUA 4DWJA 4KXFB 1GL9B 1CU1A 4FWIB 4KSBA 3K0AB 5J4YA 2C95A 3MG9A 1XPOA 3U4QA 4V0NA 1KY2A 3AVQA 3E70C 3M6AA 1HV8A 3Q85A 3PEUA 4HAXA 5DHFA 1G4AE 3SQXA 3PEVA 4R98A 4V02A 1DOAA 2XB4A 1E2MA 4HLDA 3NDPA 2W6JA 2ZI5A 2F6RA 1J99A 1V43A 2RMKA 3QF4B 3QUSA 4PC2A 2OFXA 1YKSA 1CJVC 2I3BA 4URXR 4FW9A 5FI1B 2YOGA 2HUPA 2OO7A 5AJXA 2LKCA 4FMBB 2VIIA 3IO3A 3LDAA 1MKYA 2YZ2A 1G41A 2PT7A 5K8LA 4C2UA 3ADBA 3EZ7A 3ZVNA 4B48A 1HE8B 3ND8A 1GKUB 4Q03A 4FD2A 4M9QA 3K09A 1IJEA 4NP6A 1L4YA 1NN1A 3EZFA 4FXPA 4Q9JA 2D4HA 3THYA 5CJ2A 3LA6A 3OIUA 1CBUA 2B6HA 2W6JD 2ZI7A 4LHZA 2ZITA 1NIPA 1G3MA 1U8YA 2L0XA 1KYIA 2PCJA 3RS0A 4DLRA 4Z1MA 1E0AA 1Y63A 2MMCA 1W48A 2P67A 1KMHA 4KODA 2TMKA 1X8JA 4D4MA 1LV7A 1ZMXA 4JL5A 2VF7A 3FYHA 3LLUA 4GRAA 1AZTA 5FH9A 2AD1A 1CJTC 2CHVA 3DMDA 4DLSA 4KBFA 1DAHA 3KTAB 1ZU4A 3SEAA 4EKDA 4NDZA 5EUQB 2R6AA 4QJ3A 1E4VA 1KDOA 4LPSA 4TMXA 4F4IA 2XXAB 2ZJBA 3B78A 4EAQA 2X2EA 3K0EA 2XJ9A 4FI3C 1G7CA 3W90A 4Q1CA 5HZKA 5KNBA 4AWXA 1DG1G 3B8HA 1WQ1R 2JLRA 3H1TA 4MYHA 4Q1EA 2ZRJA 1E2QA 3F5FA 3GLGE 2FFBA 1XP8A 1XD2B 1TQ2A 4B71A 3AVTA 5D3QA 2W0MA 1OT3A 1T5LA 2VHCA 4A2WA 2HLDA 2IS1A 3GJ4A 1OPXA 3K0FB 3BFKA 5B64A 2EFCB 1ESNA 4TL8A 1E9FA 4IDPA 4K46A 3OAAD 4QBFA 3KUCA 4NCNA 2Q0HA 1OYWA 3AM1A 3PR1A 1UM8A 5G3ZA 1JJVA 1OIVA 5J4KA 2GKSA 5CITA 3N70A 4QHSA 4URUR 4DCSA 3A8TA 1DAEA 1AN0A 3P26A 4MUAA 3AVYA 1FX0B 2QEQA 1YR7A 4EDHA 1UJ2A 1SVSA 5JS8A 3QEOA 4PHTA 2Y8EA 2QSYA 4C0HA 2P3SA 1S9DA 4GDFA 3QG5A 2HLDD 1NLYA 3QVUA 3IIKA 4C30A 1BH2A 2F43A 2JDIA 4FWTA 1RRPA 1X86B 4XVQA 1ZIPA 1ZVQA 4GT1A 4KFSA 1IN4A 3CZPA 4US0R 3GD7A 1EESA 1D2NA 2IW3A 1JECA 3CWQA 4DT1B 3THWB 3LBHA 2ZJ5A 5A4JA 4AC9A 3CRQA 3W5IA 1E2GA 5J4VA 2G0TA 4ESVA 4MQBA 3UATA 5E7IA 3B1ZA 2OBLA 2ZE6A 2PZEA 4FMDB 1E2IA 1ZM7A 4GMDA 4MITA 4Q9LA 5EP4A 1IAQA 4CZ2A 2AKAB 1OKKA 1W0KA 1Q1QA 1YZTA 2QM8A 3TUZC 5JJLA 3AVUA 2P5SA 1JALA 3WHKA 3RSOA 3B60A 2VEDA 2PEZA 4UNQA 1SXJA 4DSOA 3WP0A 4PR0A 1G7SA 1ZAKA 2JDID 5FTKA 3EA5A 1KDPA 2O5VA 2X77A 3LFUA 2CJWB 3GEIA 3WXMA 1E1RA 3A4LA 1II0A 1QZXA 2RGXA 5IHPA 2FPLA 4DHEA 2BBWA 4KJZA 2KBEA 1U98A 2WJJA 4DCTA 2OCBA 1E2DA 3PUYA 4MGIR 4DDUA 4KV9A 4PQFA 1T6NA 3SNHA 3KKPA 4IOMA 1IN5A 3DZ8A 3CPEA 1XCMA 2ZROA 2D62A 1GM5A 1SQ5A 3TSWA 4RD2A 3UWOA 4V0ME 4QGAA 1W0KD 1D2EA 1M6NA 4JLOA 5EZ5A 2O0HA 3BRWD 2PT5A 1VTKA 2ANCA 2QPOA 2NGRA 1U81A 1Z0DA 3NBFA 1TL7C 4I4LA 1SXJD 1D9ZA 2QPTA 4FIDA 3BH0A 3EC1A 5IRCD 5FTNA 2PMKA 2VP0A 4X8MA 1T8TA 1E1RD 5JFGA 4LYAA 2RHMA 4C0SA 1JQJC 1W1WA 4QXAA 4XTRA 2AXNA 1S9HA 1AA3A 1VG8A 4H1UA 2XNSA 3U7FB 2O8EA 2YYZA 3SFVA 3FKQA 1XD9A 2N1BA 3M1IA 3OF5A 4DLVA 4JLBA 3QI2A 4LDJA 5KU1A 1VHLA 4I81A 1I4DD 3SJZA 2AXPA 2VA8A 1P4SA 4B2PA 4HDCA 3M4YA 2HEIA 2X8AA 3UANA 4RD3A 2ZJAA 1KSFX 3KQNA 2NG1A 2CCGA 2JATA 1MO5A 1KO7A 1R0XA 1N5JA 4JBYA 3PEYA 1Z0KA 3T06B 1W36D 2WVJA 1G20E 5AWFC 5H68A 1XEXB 3RHFA 1F2TB 2ZJOA 2IHYA 3TAUA 1CRPA 1NKSA 3RDPA 3C16C 3KQUA 1KK1A 3KQKA 2EWWA 2A9KA 4HI0E 4JLMA 1XMJA 5JSZA 2EFGA 2WHXA 4AIIA 4B76A 1SKYB 2BBSA 2J0SA 3ZZ0A 1RW4A 1UBEA 3MD0A 4PPQA 2OEPA 1Q20A 2LKDA 3LW8A 4Y0AA 5AUOB 2QGZA 1YE8A 4AKEA 3WBKA 3VR5A 1XJQA 4K8OA 3CF6R 3V9PA 2H7VA 3QIAA 1IM2A 4GNKA 3BAFA 4PC7A 1GIAA 4KAXA 2JJ8A 4QM6A 1Z28A 1E2JA 1AA9A 4DDVA 2WTUA 3VFDA 1SVWA 3EASA 4D2IA 4G5SA 2XZLA 1VIAA 2H57A 3TE6A 4L9SA 2DFTA 5JCZA 4RFSB 2FSHA 3SDZA 4JLKA 4TL7A 2ZU6A 2V4ZA 4KVAA 1SKQA 4B3BA 4RVCA 5IF9A 1Q1ZA 2D7CA 3VMFA 1KY3A 1G19A 2ZI3A 4TYQA 4ZI3A 1GL7A 1KJWA 2Q9BA 4Q5IA 1TF2A 2OCAA 3GLIB 2XZPA 3WY9A 2VP2A 1ODFA 1TU4A 1T3SA 2HV8A 3TW8B 5JRJA 3VX4A 2ZS9A 4Z8YA 2YVUA 5DE3A 5TVKA 3CONA 3QQ5A 1ZINA 4Q7JB 5FBRB 4LHYA 2HXYA 3BH7A 2W83A 1KSHA 4IVQA 3U6KA 1OH6A 2NQ2C 3KXKA 2DCUA 4URWR 2J7KA 4G3XA 4U7DA 8OHMA 4LX0A 1OF1A 3AEZA 3WMEA 3GLGA 1KJZA 3K1JA 1RJ9B 1QVAA 3CM0A 4KBGA 3TJZA 3WYAA 3K0AA 4BFSA 2QBYA 4C0BA 2R44A 2X2FA 2P6UA 4LJ9A 3TKLA 5FPTA 3WYFA 3W8RA 4FMCB 1XFAA 4BLOA 4KI0A 2DWPA 4V0OA 4R9UC 1KAOA 4BUJA 1G291 5EXSA 4GOXA 1K5DA 2QAGB 2YC4C 2NIPA 3GEHA 2O8BB 3U3KA 1IY1A 1Q3TA 2OAP1 5JBQA 1EFTA 3NIBA 4LJ4A 4D81A 1DAKA 2FJUA 3P4XA 3Q9LA 4CIDA 1QHNA 2UKDA 1KI2A 4C0KA 3NDBB 1K8RA 3QKRA 1K6MA 3MUFA 1XTKA 4GFDA 1XPUA 1EX7A 5F9FA 5GVRA 1ZC4A 1R0ZA 3LD9A 2GTPA 4BLRA 2DFNA 3GLFE 2NOAA 2G3YA 2QMHA 3LX8A 4Q7KA 4XIGS 4YDSA 1COWA 1E0JA 2FPMA 2PEYA 4M1OA 5J4HA 1ETUA 3QBTA 2PL3A 4B43A 4YMTA 1S3GA 1Q57A 3KXIA 5L3RA 2QA5A 4JYBA 1NG9A 1NSTA 3WMFA 3R8CA 2XZOA 1DEKA 1IY0A 4B3GA 2WKQA 2ERYA 1FMJA 1Z6AA 2QY9A 3ND9A 1FL9A 2AKYA 1UBFA 2J41A 3RWMB 1N5IA 4WZ6A 4HB0A 3K70C 4Q4JA 1OH5A 1BKDR 1B23P 1ZM9A 1CS4C 3CO5A 2HT6A 1KMQA 3B1XA 3ZZTA 1XEWX 1U9IA 3IQWA 4TYYA 1P7CA 4I1OA 2D2FA 1P3JA 2D06A 4E07A 4BZXA 2CL7X 3IQXA 3ONWA 4CEHB 2QP9X 1COWD 1FMLA 1CJUC 4OJKA 