4PPNA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
327
structure length
311
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 311
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppnA01
1E2QA 3QG1A 1FZQA 3ECCA 4EKDA 2YOGA 1XEWX 5IT5A 3L8YA 4G5RA 4MRSA 1HE1C 2XEXA 4NCHA 1B23P 1QRAA 2AL7A 2QY9A 5DISB 2A5GA 3A8TA 4LX0A 1Z6GA 5BYJA 1AA3A 1W49A 3R9IA 3GLFB 2OXRA 1KY2A 1QHHB 421PA 3CNNA 4B2LA 4DLSA 2A5FA 2FJUA 1P62B 4TL8A 1NMXA 1X8LA 2O5VA 4A9AA 3GLFA 1P75A 2JATA 4EPTA 1KK2A 1IXSB 1QHHA 2IHYA 3BH0A 3BH7A 2B8WA 1N5IA 4BZPA 3MUFA 1NN0A 4KBFA 2PZFA 4MYUA 2EFCB 2R6FA 4XVRA 3A1TA 4LHYA 3RS2A 4KXFB 2WWWA 4M4SA 3GLHB 2QZ4A 4XD7D 3HR7A 4JYBA 4LJAA 4UXHA 2HT6A 4B3BA 2R62A 5J4VA 1DARA 4TSFD 4G5OA 4X8OA 2XZLA 1Z6YA 1JXMA 2G0TA 4B6EA 4B2IA 4EAQA 4DEYA 3GLHA 2E87A 3WY9A 2HYDA 5JHHB 4GOKA 2F43B 4RZ2A 1HE8B 3WP0A 1P6XA 4V03A 3AVTA 1JI0A 1LF0A 1AZTA 2QMUA 2QTFA 1P2SA 1JEDA 1ZC3A 1ODFA 5CDFA 3B78A 2F43A 1IY1A 1R5NA 3UANA 1D8TA 2W58A 3ZD7A 1PUIA 3QXHA 2WWHA 3R8FA 4OI4A 4Q7KA 3TW4A 4AIIA 1D9XA 1FMJA 2CNWD 3EW9A 2ZSDA 3KUDA 2EQBA 2R8RA 1SKYE 3SU8A 2BOVA 3CNOA 4HYYA 1XU4A 1NL3A 4AG5A 1PLKA 1NVUQ 3LRPA 4B3XA 3IIMA 3B1WA 2RGGA 2UZ3A 3A4MA 4TTPA 1VPLA 4OQNA 1G8HA 1UBFA 3BJIC 2ZRHA 3LH5A 1WBBA 2DWPA 4DEXA 5F9FA 2P6NA 1TF2A 2CL7X 4LHXA 1VCMA 2XNDA 5KDLA 4A2WA 4PAOA 1AA9A 1SKYB 5EE5B 3N70A 4O2LA 1ZU5A 3ND8A 2I3BA 1QG4A 1KYIA 4CT5A 4JLAA 3UK6A 1LTQA 4AD8A 2Q9BA 3TIFA 1JB1A 4NU0A 3AF3A 4M1WA 4BWYA 1JJ7A 1EFHA 1II9A 1Z2AA 1FP7A 2B7CA 3W6PA 2RAPA 3FWYA 4OBEA 4OJKA 4UNSA 4RD4A 4D0NA 2X2FA 2FE4A 4YQFA 2NOAA 1Q21A 4BFUA 1XTIA 4HLUA 5KTYA 4Q7MB 1FP6A 2IHBA 3EC1A 4V0OA 2R6AA 2O0JA 5KSZA 1KOFA 2WZQA 2F55A 1LW7A 2ASEA 4NKRA 2J1LA 4GZLA 1CF4A 1NVVR 1QHIA 4Q1FA 4DCNA 1W2GA 2CK3D 3QKTA 3VU9B 1IY2A 2CBZA 2F9MA 5IRCD 3OIVA 2VHCA 4KFUA 1DAEA 1SXJB 2IYTA 1OKKD 4TL6A 1EGAA 4HI0E 1Q44A 5F98A 2YJTD 3SS8A 5FPSA 5D3MB 3RRYA 2KBEA 1N5JA 2GCPA 2OO7A 5CK5A 1SXJA 3V00A 1S2MA 1VMAA 3T1TA 3X1DA 1GFIA 1E9EA 1E69A 2Q3HA 5FOWA 2QSZA 1XJ0A 1MV5A 2RMKA 2L0XA 3BORA 4R7ZA 1ZD9A 5D3MA 4ZDKA 3AV0B 4Q4HB 2R65A 2PJZA 3SBDA 3T61A 3I8XA 1S4QA 1R7RA 1KJZA 1IXRC 5B30A 3U7FB 1GKYA 2XSZA 1JAIA 4U00A 1G4UR 2WWFA 1BMFA 4Q4HA 4PR0A 2OG2A 3ASZA 3CR8A 3LD9A 4GZMA 2ZE6A 4ITRC 1E98A 1KMQA 1DAHA 1Z0IA 2J59A 4XWAA 3ZS9A 1A1VA 1E0AA 3TVTA 4M1YA 3AKEA 2FSHA 4FW9A 3WNBA 1O3YA 2FA9A 2FPLA 3T06B 2O8CA 1MO3A 1OPXA 3BERA 3F3YA 3SE0A 1EX6A 1FTNA 5B2ZA 1JBKA 3U7HB 3CM0A 1RKBA 2ZYWX 4NCKA 1ZUIA 4V0ME 1AS0A 3IPYA 8OHMA 2GESA 4AWXA 5F3WB 5FR1A 3MWLA 4FMCF 2J0QA 4JVMA 2GF9A 1R4AA 2GK7A 2J7PD 3MAAC 1KJWA 4OKSA 5A4JA 1G8YA 1ZC4A 2VRWA 4Q4AB 1QBKC 3K9NA 1X1RA 1UF9A 4A92A 1S1CA 2NPFA 2JIZA 2PBRA 3PXGA 3RRZA 4JVSB 1R6BX 2WV9A 4GP6A 5F2EA 4Q4AA 3BFVA 5EUQB 1E0JA 1YE8A 4JLBA 4BEJA 4Q7JB 1E2JA 5IK2A 4RKEA 3MG9A 821PA 2DY1A 4AY2A 3LQRA 5EJEA 5FL3A 4PSKA 4TLEA 5TARA 1F60A 4V0MA 1T8TA 1ZNXA 3KJIA 1XJCA 2KJQA 3K0SA 3LQQA 1Z8FA 1HY3A 1YQTA 1R0YA 3B85A 3NKVA 5CM8B 5DIFA 5FL7A 3X1ZA 4EJSA 1K5GA 1NP6A 1W4BA 3T5DA 3KXKA 3VAAA 1N6OA 2LKDA 5FTKA 2WKQA 5L3RA 2NMVA 3K0CA 2ZREA 2OFOA 1VECA 2WJJA 3WRXC 2C04A 2F3RA 4Q1CA 3SJCA 1U94A 4H1UA 1MABB 1NSTA 1XJQA 1IN4A 1NBME 2MMGA 4M9XA 4A8JB 2ANCA 4GFDA 2WWGA 2NO1A 4Q1EA 2ZJ8A 3P32A 2NZJA 4YMVA 4DRZA 2Z6VA 5FI0B 1AS2A 1A7JA 3OEEA 1MABA 3CZQA 2QMOA 4K8OA 4A8JA 4JL6A 1FQJA 1XTJA 2XTNA 3IQXA 4YMTA 2ZYVX 4Y0VA 3X1YA 3FE2A 3WYFA 4IEIA 5EP3A 3B1VA 2K5UA 3CBQA 5KSOA 1GNQA 4GRAA 2RGNC 3WMFA 1E4VA 1ZUHA 2ECKA 4HDOB 5EUMA 2HJVA 1T0HB 3D8BA 5JS8A 5JWRA 3FOZA 4F4CA 5H1YA 3AB3A 5GVSA 2OSBA 3NIBA 1NBMA 2UZIR 4JS0A 4G5SA 4RCYA 4F4IA 1E2IA 4PZYA 4TMZA 1P7CA 1BOFA 2V7QD 4BFWA 4NP6A 3K0AB 3JVVA 1GITA 3WBJA 5LD2B 1XD9A 2EW1A 2XJ4A 4ZV4A 5CB6A 3QKSB 5HPYB 2QUZA 1GWNA 4DB2A 1I2MA 2ZRJA 4L9SA 5EXTA 4PC1A 3K0AA 3Q5EA 1Z0KA 3REFA 2ZSBA 1IM2A 4LBWA 4Q1DA 5KNBA 2O0KA 3LFUA 2CE7A 4NTZA 2XTZA 3QG5A 3QKSA 3NVAA 5FOTA 4A82A 4B73A 3A1UA 3N2IA 4M9SA 4TLCA 1EESA 1RRFA 1HH4A 3U3OA 2BIFA 5A5GA 3LVRE 1UJ2A 4WZBE 3NHAA 2BJVA 1U90A 2OCAA 2ZYUX 3WHKA 3EWSA 1XTSA 1JQLB 2PZGA 5HKKA 1DPFA 1LB1B 1DAKA 2XOKA 4KYUA 4FN5A 1I4TD 2AN9A 2LWIA 1E9BA 1E0SA 3AVYA 3B9PA 1NRJB 2IEZA 1JQJC 4XVQA 3LAWA 4QNMA 2NZ8A 2A5YB 4M1OA 3IHLA 3KQKA 2AFIE 2JJ8A 1FUUA 3O8BA 4OI2A 2BBWA 4PC6A 5FFMA 2EYQA 2FX3A 3L0IB 3CZPA 4D82A 3SNHA 1Q3TA 1H8ED 4KV9A 4UNNA 4DCSA 4M1TA 4PPQA 3LBNA 2F9LA 1ZM4A 3I5XA 2A2ZA 2ZIAA 4PXAA 2IS1A 2C5LA 3PV0A 3FKSD 2EWVA 4TYYA 1EWQA 1OXTA 1S9DA 4UJ5A 3Q9LA 3VKHA 1MKYA 3NXSA 2YOHA 2NPIA 5AK0A 2R6CA 3LVQE 1CKEA 4IW3B 1G19A 3B8HA 2YC4C 2H8KA 3QE0A 2B21A 3U44B 2ZR9A 4WZ6A 3AVWA 1E2GA 5UKDA 3RYTC 3PUWA 4XTRA 4DUGA 2BMDA 3KJHA 1KMHB 5JJLA 3U44A 3BB1A 1PJRA 3QOFA 1ZAKA 3NBYC 4HLCA 1US8B 2CXXA 3RRMA 5B64A 1KMHA 2BKEA 1Z83A 3QY0A 4TL9A 1QVRA 3W90A 1TQ4A 1XX6A 1OYYA 1KTVA 2C03A 2AFHE 2N1BA 3VQTA 2VSFA 4JBWA 1US8A 1FX0A 4JJZA 3Q85A 3WYGA 1Z6TA 2IL1A 4I1VA 3X1WA 1R5OA 3BWDD 5TMPA 1T4GA 4MH0R 5BQ5A 4B3GA 1S9HA 3H0KA 1PV4A 4LI0A 5J4HA 1IJEA 1CR2A 4OK6A 2FOLA 1E2PA 1E32A 3K1JA 3LBIA 4DT1B 4LC1A 1R0ZA 5LBIA 