4PPNA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
327
structure length
311
Chain Sequence
b'TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
total genus 95
structure length 311
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppnA01
1VYTA 2BM1A 2OXRA 4JT2A 3GLIE 2AD5A 2KSQA 4B71A 4XWAA 2W58A 2ZI6A 3TSWA 2R6GA 4ZDIA 3CZQA 4BLPA 1OT3A 1F2UA 4JLMA 4OJQA 5CM9C 3RC8A 4URZR 1EFRD 5KOYA 2H17A 4Q9JA 4ZIRA 1Y63A 4X8HA 2CNWD 3L0OA 3K0AB 3U44B 1RYHA 3B1VA 3GPLA 1E9CA 1D9XA 2ZE6A 4TMKA 4B2PA 3KFXA 3OIUA 4MKIA 2XXAA 3KXKA 1YZLA 3SFVA 4H9GA 4MRRA 2FSIA 3WNBA 1VG1A 2Y8EA 4P4UA 1G7TA 1G3RA 1OFUX 2ZTSA 3U3RA 2D2FA 3L0IB 3THWB 3BB3A 2VQSA 3NVAA 1G1MA 1E1RD 3OEHD 3QY0A 2IXFA 3WBJA 3ZGXA 1E2KA 1ESNA 4JLJA 1GOTA 4UNRA 3CF6R 4DT1A 4ZCMA 2ZRNA 3BFXA 3PJRA 2OILA 4JBYA 2C9YA 1XD8A 1X6VA 1M8PA 3KJGA 521PA 4ASUA 5JRZA 1W4AA 2PEYA 1JALA 2WWFA 4HYYA 4ITRC 4B34A 1M1YE 1UDXA 1GNRA 1OH6A 4US2R 4LDJA 5A0FA 1SKYE 1FFHA 1IN7A 1X1SA 2V6IA 1YZGA 2XEXA 4N0DA 2CJWA 4JLDA 2XNDA 3BAFA 4GFDA 1CJTC 4KBFA 4LV5B 4PPGA 3QF4B 4AKHA 2DWQA 5F9FA 1XPUA 2DHRA 4AIIA 4HB2A 5J4YA 2ZEJA 3PUXA 3ZVMA 4V0ME 1RPZA 1E4YA 4BE7B 4W7SA 2R62A 2J1LA 3BC1A 4Q66C 3FMPB 5D3QA 3OFNA 1A2KC 4B3DA 4CF7A 5EE0A 3AF3A 4BQSA 4GP7A 4H1VA 3U7FB 3IBYA 3REFA 4IVQA 5A4JA 3SQWA 4DLYA 4DIEA 3Q3JB 3EC2A 1KI6B 4DDWA 1NG1A 2QGNA 3GLFA 2QBYB 1D6JA 4ESHA 4EFLA 4TL8A 2FFBA 2QM7A 2IC5A 2I3BA 3KQKA 1UM8A 1OYYA 4YONB 3OAAD 4A4DA 3GJ4A 1OIVA 2W83A 3L0PA 3V4FA 2IYQA 4II7A 2QNRA 5SZIA 1CTQA 5KTYA 1OYWA 3QG1A 5KO2A 3IO5A 2F43A 5FUXA 4C2TA 5JSZA 2AFIE 2D62A 2R2AA 4LHWA 1OB2A 1T3LA 4IDHA 5HZKA 4MYCA 4A92A 3TBKA 5FOWA 4EKDA 2CVHA 4KVAA 4E09A 1IOZA 1TX4B 4DZZA 1KK0A 2GXSA 2QT0A 1UDWA 3PVSA 4LJAA 3X1XA 1P5ZB 3WNCA 4NBSA 1KJYA 3KX2A 1DS6A 4JLVA 2NO6A 1FMJA 2IA5A 4JKIA 4KSBA 4XSHA 5IRCD 3PEYA 4B47A 2PCJA 2ZR9A 1WMSA 1XX6A 3MCAA 2O8DA 1HUQA 1GIAA 3LO5A 3EPLA 2WWYA 1AGPA 3ZDQA 3LLUA 2CLDX 3B7GA 3H0KA 2WM9B 2H18A 1S8FA 2FEMA 4LBVA 3L43A 3ZZTA 4Q7KA 2EFDB 4PQFA 1EFRA 4NCNA 4V03A 4XD7D 4AYTA 3W6PA 3E70C 3SBEA 4CEIB 5TY0A 3W3ZB 2EFGA 1DADA 4CEJA 2E9SA 4PO9A 3B1XA 2AFHE 2HJVA 2WWXA 3Q8XB 3KJHA 3VMFA 5EE5B 1WDTA 3AF4A 4JJKA 2WSMA 3TMKA 1Q22A 5LB4A 1H65A 4QGAA 1KJZA 5L3VA 1JR3D 4HDQB 1QG4A 1D9ZA 2DY1A 5JS8A 2A9KA 2J87A 3WRYC 1G3QA 3OFND 5L3QA 1LS6A 3WY9A 4B33A 1IXSB 3W9YA 3QXHA 4A0RA 3E5HA 1OFIA 2RGXA 5DHAA 3RANA 3RRMA 4LYHA 2GJKA 1F5NA 2QTVB 3OEED 4TT3A 1GL7A 4C0BA 2GZAA 1E2PA 3EIQA 3X1ZA 2KWIA 4G5QA 3LXXA 2RH5A 1DAHA 1NRJB 2IUSA 1HV8A 3OIVA 3EZ2A 1GZSA 4JZKA 3MMPA 3C15C 4C7OB 5H1YA 1HH4A 2FU5C 1CBUA 1CU1A 1Z0FA 4NU0A 4OHVA 2D06A 1NVVQ 2HYDA 1FUUA 4FN5A 4LJYA 3D31A 3GLGE 3W5IA 1T8UA 1LTQA 4KLNA 3QKSB 2N1BA 4R2HA 4GBMA 4D4LA 1PLKA 2ERYA 3THXB 3DMDA 5FFMA 1VG9B 2GILA 3NEYA 2H16A 2VBCA 3WMEA 1D2MA 3GP8A 1SZPA 2J0SA 1W44A 1LB1B 5JEDA 1R8SA 1H8HA 3QENA 4NE2A 1KSGA 4PO1A 1QRAA 1II8A 2IHYA 2IYSA 1DARA 4TN1A 3AKEA 1ZU4A 4AYWA 4LC1A 1ZMXA 5B2ZA 3F3YA 3U3KA 4EAQA 3DZ8A 1NMZA 2Q6TA 1HQCA 2BKEA 3AKCA 3BH0A 1YQTA 4B3GA 1OH5A 4QNMA 1YZTA 4OKSA 1VIAA 4HAUA 1SXJE 1E79D 1GKYA 3PV0A 4G5RA 3D6TB 2XSZA 3AF2A 3VR5A 1II9A 1R5NA 4RKEA 4PPFA 2FV8A 4LUCA 2ZE8A 1XF9A 2YWFA 4JSYA 5G53C 1RJ9B 1YRAA 2A5YB 1E9AA 4IVPA 1JAHA 1ZP6A 3QKTA 1XEXA 2D2EA 1KDPA 5EJEA 3ICQB 2H1LA 3ZIAD 1QHHB 3LWNA 2OXCA 3U3JA 5AR1A 2GXQA 3J81k 3EWSA 1SVLA 1XB2A 1XJ0A 3M4YA 3NKVA 4ERNA 1NY5A 3EW9A 2REOA 1TL7C 1Z47A 4MRPA 1A1VA 1G9XA 2BV3A 2WAYA 1XWIA 1G8FA 1ZW6A 4PO8A 3OZXA 4HDCA 4HUTA 4FINA 1AS3A 4HI0E 1IXZA 3KKQA 2FEOA 2BKUA 3SS8A 2XZLA 2RB4A 2QAGA 2LKCA 1NKTA 2L0XA 2C04A 2YINC 4JLPA 1U8AA 1OXSC 1KDOA 1LW7A 1N6RA 3FMOB 5FUYA 2BWJA 1ZAKA 2REBA 2HXYA 1J8MF 3RYTC 5E3HA 2YHSA 4PHGA 1N0WA 2P6NA 4WW0A 1W36D 1CR0A 4HAYA 4Z51A 4NONA 5C4GB 2PT5A 1TPZA 3NBXX 2ZRDA 4NL4H 1P9NA 2WAXA 4ON9A 4TYNA 3AVVA 4GI7A 2PL3A 4FMDF 4A9AA 3UIEA 3TSZA 5JWHA 4C30A 2H7VA 3A8TA 2LCFA 3K09A 4LHVA 1U98A 3L8ZA 5LB2A 3ZZUA 2P67A 3AVYA 4BEJA 1VCIA 3BK7A 3PUVA 2OCYC 3KJEA 2BCJQ 3EZ6A 1N5KA 1VTKA 3FKSA 4TLAA 1CP2A 2FZ4A 3T61A 2JIZA 2AKYA 1NVXQ 5KDOA 1E9DA 2OG2A 1XEWX 2D4HA 2OBMA 1G8PA 5CK5A 3TVTA 1O87A 4F91B 1MT0A 4QL3A 4EPWA 4BFSA 1KMHB 1FNNA 1GG2A 2IS4A 1P9WA 1KO5A 1XD9A 4MH0R 1Z6YA 2MSCB 2IF2A 2W6JD 4W5HA 2G9NA 1AZTA 4UXJA 4ZO4A 1Z0AA 2GAOA 1AZSC 4LHYA 4OQMA 2WMNB 4O2LA 3LD9A 1EX7A 4RKFA 1G8YA 2O8BA 1C1YA 2BVNA 3RS0A 2ZRHA 4A6PA 2XZPA 5JECA 2V55B 2PMKA 4MRVA 5FTJA 2BDTA 4EJSC 3GMTA 2XZOA 4BFUA 2NO0A 5EE9A 4OI0A 1N2CE 3QPWA 4PC2A 2I1QA 1G3UA 1A82A 4NYIR 4O2RA 4CZ2A 3MAAC 3R8CA 2HT1A 2OAP1 3KZ1E 4P3YA 1XPRA 1W5TA 2A5DA 2WZQA 3KB2A 4OK5A 4DDUA 5F9HA 4B3XA 3TGPA 1KJWA 4DLZA 1MABA 3B13B 3AGQA 1T4GA 3QBVA 1OKKD 4GL2A 3T1OA 4S2EA 4ZCIA 3KQHA 1PUIA 1S9HA 2Q21A 3P1JA 5FBLB 2C77A 2GDJA 5E95A 2JLUA 2Q9BA 1IN6A 3FWYA 3F8TA 2DFLA 2F1RA 3NTUA 4PC1A 5H68A 2JJ1D 5JCZA 3SBDA 5JJIA 5J4KA 2ODEA 3FOZA 3DL0A 3SYLA 4XWKA 3VR4A 1E1QD 1NBME 3JZAA 4NYMQ 2BMEA 2BMJA 4PAMA 3DMNA 2FE4A 4HB4A 3ASYA 1XBTA 4WOPA 2F55A 4LJ8A 3RHFA 4LC0A 4PQYA 4PPQA 1MKYA 3G5UA 2FWRA 3PITA 3NIBA 4GNKA 2UZIR 1W2GA 1W0JD 