4PPGA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-br
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
329
structure length
311
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 311
sequence length 329
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppgA01
1KTVA 3UMRA 1RRFA 2WJVA 3K1JA 3W8RA 1AS2A 3V9PA 2O0KA 1IOZA 1N6LA 1Z0KA 3DL0A 3S1AB 1CR2A 4R9UC 4C7OA 3U7HB 2W00A 1I2MA 1IAQA 4V02A 2QSYA 1BH2A 4BASA 3U6BA 2VO1A 4DT1B 1LNZA 5B58C 4DUGD 1MO5A 3A37A 1UBCA 1KOFA 2HUPA 1W44A 4Q4JB 5CIQA 2WWGA 5P21A 4QGAA 2KI5A 1FMLA 2VHUA 4LYHA 2QAJA 1FQKA 1ZD8A 1AQUA 5J4VA 1P72A 4JLOA 4DLRA 1N6RA 5C46F 4H1VA 3HYRA 4UXIA 4KJZA 2J0QA 5FPYA 4M1WA 4G5RA 1OE0A 4BECA 1AGRA 1WXQA 2J46A 2A7QA 1ZM9A 1EFCA 1N6IA 2Z4RA 4NONA 3C5HA 2XOKD 721PA 2AR7A 5JI2E 4UNSA 1LV7A 2V7QA 5KU1A 3VFDA 5J47A 1XMIA 5FPTA 4XOIA 4JVSB 3BFKA 1WA5A 4XTRA 4AG5A 3AVTA 2HXYA 1CJMA 1SVOA 5C4MA 1HUQA 1A4RA 1EX6A 4PHTA 4ZI3A 4C0AC 2MMCA 4EPXA 4LHYA 2C04A 3DDCA 4MUBA 3B2EA 4G5QA 5L3RA 2QTFA 2CL0X 1XCMA 3T5DA 1D6JA 3EIQA 5J5CA 3TUZC 4ILEA 1OH6A 3RRNA 1DELA 2OLKA 4UNQA 1SGWA 2VEDA 3IO3A 4LYFA 2CK3D 2IC5A 3UG6A 3WNCA 2ZI6A 2QMEA 3P32A 5F98A 1DE0A 4GMXA 2KJQA 3SDZA 3QEOA 3NBXX 5C2JB 3ND9A 1A82A 2RB4A 2XAUA 2J0SA 4LJ5A 1NN1A 5KSPA 2GXQA 4QG7A 4Z54A 1TEXA 2JLRA 4NBSA 3WMGA 1MO6A 5FOVA 1GNQA 5FTMA 4ZI2A 5EUMA 2B7CA 2EFGA 1VCNA 2KB0A 2NG1A 2WJYA 4RZ3A 3U2QA 3Q9LA 4Q02A 1ZD1A 1LF0A 1KGDA 4B3XA 5E4FA 4MRSA 1X86B 3OZXA 3ETLA 4BLTA 1MV5A 4MKIA 1Q1ZA 3CWQA 4LBZA 4D0LB 5HKKA 5L3SB 1YZNA 4KFSA 1ZU4A 3C15C 2R9VA 3LVQE 4JJKA 3IHWA 1G3RA 4A82A 2F43B 1FFHA 4HI0E 4O0MA 3TAHA 1CRPA 2CVHA 3B85A 4HDCA 4QKQA 1T6NA 2Q3FA 2IYVA 1YZKA 2WVJA 1ZJ6A 1AZTA 1CXZA 2HT6A 4A0HA 1RKBA 2GBLA 3P4XA 4IW3B 3H0KA 4DLTA 5FTLA 1OIXA 1HQCA 2CBZA 5HPYB 1V43A 2BCGY 2O5VA 5G53C 5DE3A 3WYGA 4BFXA 1E9AA 1NMZA 1Z6GA 4BLPA 3SFVA 1SXJB 5CYPA 1ZC3A 3TKLA 3ZYCA 4AKEA 2KBEA 3TQCA 3HPRA 1J70A 1VYTA 1II0A 4ZPXA 2RGEA 1XEWX 4JT4A 3UXMA 2CK3A 4MQBA 4B76A 4LX0A 5J4HA 1YR9A 3GD7A 4NP6A 3RWOA 1OIWA 3T35A 4LUCA 3VR2A 1YZTA 3WP0A 4D4LA 2ASEA 4R2IA 3ZZTA 1NVUQ 3PUXA 5H8WA 1IN8A 1UM8A 4KI0A 2O0HA 1E2IA 3HJNA 2CHQA 1VMAA 1YE8A 4TL9A 3QENA 3BFVA 4X8HA 3U4QB 2O8FB 3FPAA 3MJRA 1FW6A 4Q9HA 2WKPA 3T1VA 3WY9A 4U02A 3RAPR 4QHSA 3F0TA 1IY0A 2QORA 1QRAA 4MGKR 1NVXQ 2BMEA 2DWQA 2X2FA 3HDTA 3KQHA 2ZI7A 521PA 3DM5A 3P27A 3VX3A 2ZE8A 4EFMA 4QRHA 3W5IA 2ZRPA 1TQ2A 3GQBA 3WP1B 3K0EA 4Q4LA 2FU5C 2QZ4A 2IYZA 3TQFA 3U3RA 2JLYA 2D3WA 2ZSEA 1VECA 2IXEA 1UDXA 4IKEA 1NSFA 2KBFA 3OFND 4FCVA 2F1IA 3SC3A 4KFUA 1UKEA 4CEHB 2P6RA 1JB1A 1W0JD 4AIIA 3M4YA 3LY5A 4IXNA 1XEXA 1P73A 1TUIA 4RD3A 4B43A 3CRRA 1W2HA 4GOKA 4CZ2A 3KZ1E 3AV0B 3TVDA 1E0JA 3QXXA 5IF9A 4LGMA 4LJYA 2QM7A 2AKAB 2W0SA 1G4UR 5DO9A 5TARA 4CT5A 1Z29A 4EQ6B 5SZIA 5BYKA 4F7WA 2CLDX 3C41J 4LHXA 2IEZA 1I4LD 1IY1A 1KI3A 2GF9A 4BFWA 5JS8A 2FMXA 1W48A 1DAIA 1NMYA 1W0KD 3CRQA 3Q7QA 5CJPA 1P62B 3CBQA 1DAKA 1GKYA 3TUJC 3NH6A 3ZVLA 2YNMA 4WA7A 4BFTA 1Z0IA 1X8KA 2ORWA 4JBWA 3TBKA 1FTNA 2X1VA 4QJ4A 3CW2A 3AUXA 2QPTA 3K70B 1Q22A 4BFZA 1XTQA 2ZJZA 2IWRA 2GJ8A 4D80A 2Q3MA 4JVNA 1OFTA 2J87A 1WBDA 1OHHD 1OH8A 3TRFA 5JS7A 5EE9A 3W34A 1XBTA 4LYAA 2P2LA 4B32A 1M74A 4D26A 4MYHA 1KJZA 2ZE6A 4TWZA 3PXGA 1KDOA 4AYXA 1RE0A 2DY1A 3D6TB 4TYPA 1XD9A 3DKPA 1GSIA 3EX7C 3MWJA 2HF9A 4QL3A 4IHQA 2FZLA 4YQFA 1RW4A 2PLFA 5FOTA 3FHOA 3BH7A 1G7RA 1XFAA 4BUJA 4LI0A 1ZBDA 4US0R 4XD7A 2EWWA 4IDNA 3S1AA 3OFNA 1IN5A 4K46A 4GRAA 3HP1A 1OW3B 2WWFA 4KFTA 4KODA 5M04A 4LC1A 3T1OA 1G41A 2JLXA 2ERXA 2IYXA 2VBCA 2X2EA 1W0JA 4LV8B 2WMNB 2WJIA 4DT1A 1FZQA 1TNDA 2OFOA 1OSNA 3U3JA 2YHSA 3I73A 3DO6A 4D2IA 1FQJA 2XX3A 3AF4A 2YWHA 4Q4JA 3RS7A 3GLGA 3ADBA 4EJSC 1GNPA 4G5GA 3CPEA 2VP9A 2WSMA 1XP8A 2X19A 3I3SR 4TMTA 1X1SA 2BKEA 4DIEA 4NKRA 2QROA 2QP3A 4HLCA 4I1SA 4C0BA 2VLIA 3T61A 4C0QC 1P60A 2G83A 3QXJA 1ZNYA 2V6IA 2XNSA 2W6IA 3LO5A 2C96A 3OE7D 3X2SA 3UANA 4NL4H 4TYNA 2G0TA 4DLXA 2BIFA 1E2FA 3EC2A 3KUDA 4GT1A 2QTVB 1GKUB 2IUTA 2KSQA 3B1YA 1SVKA 3WMEA 1XEFA 4PZYA 4F92B 2WWIA 4YDSA 2CE7A 2O8EA 4B3DA 3AVOA 1AK2A 3H84A 2JJ2D 4NU0A 3VQTA 4DLWA 3OAAD 3K0CC 3BFXA 5KYKA 1Z22A 1G8GA 4RD6A 4A15A 3I8XA 4CT4B 4JSYA 1E69A 3UMSA 3FDIA 4XWKA 1IY2A 2ZJOA 1Q20A 1ZM3A 3SFZA 1RPZA 3VHLB 1QHXA 2CL6X 4E22A 2H92A 2ZJ5A 1S1CA 2GTPA 3Q85A 4EPTA 3MSXA 3OIVA 3B1WA 4K81B 1E0SA 1M7BA 4Q66C 2J1LA 3A36A 4LYJA 3EZ6A 3REGA 2WWXA 3EAQA 4PAOA 3IPYA 4DHEA 4GL2A 3L8YA 1H65A 4HDQB 1NRJB 3BOSA 3ZLJA 2P6UA 2ZRLA 3EARA 3NBZC 4N1AA 1WP9A 4TQUS 3KKMA 1JQJC 1M2OB 2PT5A 1CF4A 2JJ8A 1KDRA 2BBTA 4MUAA 4DVGA 1VG8A 3F3YA 2AK3A 2C5LA 4IRUB 2QA5A 4C0KA 4JVLA 2ZM5A 4F91B 3EPLA 2XGJA 4B44A 5A4JA 1KMQA 2WWWA 2N42A 1L8QA 2GF0A 3DM9B 3M1IA 1E96A 4EKDA 4NYMR 4KCGA 1N5IA 4W5HA 3SU8A 3OEED 3QXHA 2O8CA 3GLGE 2GESA 2MSCB 3EIEA 5J4LA 3CR8A 2ZRJA 5CK5A 5LD2C 1M8PA 1QHYA 3NH9A 5TXGA 2F43A 3VU9A 4CEJB 1HT1E 2OXRA 4BLSA 1OXTA 4HAUA 3O8CA 3OE7A 3B9PA 4V0KA 2OBNA 4NCJA 3PUVA 4ON9A 4PQRA 1TF5A 1WDTA 2JDID 3VMFA 3NEJA 4A2PA 2WPDD 3EG5A 1W4CA 5EUQB 3SJZA 1OYYA 4TYQA 4DDTA 4HUTA 2HXSA 2JJ2A 