1Z6XA 2ZAOA 3MWYW 1ZMXA 2FNAA 2ZJOA 2GVZC 1XP8A 3PEVA 2OLJA 4A0RA 3TJZA 4D4LA 5K8IA 1Q1BA 1AIPA 4DT1A 1X8JA 3OIYA 4JVNA 2FSGA 1YVDA 3DEFA 4DIEA 4KLZA 4CIDA 4LCBA 4P4SB 3EXAA 3TKLA 2FV8A 3UG7A 2JLYA 3EZ6A 1HURA 3R20A 2WJGA 1CR1A 3U60B 1VG9B 1P61B 4P4SA 4EFLA 1JJVA 3C14C 3IO5A 2ZRNA 2ZPTX 1UDXA 2W83A 5JWHA 1GM5A 3ICQB 1DAGA 1GTVA 2QA5A 1P9WA 1RJ9B 5LPNA 1RIFA 3AVQA 4G0NA 4WVFA 3K09A 2V1UA 2NO7A 1OHHA 4FI3C 1L2TA 3L0OA 3AM1A 5FOUA 1RJ9A 2X19A 4G01B 1E96A 4MRNA 1KNXA 2ZUDA 2PL3A 2NO9A 2VP2A 4CEIB 4PQRA 1E1RD 2YC2C 2ONJA 1XD2B 1Z0JA 5GJVC 4NH0A 3CKLA 3H2YA 4PHFA 4B76A 2O8BB 4BLTA 1X3SA 1G20E 4MKGA 1C9KA 4QJ4A 3SR0A 4CEIA 2C8VA 5AWFC 4F91B 4LV8B 1XD2A 1XFAA 2WSSD 2Z5FA 3BH6A 3QF4B 3TQFA 4RSGA 2O8BA 5E3HA 1W5SA 521PA 5B57C 3CX7A 4QM6A 4DZZA 4YDSA 2EFGA 5E4FA 1J8MF 2VPPA 3QF4A 4TMXA 2BV3A 1HYQA 5CK4A 2EFDB 4UNQA 3T15A 2JCSA 4JZKA 4BQSA 3LWNA 3WYAA 4TQUS 1U99A 1EK0A 2BBTA 2WVJA 5EE9A 1H8HD 3QBTA 5BN4A 2H17A 2C77A 1MO4A 2CEAA 3EG5A 1U8AA 2CVFA 1TAGA 1XMJA 1KK1A 5DN6D 2YOFA 2QSYA 2Q0HA 2ZE8A 5JEEA 1TQ6A 5DI3B 4BLOA 5CLQA 4URZR 2YWFA 1N6LA 2ZSAA 4FWIB 1PVOA 3AGPA 3RS5A 1AZSC 1XEWY 2GJSA 4HAZA 3O8DA 3UMFA 2DFTA 1SULA 4RD3A 1TUEA 3Q5DA 5DI3A 3THYB 2AR7A 3I62A 1VG1A 2VSXA 2ZJ5A 3MRSA 3OAAD 4US0R 3LXRA 1XWIA 4F93B 1JECA 1EFRA 2J0SA 2J0UA 5J40A 2D06A 5EP2A 4TZ6A 5FTJA 3UWOA 3THYA 4HAWA 5CYOA 1Z06A 2VA8A 4EPVA 5L3VA 1VIYA 4XSHA 2CMKA 3LO5A 4X8LA 4DKXA 3H84A 1KI3A 4PHTA 3GJXC 3NBFA 4LSGA 2KWIA 3DOFA 2VF8A 4NONA 2LCFA 3UWKA 3MWJA 2CHQA 1W0JD 2YKGA 1T5IA 4IDPA 2RB4A 1LFDB 3TNFA 3HJNA 1W36C 1C1YA 2EYUA 1J70A 3AKCA 2BVNA 1ONBA 1KO4A 4LHZA 4DDWA 1GNPA 5L8VA 3A36A 1P60A 4QJ5A 4B6FA 5HR5A 3EARA 4DLRA 2P6RA 1DG1G 1R8SA 3C41J 4C0HA 5HZHA 3TR0A 4QRHA 4DIDA 1E79A 4QBHA 3U4QB 5DHAA 2GJ9A 1M34E 3I4LA 3W9YA 1CULC 1A2KC 1G3UA 4I1OA 3SJBA 4DWJA 4O3MA 1Z3IX 2GXQA 4KJZA 4DLVA 3U4QA 2JLQA 4LHVA 3BFXA 4QL3A 1LS1A 1Q20A 2KBFA 1Z28A 3IIJA 3QPUA 4DSOA 3NH9A 1HV8A 1ZRHA 4DBLC 4ESHA 2N46A 1D9ZA 1BIFA 1FNNA 1KKMA 4KHZA 3ZJYA 2XX3A 4O25A 1W2HA 4CW7A 4D6PA 2HJGA 4GT1A 1YZTA 2WMNB 1W5TA 2WPDD 1Z08A 3DHWC 2VP9A 3L43A 2W2XA 1CP2A 1OSNA 3U7GA 4HB3A 4NL4H 1XDBA 1A82A 4HZUB 4AG6A 4B33A 3OEHA 2ZTSA 1F5NA 3KKMA 4E09A 2BMEA 4US1R 2IF2A 3TLXA 1SVKA 4PC3A 1EFUA 4PX9A 3UMSA 2OBNA 3W6OA 3QSYA 4A15A 4YXWA 2ZRAA 4HZUA 2REBA 2OFWA 5JCZA 4QGAA 2ZETA 1BH2A 1FNMA 1GAJA 1AM4D 1KY3A 1ZNZA 3MLEA 3G5UA 3I61A 1K8RA 4P3YA 1UPTA 3NC1C 1JALA 1UEIA 4ABYA 2W6JD 2WWYA 3HU2A 3C8UA 4X8HA 5BN3A 5FOVA 3DDCA 4RKFA 2TMKA 1RRGA 2WM9B 1ZIOA 4JIMA 1O87A 2FFHA 4UJ3A 2GXUA 2IYQA 3K0FA 2ZE5A 4TN1A 3EPJA 2JLXA 2FU5C 2PZEA 2ZS9A 2QT1A 4C0SA 3LW8A 1NN3A 3I72A 2GJ8A 3MMPA 4HDCA 2BBSA 2BMJA 2F6RA 5KU1A 1W4RA 2YWEA 4O0MA 1KZ7B 4LBYA 4LRWA 5HE8A 3EZFA 3PUVA 5C18A 1COWA 1ZP6A 3VKGA 1PLLA 2V4ZA 4IDNA 3PENA 4Q00A 3Q8XB 4CF7A 4RZUA 3EX7C 2FFQA 4LC0A 5EXPA 3VFDA 1WXQA 4KCGA 3GJ8A 3RWMB 2ZI7A 1S3SA 1GKIA 3AKYA 3BC1A 1XCMA 4FD2A 3U7EB 4A1FA 2P6UA 4JLNA 3VKWA 5FOSA 1W0KA 3GJ7A 4GI7A 4KI0A 1UKYA 4HLUC 3BIFA 3BBPA 5A0FA 2D7DA 2BDTA 3VR2A 1KK0A 4I4LA 3U3KA 4QOSA 5J4YA 4M1MA 2CLDX 2F1HA 1M2OB 4LJ7A 1Q0UA 2W0MA 2OT3B 4BFXA 4LK2A 4JT2A 3EA5A 1UBEA 4LJ5A 4TMWA 4II7A 1RFLA 3ZIAA 1NJFA 2PEYA 3A6PC 1MO5A 1NKTA 1NN5A 5BN5A 1P72A 1XCGB 3QXXA 2EU8A 4TLDA 1LVGA 3ZVNA 2ZUCA 2H57A 4FCTA 1OH8A 2ZRPA 2C9YA 1R0WA 1JNYA 6Q21A 1VHTA 2Q9CA 1QHXA 1OB2A 2OILA 1KSJA 1RE0A 1SXJC 1G3QA 4LY6A 2W00A 4V02A 3EIHA 5FUVA 5JRZA 3RSOA 4Q48A 4HB4A 2F1RA 1GUAA 3CRRA 4OHZA 4ARZB 3CF0A 3CH4B 1WE2A 2FSIA 2JLZA 4NPHA 5L3SB 3RNLA 3ZS8A 2F1IA 2JAQA 3I3SR 1EXMA 1GIAA 4Q4LA 2XXAB 1M7BA 1VYUA 4ARZA 4ZDJA 3T1OA 4JLVA 1D6JA 3E2IA 5L3SA 4MKIA 1JR3D 2Z4RA 1GOTA 2X1VA 1MT0A 3IEUA 1G3IA 1HQCA 2PMKA 2XXAA 4KLNA 1SVLA 3MSXA 4LZZA 5SZHB 5KO2A 2AD1A 4QBIA 3A37A 3BD9A 4AKHA 3UATA 1U9IA 2QE7A 3N5CA 3C4JA 3IBYA 3RS0A 4F38A 3B1ZA 3H86A 1ZIPA 5BW8A 4R2IA 1UADA 3QJYA 1CR0A 1LNZA 4HB0A 4MKFA 4ZKEA 5JI2E 3G0HA 2A5JA 3U3RA 1OT3A 1OV4A 3MWKA 1KI8A 2ODWA 4NMMA 1G7TA 4PAQA 621PA 4WW0A 4PQYA 1K6MA 2DYKA 1CBUA 1G21E 2CDNA 2QTHA 4E5UA 2OAQ1 4M22A 3SQWA 5SZKB 1XNJA 2G77B 1L4YA 1U81A 5AUPB 5FBQB 3CB4A 5E7JA 5LB4A 3GJ0A 4D2IA 5M04A 4WZAE 2OBMA 3KKOA 2FSFA 3SHFA 1IN8A 4BLRA 1P4SA 4BRUA 2ZRKA 1UM8A 3PUYA 2ODBA 2AXPA 5K8LA 2OE2A 1G8PA 2C9OA 4Q21A 3FB4A 2DCUA 4A4DA 2WJHA 3PEWA 3VNVA 1OYWA 2QEQA 3SDZA 4IVQA 4HAUA 1N0WA 1KK3A 4KFSA 2A78A 3NBZC 4B2PA 3P4XA 1XBTA 2G1JA 3VX4A 3B13B 3U6BA 2O8CB 1XRJA 2GAAA 1M7HA 3TE6A 4M8NE 3D6TB 2ZVQX 3GLIE 2JJ2A 2GKSA 2ZI3A 3TUZC 4ESVA 4JYCA 2ZROA 5FH9A 3KFXA 4JL8A 5JFGA 2QRZA 3K0CC 5L3QB 2GBLA 2YWGA 4NBSA 2DFLA 1N0VC 2FGJA 3T1VA 3CO5A 4MDFA 2X77A 4B48A 1TU4A 2Q3FA 4IOLA 1VG0B 5FBRB 5L3QA 5BWMA 2BKUA 1G7CA 3SQXA 4KVAA 3CR7A 5DI9A 3GLIB 1OW3B 1CRQA 4A8JC 4B75A 1XMIA 4JMPA 4EPRA 4C7OA 1U98A 2YINC 1XZPA 4DDVA 3HP1A 4QGFA 2BM1A 1C4OA 1KJYA 1Y3AA 3QPWA 3GLIA 4GMDA 1L7VC 3ND9A 2ZJ2A 4FINA 5FUXA 1T3HA 1D5CA 1OXXK 2VP6A 3L82B 1XTKA 5DNYB 3O47A 1NJGA 4NZYA 2G9NA 4OQMA 1R2QA 4DB4A 3DKVA 4ACBA 1ZINA 3QUSA 3QVVA 4FCWA 4NYJR 1J99A 2BMFA 2DFKB 4H9GA 