1M2OB 1FP6A 2FSFA 2IEZA 2AXNA 1Y3AA 2D3WA 2DFNA 2BJWA 1XEXB 1XJQA 3THYB 1SKYB 4DLUA 5H70A 4BZXA 4LPSA 1WQ1R 1XTSA 3NH6A 3SC3A 3ZIAA 1F2TB 4PTLA 1GRRA 4URYR 2VH5R 1RRCA 4EDHA 3HPRA 4IRUB 3K9LA 1CR2A 3QBTA 3U3OA 2XJ9A 2WKQA 3V4RA 4KFTA 1E2JA 2OLKA 1KI8A 1VIYA 3P27A 4IOKA 2QL6A 2J9RA 4AURA 4R2IA 3SI7A 5IK2D 1II8B 5HE8A 4BASA 4DCTA 4W9MC 3P32A 4P4SA 2VP9A 5L3SA 2W6ID 3EIHA 2WMOB 4QM6A 5GVRA 5AWFC 4ZDWA 1JEEA 3X1WA 4R7ZA 4ABYA 1NN3A 1RZ3A 3WYAA 4IVRA 4JL8A 4Q1BA 3QKRA 4HLQB 4TMXA 1DPFA 3I8XA 1NN0A 3GJ3A 4YDSA 4NYMR 4JVLA 5CLQA 2V9PA 1QHXA 2OFWA 3EIEA 4LZZA 1G3MA 2GVDC 3LAWA 3AVUA 2QP3A 2OEPA 3R20A 5C46F 4FCWA 4B32A 2Z5FA 1FTSA 5UKDA 2ODNA 4MKHA 1WRBA 1T3SA 1Z29A 2OHFA 2V4ZA 3H2YA 1EFUA 3ZJYA 1Z06A 2ANBA 2ZJ8A 4YXWA 5DN6D 4HZUA 3B6EA 2NMVA 1WBBA 4P4TA 1EFCA 3EXAA 2VIIA 4RD2A 3H84A 2A2ZA 2BBOA 3W6NA 3EWAA 3ZH9B 3CM0A 2QE7A 1E2NA 1TF7A 4IXNA 1G17A 2ZVPX 5B58C 2RGNA 2EFCB 2F3TA 5EUQB 3EARA 1EGAA 1UKYA 4M22A 4FMDB 1ODFA 1E2QA 3BS4A 5JBQA 1A4RA 1CIPA 2QUZA 3QNUA 2HYIC 2JDIA 2GCOB 3FB4A 5ANRB 2O8EA 4KBGA 4F4JA 4F4CA 1ZM3A 3I61A 2P6UA 2YVUA 4LJ9A 4KSCA 2CK3D 2WWWA 2C96A 3KXLA 4ZI2A 5KU1A 1NF3A 1XRJA 1W36C 4OHYA 3PR1A 2EW1A 4X8MA 1EFTA 4QM7A 3QQ5A 5JEEA 1TF2A 3I92A 4FMBB 2C2HA 2Q3MA 1AJEA 2J45A 1U90A 3QXCA 2QZ4A 1UBFA 1RVDA 2O0KA 1FX0B 4MYTA 1VHLA 4P33A 5IK2A 2ERXA 4ZI3A 3ONWA 5JWOA 3LY5A 4B48A 4DXAA 1XEWY 3MG9A 2W6IA 4A2PA 4W5JA 3NXSA 2WWGA 4JMPA 4BRWA 1PJRA 1GFIA 1QG2A 4IFEA 4LI0A 2V8OA 3IBGA 2AXPA 3C5CA 2N46A 4D26A 2WHXA 2ZAMA 5TV2A 3V9PA 4GMXA 3AVWA 2DBYA 3QKUA 3B78A 3E2IA 4UXHA 4XOIA 5JSZB 1P62B 2G3YA 1ZIOA 3QKRB 2GEUA 2GJSA 3GFPA 2EYUA 4GSYA 3LBIA 1E3MA 4M2LA 5EZ6B 4QBGB 4HEJA 4DWJA 4TZ0A 2QSYA 5SZKB 4RD3A 3CF2A 4DSNA 4A36A 5L3SB 2JLQA 1DELA 3LNCA 1BYUA 2CE7A 2QQEA 4NCIA 2CL6X 4X8LA 1DG1G 4NCKA 1QVRA 3JVVA 4TTQA 3TK1A 1KI2A 1TQDA 4BLSA 4POAA 2OESA 1WB9A 1E9RA 1I4TD 2ZRKA 2LWIA 4HZIA 5HKKD 4Q7MB 3CNOA 3LVRE 2OFOA 1X8LA 2JATA 2EQBA 4IOJA 1R10A 5DGXA 4D82A 2AKAB 2GCPA 2QENA 1QDEA 1I2DA 3MJRA 5FR2A 4A0GA 1IN5A 2WTUA 1RC8A 2QP9X 2ZRGA 3GEIA 4B43A 3D3QA 1EESA 4LYAA 1J2JA 2BJVA 3L0SA 1LF0A 3CWZA 5K8TA 2QSZA 5EZ5A 1NVWQ 1C9KA 2A5JA 1EK0A 1W4CA 3LXRA 2ZI7A 4DEYA 1IBRA 5JRJA 4QBHA 1ZBDA 3SJZA 5AUPB 5DNYB 1MR3F 1G5PA 1ZNWA 2B8TA 5KSYA 3L82B 4M1YA 4DLXA 2FPLA 2VTKA 4JJZA 4DT1B 1VPLA 2ZSAA 2PZEA 1AN0A 5TMPA 5IDVA 4C4PA 5FPHA 2G0NA 2ODWA 1X8KA 4MUBA 4RD6A 4Q01A 4WZAE 3VX3A 2JLYA 1ZUIA 2R6CA 2IF0A 4NH0A 5JHGB 5F3WB 1ZD8A 2P2LA 3QXSA 1KI9A 2XXAB 3PIRA 4EPVA 2BC9A 3AB3A 2HJGA 2CL7X 3BERA 4EPYA 2W2XA 2QA5A 1NBMD 4B73A 4YC7A 1GITA 1P2TA 3IHWA 4QHSA 4ZIRB 1MABB 4G3XA 4IDNA 2XNSA 1R0ZA 4M1MA 1XDBA 1S4QA 1ESMA 2V7QA 4P0TA 1XCMA 4TLCA 3SE0A 3TE6A 1CF4A 4C0QC 4BLRA 4G0NA 4N0EA 4DUGD 1U94A 1TUEA 3QF7A 4CW7A 3VTKA 3MWLA 3FKSD 1CRPA 4LBZA 2QN6A 1R0YA 5DIFA 1QBKC 1R4AA 4IXMA 1NLYA 2NZ8A 1MO4A 3KDSE 4PHHA 4Q4HA 4ZPXA 1KI1A 3GLFE 3LQQA 1ANKA 2ZRIA 3AP1A 3X1DA 4ILEA 2FSHA 1E9EA 2GKSA 2Q3FA 2XB2A 1FTNA 5EP1A 3NH9A 4U7DA 2I1VB 3K0SA 1VCNA 2IYTA 4I1SA 3ZYCA 1U2RA 4DEXA 2IS6A 3R9XA 1Z6AA 1YU9A 3ZS9A 1Z2AA 5BWMA 3ECCA 2KE5A 2ZI3A 3PFIA 3MWJA 1NN1A 4GMDA 3WP1B 3BB4A 1A7JA 1VDZA 4D4KA 1FPMA 1E69A 1L2TA 1KSHA 1P9RA 2Z4RA 1W49A 3DHWC 2F3RA 3I72A 4GDFA 3AP2A 1I4DD 4MRSA 3FVQA 2F9LA 3FTQA 2D74A 1DG3A 5AJYA 3NDBB 4E22A 2J5XA 2IUUA 2H57A 3C41J 3M1IA 4US1R 5IHPA 4ARZB 4OK6A 1JQJC 3SEAA 4Q48A 3GLHB 4NCHA 5FOXA 4HLCA 4ZKEA 5FTMA 1OLOA 3VX4A 1QVAA 4Z8XA 3MJHA 3TW8B 4TMVA 3FYHA 2FFAA 3IIMA 3T15A 1E0SA 1NMYA 3CX6A 1I2MA 3K0CA 4A2QA 4KI0A 3ND8A 2YOFA 4PXAA 3FHTA 4P31A 4Q21A 3R9IA 2HEIA 1XCPA 3OEEA 2PBRA 2KBFA 2PZFA 3B8HA 4IDQA 2W2VA 4OQXA 3VKHA 1Q57A 4RD0A 1COWD 1OJLA 5H8WA 5BN5A 2FA9A 1NI3A 2CMKA 2EVWX 4G5OA 2WKRA 1XD2A 1YR9A 3KUDA 4DDVA 2CLSA 1YE8A 4JLBA 3K9GA 4MGIR 5FPSA 3Q5EA 1RW4A 2QMUA 2MSEB 4BEBA 1JB1A 4LGMA 4Q00A 5F98A 4C0HA 1VCOA 1ZD1A 3EPHA 1KO4A 4LX0A 1FZQA 2GZHA 5E7MA 1JR3A 4AG6A 4LJ6A 5JI2E 2YYZA 3CPEA 3SHFA 1MO3A 3ADDA 1B0UA 1RJ9A 3DOFA 3VR3A 3GEHA 4Q02A 4IOMA 1G64A 3BXZA 1NBMA 3EX7C 3TAHA 1YVDA 4EUNA 5KSZA 1LS1A 3ASZA 2ZJAA 5EXXA 5FBWB 1DAFA 2V7QD 3KQLA 1A5TA 2F1HA 1HTWA 3SR0A 4M1TA 1AS2A 3K8YA 3W6OA 2HLDA 3O8BA 4D0GA 3B82A 1E6CA 4PHFA 4FXPA 3IGFA 4QOSA 1N6IA 4TLBA 3NWJA 1BMFD 2IUTA 2CHGA 3GLHA 4NYJR 2FZLA 2XOKD 5KPJA 3LQRA 2QTHA 1RIFA 3TLXA 1AS0A 4ARZA 1ZNYA 2G1JA 4MGYR 4YLGA 1D2NA 1R0XA 4PSKA 2CXXA 2OT3B 4LYFA 3A1TA 1BS1A 1T91A 1W48A 3Q7PA 4M1OA 1QHYA 5FR1A 2OO7A 1IJEA 1PLJA 1Z07A 2ZANA 4PAQA 3VR6A 3VHXA 1QHSA 4HAWA 3LLMA 2DWPA 1VCMA 2WICA 2IS2A 1KTVA 4FWTA 1U8ZA 2VF8A 4KAXA 4Z8YA 3RS7A 4M9QA 2GXAA 4MRNA 2R6FA 3KFVA 1E99A 4C7OA 4TQUS 2OCAA 1FQKA 1P3JA 4QKQA 3UPUA 4GZLA 4AG5A 1YKSA 1E0AA 1ZRHA 2C9CA 1S1CA 2AWNA 2ZUDA 5P21A 4JVMA 1NKSA 4DHEA 1S0UA 4WIAA 5D3MB 1XTRA 2RCNA 4XWOA 1G5TA 3BFVA 4MGZR 1ETUA 2PX0A 1IY0A 1YRBA 3FPAA 4IDPA 2BMDA 4M1WA 1R6BX 2Z43A 4IEEA 4Y0AA 6Q21A 1K5GA 4GZMA 4PFSA 3I3SR 3ZZ0A 5JFGA 2O8CA 1N3BA 4JL5A 2YC2C 4NCJA 1G7RA 3CF0A 4JKYA 1GILA 2X1VA 4I1VA 2UZ3A 4OQLA 4RFSB 5A5GA 2VSOA 3MD0A 1AIPA 5G40A 5KNBA 4EPRA 4QRHA 