2DWOA 2V1XA 3BFVA 2VHJA 1JR3E 2ZANA 221PA 4NKRA 3IPXA 3F8TA 1R0YA 4O2RA 3C15C 5IK2D 1MO6A 1YRBA 1YZLA 4L9WA 4XTCS 1AIPA 1E2PA 2ZSFA 2O8FB 2AHOA 5J47A 2WAYA 2CLSA 5KSPA 4E22A 4ZCIA 1A1VA 3CW2A 4LOAA 4BFZA 1XTSA 4DRZA 4AD8A 2GESA 1JB1A 1KO1A 1P2TA 2RGGA 4DXAA 3OZXA 1Q21A 4TYPA 4OI1A 4G5QA 3TUIC 3AKYA 2BDTA 4JIMA 4KFRA 4RD4A 1H65A 4B3CA 4JKYA 3PENA 3EC2A 5JHHB 3CR8A 1E32A 2FGKA 1Z6YA 4LY6A 1I2DA 3CX7A 4XVUA 4AYXA 1CR0A 2GVDC 1UEJA 3AKDA 4NPHA 4QHTA 4MH0R 1A7JA 5DGXA 2V7QA 2IWRA 4JLJA 1I4TD 2WMOB 5SZHB 1U99A 4IOJA 4A2PA 1FQKA 2GILA 3MFYA 4I1UA 2VH5R 2C5LA 4DEXA 1D9XA 3TQCA 1TAGA 2RGDA 2ZR7A 2CE7A 1R5OA 2JEOA 5B58C 4BE7B 1Z29A 1BOFA 4RZ2A 4PSVA 4Q9HA 3PV0A 3SJAA 2J5XA 1XJ0A 2QI9C 4GPTA 2Z0MA 4AYWA 4E09A 2IEZA 3QXSA 5CIQA 2A3RA 3AF0A 1E2LA 1R5BA 1T0JB 4URZR 3ZS8A 3AVWA 3Q7PA 2OBNA 2QT0A 5A5GA 2KBFA 2QN6A 3CLVA 3OEEA 2V7QD 3DMNA 3GFTA 2A7QA 2DFLA 3WRXC 4NYMR 1QHIA 5FTJA 4B34A 3LO5A 3J81k 4M53A 1JAHA 1W44A 3RS2A 2WOJA 2OAQ1 4RJLA 5FUVA 1JR6A 5EE3A 1NMZA 4HEJA 2GJAA 2YJTD 3ZS9A 4M1SA 1XWIA 3C5HA 3UKDA 2ZRKA 1M7BA 1OFTA 3TUJC 3ZDQA 4TQAA 4DZZA 2D3WA 5E4FA 4DVGA 2XEXA 3AVXA 2ZM5A 4W7SA 4DB2A 2IF0A 2OXRA 4IVRA 1W7AA 1SVIA 1NY5A 2IUSA 1OFIA 3TNFA 3RABA 4LYFA 4IXNA 4PFSA 4IDHA 5FOSA 2DFKB 4NTZA 3OEED 2JLQA 2RGBA 3VTKA 3OESA 1M7HA 5EZ6B 1KKLA 4HATA 3GLHE 4D0NA 1GRNA 5DLQC 4IOKA 3O47A 3WRYC 1KTVA 1KI6B 1VPLA 4LJ7A 3TRFA 3KFXA 1MABA 4EFMA 4OQFA 5E7MA 3X2SA 3VX3A 1GSIA 4C4PA 1RZ3A 2QE7A 2GZHA 1Z22A 4QKQA 4O0MA 1MO3A 1DPFA 2FGJA 4Y0VA 3RRMA 1XXHB 2W58A 1ZD1A 1WDTA 2VPPA 3IUYA 5GJWC 4D4KA 3IEVA 3Q7QA 4CGZA 2YOFA 4ZDJA 1XMVA 3IILA 2OUKA 1GNPA 1KNQA 2N46A 4ZCLA 3LXRA 4TQUS 1LY1A 3AGQA 3QVVA 1BYUA 2CCKA 4OI2A 5LD2B 4JLPA 4KU4A 3LY5A 2OCYC 4GOJA 2CL0X 4RZUA 1VHTA 1DVRA 2G1KA 1XX6A 5E7JA 2X1VA 3HPQA 4PX9A 3CX6A 3PXGA 2R62A 2F9MA 1J70A 1TEXA 2O8DA 1G8FA 2OM2A 1JBKA 1P61B 4D25A 3JZMA 1UADA 4Q9IA 2JIZA 3T1VA 1OXSC 5C4MA 1CKEA 2CL6X 2ONKA 4LK2A 5L3SB 5L3QB 3H2YA 4YQFA 1E9DA 3KJHA 1UBGA 3B9QA 5HKKA 4E03A 1R6BX 2QT1A 1XEXA 3IIJA 1F2TA 1GZSA 1UF9A 4R7ZA 5SZIA 1PVOA 3I4LA 1RRFA 4ABYA 1E69A 2FWRA 4LRWA 4P4SB 1R4AA 4TMWA 2HYIC 1OIXA 2AR7A 2ZRDA 1BYIA 2GRJA 2IK8A 5JHGB 4YDHB 1L8QA 3UPUA 4P3YA 4MYCA 4OKSA 5L3VA 1XCGB 3U44A 1RRCA 3FKSA 5TB5A 5K8TA 3GLFA 2VL7A 2JLWA 3I3SR 3HYTA 3A1SA 1EFCA 3UG7A 1M34E 1AS0A 1C9KA 2BJWA 2JIZD 1P75A 3R7WB 1ZRHA 3AP2A 3IHWA 1U0JA 4J0QA 3E2IA 5B57C 1N3BA 5HKKD 2F1RA 5AK0A 4ARZB 1X8LA 4OHWA 4UXIA 2JA1A 3NEJA 3QSYA 2GK7A 3GJ5A 4RFSA 5HR5A 2ZRHA 1E2HA 2ZJ8A 4CW7A 2I1QA 3KJIA 1NJGA 2UZ3A 1VG0B 3OIYA 3FPAA 5C46F 2R6DA 2ZI6A 3EARA 4PZZA 1Z83A 4Q01A 2CHQA 1JJ7A 3DM9B 1HYQA 3RS3A 4A8JA 1U94A 4BLQA 2XTZA 4P33A 1N6LA 2AWOA 4MGKR 3VHXA 3TQFA 1X3SA 5FOXA 3REFA 3GLIA 1XTJA 3V4RA 4OHZA 2ZRIA 4PZYA 3OIVA 4TZ0A 1X8KA 2C9YA 1WB9A 1JR3A 4P4UA 5HE9A 4QOSA 1J8MF 3U3RA 3ADDA 3MMPA 2BMFA 2J0UA 3FWYA 4OQMA 1YR9A 4HB4A 1X1RA 1XPRA 1RIFA 2NTYC 3EPJA 4MDEA 1ZD8A 1OXXK 3AF4A 3NHBA 3W9YA 4FMCF 3CF0A 1F6BA 1R2QA 2JCSA 3UXMA 4D4JA 3GEEA 1LVGA 1NL3A 3SOPA 2IYVA 1DELA 3EZ6A 4HDQB 3CRW1 4I1VA 2V55B 1A5TA 1IY2A 2FN4A 2EYQA 4EPVA 5K8IA 3DEFA 2ZE7A 2XAUA 3NTUA 3TK1A 3X1WA 2GAOA 1EX6A 3AV0B 1AKEA 2QMOA 4Q4LA 5EP2A 1ZUIA 1SVMA 1NG1A 3GFOA 2QAGA 1LS6A 3EX7C 1IXRC 1G9XA 1JR3D 4PHHA 4B2LA 2O8BA 4GI7A 3CH4B 4JSTA 3W6PA 3GFPA 2FG5A 1E96A 2V8OA 4RZXA 4WZAE 3KKNA 3HP1A 4W5HA 3PUVA 4TLEA 1I2MA 2Q6TA 2XSZA 4QGHA 4G01B 5CDFA 4RFVA 4TTPA 1W49A 4CT4B 3LBNA 2O52A 3A1VA 3IHLA 3QXHA 1M74A 1P9NA 1MH1A 1U0HC 4DUGD 1HQCA 2I4IA 2GCOA 2OG2A 4JKIA 3L43A 4C7OB 1Z47A 4LUCA 3E5HA 2ONJA 4RCYA 2OV2A 2IHBA 3SC3A 1II8A 2VP6A 1D8TA 2IYYA 1SGWA 2V9PA 3IKJA 2FMXA 4ZDWA 1EFUA 3O8CA 4A0HA 2REXB 4R2HA 3GQBA 2DR3A 2YHSA 4ZPXA 3OAAA 4N0DA 4MRVA 2ECKA 3B6EA 4ASUD 2P2LA 3L2OB 4HAWA 3SU8A 5B30A 1OB5A 2JLUA 1KSJA 4PHGA 2G88A 1WF3A 4B33A 1XEWY 1JPNA 2XSZD 2WJHA 5FL3A 1G17A 2GEVA 2LCFA 5SZKB 4BZPA 1CLUA 1T3LA 1G3QA 3A37A 4DLZA 1GDDA 3MRSA 1Z06A 3TR0A 3WNBA 3FMIA 4PZLA 3DZDA 2H92A 4JL6A 4B47A 4L15A 2ZPTX 1SXJC 1FZQA 4IFEA 4DC9A 4IXMA 2NMVA 3RS7A 3CRVA 3QPUA 3CZQA 4AYTA 2ZU0C 2WPDD 1GUAA 3LW7A 2EFEB 4NU0A 3ASYA 3N2IA 4KVGA 5FOTA 4JLDA 3GLHA 3FVQA 2QP3A 5FBVB 1UDXA 4QGFA 2IBMA 4A15A 2IA5A 1W5TA 1F3OA 2CXXA 2ZE5A 3OIWA 2CBZA 4OJQA 4N3NA 4MKGA 4WVFA 5F9HA 3ICEA 3SBEA 4O2LA 3I62A 4TLAA 4BLSA 3FTQA 4XSHA 5EE1A 2J46A 2J0VA 1P73A 3K53A 1P2UA 3KQHA 2I1VB 4BRWA 3CH5A 2C9CA 3VNUA 1JAIA 2XX3A 4TMKA 2RB4A 3EA0A 2ODNA 4IJMA 5BWMA 1W36C 4QG7A 4JBWA 4QBHA 1ZUHA 3CUEF 4LV5B 1Q44A 3UK6A 3FMOB 2REBA 3B13B 4GP7A 4JLAA 2UVQA 3RC3A 1KI1A 4JVLA 4JBXA 1NN5A 4HDOB 3HWSA 1E9EA 4KLNA 1GFIA 4KSCA 4DLWA 4WIAA 3LWNA 2O8CB 4DBLC 1G8GA 5KO2A 4EJSB 4AK9A 3GJ3A 4ZKEA 4PAQA 1GKYA 