4PPGA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-br
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
329
structure length
311
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGESHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 311
sequence length 329
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppgA01
1A2BA 2IUSA 2XB4A 2NZ8A 5F3WB 1YZKA 1G8FA 1ZBDA 3AUXA 3I61A 2A7QA 1KSFX 2Z6VA 2HXSA 5CK5A 1OYWA 4DDVA 2Q3MA 1OF1A 1E2DA 4URZR 4D4MA 1W0JA 5AJZA 2EVWX 3C16C 4C7OB 4B2LA 3NH9A 1JPJA 2FV8A 3A4NA 3DL0A 4IOMA 2ZRFA 3I3SR 4LPKA 2OILA 4KSCA 2ANBA 2JLXA 3NDBB 2VL7A 4F38A 1OH6A 1Q20A 3BB1A 1YR8A 3PIRA 1CR4A 3BBPA 1NBMD 4HDOB 4ZCIA 1Z6GA 2HJGA 3R9XA 4W5JA 2EFHB 1IXRC 3QBVA 4TMXA 2QAGC 2TMKA 1VHLA 4LC0A 1Z0KA 2PEZA 4M22A 4N0DA 4EKDA 3THYB 1CU1A 2AHOA 2WSSA 1DG1G 1KTVA 4HZUB 4MRVA 5H68A 1P61B 3PXGA 4QG7A 1S4QA 4B43A 3CPHA 5DO9A 2NQ2C 3N5CA 4KFTA 4Q1BA 3A58B 3VKWA 3M4YA 2QTHA 1DO0A 4M9XA 2J0UB 4ZPXA 4BQSA 4B3GA 2NO1A 2NO9A 4FWIB 1G20E 4LJ9A 4AI6A 2XOKD 3LX8A 3AF3A 1Z6YA 1JEDA 4LZZA 1GIAA 3GJ3A 1WMSA 2QP4A 1NMZA 2VBCA 3K0FA 2OHFA 3K0CA 1OFIA 5DYIA 3U5ZB 2ZRMA 2ZSAA 4D4JA 2YWGA 2Q0HA 3DZDA 1W4AA 2B92A 3GEEA 1Z0DA 5EE5B 1AZSC 4PC1A 4RD0A 3EA0A 3WP1B 4LV8B 2D4HA 4M9SA 1J7KA 1F2UA 4RZUA 2A78A 1DAEA 4L5BA 3W5IA 4PSAA 3SQXA 4Q48A 5CYOA 1I4DD 2CE7A 2ZTSA 4FMCF 3X1DA 1CF4A 3QPVA 2A3RA 2VQSA 2B8TA 3PUVA 1W47A 3PQCA 2N46A 5FOWA 1OXSC 3GLFA 4URXR 2QSYA 3W6PA 4J0QA 4JVMA 4PAMA 3JZAA 1NLFA 3GLFE 2OCYC 4B3CA 4H9GA 4OHWA 1XCPA 1JAHA 5FBWB 2WICA 5HKKD 2H7VA 1T4GA 2ORIA 5EQTA 2JJ1D 4K46A 5EP2A 1D5CA 4EJSA 1FQKA 3MLEA 5C1BA 2QBYB 1W0JD 3KJEA 1KI3A 1G3UA 4ZDKA 4P0TA 3QY0A 1WBBA 4BFYA 4KLZA 4M2LA 1K8RA 4LV5B 4XD7D 5E7IA 1TF2A 3ETLA 1KI2A 3U7GA 1G6HA 4TTPA 2GESA 3K0FB 5FR2A 3UG6A 1R6BX 1E2GA 4JKYA 3A1SA 4PX9A 2P5TB 1SULA 4TMZA 1KOFA 4Q19A 1E94E 4TQ9A 2G3YA 5JECA 2O8CB 1N2CE 1YZTA 4R98A 1Q44A 1F2UB 4OHZA 1TQ6A 1IAQA 3LV8A 4Q9HA 1KKMA 1ZNZA 1G3QA 1P6XA 2OEPA 1I4LD 3AGQA 4LHZA 4GRAA 1JI0A 3ADCA 2J7KA 2R8RA 3CX8A 3LO5A 5GVRA 2IYSA 1GKUB 2ZRDA 1KIMA 1MR3F 4OBEA 1IY0A 5JRJA 3KDSE 3NVAA 1FFHA 3HJNA 4D4KA 3GLFB 1L4YA 2YHSA 3WRYC 2F1IA 4CT4B 1P7CA 3PUZA 1PLJA 3A1WA 5KU1A 2ODEA 1X6VA 3IUYA 4MGIR 3Q8XB 4UXHA 4A92A 3Q7QA 2WHXA 3NG1A 3MSXA 3RS3A 1RW4A 3PEUA 3SEAA 4D25A 1GSIA 1U0JA 4DRZA 2OM2A 3FTQA 1ZIOA 2JJ2A 1BYUA 2GCNA 4EJSB 1EG7A 1I2MA 4RFVA 3RWOA 3VR3A 2OG2A 3CNOA 1UBGA 4HATA 2C9YA 1FMLA 4HLDA 4TZ0A 3F5FA 3AF4A 5FBVB 3AV0B 3GLGA 3VKGA 1D9ZA 3AVOA 2CEAA 5C4GB 5EUQB 3LDAA 1W4RA 4QNRA 1L2TA 3WHKA 2CCGA 2IW3A 5KSPA 5TMPA 1YVDA 5TY0A 2E87A 3U44A 3WY9A 4HSEA 3CWQA 1VG9B 1NMYA 1W5TA 3FB4A 5GADl 1DAMA 1PUIA 4RJLA 3TH5A 1YKSA 5HCNA 3MUFA 1N5KA 1HH4A 1XPOA 2VHUA 2Z4SA 1U8YA 5TV2A 3K70D 3T1TA 4G5OA 2ZJ2A 2ZRKA 3BK7A 1FQJA 4I1VA 4KLNA 1HY3A 3GQBA 3LVQE 1X8KA 4BWYA 1GM5A 4JLDA 3C41J 4US1R 5AJWA 3SHWA 1AM4D 3B60A 2QPAA 2J5XA 2GZHA 3LBNA 3SC3A 4LSGA 5FPSA 3RS2A 3MG9A 4B47A 1ONBA 3X1WA 1Z63A 2IHBA 1P2UA 4Q7JB 2ANCA 3L43A 3BAFA 4GOXA 4QRHA 2C95A 1T0HB 4DLYA 4JLJA 3AF2A 2RAPA 2NO6A 2WAXA 2IS2A 2QGNA 3QNUA 4C30A 4Z51A 2XSZA 1PV4A 3IIMA 3HPQA 3MJHA 5HE9A 2BMFA 1W4BA 4KODA 3W6NA 5F9HA 3NC0C 4A0FA 1N0VC 1Z07A 2VPPA 3G82C 1UBEA 2EYQA 4N1AA 1AGRA 2BIFA 1KDTA 1Q1BA 2I1QA 4QXAA 5FTKA 3BFKA 4HB4A 3ZLJA 2EFGA 3U44B 4G5SA 3FMOB 4TL9A 3A4MA 1G8HA 1UEIA 2NOAA 4MYTA 4G3XA 4Q01A 3GJ7A 2YKGA 1OW3B 2FFHA 2CNWD 2ZU0C 3CM0A 1E2FA 1YU9A 2QSZA 3MWJA 4LYFA 1NG1A 2HV8A 4DDWA 1E9BA 1NKSA 5CYPA 2ORWA 1E2LA 2B6HA 4DCSA 4POAA 3KKOA 5JJKA 2B8WA 2OFOA 2ZITA 4IW3B 2VA8A 3LQQA 4UJ3A 5JLJA 1PZNA 4NZYA 1E0SA 1Z0IA 3HDTA 1N5LA 3O47A 2VF8A 2RGNC 5BN3A 1COWD 1ZCBA 5J4YA 4A2PA 1F6BA 2WWFA 4LBWA 3ZVRA 2QY9A 1V43A 1XNJA 4NH0A 3F0TA 1E9AA 4DLXA 4IEEA 3SOPA 2PJRA 1OXXK 1Q0UA 4DSTA 5SZHB 3NHBA 1Z2AA 4QM7A 3JZMA 1SVLA 3VR4A 2AFIE 3WMFA 2QRZA 2C9OA 3HU1A 4K8OA 3SYKA 4LPSA 3QXHA 1ZMXA 1QHSA 4EPWA 4AKGA 3SN6A 3H0KA 3MWKA 1I2DA 4OL0A 1DARA 3K0EA 5ANRB 2W6IA 1CP2A 2V1XA 1BYIA 1FNNA 2P6UA 4Q02A 4NCIA 1CRPA 1MRSA 5JCPA 3KQUA 2H92A 1KZGB 4U5XA 1F3OA 3QKRA 3AQ4A 1KDPA 4NHOA 2IEYA 5FTJA 1G3MA 3PFIA 4HYYA 3QXCA 1G7SA 1U98A 1W5SA 4PO9A 1G3RA 1U90A 1KAGA 1EFUA 3CONA 3K09C 4HLUA 5D3MB 4AC9A 4DVGA 1GL7A 1NIJA 1XD9A 5AJYA 4ERNA 4B33A 4BUJA 1YHNA 2Z4RA 1LS6A 2JLZA 3FVQA 1E2IA 2O8BA 3OAAA 5FL3A 2GJKA 2W6JD 4U02A 3SJCA 4ESHA 3TGPA 4HAWA 621PA 2GEVA 3A1TA 3ZVLA 2F7SA 2FPLA 1GAJA 2O8EA 1FPMA 5F9FA 3ECCA 5BQ5A 4BFZA 4X8HA 5SZKB 3T61A 1P2VA 4TQUS 4D80A 3UANA 4RD3A 4OI4A 1OHHD 4G5RA 4DB4A 3SJBA 2BEKA 4ZO4A 4MDFA 1OV4A 4Q18A 2MSDB 3ASYA 4M0LA 4XWAA 4RKFA 2P5SA 5IDVA 4AK9A 4LYAA 4YXWA 1VMAA 2ZR0A 1GVNB 1KI7A 2J0QA 5LPNA 1KI9A 1U8ZA 1OT3A 3K0CC 4QNMA 2FEOA 5KDOA 3TMKA 3QJYA 2Z83A 1MRNA 4RD2A 1E3MA 2VHQA 1UEJA 1GP2A 3O8RA 2IYTA 3B9PA 2IUTA 2JDIA 2I1VB 1M7HA 1TU4A 2HLDA 3HU2A 4PPGA 4RY2A 3R8CA 4B74A 2ZANA 1SXJA 2Q9CA 4TYNA 3JVUA 3WYGA 4L9WA 3IKJA 4BASA 4GDFA 1SXJE 5KNCA 4OJKA 2ZJYA 4FCTA 2PMDA 1GFIA 2AXNA 5CB8A 4HB3A 1W7AA 4S35A 4UNRA 2QZ4A 2FGJA 2OZEA 3QKRB 4W7SA 5JWHA 2Z43A 2QU8A 1E0AA 4Q66C 1K6MA 3J81k 