1Z0JA 1N5KA 4JBXA 1E9RA 4DB2A 3IIMA 4TT3A 5KSOA 1SXJA 2MSEB 1UKYA 3A58B 3PEUA 2R6AA 4N3NA 4E5UA 1J90A 2ZI4A 4JKYA 3KKPA 4PC2A 3A4NA 3FVQA 4KFRA 4F4JA 5BN5A 2QUZA 1TTTA 1FX0B 4PTLA 4MGYR 2ZRDA 4C2UA 5KHOC 3IPXA 3PEYA 4URZR 2HCBA 4A0RA 2JASA 1PZNA 2XB4A 4OYHA 4QFMA 3H4MA 3ADCA 3THOA 3EA0A 1WBBA 2C98A 1PLKA 1NSTA 2ZQ5A 3CWZA 1RFLA 3MRSA 5C18A 2FJUA 1VG0B 3ZD7A 3TW4A 3MWLA 1YU9A 4WAUA 4BPBA 3U4QA 2O8FA 1GNRA 3VR5A 3FHTA 2EWVA 2IX3A 5ELXA 1Z6XA 2ZUBA 4HDOB 4EJSB 2QEQA 1T3SA 1RRPA 5BN4A 1P9RA 4JYCA 4QBGB 4URYR 4E09A 2AFHE 4A8JA 3T34A 1XDBA 4Z8YA 3B1ZA 1U8AA 1VDZA 2WAYA 3TE6A 2JLUA 4H9GA 3PFIA 2XSZD 3LRPA 3HYTA 3WYFA 1UEIA 1AS0A 4ZCLA 4ASUD 2DFLA 2RGBA 3JZAA 2GHIA 4CEHA 1X6VA 1ZUIA 3AEZA 1LVGA 2FEOA 2OLJA 1UPTA 2DWOA 2WWHA 3DOFA 4LCBA 2DCUA 4GP7A 1II8B 4W5WA 3GJ7A 4A2QA 2DFTA 4PC6A 5KDLA 2QMOA 1TQ4A 2GXSA 3QKSB 2NMVA 1KJWA 2XJ9A 1W47A 3A1TA 1VHTA 4PSAA 2ODEA 4UXJA 4V0NA 3IO5A 4IFEA 1TU4A 1ZW6A 2AD1A 2D62A 1CS4C 1W4RA 4XH9B 4XTCS 5FBVB 2NZ8A 1KSHA 3AF3A 5D3QA 2FX3A 1WMSA 1Y3AA 5JWOA 3CR7A 5FBWB 2G0NA 1SXJE 2ZJAA 3VKWA 5KNCA 1R10A 2HYIC 4LJ6A 4A4DA 1E6CA 2BBOA 2W2VA 2J7PD 4TSFD 4CRWB 3BS4A 2XB2A 5H70A 2P67A 3TNFA 1J8MF 4OI2A 2ZXUA 2PJRA 5FR1A 4Q47A 4CEIB 5DSZA 2R44A 1BKDR 4DLZA 1EXMA 3TSZA 2AX4A 2C9YA 3NEYA 1WRBA 1P2SA 4RSGA 2AD5A 4RD2A 4RKEA 4UNPA 4BFVA 2PZFA 1ONBA 1KO7A 3UK6A 1QHIA 2W83A 3JVUA 3KKNA 2VHTA 5CJ2A 2D4HA 4HLUC 4EUNA 2BMDA 1JJVA 4M9SA 2CCKA 3GJ0A 1Z6TA 5L3VA 3G5UA 1VIYA 3RYTC 3WNDA 2QBYB 1DPFA 4LHWA 2CEAA 3CF2A 4OL0A 2C8VA 3DKVA 4MDFA 3AVWA 2BHRA 4QGFA 2ZE5A 2ZAOA 4TQAA 5AJVB 3U7GA 1E0AA 2WJGA 2VSOA 3KQLA 3RLFA 1WB9A 4NYMQ 3NXSA 4B2IA 3SJCA 4BE7B 4DIDA 3ZZ0A 1U0LA 2WIAA 2YC4C 4HAXA 2ZVQX 3LXRA 1QG4A 2ODBA 2Q9CA 1SULA 1IONA 1U99A 2ZR9A 3WHKA 3K9HA 2QL6A 2J3EA 3AVXA 1Z07A 1Z63A 1DAGA 1ZIPA 2ZVPX 3C14C 3MWYW 4XVQA 4HB4A 4MRNA 1AA9A 4AKHA 4URXR 4Q00A 4BEBA 1W36C 1OKKD 3SE0A 3X1DA 1JQLB 3KXLA 4B35A 2PZEA 3QVVA 4B75A 3NC1C 5J40A 5FBRB 5JHGB 3AVVA 1NKTA 4MH0R 4RCZA 2PCJA 4DLSA 2PT7A 5KDOA 1IJFA 5CDFE 4GPTA 2BVNA 1XD2A 3QPUA 4HAYA 3PJRA 1GIAA 4KAXA 2ZAMA 1MO3A 1P3JA 3QKRB 4GI7A 2PL3A 1DAFA 1G17A 1T5LA 1XB2A 4IOJA 5CIWA 4B48A 1HE1C 1KDPA 1EFTA 2WTUA 4YXWA 3LDAA 1E9EA 3SHWA 1OLOA 2GA8A 2FGKA 4JKIA 3TW8B 2ONJA 4B47A 3GFOA 2FDCA 2HJVA 4QJ5A 3DPUA 4PQYA 1A2KC 1N5JA 2QAGA 1F2TB 1Z2CA 2GJ9A 5B64A 1KI1A 1EX7A 2QMHA 1ZAKA 4W5JA 2VP4A 1RZ3A 3I4LA 4XIGS 5FR2A 3X1WA 5AUQA 4OHZA 1AM4D 2G3YA 2B7BA 3TUIC 4D0GA 1AKEA 1BYIA 1G6HA 1XCPA 2C2HA 4HEJA 3AVPA 3DZ8A 1ODFA 4OK5A 4BLRA 5JCZA 5IDVA 2ODWA 2BMFA 2ZS8A 1GVNB 4HUQB 2NO7A 4P33A 2GEDA 4KLZA 3B1XA 4Q1CA 1SVWA 2X77A 1EGAA 3QXCA 2ODNA 3QF4B 4HAWA 4RY2A 5B2ZA 4WVFA 1UBFA 1N2CE 4PHHA 2XZPA 4IXMA 3WNBA 3EPJA 5CYOA 3AKEA 3ZVMA 3LW8A 2QE7A 3QOFA 3CRMA 2QM8A 5L3QB 3OEHA 2IS1A 1EFHA 1XTIA 1DAEA 2XNDA 4MRPA 1K6MA 4U5XA 1ZD9A 3IKJA 5BN3A 4EFNA 4Q9JA 4CEJA 4MGZR 4PFSA 1P75A 1MABB 1R5OA 1YZUA 2FNAA 3OESA 4DLUA 1HH4A 2YZ2A 2BCJQ 5HZHA 2H5EA 2H57A 4MKHA 3DZDA 3U7FB 3CX7A 1VYVA 3ZVRA 3U3OA 1I4TD 3FMPB 1E2QA 1US8A 3U60B 1AJEA 4CVNA 3KJGA 2OEPA 5CB6A 1CR1A 4KITB 5SZKB 4R98A 3Q5EA 5JSZA 5E95A 4ZO4A 2GILA 2GAOA 1AA3A 1KYIA 3A1SA 1U2RA 1H8HD 1M34E 2ZR0A 1VG1A 3EW9A 3PR1A 1GFIA 3VTKA 4EDHA 4IVRA 4M22A 4MKFA 2AK2A 2CVFA 1QDEA 4MITA 2D2FA 2HLDD 2JIZD 2Q9AA 1FX0A 2FWRA 4G3XA 2ZIAA 2LWIA 2OUKA 2AN9A 5FL7D 4I1UA 1AZSC 2J41A 2QP4A 3PV0A 5HR5A 1E4VA 1KO1A 1UJ2A 1G3MA 5G3ZA 4L16A 4JYBA 2P3SA 2CNWD 1NKSA 1XTJA 4LJ8A 2HJGA 5G40A 4TQ9A 4OHVA 3BH6A 3PEVA 1NBME 2QT0A 1ETUA 4HATA 3L0PA 5FOSA 1E2HA 1VYUA 4IEIA 1ZM4A 2EYUA 1YHNA 2WICA 3W6OA 2IUUA 1G7CA 4DCTA 3K0SA 3EZ2A 4US2R 4J0QA 3KXKA 4KV9A 5JJLA 3QVUA 4TL8A 3CKLA 3BORA 4IFBA 2H7VA 2QSZA 4B3CA 4D4KA 3CB4A 1KO5A 2RGNA 4Q21A 2CJWB 1G8HA 3H86A 5JRZA 5EQTA 3CF0A 1ZRHA 3QJYA 4TLCA 1QHHB 1ELOA 4NPHA 4I99A 2E87A 5J4YA 1T0JB 1MRSA 4DUGA 4GFDA 1JXOA 1II8A 3DMNA 2IYSA 2WV9A 4HB2A 2BBWA 2EW1A 1SKYB 2OM2A 2ZYUX 2ZRHA 3SZRA 1UF9A 4M21A 2JJ1D 2XXAB 4FW9A 2Z5FA 3JZMA 4Q03A 3ICQB 1L4YA 2ZRMA 4XSHA 1XCGB 3RC8A 3K09A 4L9WA 4M9XA 3REFA 4PHFA 1U0JA 1OIVA 2BEJA 4XJXA 2J0UB 3PCRB 2GVDC 2XOKA 3VKGA 1BYUA 2HLDA 3CX6A 2GJKA 1GRNA 2ZTSA 1DADA 1XXHB 3BK7A 3K9NA 5DGXA 4F38A 4URVR 4QM7A 2F6RA 3MUFA 1ZMXA 4TLBA 5DIFA 1Q12A 1R5BA 4YMSA 3TIFA 5FL7A 1YR8A 4O2RA 1XEWY 2A5DA 2Q0HA 3KX2A 4M1MA 3BAFA 1XMSA 5FPSA 4P0TA 2VTKA 4CEIA 1KK0A 221PA 3D7MA 4LJ9A 3A6PC 4G5SA 4WBSA 3DOEA 4PO1A 1H8ED 5KNDA 1C1YA 3N70A 3QY0A 5AWFC 2PH1A 3THXB 5F2EA 4TZ6A 4R7ZA 1NN3A 2RHDA 5FTNA 2FFBA 3ZDQA 5LPNA 4UQOA 3CX8A 4JLBA 5ANRB 5E7IA 2P65A 2F55A 4BRWA 3EASA 4OK3A 1D2EA 2FOLA 3I5XA 4DSOA 4AYWA 5SZJA 1P5ZB 3A4LA 4Y0VA 4DSUA 1G7TA 4DWJA 2P0EA 3B9QA 4GOXA 1IXSB 1NIJA 1RC8A 2JGNA 1FP7A 1OXVA 3NIBA 2QBYA 4A36A 1B23P 4DSNA 1A1VA 3KKQA 2J9RA 5DHAA 3IBGA 3PUZA 2BC9A 3QIAA 3ADDA 3DHWC 1S9DA 1K8RA 3GJ4A 4D81A 4JL5A 5HZKA 1XMVA 5KTYA 4RZUA 4HAZA 1HV8A 3MFYA 1IXRC 4B6EA 3NHBA 4X8OA 2ZSBA 2I1VB 1NF3A 1NVVQ 2G88A 1OV4A 2NO9A 5AJYA 4ZIRA 4I1VA 3QF7A 1CIPA 1IXZA 1WQ1R 4LWZA 4YONB 3Q7PA 1KY3A 3B82A 2ZI9A 1KMHB 3FB4A 2JJ1A 2BWJA 