1DVRA 4NYIR 5EXSA 3AVPA 2OLKA 4RD1A 1J2JA 3AF2A 4JLKA 4LPKA 4Z1MA 1MOZA 3RANA 4HSEA 3SEAA 2XZOA 5CJ2A 4GOXA 1N5KA 4B3FX 4JLJA 5HZKA 4F7WA 2D2EA 2IF0A 2QNRA 4ZIRB 2XB2A 3F0TA 3NEYA 4QHYA 4ASUD 1YJ5A 1AGPA 4DSUA 1DAMA 1V43A 4LYJA 3RRNA 5LD2C 4PQFA 4EJSB 4ZDIA 4ZIRA 3BK7A 4TT3D 4M9ZA 1SHKA 1W4AA 4JLOA 1NIPA 1KO7A 3OFND 4XOIA 1XEFA 3HYRA 4LOAA 2VLIA 2VBCA 1WRBA 4DSTA 5JLJA 2QQ0A 2N42A 1XTRA 1WMSA 1L8QA 1GDDA 4EPWA 3EZ7A 4ILEA 2D62A 1E94E 1Z07A 3MGCA 5ANRB 1YZNA 3PJRA 5FBLB 3O8RA 1F6BA 1OF1A 1ZUNB 3OESA 4S35A 4PSVA 1V5WA 4CRWB 1N6PA 4BZQA 3OE7A 5CIWA 1QHYA 2GRJA 1P73A 5BXQC 3VX3A 1E1QA 1E9AA 4BPBA 2IXGA 2GVDC 1CIPA 3B6EA 1K5DA 1W36D 2NG1A 1ZVQA 4FMDF 2ZRGA 1DBSA 4RD0A 4NCIA 1NLYA 3W5JA 2G88A 1M7GA 3C7KA 4C0QC 1BO6A 2FEMA 4D4JA 2IYWA 2JLRA 1UKEA 4L16A 2GHIA 2QTVB 1PLJA 4RD6A 2G0NA 3LLMA 2WICA 5KNCA 2C99A 2AKAB 4JJKA 2FEOA 2WJYA 1N5LA 2Q6TA 1SKQA 1KI4A 3C5CA 3Q7PA 1OE0A 2A5DA 3D7MA 2A9KA 4QBFA 2X8AA 4OHWA 2JDIA 5JECA 3S1AA 1E2LA 1IONA 1XMVA 3ZLJA 1YR8A 1DS6A 4HB2A 4B35A 4DC9A 3K70B 4RVCA 5E7IA 4M2LA 1XXHE 2D4HA 4ZI2A 1Z0FA 2XTMA 1F2TB 1ZM3A 4IRUB 5FR2A 3VHLB 1G4AE 2QMHA 2ANBA 4URXR 1YZQA 3EPLA 1Z47A 4KSCA 1ZNYA 2ZAMA 3RABA 2PCLA 1F2TA 5CLLA 2VEDA 3N2EA 1BKDR 1NVXQ 2IYYA 4E07A 4XH9B 4EQ6B 1P5ZB 4JLMA 1CLUA 1CXZA 4P4TA 1NMZA 3PUXA 5JHGB 1Q1EA 2GZAA 4IDOA 4AC9A 1XXHB 2UKDA 4XTCS 2WHXA 2X2EA 3GJ4A 1JPNA 4EQ6A 4MRPA 2HCBA 1OFHA 1IN7A 4C3ZA 2JJ1A 2J87A 2W6IA 4MRVA 1QDEA 1YRAA 1P2UA 3L0SA 3RS4A 1EX7A 1XXHA 1E9RA 3AP2A 3C5HA 3DVLA 4M53A 5FPTA 1R0XA 1W7AA 2QP9X 1W48A 1DG3A 1XZQA 4JKIA 3ZVMA 3PR1A 4GMXA 3TUJC 2F3TA 3DM9B 4QHSA 2VTKA 4MITA 2HLDA 2ERXA 3NC0C 2G3YA 2CCJA 2XNDD 121PA 3GPLA 3ZH9B 3X1XA 1RPZA 2RGXA 1Z22A 4GL2A 1YZGA 4Q66C 3I92A 5TV2A 4A0FA 1LY1A 4W5HA 4C0KA 1KI6B 2GILA 1WP9A 3ZZUA 2QENA 3QPVA 2IC5A 1KDOA 3HPRA 4UNRA 3M4YA 4AK9A 2YZ2A 2I1VB 1KI6A 1D2EA 2NGRA 4LWZA 2B7BA 3K09C 1HQYE 1KDPA 3HDTA 2GA8A 3PEYA 3CPEA 2ODEA 1F2UB 3FYHA 4JSYA 1TUIA 2ZJAA 3REGA 1VDZA 4TMVA 4AKEA 4KSBA 4M1SA 4AKIA 1Z63A 1EG7A 3PUZA 1CU1A 4YDHB 4J0QA 2XJ9A 1F2UA 1FX0B 2GWHA 1I4DD 3BE4A 4PPFA 1Z29A 1E9DA 3EWAA 5FPHA 2C95A 1G291 2W0SA 5EE0A 3TUIC 2DBYA 1W47A 3IDQA 1GSIA 4OHYA 1B0UA 2VHUA 1KNQA 2IXFA 3L0PA 4AURA 1RVDA 3EC2A 2IT1A 3T35A 1DO0A 3IGFA 4MKHA 2VP0A 4QG7A 5F9HA 2WJVA 5ELXA 4C0LA 1SVSA 2I1QA 3BOSA 4MUBA 1DEKA 2AXNA 3U3JA 3AVXA 3BS4A 1CRPA 1SXJD 4B44A 3CNLA 4XD7A 1IJFA 3WP1B 2VHTA 2J7KA 1N6HA 2O8FB 1N2CE 4TSFA 2D74A 4OK5A 1HT2E 4BZXA 2IYSA 5AUNB 4E22A 3FTQA 3T12A 1NLZA 2GCOB 2A3RA 1WQ1R 1F3OA 5AUOB 2O8FA 3KQUA 2XSZD 2ZANA 1BMFD 1SVMA 4S2EA 1YHNA 4L15A 2GCOA 1OXVA 1FQKA 1S8FA 4PZZA 4QHTA 2ONKA 3RDPA 2ZITA 1E2KA 1KZGB 1GRRA 2E1RA 1IAQA 2SHKA 4TQ9A 4LPSA 1P3JA 1LF5A 2CNWA 5EZ5A 2IWRA 3WXMA 3Q7QA 4Q4JB 1E9FA 5LDDC 4IEEA 4B3CA 3KJEA 1OB5A 2R6GA 1DTSA 1NIJA 1NVWQ 5G3YA 3AF0A 3U5ZB 1NMYA 4PANA 4Q4JA 3KUCA 5DLQC 3QEJA 1ZCBA 2IA5A 2PLRA 3IPXA 4KO8A 1NVVQ 2AWNA 4RJLA 4WXRA 3SI7A 4YC7A 1G8FA 4TZ0A 3KZ1E 1SVWA 4KAXA 2QAGB 2ZU0C 2JASA 1ZBDA 3LW7A 3RS3A 1KO8A 3A1WA 3B82A 5FTNA 2JIZD 3I8SA 4V0NA 5KOYA 2ZRMA 4WAUA 2XZPA 2V6IA 1E99A 3KXIA 2VIIA 2QAGA 4EIWA 5FTLA 5IK2D 2QORA 3OZXA 4EDHA 1ETUA 1S96A 4QGGA 4W7SA 2QU8A 4Q03A 2JLUA 2OHFA 3FHCB 3KXLA 3FVQA 4BRWA 2W2VA 3VR4A 3I5YA 3FMOB 3SZRA 1WBDA 3CX8A 1E0KA 1P2VA 2WOOA 3RAPR 2FG5A 1FOEB 5FL7D 1JAHA 1KAOA 1X1SA 1XEXB 1SQ5A 3MFYA 5K8UA 4FIDA 1NKSA 2C98A 4A6PA 2J0UB 3H1TA 4R2HA 2B8TA 4YMWA 5GJCA 2CK3A 1XEXA 3VNUA 1AK2A 3VHXA 4G5QA 5LB2A 3IIKA 4YMUA 1KI7A 4Z54A 1OKKA 4L8GA 5IDVA 2Z0MA 3OEED 4PSAA 4XWKA 3QQ5A 1WA5A 4X8MA 4MGZR 1IN6A 1UEJA 1U8ZA 3TAUA 3BB3A 3WMEA 4D0GA 1G3MA 4TWZA 2P5TB 3MD0A 1VTKA 1G64A 1E2DA 1HUQA 1X86B 5C2JB 4C2UA 1G16A 2WOJA 4QBGB 3QBVA 3CUEF 2CLCX 4G5GA 4UXJA 3ZDQA 3L2OB 4CDGA 4QKQA 5GADl 2KB0A 2PX3A 5JJKA 3TRFA 3EA0A 1TEXA 4KU4A 1KI2A 1G6HA 4FMCB 4MQBA 4PFSA 1OLOA 4DCTA 4N0DA 3KQLA 1FFHA 1G7SA 1NBMD 4LHWA 4LBVA 1VYVA 3FFBA 4MYTA 1YR7A 4DDTA 3AVVA 2EWWA 4CZ2A 3PQCA 4Q01A 1FW6A 2MSCB 2JEOA 3GFTA 1I4LD 1RYFA 2G1KA 2OCPA 4I99A 4KYIB 1R8QA 2ZSFA 2DWQA 2ZE7A 4LUCA 1PZNA 4FMBB 4TTQA 3SBEA 1GL9B 4DSNA 4MGYR 4DCVA 5EE3A 2QP3A 3CLVA 3DMDA 4PAMA 4PHGA 1KSGA 2Z43A 3W8NA 4XVUA 3H4MA 2ZM5A 4V0LA 4GBMA 1G5PA 2ORIA 3GLGE 4TMKA 3JZAA 1XTQA 2FGKA 1IBRA 1N6RA 3PITA 4LV5B 1G5RA 4C4PA 4IFBA 4PPGA 2CVHA 3FPAA 4OI1A 2J41A 2KSQA 3I32A 2QPOA 2J7PA 2V1XA 4PC7A 2CCKA 2WKPA 3V9PA 2GDJA 4NE2A 2IUSA 4WIAA 1NLFA 5HKKD 4DLTA 4GP7A 4P4UA 2XOKD 4IOJA 3SFZA 2IS4A 4IDQA 1P2TA 5AJXA 2AKYA 2PT7A 2XB4A 4KVGA 1AJEA 5TDHA 2PEZA 1P9RA 2AHOA 2EFEB 3F8TA 1RC8A 2XITA 4EFNA 5BYKA 2RKOA 4LJ8A 3MCAA 4PC2A 1T5LA 2XAUA 2QG6A 3TSOA 4TMTA 4Q9HA 3NDBB 5TY0A 2RHDA 1D2MA 1WB9A 1T9HA 3SHWA 1Q22A 4PO1A 3EAQA 1CJTC 1G41A 2WSMA 3K0FB 4MYHA 3GEIA 1RYHA 3GFPA 1W44A 1UKVY 1CR4A 1PUJA 4C0AC 4V0KA 2CLSA 2ZRFA 1XB2A 3AH8A 4I1SA 4DHEA 3GJ5A 2IUUA 2FF7A 2PJRA 4D26A 2NIPA 1XPUA 1II8B 2R6DA 3THWB 3A1SA 4QGHA 3IHWA 3SJAA 4BFTA 2EFHB 2FZ4A 2MSEB 3KDSE 4DUGD 4IXNA 4OHVA 2P2LA 1UKZA 5JSZA 1ZU4A 1CJUC 1U9IC 5JWOA 1II8A 2WBLC 4WA7A 1MH1A 3THWA 