4PPNA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
327
structure length
311
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 95
structure length 311
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppnA01
1JI0A 1OXXK 3FFBA 4TQAA 4ZV4A 4GOJA 1ZP6A 3ZLJA 3K0CC 5C46F 3TKLA 1GVNB 1TEXA 3I5YA 2GXUA 1Z0DA 3QKSA 5EE5B 5GJCA 2PLFA 1KI9A 2QUZA 2QMOA 2X1VA 2GWHA 3CR7A 5K8LA 2ZXUA 1US8A 2OSBA 5JBQA 4BECA 3MJHA 3K0CA 4Q7JB 3PUZA 2ZYWX 1E9BA 2ZRDA 5JWOA 1SZPA 3U6KA 1W2HA 2RHDA 2F7SA 3BIFA 3LO5A 1NIPA 4BRWA 3A1TA 3BBPA 2N46A 4HUQA 4O25A 2H17A 3BRWD 1ZNXA 2QM8A 3V00A 2E9SA 1MKYA 4W9MC 2WKRA 2IYZA 5CLLA 5L3VA 2IWRA 2WKPA 4GOXA 2W00A 4M4SA 4BZPA 3ZH9B 1XTRA 2NO6A 4Q1BA 5JZVA 2O8FB 1G3IA 3CB4A 1X1SA 3EZ7A 2C2HA 3GJ4A 4JLOA 4NPHA 3QENA 5F2EA 2IX3A 3EIHA 2NGRA 4JYCA 1T8TA 1O87A 3E1SA 3WMEA 1KJZA 4NU0A 4US2R 3KQLA 1N0VC 3H84A 4U5XA 1AA3A 2ZRAA 2ATVA 2WSSA 4B6EA 3U7HB 4ZCIA 2P6RA 2JCSA 2H8KA 1G20E 2Q3HA 2JJ1A 3DM5A 2B21A 4FCTA 4JLBA 4DRZA 1TX4B 4I4LA 4A2PA 1Q57A 4ZI2A 2GDJA 4ASUD 2REOA 3K09A 1QHSA 4NCNA 4AKGA 2W6ID 1IN8A 5GVRA 1AJEA 1F2TB 2X19A 3KB1A 3RYTC 1Z6YA 1H8HA 4AKEA 2GF9A 4JMPA 1NIJA 5G41A 1BS1A 3QVVA 4TQ9A 1CRPA 1R4AA 1Y63A 1EK0A 2WWYA 3B8HA 1TQ6A 1X8KA 1ZVQA 4YLGA 4BEJA 4AKIA 2QG6A 4NCHA 3LBHA 1CS4C 3T1TA 4DLUA 2O8BA 4EFNA 1OKKA 2ZEJA 1UKEA 3CM0A 3CLVA 4GDFA 3NWJA 3ZS9A 2RGNC 2ZVPX 3REGA 4NCJA 1KK0A 4JLJA 2QA5A 3I3SR 1BMFA 2IXFA 4KODA 2NPIA 5FPHA 4Q1DA 1Z0AA 3I32A 4Q4AA 5HCIA 3A1SA 1AZTA 3TMKA 2WZQA 3IO5A 2J3EA 3X1ZA 1JNYA 1DEKA 2ZRIA 2ODWA 1M74A 1XTJA 4MYCA 5BN5A 1G64A 4RD3A 1T8UA 5DISB 3PCRB 2ORVA 1U8ZA 2A78A 2IYXA 3OEEA 2A30A 3IIJA 5JEEA 4I81A 5FBQB 2H57A 1K6MA 3DM9B 2ZM5A 1M7GA 5EP2A 4MA4A 4OI4A 3BH6A 1OB5A 4H1VA 3ZZUA 2PMKA 1FPMA 1PLKA 1A1VA 4KFUA 3RHFA 4DEYA 4M9QA 4OKSA 3EC1A 1EXMA 3FHTA 4OJQA 5FFMA 4O2RA 4M9ZA 3T5DA 2G1JA 2RMKA 3NHAA 1KNXA 1GRQA 2B8WA 4PO8A 1ELOA 3CRMA 3H1TA 1W36D 3X1DA 5CJPA 1KI4A 2P2LA 1UBGA 1BIFA 4QBGB 1XCMA 5P21A 1WDTA 4D4MA 1T0HB 1YJ5A 3FYHA 1U94A 3Q7QA 1LW7A 2P5TB 3EAQA 4QHTA 2JJ2D 2GEVA 1QRAA 3ZVNA 2AXNA 2YC2C 2ZYUX 4KAXA 3L82B 3EIQA 4LZZA 1T3LA 2GK6A 4JSYA 4MKIA 4RZXA 1MRSA 3SJCA 4DKXA 4HUTA 1E9FA 4CT4B 3KUDA 2PCJA 221PA 2XXAA 1NBME 1HA3A 3RS4A 1C1YA 1YZQA 1E1QA 1FP7A 1TQ2A 1EX6A 3BB3A 4NCKA 2DR3A 2X2EA 5HE9A 4EJSC 1MO5A 2ERXA 2ZE5A 5CB6A 1G4AE 2A2ZA 2VP4A 4LYJA 2OEPA 4E22A 3DDCA 4Q9IA 1XD2A 3MWLA 3GLIB 1KAGA 2LKDA 3BC1A 2BMJA 2VQSA 4JJKA 5FUYA 3LV8A 5J4HA 1L8QA 3AVQA 3TJZA 3NHBA 1AS3A 2ZS9A 5FUXA 2QE7D 5KNDA 2OBLA 1IY0A 4ACBA 2BC9A 3OIVA 4LDJA 1KO1A 4GMXA 3E2IA 3OE7A 1H8ED 2QENA 2FF7A 3ZVLA 1P61B 2DFTA 2P0EA 3I8XA 2NPFA 2GAOA 4CIDA 2BKUA 2WHXA 1N6OA 4M1MA 4Q47A 3SEAA 4P33A 1OV4A 2WAXA 3WMGA 1VG8A 3OEHD 3OAAD 3QEJA 4AYWA 4DT1A 3EPKA 3SHFA 4HAYA 4IRUB 5BN4A 2FOLA 3BJIC 2R6CA 2HT6A 1XXHE 1BO6A 3EZ2A 5GADl 2ODBA 4A4DA 1DELA 1JEEA 1GL7A 3T15A 5FPSA 1VYTA 3B9QA 1AKEA 2ZIAA 3W90A 3WP0A 1W5SA 2PZEA 4LPSA 1IY1A 3HU1A 1KI3A 1XFAA 4JIMA 3T61A 4HZUA 1E2HA 1UPTA 1ZUIA 2D62A 3LY5A 2XNDD 1DO0A 2QP9X 3WYFA 2ZR7A 3UWKA 4URYR 1CF4A 4MH0R 1FUKA 2O8CB 4RSGA 2A5YB 1FX0B 1G8GA 1Z0FA 4IDHA 4OJKA 5FOTA 3SFVA 3MMPA 2ZJ5A 3LVQE 2QAJA 4UJ5A 3UIEA 3SQWA 3D3QA 1YR7A 2WOOA 4Q9LA 2ZJYA 5EUMA 3SU8A 3HYTA 4XJXA 2FFQA 1W49A 1E0AA 2VHUA 4M1YA 1E79A 3GCGA 3VR1A 1LS6A 3Q9LA 1WCV1 3D8BA 3HPRA 2ZJOA 3BS4A 4IVRA 3KL4A 4NDZA 5BWMA 1FTSA 3I61A 2CNWD 1VMAA 2XTMA 2RGXA 2WM9B 1JJVA 3A4MA 2A7QA 4EQ6A 1XU4A 3MWYW 3AVWA 1TQDA 3L0SA 2GJKA 2YJTD 2ASEA 2AR7A 4PSAA 1IN6A 4QHYA 3GLFB 3PUVA 3QSYA 3QEOA 2BCJQ 1M6NA 4OYHA 2WJVA 2VP0A 2ZI6A 1FTNA 3MRSA 1TPZA 1A5TA 1VG1A 4C4PA 4ARZB 3BOSA 2EVWX 4Q1CA 3NIBA 3ZD6A 2O8FA 1D9XA 1P73A 4OBEA 5CIQA 3RRYA 4S35A 3GLIE 1XEXB 1NN3A 1DAGA 2HEIA 3HWSA 1AM4D 3ZDQA 3G0HA 2WPDA 3SQXA 3N2EA 1NBMA 3HJNA 4EPVA 4V02A 2NG1A 1CIPA 4TMKA 1Z8FA 3WBKA 1CR2A 5LDDC 5EE9A 4PX9A 3THYB 1PZNA 1S1MA 3EPJA 5FPYA 3DEFA 3OFNA 1YZTA 4A8JA 2VP2A 1H65A 2HXYA 1HURA 3K0AA 3VAAA 3QXHA 2DBYA 3SE0A 1P4SA 3LX5A 3VKGA 4Z1MA 1XX6A 4MDEA 4B3DA 5KOYA 2F3TA 4Q01A 3FFAA 4MYHA 4A6PA 1Z83A 5AJWA 2OCBA 3UATA 4CF7A 2F1JA 4ZIRB 5FBVB 3FTQA 3CPJB 1Z0IA 4E03A 1ZC3A 3QUSA 1FNMA 1L2TA 5FBRB 1OFIA 2Q0HA 3LXXA 5A0FA 4NCIA 2NQ2C 1P2VA 1XMVA 2GKSA 2PMDA 1XXHA 2RGGA 1QHHB 3AVPA 4URXR 1GNQA 4PANA 4OHVA 3BORA 5J4LA 2QT1A 2HYIC 2GILA 3NEYA 2XZLA 1S1CA 2ANCA 3QG1A 5EP1A 1Q1EA 1LS1A 4Y0VA 2ODNA 3U3KA 1TQ4A 3Q8XB 3AVXA 3B1YA 5CITA 3IPXA 4P0TA 3WHLA 2HV8A 6Q21A 3IEVA 2G6BA 3KTAA 5H8WA 3KFVA 1FUUA 4F4CA 3K9LA 2VF7A 2ZE8A 5BN3A 5TXGA 2VP9A 1Z28A 2WWIA 2O8EB 1C4OA 4Q1FA 3K0FA 1WMSA 2CLSA 4Q9JA 5JRZA 1KZ7B 2A5DA 4EPXA 1G6HA 4JVLA 4H1UA 2RGAA 1TF5A 3KKMA 4KLNA 1MOZA 4PQYA 3KQNA 1DAMA 2KE5A 1AGRA 1M8PA 3PVSA 2IHYA 1F5NA 4M1TA 2VP6A 4B32A 2RCNA 3GLFE 4P4TA 3PUWA 5FTLA 1E2QA 2R6FA 1AKYA 1SKYB 1KO5A 3AH8A 4KYIB 4EFLA 3ZQJA 3QKSB 3E70C 4QBFA 1IN7A 1KI8A 1R0YA 1M7HA 3HPQA 3MCAA 1YU9A 4ESHA 1N6LA 2XSZD 4ZCLA 1D9ZA 3SJAA 2D2EA 1US8B 4LBZA 1OHHD 2XJ4A 1KO8A 4OQXA 2WWXA 1OXVA 1MRNA 1QHIA 5DGXA 5KNBA 3E5HA 2FH5B 2GA8A 3C41J 3VHXA 2R6GA 4QNMA 