5D3QA 1OFUX 3DPUA 1X1SA 3U6BA 2GZAA 1ZD9A 4KSBA 4ILEA 4M1TA 1Q22A 3DM9B 2O8BB 4XSGA 2CHGA 4URVR 2P6RA 1XD2B 2QAGB 1C4OA 3KB1A 1E2MA 2EU8A 1U0HC 2PCLA 1AN0A 4LYHA 2O8EB 1YR6A 1OXTA 1WQ1R 2D06A 5HCIA 4EJSC 3IEVA 4B75A 4D81A 1DE0A 4H1UA 2IS6A 4O0MA 4CGZA 4EQ6B 2V7QA 4F4CA 1W2GA 3NDPA 4M53A 4QGFA 2NMVA 5DH9A 2D2FA 1VG0B 3AB3A 4PPFA 5G53C 4CVNA 1DADA 5JHHB 1YZLA 1ZYUA 2Q3HA 2PJZA 3AGPA 3RSOA 3WNDA 1UF9A 2VSOA 1BH2A 3OAAD 2V6IA 1SXJB 5B2ZA 2IWRA 4ZDIA 3THXA 4Y0VA 2BWJA 3EA5A 4GBMA 2JLRA 3QOFA 1GUAA 5FR1A 4HAVA 4EPYA 1E1RD 1E4YA 5FUVA 5JZVA 2DPXA 1IHUA 2V54A 2OSBA 3BERA 4F91B 4H1VA 2XNDA 3THOA 2BEJA 4M1MA 2VP0A 1CLUA 5JMTA 1SVSA 1XTIA 3NXSA 2C96A 1OIXA 1II8A 2GK7A 2FPMA 4Q4JA 2JA1A 4YXWD 3K0AA 1W44A 1ZM7A 3QVVA 1D2EA 1SHZA 2ONKA 4EPTA 5L8VA 4II7A 1E79A 3QPWA 4PHFA 4WAUA 1T91A 3NHAA 4IFBA 3E70C 4QGHA 2HLDD 1VCOA 4AY2A 2E9SA 1XTSA 3U60B 1UBFA 1SXJD 2ATXA 2IHYA 1NP6A 2J9RA 4KVGA 4KFSA 1NI3A 2XITA 4RD1A 4JLVA 1ZVQA 2PH1A 5L3QA 4DJTA 1FOEB 3UG7A 3EG5A 521PA 4TYQA 3B1VA 2J41A 2BDTA 3KJHA 3RC8A 4CRWB 1NIPA 2PLFA 3AKDA 4Q1CA 3DKPA 3TRFA 1Z22A 5AUQA 1MO5A 1HA3A 1XEXA 3B8HA 3RANA 1DPFA 4HZIA 3ZH9B 4BLTA 1AQUA 3KX2A 3PJRA 2IYQA 2QMOA 3CBQA 3P27A 3T1OA 1KHTA 4F4IA 3BE4A 3SBDA 3IGFA 1UPTA 4BEBA 1XFAA 1CR2A 2ZPTX 4KFUA 3TNFA 1D2MA 5GJWC 1NJGA 2WM9B 1GZSA 5CK4A 3ZD7A 2X77A 5HTKA 1E96A 5GVSA 3N70A 3ASZA 2D74A 4Q4AA 1ZUHA 4Z8YA 3UWOA 1AK2A 3EIQA 5JFGA 2QN6A 2VP5A 3FKSD 4GMDA 4NYIR 1LNZA 2IS4A 1IONA 2J45A 4MGZR 4LJ5A 3W34A 3ZQJA 2F1RA 2CK3D 4ZV4A 2PL3A 4CEJA 1QVAA 4ITRC 4DCTA 5JCZA 3A4LA 2ZUBA 1NMXA 1II8B 3MWYW 3RRZA 4V0ME 1T3LA 4Q4JB 4KHZA 3K0AB 4B6FA 4MA4A 4IDHA 1KSGA 5BWMA 2RGBA 2J7PA 4GSYA 3CPJB 2GEDA 2EFCB 1P75A 1MH1A 1J8YF 4B3BA 3ZVNA 2R6FA 3AM1A 4JLMA 3UMFA 2WKQA 4Q7LA 4LBZA 1ZAKA 1ZW6A 2WV9A 2XXAA 2D3WA 2REXB 4IVQA 2ZSDA 2WTUA 4NTZA 1E2QA 1M7GA 3IPXA 4C0KA 4TLAA 3QBTA 3AF1A 3SU8A 4D2IA 1XEXB 4Q9IA 1SKQA 2XTNA 1QBKC 2IYXA 3IHLA 5P21A 2PZGA 2QMEA 1LVGA 2WJGA 4IOKA 2IL1A 2Y8EA 2C9CA 3OEEA 4NL4H 4Q00A 4C0QC 2HXYA 4Q7MB 4A0GA 1E2JA 2P65A 3FHOA 2P6NA 3ZDQA 4Q4AB 1Q1EA 3IO5A 1OH8A 5FOSA 2VTKA 3Q9LA 1E1QA 4Q5IA 3SYLA 1EFRD 2FFBA 2R62A 5G41A 4GPTA 4GFDA 2D7DA 4UQOA 2A5JA 1XTRA 2AK2A 1KO5A 2VP4A 3C14C 2NIPA 4MKGA 3THWA 4E07A 4RZ2A 4M9QA 1P5ZB 4MUAA 4MUBA 2GAOA 4LX0A 3DMDA 4MH0R 1VIAA 3UIEA 1CJKC 1VDZA 4JL6A 3EW9A 4QHSA 3DKVA 4Y0AA 1YJ5A 4OQFA 2BMJA 3EIHA 4DBLC 1T3HA 1K5GA 1CJVC 2X2FA 3NWJA 1T8TA 3E2IA 3OFND 3V4FA 5CITA 1VG1A 2X1VA 3QEOA 2FNAA 1AA3A 4JJZA 3TLXA 3K9NA 4TLDA 4RZ3A 1Z83A 4PC2A 2E1RA 1W0KA 1DAKA 5TDHA 2XXAB 1W48A 4ZKEA 3CW2A 4IVPA 821PA 1R7RA 3L2OB 3MJRA 1MV5A 4KU4A 5EZ5A 4V0LA 3TIFA 3IIJA 1QG2A 5FH9A 4HAZA 1BS1A 4D0NA 3FWYA 4LJ7A 1Z47A 2JJ8A 3F8TA 5KSOA 4ZCMA 1IXZA 3TAUA 4A82A 4M1WA 1E69A 5JI3E 1CR1A 1UDWA 2ZSEA 2JIZA 3RVBA 2ASEA 4YMWA 1UJ2A 1QHGA 2X8AA 4HLUC 4DCVA 4JVLA 1G8YA 1PJRA 3K09A 4Q03A 2F9MA 3BRWD 1G7TA 4NCHA 4W5HA 4AYTA 2W0MA 1ZIPA 2XZLA 2ZAOA 1M7BA 1N6PA 1TQDA 4GOKA 1DG3A 3BJIC 1XF9A 4TQAA 3P4XA 1ZM3A 2CJWA 2ZE7A 4IRUB 2GCPA 3LXXA 2Q21A 3CKLA 1ZM4A 3KXLA 2R6DA 4Z1MA 4GZMA 4BLRA 4Q1DA 2ZR9A 2RH5A 3PCRB 3T1QA 3P20A 5L3VA 1XX6A 2FSGA 2ZYTX 3BH7A 3KKNA 3OEED 3K9GA 3U3JA 1TUEA 3GJ5A 1A1VA 4UJ5A 1U81A 5E7MA 1XJCA 2IYVA 2RGDA 2VP6A 3AUYA 1HE1C 1KI1A 4V0NA 4Q9JA 4DWJA 1SXJC 1YRAA 5E3HA 5C2JB 1OB2A 2J59A 1E1QD 1KK3A 1XZQA 4XSHA 1ZCAA 3UMSA 4IEIA 3B7GA 2HUPA 4XH9B 2J46A 2ODNA 4EFLA 4ESVA 2VP2A 4MRSA 4LI0A 721PA 5LD2B 3A1UA 3GFPA 2WOOA 3ONWA 1JNYA 1WP9A 2NPIA 2RHMA 2JGNA 2OUKA 4DUGA 1J8MF 4FCWA 4OHVA 1HQYE 1XPUA 1CEEA 3AVWA 2CL0X 2A2ZA 2A30A 4FMCB 2SHKA 3VU9A 1AKYA 1QZXA 1A4RA 4DHEA 1VIYA 5CIWA 3W8NA 2YINC 3S1AA 3KFVA 1A82A 2IX3A 1C1YA 3AVVA 2IWHA 2DFTA 2QQ0A 1KGDA 3GJ0A 1OSNA 2FFAA 3KJIA 5GJBA 4OQXA 1EFTA 3ZGXA 5K8LA 2FA9A 1Q3HA 2W58A 3AVQA 3ZD6A 3MD0A 1ZP6A 4QGAA 1WF3A 1IXSB 2OFXA 5DHAA 1OIVA 3MCAA 2YOHA 4PO8A 2Q3FA 2JEOA 3L82B 1GDDA 4LJYA 3AVUA 3GLIA 2JIZD 3ZS9A 5JI2E 2AWNA 2R65A 5KUTA 4PO1A 3B1YA 1RZ3A 4JLPA 3GLIE 2HT6A 3TK1A 1QF9A 5J47A 1DAGA 1OXUA 4B76A 5JJLA 2AXPA 2WSSD 3CRVA 3TVTA 2LKDA 4PC3A 4UNNA 4PZLA 5IRCD 1H8EA 4AKHA 1VCIA 1XPRA 3PUWA 5DHFA 4DCNA 4IHQA 2GDJA 3CR8A 3M1IA 2CVHA 2W2TA 4JVSB 5KPDA 4G5QA 2C03A 2NO7A 3CNNA 4MKFA 4TWZA 1GITA 3B85A 3BC1A 4EPRA 2ZRCA 1A2KC 1FP7A 1DO2A 2QNRA 4LBVA 1N6RA 1Z08A 3O8DA 1YZQA 3H86A 3U7EB 1U8AA 2NG1A 3KKQA 2FMXA 4LJ4A 3VU9B 1MT0A 3BB4A 4HI0E 4YDHB 3S1AB 1TL7C 1A7JA 2BBTA 5DI9A 1JPNA 4ZI2A 4JLNA 1G41A 2DR3A 3HR8A 4I1OA 4NP6A 2CHQA 3AKYA 1O87A 4LY6A 4JJKA 2ZYUX 4C0JA 2I4IA 3SZRA 4PQRA 1XCGB 2YWFA 3AVPA 5KOYA 4NKRA 3OE7A 3FGNA 3TSOA 3ZZTA 2GHIA 4WA7A 3ADKA 4K81B 4BLSA 3LBIA 5E7JA 5FUYA 3ZJYA 1WB9A 2QUZA 2QT1A 3TAHA 3GLIB 1X8LA 2O8FA 1P62B 4NONA 1NN5A 1YZGA 2QP3A 3GLGE 2CL7X 1XMSA 2YWEA 3SHFA 3V9PA 1EWRA 1IN8A 1YE8A 1U9IA 1NNEA 5FTNA 3SI7A 1SZPA 5FI0B 5H1YA 5GJCA 2HT1A 3TR0A 2ZS7A 1OIWA 1R5OA 3C4JA 1EX7A 2REOA 1EWQA 3A1VA 2HCJB 3PITA 4FXPA 1FX0A 1US8A 1ZC3A 3C7KA 4KVAA 2C99A 4V0OA 2ZROA 4PAQA 4IXMA 2VH5R 1YRBA 4TL6A 3SQWA 1W2HA 3C8UA 1XP8A 4R2HA 2GEUA 2RGEA 4A6PA 1L4UA 2YVUA 