2ZJ2A 3KKQA 4MYUA 3NXSA 5B2ZA 3BERA 1UKYA 2OSBA 1FFHA 2QTHA 4QL3A 2R8RA 1ELOA 4LC1A 5JWOA 1OLOA 1MO4A 3G5UA 1N2CE 4G5GA 4M2LA 4KFUA 1S1MA 3QKTA 1GRRA 4CVNA 5EXTA 2JASA 1OHHA 4PTLA 1PLLA 3U6BA 4KHZA 1Z07A 2JLZA 5H8WA 1ZNWA 3MWLA 2KSQA 2XTNA 2ZJYA 4X8HA 2CNWA 4X8LA 4A9AA 4PO8A 4NL4H 2QGNA 5EUMA 2C78A 1R8QA 2UZIR 3TBKA 1NSFA 3PIRA 1EFHA 1YR6A 2G77B 5FUYA 2IWHA 2DBYA 3ADCA 1G7TA 1GVNB 3N2EA 4AI6A 3N5CA 1Z0AA 1OHHD 3BJIC 2RGNA 3THOA 5FUWA 3UMFA 5KDDA 5EQTA 3KX2A 3I5XA 3UIEA 2A5DA 1KNXA 3NC0C 3RLFA 4DIEA 2FFHA 4JLNA 3TSOA 3K0SA 2ZVPX 2GJKA 4BLPA 1RC8A 3LQQA 2CNWD 3BGWA 2MSCB 2BMDA 1WA5A 1AGPA 3AP3A 2ZSAA 3RANA 2YOHA 4PAOA 2IT1A 4OBEA 1N5KA 5DI3B 4DIDA 2H18A 4W5JA 4NZYA 3Q5EA 1VCMA 1AQYA 1H8HD 4EIWA 4TYNA 5HCNA 2HXSA 4KYUA 2CEAA 2J9RA 3VR6A 3VU9B 3P27A 2VSFA 2JGNA 1NI3A 3P4YA 2QZ4A 2WWYA 2F55A 4TLDA 1KK2A 3F3YA 3R20A 1JEEA 1ZU5A 2OCPA 4BFTA 2OILA 3UMRA 5L3SA 3QPWA 4OK6A 2FFQA 3KFVA 2J0QA 2IYTA 3EWAA 3A36A 1E94E 1KI9A 4BQSA 1FPMA 3GJ0A 3NBXX 4TYWA 3B85A 2WOOA 2EVWX 5LB2A 4ZCMA 2GF9A 4AG5A 1CXZA 1TQ6A 3MJRA 3GJ6A 3EIEA 2GZDA 4Q00A 4G5OA 4DLXA 3CBQA 1CR4A 4LJYA 1E2NA 2C8VA 1IN7A 1N6HA 2YINC 2Z43A 2G9NA 5CM8B 4I99A 4BWYA 1NVVR 1ZCBA 2OBMA 1P2VA 4D0LB 4YONB 2FEMA 5EP3A 2WMNB 4QBGB 2WJGA 1I4LD 3QXJA 3W3ZB 3KUDA 1GP2A 1F60A 1HY3A 1NLFA 1T91A 4L4UA 2WJYA 1UAAA 1GILA 2KI5A 121PA 4CEIB 2JLYA 3OEHA 4ARZA 2R6CA 2YWHA 3RWOA 4Q02A 1JPJA 2BOVA 3B5JA 4HLUC 4HZIA 2CLCX 3B1VA 4GOKA 5DISB 3ZJYA 3KJEA 2IYQA 4B6EA 4W9MC 2NO6A 1JXOA 4HUTA 4XVRA 1R7RA 1XMIA 3AH8A 2VP5A 3ZVRA 4JT4A 2H8KA 3K0CA 4Z54A 1DARA 4KLZA 5K8UA 2JLXA 1L2TA 4TL6A 1U9IC 2OESA 4OK3A 2ZRCA 5AJVB 2QORA 4ZDKA 1NVUQ 5J4LA 1Q1EA 4JVNA 2VSXA 4H9GA 3V4FA 2ORVA 4WXPA 1DS6A 4II7A 2WSSA 3HYRA 3Q3JB 3MSXA 1LTQA 2ZUBA 4YLGA 1YZQA 1UKEA 2WWHA 3D6TB 3R9IA 1FW6A 2PZGA 1G64A 3OEHD 5DHAA 1IXZA 4IDNA 4IOLA 1ZCAA 4NHOA 5JLJA 3QF4A 3GJ7A 2GA8A 4FINA 4HAVA 1ZD9A 2CLDX 1M8PA 3B7GA 4M0LA 1YZUA 5DNYB 1XB2A 2PX3A 4P31A 1QHHB 4XJXA 3CPHA 3SHFA 2V1UA 1SKYE 1F48A 1P9RA 4HSEA 4UJ5A 4UQOA 4ZIRB 2NPIA 3CF2A 3LX5A 1DBSA 1U0LA 4TL9A 1AQUA 4R2IA 1OJLA 4D82A 2ZYTX 5JCPA 2WSSD 1P62B 2B7CA 4OI4A 4P32A 4QJ5A 4LJ8A 5FR2A 1UKVY 4LYHA 4MKHA 4OHXA 1YZNA 4M22A 4BFXA 4Z51A 1KJYA 3U2QA 4BPBA 3W5JA 2GJ8A 4HLUA 5IK2A 3THYB 4BASA 3EXAA 3W6NA 1IQPA 2AN9A 4IEEA 1YJ5A 3I32A 1PV4A 4GZLA 1HEIA 2ZYVX 3AB3A 2JLVA 3ZH9B 1AS3A 3PFIA 3HR8A 1J7KA 2RKOA 3T15A 1HTWA 2CK3A 1MR3F 3A1UA 4LV6A 5G40A 4EPRA 1KMHB 1Q12A 2ORWA 3KB1A 4L5BA 3GLIE 1OH7A 2R6GA 1IN6A 4EUNA 1US8B 3Q8XB 3KTAA 1WBBA 5DI9A 2Z6VA 2VHTA 3SBDA 5GADl 3SHWA 1HA3A 2XXAA 2DWQA 3JVVA 1W4BA 2R9VA 4LBZA 3BB3A 3WNCA 3BK7A 5CB8A 4YXWD 2W0SA 3CB4A 1H8EA 3A1WA 1NLZA 3AGPA 1WBDA 4D6PA 3M0EA 2NO0A 2R65A 4O25A 3SZRA 3U3MA 2Q3HA 1G8PA 4RD0A 3UMSA 1XD2A 2CK3D 2ZTSA 4A82A 3I8XA 4B6FA 4NMMA 3K0FA 2OT3B 5TARA 2H1LA 5FOVA 2Z4SA 2P65A 1ZM2A 2J3EA 1Z2CA 4JL8A 4EPTA 3T1OA 1NVWQ 2GNOA 2HCBA 2WJVA 5TY0A 1FQJA 4PO9A 3RS4A 2IS6A 4N1AA 1R10A 2YV5A 4LYJA 1J90A 2ZSEA 4M1YA 2GCPA 1H8ED 3B9PA 1E6CA 2W2TA 3GPLA 1E0SA 1FX0A 5CDFE 1G7RA 3D8BA 4DJTA 4ILEA 2QG6A 2FDCA 3H0KA 5E3HA 3QEJA 4B32A 1S96A 1F2UB 4LV8B 2BJVA 2WZQA 2ZI9A 4Q1FA 1GNRA 2DPXA 5CLLA 2F43B 1Z6TA 3T5DA 1KK3A 1AJEA 2GZAA 4C0LA 2ZYUX 2J1LA 3PQCA 4UNPA 4DT1A 1ZW6A 3THWA 1LNZA 4TWZA 4FMDF 4LBYA 5BXQC 5DIFA 5HPYB 1WP9A 4QBIA 4PSAA 2GWHA 1XU4A 2GBLA 2J7PA 4IRUB 1N6OA 1XTRA 2D7DA 2G0NA 2IUTA 2PCLA 2ZVQX 4AY2A 1G8YA 3CRMA 1NIJA 3EWSA 1W4AA 1XRJA 3SJCA 3K9GA 3DKPA 5CYOA 1WCV1 1G5TA 2O8CA 1O3YA 4MDFA 4EJSA 1PUIA 5AR1A 5JEEA 5UKDA 3I61A 4S2EA 3RVBA 1EGAA 1UPTA 5H1YA 1ONBA 1X1SA 1SXJB 3KZ1E 3TSZA 3RC8A 2CJWA 2FSIA 1OH8A 1OFUX 2IS4A 1VYTA 1LF0A 3LQRA 4UKDA 2EW1A 3FFAA 2D74A 3DOFA 4ZDIA 4PC3A 1M7GA 4M8NE 2J7PD 4MKIA 5C2JB 1OXTA 4MYTA 1G3RA 3DM5A 3QKUA 3QXCA 1FOEB 3BORA 3TIFA 2CCJA 2IYXA 2PJZA 3EAQA 3I8SA 4A0GA 2WKPA 2VP9A 4B75A 3IO5A 3MCAA 4DCVA 4DLYA 3FMFA 2WSMA 5FL7D 5GVSA 4V03A 3HPRA 1OXUA 1QF9A 4ON9A 3RRZA 2YKGA 1M1YE 1G18A 1E98A 2QTVB 2VSOA 2WIAA 2A78A 1G1MA 2HF9A 3U5ZB 3SQWA 5JI2E 1DAMA 1T5IA 2AD5A 4P4TA 5EE0A 5FUXA 1E9AA 3L8YA 2BKEA 4LCBA 3RRYA 3PJRA 3THXB 3BWDD 2NO9A 4NCKA 4NE2A 4Q4HB 4D4LA 5JI3E 1Y3AA 4TT3A 1JI0A 1KAGA 3KQLA 2J45A 4ZO4A 2BBOA 4AKHA 2QROA 1DE0A 1WRBA 4TTRA 2F1JA 3AKCA 3DO6A 1NN3A 1M2OB 3AP1A 3I1FA 1TTTA 3AVPA 1AM4D 3DHWC 3QNUA 2ZRFA 3LLMA 2F3TA 1G8HA 5HE8A 4A8JC 2GK6A 2O8EB 2E9SA 2ZS8A 2VHUA 2XJ4A 4PXAA 4HUQB 4QJ4A 2NZ8A 4GBMA 2Z83A 4I1SA 1RVDA 5C4GB 3U7HB 1TNDA 1XJCA 2VTKA 1FNMA 1Z08A 3RNLA 3SYLA 1GG2A 1W47A 3CNLA 3QY0A 4Q47A 4RD1A 5FI0B 3U3JA 2D2EA 3BOSA 4CRWB 2ZXUA 5JECA 4C0QC 2P0EA 4TT3D 3KKMA 4WAUA 1GKIA 3GMTA 1YRAA 1IONA 1GRQA 1XTIA 3L82B 1G16A 3ZQJA 1OB2A 3SFZA 2H16A 