4LCBA 5H1YA 3TVTA 2HUPA 3U2QA 2VL7A 3P1JA 3UK6A 3ZQ6A 4BFXA 5JLJA 3AP2A 1KSGA 1LV7A 3IIMA 4G1UC 1NJFA 4NKRA 3WRXC 4AURA 3I72A 3GLIA 2BEKA 3FPAA 5LD2C 3I62A 2MSEB 1LF5A 2VIIA 2XAUA 4Q4HB 3C4JA 4KLZA 1G3MA 1T3HA 1ZMXA 1P60A 3RS5A 4PC1A 4PHTA 3FKQA 5HKKD 4Q9HA 2OT3B 5A4JA 4XVRA 5JS8A 1II9A 3A1WA 2QAGA 5FOWA 4AIIA 4D4LA 2IEYA 3A1VA 3ND9A 3RANA 4BQSA 4DEXA 4TMXA 3GJ6A 4A0HA 1JR3E 2BDTA 2ZUCA 5F9FA 2UVQA 1EWQA 2EWWA 1G5PA 4IEEA 1N5JA 2OG2A 3K1JA 5FL3A 4D80A 1DAIA 4DSTA 1Z63A 1N6KA 1E0SA 1ZNWA 4LYHA 4HAWA 3M0EA 1A82A 2QTVB 4QRHA 3L0OA 3CF2A 3WNCA 3FDIA 2V4ZA 2CBZA 1OXUA 2CLCX 3CPHA 3QQ5A 5DO9A 3A6PC 2QNRA 4OQFA 1W0KD 2C9CA 3AF2A 4P3YA 5IF9A 1UKVY 4UXIA 3QKRA 2O0JA 4G0NA 2Z43A 4XWKA 4E07A 3B1WA 1JPJA 2QSYA 1JEDA 4V0ME 3ADCA 2CCKA 1N2CE 1CJUC 5HE8A 1ZINA 1U9IC 3LD9A 3TSOA 2DFKB 2IYUA 1FX0A 4GSYA 1OE0A 1CR1A 4ZI3A 2VO1A 4M53A 4JVSB 3W34A 4TL8A 1ZNYA 4NYJR 4WZ6A 1TUEA 4KCGA 2OFOA 2CK3D 2O5VA 2UZIR 4HLCA 1RYFA 3NBFA 4D82A 2W2VA 3QPUA 3KQHA 3CONA 4UXJA 4AYXA 4WOPA 3VX4A 2AK2A 1IJEA 4OK6A 5K8TA 4Q7KA 3IQXA 2J7PD 1AQYA 2JDIA 1M2OB 1P9RA 1KZGB 4YXWA 5JWRA 4A15A 5EE3A 4GP6A 4DUGD 4B34A 4EIWA 2RGBA 1L4UA 4FXPA 3TNFA 3CKLA 3F0TA 5G53C 3EA0A 3NTUA 3QNUA 4Q1AA 2L0XA 3LRPA 2HT1A 4DHEA 1ZU4A 2YWFA 4DLVA 3GLFA 1XD9A 3TW4A 1R5BA 4JS0A 3NC0C 3VR2A 3PQCA 2ZE6A 521PA 1NLZA 4O0MA 3T1VA 5KPDA 2OILA 4POAA 1SHZA 2VSXA 2DWOA 2V54A 1J90A 2WTUA 2XNSA 1YQTA 2OFWA 3Q85A 3FKSD 2EU8A 1KSFX 2JJ8A 1VCMA 2VHTA 1F6BA 5TB5A 2ERYA 3PEVA 4DLZA 5FPTA 3KQKA 3PXGA 4FMDB 1S96A 4Q4LA 3W8RA 1T0JB 1XEFA 5TMPA 4D0LB 3T34A 4MRPA 2XXAB 3M6AA 3DVLA 2PEYA 3S1AA 4GRAA 2ZTSA 1YHNA 5C1BA 1P9WA 3G5UA 3GLHB 3QOFA 2V55B 2WWWA 3UWOA 1EFRD 3CX6A 2Z0MA 3V4FA 3TR5A 1MT0A 1E32A 4NZYA 4Q48A 1ZNZA 2ZROA 5KU1A 3GJ8A 2AN9A 1E2MA 2P6NA 4MRSA 1YZGA 4WVFA 2GEDA 3SYKA 4UNPA 5J4VA 4ZIRA 4UQOA 2FPKA 2DFLA 4MRNA 1JR3A 1RJ9B 4II7A 2KBFA 3I73A 1NN1A 1GFIA 2G1KA 4MRVA 3GJ3A 3SNHA 4D4KA 2GEUA 2CE2X 2D74A 4PO1A 1Q44A 5BYKA 2QN6A 4AK9A 5FR1A 2R8RA 4DT1B 1EFCA 1ZCBA 3CWQA 3GFTA 4DB2A 2ZJ8A 5B58C 3HYRA 1U8AA 2I4IA 1KO7A 2ZAMA 2YC4C 3QF4B 3ASYA 1QHNA 1GZSA 1COWA 1N5LA 3DOFA 4OI2A 2A5JA 3TLXA 4UNRA 1KOFA 1YR8A 4JLKA 1AGPA 4TZ6A 4N3NA 1W44A 3UG6A 4V0MA 3RAPR 4B3GA 5JMTA 4DSUA 1MR3F 2FX3A 4M2LA 1T6NA 3T12A 3X2SA 3CZPA 4IOLA 3FGNA 4DLSA 3FMPB 4UJ3A 3LLMA 5EXSA 3QPWA 4KSBA 5DLQC 4G3XA 3IILA 2CHGA 4TTPA 3HR8A 2G83A 4HZIA 1G3QA 1X8JA 1CXZA 2MMGA 4D6PA 5B64A 2C9YA 3TBKA 2QU8A 3NEJA 3X1YA 5FBWB 3DKVA 2HCBA 3DKPA 3N70A 4GZMA 3UMRA 2G0NA 2WSMA 1PUIA 3SR0A 1NN5A 2J46A 2V7QA 2YWHA 3RNLA 2BJVA 3SJZA 1DG3A 3VTKA 4D2IA 4W5JA 3EIEA 5AJZA 2AD1A 2IC5A 2IYTA 2BJWA 5AUOB 1S8FA 2V8OA 1JAHA 1N6HA 2V9PA 3A4NA 3SBEA 2OXRA 4EQ6B 3QXXA 2X77A 4B2PA 1Z0JA 4M0LA 4PHGA 4GI7A 1D2MA 4YDSA 5EQTA 4R9UC 5IK2D 1KMHA 1CTQA 4KYUA 4LHYA 4EFMA 3W9YA 2FGKA 4EUNA 4PR0A 4DJTA 1H8EA 5DN6A 1YVDA 1E9DA 2RAPA 4DCSA 3GLHE 3KKOA 1XCPA 1IQPA 1ESMA 4Q4HA 1UBEA 5F3WB 1T91A 2F1HA 3M4YA 4PQRA 4KFTA 3ZZTA 4JYBA 2C03A 1ZC4A 2NO1A 4GT1A 4FWIB 3QY0A 1VIYA 4QL3A 5TV2A 3LAWA 1G16A 3A36A 4FCWA 3K09C 4QHSA 1XMIA 4QBIA 421PA 3CO5A 3KX2A 3B9PA 1Z5ZA 3P32A 1ZIPA 3BERA 1XD8A 2ZRCA 4KITB 1NNEA 1OIVA 3EPLA 1R0ZA 1G7TA 3BFXA 4ZPXA 2IUSA 2EFCB 4IKEA 2FZLA 5DHAA 2HLDD 2D06A 1TL7C 1S0UA 1T3SA 4LY6A 4A2QA 2BBWA 1ZM2A 4A8JB 2IYWA 2I3BA 3K0AB 3RS0A 4DLRA 4DSNA 1X3SA 5JS7A 3SOPA 1G8PA 1II0A 4OQLA 1XMJA 4KI0A 4QG7A 4KHZA 2C99A 4XVUA 4TSFA 2J7KA 2H5EA 3K0SA 4MGZR 2DWPA 1YZKA 5FL7D 1I4DD 5CK4A 4DVGA 1VCOA 3TUZC 3VX3A 1DE0A 3KKNA 4HSEA 1FQJA 3GEEA 3LDAA 3CRW1 4B33A 4C0HA 2ZRBA 2FSFA 2H1LA 3RWMB 3TH5A 4DCNA 4XIGS 2PH1A 1KSJA 3UANA 3VHLB 1XEWX 4HYYA 4Q4JB 2NIPA 4WIAA 1DS6A 1XXHB 2OCYC 4JBYA 2VSOA 3ZIAD 1A7JA 3WP1B 2FU5C 4NYMQ 1I4LD 1S9DA 2P67A 2WWFA 4F38A 1A4RA 4A0FA 2WJGA 1SXJD 2C77A 2C9OA 1WA5A 2GZHA 2KB0A 4BLRA 2QZ4A 1OFUX 3EZ6A 3UPUA 5CK5A 3U3JA 2VYFA 4Q9KA 2FG5A 4OHZA 3MG9A 3ECCA 2VHCA 2QGNA 2CJWB 2OESA 4QJ4A 2GZDA 2ZYTX 4Z8YA 1NMYA 1OH8A 2PX0A 4TYYA 2BMFA 1CJKC 1OPXA 1CEEA 3KTAB 3L0PA 4TLAA 1LNZA 3AGQA 3EZ9A 4N0DA 2IYRA 4LBYA 2O8DB 2YVUA 3J81k 3GJXC 4A2WA 3K0FB 1L7VC 1MABA 2ZRNA 3OZXA 2DCUA 3SN6A 1VPLA 1VECA 3BAFA 3RSOA 1KY2A 1TF7A 2ZU0C 3THXA 5JJIA 2R6DA 1E9CA 3AKCA 4OK5A 4PZLA 4WZAE 2V6JA 4BFZA 2QRZA 1P2UA 1RYHA 2JIZD 1PLLA 4AG5A 2A3RA 3TW8B 4BFSA 4R7ZA 5K8UA 1P2TA 3MUFA 1RRFA 3SC3A 1AQUA 4Q18A 3AM1A 3U3MA 4DLYA 4D81A 4HLUA 1OFHA 1II8B 1UDXA 3RVBA 4L8GA 1YZLA 2QSZA 4I99A 4URVR 1J7KA 3EWAA 3IIKA 3Q7PA 2JLQA 3Q72A 4XD7D 4QM6A 4BUJA 2ZSEA 3B85A 4RCYA 3HU3A 1ZCAA 3P20A 4JJZA 3O8CA 3GD7A 3VQTA 3D7MA 2C96A 3FMIA 3GLHA 3WY9A 1ZM3A 1Q1BA 4TL7A 2GETA 1XPRA 2R9VA 2BWJA 1OXSC 4B74A 3BWDD 4B43A 1E2IA 3I8SA 3KKQA 3ZGXA 1CLUA 1UEIA 4YONB 1SVOA 4ACAA 4A92A 5M04A 5CIWA 3QJYA 2QBYB 2GJAA 1NMXA 5ANRB 1KSHA 1N6RA 4DDUA 2NMVA 5JSZA 2JLYA 1HH4A 5FUWA 2VBCA 2QROA 4IHQA 1RJ9A 1JR6A 4HB2A 1F48A 2QAGB 1KNQA 2ZAOA 3QG5A 3KJEA 1G5TA 1NRJB 4ABYA 4O3MA 2XX3A 4NYIQ 3LX8A 4G5SA 1HEIA 2EFGA 2J41A 3LQRA 1GM5A 2Q9CA 2QP4A 4JLDA 5F98A 4LJ9A 1G7RA 2W2TA 4OQNA 4WW0A 5ELXA 2J45A 1W0JA 4OHXA 