2DYKA 2VF7A 4FIDA 3E70C 1FNMA 1ZNWA 5CITA 1ESMA 1OFIA 4PHGA 2ATVA 3B1VA 4IOKA 2K5UA 4Q4AA 4HZIA 4JLJA 4AG6A 1S1MA 2ZSDA 2F7SA 5HCIA 1NIPA 2C9OA 2WOJA 4N0DA 5FFMA 4AYTA 4TN1A 5DLQC 3CPHA 3ZS9A 4HZUB 1EG7A 2V55B 3HU1A 4RCYA 3GJ5A 3W3AA 5JWHA 2OCYC 1G3UA 2V6JA 2ZYWX 3IDQA 3KXIA 3L0SA 4UXHA 5DISB 4Q9KA 4OI0A 4ERNA 3GEHA 3LBHA 3VNUA 3SS8A 2BOVA 1U8YA 1X8LA 2Q3HA 5FPHA 1JR3D 2RH5A 2F1HA 3QKRA 3QQ5A 4YMUA 4JLKA 2CLSA 2CMKA 3TR5A 3T15A 3GJ6A 5D3MB 2N1BA 3M6AA 4QNRA 4B3GA 3EWSA 1H8EA 4ITRC 5LB4A 1XX6A 4LPSA 4ESHA 4OJQA 5EJEA 1F2TA 2RCNA 2UZ3A 4ABYA 3GLFB 3MD0A 1CBUA 4RVCA 2ANCA 2RGAA 4US1R 3QNUA 2DWPA 1GTVA 2ZJ2A 5C4GB 4JVMA 3BC1A 1I4DD 1AN0A 4Q19A 2GKSA 3ICEA 5BQ5A 1CEEA 4MA4A 1KZ7B 1T0HB 1KI2A 1Y63A 4PAQA 1KI7A 4BZPA 2ZI3A 3ZVNA 1E2EA 2YKGA 2HF8A 4EPYA 3QF4A 2IHYA 1DOAA 4NCKA 3SN6A 1IM2A 1GRQA 1E0KA 3GLIB 4I81A 2QP9X 2WJJA 1F60A 1SVLA 2CXXA 3O47A 5L3QA 2NQ2C 4RFVA 1W36D 3BIFA 1KAOA 1KI6B 4X8MA 4TMWA 1OB5A 4L15A 1Z0DA 5FTKA 1D9XA 3WBJA 5F3WB 2WBLC 1E2MA 4DDWA 1T3HA 2EFCB 3RNLA 3X1YA 4M1OA 2LKDA 1F48A 4E07A 1KJYA 4Q9IA 4FMDF 5KO2A 2PBRA 1KI8A 2A3RA 4MKGA 1E94E 2CDNA 1R6BX 1JR3A 4B34A 4DCSA 2VA8A 4PPGA 2RGXA 4LV6A 3AQ4A 2G77B 1CU1A 4RFSB 4AK9A 3EC1A 5CM9C 3TJZA 2HT1A 1W0KA 4ZCIA 5BYJA 3ASZA 1VHLA 4OQNA 2F3TA 1OF1A 3W8NA 2KE5A 4PPFA 2ZU0C 4HLUA 5FOXA 1D2MA 1WCV1 2V54A 3H2YA 4UKDA 4NMMA 2VPPA 2NO6A 1U8ZA 3BXZA 3AKCA 1G18A 1DAHA 4Q7LA 3SJAA 2P5TB 2W6JD 1SZPA 2XEXA 3L82B 5HCNA 3Q3JB 5AR1A 4FN5A 2GRJA 4PPNA 4MYTA 1G3QA 1OHHA 2REBA 2ZRNA 1XTSA 5FUYA 5HE8A 5E3HA 2N46A 3TR0A 1RIFA 4N0EA 1N0UA 2YV5A 1VPLA 3LLMA 1J99A 4QNMA 2CHVA 1GAJA 3IIKA 1SVIA 1NNEA 1Z2AA 5GVRA 1WE2A 5H68A 5FH9A 1W2GA 1MR3F 1QF9A 3KTAB 4TL6A 2XJ4A 2IEYA 2WM9B 4IDQA 1XWIA 3K53A 1QHHA 4NYIQ 3WXMA 4AWXA 4LHZA 1NJFA 2GEVA 1G9XA 1CJTC 2ZU6A 4KVAA 3ZQ6A 3X1ZA 2WSSD 1RJ9B 3ASYA 2GBLC 3FWYA 4A2WA 3B8HA 4FCWA 3U3KA 4QHTA 3SI7A 1CTQA 2ZI5A 4M1KA 3LXXA 3GFPA 5L3SA 2P6NA 2XXAA 3C7KA 3PUWA 4MRVA 2BM0A 3BWDD 3AGQA 5JECA 1IN4A 1Z6YA 2D2EA 5EP4A 2ZRGA 4QXAA 4OI1A 1Z6AA 3BH0A 3RSOA 1PVOA 2AXPA 3EPKA 4PXAA 3I5YA 1GITA 3BB1A 2EFHB 2A30A 2OILA 3FFBA 2J0UA 2YOGA 3MJHA 2Q6TA 5JFGA 2GAAA 2VHQA 3NVAA 4OQMA 3OHMA 3EA5A 3FHCB 3A1WA 3LX5A 3CH5A 2VHCA 2IF0A 1U90A 2Z83A 4JJZA 2R6GA 4XSGA 3UG7A 2A5JA 1BIFA 2A5YB 2PLRA 2RMKA 5DI9A 5J4KA 2OCAA 5GJCA 3PENA 1VTKA 4C7OB 2QG6A 3TMKA 3OAAA 2J0VA 3R8CA 4TYYA 2GCPA 1AS3A 4LK2A 4PX9A 5FUWA 1A2BA 3WBKA 4B71A 2LCFA 4ESVA 4L9SA 2RGGA 4FWTA 2VRWA 8OHMA 2BBSA 2ZUDA 1YZLA 3CONA 1NMXA 2IYQA 1VKJA 2OCBA 4ZKEA 3THXA 4ARZB 1B0UA 2GETA 4FXPA 3SQXA 3IHLA 4B6FA 2HDNB 3I72A 1TEVA 3LFUA 3LQQA 3PVSA 2ECKA 5EXPA 4G0NA 3AM1A 1MO4A 5AJZA 4BFUA 1X3SA 1G64A 3N2IA 3KUCA 5JJKA 4OBEA 3Q72A 4DLVA 1F3OA 3R9IA 1YZQA 2RHMA 3UWKA 1E2DA 4BEJA 2F9LA 2X8AA 3TLXA 3AP2A 3ZIAD 3KL4A 621PA 3IIJA 1IHUA 4JLVA 1E79D 1N6KA 4KLNA 1RYFA 3R20A 2ZSAA 1DS6A 2BJVA 1G6OA 2KWIA 2VYFA 1AQYA 1HURA 5TY0A 2F9MA 1EFRD 1GG2A 2WSSA 5EXTA 3I61A 4KVGA 4XWOA 3LAWA 3G0HA 1BOFA 4TMXA 4A92A 3OEEA 4ACAA 1KK1A 1NG1A 2C78A 2V1UA 1M6NA 1IN6A 2E9SA 4IEEA 4B74A 2IK8A 3VNVA 2CCJA 1CP2A 4TTQA 1YRBA 2NPIA 4DJTA 4CGZA 1R0ZA 3R7WB 3SYKA 1G291 3AB3A 2V9PA 4A9AA 2ZANA 2NOAA 4HZUA 3WYAA 3K0AB 2OFWA 2V1XA 2JDIA 3IGFA 1CRQA 2REOA 5JLJA 2WPDA 4CYMA 5HTKA 3DVLA 2R6CA 3E1SA 3CRW1 1DG1G 1N3BA 4A6PA 3OIWA 3SHFA 4M2LA 1E2PA 3A1UA 3QBVA 1KKLA 1N5LA 2YWGA 4ZDWA 1QZXA 4EQ6A 3I1FA 4URWR 4HLQB 2ZS7A 3CF6R 1TADA 1CKEA 3SNHA 4DLYA 1XJCA 2FPKA 3Q8XB 3PEWA 3AF2A 3VR6A 1VCMA 2IS2A 3EZFA 2AL7A 4GZMA 2D06A 4PQFA 4TLEA 2DFNA 2OSBA 2VP2A 2J5XA 2ZEJA 5FUVA 2DHRA 4EPWA 3H1TA 3GLFA 1JXMA 3CNNA 1SKQA 1IJEA 3K0FB 4YC7A 4D0NA 1ZCAA 1DG3A 4Q7KA 2YOHA 1HA3A 4OI4A 2W2TA 2NTYC 1N0WA 5DYIA 2HYDA 3FTQA 2ZJBA 4Q48A 4TTPA 2IYYA 3CM0A 3RHFA 3ZIAA 5BW8A 1JR6A 1NLYA 1YJ5A 1S96A 2WJHA 3UIEA 4BWYA 4M1SA 2ZRKA 1EFUA 1E98A 2PMDA 2EQBA 2JLWA 1EWQA 3PQCA 1UBEA 4OK6A 2Z43A 5LBIA 4QBHA 5DNYB 3GLIA 4ACBA 1P6XA 4F93B 2VP5A 5EE1A 3B6EA 5LD2B 1G8FA 2XSZA 3HR8A 2IYUA 3KQKA 4PZZA 3RABA 2JLSA 2O0JA 3LQRA 4ASUA 1KI6A 1OH5A 4PANA 2G1JA 4Q7JB 3SBDA 1J7KA 1KSFX 2GK6A 4B73A 1P9NA 2HV8A 3C4JA 2EU8A 1E1RD 4ZV4A 3ND8A 4JLPA 4EAQA 4MGIR 1NLFA 5EP1A 5GJWC 1UEJA 1NVWQ 1Q3HA 1T9HA 5KSZA 3P4YA 3WRXC 3TH5A 2DB3A 3IILA 4EPVA 3P26A 3BB4A 4II7A 1JNYA 1X8JA 4GMDA 1ANKA 2NPFA 3VHXA 5AUOB 1KZGB 3V00A 3BJIC 3QBTA 3IUYA 1XZQA 3PIRA 2FA9A 3E2IA 5B57C 5IK2D 3GJ8A 3NBFA 3B78A 3A8TA 4Q4HB 4DCVA 4Q18A 5EE0A 5JRJA 4NCHA 3QUSA 3M0EA 4LDJA 2MMGA 4U00A 3T06B 3CPJB 3U7EB 2CE2X 2J7PA 1P2UA 4TSFA 5TB5A 5DYGA 3GCGA 2B21A 4BRUA 1MH1A 2GCOB 2AXNA 3B13B 3GFTA 3GLHB 1KSGA 1VG9B 5CLLA 2IW3A 4LSGA 2PCLA 2AHOA 1LS1A 1TX4B 2Z6VA 3R9XA 1XEXB 4PR0A 1XZPA 4KBFA 4IVQA 4PC3A 2Y8EA 2OESA 4NYJQ 1EWRA 3SQWA 1DO2A 1ZUHA 1XTKA 3MMPA 2QT1A 4WZ6A 4NCNA 4ZDKA 4W9MC 1HY3A 1KKMA 2GJSA 5DN6D 1BS1A 3NDBB 1ESNA 4LOAA 2B8WA 4AKIA 3WMFA 1Z06A 3CH4B 4JL6A 1SVSA 2BEKA 1TMKA 1W49A 2L0XA 5K8LA 1AGPA 1YR7A 4Q1DA 4POAA 3KTAA 821PA 1E2JA 5AUPB 3TVTA 4W7SA 2JEOA 1P2VA 4WZBE 1G8PA 5DH9A 1CLUA 2V7QD 4DBLC 1W46A 3EXAA 2QN6A 1JAIA 1VIAA 