3AF3A 1QG4A 2PLFA 3MAAC 2VQSA 1RFLA 3MWJA 3U3OA 1P6XA 4R71A 5JSZB 1L7VC 2VLIA 4EQ6B 1W0JA 2BIFA 1E2KA 1VCNA 1TF5A 4OYHA 1WXQA 1V5WA 1NBMD 2ODEA 3MGCA 3K9HA 3FDIA 3AF2A 4DEYA 4EFLA 2FX3A 2OXCA 4NYJQ 1KZ7B 4E5UA 1LFDB 2QAGC 4LHVA 6Q21A 3TVTA 2FSFA 4LSGA 2NZJA 5D3MB 3C5CA 4A92A 1QBKC 1KGDA 2A5FA 2A2ZA 2IEYA 2GVZC 4JZKA 3OHMA 4WZBE 2GXUA 4U00A 4DSTA 2ODWA 2ZRMA 3VQTA 4F4JA 1E9SA 5G41A 5KTYA 2Q3FA 1J8YF 3P32A 4WA7A 3C14C 4B2IA 5BN3A 3MWKA 2FF7A 3R9XA 4TZ6A 4MGZR 1W0JD 3UG6A 1RRGA 1UKZA 1A82A 4M4SA 5KUTA 1XXHE 5EXPA 1P72A 4RKFA 3VR3A 4CEIA 5EE5B 2ZSDA 1C4OA 4DSNA 3VKWA 2WICA 1T9HA 5KNCA 3FHCB 2BC9A 1Z0FA 3JVUA 2V6IA 2P6NA 4RCZA 3ZQ6A 3LBIA 2SHKA 2Z5FA 4OHVA 1EWQA 2VO1A 4NYIR 1OE0A 5FBLB 1KIMA 3ZLJA 2A30A 3TGPA 2ZE8A 3CKLA 2GEUA 2JJ2A 1E4YA 3ADKA 5CYPA 3HJNA 5ELXA 4GSYA 1KO4A 2GF0A 1OW3B 4Q48A 4V0LA 5G3YA 1XZPA 2OLKA 1RJ9A 1G21E 1U2RA 2BMEA 2K5UA 5JJKA 3GLGB 3S1AB 2R6FA 2C96A 3ZYCA 4DUGA 1T3HA 2BBTA 2QBYB 3T5GA 3SJBA 3VR4A 1HT2E 2QRNA 2WJIA 3ASZA 3QBVA 5DSZA 3FMPB 5KNDA 4QHYA 5SZJA 2ZJZA 4LHXA 4OL0A 3AVOA 3BH6A 4IW3B 2IXEA 1SZPA 2ANBA 2WWXA 5E95A 4ASUA 2JAQA 1QHHA 521PA 4JT2A 2H5EA 2AL7A 2JJ2D 3C7KA 4CF7A 5M04A 2ZRPA 2REOA 2RGEA 3T34A 4ZIRA 1NY6A 4HZUB 5C1BA 4CYMA 3QKRB 2OZEA 5JEDA 3VKHA 4LI0A 3VAAA 3SN6A 5CK5A 1D2MA 1EFRA 2IYUA 3QE0A 4QFMA 5F2EA 3KXLA 5JWRA 2QP4A 3G0HA 5AJZA 4CT5A 1ESMA 2ORIA 2CMKA 1KI8A 2YWFA 2FV8A 1KKMA 1ANKA 1TU3A 2ZYWX 5EXXA 1NVXQ 2Q9AA 2VP4A 1GWNA 1KZGB 4A2QA 1RE0A 1HT1E 2QU8A 4Q1BA 2WPDA 1HUQA 4JS0A 2FPKA 3IIMA 4ACAA 1U90A 4ACBA 4GL2A 1QDEA 4Q4JB 4JVSB 4H1VA 4HAYA 1VDZA 4UXHA 2C77A 4IEIA 4BFWA 2OHFA 1IXSB 3DVLA 3ETLA 1CP2A 5FBWB 1ZIOA 1KSGA 4XH9B 2FOLA 4PSKA 2ERXA 4CEHA 1EFRD 1P9WA 3LAWA 3I92A 2IF2A 1US8A 3ZZUA 2CE2X 3PUZA 4DLTA 3FE2A 1D5CA 2ZRAA 3D3QA 2ZUDA 4U5XA 1QHSA 3G82C 1UDWA 2QL6A 5LPNA 4M1KA 3R8FA 1AGRA 2Q3MA 3T1QA 3NVAA 5JWHA 1IN8A 2O8FA 2BCJQ 3IEUA 5AUNB 4Z1MD 5KOYA 4B74A 621PA 3TAHA 4D26A 1KI3A 1TQDA 1QRAA 3UWKA 1E1QA 1U8AA 1IJFA 3AKEA 2PH1A 2AK2A 3MWYW 3PITA 2W00A 3E1SA 5BN4A 1GTVA 3ZVLA 5F3WB 1TMKA 4GMXA 4NCIA 4DDTA 2OFWA 4LGMA 2VYFA 4EFNA 2XITA 3H4MA 4WW0A 2C98A 3JZAA 3U60B 3HU1A 4Q21A 1QG2A 4Q1DA 3AVVA 3BD9A 3QXXA 4C9BA 3D7MA 2DYKA 4F91B 4OQLA 1KI4A 2GXSA 1CULC 1NMYA 1Z3IX 3K70B 4QC2A 5FPSA 5EE9A 1WE2A 4Q66C 1NJFA 1ZJ6A 2RGNC 4M1TA 5LBIA 4AURA 4AKGA 2DY1A 1E0KA 1N6PA 4X8OA 5CB6A 2A5GA 4C0AC 1VYVA 2FU5C 1P60A 2AWNA 3IDQA 5H70A 1E1QD 3A58B 2HJVA 1F2UA 3HR7A 2DB3A 1E9BA 1PJRA 1TUEA 3BC1A 4LZZA 4D0GA 2G1JA 1U8ZA 4NONA 1RPZA 1XCPA 1FNNA 4F92B 4Q4AB 5FBQB 4DCUA 3BE4A 4LPKA 2P6RA 4O3MA 3QPVA 1QHGA 2QPAA 3WBJA 1G4UR 2HYDA 1TF7A 3IPYA 1KDTA 4B3DA 5LD2C 4OI0A 1VG1A 4RSGA 4UXJA 5CM9C 4AKIA 2OLJA 2NPFA 4XOIA 1VMAA 3L0SA 2BV3A 3IGFA 3CNOA 4MRPA 4FN5A 5FFMA 1DG3A 2PLRA 3H84A 2QAJA 2QENA 3W8NA 2FEOA 1Z8FA 3LH5A 4NCJA 1A4RA 4PANA 4TTQA 1QHXA 3AUXA 3VHLB 2KJQA 4MGYR 2DHRA 2C9OA 2MMGA 4WOPA 3WYGA 4UNSA 3L0PA 2GJ9A 3QJYA 4OQXA 3SI7A 1OIWA 2BEJA 1L4UA 421PA 4A1FA 3NHAA 4MRNA 3WP1B 5JZVA 2IXGA 3FHOA 3A6PC 3BFXA 4IKEA 4Z8XA 2RHDA 1H8HA 2ZEJA 1TPZA 3L8ZA 4LJAA 1KI6A 1W5SA 1FP6A 3AF1A 3RRNA 3ZIAA 2P5TB 2IYZA 4KITB 4PC1A 4OHYA 4Q7LA 2YNMA 4JVMA 1OKKD 4ITRC 2A5JA 3BBPA 4B3XA 1MABB 2FFAA 1CTQA 2FNAA 4LWZA 2WBLC 2WWGA 1SHZA 1RYHA 1G6OA 2AFHE 1E2EA 1E79A 1XDBA 1XXHA 2VBCA 5TDHA 4ERNA 2IUUA 1HH4A 4TMVA 4B35A 4ZI2A 4Q4HA 3THXA 3SR0A 5BYKA 1ZUNB 2VHQA 3FFBA 1KI7A 2FZ4A 4JJZA 2RAPA 2QRZA 3TH5A 1MRSA 4CDGA 3NC1C 4A0FA 3Q72A 4BFUA 1G3IA 2ZIAA 3KB2A 1JNYA 2QSZA 4RKEA 3K0CC 1N0VC 1TEVA 1N25A 3EIHA 3B2EA 2JJ1A 4US1R 4LBWA 3ZIAD 2EFDB 4BGDA 3TLXA 5TMPA 1DAFA 4KO8A 5A0FA 1CEEA 1IHUA 1FTSA 2WAXA 4HUQA 2HDNB 5DYGA 2QMUA 1ZM3A 1P2SA 1XF9A 2AFIE 1NVVQ 2FZLA 2IC5A 4PAMA 1S2MA 1BMFA 2O8DB 5JJIA 3VNVA 3REGA 1E79D 3QKSB 4YMWA 5L3QA 4JJKA 3ZD6A 5FOWA 1E2FA 4MA4A 3DL0A 1KK0A 2PJRA 3L0OA 1G6HA 5HTKA 1N6NA 1BIFA 3A1TA 4LBVA 2ZRBA 4OK5A 2V54A 1Z0JA 1EWRA 5BW8A 4P4SA 3TMKA 2AK3A 2C04A 1SVKA 4FCWA 4MKFA 1KDRA 3CR7A 2XTMA 1ZNZA 2YWEA 4A36A 2JJ1D 2ZRGA 3HDTA 4UNNA 5CIWA 3VR1A 1O87A 1TX4B 4EQ6A 3B82A 4DCNA 3KKOA 5LDDC 3CIOA 2C03A 1OFHA 1N6IA 1OYYA 3X1YA 3U44B 1YZKA 1R8SA 4PPGA 1BMFD 2J87A 2KE5A 4HB2A 3U7EB 3KL4A 1GNQA 2F1IA 1LW7A 3GLFB 4IHQA 3R7WA 2EYUA 5D3MA 3T61A 3NEYA 4BEBA 4ZKDA 4NH0A 4F93B 3T1TA 4CEJB 1AS2A 1HQYE 2IX3A 2O0JA 1PLJA 2BCGY 5FOUA 3PVSA 1II9A 4TSFA 1MV5A 4B3FX 1EK0A 4B44A 3OFNA 2ZI4A 2YC2C 1Z63A 1KOFA 4PQYA 2XNDA 1DAGA 2QTFA 5FPYA 5EJEA 1QHYA 5DN6A 1E9CA 1CR2A 1YQTA 2WWFA 3QOFA 4A8JB 4BFVA 3D31A 1YHNA 2FH5B 2PMDA 1NBME 2GJSA 4YMSA 3SE0A 5GJVC 2ZQ5A 3W6OA 3CPJB 3RAPR 5IT5A 1Q1BA 2Z4RA 3U4QB 2CHGA 2AX4A 3P20A 3NH9A 5LB4A 2J0UB 4BECA 3Q5DA 4TSFD 1E3MA 3RS5A 1N6RA 