2GA8A 4MKHA 3ZYCA 1N6HA 1JECA 1SVOA 2IF0A 3A36A 4OQMA 4I1SA 4CT5A 4L15A 2AKAB 4M1SA 3G0HA 2QPOA 1U94A 2DY1A 3ADDA 5EXPA 2WMNB 2QROA 4KYUA 1N5JA 4LHVA 5A5GA 2NZJA 5CLLA 2BCGY 2EQBA 1RC8A 4UNPA 2PX3A 3LFUA 4P32A 1JJVA 1TMKA 3DDCA 3LLMA 1RRGA 4OJQA 1H8HA 3PG5A 4TN1A 1P4SA 1QHXA 4QM6A 1N6LA 1KO1A 4EFMA 2PX0A 4Q47A 4C3ZA 2GTPA 2ZSFA 4FD2A 4JLOA 1CRQA 5G40A 1E9SA 3WBKA 3W3ZB 3CZPA 4AWXA 3GLGB 4XJXA 3H1TA 4KV9A 4PQFA 1SQ5A 3QKUA 1NN1A 4FINA 4NYMR 1ODFA 3CF2A 4DCUA 4R71A 5A4JA 5B57C 2O8FB 1J90A 1MOZA 1XJQA 4M1KA 1T9HA 1DAIA 2KBEA 4MYUA 4XVUA 3SS8A 4PPQA 5IK2A 4KI0A 4M9ZA 1X3SA 3OIUA 3QENA 4L4UA 4C0SA 5H8WA 1KMHA 4P4TA 2D62A 2KBFA 4GT1A 4JL5A 5A0FA 4ZDJA 2JLWA 1N6KA 1HEIA 1JXOA 3ZZ0A 4XWKA 1FX0B 1US8B 4M1YA 1OPXA 5EZ6B 4L16A 3X2SA 4ACBA 3DEFA 4AD8A 2FF7A 2HDNB 2JJ2D 4S2EA 4IJMA 1VG8A 1HURA 121PA 5TARA 2VHCA 3FPAA 3SE0A 2CL6X 2EYUA 3BORA 5CJPA 5K8UA 3KUDA 2O8DA 1WXQA 2N1BA 1FMJA 2WOJA 3QF7A 3WRXC 4PXAA 2VF7A 5DE3A 4OK5A 3P4YA 1G4UR 1G7RA 4BZPA 3LAWA 3VR1A 3U3OA 1UKVY 4BFWA 1W36B 4B2IA 2KWIA 4EAQA 2VIIA 2B7BA 3NBZC 2WMOB 1UKYA 3GLHA 4HUQA 1E2NA 1S8FA 1UKEA 2FZ4A 2C2HA 3LVRE 4BZXA 5FPYA 2A5FA 1NSTA 5HPYB 3IQXA 2DCUA 2KE5A 4JKIA 2ODBA 3OEHA 4EFNA 3AVXA 5LD2C 3IIKA 3IDQA 1LY1A 1M34E 4DLRA 2MSEB 3E5HA 4JIMA 5FL7A 1TX4B 1KMHB 1S9HA 2D7CA 1W1WA 1GRQA 1W36D 2C98A 3N2EA 1XDBA 3V00A 2IYRA 1IOZA 4M8NE 1H8HD 3IPYA 2WBLC 2EW1A 1K5DA 4D0GA 2XSZD 2WAYA 3P1JA 4ACAA 2ZYVX 4C2UA 4A9AA 2WJIA 4NMMA 2V1UA 2GJSA 1TAGA 4OHXA 3GPLA 1ESMA 3CZQA 1E9FA 2GKSA 4MGKR 2QEQA 1N25A 3BB3A 1ANKA 4LHYA 1N0UA 2B7CA 2CVFA 1P9NA 4OYHA 4V03A 2O8DB 2ZI9A 1GNRA 4IDOA 5JJIA 2F1JA 2PCJA 3GMTA 3HU3A 3FKQA 3P26A 3UMRA 2W2XA 1L8QA 2DB3A 3I1FA 5IK2D 2PMKA 3EXAA 1B0UA 3WP0A 3FHTA 1Z2CA 4JL8A 4JBXA 5EE1A 1RE0A 3KL4A 2AFHE 4B3FX 4NE2A 6Q21A 2OFWA 3KXIA 3CRMA 1XWIA 3GLHB 4HUQB 1KZ7B 3LLUA 1JAIA 4OK6A 1DVRA 3UATA 3FHCB 4B44A 1V5WA 4MYCA 1GNQA 3QIAA 5SZIA 3CPEA 3RAPR 3B78A 5E4FA 4TSFA 1WCV1 1PUJA 5L3SA 4PFSA 3WYAA 3EPHA 2PLRA 3B9QA 1ELOA 1XZPA 4ZKDA 3W6OA 2VYFA 3GJXC 1OKKA 2PBRA 3CIOA 3EZ6A 3K9LA 4PZZA 1GRNA 1M1YE 1HE8B 5CM9C 2VP9A 2WWXA 5FTMA 4GI7A 4GP7A 1G6OA 1IM2A 3B13B 2NTYC 3EPKA 3DOFA 1QVRA 3RS7A 5C4MA 1FZQA 3SR0A 1KJWA 1XTJA 3TW4A 1TTTA 1EX6A 3NC1C 4MQBA 4B32A 4URYR 2WPDA 1BMFA 4HB2A 2ZM5A 3B1ZA 2H18A 3M0EA 1E9RA 1R8SA 3BXZA 5KPJA 1FP6A 2ZJZA 1R0WA 3X1XA 2W6ID 3OEHD 3ZVMA 2AL7A 2GCOA 3PEYA 2F3TA 1M6NA 2P0EA 3C5HA 3WBJA 1TF7A 3WHLA 2IF2A 2P67A 2ERYA 3I72A 5KHOC 3EWAA 3CX7A 4WZAE 3VKHA 3QPUA 5IHPA 4Q1EA 3EASA 1JQLB 4HLQB 4OQLA 4FW9A 1NRJB 2PT7A 1H65A 4MDEA 2QTFA 3LXRA 3TJZA 5L3SB 2YOFA 1MKYA 2VO1A 3NH6A 2XTZA 2IXFA 2GVDC 3E1SA 4KYIB 4DT1A 1R5NA 1BOFA 3LY5A 1XMVA 1N5IA 2IT1A 4BFTA 4GMXA 5KTYA 2WWYA 2ZR7A 2ZUCA 3EIEA 1S1CA 1KJZA 2G0TA 1VCNA 1VYTA 1KDOA 2BVNA 5FFMA 3REGA 4UNSA 4GZLA 2RGCA 3QKSA 4PC6A 2V3CC 3T15A 1FW6A 2BBWA 3AP2A 1OH5A 4L8GA 4DLTA 2JDID 1N3BA 3NEJA 3OHMA 2QG6A 4QHYA 3SNHA 4DDTA 5DN6A 4KFRA 5BW8A 4WOPA 2DHRA 2J0VA 3BS4A 3BFVA 3IILA 2FN4A 4TSFD 5M04A 1LS1A 4Q4LA 2JLUA 3W9YA 3RRNA 5DI3A 2GCOB 2OO7A 3KKMA 4B6EA 1S0UA 1CTQA 3U6KA 3HP1A 2QAJA 3RNLA 4DSUA 2QENA 3VNUA 1WRBA 2CLDX 3QI2A 2OESA 3IHWA 4BGDA 2GXSA 3VTKA 2MSCB 1U9IC 1A5TA 3H2YA 3TUIC 5EUMA 1JJ7A 2QI9C 4NCNA 4YDSA 4BE7B 1TEXA 3CF6R 2AKYA 3PUXA 4FMDB 2R6GA 4JZKA 2G1KA 3VX4A 1BMFD 1Y3AA 3THXB 2FEMA 1AQYA 1NN0A 1R10A 2W00A 2IC5A 2ZS9A 4HAXA 4QGGA 3AH8A 4A2WA 1XMIA 3BIFA 2LCFA 3B6EA 4TT3A 2PT5A 3GFOA 1QRAA 4M4SA 4DT1B 4R9UC 1SVIA 5J4LA 4DIEA 2D2EA 2ONJA 2R6AA 1Z0FA 2C5LA 3C5CA 2J0SA 1KI6A 3W90A 4ZI3A 2V7QD 4TTRA 3F3YA 1Q57A 1RYHA 4LK2A 3UWKA 1E9CA 1E0JA 4JMPA 5GJVC 3QKSB 3FDIA 3PEVA 4UNQA 2BJWA 221PA 5HE8A 2GWHA 3QE0A 1W36C 4BRWA 5TB5A 4D0LB 2ZRPA 1X86B 5BYKA 3VMFA 2XZPA 3EZFA 1LB1B 3VR5A 3U4QA 5AUPB 2JLSA 1FUKA 4KBGA 2GF0A 4KO8A 4TZ6A 2DYKA 4US0R 2ZE6A 1RFLA 5L3QB 3U61B 4TL8A 5EE9A 2CXXA 1XRJA 2XNDD 3BGWA 1RJ9A 3QVUA 2OE2A 5DI3B 3CNLA 5E95A 3RLFA 3W8RA 3LD9A 4C0HA 4DSOA 4E5UA 5DYGA 1DELA 1S1MA 3KUCA 2ATVA 1CKEA 1NBMA 4P31A 1Y63A 3WYFA 5EXSA 2DFKB 4AG5A 3T12A 4YC7A 5FI1B 3UKDA 1E79D 2J3EA 4G5GA 3Q72A 1AZTA 1JB1A 4ON9A 1Q3TA 5CB6A 4BFVA 3B1WA 3T06B 4FIDA 4XIGS 2GETA 2Q9AA 3K53A 1IJFA 2AWOA 2GJAA 5KO2A 3SYNA 4TLCA 2V4ZA 1LW7A 1IBRA 4YONB 1RRCA 2XAUA 1EFCA 2F9LA 4QKQA 2FSHA 4U7DA 1G8GA 2O0HA 1SVKA 4LOAA 5KDDA 1IQPA 3D31A 2QA5A 2XOKA 2R2AA 1KI6B 2IXGA 1XEFA 1X1RA 2BKUA 3Q85A 3VR2A 2NGRA 2JLYA 3CWZA 3RRYA 1ZNYA 1G5TA 4WZ6A 3KJGA 2OBNA 1E4VA 1LF5A 4YMUA 5EP3A 1CULC 1N6IA 2A5YB 3THYA 1S9DA 1KMQA 1FNMA 1BO6A 5JBQA 2IXEA 1GILA 3U4QB 2I3BA 4B3DA 3L0IB 1OLOA 5C46F 5FTLA 1MO4A 5CLQA 3G5UA 4A15A 2A5GA 1ZUIA 3EPLA 3NTUA 1F2TA 3DO6A 1RJ9B 3KTAA 3SBEA 4P3YA 2H8KA 2ZREA 2WIBA 2YV5A 4C9BA 2ZI4A 3U3MA 3W5JA 1KI4A 2DFLA 4DXAA 3A37A 3GP8A 3FOZA 4DDUA 2JLVA 1T0JB 4AYXA 2GBLA 4JLBA 1XTKA 2CHVA 1E32A 2G6BA 5BXQC 4QBIA 3T5DA 5IF9A 2J7PD 2RMKA 1TUIA 3AP3A 1EFHA 4QOSA 4UKDA 4BFUA 4NYIQ 5AWFC 4CW7A 4ASUA 2BV3A 1P2TA 5HKKA 4RVCA 1XEWX 1KK1A 2GZDA 3U3RA 3I4LA 2ZI6A 5G3YA 1AJEA 4QHTA 2HEIA 2ZRAA 2ZSBA 1HT1E 2IYUA 3U7FB 1D2NA 5TXGA 