4OJKA 1Q1QA 4WXRA 1ZCBA 3LX8A 4DEXA 4GP6A 1JPNA 1UADA 1Z83A 1U98A 3CNOA 3QG1A 1KSJA 4FMCF 1KK2A 1NVVR 4LJ4A 1E32A 4OQFA 4CW7A 4UJ5A 1DAMA 1R0YA 1SXJC 4GNKA 5IK2A 1E2NA 2D7DA 4AURA 5FOUA 3UWOA 1OKKA 4DB4A 1J2JA 4M9QA 1HQYE 2PEYA 4L8GA 4UNRA 1T8UA 2TMKA 2NGRA 1G5TA 3FKQA 2OE2A 3CZPA 3J81k 1VCIA 2H8KA 1E99A 3GPLA 1OJLA 1P61B 4PSKA 1PLJA 4C2TA 3IQXA 2QGZA 1O87A 3B7GA 5FL3A 1XNJA 1ZC4A 1JECA 2UKDA 4OHXA 5FBLB 1GRRA 1GOTA 1P7CA 2JAQA 3I32A 3PITA 4ARZA 5IHPA 2I3BA 1G3IA 2FPMA 3LA6A 3GLGB 2EFEB 2IBMA 2OXCA 1NG9A 5DN6A 1LFDB 3TK1A 4FI3C 5K8UA 5HKKD 4QGHA 3ECCA 2VHJA 3F8TA 4KHZA 4A8JC 3NWJA 2A5FA 1U9IC 2B92A 1YR6A 3I92A 3LVRE 5KUTA 1D2NA 4HLDA 1FMJA 4JLMA 4RJLA 1N6HA 2SHKA 1N6OA 2GDJA 4KSBA 2YWEA 1LF5A 1N25A 4EJSA 2FFAA 1HEIA 1S2MA 3B60A 1LTQA 3FMFA 4LBYA 1J8YF 2OT3B 3GJ3A 2VP0A 2O8EB 1OFHA 1CJUC 3U5ZB 4O3MA 3ZD6A 2FG5A 3RRMA 2GZDA 3OF5A 3SYLA 5CB8A 1W36B 3TSWA 3MWKA 2GWHA 4G01B 2C77A 4E03A 1UKZA 2XTZA 2GCNA 3AKDA 3L2OB 2H1LA 4LHVA 2FV8A 4LV5B 3VR3A 2W58A 3AKYA 3RS0A 2R62A 3SR0A 3R7WA 3FOZA 1GL6A 2QNRA 1U94A 3FMIA 1RRCA 3L0OA 1C9KA 2OAP1 3K0AA 4RD0A 5K8TA 3EWAA 2C99A 3K0CA 4M1YA 3QKSA 1R8SA 3VX4A 4ZCMA 3LNCA 3N2EA 4KBGA 4HAVA 6Q21A 4NE2A 2V3CC 5GJBA 1ZP6A 1NN0A 3N5CA 2J45A 2YC2C 1GP2A 3K70C 4DDUA 2REXB 2C9CA 1S4QA 2O52A 2R6FA 4P4TA 3RANA 1Q1BA 2VP6A 1H8HA 2A5GA 5JHHB 1NN5A 2F1RA 2R65A 2JIZA 4IOLA 2O8BB 4I4LA 4WIAA 1QHSA 1MOZA 3CZQA 4FMDB 3L8ZA 3ZH9B 2DFKB 4A0FA 1UKVY 4YLGA 2OBMA 4KSCA 2O8CB 4Q1EA 5IT5A 4NH0A 1Z0AA 1G5PA 2WKRA 2YJTD 3KJEA 1EK0A 3K0FA 3VR4A 2BKUA 4FD2A 3VU9B 2CNWA 2F3RA 4JMPA 5EP2A 1OXXK 4Q9LA 3RS3A 3QKTA 3LV8A 2MSDB 3BGWA 5EZ6B 1FNNA 1T3LA 1SHKA 4IOMA 4TLAA 1DVRA 2DR3A 4AD8A 2ZROA 2BJWA 3QPVA 3ZJYA 3BBPA 4M4SA 3UKDA 1L7VC 4M53A 3U61B 1G7SA 2C03A 3LLUA 2BMJA 1G19A 1DEKA 4P4SB 1YKSA 1KHTA 2Z0MA 1E9FA 1W1WA 4FMBB 5H1YA 2GK7A 1CR0A 1XF9A 4XVRA 1COWD 4LBWA 4PZLA 1ZNXA 3UMFA 4UNNA 1AIPA 4JLDA 4Q1BA 1PJRA 5F9HA 1U81A 2UVQA 2HEIA 4BLQA 2OCPA 2OAQ1 4D4MA 1F6BA 4AC9A 1R0WA 1K5GA 4Z8XA 4EPRA 2CLCX 1GL9B 2ZJYA 3KFXA 5LB2A 2ZJ8A 5C1BA 4TMKA 4LJAA 2QQEA 1QG2A 2BDTA 4NYIR 3IBYA 3NHAA 5BXQC 1MT0A 3LWNA 1XU4A 2VSFA 1K5DA 2GJAA 1TU3A 5JWRA 1S8FA 2A2ZA 3D31A 5KSYA 1AKYA 4RD1A 2OBLA 2XITA 5FPKA 2FE4A 3X1XA 1OB2A 1XJQA 1G5RA 1YVDA 1ZUNB 1ZVQA 2YINC 3HU3A 2G9NA 3AVYA 4C0SA 4Q4HA 2VQSA 3TAUA 2ZRCA 1Z0FA 4Y0AA 2QGNA 2FGJA 2ZYTX 4KYUA 5EXXA 3U3MA 2Q21A 1D9ZA 4MYCA 4A8JB 4ZDIA 2QAGC 3KB1A 5JEEA 1D8TA 1UFQA 4OKSA 3I62A 4XD7D 4PC7A 1KY2A 3AVQA 1QBKC 2FEMA 3TGPA 1S0UA 2GCOA 3GLHA 3PG5A 1E2LA 3AF1A 3AUYA 1P2TA 3ONWA 4HYYA 4YMTA 1M7GA 2GVZC 4WOPA 5A0FA 3V4RA 4S35A 5FTJA 3Q5DA 4PC1A 4LY6A 3HWSA 3GMTA 4DSTA 2RGDA 3L43A 4BGDA 4C30A 3A4MA 2ZR7A 2V8OA 4TTRA 1Q0UA 3QPWA 4D82A 1IQPA 1M1YE 3RS4A 4Q7MB 3SJBA 3WHLA 1F2UB 3MCAA 4Q1FA 5FI0B 2G1KA 4TZ0A 3O8BA 4EFLA 1JEEA 4QOSA 1Z5ZA 3LH5A 1HTWA 5GJVC 4KYIB 2WHXA 3C16C 2ZYVX 2ZETA 5GVSA 3FGNA 4BFYA 2QY9A 2W6ID 1G8YA 3DEFA 3I8SA 4I1OA 1COWA 2FN4A 1CULC 4HB0A 4HUQA 2AWNA 4P31A 1R5NA 1QVRA 4YMVA 3U6KA 3AVUA 4ZKDA 2YVUA 1HE8B 2IF2A 2GXAA 5B30A 3U44B 1KO4A 5UKDA 5HE9A 4M1TA 4DRZA 3R9WA 2OV2A 1HYQA 2RAPA 3ZGXA 4URUR 4BFSA 2Z4SA 2PMKA 1XJ0A 3OIYA 3THWB 1RRGA 2A9KA 1GILA 4KU4A 3EZ9A 4TMZA 4DDVA 4H1UA 2DPXA 3LW7A 2YOFA 4OQLA 4GDFA 4YDHB 4MDEA 1UDWA 5A5GA 2OFXA 4R2HA 4C0JA 2XTMA 1FTSA 1MABA 3EIHA 2Q9BA 1PV4A 1EESA 4QBIA 5GADl 4BZXA 1UAAA 4LBVA 1GDDA 1ZM7A 4DXAA 2O8DB 5AK0A 3KB2A 5KDDA 1KIMA 2NIPA 1DO0A 1CR4A 2QMUA 4V0MA 1Q3TA 4FCTA 2GEUA 4Z51A 3T5GA 1IBRA 3AGPA 2IA5A 4B3BA 2IS4A 4QM6A 1XPOA 4DEYA 1ZINA 2ZRFA 2H17A 3HPQA 5CK4A 2CL7X 1FL9A 1KAGA 2QRZA 3GLHE 3K9LA 3C8UA 3KQUA 3GEIA 2WKQA 4G1UC 1A7JA 3B5JA 4LPKA 1G16A 3VAAA 1DTSA 3R8FA 1UBGA 1MRNA 1GUAA 4P3YA 4M8NE 4C3ZA 1SHZA 2OHFA 3QXSA 1XMJA 3FKSD 3QSYA 5JZVA 2QTHA 1RYHA 3UATA 3CLVA 4XVUA 2FFHA 3QKUA 4JIMA 4NHOA 5EE3A 1GWNA 4QBFA 5F9FA 2RKOA 2RGNC 2ZSFA 3BRWD 5G3YA 2IYLD 5G41A 5JI3E 3RRZA 421PA 4DCNA 1T5IA 1BO6A 2F1JA 4X8LA 1LS6A 3THYB 1XPUA 2JLVA 2ZE7A 1XD2B 3FMOB 4JBYA 3FE2A 1KNQA 4WXPA 4FWIB 2ZREA 4JLAA 4TT3D 1SXJD 2IYRA 2IYTA 1WF3A 2W0MA 3SOPA 1Z8FA 2I1QA 4B2LA 4R71A 1NJGA 1XTRA 2CJWA 1GL7A 3P1JA 3K09C 5DI3B 1TPZA 3QEJA 1LB1B 1NI3A 1E3MA 5TVKA 2IL1A 4JL8A 2FPLA 1E9CA 4C0HA 4D6PA 2QAGB 5KPDA 2IHBA 2VIIA 3RSLA 4WZAE 5JBQA 2ZUCA 2PEZA 5FOWA 3RC3A 5JCPA 3FYHA 1JPJA 3RDPA 3GP8A 1P4SA 1N6NA 1TQ6A 4IVPA 1KK3A 2JA1A 2PX3A 3SYNA 2R8RA 4HB3A 5CLQA 1JEDA 3NC0C 4IDOA 1YQTA 1Z3IX 2RGCA 1SQ5A 2XTNA 2GXUA 4WW0A 4V0ME 2R2AA 2VSXA 1JR3E 4GOJA 1IN7A 4RZXA 1Q44A 4O25A 3NBYC 5KPJA 4Q1AA 1P9WA 3ZQJA 1OXSC 1QHGA 2O8BA 2ZS9A 3QI2A 1XXHA 3K8YA 3W6PA 4C0LA 3T1QA 5AJWA 2A78A 5DHFA 2CCGA 1VCOA 4KO8A 4PO8A 5TV2A 4EIWA 1KI4A 2I4IA 3ADKA 3FKSA 1T91A 2QPAA 4JZKA 5BWMA 2ANBA 4MRRA 5FUXA 5JMTA 2W6JA 1U0HC 1X1RA 2D7CA 4IDPA 2LKCA 1TQDA 1R8QA 2BM1A 2H18A 3HR7A 3MG9A 2PZGA 4U7DA 1NY6A 2FF7A 2GZAA 2JATA 4P32A 1N0VC 3KJIA 1V5WA 3W5JA 1US8B 2XZLA 1YRAA 1Q1EA 3TSOA 1W5TA 4NYJR 5JSZB 3OIUA 1TF7A 1Z28A 2ONKA 1A5TA 4P4SA 2ZRBA 3IEVA 4A0GA 1GKIA 1QHNA 4XWAA 2JCSA 4PAMA 5CM8B 3W6NA 