3SJBA 3WNDA 4ITRC 2DPXA 3TUIC 4FMDF 1TTTA 1W48A 3QF4A 4XSHA 3ETLA 3LXRA 5LBIA 4BLQA 4AD8A 3FVQA 4US1R 5KSZA 4HDOB 3WNBA 2AFHE 3R8CA 4B76A 2ZRGA 4WBSA 3QKRB 1YKSA 3KXLA 2ZRHA 1HT2E 1E2JA 4LJ6A 3KJIA 1VG0B 2PZGA 1R5NA 1R7RA 2B8TA 1NP6A 5TY0A 1B23P 4OHYA 1QG4A 1NSTA 2WSSD 4NHOA 1KK1A 3QIAA 4LRWA 1XNJA 2ZI5A 4UKDA 1W7AA 3NBZC 1M7BA 2XSZA 1E4VA 2JJ1D 3CRVA 4TYQA 3UXMA 2AD5A 4MYUA 4E09A 2X2FA 4PFSA 4NE2A 2W6JD 1P7CA 3PENA 2Q3MA 3ZVMA 1HUQA 3VNUA 4QNRA 5H68A 3NG1A 1H8HD 2GXSA 3X1XA 5C4GB 1D2EA 1FZQA 1U99A 5DI9A 3C5CA 4B48A 4DSOA 5BW8A 3C14C 2ZETA 2ZS8A 4QBHA 2AKAB 2ONJA 2JLWA 2OHFA 4ZO4A 4IOMA 4KO8A 5SZIA 2ZUBA 4FW9A 1GRNA 4BFUA 1OKKD 4A0RA 1KI7A 2QGZA 1LTQA 3B1XA 1BYIA 2WWGA 4HI0E 2DHRA 5EXPA 1RRGA 3RRMA 3PEWA 3I5XA 1CBUA 1KY3A 4B75A 1E2FA 1OXTA 2O0KA 3C7KA 1MO3A 4JVMA 4DDWA 1BMFD 4TN1A 3W6NA 1HT1E 4HB0A 3T35A 2XTZA 3PIRA 1ZW6A 2FEMA 2WMOB 1E3MA 2QQEA 1W5TA 2V3CC 3L8YA 3QF7A 4CZ2A 4HATA 1YZNA 2FFHA 2KI5A 3O8BA 4LYAA 3T5GA 3OIYA 5JCPA 5SZJA 1RPZA 3ASZA 4QGAA 2D4HA 1JBKA 1M34E 4A8JC 2YOFA 1TUIA 4DDVA 2G3YA 5BQ5A 4TMVA 4BZXA 2HYDA 2PBRA 4GMDA 1GILA 5GVSA 4TTQA 5AUPB 1OIXA 2NO0A 2XJ9A 3PUXA 4RD2A 4TT3A 2QRNA 2Q9AA 3TSZA 1Z47A 3U5ZB 4XWOA 3A58B 3Q5DA 2QORA 3S1AB 4B73A 5GJBA 5DYIA 4PPQA 3D31A 1IXZA 2QTHA 1D6JA 1TU3A 2XOKD 2ODEA 5HCNA 2ZREA 1I4TD 2IS1A 5SZHB 1KDPA 4MITA 3VMFA 3KUCA 2KJQA 4Q03A 1Q1QA 1XTQA 4DXAA 2IF2A 4BPBA 3GQBA 2OZEA 3TUJC 1NLFA 5FTKA 3U44B 2IYLD 1G7CA 3AVTA 1JAIA 4CDGA 2AFIE 2YOGA 4RVCA 5GJWC 1E1RA 2QPAA 4Y0AA 4Q4JA 1XWIA 3ZD7A 3CWZA 1NVVQ 4QGGA 2QMEA 1CU1A 4Q5IA 3BFVA 1S2MA 1RVDA 3EWSA 4YMVA 3QXSA 1XDBA 1JQJC 1DO2A 2GCOA 4JT4A 4D4JA 1WQ1R 3KDSE 1E1QD 1UAAA 2PCLA 1GG2A 2BMEA 3EW9A 2BHRA 3H86A 1W47A 1JECA 1ZD1A 2CJWA 4JLVA 1U2RA 4B3BA 1X1RA 1DBSA 4BASA 2J0SA 4V0LA 3R9IA 1W36B 5KSYA 5HZHA 1TADA 3U3RA 1UBFA 1T5IA 3O8DA 3OE7D 4A6XA 5AR1A 3AUYA 2OBMA 1CJTC 1QDEA 3IQWA 3FMOB 4PZZA 4IEIA 5BXQC 1GSIA 4KJZA 1AN0A 4JKYA 3U6BA 4YC7A 5JRJA 3NXSA 5HTKA 4L15A 2DFNA 3GPLA 1SKQA 2QT0A 1PJRA 4P4SB 1II8A 1U81A 2Q6TA 3TE6A 4IOKA 4OI0A 1KKMA 1WBBA 2G9NA 2AK3A 1KDRA 4DLXA 3DMNA 3EX7C 3B1VA 1GNPA 1ZM9A 3ZVRA 2B7BA 1VIAA 4AG6A 2CCGA 2ZI7A 3W6OA 1CR0A 4YMTA 2MMCA 3IGFA 2CL0X 3DOEA 3AP1A 1NLYA 3FOZA 1HV8A 2WAYA 3P4YA 2RKOA 4K46A 1FOEB 1GDDA 2PLRA 1KMHB 4OL0A 2GAAA 4NTZA 2ZYVX 5EP3A 4TL6A 1E99A 2QAGC 1SULA 1T4GA 1WE2A 4C0QC 1AZSC 2YWGA 3TK1A 2IS4A 2O0HA 3FB4A 4HDCA 5CM8B 3U3OA 1T5LA 2R44A 4LJ5A 2QBYA 4LJ8A 3U60B 3AVYA 2VF8A 1ANKA 3AB3A 5IRCD 1HE1C 2Z4SA 3M1IA 4V03A 4A36A 1Z0KA 2EYUA 2FMXA 1Q0UA 4PTLA 3IHLA 1I2DA 1S3SA 3BFKA 5GJVC 1Q20A 5AWFC 3EZFA 4EAQA 1NMZA 4I1VA 1E79D 4BZQA 2AX4A 2IF0A 5FOSA 2YNMA 4QC2A 4TL9A 1E69A 2R62A 4Q02A 3RS3A 2IT1A 4GP7A 1TF2A 3BK7A 2WBLC 4G5QA 1OSNA 3CNLA 4GBMA 4Q1EA 2ZRKA 1Q12A 2NO7A 1R0WA 4B47A 4ZDIA 4Q7MB 2JLRA 3CUEF 3QE0A 2H7VA 1FQKA 5HZKA 1NF3A 1G21E 2VTKA 3AF4A 3DHWC 4O2LA 4TQUS 1Z2AA 4GZLA 4QM7A 1N5IA 1Q1ZA 1ZUHA 5IDVA 1E9RA 3SYLA 1SVIA 3SI7A 3C16C 4M1KA 4C0KA 1NVWQ 1E6CA 2GHIA 2HF8A 2IYVA 4IDNA 4HDQB 1E2NA 1G3UA 5TDHA 2IK8A 5EZ5A 1DPFA 3B60A 3WHKA 3RC8A 4PHHA 2ZSDA 3THOA 1EFTA 1IHUA 1ETUA 2TMKA 3C5HA 4JLPA 3W3ZB 2CVHA 2WOJA 1JQLB 2WPDD 3IDQA 4NL4H 4DZZA 3ICQB 3CR8A 1NBMD 4J0QA 2XB2A 2H18A 2XGJA 4LV8B 4CW7A 5HR5A 4AKHA 4XSGA 1LFDB 2D3WA 1XF9A 5FBLB 5L3RA 2GXQA 3GLGE 2VHJA 4IW3B 2UZ3A 1KO4A 5K8IA 1KI2A 5HPYB 3GJ5A 1QVRA 3OFND 3VR3A 1G18A 5C2JB 5DE3A 3MD0A 5CDFE 1XP8A 4FMCB 2W0SA 1DAFA 1QG2A 2J1LA 4JZKA 1V5WA 4DLWA 1RKBA 3MJRA 4Z1MD 1MO6A 2VSFA 4LJ4A 1TAGA 2BV3A 4PSKA 2GRJA 1GKIA 4TLBA 1P5ZB 2ZRMA 3RABA 4TTRA 3B2EA 3K9GA 1HE8B 4NP6A 3VKWA 4Q19A 4RY2A 4OHWA 3IBYA 1OF1A 2FPLA 1MABB 1G9XA 1ZD8A 2ANBA 2LWIA 4HB3A 4W5HA 1QHXA 3THXB 1Q3TA 1EGAA 2D7DA 1DTSA 4B71A 1VCIA 3B78A 3WXMA 2IYQA 4NBSA 1NKSA 1XJQA 4URWR 4LYFA 3VU9B 4QOSA 5BYJA 2PL3A 1XJ0A 2R6AA 2QY9A 4RZ3A 5IT5A 4HLDA 1HY3A 1VCNA 3PUYA 5DHFA 4IJMA 2XZOA 1PLJA 4DCUA 3I4LA 4UNQA 1A2BA 2HLDA 3A1UA 3EXAA 4ASUA 2P3SA 4M9XA 2GJ9A 1HQCA 2W6IA 3X1WA 1R5OA 5G3YA 2JGNA 1GIAA 1N6IA 2CXXA 2OBNA 3BH0A 2GK7A 4HAUA 5LB2A 2VP5A 5CYOA 1BKDR 1YR9A 3VR5A 1KJYA 3B1ZA 2JAQA 4JL8A 3K70B 5JJLA 3PEUA 1E94E 3PG5A 5FL7A 3GJ0A 5JFGA 1E9EA 3G82C 2W0MA 2WWHA 1AS2A 1QBKC 2WIAA 4QXAA 4IFEA 4PXAA 3RC3A 1E2EA 1Z29A 3AF1A 3W3AA 5C18A 1KI6B 3B6EA 3SFZA 4C7OB 5B30A 2REBA 2ZRLA 4BLOA 5JSZB 1RRPA 4BFWA 5DH9A 2ORIA 5A5GA 2Q3FA 1NL3A 1W2GA 2V1UA 2ZI9A 2WJIA 3U44A 4XVQA 3VKHA 4URUR 4UNNA 2WVJA 2X8AA 4LBVA 2XB4A 4Z54A 5AJYA 3TRFA 1NKTA 2IXEA 3QXCA 4RD4A 3VR4A 2CMKA 1RC8A 1G8YA 1N0WA 4EPTA 4TLCA 3IPYA 3BB4A 4M21A 2OM2A 1S4QA 3CZQA 1F2UB 1W36C 4V0KA 4N0EA 4RJLA 4RCZA 2VLIA 4IDQA 1IOZA 3CBQA 1FP6A 4BGDA 1XEWY 4C0SA 3F5FA 3KJHA 3Q3JB 4X8OA 5AUQA 4EJSB 1K8RA 4DIEA 5L3SB 1N6PA 2JLSA 4AWXA 3W6PA 4K81B 4PC7A 4A82A 1HTWA 2W83A 1OIWA 1Z6TA 2FGJA 5J40A 4BRUA 1G7SA 5JI3E 2ZJAA 2ZSBA 3F8TA 4URZR 5DIFA 3NDBB 5CJ2A 3NKVA 3JVUA 4KSCA 3A4LA 1XTKA 2FJUA 4MQBA 1IY2A 2IW3A 1WP9A 4UNSA 5FTJA 3GLGA 4FWTA 3BE4A 1XBTA 3CRRA 4JVNA 2JJ2A 4KFSA 4JLNA 4LK2A 2AL7A 4M1SA 5DNYB 5CDFA 4LSGA 1LB1B 