4U00A 2JJ1A 1DBSA 1FL9A 1NVXQ 1R8QA 3RHFA 1U0LA 1G9XA 2OBLA 1YZNA 5AR1A 2KI5A 3TW8B 3ZS8A 4C0LA 3THWB 1G19A 4XD7A 4HDQB 1Z29A 4X8OA 2ZIAA 1E98A 4R2IA 3RABA 1RVDA 2AX4A 4MKIA 4C0AC 1OE0A 2ZU6A 3D7MA 2F1HA 2UKDA 1GOTA 1NVWQ 3Q7PA 1ZUNB 3LQRA 3NKVA 3H4MA 3NBXX 2ZVPX 3TE6A 4E03A 3GCGA 1JXMA 1LV7A 2F55A 3AKEA 3B1XA 2JAQA 2ECKA 5AJVB 5LBIA 3SFZA 2FDCA 2F6RA 2QM7A 4IDNA 5CIQA 5DNYB 1VCMA 2W2VA 5EP1A 4IFEA 2QBYA 4JYBA 1F2TB 3KTAB 4I4LA 3AVTA 2BJVA 1IN6A 3X1ZA 1CXZA 4CEJB 3PUYA 2FU5C 4IVRA 2VLIA 2ZRJA 1GKYA 1U2RA 4BPBA 1Z6XA 5DIFA 1CR0A 4CEIA 1NY6A 3FE2A 5JSZA 4BZQA 1CJMA 4PTLA 2ZRGA 4C4PA 4UXJA 1OYYA 2BCJQ 1GRRA 1G4AE 2ZI7A 3FFAA 2OAQ1 4AURA 1E9EA 3DZ8A 2XNSA 4QL3A 1NSFA 4DLZA 3OF5A 2R9VA 2O8CA 2ZI5A 5FBLB 3AVYA 2BBSA 1NJFA 1TQ2A 1GL6A 1W0KD 2QL6A 4JBWA 4CF7A 3QG5A 1GL9B 3W3AA 2CJWB 5FBQB 5KYKA 4ZCLA 1G5PA 2QMHA 5G3ZA 2W0SA 3H84A 3QSYA 4G1UC 1SVMA 3VX3A 3CF0A 4RD4A 3ZZUA 1Q21A 2AN9A 5ELXA 2AK3A 1I4TD 3DOEA 4E09A 4CEHA 1EESA 1KY2A 3CR7A 3NBYC 5L3RA 1XD8A 4BRUA 5FBRB 5J5CA 1DAHA 3KFXA 4ASUD 3UPUA 1KK0A 3L8YA 2AD5A 1NLZA 2YC2C 2IYZA 2PZFA 2QTVB 5FOVA 3T35A 3QG1A 3L0SA 1AGPA 1FUUA 1DOAA 5FOUA 4NU0A 2NO0A 3RC3A 2KB0A 5KSZA 2C8VA 1NVVR 1P72A 3TR5A 4O2RA 1ZD8A 2WKPA 2N42A 1GG2A 1FTSA 2ZEJA 5DISB 4CEIB 3MAAC 1QHHA 2CCKA 4Z1MD 4WXRA 2ODWA 2H57A 2IYLD 5JSZB 1E99A 1RRPA 4JBYA 2ZRBA 2J1LA 3LH5A 2ZETA 2ZYWX 1ZINA 4NYJR 2H16A 2JATA 1ZD1A 2OLJA 2IA5A 5KDLA 4E22A 3AP1A 5FPHA 1N6OA 3TVDA 3LA6A 3K8YA 2BHRA 1W49A 4DLVA 1MO3A 2IBMA 4LJAA 2BBOA 1TNDA 1Z3IX 3OIVA 1P2SA 5BN4A 1YR9A 2ZI3A 2ZUDA 4W9MC 4X8MA 5K8IA 3IQWA 4FCVA 1NN3A 5F98A 4PR0A 3ND9A 4TLEA 1PVOA 3FFBA 2FX3A 1R0YA 1RPZA 1PLLA 1R5BA 2LWIA 4R7ZA 3VFDA 3HWSA 1HV8A 4PSKA 3RS4A 1CBUA 1ETUA 2QE7A 1J2JA 1DAFA 2ORVA 4LJ6A 4OI1A 1Q12A 2ZRLA 5HZKA 4TTQA 4DUGD 1D9XA 4CEHB 2ZRNA 3GD7A 4I81A 2FE4A 4LYJA 3I5XA 1KO7A 2MMCA 3R8FA 2C78A 1SHKA 2CNWA 2ZVQX 5K8TA 1F60A 4P33A 3RDPA 3KB2A 2G83A 1KO4A 2MMGA 1S3SA 4XVRA 3AKCA 3K70B 3R9IA 3TSWA 3U2QA 1P9WA 3ICEA 1JR3A 2X2EA 3LX5A 4LC1A 3REFA 4YMVA 4FWTA 5CDFA 2ZS8A 4MRNA 1JR3E 2OXCA 1AKEA 2O5VA 4O25A 4A1FA 4IOLA 3R9WA 4LUCA 5CDFE 2XX3A 1R0ZA 1COWA 1QHHB 4Q1FA 4BLOA 2OAP1 3NEYA 4PANA 2GK6A 1G5RA 5DSZA 4Q4HA 4WBSA 3I92A 1DEKA 4GNKA 4O2LA 1AIPA 4MYHA 2ZAMA 4PC7A 4FMBB 1W46A 4JSTA 1E2EA 5AUOB 4OKSA 3DM5A 1N0WA 2ZQ5A 1AA9A 4JYCA 4QC2A 2GXUA 3VHLB 3NIBA 1WE2A 3CH5A 2L0XA 2GAAA 2WSMA 4JSYA 5EP4A 1H8ED 2XB2A 3KQNA 1AS0A 4IDPA 3IEUA 4HAYA 5JEEA 2FPKA 4Q1AA 3U7HB 3QUSA 1T5LA 2QQEA 2IYWA 1BKDR 1SKYE 2G1JA 1BIFA 4B3XA 4YQFA 2ZRHA 2CLSA 4LWZA 3SJZA 2ERXA 1HQCA 3LW7A 4NCKA 3QEJA 4EPVA 3VR6A 5B30A 5FPTA 4Q21A 1JQJC 1RIFA 2IYYA 2DFNA 3D8BA 3UXMA 4MRRA 4GL2A 2VSFA 1NVVQ 4ABYA 1OJLA 3R20A 1YR7A 4G0NA 3CRW1 2AD1A 2GJ8A 2HYDA 5DLQC 2W6JA 1KO8A 4A4DA 4URWR 2H1LA 2FSFA 2XJ4A 2VSXA 2QPTA 1CS4C 2WZQA 3HYRA 3RYTC 2YOGA 5UKDA 3UK6A 3TUJC 2WKRA 1RRFA 1IY2A 3QKTA 2XGJA 1II9A 4NYJQ 4OI2A 1II0A 2ZJBA 1CIPA 4B48A 4DSNA 2FFQA 2JLQA 1OHHA 1IN4A 4IOJA 2QGZA 5CJ2A 3TBKA 2R44A 3ND8A 3OE7D 5EXTA 4A0HA 5C18A 2GF9A 4PQYA 1QG4A 4Q9KA 3KQLA 3DMNA 2QE7D 1ESNA 3M6AA 1G3IA 4DEYA 2EWVA 4Q4HB 2G9NA 4W5WA 3RS5A 1XXHA 1EGAA 2QP9X 5D3MA 1XMJA 4NDZA 3T1VA 1UAAA 1ZRHA 3B2EA 2J87A 3BWDD 3IO3A 4DLSA 4P4SA 1NL3A 5JS8A 1XXHE 2JASA 3WMEA 3U3KA 4BEJA 1GKIA 5AK0A 3L8ZA 4YMSA 2OBMA 2V6JA 2ZE5A 4Q7KA 4KITB 3KQKA 1LFDB 4NCJA 3I5YA 1L7VC 3SJAA 2A9KA 1JR3D 1ZM2A 2CE2X 2WJVA 1SKYB 4Z8XA 5FOTA 4UXIA 1R0XA 4Z54A 5LB4A 2W83A 3EPJA 3BH0A 2QM8A 3GLHE 5HZHA 1J99A 3LRPA 4A8JA 1UADA 1OFHA 3PVSA 5J4VA 3T34A 2GBLC 4DKXA 2RB4A 1JR6A 4F7WA 3LBHA 1JEEA 2BMDA 2XJ9A 4CDGA 1IN5A 3Q5DA 1ZM9A 4DLWA 1ZNWA 5AUNB 4TLBA 2OCPA 1U99A 2XEXA 4QFMA 1G18A 1VPLA 3QF4A 1T6NA 2OT3B 3EARA 3MMPA 2DBYA 3LWNA 3PENA 3L0PA 4N3NA 4PAOA 2DWPA 3OIWA 5BN5A 3CB4A 1RKBA 3GFTA 3SFVA 2YYZA 3A8TA 4HLCA 1NY5A 4B2PA 3O8CA 4TMWA 1E0KA 1KSJA 1OFTA 2UZ3A 2H17A 3DVLA 1P60A 4IKEA 4LJ8A 1Z5ZA 4RFSA 2BC9A 2LKCA 4D82A 3RWMB 4A36A 1RYFA 4M21A 1MABA 4LBYA 4A0RA 3PV0A 1ZU4A 4TYPA 1XXHB 3CRQA 3T5GA 4LCBA 2RKOA 3WXMA 3ZIAA 4EIWA 1XCMA 4P4SB 3QXJA 1HTWA 5J4KA 1P9RA 3N2IA 2FWRA 5AJXA 5CM8B 1XD2A 2QAGA 2WJHA 2BM1A 1R4AA 2C77A 4QJ5A 3VQTA 3K1JA 4WVFA 2C04A 2UZIR 1E1RA 3CH4B 4LHXA 2GVZC 2FGKA 1XBTA 2EWWA 1UM8A 3CO5A 4NYMQ 4B34A 1KK2A 2UVQA 3EX7C 2GXAA 1D6JA 2WIAA 3OESA 3I32A 4LRWA 4EQ6A 1KYIA 2NPFA 4A8JB 5LDDC 4XTCS 2K5UA 2FH5B 4JT2A 1M2OB 2AR7A 3TKLA 4C0BA 2EFEB 4B73A 2O0JA 2ZXUA 2P2LA 5KNBA 1Z0JA 1KSHA 1UBCA 2HF8A 3BOSA 3EWSA 3QQ5A 4I1UA 3CX6A 4RCZA 3GEHA 3CLVA 2IK8A 3TQFA 1D8TA 5EXXA 2Q9BA 3QF4B 1GTVA 3I8SA 4LV6A 1XB2A 1FTNA 3WNBA 1IN7A 1O3YA 4OK3A 4XVQA 3WNCA 2RGGA 2GNOA 4P4UA 3O8BA 4CYMA 3B5JA 1G17A 4RD6A 2Z5FA 1LTQA 4X8LA 5KNDA 2YC4C 4CZ2A 4M1OA 4PHHA 1P3JA 4B71A 3Q5EA 2DWOA 3BH6A 2PEYA 4L9SA 3L0OA 1TQ4A 1GNPA 4RFSB 1Z06A 1WA5A 5B64A 2H5EA 2ZE8A 1TU3A 1Z6TA 2F3RA 1MABB 1NKTA 2CMKA 3LW8A 1S96A 4PSVA 1WDTA 2HYIC 2RGAA 1G8PA 4MGYR 4KCGA 2G88A 4XTRA 4BECA 1N6NA 2FG5A 5FL7D 1VYVA 4RZXA 1GWNA 1TADA 2QT0A 3LNCA 4FN5A 4HUTA 4DB2A 2V9PA 1OXVA 4TMVA 3C15C 1G7CA 5TVKA 1XU4A 1SGWA 