2D74A 2FH5B 2QU8A 4IDHA 2V4ZA 5FI1B 3QE0A 1PUJA 2W2XA 1Q57A 4P4UA 1Q21A 1DBSA 1ZYUA 3K70D 2YWFA 4HSEA 1KMHA 3PUYA 1NP6A 4V0OA 2QI9C 3F5FA 1R4AA 1E9BA 3A1VA 3QG5A 4G5OA 2QQ0A 4A6XA 1SKYE 2FZ4A 3O8DA 2J59A 1BMFD 2YYZA 2ATXA 1ZM2A 2IUSA 2ZRAA 1FP6A 1ZU5A 2UZIR 1L2TA 5IRCD 2IXFA 5SZHB 4LRWA 3JVVA 4NCIA 2R6DA 1LW7A 4AKGA 2WIBA 1JAHA 2ZPTX 1U9IA 4BZQA 2ORVA 4RZ2A 4BLOA 3CIOA 1W5SA 4FMCB 5E7MA 3BE4A 4RKFA 3AH8A 2PJZA 4JS0A 1M7HA 1L4UA 1XXHE 2QRNA 1E9DA 3LBIA 3T12A 4OHYA 4QHYA 1R7RA 3CUEF 3NKVA 2QENA 3MGCA 3LD9A 3W90A 4NZYA 5D3MA 5LDDC 3W3ZB 5JEDA 1QVAA 2WAXA 1E9SA 3CO5A 2WMOB 2G6BA 1R0XA 4S2EA 5AUNB 3O8RA 1F2UA 4YMWA 2QPOA 1DARA 4GZLA 3EZ7A 3KJHA 4QGGA 4M9ZA 2ZRIA 3BERA 1XPRA 3EPHA 4Q01A 1ZIOA 3ZZUA 4AI6A 2AKYA 2GZHA 2VH5R 5TMPA 4V03A 4Q5IA 2ERYA 3NDPA 5CDFA 1E79A 1FUUA 3CRVA 3HU2A 4PPQA 4MYUA 1S3GA 4LJ7A 2OO7A 2VL7A 3U44A 3AP3A 1EFRA 2BV3A 5AJXA 2AFIE 3FFAA 3RWMB 3DMDA 4TL7A 5K8IA 1D5CA 1E1QD 4DCUA 3THWA 3T1TA 1T4GA 5JJIA 2AWOA 1NLZA 1RVDA 4YXWD 4V0LA 2VF8A 4Z1MD 2EVWX 2WOOA 2IYWA 2NO0A 1OPXA 4FINA 1BMFA 4JSTA 5TDHA 4A1FA 3IQWA 4UJ3A 4B2PA 1E4YA 3E5HA 3SEAA 2WZQA 1FPMA 4O2LA 4QC2A 1KNXA 5E7JA 1JBKA 2IXGA 2O8DA 3VR1A 2OG2A 3CNLA 3ZS8A 1JALA 4ZDJA 4D4JA 4KXFB 2JLZA 3D8BA 1NBMD 1OFUX 2EFDB 3NG1A 4JT2A 4AY2A 4IJMA 4DC9A 4RD4A 3GEEA 2H16A 4RFSA 3KKOA 3RVBA 3AF0A 1TF2A 2EYQA 1OH7A 2FSHA 1F5NA 3AP1A 2PX0A 3KFVA 4NTZA 1TL7C 4ZIRB 1T8TA 4PO9A 4K8OA 4DZZA 2FFQA 2FSGA 2QE7D 4TMVA 2C95A 2ORIA 3VKHA 4F4CA 4TLDA 3OEHD 4CIDA 1FUKA 5KNBA 2GNOA 3K9GA 2XNDD 1CJVC 2JLQA 1W4AA 3GLFE 4Q4AB 4TYWA 4DKXA 2FSIA 1XRJA 2B6HA 2NO1A 2XZOA 1KI9A 1KDTA 3SBEA 3WRYC 4B33A 1NY5A 2P5SA 4B3FX 4BQSA 4D25A 3BB3A 4M0LA 5EZ5A 3NTUA 3W9YA 1JJ7A 3V4FA 1OT3A 1LY1A 1GM5A 121PA 4PSVA 1R2QA 1S3SA 4CDGA 3RS2A 3KDSE 1G21E 2OZEA 1Z47A 3P20A 1CJKC 1FOEB 3G82C 3THYA 5EE5B 1JI0A 4C9BA 4QJ3A 1W4BA 2HCJB 5FBQB 5EXSA 4JLNA 3D3QA 1OYWA 3MLEA 5KOYA 1E1QA 1PLLA 1G1MA 4LC0A 4L4UA 2B8TA 3GLIE 1MKYA 2FSFA 2J7KA 1PUIA 3L0IB 5L8VA 1E2GA 1NL3A 2NZJA 4Z1MA 4GBMA 4CF7A 5DI3A 2E1RA 2DBYA 1SVMA 1N6PA 1W7AA 1YZGA 1XD8A 5EP3A 1TUEA 2WWYA 1E1RA 2CHGA 4L5BA 4OQXA 3RRYA 4F4IA 3KQNA 1RJ9A 1G4AE 4GSYA 1C4OA 3RS5A 2ZITA 1KO8A 1I2DA 1TAGA 4LZZA 3UPUA 1NBMA 3LBNA 4OHWA 1S9HA 3BD9A 2IS6A 1O3YA 1E2KA 3IEUA 1OXUA 1GZSA 3MAAC 4C4PA 3GJXC 2IWHA 1G20E 1II9A 4NDZA 3C5CA 1ZNZA 1HT2E 1Z08A 2IT1A
chains in the Genus database with same CATH superfamily
1HSZA 3CX4A 3OTGA 4Q34A 3UMRA 5HRCA 3P2KA 2IYEA 5L6MB 1N5OX 3ZWKA 2B3TA 2NSLA 5TJ9A 3OCVA 2O0KA 2ZPAA 3JQ9A 4ISCA 1Z0KA 2VDQB 1VZ2A 5E9AA 3S2YA 4GIBA 2HXGA 1WCIB 4I14A 2AMLA 3ZY2A 2ZBVA 3SMQA 5GZ1A 1YS2X 2A1IA 3FOWA 2W00A 1I2MA 1M75A 1IAQA 1YCHA 4H6PA 4JQZA 5B7PA 1TTHA 3KLPX 3LT1A 1LNZA 5E8JA 4DT1B 2RARA 1D4FA 1TECE 2QYOA 2X5NA 4MDYA 5CH8A 2O0LA 4DUGD 2ARKA 1CE8A 1UBCA 4MQUA 1W44A 4HLNA 4IQFA 4Q4JB 3RTGA 2BI7A 5KMGB 3KSZO 3VR4H 1V9CA 2A9QA 4QGAA 4KZKA 1WUHS 3ZWNA 2I4LA 2VHUA 1EXDA 2XT6A 1V7PC 2C7VA 1IAVA 4ZYYA 1AQUA 4DLRA 4ZHQA 3RARA 4D3SA 5C46F 4G0WA 1S2OA 2YWXA 1TM7E 1SOUA 4FTWA 4HNAA 5KQPA 3QOYA 1JQAA 1M1ZA 1OE0A 4G5RA 4M1WA 5BOVA 1WXQA 2VYVA 2YYSA 2GBCA 1SIOA 4FC6A 1N6IA 2Z4RA 3QU9A 2XOKD 4D9GA 4IH1A 721PA 2AR7A 3KAJA 2H11A 5I01A 4UNSA 3ESCA 1RR6A 2H2WA 2R0QC 3GDHA 3PDIB 4JJEA 4IS2A 3N2KA 3ZJVA 4ZOAA 1P1JA 2OBYA 5DSXA 1Q7CA 2G5PA 3AVTA 2HXYA 5A6SA 3HA5A 4Z4HA 2BGIA 5EC8A 3KZXA 3B1FA 3HO1A 3AHJA 4RHYA 4ZI3A 2IH4A 4CUKA 1ZXXA 2F4NA 2I7CA 3NASA 3TXXA 4C0AC 3JSAA 4AY3A 4ESEA 5A4IS 4LHYA 2C04A 2HMTA 2JHAA 2PZKA 3DDCA 3B2EA 3MWDA 4Q39A 2E4YA 4R1LA 3R76A 4BNGA 3JQAD 1JTEA 1GSHA 4J4HA 1E20A 5DM4A 4YRQA 3FSJX 1OH6A 4EGSA 5HJEA 4JJAA 3K2IA 4LYFA 2CK3D 2DFVA 2YW2A 4G2NA 4P34A 4FZ5A 4WKOA 2ZI6A 2QMEA 5E1MA 3GJYA 3U17A 1J07A 1CYEA 1T35A 5F98A 1P1HA 2GTIA 4CMKA 5TPZA 1F51E 3H3JA 3HCWA 4IO1A 4WOJA 3HKCB 4KXYA 3PTAA 2AYXA 2VNAA 3OG9A 4UHCA 2YCLA 4I8IA 4MR7A 1M2JA 4MA0A 2BYTA 4Q03A 5C2JB 3O3MB 3RFUA 2GAFA 4HX9A 1XZKA 2HU2A 4LJLA 4FYPA 1NN1A 2CFIA 3ZNQA 2W4QA 5JFTA 1QE3A 2XVYA 2XUZA 4ZCQA 1O5OA 2UUAB 5F76A 1GNQA 1PX0A 4ZI2A 5BURA 2B7CA 2EFGA 4TMFA 2WJYA 3LCVB 4MCHA 1PKXA 4R2KA 2NUTA 2OC9A 4RV9A 5AKEA 3Q9LA 1OBVA 4Q02A 1ZD1A 1LF0A 4QQNA 1DXQA 2LIPA 1IDN1 1KGDA 2ZB7A 2CZGA 4FLFA 3S6JA 4B3XA 2RKBA 3OZXA 4F8YA 4E13A 2RBGA 1ZCFA 3PHJA 3U37A 5L3SB 5ALZA 5C31A 4Z1OA 3HDQA 1RLMA 1H2XA 1EXWA 1UBRS 1XL1A 3AF5A 2R9VA 4JJKA 5JD4A 4M8SA 2WM8A 3ORSA 2IU0A 1JIKA 1YOBA 2F43B 3KNZA 1FFHA 4HI0E 3ZWAA 3TAHA 3W2GA 4YUZA 4DJAA 2VK4A 2OV8A 4QKQA 4S3MA 1T6NA 2C4MA 4P81A 2UZ1A 3NVDA 5F64A 4BKQA 1AZTA 3DHYA 4BP8A 1K8ZB 5CB4A 4RNCA 4A0HA 4HDAA 2XCIA 1C2TA 1V11A 1WTCA 3P4XA 3ROPA 3EDOA 3W3AD 3ANNA 2XA2A 3W1WA 3R7BA 3GAMA 4XFDA 1EGMB 2CBZA 1V43A 4PVDA 1GA1A 4ZVPA 5G53C 2K2WA 3RQIA 3WYGA 4EGQA 1Z4IA 1Z6GA 3RRFA 1GYPA 3QLVC 3IIIA 2PIDA 3KZNA 3SFVA 5LN1A 3DLHA 1VPEA 1XO1A 3TQCA 3IR6A 4XARA 2HU8A 4ZQFA 3K8ZA 2BP7B 4MUNA 3TX6A 2QRUA 2AQKA 1PR2A 3TZQA 3V80A 4UASA 4MQBA 2Y2UA 4E2YA 2A57A 3T1VA 4QSHA 3T35A 1AN9A 4DG5A 2Y6VA 3F5SA 1YZTA 2VI5A 4ND8A 3VR2A 4BMPB 4EW1A 4YUXA 4ZOQI 1Q83A 5AQ1A 1I24A 