3OFND 3DKVA 2B7BA 2RH5A 2G6BA 3CRRA 1ZBDA 2XNDD 2GAAA 1XD8A 1TQ4A 4BRUA 5DN6D 2V3CC 2O0KA 4DKXA 3I73A 4HLQB 4YMVA 2ODBA 3CX8A 3V00A 3S1AA 1NF3A 3U7GA 4U02A 1FUUA 4S35A 1OSNA 3TW4A 2GEDA 4C0JA 3EPLA 2ZR9A 2NO7A 3CNNA 3NBYC 2WWIA 3GCGA 5ANRB 2F7SA 4EPWA 5KPJA 1FUKA 4FCTA 3U61B 3LVQE 4PO1A 1ZYUA 3PUWA 3EW9A 4DLUA 4DB4A 4IFBA 5FPKA 2ASEA 2HF8A 4M9XA 2E87A 4A4DA 1JXMA 1Z5ZA 3CWZA 5JS7A 3BIFA 4HZUA 1K5GA 2PBRA 1DO0A 1PUJA 4TQ9A 4YXWA 4IDOA 5DH9A 3ZD7A 2IL1A 3K9NA 2IYWA 1Z6GA 1UEIA 1R0WA 1VKJA 3LRPA 4F7WA 4LHWA 4QNRA 1NMXA 4C7OA 3A4MA 2GCOB 2WWWA 3RYTC 5CK4A 4DSUA 1R5NA 2WIBA 1W46A 2ZETA 1N6KA 1Z0IA 3DOEA 4NBSA 4TMZA 5HCIA 3LVRE 4QNMA 3WMGA 1T4GA 1II8B 5TXGA 1SHKA 2PX0A 2QUZA 1A2KC 2XGJA 5GJCA 4D80A 1MRNA 2IYSA 3PUXA 1GAJA 821PA 1RYFA 1XTQA 3TVDA 2MSEB 3FHTA 3SYKA 3ICQB 1T0HB 2GBLC 2HJGA 1UFQA 3PCRB 1G3UA 1PLKA 4MUBA 3AUYA 1SVOA 4NCHA 2BWJA 1CR1A 3EIQA
chains in the Genus database with same CATH superfamily
2D1FA 1OV4A 3NI2A 3K31A 1DQYA 3ZVMA 5IDVA 1ZLYA 4UFOA 2G76A 4G1UC 4KGZA 4AG6A 1Q1NA 2W2MA 3FUXA 1HURA 2ECFA 3K30A 4NOMA 4X84A 2CZCA 3H16A 3P2KA 4N47A 3UY4A 2XE4A 2H4JA 1CQJB 3PYMA 5D2CA 3GHYA 1T24A 4IL5A 4KFTA 2VF8A 1V7ZA 2ILVA 3BZWA 2B37A 3BN3A 1SBNE 5H16A 1W34A 4LJ5A 2NTJA 2RGYA 3GOQA 4KMSA 4CR6A 1NU6A 4MPJA 1UFOA 3OOSA 5ICEA 2IZ1A 3OE5A 4CCSA 4E2YA 5K45A 4V0SA 1NOJA 4NF2A 5FV4A 1EUQA 1B43A 1F5NA 4YT5A 1V7QA 3QVGB 4GI1A 1JKFA 3ECCA 4YC7A 2EW8A 3JD3A 1MX9A 3TQRA 5FEUA 1CY0A 1PZNA 3EGEA 1ZNYA 1TB4A 3IBGA 3O3OB 4G1EB 4N9QA 1NAHA 4V0MA 4B6PA 5BWOA 4ARAA 5KAPA 1IOZA 1Q22A 1NNEA 5F98A 2F2TA 5U4XA 5KYKA 2GETA 5BYAA 4JGBA 4UULA 4P3NA 1DAIA 4LC0A 2P35A 4TLBA 4EPXA 3T35A 2DH5A 3HCDA 1AKNA 2IUYA 1W2GA 2QGFA 1UC4B 2H54A 1USWA 3LT2A 2E1RA 3IR7A 4YLEA 4ZMRA 3DE4X 3GXOA 2BM0A 3H3FA 1PR6A 1TA0A 1SCIA 2DSNA 2HK6A 3NT4A 1O6FA 4TS4A 3A0RB 4OQNA 5CXSA 4C6HA 2Q50A 4JBGA 4US2R 5HJ5A 1KRXA 3EIWA 3G02A 1NOIA 4XEUA 4F2WA 2IS2A 1CV2A 1FYWA 3FGNA 3NKVA 4WKCA 3EFBA 1ECGA 1VKOA 2N42A 4YMUA 3MN1A 3HP7A 4H2DA 3ROTA 4LNHA 1JSCA 2IZOA 5B5SA 2CFCA 2ZKLA 5DBHX 4AZTA 4ZI7B 2AFIA 2IYLD 3CG0A 1ZM4A 1QGZA 5FL7A 4HGOA 2HDHA 5LYJB 3WHLA 5HUQA 2XWJI 2JIQA 4KYIB 4I9GA 5FD8A 3V8BA 3EFHA 3FPGA 2DQYA 3NEPX 1VA5A 4G37A 5FO0A 2BH9A 3ZI0A 1RKBA 1KDZA 2GZMA 2GRAA 2OB1A 4MRRA 4CL3A 1VECA 4NFSA 2WE7A 2XOKD 4G0XA 1GGMA 4UE2A 2QTBA 2F3UA 4MTCA 3K70D 4FYJA 2GBIA 5A2QA 2BM1A 3AIMA 4FUQA 1R6UA 1G8JA 3E8XA 3NR2A 1KO5A 4NENA 5EIOA 1QJCA 3B2QA 5LQUA 1CRQA 1G42A 5LJIA 1ZITA 1BJRE 2GBGA 4P34A 4BEJA 5DYNA 4WRRA 2P1ZA 1C1DB 1JVSA 3LE8A 3JSAA 4A6XA 3KU1A 1I5RA 4B8ZA 4HLCA 1CIPA 2V7PA 1CY1A 1YJXA 5E8RA 3GP3A 3RC2A 1D2AA 4EOGA 3AM5A 5C81A 2BFOA 2H1HA 3I28A 1H2AS 1WMSA 1PT9A 3ZCPA 2D1QA 3UICA 1M34B 1MTZA 3B3FA 1JKJA 3AQ4A 5KHOC 1UXKA 2ZAMA 4PPFA 1A5AB 1ID1A 3F49S 5AUQA 5TT0A 4GPEA 3S2SA 3T12A 2QTZA 1HDRA 4QFCA 4R3UC 4K81B 3BUSA 3FVWA 4X93A 1H2WA 4BN4A 4F3RA 2YZKA 3L7JA 4UM7A 721PA 1W36B 1ZVJA 3JY6A 2XCRB 5B1EA 4K0RA 5ETJA 1SCJA 1SUDA 1X94A 2OKCA 2P90A 2V7VA 3GA7A 3O2QB 3IPAA 4A16A 2NUAB 2VBIA 2ZUWA 4N8DA 5J5CA 4DQUA 1XTBA 1N0UA 3ELBA 3IP9A 1ZOPA 3KQSA 1DKOA 1S1CA 2ICAA 1NBMA 1QTIA 4AM8A 3LC2O 3QF7A 3TINA 2PNJA 2ZVDA 4FQ7A 4E2WA 2ZAGA 3BXZA 3CLTC 1M5RA 4DJ5X 2FWNA 4HAUA 1YZGA 3A1CA 1GCAA 1Y89A 2WTEA 4PYIA 5FNVF 4CE6A 5B58C 1GOTA 2NZVG 2FDRA 3H1FA 3H65A 3O83A 3ZGXA 1O2DA 3AIKA 4TV8F 4UE3S 5H5JA 2ZT6A 1JIXA 3GJXC 2RHLA 3PXXA 2MSWA 2GR9A 4OHBA 3U4AA 3H2IA 1JSZA 2X0KA 5BMVB 3VU9A 5HIIA 3O8RA 3UJBA 2Q9CA 3DQPA 1VI6A 1Y0BA 1CUSA 4HNQA 5EJAA 2RGAA 4B73A 5CAEA 5T4HA 2IOFA 1KYZA 5C18A 1Y6FA 2QQ5A 3E3LA 3EXHC 1JB9A 3EQ9A 1SXJE 1W8DA 4CL8A 3OVMA 2IY9A 4OQDA 1SA0A 4OQYA 1EFAA 3I72A 4JENA 1QG6A 1JYSA 1RVV1 5JCJA 2PY6A 3VR2D 4AP5A 3RB8A 1XEFA 2P9HA 2VJQA 4CQLB 1EVZA 4ZK2A 2OSVA 4ZREA 3UC5A 2PS3A 4I9FA 1MT0A 4YV2A 3RK4A 3ND6A 1F5SA 1LF5A 3GFVA 4C4YA 1DOHA 1G5RA 2ZGVA 1YI0A 1GITA 2ZWPA 5CYGA 2I6GA 4RD6A 3L7IA 3AW9A 4GGOA 2XD9A 5G53C 4PX2A 1KZ4A 1SOMA 3UB2A 4DABA 4LHSA 2C2HA 4OFWA 3HUTA 4HDSB 4IIJB 2ZIVB 4ZWNA 2ZREA 4WNAB 1PQUA 3EUWA 4OLFA 3RT7A 1RWVA 2KM1A 1MOPA 3BRSA 2IIPA 4M9ZA 4YAGA 2G36A 3LV8A 1LPBB 1V8FA 4GZMA 3UW1A 3O3CA 3FCXA 2YXNA 4HYYA 2CZQA 1WVGA 2XVYA 2IP4A 4WFKA 4Y6LA 2FK7A 2Q21A 4HNAA 4JJGA 1Y8RA 1QRSA 1SVLA 1QIHA 2DQ4A 2CVQA 1GCOA 3LXXA 2F1HA 2I7DA 2ZFUA 5AD1A 3X1XA 1UBCA 1QNFA 2QJTA 2QV7A 4DDMA 3SYMA 4E5KA 1U7HA 4HBGA 2RSLA 4YAFA 3F5MA 4CNBA 5KPDA 1B0UA 5MF6A 4CM8A 1S4QA 1DUSA 5TQJA 4UU1A 4PHFA 1GQ2A 4K9OA 3LHSA 2ZUVA 4FWIB 4YCSA 4MI1A 5J4YA 5C51B 2C95A 4YP7A 5CBPA 2WP0A 2CV2A 3TTUA 3ZWVA 3AVQA 4E33A 3P2YA 5DHFA 1CR6A 3WADA 1E1MA 2WNSA 1JMYA 2RH4A 2WF9A 1K97A 1YR1A 4AO7A 4V02A 5HS4A 1XMXA 2XB4A 3BHIA 3CR3C 3KUKA 2W6JA 2XOXA 1PYDA 