1KY3A 4N0EA 2OLKA 4TMKA 2VRWA 3EZ9A 3Q3JB 4BLPA 3FKSA 3KZ1E 4MRPA 4QJ3A 3K70C 2YNMA 1QHIA 2A5DA 4HEJA 4DEXA 4D26A 1F48A 2CK3A 2B21A 2G77B 8OHMA 3IBGA 1JALA 4EUNA 1G64A 2JCSA 3MWLA 4NPHA 3QXSA 5FUXA 2QRNA 3K9HA 1R2QA 4TYYA 1QDEA 4NBSA 5H70A 5F2EA 3ZIAD 4IXNA 2G0NA 1X8JA 1UDXA 3HR7A 5JWRA 4JVNA 1KNXA 4QBGB 1NLYA 4A6XA 3I73A 3FMPB 1ZC4A 2DWQA 1M8PA 1ZJ6A 4KXFB 4QBFA 4ARZA 5LB2A 4XWOA 2FZLA 4AYWA 5JRZA 1Z0AA 1G291 2OCBA 2CCJA 4URUR 4WIAA 3EC1A 421PA 2QMUA 5SZJA 2V8OA 2KSQA 4O3MA 4AKEA 5JWOA 1KI8A 2P3SA 2O52A 1EK0A 1KKLA 1ZU5A 1JBKA 2CBZA 2YJTD 4MITA 5EE3A 1G21E 3GJ6A 4HAUA 4V02A 1OKKD 5J4HA 1KAOA 4QBHA 1E9DA 1E2PA 1SVWA 1NG9A 1J70A 2VEDA 1HT2E 2XTMA 3ICQB 2X19A 2VHJA 4FI3C 2XZOA 3KXKA 2CLCX 4ZIRA 1G16A 1QHYA 3R7WA 2OXRA 3JVVA 4EDHA 1UKZA 4BFSA 3OIYA 3OZXA 2R6CA 3AEZA 1VECA 2FOLA 1EFRA 3KKPA 1C9KA 2WPDD 3V4RA 1T8UA 1WBDA 3GJ8A 3IBYA 1EXMA 1IY1A 4PZYA 4YLGA 3VAAA 1XEWY 3HYTA 3GEIA 3X1YA 5EJEA 1OB5A 2Z0MA 4DLUA 2WWIA 4LHWA 1CJTC 1S2MA 1M74A 3K0SA 5J40A 1E2HA 2F43A 4AIIA 1S3GA 4HDCA 1G1MA 2HCBA 3HPRA 3MRSA 4FMDF 2QORA 4OHYA 3FMFA 3CUEF 1T3SA 3WMGA 3PEWA 1IJEA 4CIDA 2VHTA 1AS3A 4JS0A 3OFNA 1AS2A 3GJ4A 4F4JA 3QXXA 2RCNA 1TPZA 1KDRA 3TQCA 4JLAA 3RRMA 2BM0A 4ARZB 1LF0A 1YQTA 3I62A 4AKIA 4B35A 3TSZA 1E6CA 4HB0A 4Q9LA 3ZQ6A 4BLQA 4IDQA 2RGXA 4GP6A 2WJYA 3D6TB 4US2R 1YZUA 4V0MA 4C2TA 3P32A 2RHDA 4WZBE 2ZJ5A 3EZ2A 4G01B 5IT5A 1HUQA 2GRJA 5KSYA 3SDZA 3NBFA 3VHXA 1Z28A 3BD9A 2V55B 4GOJA 2FSIA 5EE0A 4TYWA 3EZ7A 1ZNXA 4LGMA 3DHWC 2O0KA 3I8XA 3ADBA 2ZRIA 2WJJA 4KBFA 4XOIA 5JS7A 4EPXA 4PPNA 2PZEA 1XJ0A 4RKEA 4TMTA 4DC9A 1NVUQ 3R7WB 4ZIRB 3VNVA 1NBME 2GXQA 4KJZA 1W4CA 1KJYA 1F5NA 4PHGA 1P73A 2YZ2A 1TEVA 5FUWA 2WVJA 2YWHA 4OQNA 5JHGB 5DN6D 2KJQA 4BFXA 1PLKA 4OI0A 4WW0A 1Z8FA 4RSGA 4V0KA 3KQHA 4ZDWA 1TF5A 1XTQA 2WWHA 2IS1A 2WWGA 4F92B 2BOVA 4D6PA 1OH7A 4C7OA 3PR1A 1VKJA 3BFXA 4QJ4A 2IUUA 2F43B 5DGXA 1Z6AA 4WXPA 3RSLA 2HJVA 3MGCA 1VTKA 1Q1QA 2GJ9A 4AG6A 4DZZA 5FPKA 2GILA 2ZJ8A 5FOXA 3MFYA 3D3QA 4A2QA 3AF0A 4F93B 1DTSA 1Q1ZA 4YMTA 2IEZA 2ZJAA 4D4LA 2HF9A 5B58C 1E2KA 3EC2A 2FJUA 4HZUA 5JEDA 1VHTA 2BMEA 4I99A 2OV2A 2EFDB 5BYJA 3TUZC 3B82A 2REBA 1QHNA 3RS0A 4PHTA 2OCAA 1KNQA 2BKEA 4TT3D 3FMIA 4A8JC 3A6PC 1DS6A 2J0UA 3FYHA 3CRRA 4DIDA 1NF3A 2RGNA 5HR5A 4JLKA 2ZJOA 4RCYA 1VYUA 4TL7A 1HYQA 1CJUC 1B23P 4JT4A 4LDJA 2Q6TA 1T5IA 2WWWA 4KAXA 3EAQA 2CDNA 1UFQA 1MO6A
chains in the Genus database with same CATH superfamily
1NHGA 2IUSA 4TM8A 5C5DA 4B3RB 2W6OA 2CN1A 2B83A 4FGWA 5F3WB 3GT3A 2GPBA 5A9RA 1MW9X 1E3JA 5AKIA 3T5AA 2A7QA 1KSFX 2XPCA 3ESRA 3SMQA 3TZHA 4A03A 2XUKA 3AHFA 3VR5D 1SHUX 1QFSA 4UD6A 1NT4A 2DEUA 5KZMB 1E2DA 1EWYA 4G4SP 1TCUA 4L28A 1ZQ1A 2IPAB 4P92A 4DIOA 4C7OB 4TTTS 4YR7A 4WN9A 3JASB 5JUWA 1E3EA 1M1XB 2IIQA 3QVXA 4LY0A 1E7MA 4ZQCB 4BN0A 5JSUA 3STHA 3U4DA 3I3SR 2A9RA 2OILA 4OAPA 4KSCA 1BJRE 5BW4A 2JLXA 4NS1A 3IAS1 4IRXA 2CBGA 2EKPA 4F38A 3IUSA 4IJ6A 1YR8A 3U4CA 3H1GA 3CVXA 4ZCIA 2WJ6A 1A9SA 5K3SA 4JZYA 3VPBA 3ZHYA 5HQ3B 2QJRA 1X8XA 3H5IA 3QBVA 4K9OA 4FONA 1VB5A 3SXPA 2TMKA 4GVPA 1VHLA 4R8MA 2PEZA 3WR5A 4D8XA 3H2IA 4MJ3A 1CU1A 2AHOA 2CFOA 1DG1G 3IPLA 3NWEA 4LNHA 1L5VA 4MRVA 4UMFA 4XGQA 3RVQA 5KOHA 5C51B 4QG7A 4JOCA 5CXSA 2QJTA 4PYLA 4B43A 2XWSA 4PTZA 4XYGA 5DO9A 4F96A 4K0RA 4Q1BA 3E0QA 3T7AA 4L0DA 3QLUA 2D00A 4KPUA 4M9XA 4QIHA 2J0UB 1C0IA 2QYHA 2BGTA 4J3JA 4ZPXA 1OD6A 4XWTA 1IQ0A 2QUAA 4BQSA 2TSYB 2NO1A 4KQXA 2NO9A 4E88A 1G20E 3DWFA 4AI6A 4DEVA 1Y7PA 2J0EA 1TQ8A 4FFBA 3VR2D 1MIOA 2Y68A 3VSEA 4R05A 3T4PA 5BRNA 4G24A 1WMSA 3FVTA 5SICE 4DYDA 1HGXA 4MR8B 3RTEA 4AXXA 2VBCA 3K0FA 3L8MA 4ITVA 2OHFA 1JDSA 3EGEA 4D8TA 3B3AA 2J6CA 2ZSAA 3S7ZA 4LYGA 4XX0A 1Y6FA 4RIIA 4RF5A 2AT1A 2HPZA 1BS9A 5AIBA 2H2DA 4UU8A 1LK7A 3U4GA 3ONFA 1LV8A 4FE7A 1VHQA 4LV8B 2NTNA 1J7KA 3PHBE 4YRTA 1ZKMA 1ZD5A 2J4DA 3NWBA 2BGKA 5G2OA 3HHEA 4L5BA 1L5NA 5YASA 4WN9B 1FXWF 4I3FA 3AR8A 4F45A 2IYOA 4D02A 5HXAA 1ODCA 3OQJA 1ZOPA 2JFGA 5AM4A 2VQSA 2AUMA 1TMGE 2R84A 3AK4A 1SC9A 1PN3A 2NUBA 2YRWA 1VLVA 1JRLA 1JIUA 1OJ7A 4AX4A 4HOYA 4TWBA 2QSYA 4P3NA 3UA3A 1W5AA 4JVMA 3L0YA 3QYFA 4EB6B 2FJ0A 3P9SA 4LFBB 3GLFE 1PV1A 4B3CA 1V4BA 1YFJA 1XCPA 5F51A 2DR0A 3OBIA 4C4TA 1U65A 4JUDX 3WQRA 3ZOKA 1B2RA 4LIPD 4ECEA 4RSRA 2ORIA 3KS9A 1RXUA 3B6KA 3BPSA 3HVJA 2JJ1D 2YNMC 1ZN8A 1L7BA 1LTKA 4QU8A 4JR0A 4FR5A 4UCFA 5EP2A 4X62B 3ZWWA 4I4NA 1W0JD 2OK8A 4YEDA 5D1NA 4O5OA 4C4YA 2R00C 2C5SA 3LY7A 2FUG1 4KPUB 3ENZA 1G3UA 5E6RA 4ZI7A 4DRYA 4ZAGA 4PG8A 1IOLA 3MGBA 2CNDA 3QY0A 4P0TA 4DC0A 2PQ2A 4DFDA 3D4PA 4Y8VA 4G2NA 3ZBPA 3GGSA 4PBTA 4UW9A 5FORA 4M2LA 3INTA 4FFBB 4Y1FA 4AECA 1MIOB 3GJSA 3I01M 1UPFA 4I55F 3ETLA 3GNSA 1S8AA 4FXOA 2O0MA 4TTPA 2GESA 1PI3A 2VYNA 3K0FB 1B8UA 1MW8X 2ZWAA 1NM5A 3DMGA 3LZ6A 3L1KA 3NCHA 1HEYA 2VA9A 1OYOA 2WW8A 1KQGA 2ZP1A 2C88A 4XX0B 3DE5X 5ETJA 3DDZX 2DMRA 2XA1A 3QNWA 4RJJA 4P8RA 3ZDBA 4BNZA 4TQ9A 2JJYA 2O8CB 3SOOA 2G70A 3EIOA 4JJ6A 3KSRA 4IXWA 3KVNA 1S89A 1EE2A 2IPNA 4B6PA 3O2SB 2BR4A 4Y6PA 1KKMA 1POXA 3CG4A 2PZMA 1D2AA 1JP7A 3FCUB 2J7KA 1EFDN 3BL8A 4OHPA 1GKUB 5GVRA 2ZRDA 