3MWKA 4C9BA 1Z6AA 4Q7LA 1GAJA 2RHMA 3PR1A 3AV0B 1P62B 1Q3HA 2FN4A 2KWIA 2FPMA 3EA5A 1MO4A 4H9GA 2HDNB 4F93B 2GTPA 4P4SA 2OV2A 1IXSB 2IYSA 2QMHA 2H16A 3CF0A 4PAOA 3PJRA 1AIPA 3KZ1E 4KU4A 4JL5A 5EZ6B 2CL6X 2ZRFA 4C3ZA 4A1FA 5B2ZA 3RSLA 4YDHB 3QKTA 4TYNA 3LW7A 5C4MA 2OO7A 2F1IA 3LWNA 5KPJA 5FOXA 5UKDA 2ZVQX 3NH6A 2IYYA 2P5SA 1R10A 2G0TA 2QE7A 4ERNA 4DDTA 5LB4A 5FR2A 1BYUA 3PITA 3O8RA 4CEHB 5KDDA 1N3BA 1UJ2A 4C0AC 1JXMA 1QF9A 2BM0A 2IEZA 4WXRA 3OIWA 5FTMA 1NN0A 3L43A 2MSCB 3C8UA 3OEHA 3OAAA 3MWJA 1QHGA 5JECA 4TYWA 2F9LA 2BOVA 3T1QA 4WXPA 1GL6A 2JDID 2J0UA 5KSOA 1OFTA 1XB2A 4YXWD 2QM7A 1VG9B 5E7MA 3TAHA 1IONA 3AGPA 1FNNA 4IDOA 1HQYE 4RFSA 1OJLA 1KTVA 2Z4RA 3KQUA 3KFXA 4V0NA 4PQFA 4Q21A 1O3YA 4MUAA 4FIDA 3RRNA 4BFTA 2R2AA 3TVDA 4IOJA 4PC2A 4WAUA 2XNDA 1KDTA 1OH6A 8OHMA 1Z07A 2W58A 1G8HA 4AYTA 3CIOA 1S9HA 3B13B 1K5GA 5KO2A 1KK2A 1E9AA 2BBOA 2C8VA 4OI1A 3A8TA 4MKHA 2BIFA 2IXGA 4JL6A 4TMTA 2GCPA 121PA 1GRRA 2AWOA 4BEBA 4IVQA 3NBXX 5JJKA 1VYVA 3QPVA 1DADA 2EYQA 2ZSFA 2FSIA 2W6JA 2ZRPA 1C9KA 3CNNA 3DMDA 1QVAA 1XRJA 1YE8A 2WJHA 3L8ZA 4QGHA 4EPWA 3K53A 4R71A 2J0QA 4F4JA 2OUKA 3A37A 3DPUA 4FI3C 2IUUA 3L0IB 2IHBA 2EFHB 4XTRA 2PJRA 1G19A 2GCOB 3ZS8A 5E95A 2Y8EA 1G3RA 3U7FB 1OW3B 1VYUA 1EWRA 1XPUA 1V43A 2NTYC 2VEDA 1F3OA 2CNWA 2ZUDA 4N1AA 3DZDA 2WKQA 1XTIA 1ZIOA 2HF9A 3TSWA 1XMSA 2HXSA 1GWNA 1TU4A 2FFBA 2C5LA 3TQCA 1IN4A 3PEYA 3WYAA 2YOHA 4PO9A 3R7WB 2GVZC 2F55A 2DYKA 3W5IA 2DY1A 1E9SA 1JR3D 4QKQA 4IXNA 1Z3IX 2D2FA 4CEJB 3NVAA 5L3QA 1Y3AA 2ZI4A 4HLUC 4CRWB 3LQQA 2RGNA 2IL1A 2CCJA 2EQBA 3AF3A 4HLQB 2PT5A 4TYPA 4B44A 5IHPA 4L16A 1TEVA 2FFAA 3RWOA 1CJMA 3MAAC 3VU9A 2V1XA 4JBXA 4FMBB 3FHOA 3UMSA 4LC1A 4ZCMA 3K70C 1AA9A 5L8VA 4MUBA 5DYGA 2F1RA 2I1QA 3U7GA 4D25A 1COWD 4RD6A 1AS0A 3WBJA 3HP1A 2ZR9A 1G5RA 2XOKA 2AWNA 4D26A 1IN5A 5JWHA 1D5CA 4LV5B 3RLFA 4FMCF 1XTSA 621PA 4LI0A 1XPOA 4C2UA 3NBYC 3CX8A 1KYIA 3TAUA 3RS7A 4L4UA 4GNKA 3RS2A 4F92B 1G41A 5G3ZA 4LHXA 5DI3A 3MFYA 3C15C 2GCNA 1NY6A 1G8FA 2K5UA 4CEIB 3MSXA 2YV5A 4MGIR 3UKDA 3FE2A 2R65A 1U0JA 5JHGB 4DCVA 1KI6A 3F3YA 4S2EA 4C7OA 4R98A 2WV9A 1Z6GA 1Z08A 5CB8A 1KKLA 3HU2A 5D3MA 3UMFA 1NG9A 2AHOA 3MGCA 2GXAA 4U7DA 4LHZA 4KVGA 3GP8A 2ZJBA 2REXB 4M22A 4RKFA 3W8NA 4DLTA 3CF6R 1ZJ6A 2YKGA 1P6XA 3LBIA 3N2IA 2V7QD 2JLUA 5CLQA 4BLSA 2OXCA 5JHHB 3THWB 2KBEA 2A5GA 1FW6A 4DB4A 1KMQA 5H70A 5FI0B 5CYPA 4LOAA 2VPPA 4U00A 1UFQA 1F2UA 1UKYA 3AEZA 1R0XA 2ZU6A 1KIMA 3CW2A 3OIUA 1FFHA 2MSDB 1U90A 1PV4A 5L3SA 4EJSA 1TMKA 3KKPA 4B3FX 5EJEA 5E3HA 5DN6D 5LD2B 3H2YA 1X8LA 3AKEA 4U02A 4BLTA 5G40A 2UKDA 4IFBA 2ZANA 1M1YE 2JA1A 5FPKA 2A9KA 3NH9A 1ZYUA 821PA 2RGEA 2J9RA 1NJGA 2JASA 4NYJQ 3SYNA 1J8MF 721PA 3LW8A 4MRRA 4Z8XA 2O8DA 4L5BA 1JB1A 3ICEA 4W5WA 1SVSA 4B6FA 4NMMA 4L9WA 1YZUA 2FV8A 4BFVA 4FINA 4HB4A 4TMZA 2ZR0A 5AJVB 1NSFA 2QPTA 3V9PA 4RZUA 1OHHA 1Z06A 1WB9A 3FMFA 4FD2A 4HEJA 3ZJYA 5EUQB 2ZI3A 2ORWA 5SZKB 4UXHA 4WA7A 3N5CA 4B2IA 4MGYR 1OLOA 1UDWA 5KSPA 4LPKA 5LPNA 4X8MA 4GL2A 4MKGA 2G88A 2YWEA 4TSFD 1DAEA 1ZU5A 2BEJA 3IHWA 2G77B 2J87A 4PZYA 2GJSA 3AVUA 2FZ4A 3U7EB 1YRBA 1LF0A 1HYQA 1K5DA 2AKYA 4LHWA 4QJ3A 1G1MA 3AVOA 1Z6XA 5HKKA 3VR6A 4EPYA 1J2JA 4CEHA 4YMUA 3REFA 4PAMA 2WIBA 3ONWA 2HCJB 1I2MA 3DO6A 4TWZA 2H92A 4B35A 3VFDA 2YHSA 2Z6VA 4JLMA 2QL6A 4I1SA 1W1WA 2C98A 1P2SA 1NI3A 2IBMA 5J47A 1W4RA 4IDPA 1PUJA 3BD9A 2FA9A 3R20A 1U0LA 3OEED 1RW4A 1Z22A 2OLJA 3EG5A 4JSTA 1KDOA 2ATXA 2RB4A 4XWAA 5D3QA 1LVGA 4EKDA 1XZPA 3OF5A 4R2HA 1KI1A 2O52A 4HAVA 1BH2A 1RZ3A 2EW1A 3IUYA 1W0KA 1E2LA 3QBTA 3CX7A 1GKUB 3W5JA 4FCVA 1SVMA 3L2OB 1OYYA 2RGDA 2FSHA 4GPTA 1GKYA 5KDOA 1LY1A 1E4YA 4JBWA 3GJ7A 1E0KA 1KAOA 2C04A 3K0EA 1AK2A 3GFPA 2FE4A 5KNCA 1J99A 1IAQA 2BM1A 3B7GA 3DZ8A 1J8YF 4BWYA 2ZQ5A 3LFUA 2CLDX 2ONKA 2VA8A 4BE7B 1SXJB 3K8YA 2CVFA 3SHWA 2CK3A 4QJ5A 4US0R 1NY5A 3QI2A 4KBGA 2CEAA 1F2TA 1ZM7A 3P27A 5EE1A 5KHOC 2NO9A 2BKEA 2J7PA 2GF0A 2F43B 3K70D 1IJFA 2N42A 2VH5R 3U4QB 3GMTA 5E7IA 4DUGA 2FWRA 3HR7A 4I1UA 2KSQA 3QBVA 3EASA 4OQMA 4CGZA 1NG1A 2JLVA 3LA6A 3LH5A 1W4AA 3JZAA 3TR0A 5AJXA 3ND8A 4C2TA 2OAQ1 2GBLC 3AQ4A 2GESA 5E4FA 4NH0A 4LJ7A 2J5XA 3K9HA 2PT7A 1WF3A 4JT2A 4P31A 3CH4B 3R7WA 5KUTA 5E7JA 4KXFB 4Q66C 4XOIA 3BGWA 5AK0A 3GLGB 2IS6A 4CEJA 4B3CA 1R8SA 1PVOA 1E2DA 2ZJ2A 4DIDA 3FKSA 2ECKA 2PX3A 4QFMA 2Q9BA 4NYMR 2CL7X 2GBLA 5DSZA 2NZ8A 2QEQA 2YINC 2P65A 4XH9B 1TNDA 2OE2A 3O47A 1W0JD 4F4IA 5FI1B 5B57C 2FSGA 4PPFA 4EPRA 2OCAA 4KV9A 4ON9A 4M1OA 4CYMA 3TGPA 1RRCA 3OHMA 1Z2CA 3B5JA 4M8NE 2SHKA 5TARA 2ZRJA 4PPGA 2JEOA 5J5CA 1ESNA 1EFRA 1EFUA 5KDLA 4C0LA 4ZKDA 1IM2A 3ZYCA 2HJGA 3GEIA 4XTCS 3AUXA 4CT5A 2OCPA 2B6HA 2CHVA 4PC6A 2IUTA 2F6RA 3QXJA 2B92A 2VHQA 1VHLA 4CEIA 2F3RA 4HAZA 1DAKA 3ADBA 1CKEA 2BBTA 4BFYA 3IBGA 1W4CA 1S3GA 4TMWA 1B0UA 5FOUA 4LGMA 2CE7A 1ZM4A 1GITA 2BCGY 3NC1C 1EESA 2BBSA 2GZAA 2PJZA 4JLAA 2EFEB 3QVUA 3BB1A 1CJVC 4G5OA 1DVRA 4LWZA 1WRBA 2Z5FA 2ZE7A 1XCGB 4IXMA 2J0UB 4RD1A 3UG7A 1N25A 2JLXA 4HUQB 4X8HA 1VTKA 3GFOA 3THWA 2NOAA 1SXJE 3KB2A 1UKZA 1DAHA 4RFSB 1SVLA 3SZRA 1SQ5A 1W4BA 5KTYA 3R9WA 2Z83A 