2WSSA 4Z1MA 1P6XA 3GJ7A 2IYVA 1WA5A 3T1TA 4L8GA 3LX5A 3SQXA 1U0HC 2R44A 2GK6A 2GTPA 1MRNA 3W3AA 1SVIA 1G6OA 2ZVQX 3UKDA 4E03A 3RVBA 4YQFA 4CGZA 2WPDA 5E7IA 3RWMB 1G16A 3O47A 5AJVB 4DC9A 2QU8A 1XTQA 4U5XA 1J70A 4BZPA 3HU3A 2PEZA 2VLIA 4GOJA 3A37A 2E87A 1CR4A 2ASEA 4QGFA 5LPNA 3QXJA 4DJTA 4YMSA 3L8YA 4QJ3A 5J4LA 3AVQA 2ZSFA 3C14C 3LW8A 1Q3HA 3S1AB 1KYIA 2VHQA 3RSOA 4Q9IA 4IKEA 2QEQA 1MOZA 4WZ6A 4Q4AB 4TMWA 3VKWA 2ZROA 2HF9A 1Z3IX 1ZIPA 3UWOA 2KI5A 1ZM7A 4TWZA 4A0HA 1P2UA 4DLRA 1RRFA 1KO7A 4D0LB 4DB4A 1OXTA 2QP4A 1XJCA 2P6RA 2X2EA 2VHUA 1AKYA 3SNHA 3AVXA 1FW6A 3CH5A 4Q18A 1GP2A 2OV2A 1Z5ZA 5G3ZA 3NEJA 2ZUCA 2FF7A 4NMMA 2QG6A 4Q1FA 3HU2A 3QI2A 1TUIA 4TTRA 4GT1A 5HKKA 1S96A 1CKEA 3JZMA 1JR6A 4OYHA 1E1RA 1JPJA 4QC2A 1SXJA 2ZSDA 5CIWA 1T8TA 1M34E 1UKZA 3BB1A 3RRNA 2GA8A 2GETA 1SVMA 3AUXA 3UANA 2GESA 4LBWA 4B76A 3GLIA 5B57C 3R9WA 1XEFA 1N0VC 1PLLA 1DOAA 3W34A 5DI3B 3B60A 1FMLA 2YWGA 5E4FA 4D25A 2QQ0A 4ZV4A 4WBSA 2GF0A 1P61B 8OHMA 4O25A 2YNMA 3N5CA 2V1UA 5KNDA 2VP4A 3A4LA 3RNLA 2F6RA 4JBWA 5HE9A 2CJWB 4B6EA 1ZCBA 4QGHA 3QEOA 4N3NA 1RRPA 2O5VA 4QNRA 1D8TA 4BFXA 1T3HA 1W4BA 4YMTA 721PA 4KLZA 2JLXA 4KYUA 4OHZA 4IEIA 4R71A 3QEJA 4TYPA 4PQRA 2REXB 1OKKA 4MYHA 5EP2A 4P32A 1XPOA 3E1SA 1J99A 3TJZA 1KAOA 2DYKA 3SFZA 4UNSA 4IW3B 3THWA 2VO1A 2HT6A 4Q4AA 3LV8A 2JCSA 3K9NA 4XH9B 3B1YA 4DCVA 5FBQB 4IDOA 1CJVC 5CK4A 1Z63A 5JMTA 1VMAA 1XFAA 3I5YA 5JJKA 2V3CC 1GL6A 2QROA 1SVWA 3IDQA 5TXGA 4DUGA 4DLSA 1IXRC 1G7CA 1BMFA 2ZYWX 3VAAA 1ZD9A 4MGKR 3WMGA 1JPNA 4EIWA 2ZJBA 1S9DA 5EE1A 1W2HA 3TUZC 2JAQA 2VF7A 4EPXA 3Q85A 4KJZA 2BCGY 5C18A 3X2SA 2AWOA 4QHTA 4W5WA 1WXQA 3NHAA 2GCOA 5FI1B 2O8EB 1OPXA 2ONJA 3K09C 3ZD7A 4CT4B 3PEVA 1BYIA 3CRW1 2LKDA 3VKGA 3AH8A 4RFSA 1KKMA 2J7PD 2VP2A 2VP5A 4XVRA 5JLJA 1TU4A 1Z6TA 3KKPA 1J8YF 2BEKA 3G0HA 3FE2A 4Q47A 3IQWA 1T5LA 2RHMA 2AD1A 2ZI9A 4JBXA 4V02A 5CB6A 5GVSA 4HZUB 3UG7A 4LK2A 1N6PA 2J0UA 3KJIA 4FMCB 1XXHB 1NIPA 2CHQA 2FX3A 2H92A 4RCYA 1Z0KA 4JVNA 4ACBA 3QVUA 4QFMA 3CRRA 3SJAA 3K9HA 3EPJA 1UBGA 1E2MA 2A30A 1E9BA 4CEHA 2PLRA 2QM8A 4D4MA 4LHZA 5FBVB 5KSPA 1SGWA 4B44A 4JIMA 5BN4A 5J40A 1W36B 1MO6A 3BORA 1P75A 3DEFA 4MKGA 3KKMA 2QE7D 5BQ5A 2QY9A 4HB0A 4A6XA 4A8JB 4BFTA 3FMFA 4DKXA 4HUQA 2J0VA 3SHWA 4A1FA 1S3SA 2CLCX 2WWHA 3A1UA 2IXEA 3A1WA 2YOGA 4V0NA 2WJHA 4G1UC 4C0LA 1G8GA 2JLZA 1K5DA 4UKDA 1DBSA 1KHTA 3C7KA 4UXIA 3ZD6A 1AK2A 3AVOA 4C0SA 4OBEA 1ZUHA 1TEVA 4IFBA 1AQYA 4OI2A 3L2OB 3IUYA 1N5IA 1Z8FA 2B6HA 1IN4A 1Z6XA 4Q19A 4BLOA 1W47A 1CJKC 3PCRB 4Q9KA 4KITB 5DH9A 2MSDB 4D4JA 3Q7QA 4BFVA 1US8A 1RRGA 5DLQC 3A36A 2ZITA 5JCPA 5CYPA 2ZRCA 1MRSA 1P2SA 1SXJD 1PV4A 3CX8A 2OZEA 5F2EA 5FOSA 621PA 3EA5A 5ELXA 1CRQA 3CRVA 2FOLA 4Q1DA 4V0MA 2C99A 3H86A 3DZDA 5FPKA 1DVRA 3RS5A 4D81A 5KHOC 2QRNA 3TVDA 4YMVA 3FFAA 1OH7A 2D7DA 2W2TA 1E2HA 2IL1A 2PZGA 2ONKA 3THYA 1UPTA 4XD7A 2ZRBA 3ZVLA 5FUWA 1R8QA 3CKLA 3T5GA 4RD1A 1GTVA 1OE0A 1TEXA 1P4SA 1TTTA 1CS4C 2FNAA 1QHIA 2ZYVX 2ECKA 4BFYA 3K70B 1YR8A 5EUMA 2ZRFA 4H1UA 4B74A 4MA4A 3ZQ6A 1NNEA 2PJZA 2OSBA 4HDOB 4L4UA 4CVNA 3KQNA 5LD2C 4G01B 1AGRA 1D2EA 1XMJA 2HLDD 3IHLA 4M9ZA 2R9VA 3O8CA 4BFWA 3U61B 4EQ6A 5KNCA 221PA 2C95A 3HJNA 3RSLA 4L15A 5K8UA 3EPKA 4M1SA 3U6KA 2WV9A 1OFTA 1GVNB 1W1WA 3CLVA 4KVGA 2XTZA 2G0TA 2NTYC 2JIZD 4V0LA 5AUQA 2W0MA 2Z6VA 3BH7A 1Q0UA 4BECA 1NN5A 5JI3E 2C9OA 3AGPA 4XVUA 1UBEA 3BJIC 3TUJC 3Q72A 2IXGA 3I62A 2R6AA 4WVFA 4F38A 2RGGA 2CBZA 4NYJQ 1W5SA 1KI7A 1UAAA 4UQOA 1MV5A 1R7RA 4PAOA 1R5OA 1LVGA 4B75A 5B64A 2VP6A 4TZ6A 3Q9LA 5CDFE 2WIBA 3CRMA 4DBLC 1ZU5A 3UXMA 2AL7A 2P3SA 5DO9A 2NO7A 2ZYTX 3K70D 4JT4A 1G21E 3U60B 2ZRAA 5M04A 3V00A 3RDPA 3TR0A 3IPYA 1DAGA 4HB3A 1EWRA 2GBLC 4JVSB 3RS3A 1KAGA 5FPYA 3U2QA 2IBMA 1F3OA 2QPAA 2A78A 2J7PA 4IOLA 2ZU0C 2J3EA 1G291 2HCJB 2IWRA 1KMHA 2KJQA 5BN3A 4AKGA 3I4LA 2K5UA 5FTKA 4JLAA 5JWRA 2AHOA 2G6BA 3KUCA 5IF9A 3RRYA 3CUEF 4I1OA 2JLSA 3RAPR 4KFSA 3N2EA 3T34A 2Q9CA 2F7SA 3QOFA 1GDDA 4LSGA 3WYFA 1G7SA 2GRJA 2B7BA 3BIFA 2WJYA 2VHJA 1NLFA 2FG5A 3KB1A 2X2FA 4Q1EA 3OESA 1S1MA 1JECA 1U9IC 3R7WA 4B35A 4DSOA 3GEEA 1SVOA 4M53A 4OL0A 1FP7A 3QXXA 1DAMA 2TMKA 4RCZA 1X8JA 5AJWA 2AK3A 4HLUA 3A4NA 1UF9A 2DR3A 1KI4A 4TLEA 2WVJA 1KSJA 4O3MA 1K8RA 2BEJA 3SYKA 5E7JA 3QE0A 5CB8A 1JXMA 1J90A 5G3YA 2UVQA 3AKYA 2ZJYA 1E2FA 4Q4JB 3LBHA 1ZYUA 4M8NE 4NZYA 4KO8A 5AJZA 1Q3TA 2D7CA 3KTAB 3I1FA 2JGNA 2YJTD 2ZJ2A 2FDCA 3KQUA 1T5IA 3FMIA 3EZ9A 5JHHB 3K0EA 5AK0A 2J0QA 2MMGA 1IAQA 4K81B 2WOJA 1GAJA 3AF1A 2QGZA 2EU8A 1R2QA 4B3FX 2ANCA 1Z22A 4TSFD 1HEIA 3QPUA 2EFEB 2HXSA 4KFRA 1DEKA 2ZSBA 5GJCA 5DYIA 3ZVNA 3D8BA 4FW9A 1OXUA 2CNWA 3T12A 4GRAA 4MUAA 2NOAA 4RZ3A 4KV9A 2GJ8A 1KGDA 4LJ4A 4QJ4A 1OSNA 1RFLA 5FPTA 2CCJA 2QPTA 2IHBA 3AP3A 4DCSA 4F7WA 4CRWB 1IHUA 2ZR7A 2IYZA 1P73A 3C16C 4UNQA 3I73A 2BHRA 2DPXA 3KXIA 5B30A 2N42A 3P26A 3U3MA 3CZPA 1NJGA 5CJ2A 2SHKA 4N1AA 4Q4LA 3B1ZA 5JZVA 2JLWA 4KODA 4L9SA 1N6KA 2C8VA 1E96A 4WXRA 4WXPA 1EFHA 4TYQA 4B2LA 4MQBA 4ACAA 1QF9A 2XJ4A 2YWHA 4URXR 2GBLA 4C0JA 3HP1A 1HURA 4AK9A 1L4YA 3IILA 1XP8A 2ZRJA 2FFQA 2FSGA 3GCGA 3LVQE 