4AQYB 4V24A 5DBHX 1MR3F 2XCTB 1Y1QA 1X0XA 3HFRA 1CVRA 1IBCA 2JD1A 2Q1WA 3BULA 2JG3A 1P7CA 3IVAA 1YFKA 3PNBA 4QUHA 1Z16A 1PLJA 1NYLA 4UE3S 2ZWIA 4A92A 2ZPAA 3KEOA 3TNLA 2IY7A 3MSXA 3W5HA 1JQDA 3PEUA 2XCRB 4IGEA 2NP7A 4B4OA 1WDKA 1JHAA 2F62A 2V9CA 3AOGA 4S24A 1EK1A 2J9ZB 3DR5A 1U0JA 1TC1A 2JJ2A 1NBOA 3CKYA 3RS8A 1I2MA 3RWOA 1EFAA 3VR3A 1W581 3B6IA 1NBWB 5JJBA 3AI7A 3O0TA 1FYVA 2PKRA 4DTCA 5E6RB 4ZI7B 2C9YA 3B2NA 1FMLA 4HLDA 3A3NA 4I19A 3LHKA 2HK9A 2PDAA 3QW2A 2EX1A 2JVJA 3V55A 5I7HA 2M6KA 4N3GA 2CEAA 3P9IA 4RY9A 4DADA 3STXA 3WYEA 4QNRA 2H8GA 1L2TA 3ETHA 2CCGA 4FOOA 1CEXA 4I4IA 5KSPA 5TY0A 3NP9A 3TMAA 5TMPA 5BQXA 2J3QA 3PNOA 4B4WA 3WY9A 1J21A 3R3VA 3A32A 4U9IS 1PR5A 2J4FA 2Y92A 3CWQA 2FX2A 3FB4A 2AXQA 2VTVA 3QE4A 4OV6B 4A2CA 2HNAA 2X23A 1CUHA 1B93A 1PUIA 1KS9A 3MPOA 3R77A 3MUFA 1XT6A 2P3QA 3ITDA 4L72A 1WU8A 1GFWA 3DXFA 2H1OA 3I83A 2KHZA 2XMQA 3DQQA 4X1OA 5CTAA 1LLUA 1CHNA 4BV9A 1HNNA 3K70D 1FTQA 3ETGA 1NE2A 3G13A 1Z13A 4F8JA 3A3YA 4P2GA 3G17A 4TLLB 4RMGA 3ECAA 4XLLA 3KPWA 4EOGA 3UAZA 3VDQA 4ES6A 1U0RA 3G1UA 4EGFA 2XDWA 3R6DA 4RAQA 4BU1A 4G1FA 1AM4D 1LGYA 1H22A 1FP4A 3EGXB 5EC8A 1KJQA 3SC3A 3ER6A 4LSGA 3V7FA 3AY7A 2B94A 3SPXA 3X1WA 4AFNA 4B47A 1Z63A 2F8SA 2EJBA 1QR2A 1SKBA 3BAFA 3L43A 4PIMA 4Q7JB 4BY9E 1WABA 2C95A 1OV6A 4DLYA 4J94A 5LU9A 4JLJA 3K8QA 3AF2A 2PIDA 1Z4PX 1X1DA 2NO6A 4LVUA 1PCXA 3M9LA 2HHAA 5JYDA 2D2IA 3GRAA 3QNUA 4BX0A 4FDLA 1E8DA 4RVOA 1QIFA 3DHYA 1RM4A 4TV9F 3UJ3X 1DU4A 1YBHA 1EVZA 3ESYA 3HPQA 3R2JA 4MWZA 5ALZA 2ZKLA 2JHGA 1RXVA 2BMFA 3FM9A 3OTHA 2CV0A 1RM3A 1TJ3A 2D1SA 2DPGA 1R6XA 2H6EA 2R8YA 3HVKA 4H4DA 1CQIB 4A0FA 1N0VC 1WZEA 1PG5A 2DPMA 2X7JA 3JYOA 1IYZA 1TAHA 4QDUA 1BD3A 2VPPA 1EQUA 1AUPA 4JENA 4QDKA 5AH0A 3D6FA 3OOWA 1HFKA 2AEEA 2HA2A 5B12A 5HS6A 1XZDA 4QXAA 1EJ0A 3AU9A 3OTIA 2CJYA 3VYSB 3ROPA 5IT4A 3BFKA 3WIEA 2OV8A 2XYGA 3DMHA 2QL5A 3GT0A 3IAHA 5EXEA 3PD0A 2G5TA 1UEIA 4U4AA 5D86A 1P8JA 4EG6A 4G3XA 4J7AA 3GJ7A 4B8YA 2YKGA 1CWUA 2ZCJA 1TO2E 5IFLA 2CNWD 4UPDA 1P5JA 4LYFA 1YU9A 2QSZA 1Q7BA 4AULA 5A02A 5CVJA 5I4BA 4X00A 5CYPA 2ORWA 2Y4OA 4IS2A 4KMRA 3KKOA 3VJMA 2FEXA 5KYXA 2DG2A 3VI3B 1XKLA 2PZBA 2VA8A 3EEIA 4JJAA 4UJ3A 4MDHA 1Q95A 3G0IA 1UBJS 2Q4OA 2FPWA 5E4JA 2AVDA 4HNAA 2VF8A 4KO1S 1FP4B 3MRXA 5BN3A 1B41A 4XM1A 3JWGA 1F6BA 4G81A 5K6AA 1ONOA 2VWHA 1LLFA 1XNJA 2PJRA 1E9AA 3LCUA 4KN6A 3I6YA 1EP9A 3X2EA 1Z2AA 1HF3A 3QELB 1E2BA 1JKJA 3JZMA 3KWMA 4ZPJA 5FLEX 3BMXA 1D6MA 2CZQA 4K8OA 2Y3IA 1GA6A 3IV7A 4IJWA 4LPSA 2G09A 4FX2A 5I9MA 2BGLA 3NV9A 4I8XA 1Q6YA 2UUPA 5H59A 1V3TA 2VHWA 2PUBA 3D4NA 1Z5OA 1I2DA 3MWKA 6CHYA 1DARA 1R12A 1RYZA 2FETA 2IYPA 2YXEA 3O2NA 2AHRA 3K15A 4TS4A 1FNNA 1PFWA 4JT8A 3JYHA 4NCIA 1X9HA 3UT5B 5A1JA 1JIKA 2PMBA 4U5XA 1K89A 5I7SA 4B4VA 1KDPA 1LEHA 2DY0A 1LDNA 3TTWA 4RMIA 3F9IA 1GZ6A 4HYYA 1I7PA 5CM2Z 5CHEA 5CEJA 3SC2A 3D6AA 1EFUA 3CONA 2VZEA 4HLUA 4AC9A 1PJSA 1GL7A 1XD9A 2DQ4A 1VFNA 1LRJA 2JZCA 4YRLA 5AJYA 3HE3A 5HUQA 2PH7A 2Z4RA 1JGTA 4N8EA 1GGHA 3FVQA 4UASA 5B1IA 1ZKDA 2OHVA 3FSGD 4MLZA 1JDUA 1QMGA 2W6JD 4TPKA 4U02A 2G36A 4J7CA 4U5QA 3SJCA 4HAWA 4ESHA 3ELBA 5PGMA 621PA 3ECSA 1HFEL 4MUJA 2E4YA 4IEFB 3SM3A 1IH8A 1FPMA 4KLCA 5JNVA 4BFZA 5SZKB 2ZB3A 2A4MA 1DJNA 2W22A 3AHGA 1OHHD 4G56A 4G5RA 3PX3A 4OI4A 4YJGA 2OZVA 5TMEA 1HNWB 1TRHA 2P5YA 2RB5A 4HNAB 4OIFA 4IZIA 1Z4OA 5BN3B 4Q18A 3ZYZA 1X13A 3NLLA 1GZHB 3DBRB 5B1EA 3SHVA 5GTDA 1KVSA 4YXWA 3T3GA 1FFCA 1GVNB 4FUTA 2FQ1A 1FSFA 1J0CA 2VJQA 3IT3A 1KI7A 1Z45A 2P9ZA 3KLBA 3OO1A 4HEQA 3U1TA 1QP0A 1MT3A 1GKKA 4PCUA 1XDDA 5KDOA 1IEWA 1JKJB 1YQDA 1AT1A 1V41E 2J5QA 2VPXA 2Z83A 4RD2A 5DGHA 3TMKA 1MX5A 4U2BA 3B9PA 2IUTA 2JDIA 2PO7A 1TU4A 2HLDA 4PPGA 2JZOA 3V4OA 3M6IA 3TXXA 4FLFA 1SXJA 2LRHA 4OHKA 2LP4Y 3O2QB 3WYGA 4C5AA 2GS9A 4RJ2A 4BASA 3UKOA 3PUKA 3SZGA 1W19A 4UM7A 2ZJYA 1KHHA 2PMDA 3IP5A 1SO8A 4ND2A 1ATZA 1FXUA 2A94A 4HB3A 4KGDA 4RABA 1ZL0A 4E15A 3WGMA 2W7TA 5IVIA 3R7SA 3P9YA 2G6TA 5ARDA 4ZJPA 3BQ9A 2Z43A 1HOTA 3EQ9A 5JBIA 1LX7A 5L9AA 5KAPA 3GMDA 1E0AA 1NAIA 3EXHA 3J81k 4AZSA 3LBAA 2XCQA 1ZD9A 4KSBA 1I1NA 1FVOA 4OATA 3DAGA 3VHQA 1Z4IA 1P18A 2P9YA 4TXJA 2BGUA 4LF9B 2HIAA 1H6DA 1AXGA 1E2MA 2PXAA 3IVXA 3F5DA 1EA5A 4LYHA 1YR6A 1WQ1R 4EKIA 1RKUA 3W3AH 3IEVA 4CMGA 3QUBA 3AJAA 5DU2A 4YJGB 4J1TA 4Q3BA 4O0MA 2XT0A 1L7EA 1W9MA 3DMTA 4W8HA 4YV0A 2JLAA 3FH0A 3D2BA 3JWIA 1NP7A 4QJBA 1DFGA 1W2GA 2JKVA 4HN9A 4HTFA 4QGFA 4HXFB 4IG9A 1T9ZA 3O92A 5EWMB 1RJFA 2B4AA 2D2FA 2I2XB 1ZUWA 4WZAA 3IAFA 4BYMA 1YIDA 2HM7A 1TK3A 5ALLA 2Q3HA 4M6WB 4BQNA 1VJCA 2PJZA 3RSOA 4L73A 2NVBA 5DOVA 1UF9A 2JGLA 3KZVA 1SXJB 2LDXA 1ORVA 2I87A 1GLNA 4ZDIA 3C7TA 3H9CA 2FN7A 4PNPA 1BKSB 4GBMA 4OGLA 4UM8B 2JLRA 3G8DA 1GUAA 5FR1A 2Z2IA 3DLBA 4TWRA 3JQPA 1D7AA 1NZDA 5JZVA 1SC3A 1IHUA 4BIIA 4HNUA 3ILVA 3EXFB 3PR2B 1IOWA 1EFPA 4H3SA 5FHQA 4OQQA 2XNDA 3ESQA 3THOA 3WLOA 4M1MA 4F91B 2Z1NA 4G5FA 3KOOA 4JLWA 2VP0A 3LMKA 3FKJA 3NTXA 5JMTA 1QRSA 3O31A 3EFOB 1XTIA 5IU6A 4BGUA 3TEFA 3HM2A 1S3IA 1RD4A 3VTFA 4IXTA 3WKCA 3EXHB 4XGIA 2INGX 4LDZA 1NWCA 4ZOLF 2BGMA 3D6MA 1Z4NA 1D2EA 1SHZA 4NAHA 2ONKA 3KQWA 