2R2AA 2J0VA 3D3QA 1A5TA 4Q9IA 5KDDA 3K0EA 2DB3A 2O8DB 4Q18A 4URWR 1DE0A 2B6HA 4NYMQ 3GEEA 4POAA 4MUAA 3K8YA 1ZJ6A 3EZ9A 3GLHE 4CEHB 2O8DA 1TX4B 2QMEA 2DWOA 5JI3E 3PEUA 4UXIA 2WAYA 4KITB 4NCNA 4TLAA 3TBKA 3EIEA 4IVPA 2REXB 4URYR 4BUJA 1I2DA 3K53A 5GJWC 3QKRB 1OH6A 3IEVA 2V8OA 4CEHA 1R5BA 5CDFE 4TYNA 3WBKA 4JLDA 4BFZA 4U7DA 1Z5ZA 2YHSA 5AR1A 3QKRA 3AQ4A 4JLPA 1YRBA 4EFMA 2I4IA 2FFBA 2V7QA 3SYKA 4CYMA 2QGZA 4A0HA 2H18A 2P65A 5HE9A 3U3MA 4E03A 1E3MA 3T34A 2FPMA 3NEJA 2GETA 4YMSA 2J5XA 2KE5A 4A0GA 2CJWB 2OZEA 3CPHA 2HF9A 3TAHA 5CYPA 3IBGA 2HF8A 3C16C 5J4KA 5JJIA 5KSYA 5C4GB 3I73A 1EFCA 2VYFA 2CJWA 5JZVA 2ZR7A 1J7KA 4N3NA 1RRCA 4EPYA 1II0A 1XCPA 1X8KA 1IHUA 3NHBA 2ZS8A 1UBCA 2ORWA 2GBLC 4IVRA 2GAOA 4YONB 5FUWA 2GCNA 4KBGA 1TQ2A 3WMGA 1GL7A 1DADA 4BLSA 2A30A 1G9XA 2ZJYA 5AUQA 3RC8A 4ERNA 5H8WA 4LJ6A 5J5CA 1ESMA 1OHHD 3QXCA 4PPNA 3PVSA 3KB1A 4BLQA 1JXOA 1N6KA 2IYUA 2RGBA 4OQLA 1Q57A 5FTMA 1AQYA 2WKRA 2ZYTX 3KQNA 2Q3MA 1H8EA 2VH5R 3A4NA 4IOKA 1E2FA 2ZJBA 4NCJA 1ANKA 4LV6A 1M6NA 2IXEA 3BFKA 3BRWD 3DKPA 3TR5A 1Q12A 1N6IA 4JKYA 5DYGA 1TPZA 5G3ZA 3AP1A 2QBYB 2H16A 1GZSA 2WIBA 3DZ8A 3FKSA 4IKEA 2QL6A 4QJ3A 1TQDA 1GG2A 2OCBA 4FCVA 5P21A 3HU3A 1AKEA 2AD5A 4L4UA 5EE1A 2ZI5A 3VR6A 1KSHA 2QBYA 4Z8YA 5H68A 1XPOA 3E1SA 5TXGA 1BS1A 4HAYA 3FMPB 1G18A 2ZS7A 1L4UA 1RRPA 2H7VA 3ADKA 5SZJA 5HTKA 3B2EA 4Q5IA 3NTUA 3V4FA 3WNCA 3TSZA 4A6XA 2J3EA 5C46F 1AS3A 1SGWA 1SXJE 4PO9A 2JGNA 2OAP1 4BFVA 3KB2A 3V4RA 3DPUA 3RS7A 1NY6A 1KKLA 3LA6A 1IN5A 3EPKA 2OCYC 2QROA 2CE2X 2QPTA 2AX4A 1QHNA 3RLFA 5EP4A 4MA4A 2VL7A 5JS7A 1IY0A 2CL0X 2DHRA 4JSTA 1YR9A 3UMRA 4EJSC 2ZRIA 4BEBA 3IILA 4GNKA 1ELOA 3R8CA 5FPKA 1EFRD 3EZ2A 2RHMA 3SC3A 2IUTA 3KJGA 3VR1A 1OFUX 2ZU6A 1S0UA 4P31A 3VU9A 3ICEA 1M74A 2QGNA 2GEDA 3B7GA 5EP1A 3ONWA 2GZHA 5CITA 5KPJA 4UQOA 2F1JA 5FI1B 1MRSA 4H1VA 3OIUA 4C7OB 4DJTA 2B92A 3Q72A 4RZ3A 4D25A 1KGDA 3E70C 2IYRA 5TB5A 721PA 3I1FA 2FN4A 3GFOA 2V9PA 4CGZA 3ETLA 5KDOA 4P32A 4LYHA 4B71A 3ZQ6A 2V54A 4I1UA 1YU9A 1DAFA 3B60A 3M6AA 1YKSA 4Y0AA 1T3LA 2G83A 4C0JA 3KKNA 4GOJA 4HLDA 5EZ6B 1E79D 1VIAA 4GSYA 3JVUA 4BECA 1Z0AA 3A1VA 1LV7A 2Q9AA 4RFVA 5EXXA 3J81k 2IS6A 2BJWA 1KHTA 4HAVA 2OUKA 3T5GA 1NG9A 1ZM2A 2NTYC 3DM5A 3M1IA 3Q3JB 3MJHA 3R7WB 4C9BA 2Q21A 3GMTA 2JLVA 5FOXA 3OIWA 4IJMA 3LLUA 2FZLA 1NSFA 2C96A 2KI5A 4RCZA 4CVNA 3FHTA 2BCGY 3R7WA 3CRMA 4Z8XA 2GZDA 2FMXA 1HTWA 2R44A 3CF2A 3SJZA 1E1RA 3GQBA 1U0JA 3UG6A 3B5JA 3K70C 3GJ3A 3IQWA 4OQXA 3BB4A 3UPUA 4WBSA 2AK3A 3CX6A 1GRQA 1ESNA 2DFNA 2P0EA 3P4YA 3QXJA 2GTPA 3P1JA 4QC2A 1UAAA 4XSGA 3OEHD 4OJQA 2WSSA 2P5SA 5KSPA 3UXMA 4URVR 1GILA 5G53C 1G7RA 5C1BA 1OIWA 1KDTA 3QNUA 1E9SA 1ZM9A 4YXWD 2PX0A 4YLGA 5J47A 2RGCA 4FWTA 4QFMA 1U0LA 5G40A 1OXUA 3HR8A 3JZMA 4Q9KA 3K9LA 1H8HA 4MRRA 1N0UA 3B1XA 3DZDA 1AKYA 1LS6A 3FGNA 3GEHA 4A36A 1E6CA 3NBXX 5DN6A 1KI1A 2DR3A 2IS2A 2P3SA 2O0HA 2GF0A 3CRW1 4HUTA 5KYKA 5GJBA 2V3CC 4D0LB 3BAFA 4IHQA 4MGKR 5JBQA 2GEUA 4JBYA 3LBHA 1TNDA 4BGDA 4B47A 4Q19A 2HUPA 4TYWA 1S3GA 4XIGS 3OAAA 1JEEA 1GNRA 1W4CA 3ZQJA 1GKUB 2Z4SA 2ZRDA 3CWZA 1YZKA 3S1AB 1COWD 4Q1AA 3LX8A 4JT4A 5TVKA 3ADDA 3BXZA 2BWJA 4PO8A 4Z51A 2VHJA 3F5FA 2QPAA 2QP4A 1Y63A 4URUR 3ZZ0A 3NH6A 5DHFA 3RSLA 3W34A 5DE3A 2YVUA 1MR3F 2ATXA 1NN1A 3W8RA 1BYIA 2QN6A 1DAIA 2WIAA 2WWXA 1M8PA 3AUXA 4XJXA 1OH5A 1W0JA 1W0KD 3CRQA 4QNRA 2BM0A 1OH7A 3AP3A 1WF3A 3G82C 1QF9A 2DPXA 2O8EB 4L9WA 1TADA 1ZCAA 3KTAB 3P20A 4LYAA 3DMNA 1IXZA 2LKCA 3D31A 5CM9C 4Q9JA 1ZD1A 3NDPA 2R9VA 2RH5A 2JLWA 1XF9A 3FFAA 2ZI6A 4OI0A 2O8EA 1QZXA 2YWHA 3ZIAD 2QI9C 1Z6AA 3KTAA 4DLXA 1KSFX 1DELA 1ZW6A 3PFIA 1T6NA 4B74A 1X6VA 3NWJA 3RC3A 4RY2A 2GXAA 1KO5A 1DOAA 3FHOA 2HXSA 1UFQA 3RHFA 1FPMA 4TQAA 4GDFA 3NG1A 2GJAA 2QM8A 3DOEA 4AYWA 2BBOA 1GVNB 4FXPA 2QRNA 1U2RA 3QI2A 3SYNA 3AKDA 4ZCIA 3AF1A 4NYMR 1VG8A 5H70A 1SZPA 4LJ9A 4IXMA 2WPDA 1IQPA 2QM7A 2WJIA 3K9GA 4HZIA 4M9QA 5AJWA 4WXPA 3THOA 5IF9A 2ZRCA 4HATA 4US2R 1CJKC 4F4JA 5J4LA 3UIEA 3OHMA 4D4KA 3CH5A 5EQTA 1VCOA 4MGIR 1A2BA 1YZUA 2RGAA 2QE7D 1TTTA 2BC9A 3DO6A 3QXSA 2J9RA 3LNCA 4C30A 3ZVLA 2XGJA 5AJYA 4ZKDA 2NQ2C 2W2TA 4ZDWA 3HYTA 4CT4B 2ZRLA 2CCGA 4OK3A 1MO6A 1AQUA 1EFTA 4ZCLA 2YV5A 2VF7A 2GNOA 4OYHA 2VSOA 3VR5A 3U61B 1WDTA 3EASA 2D2FA 1Q1ZA 1QHSA 2W6JA 3P27A 4MDEA 3KKQA 2RGNA 1KIMA 2ZI9A 3AF4A 4AI6A 2GK6A 2ATVA 4AKGA 4ON9A 2RGDA 3K9HA 3EPHA 3LY5A 2FPKA 4BFSA 3LXXA 1KAGA 3CRVA 3CPJB 1TL7C 3EIQA 1E2HA 3O8CA 1BYUA 2PCJA 4A2QA 4P33A 2ZJZA 4DVGA 2G6BA 4LGMA 2QAGC 3W6NA 4LYFA 2VP5A 4KODA 2XNSA 1TEVA 3AVOA 3BGWA 2O52A 3ADBA 1OJLA 3FDIA 2IBMA 2WWIA 5DGXA 1NG1A 2OXCA 3TH5A 2VHQA 4PZLA 5FBWB 4BLPA 1G1MA 4LDJA 3KX2A 3QENA 5G41A 2EVWX 1QG2A 3THXB 2YYZA 1E2NA 3B1YA 2REOA 2OESA 1OXSC 2H5EA 1T8UA 2JJ2D 1E2EA 5HCIA 2HCJB 1VHLA 2ODNA 1OIVA 4KFTA 4OQFA 4D81A 3KFVA 3TMKA 2CHVA 4C2TA 3QF7A 4W9MC 1F48A 3THXA 2ZQ5A 1YR6A 1W46A 5AJVB 3GCGA 3GP8A 3HU1A 4K81B 4R98A 1SVIA 4RD2A 4A2PA 5JMTA 2HYIC 1KI9A 2NO6A 2IYLD 2HDNB 3QEOA 1Q3HA 1VKJA 5DH9A 3RVBA 3WHLA 1E2MA 4R71A 2GEVA 3X2SA 3W5IA 1JR3E 1KO1A 1NI3A 3CF6R 4MYCA 3ZYCA 3TK1A 