2J59A 3TIFA 3P26A 4TZ0A 4GFDA 2ZPTX 3SDZA 2P6UA 1WBDA 3KXKA 2RGCA 3WRYC 4CVNA 4MDFA 1E98A 2DWQA 3H0KA 4MYTA 4W7SA 1SVKA 1G4UR 3RRZA 1J70A 2XZPA 3JVVA 4WZBE 2V6IA 1BOFA 2Q21A 2WICA 1KJWA 4ZDJA 4KVAA 5FH9A 4AY2A 5EE0A 4AI6A 3R9XA 2XEXA 2XTNA 1JJ7A 2PEZA 1R8QA 4G5RA 4NYIR 2CDNA 3LNCA 4A0GA 4PHFA 4PSVA 5FTNA 1E2PA 4YMWA 2QI9C 4D0GA 1RIFA 4TT3D 3T06B 1R2QA 3ADKA 1SHKA 3Q5EA 3LBNA 2E1RA 1ODFA 4HAXA 5AUNB 1U98A 1IBRA 3I92A 1G6OA 5J4YA 5JI2E 5F9HA 3D6TB 1ZAKA 3KJGA 4RZ2A 2NZJA 3H4MA 3EARA 1NVXQ 1QHYA 3JZMA 2O8BB 1OB2A 4NONA 4RKEA 1JALA 4KBFA 3IO3A 4TLDA 5IK2A 4F91B 2QPOA 4Z51A 4BLPA 2QTFA 2O8CA 1DOAA 1P9NA 3LLUA 3PFIA 3RDPA 1N0UA 2GVDC 1E0JA 4Q4AB 2J0VA 1VKJA 2ZS7A 1G17A 3AVVA 1ZRHA 5J4KA 5L3QB 1E2GA 3CH5A 2E87A 2YZ2A 1E1RD 3IEUA 4JKIA 4PC3A 3B82A 1GL9B 1GP2A 1U9IA 4X8LA 2GNOA 1ZUNB 1R6BX 3V4RA 1A2KC 1VDZA 3QKUA 2BMDA 3R8FA 1UADA 1GUAA 4L9SA 1IXRC 1SKYE 2OAP1 3HDTA 3EC2A 5FUVA 1RFLA 1DARA 4K8OA 5FOVA 4IVPA 1P3JA 4C0BA 1ZD9A 3I1FA 4QGFA 4C30A 4D0NA 1MH1A 1CR4A 5EXXA 4EDHA 4LC0A 1U0HC 3AKYA 1OH5A 4TLEA 1KK3A 2F9MA 1E96A 1N6NA 1ZBDA 3AKDA 3GEHA 1GNRA 2HJVA 2AXPA 4ILEA 4FN5A 1WXQA 1XJCA 4RFVA 3AP3A 5TVKA 2GJ8A 4ARZA 4MKFA 5DI3B 3SS8A 1JXOA 1SXJC 1XEXA 1CULC 4KFRA 2DB3A 3T1OA 1NVUQ 1CRQA 2XITA 1EG7A 2W2XA 5D3MB 3ZIAA 1P72A 2WMNB 3THYA 2IWHA 2OLKA 3ZZ0A 1SXJA 4DC9A 3LVRE 1MV5A 3NDPA 1L4YA 4M1WA 1XZQA 2I1VB 2C95A 1U8YA 3FWYA 3FHCB 2LCFA 3KXIA 4I1OA 2VRWA 4LX0A 3EPHA 4G5GA 3K9NA 2A5FA 1RE0A 4OK3A 4P4UA 4YMSA 1XD2B 1QZXA 5JEDA 1P75A 4RD0A 2F43A 2QQ0A 3ADDA 4R2IA 5CM9C 3U4QA 3IKJA 1Q22A 3DL0A 1SGWA 3WMFA 1T9HA 4LUCA 1UF9A 3WYGA 1UBCA 1UEJA 3VNVA 2FDCA 1CP2A 3CPEA 3OESA 4G01B 4A9AA 2YYZA 4YQFA 1VHTA 2IS2A 4PAQA 4C0JA 2OFXA 3BH7A 4LBWA 4LJYA 1GOTA 4Q00A 2WJYA 2ZITA 4MGKR 4B2LA 4V0OA 1FMJA 1SVWA 1E2KA 2RH5A 2JIZA 4LJAA 1F60A 1OH7A 2EFDB 4PPNA 2IA5A 3CRQA 1D8TA 3U61B 2ZSAA 1N5KA 1QHHA 2EWVA 1FMLA 1KHTA 1OYWA 5JCZA 1G291 4M9SA 5EXTA 4DCTA 1YR6A 2CHQA 4E5UA 2BVNA 2LKCA 2ZJZA 2WJJA 4ZDWA 1NVVR 3AF0A 1D2NA 2FNAA 4GOKA 3MLEA 2C78A 1Q21A 4P32A 4DBLC 1UM8A 2JATA 1EX7A 1YRAA 2N1BA 2QMUA 5KYKA 1OT3A 4XD7A 1DG1G 1W46A 1FL9A 2D7CA 3PV0A 4ZKEA 1X6VA 1KGDA 1ONBA 4LHVA 3SBDA 4AC9A 2JLZA 1GTVA 1X86B 4HZUB 3TQFA 5EP4A 3P4XA 4B3XA 4ESVA 2O8EA 2B7CA 1EFHA 4DWJA 4LV6A 1JPNA 3BXZA 2QP3A 2FEOA 4F7WA 4ZDKA 2PZFA 3CNOA
chains in the Genus database with same CATH superfamily
2W98A 4F11A 1DKPA 3BDIA 1YQEA 4RTPA 3V33A 1TYCA 2JF0A 5FYDA 5K0SA 4TQAA 3RFVA 4ZV4A 4O1IA 5JAOA 1J0EA 1EGVB 4CR6A 1GG9A 1ZIDA 2VDMB 3N8HA 1W581 4L76A 4Y2SA 3QBJA 3TKLA 2GQ0A 2A67A 1J42A 1V5GA 2MSKA 4O4JF 5CDYA 4P7KA 1MQ9A 3AG5A 3EPRA 5EE5B 5K09A 1UKCA 5GJCA 3B1KA 2YIVX 4A0QA 3B38A 2QMOA 2X1VA 2GWHA 4P82A 4AMZA 4BKOA 2JK1A 1FIUA 2H54A 1KARA 1TYEB 4W5RA 1W52X 3H4TA 3L4BA 4Y2QA 5AOVA 4Q7JB 4B6RA 2ZYWX 3I12A 2XUAA 1JWBB 3U1TA 4I9UA 4NMHA 5JWOA 1RPTA 1SZPA 4Y6QA 5K0NA 1U0RA 4FYXA 3KWJA 1ODIA 2VJNA 1FFGA 3A3OA 1G5HA 3SNKA 4EK9A 5GV8A 1VRWA 2LW7A 3FSJX 4BJ5A 5KTRA 3USZA 1KH2A 1IEVA 2QM8A 3K05A 4TTVA 2FLKA 4FILA 4O6VA 5DLDA 2WSBA 2HCRA 1FNSA 3PUIA 1H2ZA 4Y30A 2WKRA 3RYCB 1IQ0A 1VMKA 2IWRA 3X1KA 3MQ4A 5JCJA 5FQOA 2X8LA 2W00A 4M4SA 4ZVOA 3K31A 4BZPA 3ZH9B 3EBPA 1JDSA 2Q5EA 2O8FB 3HSYA 1G3IA 3GJ4A 3EZ7A 2XD4A 3KZCA 1X7ZA 4JLOA 3C45A 3QENA 4NPHA 5T6BA 3BSWA 5LOVA 2IX3A 1BXGA 2QG4A 3GDHA 4Y2GA 3WMEA 4NU0A 5FX2A 1S89A 3WK9A 2NU6A 3H1AA 3DBIA 1X1AA 1D6MA 2H1SA 3U7HB 1I94B 1FFBA 5B1EA 2WHPA 2Q3HA 1KDVA 1J0XO 1G2QA 2DM6A 1Q0ZA 1TX4B 1KS2A 2G9VA 1Q57A 3AQIA 4FCTA 2GDJA 2Y0PA 2C1XA 2Q5LA 1QHSA 4NCNA 2O6LA 4AKGA 3HV0A 1IN8A 2A33A 2XB9A 4GM1A 1MOQA 1I5RA 1C4KA 3VR6H 3ZY3A 1Z6YA 3RLIA 4CG2A 1GR1A 2QAIA 4BLVA 4Z86A 4JMPA 1JSLA 4NBWA 5LVAA 1Y33E 4RHTA 3RGWS 1Y63A 4DQKA 2P41A 1DBQA 1C9DB 1X8KA 4BEJA 5ALRA 5LP6A 3RU7A 1HTBA 3D7KA 2P78A 4BQRA 4I4IA 3T1TA 1YJXA 1P81A 2ZWMA 2LGJA 3EFOA 4JHLA 3CM0A 3Q1KA 1RLTA 1RZVA 1C81A 3I5AA 2DPMA 3UCEA 5B55A 2NO5A 3W3AD 3ZS9A 3GLTA 5LXTB 1EK6A 1SBHA 3D7LA 1CQZA 4FW8A 3J7AC 4FDTA 4G37A 4ER0A 3K5IA 2NPIA 3ETCA 5LQJA 1XVVA 3JS5A 3DHVA 1TE2A 5CBPB 1OA1A 5LOVF 1NJ6A 5ED0A 5LR6A 1OAOC 5FLXA 3C3PA 2WF8A 3AHCA 3H5TA 2P9YA 5REQB 1EVJA 1KAQA 5K4GA 2OY0A 3IO5A 5KCMA 1WMAA 3QV1A 1EFAA 4BN0A 3D4NA 4BMOB 2Y92A 2ZBQA 1RKUA 3TTYA 4CF6A 3R6TA 1GPUA 1M74A 1WCYA 3H04A 1JNXX 1VHQA 2QN9A 3KAQA 4DC1A 1FVHA 1U9ZA 5DHSA 5BN5A 5BPHA 2Z6AA 4GM4A 3PCRB 2ORVA 4ENSA 2C57A 1XQYA 2IYXA 2Q5HA 5BOVA 5C1IA 4WBNB 5JAUA 2A30A 5JEEA 2PX5A 1K66A 3I0MA 4J0GA 2C2GA 1K6MA 3B1JA 3DM9B 3JQAD 4L02A 1M7GA 2C7GA 1LVUA 5BXYA 3R5SA 5HF5A 5IT9A 4GH5A 3B3AA 1BTOA 3BH6A 4KAFA 1SBYA 1R3DA 1K08A 3T7SA 1RXYA 1A1VA 1A9RA 1WV0A 2CLKB 4BJ1A 4OKSA 4OJQA 1WP4A 3TW0A 3WMXA 1Y3IA 2I66A 3LL7A 3DTYA 1Z2NX 2B8WA 3GOQA 3PYMA 4PO8A 1ELOA 5GZ1A 4LNUA 2YZGA 5LP6F 5FP0A 1F1JA 1X1TA 2P2LA 4Y7CA 4OFBA 1UBGA 1BIFA 1SCAA 1X87A 2QZ9A 4QBGB 3RODA 4OHUA 3SHOA 3U0VA 3UAVA 2IZ5A 4D4MA 4B1FA 1LW6E 4HNAA 3DUFB 4G85A 4KKVA 5MF6A 5LQKA 1LW7A 2P5TB 4OQPA 5DTJA 3V3TA 1TGYA 2JJ2D 3E3NA 3ZVNA 2YC2C 6LDHA 2ZYUX 4N3BA 3HN7A 4YJ3A 3M82A 5HJ5A 