3N2IA 4Q7LA 5HZHA 3T1VA 2OFXA 4NHOA 4ZCLA 5BYJA 3AVTA 4DB2A 3KTAA 4QBFA 4RFVA 4FCVA 5EXTA 4JL6A 2C78A 1XXHE 2GHIA 4LCBA 3OE7D 3F0TA 3PENA 3SN6A 4DCNA 2WKPA 4XTRA 4DLVA 4YMUA 3KKNA 1DO2A 4GP6A 1HE1C 3ZVRA 4A8JC 4QG7A 4B2IA 1KK1A 2DFTA 2ZI5A 1OXXK 2HUPA 4UJ3A 5CITA 3AQ4A 3HPQA 1HQYE 2IWHA 5FUVA 2PCLA 2GJAA 3UWKA 1E9SA 5AJXA 3OEHA 4M9XA 3W8NA 1E2EA 2O8FA 1MO5A 1R5BA 1TNDA 3AEZA 4ZKDA 1BIFA 4BLQA 1WE2A 3TRFA 2IYRA 3GJ8A 4JS0A 4CDGA 2VSFA 2EFHB 1FX0A 1RYFA 2GJ9A 4K8OA 2Q3HA 4L16A 3WHLA 3B9QA 1ZM9A 2ZS7A 1M7HA 2IS1A 1OF1A 3BRWD 2NQ2C 4YMWA 1NG9A 2RGAA 5L3QB 4Q5IA 2ZU6A 2RKOA 4OHXA 4XVQA 2BMFA 5DISB 3UK6A 1WF3A 3CONA 2C03A 1JQLB 3VQTA 3NDPA 1NVUQ 2GAAA 3AF0A 3BGWA 3IQXA 5CJPA 3O8DA 3HDTA 1SQ5A 4EJSA 3U4QB 3QVVA 5CYOA 3AKDA 3CW2A 1JEDA 3U7EB 4L9WA 5K8IA 3QIAA 3H4MA 3A1SA 4KYIB 1W0JA 3IIKA 4BZQA 1P72A 2PX3A 4PPNA 2OAQ1 1RE0A 2EWWA 4M4SA 1Q1EA 3EZ7A 5CLLA 4EPTA 1VKJA 5C4MA 2FH5B 4OJKA 3WMFA 3B9PA 1JR3E 1IM2A 1KIMA 4PZLA 1IONA 2CHVA 4FI3C 4TYWA 4L5BA 1V43A 4R98A 3UG6A 2GZDA 3QUSA 2QT1A 1Z6GA 3M6AA 5DE3A 1BO6A 5HCIA 421PA 1YR6A 4DVGA 4TSFA 4TQAA 1YR7A 3PQCA 1Q1ZA 1ZC3A 2G88A 1JBKA 2HF8A 4RZXA 3T1QA 4DSUA 2ZM5A 2A3RA 4F93B 2GWHA 2NGRA 1U0JA 4E07A 1AA3A 2QRZA 1OIWA 3GJ5A 4Q1CA 3OF5A 3PG5A 3CNLA 4JYBA 3B5JA 3RABA 1IY2A 2XTNA 5FL7D 1CULC 4QHYA 1LNZA 2O52A 1E98A 1OB5A 1BH2A 1ZM2A 2QORA 1KNQA 2F43B 5HTKA 2NPIA 4TTPA 1VECA 1UEIA 4M1KA 1TMKA 3CR7A 3W5JA 3LH5A 1V5WA 1B23P 3WXMA 2FGKA 2BM0A 3VU9B 1E2DA 1YZNA 3HU1A 3OIWA 2QBYA 3GLFB 4P4SB 2WJIA 2XOKA 4DRZA 1XMVA 1IQPA 1G5RA 1NJFA 2CVFA 2VA8A 1BOFA 3OAAA 4GOKA 1LV7A 5TARA 4B6FA 5BYKA 2JA1A 1GKUB 1TAGA 2CEAA 2GF9A 3FHOA 3OIYA 4DLTA 1ZJ6A 1GKIA 2KB0A 1KKLA 4OHWA 2WJVA 2BOVA 1G4AE 4X8OA 2Q0HA 4LWZA 4D2IA 1VYVA 3NC0C 1XMSA 1DAEA 1Q20A 4NYIQ 3ZS8A 3ICEA 3LBNA 4KHZA 4HAZA 5DN6A 1S3GA 3U7GA 1UJ2A 3ADKA 1KO8A 1U9IA 1F2TA 3WP0A 1NSTA 2ZJ5A 2EWVA 3QF4A 1E2LA 2CE2X 2B21A 1G3IA 1PVOA 4NTZA 4Q9LA 2ZI4A 1Q21A 5G41A 1L4UA 1Z0JA 3IEVA 2H5EA 1N6HA 2OCBA 2X77A 3TW4A 2ODBA 1KK3A 1JAIA 2R8RA 4FIDA 5AUOB 3P20A 2ZS8A 1KDTA 2ZR0A 1PUJA 1R0WA 4JYCA 1WBDA 3AV0B 4LHXA 3BE4A 1GRNA 3MRSA 3DDCA 1NL3A 4FCTA 3SOPA 4HLDA 1W7AA 1E4VA 1QHNA 2FJUA 1G6HA 1CR1A 1HY3A 1A2BA 1SULA 3TQFA 1KDRA 1AA9A 3TIFA 2ZJOA 3MUFA 2YOHA 3PUZA 4QXAA 3A4MA 3UMRA 5KUTA 1CJMA 3C5HA 2JLRA 2PMDA 5DHFA 1Z83A 3RS4A 3THOA 3VR2A 1Z28A 2GXUA 1P7CA 3BFKA 3VU9A 2GEVA 3WNDA 3UMSA 4BFZA 2B92A 3U5ZB 1X3SA 4YXWD 3WBKA 4TLDA 5FOVA 2C98A 5FL7A 3QJYA 2ZRMA 1ZNXA 2GEDA 4NDZA 5DI9A 3T5DA 4J0QA 4Q1AA 2FGJA 3CPHA 1XTKA 3GD7A 4C0AC 1E32A 3MFYA 3GFOA 3K0AA 2A7QA 4JLNA 3U44A 1XNJA 3I32A 1UBCA 2WPDD 5HCNA 2JJ2D 3BD9A 4PZZA 5KYKA 4Y0VA 1AKEA 3A58B 3GJ0A 4CEHB 2YV5A 121PA 4GPTA 4IJMA 4XTCS 2OLJA 3GFTA 5TVKA 4QBIA 5FL3A 2XITA 2P0EA 3ND9A 2ZUBA 1P60A 3GLHE 3IO3A 1XXHA 1QHGA 1C4OA 2IT1A 5EP4A 3IEUA 4A82A 2WOOA 3DKPA 1GSIA 1OIXA 3QPVA 3LDAA 2JJ8A 4LV6A 3EC1A 4MDFA 2O8BB 4XJXA 3TR5A 1F60A 4EFMA 3WHKA 1JJVA 4HLUC 2QMHA 4K46A 1NMXA 4F4IA 1WP9A 2HCBA 4PX9A 5J47A 1JJ7A 1FUKA 3A1VA 1OH8A 4LOAA 1N25A 1QZXA 3NBFA 3UATA 3UMFA 5HR5A 4RVCA 3B1WA 3MLEA 2VHTA 4QGGA 1OHHD 1Q44A 3C4JA 3ZQJA 2DWOA 1KK2A 1KY2A 3K0FB 2OM2A 2J41A 2YZ2A 3U4QA 4EJSB 3I8SA 3VNVA 2F9MA 2ORWA 3DO6A 4LBYA 5GJWC 2Q9AA 2P5TB 1LFDB 2W00A 4PHTA 4B3BA 3HR7A 2IYWA 5LBIA 5JS7A 3TNFA 3FFBA 3FDIA 4CT5A 5EXPA 5FOUA 1I4LD 2OBLA 3CIOA 3WRXC 2NZJA 4KU4A 1U99A 3U6BA 2ORVA 4LRWA 2A5GA 4O0MA 1LF5A 3HWSA 1L7VC 2JASA 5FOTA 2ZIAA 4MYUA 1N6NA 1P2VA 1X1RA 4MKFA 4PR0A 1ZM4A 3GLGA 2O8FB 1M74A 3RWOA 3MGCA 4G5GA 2RGCA 3NC1C 4RD4A 5LDDC 2BBWA 2RAPA 4OQNA 3Q5DA 1DTSA 2PJRA 2E1RA 2V54A 4BWYA 2GVZC 1E0JA 1OV4A 1W0KD 3OE7A 1CLUA 3BH6A 4C3ZA 4CYMA 5FTNA 2JJ2A 1IY1A 2V1XA 1WCV1 2QAGB 2ZSEA 4M0LA 3IIJA 1CXZA 1E79A 3CB4A 3JVUA 3RC3A 4AKEA 5BW8A 1UKEA 1HYQA 1JXOA 1FQJA 1J7KA 4I4LA 1AQUA 4US0R 3RLFA 2CCKA 2XAUA 4OQFA 4HAVA 4TT3D 1BKDR 1CJUC 3PUWA 5DI3A 2ZPTX 4GOXA 2NG1A 2QTFA 4DIDA 3CBQA 3GLIB 1ZC4A 1TQ2A 2C5LA 5EE3A 4A0FA 4PSVA 1QHHA 1SXJB 2CCGA 1KMQA 2IX3A 2YC4C 3LW7A 3EAQA 1EWQA 1FOEB 1KI3A 3WYGA 5SZJA 3QG5A 4DCUA 2WJGA 4YDHB 3O8RA 2QAJA 1EXMA 4XSGA 3BBPA 1O3YA 1S2MA 5EXSA 1K6MA 1M6NA 2XB4A 3C8UA 1G18A 1XZQA 3CO5A 3NBYC 3ADBA 2BIFA 1ZINA 5K8LA 1H8EA 1N5JA 2Z0MA 3GJ6A 2WJJA 3H1TA 1II0A 4NP6A 4Q03A 3SDZA 4TQ9A 5KSOA 2IYYA 1F48A 1YJ5A 2VHCA 4HSEA 2DCUA 5GADl 2ZETA 1Z0IA 4ZDJA 5JJLA 2RGDA 4PC7A 4AKIA 4G5SA 3RRZA 1XMIA 1UFQA 4IHQA 4AY2A 1CEEA 2FPKA 4OK3A 4Z54A 2JEOA 1U81A 4D0NA 2PLFA 3W90A 1TF5A 3ADCA 4R9UC 3CNNA 4TMTA 1E2IA 1TU3A 1NVVR 5GJBA 1DAKA 1NP6A 2ATXA 2MMCA 4V0KA 4JLKA 4HATA 4JSTA 3S1AA 2X19A 4C2UA 2P65A 4FD2A 2V6JA 1XU4A 3THXA 1E2GA 4NKRA 5TDHA 3QKSA 4MDEA 1EX6A 4Q4JA 2G1KA 1COWA 2RHDA 1VG0B 3X1YA 5CDFA 5HPYB 4NPHA 4PC6A 2BBSA 4BGDA 4RZUA 1L8QA 3FHCB 4OI1A 1Z2CA 2ZS9A 2J7KA 3HYRA 4B3CA 4E5UA 2O0JA 2X8AA 3CWQA 1OFHA 1OXVA 4LJ5A 2IEYA 3CPJB 2ATVA 5FI0B 2ZXUA 3CR8A 3K53A 4KCGA 2QMEA 3VNUA 1ONBA 1KZ7B 3DOEA 2B7CA 2VPPA 3R7WB 4RJLA 3LX8A 2UKDA 1G19A 2VL7A 3TUIC 3P4YA 2DFKB 4LV8B 5TB5A 5FTLA 1YZQA 3EZFA 3TKLA 2ORIA 3R8FA 3NG1A 