1HA3A 2BHRA 2ZXUA 4NDZA 1XPRA 5JCPA 3TSWA 2IYVA 2FH5B 1GP2A 3GJ6A 4AYTA 1JPJA 2PT5A 3KL4A 4HUQB 1G8GA 4CEJB 3UKDA 3CIOA 4ACAA 2HEIA 1QHGA 2C2HA 1IOZA 2QT0A 4HUQA 4G3XA 2BEKA 1P9NA 2WMOB 5JRJA 3ZGXA 4DLYA 4CEJA 2PMDA 1SVOA 2HT1A 1XMSA 3SFVA 5CB8A 1RZ3A 2ZEJA 3QIAA 4N0EA 2GXSA 5FUYA 5KUTA 2IWHA 1WCV1 4QM7A 2J46A 4NHOA 2D3WA 1JR3A 1TU3A 4DDUA 1T0JB 4HEJA 4QXAA 3SYLA 4Z1MD 1NNEA 4TL7A 2BCJQ 3RWOA 3VTKA 4DLZA 1OFIA 4IDHA 1OFTA 2IYZA 2C78A 2IK8A 2Z83A 3PG5A 5CIQA 2WAXA 1HEIA 2FWRA 1NF3A 2MSDB 3HWSA 2D7CA 4DCUA 5AJZA 4B32A 1E9CA 3ZZTA 5DO9A 3ZD6A 2RCNA 5E95A 3M0EA 4JL5A 5KHOC 1J8YF 1G5TA 1M1YE 5DYIA 3TQCA 3WRYC 3L8ZA 1OIXA 1A4RA 5SZIA 3FMFA 3QVUA 1G6OA 3CONA 3B9QA 1CS4C 3VR3A 1ZM7A 4U5XA 4C0BA 4BFYA 4UNPA 221PA 4OHXA 4PTLA 4K46A 2FDCA 2H92A 2OBLA 2JA1A 2QAJA 4RFSB 1Z2CA 2CHGA 2V6JA 2VO1A 2ZR0A 4TLBA 3A58B 1D2NA 3W3AA 4O2RA 3TVDA 4HLQB 3VMFA 3KQHA 3U6KA 1N6NA 3C15C 1W1WA 3OE7D 1G17A 2C9CA 4TYQA 4RFSA 3R9WA 4Q47A 1E1QD 1FTSA 2Y8EA 4DLUA 3T1QA 1RW4A 2HXYA 2JLSA 5C4MA 3TGPA 4M1KA 1ZYUA 4BASA 1TF5A 3W3ZB 4HAXA 4NYJQ 2P67A 2CL6X 3AUYA 2ZVPX 3AGQA 3SN6A 1QVAA 5E7MA 4GPTA 2BEJA 4NYIQ 2H1LA 2OV2A 3LX5A 3P26A 1U0HC 1Q1QA 2QQEA 3FMIA 4I81A 3E5HA 1G3RA 2NO0A 4W5JA 1H65A 5K8TA 3MJRA 4N1AA 1FL9A 1T91A 4JVLA 4D80A 2JDID 4EUNA 2OM2A 2A7QA 4AYXA 2VP4A 4M21A 2RGEA 4LBZA 1VYTA 2ZI4A 2UVQA 5DSZA 4DLWA 1N3BA 1GL6A 1VCNA 3LDAA 2PH1A 2HV8A 2MMCA 4B3DA 3WNDA 3K70D 4KFRA 4WOPA 2VQSA 3CW2A 5IHPA 1T3SA 2IW3A 1UBGA 4Q02A 1CJMA 1J90A 1TMKA 2F7SA 2FFAA 3GD7A 4RZXA 4TYPA 4Q1BA 4B34A 2V55B 1MRNA 3HPQA 2ZRBA 4Q7LA 4UKDA 1N25A 5GVRA 1ZD8A 4ZO4A 5KNDA 3CWQA 3KKPA 3IO3A 4PHHA 1JR6A 5D3QA 5JEDA 4IFEA 3ZVRA 3IKJA 4HDQB 3R9XA 1AGRA 2E9SA 1CTQA 1HT1E 2JJ1D 1ZNWA 3AEZA 2W6ID 4G1UC 2ZUBA 4OL0A 2GJKA 4F92B 2WTUA 1FUKA 3GLGB 1R10A 2AK2A 1E4YA 1VCIA 4DXAA 2J45A 3QKUA 1FMLA 3ADCA 1KDRA 1Z0DA 4B43A 2ORVA 2IEYA 1GRNA 2ERYA 5HCNA 4ASUA 5B58C 2YNMA 4Q9LA 3DL0A 1DO2A 2OEPA 1EWRA 3FKQA 4ZI3A 3GLGA 4TTRA 2HLDD 4U02A 4EPXA 1U8YA 4R9UC 4ZCMA 1S1MA 4TT3A 3OFNA 5FBVB 1SHZA 1XD8A 3PIRA 4LJ4A 4D4MA 4FMDB 4ZPXA 5KPDA 2IX3A 1NY5A 1UDWA 4M0LA 4BE7B 4P0TA 3A4LA 2ZSEA 1YZLA 1TF7A 2AWOA 3PCRB 3IUYA 4XWOA 4W5WA 3U2QA 2PLFA 5JSZB 1AN0A 3GLFE 3AVUA 4L5BA 2OFXA 3OF5A 4JBXA 5CJPA 4LJYA 3TW8B 2IYXA 3ASYA 3LV8A 4IOMA 3SOPA 1CEEA 5FPYA 1W36B 1CJVC
chains in the Genus database with same CATH superfamily
1E2QA 2O2EA 3R3VA 3H9GA 3QG1A 1YIOA 3OO0A 3NV9A 2ID4A 3L9WA 4FEYA 4HQ0A 4WUVA 4EJFA 4ZOCA 3L8EA 2DU8A 1AUPA 3R8XA 1G8MA 3PD0A 1LQ2A 4NE9A 4XW2A 2O2DA 3QEKA 4N12A 5DISB 2BFPA 2M98A 3EDQA 4QXQA 4Y2UA 1DGQA 3MEQA 1Z6GA 2CUTA 3NOOA 1IWOA 1E7YA 1MJGM 3KB6A 5CLGA 1KY2A 4DF3A 5G4LA 1JKXA 4BNXA 3RVDA 2FJUA 4RPJA 4YVFA 4IIHA 1NMXA 1X8LA 4A9AA 2XNCA 4EW1A 5DBEX 5DGTA 2QE6A 3E4DA 3LPCA 4NI5A 2OQVA 2IHYA 1IXSB 5JXWA 3BH0A 2B8WA 3LJKA 5CVJA 1N5IA 4BZPA 3P9YA 1P1BA 2J0EA 4PICA 1W88B 3BGSA 2R6FA 1RS0A 3QVGA 2QZ9A 4BDSA 4LHYA 1YIDA 1WOYA 4KXFB 2NT4A 3DMPA 3RKSA 1BEUB 2IPXA 2QZ4A 3H2HA 4XD7D 1VSUA 5F1PA 3TZEA 2QI9F 2R62A 4TS1A 3GZJA 2OENG 3Q7RA 3QKIA 3IRUA 3KG2A 4J3FA 1W88A 1JXMA 1Q1GA 2D7JA 2D0DA 5FHQA 1XWWA 4EAQA 1Q14A 3A6HA 3F97A 3F6EX 3TI7A 4Z9BA 2E87A 1MNQA 1CB0A 2LNDA 2ZLBA 3WY9A 3HYSA 3CVWA 2F43B 3JTMA 3DS8A 4UUAA 4CG1A 3H04A 4JHLA 5CDHA 4ETMA 5ALVA 1C8VB 3AEQB 2QTFA 1YHZA 4LVUA 4UUQA 1HE2A 2JH8A 1ODFA 2I9KA 4GOND 2F43A 1A04A 1MORA 1R5NA 1D8TA 4G1FA 1V3VA 3F7OA 1W96A 1OJ7A 1WZ2A 2IOYA 3AEQA 4Y2YA 4INZA 2OB2A 2XBUA 3X1MA 1D9XA 1FMJA 3HH8A 1QO7A 4DLKA 2EQBA 2R8RA 3E5NA 2JFNA 1A9RA 1SKYE 1TLFA 3FZEA 2Y05A 3CNOA 3OF3A 4JIGA 4OIFA 2W11A 1XYGA 5HG0A 2HU5A 3GG9A 4ZCQA 2AB0A 4ZCSA 5CDSA 1QVWA 1PLKA 8ABPA 1NVUQ 2EX0A 1O9GA 1XLTC 3B1WA 4LYDA 1CZLA 2HL6A 3D6AA 4EMUA 4MV4A 4TTPA 1CZOA 4JOCA 1RHKA 1PWHA 3A11A 4AVYA 3BJIC 2ZRHA 2Z4TA 4H08A 3ZJ5A 3G5AA 1F2VA 1ISSA 2ODPA 1O77A 3HXKA 5HK8A 4ZEXA 1JPVA 1TF2A 4LHXA 5T3UA 1R6VA 1VCMA 4X6LA 5KNCH 4AJOA 2XNDA 2GD2A 5ULLA 1MQ9A 4XPIB 1AA9A 1IN1A 4FHCA 3NHWA 3DP9A 4JYZA 1BWPA 4MXDA 4BX0A 5F3DA 3H5OA 1KYIA 1SZDA 4CT5A 3ESBA 5HRAA 3FPJA 3PZBA 2QD4A 1FDTA 3AY3A 4PONA 3FSGD 1LTQA 1U7ZA 4XPIA 5EINA 1ZGHA 3E9ZA 3ZI0A 2RHTA 4EYQA 4XX1A 3QIVA 5HX7A 5FUBA 2PMCA 4YDRA 5DFAA 1EDZA 2HMTA 2HF2A 2QJTA 4YPOA 3OFKA 5KYYB 3VR4D 4DPLA 4OXQA 2B7CA 5K4AA 3PHJA 5FCDA 3UNXA 1CETA 2C4HA 3ZWWA 5FKJA 1ML3A 2Q46A 5EJ7A 3MHTA 4HV4A 2JD1A 3IA2A 2RHBA 3ENKA 4RD4A 1NR5A 3E9YA 4YRCA 5EMHA 3KTFA 2I3ZA 2FE4A 3OQNA 3QPCA 5KYYA 4HGZA 1NX9A 3IB6A 4CDNA 3FPSA 3UJPA 4HLUA 3ZN2A 4D99A 5KTYA 4GMFA 4A0SA 1MV8A 1RR6A 2H9IA 2WZQA 4P7JA 1EE9A 3UQZA 3RYFB 1LW7A 1JV2B 1QH9A 4NKRA 1KEKA 1NVVR 3GXBA 3IP7A 3KFLA 2IBSA 4IZHA 4LN1A 4DLLA 1ZK4A 2QR2A 1DAEA 2IYTA 1XSEA 3RYFA 5IJ9A 2JZCA 2QL7A 4H4DA 1VRWA 1Q44A 5EESA 2GPSA 1KZHA 5FPSA 3BCSA 1H0KA 4MA0A 3RRYA 1S2DA 1NR1A 3GX1A 4J91A 1N5JA 1WXDA 2WM2A 4JJFA 4RE5A 3ZWNA 5B2FA 3S81A 1YE3A 2CXNA 1GFIA 3X1DA 1UJ5A 1E9EA 5FOWA 2C58A 4M6WB 1MV5A 4MHOA 2L0XA 1MDBA 4AMUA 1XTTA 3WB1A 3WLPA 1ZSNA 2FQWA 2AI3A 4Q4HB 2OC9A 1YWGO 1K66A 4IXTA 4UMDA 3SBDA 1V8OA 4LXHA 1S4QA 