2XUIA 2GZ1A 3F5SA 3QU2A 1PZFA 1LSUA 3H9QA 3HRKA 1O7JA 4LXUA 1Z18A 3LPLA 4WA8A 4WXEA 5AVWA 2GK6A 2HB6A 1XQVA 4UPVA 4RZXA 1MRSA 2Q3EA 4NI5A 5YASA 2I4LA 4DKXA 2IZ7A 4HUTA 1RHMA 1VLQA 2O07A 1CRZA 2QJRA 1Y1SA 4BO5A 2D1RA 3IR7A 3OETA 1C1YA 4L2IA 3VU0A 1E1QA 1FP7A 1DUIA 1TQ2A 3KPYA 5JNRA 5CB6A 4NZZA 4E30A 1J1UA 1JDBB 5F51A 3LSTA 1OAAA 4E22A 3IJ5A 3ZDRA 4B6GA 4Q9IA 3HGMA 5E6UB 5FORA 3GLIB 1KFJB 5BUSA 1Z4QA 2GI4A 5FKJA 3TLAA 2F59A 5TQVA 3BC1A 2VQSA 4PLHA 1TT5A 4JJKA 2PK3A 5FUYA 3O90A 1KL7A 1JDPA 1ND6A 1P7ZA 2JZOA 2VDUE 1YBAA 2WTMA 3KBBA 3LGXA 2EZTA 4UUQA 1H2BA 2D1QA 2D13A 2GAJA 2ZS9A 3DVQX 5TQ0B 2QE7D 4X7PA 3VDRA 1H4SA 1T3TA 4JEHA 2ASVA 4ACBA 1HETA 2FZKA 3ORFA 1KO1A 1Z2PX 4GOLD 4LDJA 2AE1A 3UGQA 1H8ED 3NAGA 4OXNA 1JLRA 3S2YA 1BXKA 3ZVLA 1FJ2A 2YBEA 4UCFA 3TMYA 1JVBA 4X45A 3WIEA 3H2ZA 5IF3A 5EESA 2ZYAA 1N6OA 4M1MA 4P33A 4LYEA 1D09A 2WAXA 1VG8A 1UK8A 3I30X 3R9XB 1Y9DA 1XL0A 4M6WA 4R1PA 4YJ3F 4IRUB 4YAFA 3IOEA 4CQLA 2QV7A 5BN4A 5B4TA 3UYLA 3PQ4A 3CINA 1RYDA 2HT6A 2R6CA 1SAYA 1X1EA 1XXHE 3EZ2A 4H7FA 4MUYA 1W85A 4F8EA 5GADl 1AKQA 1SXQA 2ODBA 3HL4A 3QJGA 1DELA 2EEZA 4IKPA 1C3OA 4XIIA 4XWGA 2EZ9A 3T7EA 3VH1A 2QNIA 2R68A 3BWEA 1Y7IA 4UVEA 3WK5A 1U6IA 1W5SA 8ADHA 2XYRA 1IY1A 4ETWA 5FUQA 3OTGA 1DSSG 1KI3A 1XFAA 2CEKA 1E0DA 5BWLA 1YDMA 1UPTA 2FRDC 3BSFA 4AP5A 2D62A 3FPBA 5F5XA 4TVSA 3LYAA 3LIPA 1DO0A 4G5HA 4ZRNA 2IKQA 2QP9X 3WYFA 2G9QA 2YH2A 1JR4A 1JIIA 3FLMA 2DBQA 1KMMA 4FDVA 3TZLA 2DFPA 4LTNA 1FUKA 1PGQA 4OYLA 4XIYA 3ZQUA 4IUBS 4RSGA 3DOHA 5C7IO 2HJ9A 1Z0FA 2O8CB 5K3CA 2HWXA 4HRAA 5JISA 3GN1A 1J9ZA 1OASA 4YASA 1VE6A 3IVGA 3TKAA 2O1XA 3BA1A 3UAYA 4Z7NB 1XHEA 2G25A 1O97D 3D3QA 1YR7A 3NUQA 1TCUA 2ZJYA 2JI9A 3SU8A 3AB7A 3HYTA 1GLVA 3P2KA 1R9JA 2GBCA 2QTMA 2RCYA 3R4VA 1NV8A 3JAWB 4KXMA 5EIEA 4PBRA 5H3HA 3KT3A 3OECA 2L42A 4F7DA 1XC7A 3SX0A 2VHUA 2F4VB 3RHTA 3RFXA 3DV9A 4M1YA 5KAPA 2NVUB 3CXRA 3HXOA 3OU6A 1E79A 3AHJA 4G0XA 3VR1A 3Q9LA 3HPRA 2P3QA 4DHWA 3B12A 4QQRA 3KL4A 4NDZA 3MTBA 1MA3A 3KVNA 4EG4A 5BWMA 4K2HA 1JJBA 4Y9RA 1LZLA 3ABRB 1HM5A 5C51B 3L0SA 4HAIA 1SD5A 2AR7A 4E5SA 3ZHTA 4PSAA 5DM1A 3S68A 5I3CA 4G26A 3AM4A 3N2NA 3WWZA 1JG7A 5ED4A 1FFCA 3EQ7A 5CH8A 1M6NA 3DTVD 1QVWA 3DEJA 3FAZA 4GSLA 2CNLA 4ZQFA 1H0SA 2VP0A 1FTNA 2B82A 3MRSA 4FFOA 4IS2A 4CFSA 5L9AA 4HSGA 4ZO6A 2PUDA 2O8FA 2RH9B 4RK5A 3UWMA 2Y9PB 5F23A 3GLIE 2HEIA 1L5KA 1AM4D 2O3TA 1NLUA 3ZDQA 3G0HA 2Y1XA 1VHJA 2C97A 3PUJA 3EB9A 4G67A 1ISHA 2EG9A 5B1SA 2O2SA 3OM1A 3UJCA 5A4IS 1J9EA 2WIDA 1X7HA 1JVSA 5HEKA 3TRDA 4F6LA 3WBKA 3HBMA 1Z8FA 2AE2A 3K9WA 3FJOA 4MVJP 1I6MA 2OO3A 3D1VA 5LDDC 1WUYA 1JXQA 4RK7A 5AHOA 3THYB 4M76B 1S1MA 3C48A 3ZU6A 5KQPA 3NDIA 4BMXA 1YZTA 4MS1A 1HURA 1TJPB 1Z7YA 2DBYA 3PNKA 3SE0A 2F3SA 4F72A 5TLSA 4EJ2A 4JJFA 3VKGA 5KWEA 1XX6A 1XLWA 1VLJA 1KQNA 4QATA 4KQFA 4Q01A 1CVIA 4XUEA 3FFAA 3ED1A 3KNZA 1EUQA 4ZZIA 3H1PA 4FGSA 5DTMA 4F45A 5CM2Z 4UHFA 1SCUB 1AT1A 3A1EA 2EJVA 5KB3A 2C3YA 2G06A 2FCAA 3VNAA 3WBBA 5INTA 3FTQA 3GF4A 2JNWA 1FY2A 3EGWA 4MEBA 3SSMA 1SG9A 5MFZA 4QUAA 1S6YA 2HRDA 2Q0HA 2Z4TA 1ZDMA 1TQHA 4LEIA 1ZXXA 1PR3A 1VE5A 4IIXA 5DZSA 4NCIA 1XJWA 4DRZA 7ADHA 5KTTA 1P2VA 1HORA 1PWXA 1I2CA 1T0PA 1XMXA 2QR5A 3DE0X 1XMVA 5F78A 2OHXA 4EUKA 1XXHA 4UTVA 4KR0A 2O7RA 1GCAA 1VHDA 3C7CB 4MMYB 1GNQA 2FK8A 1JHMA 2WP0A 3BORA 3WSWA 2QT1A 1B0ZA 2HYIC 4OV6B 3NEYA 3KR0A 2H9YA 1J2RA 1ECLA 2FPOA 2R7KA 1PR9A 4MKXA 3CCFA 3U3KA 2MCFA 1NOIA 3WTBA 3KYIB 3NOQA 5CITA 1MHTA 1AN9A 1W59A 3BTOA 3OG9A 4LDQA 4W5NA 4LXIA 2PX2A 5BT8A 2PD3A 3KFVA 1N2CB 5B7PA 4W8OA 5TXGA 1GGVA 1EYZA 1Z28A 2QLBA 5AKLA 1K0FA 4Q1FA 3K0FA 4YB8A 4Q9JA 2SCUB 1KZ7B 3A1NA 3N6XA 4CN8A 2XE6A 3OPNA 2PWPA 4OM7A 4RL6A 3OCWA 2VK2A 4BAUA 3IPCA 2FR8C 3MILA 4CU5A 5JDIA 4FK8A 1F12A 2JCXA 4IIEA 3TW8A 2QTTA 3ITNA 3AI7A 1BN7A 1S8OA 2EKZA 2VP6A 4M1TA 4C20A 4XGRA 3A04A 1YZVA 3DUFA 3HDGA 2EGHA 3Q7IA 3TJMA 4W9RA 3L6EA 4B4DA 2CL5A 4E5YA 1AKYA 2FPIA 3AH8A 4JGBA 2VF5X 4BP9A 3ZQJA 3PNMA 1EE1A 4X60A 1OGYA 3E70C 2QRGA 4QBFA 3SOZA 1R0YA 3SZGA 3DBHB 3V9AA 4E5PA 4YCCA 5L3SB 1JFFB 2ZTHA 1NFQA 4UU0A 4M7PA 1D9ZA 3SJAA 4UNRA 1US8B 4LBZA 2WWXA 4EHFA 1E20A 3FPKA 4UFPA 1W0CA 1YL7A 3GLVA 3ICCA 5EQDA 3BK2A 5KNBA 2AN3A 4YFVA 4DJAA 4ROTA 5K4AA 3A32A 1Z4LA 5KEIA 2AOXA 1MB9A 2R6GA 1AO3A 2XYPA 4MCJA 1P29A 3DWEX 4LCBA 1LWNA 1BHO1 2HUPA 2AJLI 1GCOA 2XDYA 3H9EO 3JALB 3OX2A 4ZT4A 4BFXA 3T0IA 5IKEA 1LV7A 4G1UC 4WUTA 1NJFA 4P1ZA 3HFSA 1MA0A 4IHKA 5E6UA 5EINA 3UXHA 2BEKA 3UOGA 2GS9A 4CMIB 3GLIA 5LD2C 1UANA 4G5YA 3O8QA 4GDMA 3C4JA 1RFGE 3MHPA 1T3HA 3BD7A 1P60A 3HGQA 3LQ2A 2J07A 3PX3A 4QFDA 3KQSA 4OLBA 4F3NA 3OC0A 3PFHA 3KVVA 4HUJA 1DDIA 1XHLA 3M33A 4XVRA 5DDIP 1FMTA 4YT8A 1II9A 4ZO8A 5FOWA 3VHRA 2E55A 1O95C 1XVTA 2JFZA 2Y66A 4H1TA 3A1VA 1XZGA 4G24A 3UFBA 1SUFA 4BQSA 4D4LA 2JFPA 2O8NA 4H4CA 1JR3E 4A0HA 4IFTA 1HMPA 1PYDA 4ARIA 1EA7A 3LFTA 1G5PA 3MCZA 1GGJA 1N5DA 3K1JA 4IEEA 3FI0A 4NAUA 1OILA 4TSKA 1EGHA 2VHZA 3F1LA 4G84A 3SYRA 1W93A 4DSTA 4F6RB 2B1JA 1N6KA 1E0SA 4BQFA 3HXQA 5J63A 5GTDA 3OQ1A 3SIPA 5F21A 4QRHA 4B4VA 4ZEVA 3CF2A 3FDIA 6AT1A 3AF6A 3GRZA 