4AYXA 1KY3A 4BUJA 4WA7A 2ZRPA 1SHKA 5CM8B 2O8CB 1KSFX 3CH4B 4I81A 2GK7A 3KL4A 2IYXA 2OBNA 3VHLB 5KPDA 1KOFA 1SHZA 1VYUA 2ZRLA 2JJ1A 1E94E 1W46A 2W0SA 4TL6A 3B2EA 4TL9A 5D3MA 5IT5A 2YKGA 1HT1E 4CEJB 2VEDA 1E1QA 5FBRB 4DDTA 2WWIA 1G41A 1W0KA 4TMZA 4UNNA 2AK2A 3SZRA 4XIGS 1NY6A 3CRQA 4D80A 4F92B 4CEIA 2R6DA 2XGJA 4LYJA 5KDLA 5LD2B 2G77B 2RMKA 2VSXA 2JLVA 1XZPA 3HYTA 1Q12A 4DLWA 1N6OA 4LPKA 3MSXA 2ZJZA 1N5LA 1T0HB 2NPFA 1GWNA 5J4VA 1GM5A 3B85A 2AN9A 3PXGA 2O8DB 2KBEA 3GJXC 3GQBA 4M21A 2OUKA 4PZYA 4A15A 3K70C 3FKQA 1E9FA 1ZUNB 3W8RA 1U0LA 4KXFB 2VP0A 1SVSA 4ESVA 3MWKA 5EP3A 2CL0X 4AD8A 3EG5A 2F1IA 5CIQA 1G4UR 4WAUA 1ZCAA 1EG7A 1NLZA 4M9SA 4DSTA 4QJ5A 1TADA 1TQ4A 1Q1BA 2Z83A 2FN4A 5J4HA 1X86B 3T06B 3P4XA 4URVR 1IJFA 2ZYUX 1ELOA 2PT7A 4TYYA 2VYFA 1XTJA 3TH5A 4RZ2A 2OE2A 1Q1QA 1VG8A 2FFHA 2JDID 2G83A 1HT2E 2W6JA 3K1JA 2I4IA 2IYLD 1T0JB 1H8ED 2A5FA 2AR7A 4S35A 2NO1A 1GNPA 4EQ6B 1M7BA 5C2JB 4EFNA 2NO9A 1KI6A 1YHNA 3SJCA 1N0UA 5SZHB 1JNYA 4MITA 3T35A 1E0KA 3LRPA 5GJVC 4BLTA 5C1BA 1T9HA 4FMCF 2ZE7A 4OI4A 1VHTA 3MWYW 4AWXA 3PEWA 2J46A 1W4RA 3BWDD 2P5SA 2XNDD 4UNPA 2NIPA 1ZVQA 2CDNA 1PZNA 4LY6A 5BXQC 2EYQA 5J5CA 3HR8A 2CK3A 1YZKA 1XD2B 1YZUA 3TQCA 4I1UA 5AUNB 2WBLC 2QI9C 2WIAA 4I99A 4Q7JB 4UJ5A 2HDNB 4AC9A 4ASUD 1OHHA 1RKBA 2PH1A 1OW3B 3DVLA 4U02A 1T6NA 3LFUA 4Q9HA 2RGBA 1DO0A 1SXJC 1GNQA 4TL7A 3AUYA 1KZGB 1NIJA 1US8B 2BBTA 3D7MA 3G82C 2RGEA 4PC3A 4U00A 3QSYA 3A6PC 2QMOA 3VFDA 2ZE5A 3EA0A 3REGA 1DE0A 4PSAA 1DAIA 5DSZA 5KDDA 1FL9A 1ZNZA 1H8HD 1Z08A 1Z0DA 2F1JA 1HA3A 3IPXA 4FWIB 1HE8B 3U7HB 3GLGB 4BRUA 2IYUA 2R65A 2GNOA 3DM9B 3K0CC 3NBZC 3SYNA 2B8WA 2VRWA 3BOSA 2HV8A 3AM1A 4URWR 1KNXA 1F6BA 4CIDA 2AX4A 1M7GA 2H8KA 2QPOA 4JLOA 1GRQA 4HUQB 2O0HA 3ZLJA 2FPMA 4AI6A 4C9BA 1MH1A 1UEJA 3TAUA 1UKVY 3N70A 4A8JA 1GUAA 3OHMA 1IN8A 4LJ7A 3PUYA 4V0OA 4A2WA 2YWEA 1GL9B 3TSOA 3DPUA 4ZDKA 4PANA 2RGNC 2ZAOA 1LY1A 2XSZD 3FGNA 2ZREA 5L8VA 2DB3A 1NSFA 2WSSD 3AVPA 4Z1MD 1D5CA 1F2UB 2QAGC 2IW3A 1XTIA 3M0EA 3K0FA 5EQTA 1TQ6A 3CX7A 3SJBA 4D6PA 4C0KA 1FNMA 1N6LA 1JI0A 3ETLA 1UADA 2OCPA 3NHBA 1G8HA 2FMXA 3EASA 3PEUA 2XX3A 2J0UB 4HAXA 3KKOA 3SU8A 4RSGA 2IK8A 5L3RA 4RY2A 3VR1A 3F5FA 1AM4D 4WZBE 2GCNA 2XTMA 3DM5A 5FH9A 4KFUA 4BPBA 1U8YA 2J59A 4Q4HB 3DKVA 3I5XA 3LA6A 1KO1A 4URUR 5DYGA 2Z4SA 1G20E 1SVKA 1XCGB 821PA 3IKJA 3RS2A 2ZQ5A 1SKQA
chains in the Genus database with same CATH superfamily
1FDOA 4INPA 3GLIE 2OXRA 1WD5A 4HX5A 4I55B 3IB6A 1K4YA 2D59A 3OLVA 4XWAA 2VHVA 2QW1A 2W58A 2ZI6A 3M4XA 4WZBA 3TSWA 3CZQA 1ZD3A 3TLZA 1OT3A 5EIOA 1T5DX 3WSVA 1O0CA 2ORED 3DXFA 4URZR 1EFRD 1WMFA 1O94D 1R27A 4RCVA 1YR1A 5KHLB 1H05A 4YYEA 2ABWA 2XRFA 5A03A 4X8HA 4BVEA 3U44B 1PZEA 2IELA 3TS1A 1ENPA 3DHVA 2OK7A 1P74A 1UK8A 1HKUA 3VO1A 4BVJA 4CI0B 2VCHA 3MSCA 4QODA 1QP0A 2ZE6A 2WZBA 4EVSA 2CSXA 2GNAA 2H1OA 4MVJE 4BAGA 4F8YA 1G21A 4KC0A 1E1CA 2BGWA 1J00A 3FIUA 1QYVA 2XI4A 2XMQA 3DDUA 5GZ3A 3U3RA 4DYHA 1KVUA 5E9QA 3ONFA 4XA8A 4AXXA 3NVAA 3OEHD 2FWIA 3MK31 3FF1A 3QY0A 3NWEA 2COEA 1JEYA 3ZGXA 2QVLA 4DYDA 2BEWA 3CF6R 4DT1A 1XRLA 3X2FA 3ZI0A 4Q0MA 2B98A 2Y6UA 3PNPA 4OJNA 4W9RA 1P1FA 1K7YA 1M8PA 2QZ9A 2ZYDA 4J2HA 3UEOA 4H16A 4CQLA 1Y3DE 5BRAA 1TK2A 4HYYA 7ABPA 2WWFA 4PFQA 1Y6GA 2BLNA 1UDXA 2HRZA 1GNRA 2I71A 2YIMA 4GXTA 3A6JA 5LA6F 4QE3A 4FE4A 4LDJA 4F2DA 4US2R 1VA5A 5A0FA 2V6IA 2YQ4A 5ECWA 3MMSA 3HB1A 3G0GA 3NQ41 4YT5A 2EKLA 2Y0BA 3PUKA 2XVZA 4AKHA 4IIJB 3E2PA 5EIHA 1ZL2A 3D64A 3HN7A 1X70A 1O58A 4XAQA 5L7TA 5LP1A 1XPUA 3FGPA 4AO6A 5J4YA 1EGHA 2VRNA 4GM4A 2HY7A 4TLMB 3ZVMA 4EUFA 1C30A 3VAYA 2OYRA 1GDTA 1RPZA 1REQA 4JX8A 2VJDA 4B3RB 3HP7A 4GEGA 4YV0A 4DW8A 2ADOA 1MQSA 4BE7B 2C2XA 2ISSD 4H0FA 3TJRA 3IVAA 2HFJA 1W35A 3Q2IA 1U1CA 4PYMA 4TKLA 1QIKA 3S28A 3OCCA 4B3DA 3AHJA 1PU2A 2AMLA 4BQSA 2Z6QA 1RXUA 5LOVF 4YRGA 1PV2A 3SQWA 3HJRA 1ZK0A 5HGJA 3SS7X 1P1CA 2JJQA 3EC2A 3VNRA 2QUIA 2YIVX 1V6SA 2QGNA 1O97D 2GEBA 2ECOA 1UC5B 2QBYB 3KYBA 1D6JA 2ST1A 2FFBA 1QONA 5AOAA 3WO1A 4TM8A 4YONB 3BT7A 2JI7A 1RAIA 1Z38A 2BI7A 2OOSA 2QYOA 3GJ4A 3L0PA 4K26A 3SCZA 5CM2Z 2QNRA 3P0EA 5SZIA 1RQ2A 1CTQA 5JW6A 3IA2A 3WRVA 4MUEA 3I6BA 2NSJA 1ECGA 3ZGLA 5JSZA 3CGWA 2D62A 1ZHFA 1OB2A 1G8AA 1NOJA 4OGKA 2HTEA 2X8BA 2R7NA 2IHNA 3C1TA 3NANA 4XX1A 1JDPA 2YICA 3ROTA 2FSUA 4AN4A 5FOWA 1C7RA 1E7RA 1GGVA 3PNBA 4KVAA 4E09A 1IOZA 1HL7A 1KAMA 3OPXA 2QT0A 3ANTA 4F8JA 4HL6A 2XXBA 3KG2A 4YR9A 4YRCA 3HACA 3PPWA 1JHRA 3RFVA 4L8WB 1DQYA 4ZFNA 4YRDA 1TCCA 3DEHA 4WK2B 3B5EA 3L46A 5A9SA 3GQBB 4FYXA 1YFJA 2NZXA 3MCAA 4DRXA 4XX0A 1GIAA 1RWNA 3D8HA 3R5XA 4R8VA 2WWYA 4UVIA 3EPLA 3D3JA 3DOUA 4M6WA 3B7GA 4UC0A 4XCVA 1S8FA 2FEMA 2QXUA 3H99A 4TKVA 3B7PA 4LBVA 1LQTA 2ECPA 3O1HB 3GIWA 2G63A 4Q7KA 2EFDB 4A3SA 3T3GA 4XD7D 1Z37A 3W6PA 5HGXA 3RWBA 2J3IA 3BXFA 2EEZA 3DBRB 3FTCA 4CEIB 2NV6A 1V26A 3T4PA 4Z3DA 2C8LA 5GIPE 1GTL1 1USWA 4ALLA 4QDJA 3OLYA 3Q8XB 2WWXA 3FPFA 4JBGA 4GD3Q 3KJHA 3O73A 2VYVD 2DBVO 3DLTA 2WSMA 2ZB2A 3X3HA 2DSNA 3OLCX 1OASA 1Q22A 5REQA 4EG3A 4QGAA 4Z7QB 3KUXA 2PHZA 4CLEA 5L3VA 1QG4A 1D9ZA 3HUFA 4QD3A 4L07A 4S0ZA 4RIEA 