4M6WA 1RBZA 3BN3A 1D04A 1WR8A 1IXRC 1DNPA 2H0QA 2HWYA 3DWIA 3P0HA 3ONNA 4RSRA 3ZCXA 3U7FB 3ZGOA 4G41A 3NFRA 1JAIA 4J8PA 2OP0A 1BMFA 4Q24A 4Q4HA 3KKLA 2R47A 4XWAA 5KWSA 1A1VA 1T4MA 1E0AA 2P5YA 5BOSB 2Q1XA 1KYXA 3OWOA 2CLKB 3TVTA 2P2ZA 3GBSA 2H07A 3RIGA 3INGA 3AKEA 3FNQA 3TQRA 4BO1A 4AO8A 4FW9A 1DWQA 2FPLA 1WXHA 1OPXA 2BW0A 3QHAA 4NX2A 1TCUA 5L7TA 4FHDA 3ZDCA 2JVIA 5BOSA 1BDMA 4WADA 1ZCZA 4PZAA 4QECA 3NGMA 1C1DA 5HM8A 3GQBB 1ZUIA 4EGFA 4O2BB 1CY7A 4CUKA 1QO9A 3S8MA 5F3WB 5FR1A 4ZV9A 4FMCF 1FFXB 4G4IA 1DAPA 1T5OA 3U81A 4CMEC 4JVMA 3DZFA 2J7PD 5BUCA 4OKSA 2KLBA 1XV5A 2VRWA 4O2BA 4BGVA 1ONSA 3K9NA 3HLYA 5EIHA 5ILGA 4JDPA 1FFXA 1UQTA 3W5VA 1S1CA 3B6KA 2NPFA 2YJ4A 1XVVA 1YAJA 4BGUA 4BO7A 4IV8A 2WV9A 4OX9B 3VKFA 2A9PA 2WG0A 5IH3A 1KU0A 3GFVA 4R1QA 3R7AA 3TZKA 4BEJA 4UTOA 3OX4A 1E2JA 1JXAA 2QG4A 4GI3A 4KWHA 2A9OA 4LSWA 5FLKA 1Z7BA 3HCNA 1JR2A 4AY2A 3ELBA 2CDAA 5FL3A 4RXTA 1A9TA 4OGGA 3UJCA 3DGEC 1EP2B 4PLTA 5DXFA 1IPEA 4JC4A 1ZNXA 3CA8A 2WU4A 3GIWA 4GYJA 2KJQA 4MVJP 1YQTA 1F8XA 3H5WA 5CM8B 5DIFA 3X1ZA 1ISJA 2WT9A 1K5GA 1NP6A 2GVNA 2PS1A 3T5DA 3DYBA 3CG0A 4GLBA 1IMOA 1YL5A 1LSSA 1I1QB 1I4EB 1VMDA 2PFKA 2WKQA 4ZAGA 3K0CA 5FTKA 3LYUA 3TCXB 4AY5A 2XCRB 1K8YB 1J23A 2ZATA 4YJKA 1JHZA 4IS2A 4Q3NA 2C4NA 4DAEA 2WJJA 2GCEA 2C04A 3WRXC 3H6KA 4R8KA 4PWYA 5HZGA 1V26A 1PFGA 1KFCB 1PNOA 1VP9A 1E6UA 3D0OA 2ZJ8A 4X6YA 4B79A 1T6ZA 3F46A 4UBOA 3OTHA 4LDZA 5FI0B 4ZTBA 3A6LA 3ICCA 3CZQA 3NAQA 3OEEA 2H1IA 1I1HA 3C3CA 1X7ZB 3IP3A 3WAKA 4AECA 1IU9A 3PWKA 4EYOA 1MW9X 4YYEA 4Y0VA 3WYFA 4HN4B 4N3GA 3E9NA 4DZTA 4IEIA 1E77A 1USKA 5EP3A 5MHTA 1Z56C 3P7MA 1VB5A 5KSOA 3QOWA 1X9GA 2DUJA 4BWVA 4GR4A 5ENZA 3ZHSA 1E4VA 3QBDA 2Y2UA 1ZUHA 4CLOB 4HVCA 4RK4A 1W8DA 2A35A 2TSYB 3NWOA 3N2GB 2ZYSA 4TTVA 5DMXA 2TMDA 4QTZA 4FFPA 5JWRA 2N3ZA 5ADWA 2XF2A 1ACJA 2EJCA 1GKLA 3D4BA 3FFWA 3QFHA 1SQ6A 4KN9S 5GVSA 1JZQA 3L7NA 3AIKA 3OSUA 4MW0A 3TB4A 4BQQA 1JQ3A 4C07A 4CLOA 2O3TA 2FY8A 3OA2A 3DE5X 5EKXA 3N2GA 3GA7A 4QLOA 4MI6A 4B6OA 1D2HA 2Y6VA 4RCYA 2VTBB 4MAAA 4QUAA 1E2IA 4PZYA 1XO1A 1P7CA 1BOFA 3HB5X 4GR5A 5FAKA 3W5CA 4BFWA 5EKTA 4JI5B 3WBJA 1ZSVA 4ARSA 3LTNC 3NHFA 1TTPB 2UUCB 1ECCA 3QUAA 1N7HA 1YFKA 2VTBA 3D43A 1PK7A 1AO0A 4DB2A 1E8MA 2ZRJA 3HL4A 3JQGB 2EOAA 4N5MA 1RXYA 4L9SA 5EXTA 1TT5B 3L7IA 3Q5EA 1Z0KA 2ZDHA 3Q3CA 4PC1A 4Q1DA 2O0KA 3BE6A 1SXGA 2EJUA 2HMYB 3LFUA 1QGDA 4PZPA 1XDGA 3P0EA 4NJOA 5FOTA 4B73A 3EFOB 3JQGA 2OHGA 2O2JA 3IA7A 4LKRA 1BROA 2DPHA 1TT5A 1RRFA 1HH4A 2EGHA 3EVDA 4ZI7B 4WZBE 1UZNA 4A03A 1VLJA 4MUHA 3WHKA 5B3JA 3EFOA 4LHSA 3T41A 1GDHA 1JQLB 3HVUA 3EQ6A 2M1XA 4ZI7A 4J2OA 3TVDA 2ZGVA 4KYUA 4B87A 1RVV1 1H85A 2I4NA 4U9IS 3LAWA 3TQSA 2A5YB 3HXOA 2QLFA 2B61A 2VDOB 3KQKA 2AFIE 2JJ8A 3UFBA 5AW6A 1UDAA 2UDPA 4ZO8A 5LNK6 4JJ6A 5FFMA 1A69A 1UPAA 3O2SB 3Q6NA 3BM5A 3X2FA 3L0IB 1UINA 4D82A 2GA9A 3SNHA 1Q3TA 4QEZA 5JSFA 2X8WA 4KV9A 4XVQA 3PCXA 4UNNA 1C50A 2DUNA 5IUKC 3EQZA 4DCSA 1F1BA 2O2HA 5L4SA 1U1DA 4KUEA 1FU8A 3W4IA 1HWYA 2VZ9A 4PXAA 1I1OA 3FGZA 4HCJA 3FKSD 1DZIA 2H29A 3NTRA 1EWQA 1VLHA 3MYYA 1OXTA 2Y1WA 1F9AA 1QRRA 1XAJA 4HXYA 3Q9LA 4J29A 1MKYA 1N2JA 3HDHA 3QPAA 1Z2DA 3DMTC 2XNHA 4MQFB 4RLFA 4X71A 5TVGA 3VR6D 2NPIA 3ITKA 1UZLA 2A92A 2ENWA 2GKOA 4LKOA 1F1JA 1KS9A 1MX1A 3GGJA 4NMHA 5TQVA 1EHYA 4MQFA 4AL4A 4CJXA 5EWMB 5UKDA 3IMEA 1P8AA 3PUWA 2X0FA 3N1UA 3RYTC 4XTRA 1W9MA 1Y7LA 4H6WA 4DUGA 4F2PA 2BMDA 5JJLA 4UBMA 1D1TA 4ALLA 3C74A 2JI8A 2VUUA 5JVDF 2QTCA 3IL2A 5EWMA 1SUSA 1OX4B 3GGSA 4H6XA 4WL0A 5I7OA 3ELDA 3NBYC 1WB6A 2IPAB 5F33A 1S6YA 1E3LA 1V8ZA 1GGJA 4GXRA 4ALIA 5B64A 3Q9NA 3C43A 2J5KA 3QY0A 4AJ4A 3RS7A 5IBQA 1F6DA 3ZJTA 1VXOA 1XX6A 1OYYA 1HYGA 1OX4A 4KRYA 4R2KA 2EBUA 3ROPA 5BT8A 3MIZA 2V97A 4IJUA 4IJVA 2H65A 4N65A 5F3RA 1GSHA 3ND5A 3VSEA 2ODQA 1TMYA 1Z6TA 4P7KA 2GM9A 3VU3A 1W36C 2PUCA 1T4GA 3AR5A 1WZIA 4NICA 2F4NA 1S9HA 4WEOA 5CH5A 5K0BA 1C0KA 3H0KA 1ZMRA 5EAIA 4EYEA 1QQ5A 4AZTA 1W5EA 4O0LA 2NQ8A 4DRXA 3PE6A 2YMPA 1CR2A 1FXUA 3E58A 3LOPA 5BQFA 3H87A 2FOLA 1OXBB 1E32A 1R4ZA 2CY0A 3LBIA 4FB4A 5EN4A 1FVHA 1IHPA 5FA5A 5JAPA 4CKZA 2ZAOA 2I1WA 2WYHA 3MWYW 3DWEX 1ZMXA 3U9SA 3J7TA 2GAJA 2OLJA 5K8IA 4YWJA 1FLVA 2ETXA 1XA4A 3KOOA 4XEUA 3WIBA 5E3IA 5LCXA 3VZQA 4LCBA 5IAOA 3TKAA 4JI4B 4L1KA 5L51A 5BW5A 3LWDA 3UK1A 5DX8A 2CV1A 4JGBA 2WJGA 2DH6A 1RBQA 3OJXA 4QVGA 5J59A 2AOWA 1CR1A 1X7GA 4BO8A 2MJLA 2UXDB 3D59A 1E6MA 1LPOA 4EFLA 1GNVA 3C14C 2IDJA 2ZPTX 3H16A 3PGMA 3BIOA 4A82A 2IDZA 4PIPA 1GTVA 4F84A 2P7IA 2IZ1A 4LQ4A 5FQOA 3MB5A 1DO8A 4ML3A 4OREX 3AVQA 4G0NA 4RMNA 4XUCA 1I80A 1XLUA 2HGSA 3ZOZA 2V1UA 1RWMA 3KOXA 3O3CA 3ZKWB 2H31A 3L0OA 4N03A 5FOUA 3AM1A 3SQLA 3FRHA 3OUZA 3WQQA 1J22A 3IODA 3DD1A 2Z2JA 3MQ4A 3OU7A 1QLHA 3PTAA 3NM6B 3H5NA 3ZKWA 1Z0JA 2EZ4A 2H2HA 1KFEB 3BRWA 5H83A 4PGMA 5LA6F 5DHRA 2O3QA 3UAWA 4EG7A 4MKGA 3VH2A 4QJ4A 5HEKA 1ZEJA 2UXCB 3UWDA 2ZOSA 1J09A 5EYPB 2JK0A 3TQFA 4CM9D 3E9EA 5E3HA 1W5SA 3T7EA 4BJ5A 4UQLA 2ZWPA 1Q17A 3WGIA 5CLFA 4QM6A 2NTJA 1RZUA 2C29D 4DZZA 5AW3A 2EFGA 1SVUA 2BFBB 4HWRA 4ZPJA 4JC8A 1GPH1 5EYPA 3ZNOA 1YFJA 5DK4A 2GTHA 