3ANMA 3CVYA 3AONB 4ZTUB 1OTYA 1UM8A 3T3PB 4KI0A 4I9UA 3HJNA 4CE6A 5K3EA 1KJQA 3QENA 1L1EA 5CA0B 3K9CA 2EHDA 2O8FB 5D01A 4DHWA 1Q74A 2UZ4A 4Q9HA 2ZBPA 3TEMA 2O3JA 4O4JF 2W43A 4MARA 1OAAA 1RYNA 1C4KA 2UZAA 4JJFA 3F0TA 2XB8A 3C7TA 2C00A 4TUYA 5SYMA 3TFOA 1IY0A 3OLQA 5DRTA 5K6RA 1NVXQ 1O5TA 1TZCA 1X7ZB 3QU5A 2MYUA 1E6KA 521PA 1FP4A 5BN4B 3DEZA 4QJBA 4A8TA 1BWSA 2B1JA 3AERA 4ED9A 2FDRA 2HMVA 2O2SA 2RIPA 3GRAA 4LYYA 4WI1A 3K0EA 3TQFA 2FU5C 3U3RA 2IYZA 3SZMA 5B7GA 4NBRA 1U3FA 1VECA 4IKEA 2BGUA 4XX0B 4D1YA 3LPCA 4HGYA 1JIJA 4UHEA 4EW3A 3VU0A 2PBFA 1UKEA 3A9UA 1Q7RA 3AQIA 1M1NB 4KUEA 4UATA 4RIEA 4NNOA 1RWKA 5J43A 5LZ2A 5J1SB 3PXXA 2ATIA 1TUIA 4N6GA 3DVQX 3M5WA 3WWZA 1KMCA 1FLAA 2XMPA 2DBVO 4GC9A 3TZKA 1YB1A 4KO2S 4N8SA 3AV0B 3QXXA 2YASA 1A9YA 5ALLA 4LGMA 1R12A 1FFWA 4LJYA 4OO3A 1OYOA 2H1FA 2QM7A 4R7GA 3D59A 4CMGA 2W0SA 1G4UR 1NW4A 3BFJA 5TARA 2J30A 3USZA 2VZEA 1RXWA 5FKJA 4K9KA 3E18A 3HB1A 4MICA 5SZIA 3UICA 4EQ6B 1QDLB 3R7NA 4F7WA 5BYKA 4LHXA 4RELA 5AVYA 3O93A 1DJPA 4XCXA 5DMHA 1S5PA 5JS8A 1KI3A 4C0WA 3H2KA 5BV0A 2YXLA 3DFUA 3BREA 3CRQA 1CZOA 2VTBB 5L40A 3GMDA 1SCDA 3NH6A 3Q1KA 2YNMA 3GRVA 4WA7A 5DEIA 1PTJC 3FPLA 4M1EA 1U0TA 3N0RA 5E6RB 3V4PB 1X8KA 4R8RA 2EHJA 1XLUA 4HDKB 2HH9A 1X1EA 3N8KA 2X1VA 2D1TA 1SKUA 4QU9A 4UEJA 5JZMA 3TTVA 3AUXA 4XPIA 2QPTA 1JDNA 3NYRA 5LNK1 2VRCA 3B5EA 1XFDA 4K5QA 3W05A 4BFZA 1XTQA 4BP3A 1XNQB 4JH0A 3WJ1A 2HI0A 5JU6A 4GKJB 4D80A 4H0FA 4CTJA 3TM4A 1WBDA 2XEDA 2XXBA 1ZMRA 3R5JA 2XBLA 4FQ5A 4DBZA 4GMHA 1Y5LA 1XBTA 4LYAA 3MF4A 1OXKB 2YRWA 3GUUA 1M74A 3UK0A 2FPGB 1KJZA 3WA7A 4H1TA 7MHTA 4TWZA 2FZVA 4KLAA 3VYSB 3S3TA 1BU5A 1WWKA 3ROTA 3DKPA 1XQ1A 4XJSA 1MTOA 4QL3A 2JK0A 4JA0A 3TMAA 3HGQA 2YV4A 5B6JA 4DYHA 3CNBA 4NMHA 5C5EA 5ADHA 2E7ZA 3BH7A 4BUJA 4MHOA 4LI0A 4XD7A 3S1AA 4B3TB 4ER0A 1PT9A 3OFNA 3DAOA 2IV2X 1OLUA 1H9BA 3RTBA 2H06A 4COOA 4K46A 5DFAA 1OW3B 3M9WA 1ND6A 1LPMA 1O03A 4HGOA 1ZJWA 1M8FA 1R9MA 2GZ1A 1UWKA 3DVRX 4K6GA 1OSNA 4M87A 4MV6A 4HWOA 3N6XA 3WGOA 4LMBA 2YHSA 3I73A 5IYZA 1FQJA 2VYNA 1HZJA 2PJUA 1U2QA 3FHJA 5LZ4A 1YFZA 5ALYA 3UV3A 3GLGA 3E9DA 4KV7A 4ZQBA 3EIOA 1E1CB 3C7CB 5BNFA 2LIVA 4MS3B 1O0SA 3GRKA 3RUFA 2W98A 3VNRA 3D9QX 3RSHA 4IZOA 2Q1YA 2Q7OE 5B1YA 4N8DA 3RI3A 4YCLA 3IJPA 1XSEA 2FMTA 1F2VA 1M10A 2QP3A 4HLCA 2WU4A 2VLIA 4I1SA 2CLEB 4TMYA 3FNRA 2X0KA 2VPWA 3HCFA 4E31A 3M6XA 3Q9SA 4BKUA 3Q11A 3LO5A 4HVLA 5K4GA 2Z08A 3A6JA 3ETGA 5AHKA 4NL4H 3PNQA 3NR2A 5KI6A 3UANA 1VRWA 1A7AA 3STHA 4OXQA 1E2FA 2DWUA 3EC2A 1EWKA 1YCFA 3PQ3A 5C8VA 1MW8X 3NYQA 4PGHA 2QTVB 3WV4A 4KIFA 2CKMA 3WRXA 3B1YA 3CLTD 4WFQA 4PZYA 1P44A 4C4SA 2WWIA 4YDSA 2ODAA 4CL0A 1AK2A 2BRUA 2JJ2D 3GA7A 3VQTA 5HQ3A 2EX1A 3BFXA 3K0CC 4KOAA 1PGNA 4GDMA 4N0QA 3DV0A 3I8XA 3VVBA 1RZUA 2OECA 1OTHA 4YJGB 3UJPA 2L42A 2F8SA 3CTMA 1SG0A 4R68A 4UCWA 3G1WA 4ZYVA 1ZM3A 2C61A 1B16A 1RPZA 3VHLB 3FCYA 2CL6X 4MCJA 2XCQA 4E22A 1S1CA 3N2GA 4EPTA 3PBKA 4K81B 3G89A 3GRYA 1U0FA 4CFYA 2J1LA 3ZBQA 3EZ6A 4DQXA 4L5IA 2PSEA 1P7ZA 3H87A 1AB6A 2ZIXA 1PR3A 4YWJA 4C3UA 4XM0A 2FSUA 4PAOA 5JNVA 4GKKB 3L8YA 4JB0A 3A31A 1NRJB 2WG0A 3MM4A 5E0KB 4Y9DA 5J2TA 1ABFA 5DGTA 3C70A 3EY9A 1CEYA 3EARA 1WP9A 1KETA 2G7ZA 4TQUS 5ENVA 2PT5A 2XMGA 3COSA 3QTTA 4D44A 1AKRA 1EVEA 4OP1A 4IP0A 2C20A 2FSVC 1FA9A 4MUAA 1U2GA 1ZMOA 4DVGA 5HM8A 1ZG3A 2NSDA 1VG8A 1IXYA 3F3YA 2AK3A 1FNCA 5IEBA 2ZM5A 1CNFA 4GVXA 4EBBA 1ZGAA 1JEOA 2AZDA 5E2IA 5A4JA 5LQJA 3VTFA 1M66A 1OV6A 2XUAA 3DM9B 3M1IA 4RAQA 5FULA 1NAIA 5G4KA 2HSDA 5DLEA 2HA4A 4JOCA 4KCGA 4W5HA 4HEA1 2FWMX 3OF2A 3OEED 4GOOD 3DKRA 3GLGE 3BIJA 3VR6H 4J90A 2MSCB 1QCZA 2DHCA 4CQNA 2X4IA 4ES6A 1WETA 1YK0A 1QPGA 4D8XA 3CR8A 5J4LA 5KYYB 5LD2C 3NBKA 5JXHA 5HIJA 2OQ2A 1FF9A 4BLSA 3DEHA 3BRWA 1UK8A 3O8CA 3OE7A 1QV7A 3DBHB 3RQSA 4A1OA 2BTQA 3HLYA 4PQRA 4XQCA 2IW1A 2HK9A 3T3MB 1T26A 4HH3C 4B8WA 1YQGA 2WPDD 3EG5A 1VSBA 3VTZA 1W4CA 1ZH8A 1G8AA 1V3UA 2RHTA 1GCAA 4L1KA 3G8BA 1H5UA 1OGIA 2DHQA 4TYQA 5AHRA 1Z0JA 5IT4A 3ZU3A 4RU1A 3Q7EA 4DB2A 4RF5A 3ET4A 3IIMA 5DM2A 3WGMA 1U3VA 2DTEA 5DTRA 2C3OA 3A58B 5BV8A 1ULHA 1RLOA 4H7HA 3WK5A 4H16A 3EXHA 1H0HA 3RGGA 4Y18A 2NYAA 4ZOLA 1INLA 3JQGA 3A4NA 4F4JA 1QFXA 4TGLA 2GJ4A 2GN2A 1B15A 3HSSA 1G59A 3ORHA 2E4XA 3W2IA 4MGYR 3W9UA 3WLJA 1W25A 3CKMA 5CW1A 4X1OA 5AKXA 5B53A 1OROA 5KHOC 2IXTA 2VTEA 4KH0A 5LXTB 3UA4A 3PEYA 4ZHSA 4PCUA 1RMYA 2HCBA 4U8HA 4X66B 4OYHA 4QFMA 5ETJA 3LUPA 3ADCA 5ES3A 1CB7A 2C98A 3D54D 5ILOA 2LXNA 2ZQ5A 2WWTA 1ZCJA 1FDVA 1RAGA 2FJUA 1VG0B 2ACVA 4KDCA 1LKZA 3PR2B 3RU7A 3HFJA 4QICA 2DSNA 4WBNB 4X63A 3H3XA 1CCWA 4KDFA 2P1ZA 5I4CA 4HPXB 6GPBA 4P3OA 2QRJA 1FYVA 3NAGA 3DE4X 4EHLA 1VE1A 2IX3A 2ZUBA 5A3VA 5CVTA 1EGHA 2JGDA 4MPRA 4KR7A 2IFTA 2ZKLA 4HX2A 4URYR 4F12A 2H2GA 4TTJA 4E09A 3EWIA 3T34A 4DADA 2WAYA 3JQRA 3RYFA 4RJTA 2ZWAA 4DJEC 5G0VA 2WMDA 3WS7A 4HNGA 4X00A 5AIBA 1KVQA 4UTRA 5IFKA 3HYTA 3PXCX 1BH6A 3JX9A 1J8QA 2B5WA 2YVKA 3LKZA 4LCEA 1QFJA 1GA6A 1EX1A 3P9NA 3DF7A 1CWUA 5T4FA 4DIUA 1JTVA 1SC9A 1NYRA 4HMOA 4EARA 2FB9A 5IDWA 2J8ZA 6CHYA 3ZHSA 1VPVA 2R00A 1PGOA 3AEZA 2FEOA 2R68A 5KWEA 2DCUA 