2ZI5A 3FJ1A 5JQGF 1J99A 2RMKA 4N5IX 3B48A 1CJVC 1BGWA 2I3BA 4F84A 2HO4A 1CF2O 3A9TA 4URXR 1LLDA 2OO7A 2BFFB 5K0SA 1Q0HA 2PA3A 3BIOA 1FFXA 4NQZA 4PBRA 2V3WA 4F45A 4GSLA 1H6DA 5JJBA 4HNVA 3LWBA 1BQ4A 1ESCA 1OJ7A 5CCBA 5DULA 4RZHA 4QATA 5JS2A 2FZVA 4C2UA 2EX0A 3EZ7A 1GPUA 2OQRA 3R44A 1HEUA 3ZVNA 3KAKA 5ITZA 3DE7X 4S1NA 4YP5A 1HE8B 5IKOA 2AE1A 1PN3A 1USGA 2CUTA 2G08A 1GKUB 4Q03A 4ZQEA 1C29B 2P62A 2YXPX 4YUWA 3D7RA 1FRQA 1L4YA 3EUAA 3LPCA 2OXIA 2G17A 2I2FA 4JBLA 2FZKA 3G2JA 4Q9JA 1XIVA 2Q1TA 2D4HA 1M3SA 3OBIA 5DHUA 4E70A 5IYZA 4UUNA 4XGIA 1EWVA 2B6HA 3DAPA 4FMPA 2MSKA 3SF0A 5C8VA 1HDGO 2K7FA 3IUQA 1VJDA 1KYIA 2BHNA 3MVEA 2QVCA 1E0AA 4DLRA 2WHEA 5I3CA 1VL2A 1F9AA 1N3YA 1OXBB 4OTZA 2C8KA 4TM8A 3RJTA 2Q5JA 4QA9A 5FFFA 4V1CB 3LL4A 1RJWA 4CR7A 5IHXA 2TMKA 1QQBA 1IQUA 1X8JA 4NULA 4YGYA 1LV7A 3T41A 4JL5A 2VF7A 3H5IA 3TZHA 3VHRA 2AD1A 5ELMA 4E88A 4F3CA 1SOVA 2CHVA 3DMDA 4IF6A 4INZA 4DIUA 1JG4A 2CXUA 4H3KB 4KBFA 2IS6A 3INRA 1PG2A 4FB5A 1ISMA 4HDKA 1JXQA 4NDZA 3GCDA 2R6AA 3QE4A 4LPSA 4YJKA 3IMEA 4IXDA 1DSSG 1CIJA 5J2TB 3OM1A 4H4DA 4O63O 3SC2A 3R23A 3M83A 2X2EA 1F0PA 4FI3C 2EQ5A 1NYRA 4JHLA 4Q1CA 1RHUA 3HDQA 4D4HA 3G7SA 1DG1G 2F62A 4KIUA 3H1TA 1I3MA 1EGMB 3T0FA 1P0FA 1E2QA 3C1TA 4RHCA 1HC7A 2QN2A 3W5BA 3PU6A 1EU1A 4TRJA 3O84A 3AVTA 3RFTA 3WLLA 4Y98A 2VHCA 3BREA 1EXWA 1RWKA 3L0CA 3EGVA 4OGWA 5ALXA 1ACLA 2GKGA 3QVWA 3OQJA 5EIBC 1O0CA 2HB6A 2PVCA 2C0PA 3II6X 4PFKA 5B64A 1E5DA 1DKRA 2EFCB 2GHQA 2HHLA 3ONFA 2WU8A 4K46A 1J97A 4ZO7A 2Q0HA 4FGWA 4KRGA 1OREA 3DXZA 4GF5A 1FRFS 3AM1A 2R4TA 4UAUA 1CUXA 1EM8B 3OU7A 1ZGZA 3QVGA 1UM8A 5AT1A 3G1UA 1JE1A 3RVLA 3T3DA 2GKSA 1E1LA 5CITA 1NZJA 4KC0A 1X14A 3A8TA 4QHSA 1AN0A 5LUBA 1YR7A 2PYIA 2PQ2A 4EDHA 4NXNB 5DK4A 4C9BA 5COQA 4LF6B 5AVQA 2XNHA 4G0YA 1DOZA 4G24A 3CY6A 2JW5A 4YJHA 2WTBA 5JI3E 2AOWA 2P3SA 3G1TA 3QG5A 4GDFA 2ISCA 4TTTS 1NLYA 4IP0A 1I1HA 5CNKA 5DK6A 1Y7PA 1IY8A 3IIKA 4ZU3A 2R60A 1JW9B 1GUDA 3FAZA 4C30A 1RRPA 3SJ7A 3DFZA 4XVQA 4N48A 1ZIPA 5K0BA 1V4VA 3MHPA 4US0R 1D03A 4YRDA 3GD7A 3HA2A 1ZOSA 1GTSA 5ER6A 3H2GA 1U7ZA 1Y48E 2WUEA 2O1XA 5A4JA 1GO2A 2HJ9A 4ZOLF 2BI7A 2JZCA 3FLEA 4ESVA 4UVHA 3ZXXA 3E23A 1N9GB 2XUDA 1N2IA 2AVDA 3HJRA 4MV4A 4BQFA 3Q7EA 1Y7LA 4BL5A 1ZM7A 3DT8A 3CXRA 3GELA 4CZ2A 4MO9A 4NAHA 4R2LA 1ZMBA 3V2HA 1W0KA 1Q1QA 2QM8A 3LQKA 3ZWDA 5C8ZA 2AG0A 3R7FA 4D7AA 5JJLA 4KEAA 4XQ9A 4ZHQF 1AUVA 1BJKA 5IZ4A 3RSOA 3UT0A 5ILOA 3B60A 1UQTA 1W87A 2VEDA 4UNQA 3RLIA 1CERA 4PZAA 3WP0A 1HXHA 2IEGA 2JDID 2ZB4A 3GRAA 4MW5A 2O5VA 5CFMA 3U3DA 3RJ9A 1ZG3A 1K08A 1VKHA 4NCBA 1Y1LA 2C3PA 3EF1A 1II0A 5KQLA 4PSDA 1YI8A 2WKWA 3K6SA 4LZPA 1U98A 5BUQA 5C5DA 1Y8CA 5JXGA 4TVOA 1E2DA 3RREA 2MINB 5A3JA 1BHSA 1SOWA 4KV9A 2DQSA 2VUHB 2DP4E 4IO1A 1N34B 3T7KA 4AVYA 4U6NA 4HH4A 1Q7EA 1XDDA 1XCMA 3CPEA 5LP6B 5F9MA 1HRDA 1M2GA 2D62A 2CMHA 2E1PA 2P9GA 3IQFA 3TSWA 4AZ0A 3A0UA 1T25A 1YCFA 3IAS1 3EBOA 3O9VA 4GBED 2RI0A 3HCBA 4URHA 1KHHA 5JAMA 2FPGB 1EP2B 2O0HA 4ZVQA 1VTKA 2QPOA 4QUBA 4MW7A 4S04A 1M34A 1NXWA 1Z0DA 3CUUA 4BX8A 3ZDBA 1SXJD 3CEHA 3GGDA 3A9WA 2EXXA 3FUUA 4NMWA 3EXIB 4XLTA 1ZGAA 3EC1A 5IARA 4AY6A 4RY9A 3JD1A 3TRIA 4ARIA 3PTLA 3L0BA 2F17A 5JFGA 3T3PB 4RVNA 1QIMA 3CZMA 1NVMB 4MI3A 4AMGA 2AUTA 4OU5A 2WHPB 4QUAA 1O0SA 5D5HA 1W1WA 2WA2A 3AEQA 3ECSA 3M6UA 3TLGA 2A9JA 1U8TA 2DMRA 3V32A 2NUTB 1KH2A 1AA3A 1USIA 4R81A 3JR7A 6CHYA 2DUWA 3CZ5A 3INTA 4IHJB 1HKUA 3QI2A 4DLVA 5L53A 5LQAA 5U9CA 1P77A 4BP3A 3SJZA 2AN5A 2R66A 2VA8A 4UHBA 1P4SA 2VOJA 3AI7A 3WGVA 2WSIA 4ENTA 1YB6A 1RWOA 1ZKDA 5L6LB 4R69A 3STYA 4D4GA 1NF2A 3O4FA 1OTYA 4MB2A 1NUSA 4RD3A 2J3LA 4HGYA 2A9OA 1A8QA 2F4NA 1JFRA 2JATA 2NG1A 3CVXA 1WZ2A 4BQRA 2ZBEA 1TUBB 1Z0KA 2VXBA 2JI7A 3SX2A 3T06B 3ZEIA 1BFKA 3OP1A 5AWFC 1A9TA 1J9EA 2IE8A 5DW0A 5H68A 1GPLA 1XEXB 4DTCA 4M83A 1F2TB 1OGJA 1FLAA 1ZFNA 2IHYA 3DOCA 1QPBA 1WOYA 3DV2A 4LDPA 4D97A 4DBZA 3C16C 4FFRA 2W90A 3VAZA 4MYSA 4HI0E 3VYWA 2G0AA 1TQ8A 2VUIB 3DMFA 3HN6A 2GOYA 4B76A 1KJ8A 1WB5A 4ZAXA 5KNCH 3SXJA 3ZZ0A 2A0YA 1RI3A 4I0WB 2OEPA 3LW8A 3LQ1A 2OV8A 3V46A 1YE8A 3VJMA 4X7MA 5E3JA 4KYVA 4NV3A 4BB0A 1OTHA 5DXJA 3V9PA 4YJ2A 1X80A 3QY9A 2FCAA 3KRTA 1HDEA 4OB7A 3M3DA 2ADOA 2QUAA 1RRMA 2VPYA 3IB3A 1IM2A 1UPXA 1JKMA 1AHHA 3BAFA 2YS6A 3ICCA 3N7AA 4GNKA 5FHQA 3RG8A 2ZB8A 3ZNOA 3LQ2A 5K8VA 5DDIP 2IE0A 2JJ8A 4YQZA 1H2ZA 1ES9A 4KIGA 4DLLA 4QM6A 4O5AA 5DLEA 1YZYA 1AA9A 1TYEB 4FDVA 3U7IA 1E1KA 1QK3A 3VFDA 2VJYA 2H57A 3TE6A 2DFTA 1FYVA 4L4ZA 4KJXA 4C21A 3O90A 2ZU6A 3T7RA 4P4NA 1SKQA 1ZGCA 2VPTA 5A9TA 1ZPDA 1AV6A 3IR6A 5A0TA 1DIOB 1XAIA 4RVCA 1QHEA 4HDSA 3WJ7A 5HS6A 1Q95A 4IIJA 3ZY2A 4QQKA 2OMEA 5BN3B 4WNAA 5EIAA 3VMFA 1KY3A 1KFKB 3DTVB 4CN8A 2Y1DA 2YJ3A 1AXRA 1NXXA 1R88A 