4IYRA 4CXMA 4ZV7A 2EFDB 2O3RA 4MCJA 1D0SA 1P2BA 4UHEA 2D13A 4HEQA 2Y0DA 3WYAA 4BQSA 3E5MA 4AF7A 4MP3A 4BNUA 4BVHA 2EIHA 4D0RA 2BFBA 1QGYA 4BKPA 3U26A 1U8AA 2GZ2A 4MOWA 1KK1A 4CM8B 1PI3A 2EBFX 2OHXA 2Q0HA 2ZE8A 2Z8YM 1TQ6A 5DI3B 3ZC3A 3ZHTA 3E22A 4BLOA 3PCTA 4HMQA 4UE3S 4H1WA 5KTKA 5HUJA 5JZBA 3BWYA 2PKWA 4O5OA 3ZV6A 3RS5A 1C8BA 4HAZA 4LJLA 1GZVA 4LRSB 2YZKA 5EJGA 2BGJA 4C5BA 4CM8A 1U7WA 5DI3A 4PGGA 1YR1A 4WLNA 5C32A 2VSXA 4US0R 3MRSA 1EGMB 1SHTX 1Y33E 3DEAA 2HA5A 2NN3C 3KRTA 3LXRA 3OAAD 4INAA 3WG9A 4R1UA 5REQB 5A06A 2J0UA 5J40A 4BP3A 3CLKA 1QBGA 4BJ3A 2W2LA 2G71A 4MYSA 1NBHA 3IVRA 3ZXXA 4EPVA 4W9RA 4NNOA 3LO5A 1JHXA 4X8LA 5REQA 2AOUB 3WL3A 1GPNA 2NUPB 3CT4A 3GJXC 3N6VA 4BOYA 3DOFA 1MEEA 3MWJA 4R0MA 2CHQA 2AVDA 2PKRA 4KQJA 5ILQA 4DOMA 1EZZA 2ORED 3H2GA 4ATNA 2AOUA 2XD4A 3W9BA 4YI5A 3ZNNA 2NUPA 4H1TA 1TRHA 1AKWA 4B3JA 1Y9DA 5AM0A 1J70A 4WBNA 2BVNA 1ONBA 1KO4A 1Y5NA 4QJ5A 3F9CA 4QODA 2R1TB 3STXA 1VKHA 3EARA 3K9QO 4PRKA 3TLCA 3ZXUB 3ZHRA 5M04A 4KREA 4BL5A 3BWBA 4RV4A 1FX1A 1J21A 3WKAA 4UTVA 3GW8A 2BE7A 2IU0A 4FGUA 3V48A 2VNSA 3JYQA 2YZNA 2VXBA 3TLAA 4KIWA 2R1TA 3KEOA 2GJ9A 3AIOA 3R0VA 3QTBA 1DUSA 3I4LA 1N5MA 3LPMA 3KD2A 4XGNA 3INRA 1G3UA 4EP1A 2B7LA 3AG6A 2GXQA 4JQZA 1UK9A 4KJZA 4LXQA 2JLQA 3E0XA 4R8MA 2NNLD 4QL3A 2Q4DA 4H60A 2K6GA 3G0BA 4PYKA 2KBFA 1DJQA 3UO8B 2VRCA 1Z28A 1EX9A 1P91A 1T2DA 1V7ZA 3IIJA 3QPUA 9ATCA 4DBLC 2DUWA 4LXGA 5TPZA 3L7OA 1R8XA 5FBHA 1D9ZA 4NHEA 1HNXB 2O0LA 1YO6A 1XI2A 1Z17A 2QQGA 1YMUA 3RRBA 1W2HA 3AF5A 1AGYA 5CD1A 5I9LA 1YZTA 2PANA 1S8NA 1W85B 2WMNB 4OVKA 2VP9A 5LQDA 1CX9B 1OSNA 2BTOA 3U7GA 1BG6A 1UT5A 2F62A 4QYXA 3ZW8A 2C3UA 3RR2A 3S2FA 3FTNA 4GXQA 4NL4H 4HZUB 4IFIA 4AG6A 1N5RA 3OEHA 5JNUA 1W85A 4WGGA 1K0UA 2FZVA 1X74A 1SVKA 5DK6A 1I3OA 3JXEA 2XUAA 1GFZA 4EUSA 4ZJPA 3W6OA 1S2IA 1RCUA 3PC3A 4FYKA 1ZQ1A 3FNFA 4HZUA 3WNZA 3UJNA 3NXKA 1XCOA 1P1JA 3T4EA 5JOQA 5BN3B 1KY3A 1FNMA 1GAJA 3GLGA 2VN8A 3IDOA 4YT5A 4BDTA 3I61A 3NC1C 3KAPA 3RU7A 1JALA 2GEKA 4PLWA 1E1NA 4FZRA 3QEAZ 1H6AA 4MZXA 4ABYA 3S0JA 2WWYA 3I58A 5HVNA 3C8UA 1GG8A 5BN3A 5HIKA 4QYMA 5JJBA 3GRPA 1A7UA 1QK5A 2RH8A 3BDAA 3DDCA 4RKFA 3PQ8A 4FYPA 1RRGA 4OQYA 1LLFA 1M1UA 2GXUA 3K0FA 3P8ZA 2B2CA 2JANA 2JLXA 3TX6A 3PHCA 3KZNA 2YS6A 3H13A 4YUWA 4YK7A 5EIBD 4OIMA 4BBZA 5JMWA 2F6RA 2I34A 5HQ3A 2WYIA 1QYCA 5DM0A 1HFKA 5K3FB 4V1CB 1PFVA 3G7SA 3MPOA 3LK7A 3IQHX 3HKCB 4LZLA 3JYOA 1PLLA 2HK8A 1I2BA 4KQMA 2QVLA 2QKYA 2HC9A 3L6DA 5CRIA 3EX7C 1IBKB 2NZUG 2B98A 4LC0A 5K3FA 4V1CA 3ILSA 1W1UA 3EF0A 1R27A 3DVAB 1GQ2A 3NX4A 3OT5A 4JROA 1O0BA 1MUUA 3HKCA 4GPBA 3E48A 1DXHA 2ET6A 1E3JA 2ZI7A 3FUUA 4WOJA 1F8GA 3G0OA 1S5PA 3U9LA 1M3SA 1X94A 4WLOA 2A5LA 1QVVA 1IMJA 1U9JA 1W0KA 5FOSA 3ER9A 4GI7A 1BXGB 1M66A 2QIPA 3D6UA 3GROA 5JCJA 3WI7A 1W1IA 1EDDA 2H4WA 2O57A 4HLUC 4ENQA 1C3EA 5BNZA 4BBAA 4PM4A 2BDTA 5A3SA 3VR2A 5I9IA 4I4LA 4FKBA 4HJRA 2ZXFA 5BN5B 1M2OB 3PIIA 3PRJA 4BFXA 1Q0UA 3ULKA 1BXGA 2OT3B 4KAFA 4XIIA 4OG2A 4UBIA 2I67A 2PWYA 1UBEA 1P81A 1RM0A 4TMWA 2NZWA 4Y3UA 1PP4A 2VNKA 4DJAA 3NALA 4P80A 4KOEC 1NKTA 3QVOA 2B9VA 3VZDA 5BN5A 1K9SA 1P72A 3ORSA 3NORA 4W1RA 4ZQCB 2ZUCA 2H57A 4FCTA 1P7VA 3KJQA 2ZRPA 4E7OA 1NX6A 1R0WA 6Q21A 2Q9CA 3BEOA 1UL1X 3O38A 1KJNA 3O1LA 3ZTTA 4E3ZA 4NY1A 4XGKA 1DKMA 2FMKA 2J5BA 2OBBA 4OBXA 2FG7C 1ICIA 2W00A 3T7CA 3ZJ4A 4D9EA 3RSOA 1ZVJA 2QTNA 4AO6A 3CRRA 1B2LA 2B4KA 2R87A 3CYFA 4I9FA 4ZGBA 3BIJA 3CH4B 5D7NA 2JLZA 1QKKA 4RC9A 3LGAA 3ZS8A 4KLRA 1RWNA 2F1IA 5DM1A 4G5YA 1Y48E 3C85A 1GIAA 2F48A 4Q4LA 3TOCA 1VYUA 1F51E 5H81A 4ZDJA 3HCBA 3MLAA 1YZYA 4FYWA 2R84A 1G2OA 2BFAA 4JHXA 1N3IA 3AY0A 1J49A 4UTPA 1MT0A 2FVXA 4NZOA 3F5QA 3WLAA 1LDEA 4INJA 2PMKA 3RI3A 3E7WA 4LZZA 4PZ9A 2JJYA 1XZBA 5SZHB 3C6XA 4I46A 4QXPA 4Y2TA 4JFAA 4ETNA 1WULS 1V9CA 3FTPA 2Y1OA 3UATA 3WOVA 1RYYA 4WN9B 2CXTA 2ZIFA 3H86A 5F2KA 2LZ0A 3JR3A 3Q3HA 3INTA 5M5BA 1UADA 2PGOA 2AZDA 3KEQA 2E5FA 3P19A 4ZKEA 2BHTA 1JJAA 2CHEA 3MWKA 1BD4A 1LX7A 5HTOA 4WN9A 2OK7A 2XKJE 2IZOA 2M6SA 3VVBA 5JW6A 2CDNA 2WFLB 4R9RA 1RAFA 1Z26A 3BSWA 3VR3D 4E5UA 1YRYE 1XNJA 1L4YA 4KC0A 5E7JA 5LB4A 1IUNA 3RFVA 1OLXB 3BXOA 3NHZA 5GPBA 5IAAA 4BLRA 1IWBB 1P4SA 1CUDA 3UV6A 4B6RA 4DA9A 4KR2A 1I8TA 1UM8A 3FBTA 4QIHA 2AXPA 5ESRA 2PSEA 5K8LA 4Q21A 4BQEA 1OLXA 1IAVA 2DCUA 2WJHA 1KEWA 3EGEA 3KYCB 4S1PA 4BLVA 3VNVA 1OYWA 2BSXA 4IYJA 3V7YA 3W2FA 1FFGA 1JU3A 1N0WA 2WB4A 2XGOA 1XZMA 3NB0A 2BI4A 2H1HA 5AW4A 1DMRA 5EOVA 2V7UA 1XBTA 5KX5B 2PXCA 3VX4A 4JYAB 3TPCA 4Z53A 3PLAE 2OP1A 3NUZA 4WEQA 1Y9EA 4WZAB 2XE4A 3W8FA 3K3PA 3DTTA 3NC4A 3UOGA 1OGJA 1WVMA 4RLHA 1EDEA 3VU0A 3TUZC 4B4VA 4CIAA 1EK1A 4HNTA 1AKVA 3NFYA 4JYCA 5BQPA 3T7IA 3G9ZA 4JL8A 1ZD4A 4DW8A 4R2XA 5JFGA 3AR4A 3A25A 3K0CC 4WZAA 5CW1A 3RFXA 3C8ZA 3FYCA 3BHIA 5FXMA 4D2IA 4QZVA 3PFGA 4D57A 3NPMA 2DFLA 3Q40A 3T1VA 3CO5A 3HM2A 4B48A 2UUBB 1T0UA 1JHPA 5JAHA 1NWHA 5DP2A 2QM0A 2Q3FA 4GIBA 1P0IA 3QFRA 1AX9A 1PZFA 3ZU4A 2XQIA 3DWFA 2EGUA 1C7JA 4JX8A 5KCMA 5B58T 2W4IA 4EY8A 1BE1A 2AHRA 3CN7A 3K16A 2HREA 3LPDA 3CR7A 2D5AA 4KVAA 3VR5H 4EGAA 2AXQA 2AZMA 3GLIB 1CRQA 