4Y98A 4DRXA 5L8VA 2J3MA 1E79A 3QPWA 2FPIA 1Z7EA 4PHFA 4PVCA 4TTSA 1F4PA 1WHSA 3NFRA 5HK8A 2VYCA 3BCRA 4QGHA 4EMUA 1VCOA 4IH9A 3V7NA 2I4LA 4ZOEA 1YIOA 2AN4A 2JLCA 2UZ1A 4RVHA 4KVGA 4KFSA 2QGFA 5MF6A 1QIIA 1C1HA 1VMKA 5KCMA 1MLDA 2A92A 3EC7A 1D2RA 1GTJ1 4N3CA 5KJ6A 3HJFA 521PA 5KYTA 4ZQEA 5KNDD 2J41A 3KJHA 2VH2A 5EKSA 2V4MA 1T1GA 1QYIA 4NU5A 2QN2A 3IC5A 3JQDA 5DJ5A 1Q14A 3B8HA 2H1VA 1DPFA 1MDBA 3OI7A 3LT4A 3T1OA 4WZAB 2W6MA 5PNTA 1V16A 1S7CA 1KHTA 4QA9A 4EFDA 1JG6A 3NX4A 1UPTA 3FCAA 2HJWA 4PX3A 3FNGA 3OTOB 1CJBA 1GDHA 2P9FA 3L02A 1GPJA 4AN4A 3SMVA 4ME6A 1GZSA 1TFUA 2FMHA 1QO0A 5CK4A 5DVZA 3ZD7A 5C35A 1B43A 3DSRA 4G1BA 2PUDA 3UJAA 1QH9A 1WZNA 1N8SA 3TM5A 1YFZA 4M37A 4QU9A 1EQAA 4XYMA 5FD8A 4WD3A 2ID8A 1GZ7A 1L1EA 4JH0A 3KT0A 4MMZB 4GMDA 1RWNA 1EFPB 3S1SA 3QFTA 1LNZA 3VJLA 5B3KA 3MJSA 1OTYA 4UDXX 2XWQA 2J45A 3MJTA 1AV7A 1YL5A 1J23A 2HMTA 3CLRD 3GWZA 3PNSA 3Q7TA 1INLA 4ITRC 4MZDA 3DT9A 4CFYA 3R4VA 4CUJA 3U1VA 2W4MA 2AF4C 1NMXA 3Q7EA 3PLRA 4D9NA 4LF8B 1RJGA 1T3LA 1ZMBA 3WGHA 3U5TA 4B6FA 3RQIA 2C59A 1VHDA 1BAPA 1LBSA 2YY7A 2A9OA 3P9CA 2DT5A 4DRXB 5M5BA 4MUIA 2EFCB 1P75A 3P0RA 1MH1A 1E1LA 2FPIB 4Y6QA 3FCCA 3HYNA 3BG5A 1TM7E 1WHSB 4EUFA 2EEZA 3ZVNA 1FS5A 3P0HA 3LM8A 3RVPA 3LLVA 4CMCA 1WY7A 1K68A 4QQFA 1U8EA 2J08A 1ISMA 3BRWA 1RDFA 4RORA 1ZS9A 2WKQA 1DMRA 4CUKA 4Q7LA 2OC4A 4YT4A 3DEZA 3QVTA 1ZCJA 2P68A 5CNKA 4C4AA 1H2XA 1YXMA 2WTUA 4RTOA 3IPXA 3HA7A 2CNKA 3ODGA 2GPTA 2Y93A 3TOCA 3SU8A 1K8QA 3AM5A 4Q34A 4RV9A 3RB8A 2ZW9A 3K8OE 3MVEA 4EATA 2XTNA 4U8GA 3LBFA 2QTBA 5CLHA 3HXMA 1RI2A 4L6IA 4RMJA 5P21A 1V16B 2PZGA 2QMEA 1QWOA 1LVGA 1YDWA 2WJGA 3TL3A 2IL1A 5CAEA 3JRNA 4Q00A 3NRBA 1EP2B 4NBNA 4U3JA 1POWA 2HREA 3KXDA 3VR6H 3W04A 4BO7A 4PYMA 3V8QA 5A7FA 1CR6A 4Q7MB 4UUQA 4A0GA 4AS2A 1GAEO 3J7TA 4GRDA 4YRBA 5I6DA 4EWLA 1Q1EA 2X8BA 4EARA 2F3PA 1I5EA 1A2OA 3QMPA 4BRZA 1V7QA 2VTKA 1VMIA 1E3IA 3Q9LA 4PNHA 3L7JA 3RFTA 3VPGA 2AC4A 3ZIDA 4F3RA 2V4UA 1EFRD 3E9ZA 2JW5A 4NWIA 3M83A 5G41A 1D6SA 1TU0A 4H3VA 4EY6A 1KETA 4GFDA 4M83A 2D7DA 3CSDA 2A5JA 1Y1RA 3L0CA 3QVOA 3ZDXB 1I3NA 3WLTA 4LF6B 5IKXA 1L4BA 2YFHA 3H2HA 4M9QA 2Q3DA 2QN9A 4MUBA 4OHBA 3K73O 4CMEC 1HSOA 3PIDA 4CM5A 1QIMA 3UIEA 5TF0A 1CJKC 2GN6A 2XNJA 4JL6A 1ZGAA 2WB2A 2CJFA 3B7PA 3D6UA 3WGOA 3F7OA 3T3EA 4BNLA 3RQSA 4UNIA 3NWJA 3E2IA 1JR4A 3OFND 3V4FA 3H4VA 4AP5A 5CITA 2EJVA 6NULA 3TLXA 1ZEJA 2GNPA 1GSOA 5C4IA 3LX6A 4OFWA 3VPDA 2DUMA 5JYCA 5H3HA 1Y0BA 4OXNA 4CM1A 3ZV3A 3MXOA 1F14A 4ZKEA 3C6BA 3CW2A 5EZ5A 2TYSB 3MJRA 2AQKA 5K09A 4P6VF 4FOSA 3KPYA 3IIJA 3ZHSA 1ZJZA 3G2MA 3SOZA 1ECLA 1NNUA 3IUMA 1QAQA 2OCKA 3EOBI 1IEXA 3NV7A 3VH2A 3WLKX 5LNK1 1A95A 3FDJA 4J75A 2LNDA 1YKFA 4C6HA 3KQPA 2ZWOA 3F8TA 3W77A 2WWVD 5KSOA 2NVOA 3AUSA 1E69A 5JI3E 1PNQA 3M4XA 5CFZA 4E3ZA 3BZWA 4U3JB 5DCWA 2ASEA 1UJ2A 4AZ0A 4IQGA 4DCVA 4GPIB 1U2DA 3Q41A 4PRYA 1ID1A 3SKVA 5IJZA 3K09A 1D6NA 4II3A 1ZNQO 2GEFA 1L5QA 4MSUA 4NCHA 2Z6AA 4Z4GA 2BONA 3PKIA 4OKIA 2W0MA 1HL3A 1N2HA 1QG6A 1Y7HA 1BXZA 4NSNA 5KJFA 5ISMA 3G9QA 1M7BA 4FHCA 2AQHA 4YFYA 3T7JA 1V45E 4H77A 4KMOA 2NXJA 1JLSA 2AOVA 4LXQA 1J6UA 1UJ4A 2CJWA 3FHLA 4HQ6A 3NAGA 3F5SA 4IVNA 3C3EA 3VO8A 3LXXA 2Q21A 4MVJF 4N82A 3NHUA 4ZVOA 2Q46A 1T4BA 5EY5B 5TPZA 3LQFA 2R6DA 3U4AA 1COZA 1AGXA 3DPSA 1DDIA 4Q24A 3FPSA 1FQWA 2RH5A 3PCRB 1TRKA 5H81A 1XX6A 2FSGA 1IQUA 1SRQA 3G5TA 2H0RA 3K9GA 4OP3A 1VI6A 5D3KA 3RKRA 3PPXA 4QFBA 2NT4A 2PZKA 1TZ2A 2IP2A 2Z2ZA 3PEEA 4CODB 1RAIA 4R1OA 1ODSA 1BWQA 4F9GA 1XJCA 2Q5IA 4UTNA 4RBNA 3DE0X 4DWOA 1N3IA 5D01A 1E3SA 3KAQA 3MN1A 4MYDA 1HE1C 5KQGA 2F8MA 3ES9A 2F4VB 5E3HA 1JLLA 1TKCA 3ZOZA 1KK3A 5JZBA 1G66A 1V11A 3K30A 3PJGA 4IDEA 3R74A 1S8OA 1Q5PA 5LMZA 1HQKA 4AMGA 5DMHA 2VP2A 1YI8A 3M4JA 1H5NA 4NLLA 3UJ7A 5LD2B 3GFPA 4TVKA 1YR2A 1U0NA 2RIPA 4D9HA 1JNYA 3IXMA 2NPIA 1G2IA 2RHMA 4TWIA 2JGNA 1KDZA 2GTIA 4FCWA 1XPUA 1TYEB 5BV7A 2AI2A 2C2GA 2JAPA 4R9VA 4RK4A 3ZWOA 1W88A 1MB2A 2P62A 2ZJ3A 3GMSA 2I6UA 3IFSA 4RY0A 4YI3A 4CETA 4CLRA 1IHPA 1IB0A 3R9XB 1H3FA 3K1TA 3LS2A 2JBHA 3IMCA 2HTEA 3W8NA 3AVVA 1CF4A 2YINC 5A4DA 4FSXA 1JG4A 2P3OA 3NYIA 5LWQA 2DFTA 2QQ0A 2I80A 2R97A 2QN1A 4N3AA 2M1ZA 4G89A 2P7HA 5TF4A 4L95C 2PUCA 5DKFA 5REQB 1ISGA 2LIVA 4LX8A 5DZSA 2OO3A 4OQXA 4HWSA 3V8PA 2QM3A 2JI4A 3ZGXA 2I2CA 5DGTA 2P40A 5CCXA 3AVQA 3QVSA 1EJBA 2PAAA 4QGAA 3ZD6A 1H0RA 2AZDA 1ADFA 3K94A 5I9NA 2YOHA 2Q3FA 3AY6A 3BA6A 4LVOA 2JEOA 3ZHZA 4Z6KA 4S04A 2MYUA 1GDDA 3DE2X 3AVUA 3UWSA 3ZS9A 4UOEA 5JI2E 5IJ0B 2NYAA 3NM5A 5EI5A 1O6FA 1RMTA 4PO1A 1UMBA 3T7KA 3B1YA 1RZ3A 2BMWA 1I1OA 2BH2A 3D3KA 2W98A 1DAGA 1WMAA 1DBWA 2I2WA 3Q6NA 1E1KA 1ML3A 2VUSA 3I9JA 3O3CA 4B76A 3EMKA 3OT5A 2QSJA 4DM4A 4B7XA 5J5AA 1JLLB 1XZBA 1V11B 2Z9CA 1ZEMA 4PZLA 3S27A 3L7NA 4TXLA 1WD5A 3PTAA 4N48A 2GB4A 1DJMA 2D1RA 3GG9A 4DCNA 1VMEA 3M1IA 4R4JA 2W2TA 4CI0B 1NJ5A 1AOXA 1WXWA 4LRXA 5KWEA 3KOXA 3H5NA 3CNNA 3WL3A 4WQMA 3IEMA 3B5IA 5LBUA 3GXBA 3BC1A 2FUNB 5KTSA 4EPRA 2ZRCA 3E9CA 2HADA 1XU9A 2VOJA 4Z9FA 1OX5A 1QP7A 2RGRA 2E49A 1C7IA 1H5UA 4E3WA 2ST1A 1W88B 1R0RE 1YZQA 4W4TA 3FPEA 2WJZB 2F4NA 3EODA 5F64A 4CLRB 3KKQA 