1VSUA 2BSAA 3WRYC 3OFND 5BW6B 5L3QA 3MRTA 1U0RA 4LOHA 1OFIA 2RGXA 2WM8A 3RRMA 4XQCA 3G2MA 4DIFA 1TFUA 1ARZA 2QTVB 3BPSA 1W5AA 1I1QB 4PIPA 4TT3A 1M2JA 2W2NA 1HNXB 3I83A 4HY3A 2BFBA 3LXXA 2N9UA 3RREA 1I94B 2DLNA 2PS1A 2DMRA 4I4CA 4LMBA 4R8LA 2JFBA 4PBTA 1X7ZA 4IGIA 1IM5A 4ZVMA 1IWBB 1WB4A 2DHEA 4FFSA 4AXBA 1QO0D 3FPKA 2E4XA 1FRZA 3MMPA 3OT4A 3C15C 3JQ7B 4DR1B 3EAFA 1RKVA 4JDPA 2BUAA 1FUUA 2HYDA 3K0KA 5JAPA 4Z1OA 4FDUA 3H17A 3WL5A 5IMSA 5DXJA 3W5IA 3DMGA 3AVVA 3HCPA 2E5LB 2N1BA 2CXPA 4R2HA 2QL7A 5H3LA 1PLKA 3ROKA 1C29B 3JARA 4GM1A 2GNPA 3NEYA 2VBCA 3PTZA 3U80A 5D6OA 1Z6PA 1ZX1A 2X5JO 1X80A 3K2QA 1VP9A 4Y6QA 3U81A 1DHRA 5JEDA 1R8SA 2I4LA 4NE2A 1KSGA 1OR8A 2P5YA 4ZYZA 2OY0A 2IHYA 5IXJA 1EIZA 1DARA 1QUFA 3GGGA 5C8XA 4AYWA 1G20A 2FE1A 4N8SA 1Y98A 2BP7A 1RQPA 1VCHA 5B2ZA 3ZCSA 3ELDA 1XA4A 1ZK3A 2Q6TA 2BKEA 5K7SA 2IYAA 3AKCA 3LL7A 5AFSA 5BSGA 1T4DA 1YZTA 2V6MA 3BGDA 3T9CA 3TRJA 5G4LA 1GKYA 4EMSA 3PV0A 1T24A 3UB3A 1JSXA 3B51X 3AUTA 1AKRA 1FZTA 1II9A 5BO5A 2XBUA 3LECA 3A31A 1R4NB 4RLFA 1PUXA 2FUG6 3EVZA 4IVPA 1JAHA 1ZP6A 3QKTA 4CM7A 3L0ZA 2D2EA 1KDPA 2CD7A 1OWPA 1XWFA 1LSJA 3DCYA 1PS8A 2H1LA 1PF7E 4CNBA 3L7AA 1XKXA 4IV0A 2WK1A 4QDXA 2GXQA 4LFBB 3ZXYA 3WA6A 3F2VA 3AESB 2KX7A 4MQ5A 4LXQA 4L57A 3JD3A 1NY5A 1T8YA 1LK5A 1LW6E 4TUYB 3K30A 4W1SA 1FQWA 4CMAA 2HBQA 4XDGA 3UYKA 3SVLA 4X66B 1A1VA 5AOCA 4GDMA 3VZQA 3ZYZA 2CV1A 2E4WA 1FDSA 2WFLB 3HCAA 2BE7A 2RH4A 3DT8A 3OZXA 3PQFA 3GCZA 4UBMA 5K0JA 5I7EA 3AUUA 3HZOA 2W37A 1IXZA 3KKQA 2WF8A 1TUBB 2ZJ6A 4QYIA 2BKUA 1Y7LA 2P3OA 5EIEA 5BVHB 2MINB 1LTKA 2WNSA 4DMMA 1NXPA 5IJZA 4IL5A 1J22A 1OLUB 5EEHA 1QH1B 1SC6A 1U8AA 4QU0A 3UJ8A 4I5IA 3VYRB 2WHYA 3JAWA 3MXOA 1XAJA 1RBMA 3MXTA 4YMHA 3K71B 1Z88A 4FVTA 3OIDA 2ZWPA 3EYWA 4PZAA 3PC4A 3NZEA 2B4AA 4PHGA 2P6NA 1VJ5A 3UF0A 4HAYA 2Y1LA 2PT5A 1JDTA 3FY4A 1TPZA 5C4GB 4CKEB 3NBXX 4UDNA 2ZRDA 2GD1O 4E2YA 3M82A 3GRVA 4Z9YA 2FYTA 4A9AA 2JI6A 3A0UA 1L5VA 1L6IA 4WN9A 4ES6A 1Q0LA 1W88A 2D0DA 2DQZA 3A8TA 3K09A 1GZVA 3KLOA 4Y9TA 1UKCA 2GKGA 1RRMA 1BVUA 2ZBQA 4DSAA 4YJ2A 3LC1O 3BD7A 1V16A 3H3JA 2H06A 3BK7A 4BEJA 2HWXA 5B55A 3DOIA 1MIOA 5EIWA 2D0IA 1G2OA 3KJEA 5LBUA 2NADA 3EZ6A 1VTKA 2I8AA 2J8ZA 2SKCA 1Q1NA 4RHYA 4DIBA 2FZ4A 1N8KA 3CCCA 3F46A 1N2BA 2JIZA 3B52X 2C9MA 1P44A 1PWEA 3EW7A 3DMTA 4PX5A 3CW8X 2AOVA 2YXEA 4YH1A 4EHJA 4L74A 4MI9A 2OO3A 2XE8A 3MB8A 5CK5A 1O87A 1X1CA 3M5DA 4C29A 2CUTA 4EWLA 4F91B 1UANA 4UBKA 4WOCA 2R5FA 2PRKA 2YV1A 3H8SA 4AF7A 1SVUA 4OAQA 3JWJA 1QTNA 4BFSA 2I2XB 1P80A 2IS4A 3AR2A 3FETA 2DECA 4IXTA 4X54A 2O5EA 3AIIA 4UTOA 4W5HA 4G1VA 1FNDA 1Z0AA 3ENKA 4IMRA 5LN1A 2OO5C 3F5QA 5G0UA 4QXPA 3TSAA 4DPMA 2WVGA 1QU3A 1G8YA 1PBNA 3RC1A 3WL8A 2C4MA 4WX2B 3L4BA 5JECA 1GN8A 1EJ0A 4L0MA 2F3PA 3GMTA 1ZI6A 3AFIA 4UEOA 4OXNA 2DERA 1R37A 4JYAB 4YPVA 1NUAA 5HBRA 1Y9EA 3DW3X 3ESRA 1A2QA 1A82A 4UBJA 4NYIR 4RNDB 3RD5A 3MAAC 4CZ2A 3R8CA 4F2HA 2CSUA 5I8WA 2OAP1 3KZ1E 4GG1A 4O6VA 2HT1A 1W5TA 3KB2A 2WZQA 1HEYA 3OE1A 4HADA 1ORWA 4LTDA 2C5FA 1XZJA 2DE0X 2AW5A 1MABA 3JATA 1S2NA 2WIJA 1OKKD 1RVV1 3QBVA 4OTZA 4S2EA 2R00A 1E66A 1TYDE 1VI6A 5DM1A 3T1OA 1FXSA 1ZGGA 3QELA 5ILQA 3B1FA 3JAWB 5K3CA 5J23A 2C77A 3AO0B 2JLUA 1LLUA 2DGDA 1JSLA 1OLUA 2F1RA 4PC1A 1W19A 1Z2DA 3IJRA 3OT1B 3FSEA 3RYHB 2CUKA 1I4WA 4MUKA 4JT9A 3SBDA 4UQLA 2PV0A 2IYPA 2D8AA 4LJRA 3WAGA 1TKCA 1NVKA 4EF4A 4R1TA 3KHKA 1NBME 4YAEA 5C5CA 1WV1A 2Y76A 1RMQA 3L4EA 4GPAA 3DMNA 5G1NA 3WB0A 6REQA 2WUGA 4FOSA 1ECPA 4UU7A 4IKOA 1V4VA 1XBTA 2WFLA 3P19A 4OG2A 2OYCA 1SR8A 3C4QA 3H5IA 2F55A 2EW2A 2RG7A 3HZHA 4BMSA 1HLFA 3G5UA 1U8EA 1W36D 1A7KA 1HDOA 1EK2A 4NAVA 1EVIA 4WBXC 2UZIR 4IHJB 1RLIA 1I1HA 1PL8A 3ACDA 4IWYA 3WLFA 3MTAA 1JLMA 2J07A 4BNGA 1KEEA 3E15A 2WJPA 1ECLA 1E89A 2BJWA 2AQIA 5B6JA 4FYIA 1SG6A 2PGJA 1FSZA 5H70A 3UYLA 3G2QA 4R4JA 4EJ0A 1C9MA 2GYYA 2H1VA 4V3CA 1ZGAA 1Y3IA 4OYRA 2C2OA 3D4OA 4MVJG 1F2TB 2RHGB 1U6KA 4TGLA 5I51A 1E3EA 3N8NA 2XMDA 4URYR 1OLSA 2BTOA 3HKDB 2VH5R 3HPRA 1KQOA 3VPSA 2WKQA 3WLTA 4JX9A 4PONA 3V4RA 1SC9A 2QX6A 1C3OA 1K7FB 4RANA 3T0GA 3T95A 2OLKA 2VUIB 2YWRA 4BWFB 1KI8A 4DQLA 1GG9A 3P27A 4UPEA 2RE8A 2E18A 2IPXA 4IOKA 2QL6A 5ADWA 1PJAA 5KTNA 1G20B 1H6AA 2H1SA 1J24A 2DHQA 4EA7A 3LLCA 4JB3A 5CA0A 1NC3A 3PLAE 3SI7A 5IK2D 3ZDAA 4K03A 4K86A 5HE8A 4REOA 4BASA 3JYLA 4DCTA 1FFCA 3ZLVA 1AB6A 2O6HA 4N7JA 2W6ID 1M6VB 3JYNA 2Q1YA 4NZ9A 3VO8A 2GZRA 4NBVA 2RHLA 5ITZA 1J5EB 5HQTA 1V8BA 1QIHA 1SHLA 5GVRA 5IABA 2Q6LA 5AWFC 3JRWA 4BNKA 2EG9A 4NZMA 4XYBA 3H11B 5DPMA 4ZDWA 4R7ZA 4ABYA 2B2XA 1STOA 2YW9A 5DT9A 3R3ZA 1SJ9A 5EA2A 1RZ3A 4L72A 1RHKA 4JL8A 4Q1BA 3QKRA 4HLQB 4PIVA 4Y6LA 3RROA 1TK9A 2OECA 4DNOA 4EH1A 1L0BA 2C4UA 4X60A 5HMMA 1YE5A 1L7NA 1CQXA 5IH3A 5EJ5A 3CEAA 1Z13A 4YDSA 5DKFA 4JVLA 5M2QA 1ADYA 3WGTA 4D1YA 1QHXA 4N9WA 4YJKA 3VR6D 1IATA 1G3MA 1M5UA 3LKDA 4I5FA 4EITA 2ZZKA 3IL2A 3I12A 1DCKA 1W59A 2EZUA 1Y7PA 2J9FB 3LIIA 3Q12A 4QIHA 4C7BA 4DV2B 1GYQA 1MQAA 2V58A 5CD9A 3P94A 1JIVA 4MUJA 5AHRA 2V4ZA 1EXNA 2WDPA 3EVCA 4GX0A 4HG2A 2QW8A 3WGUA 1EFUA 2VAXA 4O4LB 1Q0TA 1ISHA 1WUKS 1WW2A 3KVVA 3NPMA 