1I30A 3F7NA 2X41A 3GJ7A 4YRFA 4U7HA 2ZIEA 3WJ2A 3FOCA 4TKMA 5IAKA 4PC6A 2QMOA 2IPMA 4BVBA 2GXSA 3QKSB 2AOUB 3M6LA 5T64A 1A72A 1VGRA 1Y80A 4OSEA 3WLTA 4X71A 4LXGA 1VHTA 5BSFA 1TU4A 2OHIA 1CS4C 3U4CA 3WMWA 1RKUA 2YY7A 4XH9B 1L4GA 2I1WA 3AFGA 3MW8A 5BSGA 1QTQA 4TWAA 5E7MA 4KNWA 1N2EA 1V5FA 1ZBQA 2FEXA 3CLUD 3R3YA 2FX3A 1WHTA 1WY7A 2QXTA 4RHUA 4RY0A 5U1PA 3TD2A 1TJPB 3CR7A 5JWOA 4C05A 4L9AA 1KOGA 1ISIA 1CZRA 4YJDA 2O1WA 5KNCA 3OLCX 3VKWA 5L7YA 2ZBUA 4KPFC 5HBRA 3KWMA 4GXQA 2CWWA 2XYRA 4ALJA 1PK9A 1EQ2A 2JCGA 5FJIA 4JHLA 1QLJA 3LLVA 5FHQA 5H70A 2C4HA 1NNSA 2P67A 2E85A 1P4JA 4PWYA 2LBPA 1TW2A 3QZUA 1SB9A 1ISPA 4XIYA 2ZXUA 2DUMA 4JI4B 4Q47A 3EW7A 3ZCVA 1W19A 1BSVA 2QRKA 4OVKA 4RORA 4J75A 3GEDA 5ER6A 3TSZA 1R4NA 2JFBA 1Y1KE 3Q8KA 3ON5A 2QN8A 4ZWNA 2H1SA 3SBXA 1P2SA 1UH5A 3GW8A 4E32A 2AD5A 3EQ9A 4QPCA 4RD2A 4UNPA 1NJ6A 1PL0A 4QRDA 3UK6A 1QHIA 4F6CA 4B7UA 5ALVA 3KKNA 2VHTA 5EJ7A 2WG2A 3WWEA 1XJWA 4IJKA 4OMCA 1NASA 5KCMA 4EUNA 5LQRA 1Z6TA 3QLJA 2W6OA 1NFFA 3WNDA 3H7IA 4WCFC 5ERXA 4DNPA 4LHWA 4RHFA 4E5SA 4B3RB 3A6DA 2HY7A 1ZI9A 3O92A 4MDFA 3CZRA 3UCXA 4Z3OA 3LK6A 1EXNA 1ZA1A 3S1LA 9MHTA 1Z0SA 4QUBA 4NYMQ 1IOVA 3NXSA 4RQUA 5DLDA 1KFEB 3K31A 4B2IA 2PZJA 4BCDA 1U0LA 4IXTA 3GLSA 2YC4C 3DOJA 1OREA 4R3WA 1LLDA 2ZVQX 3ZYZA 2IVZA 2O3TA 3F3MA 2ODBA 4P0QB 3N1UA 1XVVA 5CLFA 2ZR9A 3K9HA 3CG0A 3DLCA 1MEEA 2QN2A 1Z63A 1D1TA 2VRBA 3SHTA 3MWYW 1DQYA 1KWKA 1U11A 3AUTA 4PNHA 2F4VB 1YRLA 4L22A 3MXTA 4URXR 2CBXA 1IFXA 5BSRA 5KYXB 3KB6A 1JDSA 3BGSA 3RS8A 2F17A 2XCSB 2I2AA 4B75A 3WZMA 2O1SA 2HOQA 1C3EA 3IUJA 5FOQA 1NKTA 3RSSA 2NSYA 4RCZA 4WESA 2C7BA 4DLSA 3DFMA 2XWQA 2PWYA 1ZJJA 4FDAA 5CDFE 2Q5CA 2NNLD 2XDAA 5F23A 4HAYA 1F5SA 3QVJA 4WUTA 5F1PA 5EQDA 3OOSA 1GIAA 1MO3A 1XPJA 4HXEB 1EQAA 4GI7A 1DAFA 1G17A 1BVRA 1T5LA 4IOJA 3B12A 4WQMA 2PKCA 5E1DA 3TGWA 4JC8A 3YASA 1KDPA 1YAJA 4B48A 1EFTA 3VDXA 2WTUA 3SHWA 3IESA 3FG9A 4JKIA 4P53A 1QONA 1X15A 4KVZA 4B47A 1LLCA 4QJ5A 3TTYA 1JMKC 2QAGA 3UK2A 1AQJA 4QEDA 1I51A 3EF3A 3S81A 2QMHA 5KTPA 4DR5B 3PK0A 5FP0A 1E77A 4W5JA 2VP4A 3GUVA 3NQ41 1GT6A 1MPXA 3L8MA 5AUQA 2CFOA 2B7BA 2NZUG 4RK6A 2XNHA 5DU2A 4D0GA 2Q2OA 3HVUA 4CG2A 2VT7A 3FNBA 3GT7A 5B55A 1GNVA 2Q4BA 1IPFA 1Q2XA 4ZVRA 1Z45A 1FFAA 1U3UA 4BLRA 3O82A 4MV1A 3UW1A 1DFIA 2ZS8A 5L95A 4HUQB 5G2OA 1IUNA 1EHYA 3IE2A 3RG8A 3B6JA 4X62B 4JVOA 1IWPB 3D7KA 1PJCA 4MCAA 3KE9A 4TXMA 3RAFC 4UHFA 4KIJA 3V97A 4BMDA 2H4JA 4UREA 3CEAA 3I2FA 5EGSA 4LY3A 2OENG 4PHHA 2XZPA 2Z3ZA 3B9BA 3HCRA 4F0JA 2ETVA 5CYOA 4BMXA 3ZVMA 3LKVA 2Q3BA 2QE7A 4ZYZA 2NU9B 3W5DA 1ISFA 2QM8A 2P2DA 3CYFA 1GSAA 4F85A 1V71A 1NA5A 1W5EA 1Z2DA 1I9CA 1ZJ5A 4MW7A 1D6SA 3ZWQA 1EIWA 1URPA 1TUGA 2CHFA 3IKJA 1XU9A 2CLMB 2NUBA 1PT5A 4MGZR 1MU0A 4LDZA 2O3SA 1JE1A 2R3SA 1PGJA 5KTSA 1YZUA 4DLUA 1IZ0A 4DILA 1NVGA 2AQ8A 4U2BA 4ROSA 1IPHA 2GK3A 2QD2A 2TECE 2YXEA 3AFNA 3EOBI 3U3OA 3U7FB 1VL5A 3ETDA 4QX6A 1I4TD 1KEUA 1AJEA 2ZBGA 2R6JA 3DL4A 3OZWA 2YIMA 1X14A 2N1MA 3T5CA 2QW1A 1ADCA 2VUIB 4U9IS 4WGGA 3L1HA 3UYLA 3NM4A 2PLNA 4D3DA 1VBNA 3N2LA 4EO9A 1AA3A 4IGIA 1U2RA 2ZR0A 3IEPA 1GFIA 3QX3A 1PVDA 2AK2A 2WG1A 3LQ2A 1L5OA 1U02A 2JAUA 4FC7A 4GR4A 1N3YA 5I48A 1QGYA 3ZDAA 2ZIAA 3DR3A 4F72A 4HNSA 3WWDA 3EZYA 3I23A 4WCFB 5MDHA 3K15A 1Q84A 4UBIA 2QN7A 5HKOA 4R84A 2DUNA 2OZLB 3UXYA 3CLKA 5HR5A 5J2UA 1Y3FE 2P2YA 4UM5A 1UJ2A 1G3MA 5G3ZA 7AT1A 3VR4D 3EZLA 1GGNA 3DBOB 1EJBA 3IFSA 4F46A 3UJNA 2ZM6B 3GEBA 4UBKA 5JALA 1VA5A 3M6WA 5F5NA 3C3DA 2AR0A 4LJ8A 1FRZA 2ZB4A 5DASA 5EKXA 1M1UA 1UT5A 2HJGA 4AROA 4HN9A 1NT4A 2JGRA 2B2NA 2CFTA 4OHVA 3DD5A 4K8RB 1FEZA 5FOSA 1ETUA 4HATA 1Y82A 5LMCA 1M3SA 5CDUA 2WSIA 1VYUA 4IEIA 1ZM4A 2IIVA 1ZLXA 2WICA 4C88A 3EULA 3UJ7A 4EENA 1G7CA 4C4RA 1F4PA 4RLFA 5JH7B 4J0QA 3KXKA 5JPCA 1BNCA 3BXEA 4R5MA 1P0CA 3PFKA 3OJFA 2H7VA 3THRA 3I1YA 3CB4A 2D0PB 2CJWB 3H86A 5EQTA 4RTKA 1L5WA 4B09A 2XMDA 3GX1A 3F6YA 3TTXA 4TLCA 1OQAA 3DDUA 1A8PA 4NBUA 4TVKA 5CBPA 3RYCA 4BWGA 3AZPA 4NPHA 1S2IA 4TUYF 2E87A 3WVNA 1T0JB 3ZC3A 4DUGA 2BKAA 5BVGB 1Y8QA 1YK1A 4MKIA 1RACA 1E7SA 1II8A 2QTZA 3IP9A 4FFVA 3FPEA 5EIWA 2WV9A 4C78A 3RJMA 3B7WA 1QUFA 3IEXA 3JWPA 1KP9A 1NLUA 2ZRHA 1RWWA 3P9YA 3SZRA 3FTCA 3D1VA 4FGLA 2XXAB 3ICQB 1NQTA 5F1YA 4D74A 1C8LA 2ZRMA 2A33A 3RC8A 1OC4A 4HKTA 4EYKA 1YH3A 4B4OA 1W85B 3FAZA 3EFOA 2C0QA 2BFCA 2DT8A 2K87A 2DVMA 2WVHA 3FWKA 4TWJA 4LF9B 4OKIA 4KP7A 1YFLA 1BAPA 4IKPA 2YHIB 1T5DX 1OX4B 2XOKA 4BNTA 1Z8DA 3A9TA 2Y0EA 3I6BA 1DCTA 3CX6A 4N3CA 1H6DA 4UOQA 3OMWA 3JASA 1X1DA 1JU4A 3BK7A 4BV3A 1KDVA 3LG2A 4O08A 4F38A 3ELWA 2ZIUB 4TLBA 2PUAA 5FEUA 2J3KA 3UAOA 3BDIA 3E6AA 5FL7A 3SWWA 1M5TA 4MQ6A 2FLKA 2PBLA 1YRYE 2Q0HA 4M89A 3SAJA 2WTMA 1EDZA 2V9CA 4FZ3A 3BAFA 1XMSA 4Y2SA 1KPIA 1UKAA 2VUHB 3HWRA 2VTKA 1KK0A 221PA 3ZQ4A 4INZA 3A6PC 4KQJA 1QIJA 2ZB3A 3A70A 3O1HB 3R5FA 3JQAA 5E2AA 3UM9A 4A26A 1PEAA 4D98A 3CVVA 3QY0A 2HJHA 2O2EA 3K92A 5A6VA 3UAVA 3G5TA 4W63A 5I8WA 5FTNA 5LPNA 4LMRA 4H08A 4UQOA 2C0PA 5ANRB 1W1IA 2P65A 2IDZA 1D2EA 2Z5VA 4B7XA 4S2UA 1P9LA 1ZK4A 1JAZA 1YDEA 2E82A 2UYYA 3A4LA 3QX7A 2P0EA 4NECA 4DWJA 1FMFA 2B8JA 