3KUXA 2F17A 1RBMA 4X92A 6REQB 5K0FA 2HO4A 4EY5A 4AQYB 2VPZA 2RHCA 3CPHA 3QQ5A 2QS9A 3ESAA 2IIBA 4P3YA 2C9CA 1IQRA 2E0IA 3ANMA 2JKYA 4AJHA 1KDYA 1UKVY 2X40A 4FOPA 2VTVA 1DCTA 3V42A 3ZDBA 3C8DA 3V7WA 1VL5A 3WGLA 1JEDA 4TROA 5E8JA 4J90A 1X2BA 1YQQA 1N2CE 2AG6A 1CJUC 1DNPA 3T5AA 2Y0BA 3TBFA 1M1ZA 2YWJA 5AI9A 5GIOE 1J00A 4DKJA 3LD9A 2NW6A 3V8EA 1JSCA 4X62B 3KQVA 2YRXA 1ZX1A 4A8HA 1F0NA 4HEA6 4ZI3A 1C0KA 1PT6A 1QH8B 1QYDA 1UR5A 2CXSA 4GPIB 2H1CA 1ZNYA 2OA0A 3W34A 2XLCA 4BN5A 4YRGA 2C4UA 4Z49A 2CK3D 3UHPA 2J3IA 2UZIR 3K92A 3NBFA 4LC9A 3DPSA 4HFNA 4D82A 4IM7A 4RMHA 2ZQZA 2RGYA 3TB6A 2WF7A 4NF2A 4EHBA 4NPAA 1MDBA 1KRXA 1YXMA 3DE5X 2W8BA 4A26A 1X7XB 4J1TA 1M2OB 2G1PA 1KZGB 2QTCA 1UM9B 1N34B 1HO3A 5JCOC 4GBGA 1BMTA 1KOLA 4PXSA 4I66A 4BO7A 4TS9A 4DUGD 1QCCA 5EIFA 2BY4A 2WT9A 4WZZA 3U5TA 4IBOA 4EARA 2B1QA 2FEAA 2RGBA 1EVKA 3HUFA 3K15A 3D3NA 4Y1FA 1RHUA 1E8MA 2O7QA 1K7EB 1TZMA 1T5SA 2F90A 1WULS 3L04A 3PD7A 1USIA 2I87A 5G53C 1YS1X 2VCYA 4ZYUA 3LRPA 1TVKB 1U04A 4OP3A 5H0IA 4DLVA 3N8GA 4J1SA 4QTTB 1D4AA 3TTXA 3NC0C 2L69A 3AHDA 521PA 3SVLA 3H3FA 1PL8A 4J3JA 3T1VA 3L8EA 4H6VA 2OILA 4J7UA 3VDXA 1QFMA 3TL3A 2XDWA 1CNFA 3A25A 2WTUA 2XNSA 1UPUA 2NSHA 1QV6A 1ZIYA 1FFXA 1KSFX 4IKOA 2W4QA 2ERYA 3PEVA 5FPTA 1ULSA 2CBGA 4ZV7A 4K88A 3PXGA 1CT9A 3TDNA 2QX9A 3UMGA 3W8RA 1T4MA 1BD3A 1EDEA 1T0JB 1XEFA 3M1LA 4ZVTA 3VAZA 4YCAA 3SKVA 1KQPA 4MRPA 2Y93A 3M6AA 3DVLA 2V7XA 5FWAA 5A4AA 5ILQA 5BSKA 1P9WA 2P9EA 2II6A 2CD7A 3GLHB 2EARA 3WDLA 1LX7A 2V55B 2WWWA 5JFTA 4Y18A 3DDOA 4NPCA 4ZOCA 4YWHA 3U1VA 2F00A 2Z0MA 1KC1A 4NK5A 3ZXIA 1QCDA 4CFZA 3L8GA 3T5TA 2J5KA 2P6NA 2VNSA 4MRSA 3CMMA 1SCUA 1G59A 4WVFA 3SYKA 3PX2A 5J4VA 3BCHA 3LVFO 2GUWA 3E1GA 1NE2A 1FXWA 1JR3A 1QQ6A 2WSIA 3WXBA 2ZWPA 2KBFA 1CQIB 4MB6A 5A3QA 1NN1A 1GFIA 2G1KA 3GJ3A 4Q3NA 4WFIA 3BYZA 2GEUA 1M54A 2D74A 2PR2A 1PFUA 4H18A 4RLFA 1P6UA 4PYMA 2R8RA 1EDOA 2A0XA 1ZCBA 3CWQA 1KP9A 1QDLB 4N8EA 3HCDA 3EGCA 1U7ZA 1FDOA 1AXGA 3JQAA 4CL3A 3GFFA 3G2LA 4KLAA 3BSYA 3QF4B 4U0KA 1TUBB 2BGLA 4D9KA 1GZSA 1N5LA 1UT5A 3DOFA 3SOOA 2A5JA 3INRA 5CPBA 2BKLA 1KOFA 1PWHA 2BEVB 1U2ZA 3L01A 3K6KA 4NE9A 4P58A 4YMLA 3NRCA 1N2CA 1CY6A 4KV7A 4DSUA 1XZFA 4M2LA 2Q9UA 4IOLA 3BD6A 3K4QA 3UM9A 5I7OA 5KWVA 3PD0A 5E4TA 3EAGA 3PNYA 3HUUA 2SCUA 4NNJA 2Q0SA 4W99A 4YV7A 2VH1A 5CB4B 2GN2A 5E9AA 4Z0TA 5SY9A 5BV2P 2QB5A 3NTQA 3CKMA 4P22A 1NC3A 4R2KA 1YS4A 3O9VA 4ZHSA 3EH2A 2V45A 3FIUA 3SEZA 1FXWF 3F96A 2XF8A 4HZIA 1G3QA 4ZP1A 3ONFA 1X8JA 1C9YA 4PTZA 3ORRA 1L7RA 3ZWBA 3OLXA 3TBKA 2QU8A 3NEJA 2VK1A 2YZKA 3CV3A 3PPVA 3EYAA 4MYDA 5FBWB 3L8CA 4CM9A 2RJOA 3K1AB 1GU0A 1F8UA 3Q5GA 4XUGB 3R0QA 2G0NA 3DBHA 3EVEA 3EY9A 4LF7B 1JFFA 2I7XA 3ZI7A 2J46A 1I6KA 2YWHA 3HBJA 2BJVA 4JR0A 2WRZA 3R7AA 2Y1DA 2G5PA 2Y4NA 4PQEA 3VR3D 5AJZA 5KTSA 2WB4A 3K8ZA 2Z08A 3ND5A 4HEHA 2AD1A 4GZ5A 3WYBA 4DLBA 1ODKA 2GA9A 1PSDA 1VZ3A 4XYBA 4EQ6B 3DMYA 2G7ZA 3M4JA 1TW2A 3Q12A 4CM1A 4PHGA 4U7HA 2R4TA 5HK8A 2BLNA 1EP1B 1Z37A 4BMNA 1PX0A 3SSAA 4BXOA 3RSZA 3GARA 1FDVA 3W9YA 1RC0A 4EUNA 1ZR2A 4PR0A 2ZWAA 3UJ8A 4XGQA 1H8EA 4OYYA 1YVDA 1E9DA 1FP2A 1JV2B 3PHLA 3GLHE 3WYDA 3KKOA 1XCPA 2JVKA 1U63A 2FSUA 5EQFA 3P9ZA 2WAMA 3M4YA 4HPWA 2EJUA 5AKGA 3TVYA 2C03A 3OM0A 1HFJA 1Z4JA 2NO1A 4QSHA 5AI8A 4KR7A 4NBKA 3QWFA 4QL3A 2A4MA 3MS2A 5D6NA 2XEDA 3LAWA 2VH2A 4Z53A 3A36A 4FCWA 421PA 1XDSA 4G2TA 4NS4A 1XD8A 2ILVA 2ZRCA 1C1DB 4KITB 4BPRA 5AVRA 1DJOA 4YCDA 1G7TA 2VI5A 4ZPXA 5E9JA 1N5MA 1RLJA 2BCEA 2C1ZA 2IUSA 4ZYLA 3CEHA 3VVCA 5LYJB 2CW5A 2FZ5A 2D06A 2BBWA 1ZM2A 2X58A 4A8JB 1NLMA 2I3BA 3K0AB 4F6RA 3OQNA 3AYXB 5I9MA 2HNAA 1VKOA 5BOSB 1XMJA 1ZJ4A 1K1EA 1CQWA 1TI7A 4KI0A 2LVBA 4KHZA 4MW0A 3OBIA 3AHEA 3GFRA 3U0BA 1OLXB 1AQJA 3F4LA 6REQA 4YRDA 1SUIA 5HA5A 1UCFA 2ZAGA 4UASA 1DC5A 1EE2A 1ZJZA 1ZXLA 2HSDA 4PNPA 5CK4A 1FS6A 2OYCA 1TYDE 1VCOA 2A4KA 2ZB8A 4ITUA 3VX3A 2EZUA 4UTOA 3OJWA 3F6CA 5CT8A 1IK6A 4L7VA 4PYQA 4ZQEA 1Q7EA 1KAEA 3BKWA 3CRW1 3HYNA 3A6KA 4UM7A 5AXCA 4OUKX 3IAS1 5HYVA 3KSBC 2ZRBA 2YWCA 3RWMB 3ECSA 3NB0A 2CXUA 2I3AA 2JJMA 1KSJA 2WMDA 5F1PA 5C1PA 4L5JA 4Q4JB 3SJ7A 4JBYA 4G0WA 3ZIAD 2NN3C 2FU5C 2B4AA 3K2EA 2P67A 3QZUA 2WWFA 4OBBA 3V8BA 3O2SB 3IB6A 4A0FA 2WJGA 1QH8A 5F1OA 1J5PA 1JHXA 2GZHA 1WA5A 1SOAA 1XQXA 3KLBA 4JI6B 1NNUA 3EZ6A 5CCEA 4OATA 4JB8A 4CETA 2VYFA 1CJSA 2DBRA 4YJDA 3QLUC 2FG5A 2HMVA 1WSBA 3ECCA 4NDNE 3ED5A 3N76A 4RGYA 2CJWB 3KOMA 4QJ4A 4H0CA 4X71A 3WISA 3LYHA 3ZHSA 4OAPA 2H2IA 3ZHBA 1FBNA 3BXGA 2PX0A 1X7XA 1M2OA 1ENOA 1HDYA 2BMFA 1UM9A 3C43A 3LWZA 4X85A 3V8RA 4W8HA 2IHVA 3X2FA 4D43A 5IDXA 3O1IC 2O0LA 5KNCH 3AGQA 1ZI6A 2GD0A 1NBWB 3M5CA 3OP4A 4L6CA 5E1DA 1QGAA 4MUXA 4W5OA 2YVUA 5EEGA 1T5OA 2XQFA 4JJ7A 3ZLUA 2ZRNA 2P9CA 2XYGA 2YYSA 5KQRA 5H4GA 2R87A 1ODSA 2GSWA 3BAFA 1U1CA 1RS0A 1TVKA 3THXA 1I9GA 1PWEA 4WZAE 4BFZA 4PN7A 3IKMB 1CUDA 4AG5A 2FJ0A 1W35A 4BVLA 1P2TA 4TXJA 3MUFA 2WA2A 4QAQA 2CLEB 4HS9A 1Q14A 1PJCA 1AB5A 1WWKA 4QYWA 4OBXA 4DE5A 4EI7A 3L4EA 1Y5NA 1II8B 1V47A 2ZTMA 3M1YA 1SCIA 1JT2A 1UDXA 3PNPA 4KRYA 4L8GA 4BP3A 1YZLA 5JMPA 3VOAA 5DX0A 4Y2UA 3DZBA 4GUDA 