4FOPA 1UQUA 3GO4A 1U1EA 3SYMA 1RAHA 2QLBA 2VIIA 4UEQA 5CG1A 1H6DA 2UV8A 4P35A 1NXVA 5E8JA 1WW3A 2QE7A 3P0IA 3PXEA 1HOTA 4KO4S 3GFVA 4IXNA 1TF7A 2BDEA 4NQRA 1G17A 2ZVPX 4NZOA 4C04A 5B58C 4RTJA 5EUQB 1J49A 1EGAA 1ZSYA 3DH0A 2HU2A 3O8OB 4MTLA 1ODFA 1Y33E 1MQ9A 4GQIA 1T2UA 2V7UA 3WK8A 3S68A 1I7PA 2GCOB 3B1JA 4LWPA 1PJLA 5ANRB 1MX1A 1ZM3A 3EGVA 3IB3A 1RTKA 5CCXA 3R0JA 3NVMB 1Y9DA 3PR1A 2VUTA 4O8CA 2K87A 2X3YA 2X7JA 1LA2A 1UXJA 3QQ5A 2PNJA 4U0JA 1H2WA 1B15A 2BFWA 3G5TA 2C2HA 3TNYA 4KPGA 4J91A 3FF4A 1R12A 2JGKA 2IIVA 3LWDA 5F1PA 3F6YA 4N9QA 5K20A 4M8LA 1X14A 1CZKA 2NTNA 3AONB 2Y9PB 5EIAA 1UBFA 1BQ3A 1FX0B 1VHLA 4WVLA 2ERXA 4MR9B 5JWOA 2MTBA 2YNMC 1RM4A 4ISBA 2Q4BA 4RPCA 4DS3A 4WDQA 4B48A 4KNYA 1MA3A 4A2PA 4M89A 2WQ6A 3PF8A 5DULA 3D02A 5TGDA 2J9FA 3OD5A 2AF3C 3GEMA 7AT1A 3KWMA 4X7RA 1GFIA 2QN1A 3G49A 3QXGA 4IFEA 4KIFA 5FB3A 3C5CA 3TNDA 3K15A 2ZAMA 4U9IS 1QZTA 4RK6A 4TTTS 2XODA 4S05A 3AVWA 3PNMA 5ALEA 2DBYA 3E2IA 3VOAA 5JPCA 4UAGA 2WC1A 5JSZB 1P62B 1Z5NA 2R60A 2BFMA 2Q5CA 4M1EA 2GJSA 4D4GA 1MOQA 1Q84A 3LBIA 5AW5A 5EZ6B 1I3CA 1XUOA 1XAGA 4QBGB 4MWOA 5B1DA 1CQWA 4RSMA 2J9YB 4DR3B 4LOIA 2VJMA 5SZKB 2MR5A 3GRFA 4RD3A 3O83A 3U17A 3AHCA 4O0LA 5GMOA 4C4TA 4P7KA 2VSYA 4DSNA 3OJWA 1E62A 2P40A 3C2QA 4JQYA 3QP9A 2VWGA 3KUKA 5ADHA 5L3SB 4WZZA 3ML1A 4RSHA 4NCIA 4LW8A 2A9PA 3DF7A 1NOIA 2ODPA 4TTQA 3WB1A 5B2FA 5CA0B 3T7JA 4EUEA 4KH1A 4TXLA 1RSZA 3OOEA 3EG9B 1P5RA 4DWOA 4QA9A 2OESA 1CUAA 1DJQA 5IVPA 3G23A 2AMVA 4Q7MB 4NMLA 3EIOA 5EZSA 3HXKA 1E6WA 1VLJA 3JVEA 2OFOA 3LVRE 4L2IA 4G1FA 4QPCA 2EQBA 2PPVA 3GFBA 4G2TA 5LQMA 1REQB 1FS4A 4D82A 2GCPA 4FSDA 1RXSA 5FR2A 2BONA 2JFOA 1IN5A 2PUVA 1C7FA 1M8GA 2YBEA 2QP9X 2YFHA 3W3AD 1QFXA 3GEIA 2VTBB 3RBAA 2XDYA 2CD9A 1L5HA 4LYAA 2W2PA 3FSGD 3L0SA 5BWOA 1LF0A 2UYYA 2FMIA 2H1CA 3RVLA 4B6SA 1XLWA 1NVWQ 4JJFA 2NXWA 1C9KA 3K94A 3RYIB 5JS2A 4DTIA 1IY8A 1IBRA 4OO3A 1V2HE 3SJZA 4NV1A 1FRVA 3GDOA 4PU0A 2WJWA 2YKPA 4Q3OA 4HFNA 4HMQA 3SKVA 3TM4A 1KEVA 3O26A 3L82B 4M1YA 3JWHA 4DLXA 4MHOA 1KS2A 1U5AA 2VTKA 5AVQA 4E5MA 1HX7A 1EXDA 3RHTA 4MAMA 4CPDA 3UAYA 1USGA 3UWDA 2OWEA 5KS2A 3L9XA 1V1RB 1AN0A 5TMPA 3HSKA 3I9KA 3D7LA 1GGKA 5AO9A 1C1DB 5EUBA 1FXUA 1ATIA 4QTTB 1D09A 1XTUA 2IF0A 2QTWB 5F3WB 2ETXA 1ZD8A 3MCZA 3IAS6 3QLUC 3RYHA 1KI9A 1O6BA 1DXOA 3H75A 1JDJA 1X1DA 1HLDA 2C61A 4BAZA 2XUQA 3HU5A 3D6UA 3WZMA 5M5BA 3O2SB 1NE7A 2XT9A 4JGBA 4JJ8A 1ORIA 2FSVC 3KKEA 1FCJA 1XZKA 3G2HA 1MABB 4IDNA 4QHSA 4U7WA 5LYYA 1QS0A 2XNSA 3KYDA 4M1MA 5ALZA 3FPJA 3DMRA 2OHJA 4QDKA 3I01A 1GA4A 1XCMA 2XMPA 4TLCA 1N7HA 4IINA 4G0NA 2O9JA 4N0EA 2HNBA 4L7VA 1U94A 1KR2A 1SA0A 2HK9A 4DUGD 5IM4A 4JI4B 2BFCB 3ZXUB 2PZBA 3FKSD 4AY6A 5I4IA 1CRPA 4LBZA 2QRGA 1VPEA 3QVGA 3LCVB 4G4SP 3EMDA 5KYUB 3W8DA 2QN6A 4QQ8A 3EMBA 1R0YA 2P4EA 4YBRA 3GGPA 2EDCA 2W5UA 3BJEA 4P38A 5SV2A 3ROPA 1QBKC 1NQTA 3W0LB 3KYCB 1I2BA 3KDSE 2I3AA 1OXMA 3GPBA 5EJ4A 4Q1VA 3U19A 3BX1A 4MJ7A 3K4QA 2SECE 4NAUA 5DU2A 3X1DA 2FSHA 4R2JA 3CQ9A 4UCXA 2XB2A 1P4AA 3DAGA 1FTNA 2BY4A 1F4PA 3HV2A 3EHEA 4U7DA 2R00C 3VPHA 2IYTA 3M6LA 3WWYA 1U0BB 4OLHA 3KCNA 4CI9A 3PC7A 3T8YA 2R8YA 4FBLA 3TO5A 3V4LA 5LJLA 3DLIA 1UIMA 4FYJA 1YU9A 4KQEA 4U7FA 3ZS9A 3I04M 1H1TA 2CHUA 1NLUA 3ZKWA 1LPAB 4MVYA 5DDIP 3F5SA 4C6SA 1ZOSA 3ECCA 5LWQA 2KE5A 3L92A 3GV0A 4A8PA 1SXPA 3MWJA 2C07A 3UW3A 3WP1B 4K1LA 2YRXA 2BEVA 3GNQA 4F1KA 4ZEVA 1VDZA 3K72B 4QVKA 3NPAA 1OGYA 4LXXA 3VDMA 2CEKA 1L2TA 3SX2A 1KSHA 1OY1A 1P9RA 3NGLA 4W8GA 3Q9SA 4UD6A 4DQ0A 4R1NA 2F3RA 1HLPA 1C0LA 3AR6A 3I72A 4MRSA 2Z6UA 1P0FA 3I09A 1TYCA 4OHKA 3FVQA 1UT5A 4OB6A 5LQDA 3BULA 3FTQA 1T1GA 5HKBA 3DTTA 1DG3A 2PKWA 4RIGA 1ZOPA 3BA6A 5AJYA 2OMEA 5H0IA 5L45A 4US1R 1PS0A 2V4UA 4B40A 5B3AA 3WIVA 3IE0A 1THZA 4NCHA 1MV8A 5IUKC 4MWGA 4HLCA 1E4EA 2H1WA 1OLOA 1H2ZA 3MJHA 4KYVA 5D5QA 3TW8B 4TMVA 1JRLA 1XLTC 2DWUA 2FSSA 3DVAB 1YRLA 3IIMA 2XGSA 3CX6A 5KNLA 1ZLYA 4DMLA 2BN4A 1FX1A 4KRGA 4ZANA 5KJEA 2BPOA 3OM9A 1GARA 3OX1A 3ND8A 3TPCA 3ZCTA 3FTEA 3FHTA 3B89A 4Q21A 3SSOA 3QITA 5IH7A 4OKIA 1E60A 4KR7A 3B8HA 1TPYA 4IDQA 2W2VA 1U04A 3VKHA 4QYIB 1TUBA 5KQGA 3QUTA 4JQOA 2FA9A 4PNZA 3GBPA 3OJXA 3RSQA 3TN7A 4ZICA 2EL9A 4WCFA 3KUDA 4G9GA 1VRVA 4MV0A 2Y1WA 1YE8A 3DJYA 4WLUA 2HWWA 3S1SA 3F7NA 3Q41A 3FDZB 4KUHA 4PCAA 1B2LA 3G5MA 1WY7A 2RIPA 2MSEB 2P69A 4F4HA 2CLEB 1AGNA 4Q00A 4C0HA 2E5WA 4C01A 1YA8A 3BCRA 3C6XA 4AG6A 1QR6A 1SCDA 2QD3A 3CPEA 4RFLA 2E2WA 3DBHA 4DR6B 2JFQA 2VDKB 1C4KA 1LLQA 1UMCB 5D8DA 4Q02A 2CXTA 1D3AA 1N7JA 5KQSA 1DHTA 1TYBE 1EP2B 4J03A 5E6RB 3TAHA 4UCFA 5DLPA 5K3SA 4LF9B 1PBTA 5FWYB 5EXXA 1ND5A 6PFKA 2BFFA 2ZBPA 5FBWB 3F67A 1DAFA 4NRDA 4YV2A 3KQLA 3HA5A 4HH3C 1A5TA 3E9EA 2F1HA 2AT1A 3ZDZB 3SR0A 4OLJA 4CT0A 2V7PA 2HLDA 2VJCA 2FUNB 1HK7A 3O8BA 3TECE 2C5GA 2JH3A 4L3VA 4KTVE 4EL0A 3DBOB 3Q4GA 3TQHA 3B82A 1IK4A 1C50A 4BB5A 3RBZA 2DRIA 1XXLA 1K89A 2DTXA 2NVUA 1BMFD 3NHRA 3NWJA 3FMVA 1EK5A 3OETA 3JYPA 4GOOD 4NYJR 3T38A 5KPJA 4DR4B 3ZJTA 1RZVA 2QTHA 4INJA 4U7TB 3TLXA 4JXXA 4MGYR 5D5PA 3JQ6A 4PSKA 1VIDA 1M2KA 4U7HA 2HQ1A 1IOWA 4LYFA 3UUWA 1T91A 3G13A 1WG8A 1UDBA 5LIPA 