3ESBA 4GOXA 2Q45A 5DK6A 3U3DA 1N9ZA 3NIBA 4B7AA 2ZWVA 1M0EA 4CLOA 3KKQA 2H2HA 2J9RA 5DHAA 5JCOC 1A1VA 1XTTA 1QYRA 1S9DA 1K8RA 2DLDA 3OU7A 4ZU6X 2JGAA 5CYFA 1NXXA 1V3VA 3H3FA 3QMPA 3VC7A 5KTYA 1U9JA 3OTHA 3PC8A 1O2DA 2DTXA 1YJXA 2C31A 3MFYA 3C3PA 1WVMA 2I1VB 1NVVQ 1NW7A 4TLMB 2J67A 2NO9A 3FCOA 5DBHX 5EIOA 3MTEA 5IASA 1DC3A 2UVDA 4KTTE 1IXZA 4LWZA 2ACKA 4YONB 4RDIA 2O23A 2ZI9A 3ZLUA 1KH1A 3BD6A 2BWJA 3MTAA 4ZO6A 3ICWA 4U63A 1FNMA 5CITA 4AUEA 4LRXA 1K7XB 1QB7A 3RGWS 4QYIB 1YS1X 4GW3A 5FJJA 5BQPA 3ICEA 1PO7A 3O73A 2ATVA 4Q4AA 5M29A 1E89A 4P3XA 4L8FA 4D4IA 3FPFA 1Y3HA 2V9ZA 1M83A 2F7SA 3INRA 1VB5A 2WOJA 3ZCXA 4YJ3A 5FFMA 3DCIA 2HJ9A 5EG5A 4AYTA 4R01A 5A9SB 1KEEA 1EG7A 3OJLA 2V55B 3V8NA 3KKKA 1ZN8A 4RCYA 4DZTA 2CMDA 3W3AA 5JWHA 2ZSKA 5DISB 3L0SA 4YYZA 5I9LA 1U9YA 2C88A 4ERNA 5CTAA 3LBHA 4OI0A 4NK5A 3G6WA 3K72B 3VNUA 4R1QA 1ZH4A 1U8YA 1NQUA 2BOVA 3QELA 5D87A 1KQGA 3FBWA 3QKRA 3QQ5A 5I7EA 5K3AA 3VPCA 1F1JA 1ZRMA 3PFCA 2N1BA 3M6AA 3B6ZA 4GPZA 4HDMB 4IZ6A 4QNRA 5HSGA 4B3GA 4B5LA 1JIQA 3V1TC 2A9OA 3G0OA 4YJHA 4M0CA 3HG7A 1XX6A 1BFUA 1CK4A 1TJ4A 1FSPA 1NF2A 4JQSA 1YIAA 2RCNA 1EDEA 5ALJA 1MG0A 4RPKA 1BRMA 4QUIA 2P40A 2IEIA 2V03A 3REQB 1QNFA 4QODA 4ZZ0A 1ZRNA 3L1JA 1CBUA 4GBGA 5BSKA 1JEYA 1G60A 2RGAA 4US1R 3J81A 2OV4A 4YY3B 4JVMA 3TR6A 1VL8A 2REQB 5EJ2A 2W9XA 2ACWA 3ND7A 1WZNA 4YH1A 2Q4OA 5E1OA 4IUCS 1D2HA 5BQ5A 5G0UA 4MA4A 1YQ9A 2HZ7A 3BF7A 3DE0X 3F2VA 2DCMA 4OOEA 3ZBPA 3O31A 3R3UA 3SBOA 3IYLW 4L74A 1BMTA 1KI2A 3C3EA 4Y67A 4BNUA 2D0DA 3DV2A 3ZVNA 2EF1A 2CMHA 5M7EA 1PTKA 2AG1A 3Q9NA 2YKGA 3VJLA 3TPCA 2PX4A 3GT4A 4AJPA 3X1JA 4DQKA 3LE8A 3C48A 4EPYA 3GUCA 3QF4A 4MW2A 1QFMA 5BWBA 1LPBB 2NZYA 1QRRA 4LX8A 2VN8A 3GCZA 4O4HB 4RTNA 3GLIB 2QP9X 4PZDA 4I4TB 1F3LA 1BU8A 3F2IA 1F60A 1XDZA 4UCXA 5CVUA 1M9NA 4UTVA 2R8OA 2JANA 3E48A 2IU6A 2M9MA 3UAXA 4A16A 1XALA 5KJ6A 1W36D 1IBKB 4ND7A 1UUFA 1DRKA 3FDZA 3B2NA 1X1BA 2FF5A 3HP7A 4BTLA 4EUEA 3G9QA 5AD1A 4J1SA 1JG1A 1ZZGA 3JZDA 2BEUB 2D5BA 3JZIA 4QXQA 5PGMA 1NBEA 2II6A 5IJWA 3S8EA 4I5IA 3OLXA 2XY4A 2H6EA 3ZN2A 2VJOA 4ZVOA 3B3QA 4EGCB 4GSLA 5K0ZA 1KJYA 3L7BA 3OH8A 5IRCD 2PY6A 1GN8A 5KO2A 3WKDA 5M34A 2G06A 3MERA 3Q6MA 1VI6A 3ASVA 1XAGA 3WYCA 1J5EB 1JR3A 3RUCA 5K45A 1F8GA 1R50A 1EVLA 4Q4DA 5C9ZA 4E1BA 4JITA 3AQ4A 5HDQA 2G77B 2EJWA 4HFRA 4RFSB 4D8YA 4C3OB 4AK9A 1R0BA 4FN4A 4GG1A 1C7JA 2G9QA 1FYEA 2Q5JA 3ASZA 3FGOA 4H15A 2KW5A 1Z5UA 4LNUA 1LK5A 2XHZA 4NEGA 4OQNA 2JS7A 4ENWA 1GTSA 2I6XA 5FOXA 1D2MA 2EERA 5KU7A 1P5FA 4K0KB 1NJ8A 1P33A 4BTEA 4MUGA 4W7IA 1KYQA 2A0XA 1YWGO 1X70A 2VPPA 5F35A 1L5LA 3BXZA 1G18A 1F9AA 4EX7A 4ZO9A 1RQPA 4EITA 3I2YX 3BL5A 1C14A 4ZVMA 3AJEA 3LM8A 3L82B 1TM2A 4GKVA 4I5EA 5PNTA 2NV0A 5AR1A 4LDQA 4PPNA 4NQRA 4W99A 5CT5A 2REBA 3PJRA 3OU2A 3NMUF 1D1QA 3KPYA 3VMMA 5E3HA 3TR0A 4P4NA 1SM4A 4AECA 3KR9A 3JQ8A 1J99A 3KM0A 4ZEXA 4DW8A 4OH7A 2WKSA 3DWGA 4AWAA 3JPWA 3QE9Y 4LF6B 2CHVA 3VPAA 3IIKA 1SVIA 1KVUA 3IR7A 4MCIA 1NNEA 1Z2AA 1NVFA 5GVRA 1WE2A 3HDYA 3WRYA 3HDGA 4H4CA 4X64B 1MR3F 1RYEA 1I94B 1T4CA 3FRHA 2QN1A 3DXXA 3DWEX 3FCAA 3ETJA 4FHCA 4RVHA 4RBNA 1U1DA 8ATCA 3K53A 3HYCA 2I2CA 1A3CA 3PNOA 4U2GA 3RKRA 1O9GA 1MA0A 1YBVA 4OKNA 3HH8A 1NE7A 3C3AA 3DMTA 3QVSA 2GEVA 5JADA 1G9XA 1K1EA 3DBRB 1I5OA 2DAPA 4BAUA 3HDJA 4EHFA 4YWHA 4IWNA 4F9FA 1N8TA 1XTVA 2P4QA 2PRZA 3INNA 1CTQA 4AO8A 4J0CA 3FNGA 1XXLA 3C7KA 4M0FA 3SHVA 5IPFA 1FTYA 4RZIA 4ZVNA 2Z6UA 3AHFA 2HRQA 4BQRA 3ACCA 4QXAA 1Z6AA 3BH0A 4C2AA 4PXAA 4GUDA 1GITA 3EZXA 1ISSA 4X93A 2A30A 3FFBA 1FFGA 2YOGA 2YWJA 3LKDA 1H1LA 2Q6TA 2AN1A 4W8GA 4YJ2B 3U4AA 1KIFA 2G5TA 1DQZA 3NVAA 4YR7A 1K3TA 2QDKA 3OZGA 1UM9A 4JJZA 3RIMA 1U90A 3NP9A 4XSGA 1CZKA 1G2IA 3IVMA 2Y6UA 3QU4A 5FQOA 3TPZA 3C6XA 3FOFC 1BIFA 2XRZA 5J4KA 2FQ1A 1U9CA 3MCUA 5J63A 4LIPD 2OCAA 2NU7B 2RSLA 1O97D 4J7XA 1JKFA 1VTKA 2ZATA 4RYDA 2XYQA 4C7OB 4MVJP 5KHLB 1B93A 4L4RA 4UBLA 3R8CA 4C4YA 4TYYA 1AS3A 1U0NA 2GZSA 4ESVA 3DYIA 4ND2A 8OHMA 1N2IA 2H59A 3WFJA 3SQDA 3VA7A 2M1ZA 3HM2A 3VR6D 1JXAA 2OCBA 4ZKEA 3THXA 3RFFA 1L4HA 3SQXA 5FB3A 1R37A 1HDIA 4IG4A 4B6FA 1B7GO 1V8DA 4DR3B 1NUUA 1Q0ZA 2VZ0A 3ZXYA 3G7NA 3W5BA 3LFUA 5AM0A 1YOVB 1EFLA 1XG5A 2ECKA 3PVSA 5CXSA 3UA3A 1RBYA 3AM1A 4RENA 5CXUA 3R6GA 5I5GA 1ETHA 1D2AA 3KUCA 1Y42X 2YW9A 5ELMA 3EJWA 4O4HF 1KRHA 1QGOA 3SY8A 1E2DA 1VIMA 2A1TR 1VBMA 3T9EA 1P7YA 4TT8A 4W9NC 1WXFA 4WLVA 2Q6KA 2IDMA 3KHSA 3TLXA 4FOTA 3WKAA 1IHUA 1T2CA 3H5VA 4KZPA 5BORA 1N6KA 3R20A 2HA3A 2SECE 1DS6A 2BJVA 1BJRE 2EGGA 2GM3A 2KWIA 2AFIA 3BHJA 3FCCA 3I9V1 3K5IA 2KLBA 4XDGA 2I3ZA 5TQ0A 3OD5A 1AQYA 1EFRD 3SYTA 2WSSA 3G2IA 1X3LA 2Q6LA 3UHJA 3I61A 1T1GA 2QW8A 4BEVA 5LYJF 3NOVA 4Z7JA 4A5SA 4TMXA 4LZPA 3OEEA 3QGMA 3E3MA 1ML3A 2HWYA 1MW9X 5KVQA 2E9SA 1NGSA 4X7RA 4E1AA 4J0KA 5FNZA 2CCJA 1CP2A 3BKXA 4TTQA 4B7CA 5B3KA 4DJTA 4CGZA 4YFYA 1PK8A 3ZVKA 3GA0A 4ODIA 5ECWA 1T6YA 2V9PA 2WSBA 2DULA 2VK8A 4CIBA 3SHQA 1T2EA 2OFWA 2PRSA 3MLBA 2GVNA 3IGFA 4NOJA 2REOA 4IGKA 1U5CA 2WPDA 4CYMA 1KPGA 3IBFA 4QTXA 3LXMA 3KALA 4A6PA 4MW4A 2NO4A 3CU5A 3OVMA 3LRTA 3M3PA 4M2LA 3SHFA 4I9GA 5TX7A 5ALGA 3AG6