5DP2A 4CLOB 3IIKA 4Q7QA 2PO5A 1VBFA 3Q72A 4OQYA 5BUZA 4RIFA 4EGCB 4B3SB 1KOJA 4RCYA 3HU3A 2W2OA 4HRVA 4JJZA 2HHCA 5GQSA 3VQTA 1WSAA 1N2EA 2C96A 4FI3F 3FMIA 1T9BA 3GLHA 1O6FA 3L06A 3K1YA 1I3KA 3BMQB 4MHSA 4TL7A 2C2ZA 2O2HA 1U8UA 2VZ9A 3KYDB 3ZV4A 2OC9A 1XPRA 3HSSA 5CLGA 1WS6A 1HNNA 3O0DA 3I8SA 3KKQA 4ZU3A 5M04A 3JCZA 1M34B 3BEOA 3QJYA 4W1SA 5DSXA 3RVOA 4FJ2A 4NECA 4C0XA 1BD4A 1KSHA 2N1MA 4RTOA 4B6OA 1O89A 5KQMA 3K9CA 5JSZA 3R0ZA 1ZFNA 2DQZA 1QIFA 4U7JA 4A6DA 3OOEA 1JR6A 4HB2A 1F48A 2ZAOA 1CQIA 3BBLA 3OQIB 3TKYA 3BMXA 4XM1A 3F1KA 3DXFA 4O3MA 1VKHA 1CUVA 4HADA 2UYOA 4MUEA 3KALA 3GRVA 2EFGA 3EOZA 4YH1A 1EINA 4JLDA 4ZCQA 3LUFA 4LJ9A 1G7RA 3ONDA 4OQNA 1Y4UA 5CGQB 4DNQA 1WDLA 3IMGA 4C6TA 3SJBA 1JKXA 1TA9A 3AHGA 3BN3A 4J4TA 3I05A 2WILA 2DPXA 2IY9A 1THGA 4CHGA 1C7FA 3JQPA 4L07A 4LFAB 1N1DA 1LLDA 3CB2A 3C7AA 1W48A 3WL4A 3QF4A 1DRWA 1TUBA 2ACWA 3NWEA 5L95A 1ZH0A 2Z8XA 3EEQA 3FVQA 5KSZA 3VNSA 3ZCQA 3UA4A 2P9JA 4TV8B 1RMYA 1PHPA 4WBSA 1CDOA 1FDIA 3DP9A 3H9GA 2ZRHA 2BHLA 3BHNA 3P2MA 3UB2A 3FFXA 1E2JA 4LJ6A 4H4EA 1BE8A 2PL1A 3RSGA 2QD5A 3LLVA 1JMKC 1T2AA 3N9IA 4J0HA 2B8TA 5TY0A 1NP6A 2J32A 5CB4A 5IT4A 4JOSA 2WSSD 1F8YA 5FJJA 1XNJA 4MNTA 2V9ZA 2PBFA 3O4GA 3NBZC 1E4VA 3DFFA 3NNSA 3QH4A 4KIUA 1WXXA 2BLLA 4WH0A 1JTFA 2O3RA 4N7RA 3PENA 3U48A 2WFZA 3ZVMA 2B3TA 1NVMB 5HX7A 1UMCA 2AH5A 3EXEA 3EXG1 4HFJA 5H68A 2ZJ0A 3K1AA 4C3VA 5CXUA 4R3UC 1J21A 4INPA 1FZQA 2CZGA 3FPGA 3IP6A 3ZJ5A 3PHIA 1SQGA 2W43A 4DSOA 2WYWA 3G85A 4RENA 5AIBA 5IC4A 2ZETA 2AKAB 2VYND 3RHSA 4D3FA 4K0KB 4KO8A 2HREA 2HU2A 2Q46A 1GCUA 1LJUA 3EH1A 4FW9A 4BFUA 4WZAA 3PNLA 2Z3WA 3N58A 1LTQA 2OBYA 4AS2A 1FJGB 1V25A 2DHRA 1LA2A 1RRGA 3GRYA 5EIAA 5EXPA 1CBUA 3JWJA 4AJLA 4JXXA 4M87A 4YP1A 1GADO 5I7WA 3C7KA 1FPQA 4W5TA 2HR1A 3S3TA 1YDFA 5I4KA 1BMFD 4PZPA 3GDGA 3KXDA 2OHVA 3W6NA 1EWQA 3T35A 1DKMA 2H5IA 3L0BA 3PIRA 4RKYA 3RJMA 5IWAB 1XZIA 1ZW6A 2WMOB 4BC1A 2FUEA 1E3MA 2ZSHA 2QN7A 3IAAA 4HKTA 3C1TA 2V3CC 3N2LA 2NVOA 3N2ZB 4CZ2A 3E18A 3T5GA 5SZJA 4CCYB 1RPZA 4QJIA 5CB4F 5ISMA 4UEWA 1IUNA 1M34E 4NC9A 4EFDA 1A98A 1TTQB 4ZC8A 4DCJA 3HKEB 1JKFA 5BQ5A 4TMVA 1X74A 2Q62A 3JQEA 3Q3CA 4GMDA 3Q11A 3L7DA 4KG7A 4ND6A 1V96A 4TTQA 5LL6P 1RAIA 5E2IA 4YLYA 2R0QC 2XJ9A 3PUXA 4DADA 3GRUA 3X0DA 2QRNA 1THTA 3EEBA 3TSZA 1O6ZA 5BVGB 1WETA 2IUFA 2GN9A 5LYJA 1DMSA 2C0CA 3GXOA 5CNIA 4B73A 3GVPA 1EEXB 2YBDA 4BY9E 3D31A 2X4LA 2WVAA 3C3DA 1ECJA 1TM2A 1IVSA 5BOSA 1NUTA 5HCNA 4MQFA 1QGOA 3PXCX 4BP8A 5G0WA 3UT5A 1MB0A 2Q5IA 5KYXA 4O8ZA 2Q1UA 4K6GA 5SZHB 1KDPA 1OLXA 1H2YA 3DAGA 4MITA 5BNTA 3KUCA 3VO9A 2CSXA 3LVBA 4W8GA 3S70A 4DXAA 2IF2A 1Z8NA 1TCCA 1J2EA 1T25A 2I71A 1H94A 4IDDA 4KL8S 3FZEA 3TUJC 1XZAA 3AU9A 3ZBPA 4G5FA 4KGXA 3U44B 1G7CA 1K9VF 2YV3A 3AVTA 2YOGA 4HXGA 4RVCA 5TJ9A 3LC7O 3DLPX 3MT7A 4WJZA 1KAHA 3UN1A 4JIGA 4JXKA 4CE6A 1E1RA 2ZYSA 2LRHA 5AK3A 1D0IA 4Q4JA 1ICEA 4R9SA 2I8CA 3ZQ4A 2DRIA 1AQLA 3CWZA 4G9BA 3LUPA 4RTMA 2BRUA 2QMEA 2QE6A 4M60A 4QGGA 3BFVA 4TKUB 3H05A 2BFEB 2I6TA 1JQJC 2QLMA 2YXEA 3T6KA 4LXHA 5HTOA 4KXQA 1FTYA 2FW7A 1DXHA 4J76A 2NT4A 4J0DA 1EFLA 3UJBA 2BMEA 2QSUA 3VVMA 1UC4B 2G1AA 3DZHA 3H2IA 2CJWA 4Z9XA 3VPBA 5MDHA 2XUPA 1WW2A 2VVTA 4L5AA 5LYJF 2J0SA 3EGIA 4YN3A 2NSLA 4KYTA 4EA9A 1V71A 5T5QA 5A05A 1W36B 1H6DA 5K3BA 4CMCA 1IRIA 1KMNA 4QODA 2BGJA 3M49A 1NAHA 1P33A 4D9CA 3E22B 1LD3A 3G17A 1W88B 2YXLA 2XVYA 3UCFA 4DYHA 3O8DA 1R5JA 4FOOA 1ZD2P 2V9CA 3OLVA 3AUYA 4PLWA 1CJTC 4YAJA 2WWVD 1YQWA 4FUQA 3RIGA 4CCWA 1M2FA 3M4NA 3OTIA 5BXQC 3AF5A 1F8XA 3R5JA 1GSIA 2V3VA 3DGEC 2PNJA 2ON6A 4YC7A 3IALA 4WOCA 1YVUA 5JRJA 4NXMB 4J91A 2EP8A 2X5OA 3U56A 3NLLA 2P1DA 3WOVA 1CD5A 4AMBA 4E09A 2ISQA 1SKQA 2QT0A 3SC6A 2PHZA 4P4SB 1B6TA 1CHDA 4ZQGA 3RVRA 5CEJA 1II8A 2Q6TA 1JQ3A 4PG8A 1J2TA 3D2BA 4RKRA 5H7XA 3UAOA 1A71A 4D9BA 2RGRA 1BROA 1LPNA 3NWPA 4XYGA 3SQOA 4CLOA 1TFRA 1FX1A 4KQJA 4CMGA 3DJFA 3WG9A 4UTZA 3ZVRA 1ZJJA 1VIAA 3HO6A 4AG6A 3FROA 4JUIA 1DUSA 1XK7A 4XPIB 4YMTA 3LBAA 1CR0A 4H6XA 5DSTA 4ALLA 5JYBA 2A9QA 4KYVA 3NIWA 5K0CA 4CGYA 1DP4A 2WUEA 2DUWA 1HV8A 2WAYA 3P4YA 2AI1A 4FBLA 4MARA 3BMQA 3PBKA 4ES6A 3BCRA 2X7JA 3E9DA 1S2IA 1KYQA 2GYWA 3NYQA 5DFAA 3IP8A 4JENA 1I3NA 2QAGC 1SULA 1WE2A 3CA8A 4KWCA 2B30A 1AQIA 4IV5A 3CKKA 1Q2UA 3FB4A 2PGLA 4JY7A 3U3OA 3ZHOA 5BNWA 1M34A 2E5FA 2YJGA 3CVJA 2ODPA 4LJ5A 4N7MA 1T8YA 4MI3A 4BEWA 1YE5A 1ISIA 2VF8A 4P4NA 1HE1C 1K2WA 4JMLA 2C7OA 3OH8A 1Z73A 4JBNA 1XAJA 1CW2B 2OYSA 4N82A 5DOVA 2EYUA 1Q0UA 1AK1A 4QUIA 4BIMA 4IJWA 1A77A 4ZD6A 4EAQA 1NXTA 2G63A 3WYCA 2R00C 3AESB 4I1YA 1CHNA 5I48A 4XZ3A 4F9GA 2DLCX 3RS3A 1MENA 1Q16A 4FP9A 1YQUA 3N0TA 1HPLA 2HV9A 3E7WA 3NTOA 1RRMA 3QELB 3QVSA 2WBLC 4IUDS 4NY1A 4RFLA 4AULA 1Y5MA 4GBMA 4GLFA 4C29A 2FVYA 2ZRKA 1SUEA 2SKDA 1R0WA 2VT7A 4IX1A 4RA9B 4RVNA 4GO1A 4KJXA 2ZT7A 2D0PB 3QE0A 4WSOA 2HRBA 1VLMA 3G0DA 2EDCA 1NF3A 1DCMA 2P9QA 2VTKA 3GZNA 3ZWWA 5FLEX 2QD2A 1Z2AA 3ZJ4A 3GCDA 1N5IA 2A0WA 1WD7A 4BQOA 1DWPA 1Y4AE 4KXUA 1Z5OA 2YFKA 4FHEA 3KEMA 2WINI 3C97A 4M1KA 1NVWQ 1E6CA 1QLHA 1JA0A 1ZN9A 2GHIA 2HF8A 2IKSA 1E2NA 3G2IA 4IDNA 2MINB 3CY6