3R3SA 4UNIA 1Q0RA 1QHSA 3LLMA 4I4TF 3ZWMA 1WMBA 2P6OA 1VCMA 3RODA 3TXAA 5BRJA 2IS2A 1KTVA 4ZAZA 3CLSC 1I10A 1K3FA 4QTXA 2K6GA 4C3OB 1PK7A 4MAFA 5AP9A 4PGGA 5FDFA 2R6FA 2GFQA 3RU7A 2WU1A 3WGIA 1E99A 3USES 4COOA 1K68A 1I7DA 2OCAA 1FQKA 3FOAA 3UPUA 3SF0A 4GZLA 4KAFA 4RTQA 1VJCA 3QWIA 1AKNA 1X7ZB 3SOPA 3IAS1 1S1CA 1QC5B 2AWNA 2F1OA 3NHSA 2FQ1A 4JVMA 2H08A 4DHEA 3HJFA 4WIAA 5D3MB 3M7IA 1XTRA 2RCNA 8ABPA 4X1IB 4UOZA 4AKTA 3OU2A 4HDMB 1ETUA 1XQ6A 3C43A 5IJ0B 1YF3A 2PX0A 3CV3A 3NHYA 1F4LA 5K8LA 2BMDA 2PSEA 2BZGA 4Y0AA 4CV1A 2YMLA 5IKEA 1AH2A 4GZMA 2GPTA 2PU7A 2ILVA 1N3BA 1YB5A 3NJRA 2Q5EA 3CNQS 2WU0A 3AR9A 5IJXA 1OBVA 4H7IA 3WRXA 3NXKA 3UCFA 3B48A 1IVYA 2ZWAA 4EOGA 1XHLA 2IDMA 1DC4A 3JQPA 5G40A 3V3KA 2R85A 3R7NA 3HB7A 4QRHA 2B30A 3P2EA 4MVJM 2RC5A 2YHBA 4HQKA 3R5SA 3ETJA 4WLVA 5ETJA 1LRKA 5IANA 1R6UA 2WJ3A 4O8ZA 1T4BA 1J21A 4EGCB 2EIHA 3GELA 2R44A 3W3AA 2ZUVA 1MRNA 4Q3AA 1T6ZA 1SVIA 2J9XB 1Y4SA 3PHIA 1QS0B 5SYNA 2W6OA 4GKJB 4LA4A 4EB3A 3A6DA 2WPDA 3PPVA 4YRNA 1RDFA 3I2JA 2NVWA 3DQPA 5AJVB 3O47A 1Y5RA 2IIBA 1ULSA 3HU3A 1T34A 2AJTA 3GDFA 5CNKA 3TEJA 3FCSB 4GOJA 2XUZA 3ZY2A 3OQIA 5K6AC 1S3IA 4QU9A 4RTMA 5A9SB 2QRVA 3RVDA 4DJTA 2DR2A 1BE6A 2Z3VA 3U3DA 1Q3HA 1IUOA 4YGXB 1EINA 3RSOA 2PUGA 2AI2A 1HQKA 1YS7A 4OY3A 3F7MA 3SVZA 5L40A 3KE8A 1XZBA 2J5KA 3PEFA 4YS6A 2IH5A 1JFVA 4WZ6A 5AM0A 3VKWA 4DM7A 2ZROA 3GHHA 3ZV4A 2CNNA 5JATA 3LUJA 3EVEA 1NSYA 2V0GA 1DBQA 1T1JA 4R1LA 2J31A 1K3UB 1Q1AA 1A4IA 2GCGA 5ECGC 1G6Q1 4D0LB 1PS9A 3W4JA 1AKYA 5KMGA 1A72A 4OGFA 5LMCA 3JASB 4MYDA 4RADA 3AVXA 2F4NA 1FW6A 3WYNA 4Q18A 2ZIGA 1DLIA 5JXJA 1L3IA 1N0IA 4XZ3A 1Z5ZA 1ZD5A 4ND4A 4YP9A 1N57A 1BX1A 3OH8A 3RYIA 3Q6IA 3IR6A 3OQ1A 3N39C 2O7VA 3M34A 4YJFB 1W6UA 4CKCB 4OXIA 1WZUA 1S96A 3DNFA 3IDAA 3IURA 4RTOA 2Z2XA 3CF4A 2QRUA 4OGGA 1OLXB 4UM7A 3IA7A 1P7PA 4KIWA 3RT1A 3JQGB 1L5KA 4DC1A 4BQFA 1OXKB 1JDSA 1SXJA 4HS4A 4TKZA 3IEKA 2ZYGA 2QLLA 3UMCA 1M34E 2GA8A 2GETA 2C31A 2B69A 3N9IA 4LBWA 3RIGA 4B76A 4A6DA 1KXJA 2VYNA 3LQYA 3NIFB 3EG9A 5BNFA 3J7AC 3SC4A 2HADA 1N0VC 1IEWA 1XZDA 2FX2A 1HOXA 2V5VA 1FMLA 4U3JA 1TKRA 1CZHA 5TT1A 3H0EA 1OX4A 4WBSA 2EKQA 1P61B 3JQ9A 3VYTB 4ZV4A 4GXNA 4N5IX 3N5CA 4DQDA 2OC9A 1QLJA 5BWBA 5CFNA 3GCDA 1PJ3A 2GN6A 2CLFB 3A4VA 2ACWA 1DBWA 1UPXA 1ZCBA 3QEOA 4NE7A 2WT4A 4QGHA 3EQZA 4F2WA 4FT2A 2J6IA 2BJHA 1Y1RA 4AKSA 1W4BA 1ZLXA 1XTTA 3ONNA 2OOKA 4BOYA 2WVAA 4J2OA 3BMQA 3DD5A 1XZFA 1D03A 3C7DB 1CLEA 2XTAA 2JLXA 4CDNA 1QQ6A 2P3QA 4IEIA 4R71A 2REXB 5CD1A 5JD5A 1OKKA 3MGGA 3ROMA 5EP2A 3MIZA 3ESCA 3MN1A 4B7UA 1U80A 5ALSA 3VSBA 1JEYB 2XQIA 1UPUA 2OZPA 1M66A 2DYKA 3SFZA 5B58T 2B2NA 1B7GO 2YWDA 3F5MA 5T5QA 4ILKA 2BGUA 4A16A 4EATA 2PFGA 3L8CA 5F9MA 4E3ZA 1GGJA 4XH9B 1BE0A 4NBUA 4BS9A 4GX1A 4FHEA 2ZTMA 5BORA 3D81A 2H00A 1OD6A 2YWJA 4BP3A 1XFAA 5G0WA 1VGVA 3LU1A 4H60A 5JJKA 4YK7A 3V4OA 1Y3BE 2QROA 5FQNA 2FEXA 2JRLA 4PNPA 4QREA 1E1LA 4BWVA 3T9DA 4W5NA 1UPAA 4OM8A 2J3HA 2H4HA 1RCTE 1FJXA 4K9PA 3GOHA 4R1SA 1A1SA 1JPNA 2DUNA 1JV2B 2PVSA 3RTAA 3OEWA 1S9DA 3U16A 5IVKA 2VF7A 4PE5B 4PCVA 4YMLA 2CB9A 4EPXA 3SX4A 1V5EA 1E8DA 2AXQA 3ZU5A 4ZAYA 1A97A 1FDIA 2AWOA 4QHTA 4W5WA 3NHAA 4Y0NA 1KE1A 3H8VA 4NENA 1V8DA 1NVTA 3W9SA 5CCEA 1TLLA 3PJEA 1BYIA 3R6WA 4PIMA 3GAZA 4KWHA 4WQMA 1A8SA 1NF8A 2J7PD 2J9ZB 4MKZA 4X91A 3OFSA 4KMOA 3OE4A 3S2UA 5JLJA 2Q3BA 4XIYA 5K0ZA 5BNTA 3NS7A 2XR1A 1EVJA 2WJ6A 4ZOLB 4RH1A 3E7FA 1ENZA 1KYZA 1L3BA 1VKOA 5P8WA 4POOA 4ZI7B 2ZI9A 3EIUA 4JBXA 4PBRA 2ONZA 3UG7A 3NJ4A 4WTOA 2J0UA 1RLJA 4R83A 1QOQB 4E3WA 3GH3A 4BVAA 4O4LA 1XXHB 5HQ3B 2FX3A 1IHDA 4RCYA 3ZY5A 4D5GA 5CIYA 2FPUA 3COYA 1F12A 1XKTA 3ADOA 3BK2A 3CRRA 4GGPA 4YNBA 1UJCA 3HFJA 1PR4A 3SJAA 1E2MA 2CDCA 1HYHA 1C7EA 1E9BA 4HGQA 5E2IA 4CEHA 2PLRA 2PKQP 5FBVB 5KSPA 2VPQA 4ZVVA 3LYLA 3PE3A 4B44A 2QT9A 2DPMA 2CC2A 1WBJB 4JIMA 4KPUA 2QUAA 3STUA 5I48A 5HRUA 4DMGA 1N5MA 2P7HA 1C0KA 4CKWA 1LFAA 2Z5VA 2PGIA 2QE7D 4MKGA 4HB0A 3VHQA 2CXNA 5EERA 4CODB 2Q29A 1DC8A 3CRNA 1R6TA 3FMFA 4DKXA 2WABA 3R6TA 2XUHA 4O2AB 1H0SA 3SHWA 3ZGNA 4LECA 4KMMA 5NLLA 3AUKA 4MWZA 3SEQA 4Z4HA 2DKOA 1OZFA 2PVCA 2WJHA 3I1YA 1XCLA 4G1UC 4NPCA 4WKBA 1E1NA 3AVOA 1SOWA 3DUFA 1HSOA 4C0SA 4FP9A 1FLDA 4KNWA 4OBEA 1JQAA 4UUPA 3AXTA 3P9PA 1GYRA 3VVBA 4BBJA 1IN4A 1D2RA 4ZN6A 4M87A 4RACA 4BRZA 1W47A 1D0SA 1CJKC 1E59A 5DWVA 1W30A 2HW8A 4G81A 5DH9A 1JIJA 3IKLA 4BFVA 3C6KA 3Q0TA 4XPIB 5MN6A 1EU1A 4PVCA 3S40A 3W8FA 1P2SA 2X13A 3IXMA 5A0VA 4M8IA 1CRQA 3UUGA 1GCAA 2BFFB 2Q07A 1FNCA 4V0MA 3H86A 2PL1A 1DEOA 3FVRA 4G86A 1IDN1 2A59A 5FV7A 5FPKA 2SBTA 3EFOA 5H81A 1IMJA 3D5EA 5H80A 4ZK6A 3RFCA 2QRNA 2IFTA 2GHTA 4J3JA 2D7DA 4P36A 5BR1A 3HS3A 1OILA 2BKLA 3BSSA 3UKJA 2IL1A 2PZGA 5DNVA 5KQLA 5EHGA 2HPHA 5BSHA 1QQ5A 2ZRBA 2GWRA 1EM8B 3O4FA 4EHBA 5FF9A 3T5GA 1KEEB 3WGQA 4D97A 2G25A 3K05A 1GTVA 4H31A 3V7UA 1TEXA 3IUSA 2H7XA 1P4SA 4P92A 5CX4A 4BVGA 1QHIA 5D7NA 2H2HA 4K6OA 4BFYA 2DQYA 4IZIA 1TM7E 2D1RA 5AVYA 1YR8A 2X6TA 1D0VA 3N07A 4I3GA 2CFOA 4HGPA 4MVJA 4OHMA 4ZO7A 3D43A 1HBJA 3RHSA 4CVNA 4L4UA 4BCBA 4RZIA 1ADGA 1JP7A 3BQ9A 3E9CA 1S3FA 2HUN