1KZ6A 2ZG6A 1MT0A 3WTBA 1NUAA 3SDBA 3PHLA 5FWDA 4IX9A 1JPNA 3DH0A 2DR3A 3TTTA 3VKUA 1G8SA 1RQLA 2ZTHA 4LY6A 3OP4A 3BIJA 2YWFA 3R44A 2H9IA 4Y9RA 4BZZA 1CVIA 4BVLA 1U7PA 2ZUEA 3NIWA 2XNCA 3D02A 2IX9A 2OGUA 2VNAA 2GHIA 1UXJA 2Y71A 3PWSA 4EY5A 4ZYZA 2B69A 1L1FA 3ADKA 3KEMA 4H27A 4BLSA 4ARCA 5E7JA 2PKWA 4FEGA 2Q5HA 1WB9A 3NHJA 3UCXA 5IASA 4G25A 2C97A 2NX2A 4HWPA 4IWXA 4NONA 1YZGA 3SICE 4I1IA 1UMBB 2CL7X 3W05A 3SHFA 2R3SA 1YJ8A 1FFEA 4RQBA 5H0IA 1Z18A 1NNEA 3VH3A 1JHYA 3QJGA 1Q7CA 5H1YA 1LTHR 3RAEC 1RWXA 3NYQA 2A86A 4RY8A 1SXIA 5C8YF 3SS7X 1EGVB 1F6WA 3U9TA 4IIJF 2HCJB 3N8GA 1FX0A 3L84A 2QNBA 1ZC3A 3C7KA 3FR8A 4MNTA 1DQRA 4OQ4A 3MINA 3QEMA 2H1SA 2I2AA 2DGDA 4KVAA 1V7CA 2I6SA 3E9RA 4PAQA 5E9AA 1YRBA 3KWJA 3C8UA 5U4XA 1XP8A 3UB4A 2PBFA 3OG9A 4M8KA 4NBKA 4ZO6A 4ATNA 1L4UA 5BV8A 2YVUA 1B73A 3OPXA 3ZYCA 4RJIA 3W8EA 3AJ9A 5DX8A 1N6HA 2NZXA 2ZWPA 1LSSA 3RVMA 1HL7A 3VU1A 4OM7A 2FTKE 3A36A 2JIMA 3P2IA 1FVFA 1LBTA 4JKOA 3P0JA 4M8IA 4NMLA 3U7JA 2W42A 5B37A 2AKAB 4CV3A 1RXYA 3AFMA 5A4FS 2AJDA 5IKOA 1W87A 3I1IA 4K5QA 1XCOA 4D6XA 2XT6A 1N5JA 4TZKA 3UJ6A 3WQBA 2NZJA 1AKNA 2VYND 3DPIA 1P2GA 4OKNA 5CLLA 5AI6A 2QIOA 2EQBA 3BK2A 4N5LA 3UT0A 5I47A 3COVA 1SHLA 2R86A 1TQHA 4JNCA 4YCDA 4Z9BA 3WK8A 2Q29A 2NYUA 3G88A 3P52A 3TNJA 4ZJYA 3W5VA 3BIOA 1HLFA 2PSHA 3JYQA 4KQMA 1U7TA 1IMOA 3JSAA 3UICA 1JE1A 5LA6F 1N2EA 1KO1A 5JY1A 4BN5A 3T3NA 1P77A 1HQDA 3FCSB 1DV1A 1CRQA 3GLTA 1BQEA 1FFAA 1DAOA 3PDUA 1SQGA 1ORWA 1SN7A 2Z08A 3GLVA 4KQIA 4KQCA 4X95A 5KJEA 3WBKA 3GLGB 3PNKA 3MRVA 4PQFA 5A4JA 3RUAA 4DCUA 4R71A 1ODFA 2H5IA 3CF2A 3I9LA 4CTJA 5JQGB 3BGIA 2I7XA 2KPOA 3EGCA 2VATA 2KBEA 1DAIA 4EENA 2WQ6A 3GUVA 2OOSA 4JB2A 2R96A 1TM3E 1PZFA 2X5OA 4BV8A 4ALMA 2UZ4A 3OJXA 3OIUA 1Z7BA 3DE1X 2QZPA 3K2QA 2UVPB 3DEKA 4P4TA 3PLNA 2KBFA 4GT1A 5A0FA 3ZE8A 4ZDJA 2PKXA 2JLWA 3V1YA 2O8NA 1LDBA 3EDYA 2HJSA 1FX0B 2ISSD 3TRDA 3KAJA 3FJOA 3ZHUA 1CNMA 1MU0A 1V0JA 1TUBA 3I4FA 3MINB 3KPJA 1U0EA 3DEFA 3QEMB 5IC5A 4U2DA 3V4SA 3R6GA 4ACBA 4UHCA 2JJ2D 4IHAA 3K2BA 3WRWA 4P3XA 4S2EA 1MHTA 2XBUA 1AB5A 2OP1A 121PA 1EZ4A 2DLCX 2J09A 3PXXA 1FTYA 3SE0A 3QZUA 4YCAA 4ZTUB 4P86A 1YH3A 1O95A 5K8UA 1DTEA 4UOQA 3AW8A 1WXQA 1I6KA 3OPYA 2E0IA 4WNIA 3RVNA 5BY2A 3AEUA 3GH3A 3L5KA 3I01A 4IMIB 1NF8A 3Q7RA 3FAKA 3S2SA 4CCWA 3LSYA 1B6GA 4F5YA 2HK7A 1PF7E 1G7RA 2B8NA 2BE7A 4IO0A 4XQEA 3VR1A 4BWGA 4BZPA 4DLKA 3GVHA 4BFWA 1N2ZA 2IKQA 4BX9A 3FRHA 1JQEA 3DYVA 2HRBA 4M49A 5IT9A 4KREA 1W75A 2OBBA 3GLHA 1A77A 4BZXA 3OOHA 4ML3A 5E1OA 5HPYB 3IQXA 4UBLA 4F04A 4QTXA 2RHWA 5ESWA 1SVNA 5DX0A 2YVKA 4OMUA 5KQLA 4X91A 3IKTA 3IOEA 1DXQA 4LN1A 3RLIA 5BUQA 5JADA 3E5HA 5TT1A 4Y67A 3WAKA 1GEGA 1HG0A 4D79A 3WICA 4D3SA 1J1ZA 1J0DA 1S9HA 3OD5A 3D7LA 4ID9A 1GRQA 2Y66A 5EJAA 4DGQA 3GLRA 1XDBA 1IU9A 3OF2A 1R5JA 2AC2A 3FNEA 4M8NE 5B1SA 1TUBB 2WBLC 2EW1A 4EHIA 4D0GA 4O4LF 1QK5A 2VJLA 3TRJA 1UQUA 1FX1A 1P29A 4UQPA 3F1KA 1I2AA 2V1UA 1J1UA 1WXIA 4OHXA 3GPLA 3HJTA 1L4GA 1WD7A 2EBWA 3MYYA 4I14A 3BB3A 5I7AA 1ANKA 5BSEA 1N0UA 2K6GA 1CETA 4DLBA 4IDOA 3EGIA 3OPYB 1DUVG 1RYMA 1VRVA 2F1JA 2XWPA 4MS3A 3UMRA 3L4KA 1HYHA 2D1TA 4E5SA 3BIXA 4D9IA 2YXDA 2JFPA 2W48A 3QKWA 5GINE 5IK2D 3L41A 3FHTA 4F12A 3AHHA 3GVCA 1IFXA 1RE0A 2DLNA 3I4CA 3JQCA 1HMYA 3D59A 4BCBA 1AKMA 1MVOA 3T1HB 3SCZA 2OFWA 3KXIA 3CRMA 4FGKA 1XWIA 1QJ4A 3GFFA 4FDAA 3GLHB 1Y48E 1CRPA 4OMFG 3HGMA 1DVRA 4WDQA 3UATA 1T25A 1JIJA 2HMYB 1ZH0A 3KUXA 4BO5A 3FSRA 4HL6A 4BKRA 3CPEA 3RAPR 3B78A 2FR1A 3REOA 4ZYXA 1PUJA 1QPBA 5DNWA 1ELOA 4ZAYA 1W0CA 3N2KA 4MVWA 4TTIA 3W1WA 1OKKA 2AGVA 3K9LA 1WTCA 4PZZA 2CV1A 1DC4A 1HE8B 2P6OA 4DANA 1IHYA 2VP9A 1Y6QA 5CFOA 5KSWB 4QT0A 1Z4MA 4GI7A 4JI8B 4R8RA 3GARA 3I0ZA 3AEQA 3IQDB 1NOJA 1IM2A 2C9BA 1EE1A 4I3GA 1I14A 1JYSA 1YL7A 1AKRA 2NTYC 2DE0X 3ROQA 2H63A 3RS7A 1MQAA 1UZLA 2FMFA 4AY3A 1CUJA 5TR9A 3TW4A 1VRWA 4U7WA 4D99A 1EX6A 1QSGA 3TKAA 2NWQA 4URYR 3IOBA 4N0QA 4DMGA 1CV2A 3ZD9A 3M6MD 1D4FA 3EIWA 3FF4A 1HTBA 3LX4A 2VRNA 3A2MA 3BXZA 3D2CA 1FP6A 4KG7A 4YP9A 5JS2A 2B8EA 2GBGA 1T5OA 1T9AA 3L8DA 2W2PA 1VOTA 3UTDA 5DM1A 3SZMA 4D74A 3ZCUA 2W11A 3DDUA 4D3YA 1N2OA 3PEYA 3IUJA 3T3PB 5EHGA 3FTCA 3T3DA 2P0EA 1N2GA 2H85A 3C5HA 4J0KA 4ZGGA 4I9HA 2AFHB 4BLUA 5AXCA 1UMCA 3WHLA 5KB3A 1JSRA 4HGOA 3OLYA 4C20A 3A27A 4ND7A 1J2EA 2YZMA 1RQ7A 3IPAA 4WFIA 4OLAA 5KHOC 4CKEA 4WZAE 3VKHA 5L4SA 1PFQA 3FLMA 1R0KA 2RGUA 3EASA 3DKKA 2QLLA 3N53A 1U80A 4KXXA 4ZU6X 4DNXA 1KR5A 2GASA 4LF5B 4R2MA 4WXHA 4L8WB 1QAOA 2HWWA 3BD7A 3UV3A 2MU1A 2O6HA 1NRJB 4FW9A 1K6XA 1WIWA 2ONCA 2C2XA 2F8LA 3PXDA 4UULA 2VT6A 2EZ4A 2XCOA 3LXRA 3KCNA 5EMLA 3E9EA 1MKYA 2VO1A 1M1YB 1PT7A 2DTEA 2IXFA 2L18A 2XTZA 3OIDA 3N2KB 3PC6A 5TMBA 2ZUWA 4NFHA 1BOFA 4D45A 2A1UA 2IT1A 3C3KA 3SK0A 3LXUX 1BWSA 1DX6A 3DCIA 1OZHA 5C0OE 5DPMA 1M5RA 1U2QA 4ZOQI 2CWWA 1MG5A 3N6VA 2FXIA 1S1CA 5CFMA 2OCXA 5IG2A 1Q0TA 1H4TA 1VCNA 2NUPA 2ZJ0A 3AEQB 2ZRQA 4HPWA 5C7YA 3HYSA 3REGA 3CJQA 2FPUA 4EHHA 1N8TA 3N0TA 2FZWA 2RGCA 3C7CB 1CY2A 3FNFA 4GZLA 4CG0A 4BB6A 3DV0B 1FYEA 4LJSA 3T15A 3TQTA 1OH5A 3R0XA 1P5FA 1UBTS 3VSCA 3KL2A 2JDID 4NPAA 3V8RA 3SNHA