1MIOB 1GCIA 1NZFA 3P9ZA 3UENA 4GKBA 1HOXA 8LDHA 2BR5A 2H1VA 2HFKA 2VQ3A 2CVOA 4PBRA 5G0TA 4X1IA 2BM1A 1UJCA 4ZHQA 3TFWA 1JU9A 5JROA 2Y99A 3MMSA 4E31A 3QPWA 5DMHA 3GLIA 1PQPA 1WPRA 3P45A 1L7VC 3RFCA 1EA7A 3P2IA 1L5OA 5IVHA 4CGZA 1D5CA 1OXXK 5GP1A 1B6TA 1NJGA 2EP5A 2XWJI 3DOJA 3LHKA 1R2QA 3V3TA 3AESB 4D6XA 4TWJA 3F2IA 1GLNA 3NGLA 4NYJR 2P30A 5JNLA 2JD0A 2HMSA 3WLKX 1J99A 2BMFA 3NWBA 2WABA 2HCRA 5DBGA 1DVRA 1RXIA 1JYSA 4I6GA 4YBRA 5EXSA 3X0DA 2OLKA 4RD1A 4JLKA 1HTBA 3SEAA 1ZSYA 1ZH0A 4AM8A 4FZ5A 4IEFB 4MLZA 1E92A 4DZRA 1MIHA 1ABEA 1U2SA 5F9MA 4GSKA 4V0SA 2IF0A 3NEYA 4QHYA 3UXHA 1QKIA 3GB9A 2YNMD 2WD9A 1KVUA 1TOAA 4MHSA 3AK4A 4TTJA 2IKSA 4YCDA 3WWOA 5FFFA 4B82A 3B38A 3FFXA 4OLJA 1V3TA 2YVKA 3BK7A 4OLBA 1W6UA 4BO2A 4M9ZA 1SHKA 2XDWA 3BRCA 3FW1A 3RHTA 2YV2A 4XOIA 3PPWA 2XUPA 3HYRA 1CQIB 4GICA 3GMIA 3GH1A 4FZJA 2OD2A 2VBCA 4I55F 3ML1A 4MS4B 4DSTA 4RTKA 1MX5A 2OV6A 5JLJA 5B3JC 2YX1A 1XPJA 4BNVA 3H75A 1SH7A 3L1UA 1NXTA 1SBZA 4I3GA 2Y2VA 4QPCA 4EPWA 5CIYA 5TQ0B 1CQIA 3OLXA 4ILEA 3KOYA 4FUQA 4X97A 4J94A 1YZNA 1J9ZA 1L9XA 4F6LA 5CA0F 4MS4A 5CUQA 2PG3A 4PLFA 3L84A 3OVMA 3OESA 3N75A 1ZD2P 1NDUA 3I5MA 3AUAA 4R0NA 3ZGZA 1N6PA 3GVHA 3Q8MA 1FP4A 2QXTA 5BSTA 4BZQA 5TQ0A 1E9VA 5CIWA 1YQ9A 3RUEA 3WR5A 1P73A 4MROA 4NAHA 3EDYA 3EDOA 2WU3A 1TRKA 1ZVQA 4Y2SA 4V3CA 1WVGA 1MZPA 1DJLA 4K87A 5DBIA 3W5JA 1JKIA 4RVUA 5CG2A 5HOQA 1Y81A 3RGGA 4EF4A 4K1XA 2C5BA 2VCHA 2DHQA 3S68A 4D4JA 2HO4A 4NNPA 5I9NA 3A6KA 2XOEA 2AKEA 2JLRA 5CFMA 4F8JA 1VLZA 4Y67A 1MOSA 3BE5A 3VC7A 2G0NA 1SEPA 4CTKA 4L5CA 2AKAB 2FEOA 4KYVA 1JL3A 2OM6A 1W19A 2GMWA 2WJYA 4WOCA 1A96A 1RWPA 5BURA 1ECPA 1T2FA 2CBGA 1OE0A 2CJYA 2HRBA 4R3WA 3G2NA 3D7MA 3Q3IA 1PQWA 1CZNA 4QBFA 2D59A 2V7VA 2JDIA 2X58A 1SQFA 4E15A 5T6MA 2ID7A 4J49A 4YRPA 2FDRA 1E2LA 5AHRA 2XYGA 5KYVA 3ZLJA 1U04A 4KZKA 1BAPA 1X1CA 2J67A 4RVCA 1R66A 2AT1A 2R4TA 3OX3A 1HO3A 2B78A 4LNUB 2QMHA 2ZT8A 4P4GA 5T8KA 3UK7A 3BKXA 4URXR 3EPLA 3IE1A 2HH9A 3L0CA 3IDZA 1EFPB 1L5FA 2G9ZA 2VH2A 2ZAMA 5CCBA 2PCLA 5BSEA 1BKDR 4E07A 2VDRB 2WFMA 3B2NA 1MXFA 4FHFA 1J8FA 2MR5A 2IGTA 1WW8A 4UHBA 5A04A 1WCXA 3WGUA 1FQOA 4P4TA 1EFPA 2ACEA 2VZ0A 1Q1EA 3PLNA 4LWOA 4YUXA 4C08A 2HIAA 4PCVA 5E6RB 1FSPA 1PJZA 2X2EA 2RI6A 2D1SA 2GOYA 3W5DA 3OLVA 4L9RA 2JJ1A 4MRVA 3M5DA 4P58A 2CGEA 2DH5A 3L0SA 4MB6A 3RS4A 2MTBA 1A8IA 2P40A 1GRVA 1W73A 3C5HA 3FAKA 2OBXA 4ZVLA 2YIVX 3K32A 1XN4A 1SXHA 2O8VA 3QWAA 1RLUA 3GDWA 4OYRA 1CQPA 4PG5A 4BMNA 4GMXA 1EJ2A 2G76A 3G89A 4MWBA 4MW7A 4QHSA 3TJRA 5FUQA 4MITA 2HLDA 5IW8A 4D9MA 5LMNB 4OQ4A 3PHGA 4NXNB 3E3MA 2N75A 1RPZA 1YZGA 2EKQA 1ZESA 2FMFA 1P3DA 1FRQA 1H0RA 1LY1A 2W6CX 2V98A 1XU9A 1KIAA 2E6KA 1OBOA 1J0EA 2AFIB 1W2WB 4B8ZA 1FJHA 5JU6A 3G49A 2R68A 4K5QA 4TVBA 5AMXA 4BNLA 4YR9A 4IO1A 4UNRA 1A4IA 1L7QA 3M4YA 1XVIA 1XZAA 3HKEA 1O5OA 4FGKA 2VAVA 3PWTA 3BQNB 4MI9A 2AFIA 3PXCX 2V7WA 3PXBA 4QYTA 3OKAA 4R1MA 3KV1A 5AVSA 3VH3A 4HWTA 1Q5PA 1SUCA 5HW0A 1UPFA 2Y1GA 4JSYA 3WWYA 3BA6A 2EARA 1TJPB 3OZFA 4OMDA 3RKUA 2ZUFA 2CZQA 3DLHA 2ZUUA 4H2DA 1EG7A 3OZCA 1CU1A 4YDHB 1V2HE 4C4XA 2AQIA 3UXYA 4AJJA 4MCAA 1FX0B 2X2OA 3GLUA 3GUHA 2MT9A 1SCKA 1ZOIA 1KP9A 1NBEA 3WLOA 5T57A 2C95A 3EXG2 1UP4A 3C7DB 3MD9A 4GC5A 4NMLA 2W71A 3JYNA 2XUDA 1AUXA 4OHYA 3TNYA 3JWGA 2VHUA 4HGYA 4S1TA 2VWGA 2ISCA 3EEQA 5JSUA 2IXFA 3RQIA 4DIUA 3RADC 3FWHA 3GDGA 5IAGA 3CLTD 3DV0B 3K20A 3C24A 2VP0A 3NANA 1F3LA 5DLDA 4I6EA 4IV0A 5FRDA 2WJVA 4HT3B 3K5PA 3EULA 3CH7A 3BOSA 3G7UA 3WJ7A 1DCMA 2JFZA 1CF2O 4Q0MA 4ALMA 3V6MA 1CRPA 1KU6A 3DV0A 3D0QA 3CNLA 1GCOA 3ON5A 4EYKA 1K3UB 4XD7A 2VDMB 1IJFA 1B0ZA 1ORRA 1WLSA 1EK2A 4CTNA 2J7KA 4B7AA 2D74A 4OK5A 3OTOB 3ILXA 2JGAA 1DKLA 1MGOA 3CLUC 4KXUA 3T12A 1NLZA 3F9RA 4Y7DA 5FBZA 2B1JA 1OGIA 1FB5A 4P7BA 3ZR4B 2A3RA 2I4TA 1L3BA 1WQ1R 2Q6VA 1JS1X 5AUOB 3LSYA 5CVUA 3ZCSA 1K92A 1M6HA 3FLAA 4E2YA 5K05A 3MJEA 4RGYA 5DPMA 2P2SA 2X5JO 5A9TA 2QTLA 3ENQA 4JP5A 1LPPA 1F20A 3HP7A 2OCIA 3GK3A 5D87A 1L4LA 1WZUA 3DMGA 4QHTA 5LKRA 2ZITA 4MV7A 1E2KA 1GRRA 1QCDA 3TFQA 4I1IA 3N2ZB 3SMQA 1HYHA 4TQ9A 4BATA 1M8JA 3PRKE 1YQUA 4P82A 3WXMA 4P22A 1E9FA 3FWZA 5B1DA 2R8OA 2BGNA 2HN9A 1VJRA 2JF0A 1Y3BE 4DNOA 4JGGA 2IV7A 1QZ3A 3GMSA 3HUTA 3DE1X 1DTSA 3U5ZB 3ND7A 4F1WA 1NMYA 3PYLA 2BKLA 1TK3A 5DN9A 3W79A 5DLQC 1RJDA 3N9IA 2FG6C 1RI4A 1FS4A 2AWNA 4X63A 1O5IA 1E5VA 2CLHB 1NOIA 4TV9B 3P9XA 3O7WA 5BRNA 1MDFA 1KYTA 2HHCA 2PA3A 2QAGB 2AI2A 3R5XA 3NASA 2ZWMA 1LJ8A 3A1WA 3B82A 1AVTA 2JIZD 2NSYA 3I8SA 4LOIA 4CFZA 1Y82A 5KOYA 2ZRMA 4TV9A 5FEUA 4WAUA 2XZPA 5IBPA 4QXMA 2V6IA 2FPXA 3T3MB 3STTA 3VMMA 4S05A 3H2SA 5LDGA 1GQFA 2QAGA 1Y5MA 3TMYA 4ZXFA 1YE5A 2QORA 3OZXA 2MSKA 5IK2D 3FSGA 4EDHA 2BLNA 1Z73A 1PJCA 4YJ3B 1IQ0A 4AICA 1XMXA 3M9XA 3AR2A 3CRNA 4Q03A 4D44A 2XCTB 2OHFA 3SSNA 1H4SA 1GU7A 4QU5A 3R7NA 1Y3CE 1UODA 4AQYB 3VR4A 4CTOA 2IFTA 3SZRA 2Q5JA 1E0KA 3CX8A 3ICVA 1P2VA 3NCTA 2JA2A 2WOOA 3AB7A 4JT8A 4YJ3A 5EUCA 2QAIA 3H3FA 4M87A 3H1PA 4JP3A 5FL7D 1GAQA 1DBRA 3KPWA 1SJ9A 5KTMA 3VSCA 5M2QA 3IJ5A 1KAOA 1X1DA 1X1SA 2CXPA 3HMQA 3GVIA 4LCEA 1NKSA 4BIIA 4QTUB 3B6IA 3VHXB