2A4KA 3G5LA 3LGSA 4BQNA 5CT8A 2H1OA 2YRXA 2SCUA 4CI0B 4GO1A 1Z8HA 4X3PA 3WY9A 1B6RA 1TU4A 2E49A 4CMBA 1XTVA 3D2CA 1T3SA 2PU5A 1GSAA 5CCEA 1SRRA 5K3FB 3I2FA 3VX4A 2ET6A 4RMJA 1XN1A 1Y7HA 1G2QA 3M33A 1B14A 4KLCA 3ABQB 5FBRB 3HJTA 4YCAA 2W83A 2WT9A 1I33A 1VSVA 1YBVA 3HZOA 2AA3A 5K6TA 1PNRA 3PRKE 2DCUA 1VSQA 4FKZA 3U4IA 3ZWNA 1BMDA 1S2LA 8OHMA 4U7DA 4K8RB 3WLIA 5AW6A 1CFJA 2ZDHA 3ZHRA 3DAYA 4CLHA 4ZFNA 2ZG6A 1U3CA 1QVAA 3FNEA 3WYAA 4EHBA 4HEQA 2CLFB 4C0BA 4QPPA 1U7TA 2R44A 1AGNA 1Q0QA 3FF1A 5FPTA 3TKLA 2QUIA 3WYFA 2W6NA 3GEDA 4BLOA 4YUXA 5JAPA 2FMHA 4BWFB 3UGJA 3U31A 4DIBA 1MAAA 3GNQA 4DC1A 3KBBA 1HX7A 4BUJA 1G291 4RM2A 4ILKA 5EXSA 1L4BA 3EY9A 4EJ6A 2O2CA 4ZC8A 3I5UA 2LCQA 4CG3A 1C7EA 1QRUA 5JUWA 1HDCA 2ON6A 3L02A 3NWOA 4LXGA 1CUYA 3ZHTA 1TJPB 1H4QA 4LJ4A 1U7OA 1XZEA 2FJUA 2HSDA 1RJFA 2BFFA 2INGX 2R5WA 1YWGO 2UKDA 3RARA 1M8FA 3F6YA 5TGZA 5KREA 4RLSA 3MUFA 4Z7QB 1EUYA 3PI6A 1XPUA 3CVUA 4WGGA 4AN0A 5FWYA 1G2PA 2ZATA 1U31A 4S1OA 1ZC4A 5FIUA 2XY4A 1JR2A 1AB6A 2NOAA 4FVTA 2QMHA 2DPMA 4Q7KA 5AI6A 4XIGS 4C4TA 1COWA 1E0JA 2FPMA 4M1OA 2RE8A 1BDIA 4YMTA 1S3GA 5L3RA 5KWVA 3EFOB 3DA8A 2VJOA 2AZTA 2BGMA 1LSUA 3R8CA 5CA1B 2P40A 1M1NB 1UXHA 1Z7BA 2WKQA 2V7WA 4BNGA 4B3GA 2QY9A 1GYQA 1CJBA 1WUHS 1UBFA 1M54A 1J6UA 5D1HA 1G38A 3U0VA 3ZWXA 4QNNA 4MS3B 1B8VA 1WXDA 5IKXA 4WMLA 3AR2A 4RK5A 4TXHA 4HGNA 1I7QB 4YI5A 4GUAA 3IQIX 2C7VA 4J9VA 4IIHA 2HT6A 4CF4A 2NQTA 1XEWX 1U9IA 4TYYA 5AI8A 3DLIA 3LPLA 1P7CA 1INLA 4MV9A 4EX6A 7MDHA 5NLLA 3BL5A 1E3WA 3FIUA 4QTTB 5IH7A 3ONWA 3H9UA 4BBZA 1JRLA 1ICEA 4AJHA 4F2PA 1XC7A 4XDYA 1NXQA 1CJUC 3MCUA 2IIQA 3K4PA 4OJKA 2V1XA 5KWIA 5MHTA 5IVHA 2ZANA 221PA 1PS9A 1QCDA 3RGGA 3SWWA 4YBRA 2DLNA 3EYAA 5EWLA 1PS8A 1LQ2A 2PMCA 5I8PA 3KSBC 5J2TA 2D3TA 1JTVA 3L1JA 1XDZA 2QD3A 4EY7A 4E4RA 1L5YA 3FTPA 4L9WA 2JGRA 1L4NA 1TCBA 2JFUA 3FTCA 3VR0A 4BLWA 4MQUA 4RS3A 2HC9A 1AURA 3LHDA 2CEKA 7GPBA 2JBAB 3NLLA 1J0XO 2WB4A 1C1XB 1YVEI 4DRZA 3HMKA 3K5WA 2GESA 3AR9A 1KEEB 5DCWA 4MDHA 3UJHA 1PD0A 3B9BA 5KNLA 2Q5OA 3AKYA 2BTOA 3NTXA 4CR8A 4JIMA 3WOHA 4KFRA 4PLVA 2I2DA 3K8ZA 3BQ9A 4O8ZA 1XRSB 3CR8A 1E32A 3FLBA 4LY6A 4TRRA 1I2DA 4HNUA 2UUOA 3H5RA 4AYXA 3WHPA 1CR0A 2CKMA 4NS1A 1DX6A 1EM8A 2JGLA 2V7QA 4QIHA 4JX8A 4JLJA 1U0OC 1NM5C 4NV0A 1KPHA 1K7SN 3AEUB 3PPWA 5SZHB 2WW8A 2QRVA 2XA2A 3IA2A 2ZIXA 2XMPA 4QJBA 5KINB 2GILA 3JAWB 4I1UA 3DB2A 3KXDA 1D9XA 1UUFA 2I6SA 1ECCA 1KGSA 1TAGA 2VT2A 4OQPA 3TQCA 3UMVA 4NPAA 1DWUA 1QFJA 1CY6A 1R5OA 2CE7A 2E0IA 2JEOA 1J25A 3AJEA 2FZGA 3CGGA 3FCEA 3HJBA 4RZ2A 3B7PA 3PV0A 4D8XA 4LXIA 2NM0A 1PL7A 3IV6A 4RK6A 3PX2A 1YULA 3SJAA 3V5NA 3NO4A 2QNBA 3AY3A 3QEMA 5F7XA 3KC2A 1R5BA 4G84A 4NR0A 2X8WA 2NZ2A 3DMTC 4RGBA 4TKVB 4URZR 3ZS8A 3TFOA 3E7XA 3F5QA 3Q7PA 1C0KA 4EW6A 2H4HA 1MPXA 3DBIA 4WGFA 1XYVA 3EF0A 2KBFA 4QPDA 3UXYA 3OEEA 4AY5A 4J8PA 1M0WA 2O57A 1CJSA 2W48A 3GFTA 1V16A 2A7QA 3IJRA 4R8KA 4ZU1X 1JEYA 5FTJA 1QHIA 4DG5A 2WMDA 1HE5A 4PEVA 4B34A 4D96A 3QOWA 3J81k 4EB6B 3K9QO 4OH1A 1YA8A 2O8NA 4FOTA 3RS2A 1EEXB 2OAQ1 5FUVA 3OCJA 1EVYA 1FQWA 3UUEA 5JPDA 2YWXA 4K6GA 4WEOA 4HDMA 5E6SB 4DG9A 1XWIA 3E3MA 1GFSA 4PE5B 3RTCA 2C7QA 1G66A 2IODA 3UJDA 4TQAA 3RTAA 4CKWA 3IMCA 3N0XA 3A4IA 1MAHA 3OI7A 5E4FA 1YB2A 4W7SA 1UFRA 2HOQA 3HK2A 2I4MA 4RTLA 4HGPA 3TB4A 1DKQA 1IEQA 1WHTB 1RTKA 3TNFA 4PCUA 1OFIA 2JAXA 2NVOA 2VC2B 4C04A 4E5YA 2OVFA 4A26A 4IXNA 1PKEA 2PL1A 2DFKB 4NTZA 5FOSA 5KOJA 2MINA 3KQMA 2YFYA 4C2BA 1L5FA 1EE1A 4HATA 2CNBA 3GLHE 1GRNA 2HHAA 2WJ6A 4GX0A 5CT4A 4KZPA 5DLQC 1CHNA 1IY9A 3VDQA 4RTSA 4OB6A 1JT2A 1KTVA 2J3JA 3JWEA 3P9NA 4OHMA 5JPCA 1VPLA 2IZ5A 1OILA 2OVBA 2Y1WA 4LJ7A 3TRFA 3TQHA 2PXXA 1MABA 2ESRA 4FYHA 3LG2A 5EJFA 1N1EA 5DNEA 1O08A 3VX3A 4YMHA 5LU8A 1ENOA 1KZYC 3R4CA 1Z22A 1D5WA 3EN0A 4DLNA 1DPFA 5DWVA 4UHFA 2VPPA 1WDTA 5DXFA 3IUYA 4IGAA 5GJWC 4D4KA 5BT8A 2PBZA 2JCXA 3HU5A 4QPZA 3O03A 1Q92A 2WHPA 3M9WA 1RWXA 4K3VA 4NBVA 1KWKA 1EWKA 4DLKA 1QGED 1ZISA 2NUTA 4PQGA 1UZUA 4QEKA 2B36A 4E1AA 1ISHA 4JLPA 4KU4A 3LY5A 3EA4A 1VHTA 1DVRA 2I6XA 3KNZA 1QYWA 5E7JA 1KPIA 3CX6A 4EJ0A 1TEXA 2O8DA 1ISIA 1E4EB 2SKCA 1IHYA 3FNQA 4IZIA 3IOCA 2XDQB 3WK5A 1KR2A 5KMGB 1XYYA 3DWEX 4O2AF 5GPBA 4UOEA 1QTNA 2C92A 5K0LA 2RHJA 5C4MA 2I1LA 2VUTA 3HABA 1DRUA 2BEUB 4LK2A 4PTYA 5CHEA 3UYLA 4D0SA 2WB2A 3HN2A 1TUBA 3RV4A 5IULC 5DW3A 4ZVLA 1NF8A 4E03A 4F46A 3SC4A 1XEXA 1TLFA 3IIJA 1F2TA 2JCVA 5EJGA 4BX0A 3W5CA 1S02A 2ZIEA 3I4LA 1E7MA 4WY5A 2C7PA 4LRWA 2HYIC 2GYWA 3CN9A 5AW4A 2HLPA 2J4CA 2R7NA 3EULA 2IK8A 3ZQKA 1KARA 5JHGB 2PL5A 3PP8A 1NFQA 2JK1A 3PWKA 4RMGA 1EZZA 1HEYA 3WRYA 1H1LA 4I5DA 2JS7A 3RVNA 4FS8A 3DLTA 2X0DA 1AE1A 3H9QA 5L3VA 1Z4OA 3NAQA 4XASA 5JFOA 1XCGB 1T8YA 5A4MS 3FKSA 2XXJA 3WLAA 3AB8A 2QLNA 3EIXA 3JQGB 2ZWAA 2Q45A 5KYGA 1LBQA 1X74A 5ALPA 1Y1QA 3EZYA 3SHTA 5C7OO 1AS0A 1C9KA 3QU7A 4OIMA 3SYRA 1SG6A 1F1JA 1U0JA 2D5LA 2O7QA 1B6GA 2BY4A 2I71A 2NVUA 4GOLD 1E7SA 5JNRA 5GOTA 2F1RA 1T2AA 1VHJA 5AK0A 5KHAA 5LOVB 2JA1A 2FW6A 3TIVA 2HR1A 3GJ5A 2PUCA 1E2HA 1RHRA 1P7PA 2ZJ8A 4QPNA 4XR9A 4CW7A 4ER5A 4TV9B 3KJIA 1NJGA 4ZVRA 3OIYA 2QX7A 4FFWA 1RXSA 3NVMB 2XIJA 1PI3A 3CCFA 5E4YA 3RS3A 1R4NB 4W5NA 4NK5A 4D3ZA 4BLQA 1M2KA 5KTSA 1T43A 3TQFA 4MJ3A 1XTJA 2D54A 4G5FA 3EY4A 4Z0HO 1GGKA 2ERCA 2VDWB 2YWBA 4TKUA 5BSUA 2GN2A 1R8XA 3MT9A 3C3PA 4GRIA 3IT1A 3GDFA 4BNMA 5JS1A 2FMKA 1RQRA 4R9NA 3G8YA 1OAAA 3LTNC 3D8TA 4Z3KA 1X1RA 3DBHB 3DZGA 3N2KB 3PQ5A 3EPJA 4KN5A 1F14A 1GZ3A 4FU0A 5EINA 2CLEB 3EQZA 4HWPA 4KNYA 4P82A 4OGFA 1AO3A 1T5DX 3AF4A 3LO8A 1K8YB 4U7WA 3F5SA 5KYWA 2RHOA 1NUAA 1EXVA 4BO0A 1R2QA 3GEEA 2PZKA 3M3PA 5EOVA 4IXTA 1MFZA 3WLFA 2FY8A 4QOEA 3JSXA 4KR2A 2FN4A 3IQHX 4EPVA 3BWMA 1JSXA 4KH1A 5HW0A 3DEFA 2ZE7A 4CMHA 4LXQA 2W93A 2A7XA 1EX6A 4LSZA 3GFOA 2CNNA 2AUMA 3INGA 3PT5A 4Y18A 4BMXA 1PJ4A 4E2XA 2O5RA 2OCKA 1X0VA 5F21A 5I5EA 4RY0A 1Z9BA 4CIVA 4BQOA 4ZGBA 3GFPA 4ID9A 2DR0A 1E96A 4RZXA 5H3CA 3RK0A 3EGXB 1OGIA 1VI2A 5CX1B 3JTMA 2VDVE 3EEQA 1D04A 1PTKA 4W8GA 4C88A 1JNXX 3UXEA 4RFVA 1C7ZA 2HHJA 5HBGA 4CT4B 2W2PA 4ND8A 2X15A 3KQVA 2O52A 2KQUA 3U7QB 3IHLA 3K9CA 4Q39A 5JNLA 1MB4A 1BU8A 1U4NA 1U0HC 2R1TB 2OV6A 3C3YA 3FR7A 2I4IA 3NKLA 3W4JA 3ZWKA 1H2EA 3QWAA 4JKIA 4ZA2A 3KT0A 3U0BA 6ABPA 4XKJA 2J3MA 1WETA 3TOCA 1M1NA 2ONJA 4RCYA 1ZBQA 3SC3A 3T7JA 1ZIXA 2QSUA 1JJBA 1D8TA 2QTMA 1C8LA 1SGWA 2Z2JA 3BYZA 3C3JA 3IKJA 1CUJA 2FMXA 3QYFA 3T5BA 1PYOA 4MS3A 4HLNA 3ROQA 5I01A 3GQBA 2DR3A 3PGXA 4OU4A 3CTMA 4NZOA 5EZQA 5IC4A 3HN7A 4N0MA 4MRVA 3ULKA 4F4UA 3BXFA 3D3JA 1UDRA 2HQBA 3L2OB 3OZUA 4JUCA 4I5GA 2X58A 5I9IA 5KYNA 4PHGA 4B84A 3ASUA 4N7RA 1QWSA 1AUXA 3PQDA 1GZUA 2G8LA 2GEVA 3G2LA 1CLUA 1V4BA 2XQFA 3GARA 2X7HA 3A37A 3STVA 3PTAA 1BU5A 4DLZA 2CFOA 1GDDA 4FZJA 1W59A 4R9RA 3NU1A 4QDXA 3C43A 4HPJB 4PGFA 4LF7B 3KPVA 4B47A 4JL6A 1SZCA 1YIDA 2B5WA 2AT1A 2CMDA 5IKMA 2ZPTX 4B3TB 4IIVA 3TLZA 3K15A 1ULUA 1ULAA 1VHQA 1VLVA 1R9MA 2I6QA 4BYMA 4MWEA 1GYRA 5KX5A 3DL4A 2AG5A 3PWZA 1LH0A 4IMPA 1ZEMA 1PW5A 4EG8A 5BY2A 2FN3A 2ZJ0A 1RQ7A 4G41A 3LW7A 3IT3A 3JQ7B 4I8DA 4NU0A 3W2HA 1ODIA 4IGEA 5E4JA 2Q2NA 4NJMA 3GRFA 1FQOA 1EQUA 2QP3A 3ZE6A 2AEFA 2YFKA 3DOOA 5FBVB 2IBMA 3IT2A 4A15A 3PXEA 2ZE5A 3F2VA 1KEEA 2MWMA 4OJQA 5FA8A 3WK9A 1WZUA 4MKGA 1JFSA 4Z3DA 1MHTA 5ILGA 3RVQA 1FMFA 2Y0DA 1FC0A 2UVPB 4O2LA 5DP1A 3I04M 1Q6YA 3V8PA 2P2GA 4M88A 4BZZA 2QT9A 4WLEA 2J46A 2J0VA 3JZDA 3K53A 4CJXA 3RAGA 1H6AA 1U80A 2QR5A 5D5QA 3CH5A 1RQGA 4W8OA 3VBCA 4NCAA 1YRQA 3FIJA 3W5DA 1EFKA 2PKQP 1HQKA 3EJWA 3L6OO 4TMKA 2OHOA 4BNHA 1X8XA 3C6XA 3JAWA 2PSJA 5BN5B 4IJMA 4KQ9A 2FF5A 2VT6A 4G97A 3BE5A 4JBWA 4QG7A 3AUJB 3IAEA 3KPUA 3WAKA 4PM4A 2VYND 3OT5A 2HWYA 2UVQA 5AK3A 1KI1A 2JANA 4OGGA 3ER9A 1GR1A 3I2IA 2GUWA 3R6GA 4HDOB 3AHHA 4B0PA 2H65A 1AK9A 2B5VA 1YC2A 3QMMA 3RASA 4KLNA 2GMWA 2XYVA 3K16A 3DE5X 4TKVA 3KB6A 1O03A 4CDRA 3LWNA 3I05A 2O8CB 1G8GA 1T2UA 3R6DA 3EXG1 4PAQA 1P8JA 1XLWA 5B2ZA 4JLUA 1NBIA 3BERA 4Q3BA 1IZ8A 3KWJA 3FTEA 2XEDA 4EG1A 1ELOA 1GKKA 4KRYA 2C3UA 1E6WA 4PG6A 4BMPB 4G5GA 3I1JA 4M2LA 1XZLA 5TPZD 4H3VA 5KEIA 1MG5A 1GCUA 3E7WA 4CVNA 3TZEA 4EGJA 1O7JA 2IY7A 3SR3A 3O26A 3U6BA 3N6VA 2C00A 4U63A 5ALEA 2OQVA 2UYGA 1Z07A 3C1OA 1FVHA 3IS3A 4WI1A 2J3HA 4YWHA 2A1UB 2AOUB 1XCBA 3LOQA 3SSNA 3WSTA 2RD2A 1JSRA 2G25A 2LP4Y 3OZWA 4IS2A 1TO1E 1A9XA 4PO8A 3GN1A 1U1EA 4MV3A 2WV7A 3FWZA 1C9YA 4MJXA 4NL4H 2QGNA 4UU7A 4DMCA 4ECEA 1W85B 5BQOA 5LMCA 3NONA 4GLFA 1D2RA 2OTCA 1XEAA 3ABOB 4AJ1A 2JHAA 3ZHSA 2UUBB 4BEWA 4GPZA 4ME6A 1NSFA 1OLXB 2G77B 4OPMA 1XZAA 1RHJA 3NT5A 2X9QA 3RYHB 1TEHA 1PUXA 4ALMA 4DR4B 1P5HA 1Z0AA 5ALOA 1KVSA 3THOA 2RGNA 5J2UA 3BJMA 5EQJB 2HIGA 3I5XA 2Y0EA 3T5AA 1QV9A 3D6HA 3N07A 1KFCB 4A1OA 2A5DA 1EFLA 1LZLA 3ZCTA 3RLFA 4JLNA 1ZESA 2XXBA 5LUAA 3K0SA 1YJ8A 1V2HE 3X1MA 3BGWA 2MSCB 4GPD1 5EIXA 3QI7A 4UBLA 2IDMA 4OQQA 3MEQA 4RMHA 3RANA 3RC1A 4ND2A 2UDPA 4X90A 4LF8B 3KT6A 3V1MA 4M7OA 3E9CA 3L07A 2B2NA 4KLRA 4NZYA 3IESA 4J07A 1AQYA 1GZHB 2G82A 2AJDA 5CH8A 4M7PA 3FA2A 4IIEA 3SZUA 3CJQA 4E4YA 3U5TA 2P8JA 3TPZA 1RHKA 1V3QE 3DHYA 4ROSA 5HEKA 2YNMD 2GZSA 3P4YA 4P08A 2F55A 4FKMA 4XGRA 1EXDA 1KK2A 2BZ0A 3R20A 3HFGA 4EW1A 5KMGA 1ZU5A 1NVKA 4KQFA 2OCPA 2KHZA 2ZIWB 3FI9A 2IOQA 4J76A 4KQMA 1QFXA 4LSWA 4F9EA 3KWFA 5HK8A 4OK6A 3D6AA 1GTJ1 1HNNA 3ENWA 3A6KA 2FFQA 4D9HA 4QTYA 4BY9E 2WM3A 5IDYA 3VDRA 1E94E 1XLUA 3O9ZA 4LTDA 1YA6A 1FPMA 3GJ0A 2HCRA 1XDGA 4EHFA 3B85A 1J5XA 2R7MA 5LB2A 1LDBA 2GF9A 4RADA 1J2TA 2MCFA 3JQFA 2LUOA 4JQSA 4IGIA 4BCBA 1TQ6A