4PPNA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
327
structure length
311
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RecA, 1st part, 2nd part
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 95
structure length 311
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppnA01
1IHUA 1GOTA 3QPWA 2WBLC 2OFXA 5FPHA 3B5JA 3N70A 1GFIA 1S3SA 2ERYA 4GPTA 2FEMA 1G6HA 1Z6TA 2Q9AA 2E87A 4MYTA 2KBFA 4KVGA 1HY3A 4KYIB 3AUYA 4H1VA 1G3UA 2YWEA 2DY1A 4P32A 3U44A 1EFHA 4PC3A 3RS0A 3G82C 1BO6A 1DBSA 5TB5A 1DAHA 2R6DA 3AB3A 5CYPA 1II8A 3B6EA 5DNYB 2PJRA 2OFWA 4JVMA 2C98A 3RYTC 3K09C 2GZAA 1WP9A 3NEJA 4LHWA 4KV9A 3VR6A 2PMKA 4GI7A 4BZPA 1B23P 3C5HA 1IXRC 1FUKA 1Q12A 1RRPA 2FU5C 2DFNA 2ZS9A 2ZANA 1QHIA 5CITA 1QF9A 3ZIAA 3K09A 4D4LA 1OT3A 3UXMA 2KJQA 4DCNA 1F5NA 4ASUA 2O8FA 2CNWD 1XTJA 5L3RA 2FPKA 4FCWA 5LB4A 4HLCA 5JJKA 1S4QA 5E95A 3LBNA 1TEXA 2HDNB 4GNKA 4Q4AA 1QG4A 4G1UC 5SZHB 2YOGA 5DGXA 4IRUB 2AXNA 3RLFA 3WMFA 5IT5A 2J0UB 1GKYA 3GQBA 4C30A 3B1VA 5JZVA 1DO2A 1G7SA 2QU8A 3A8TA 5GJVC 3ZD6A 5KSYA 2EW1A 3K9GA 4Q4LA 3TSOA 4FI3C 5EUQB 2Z6VA 5HCIA 3C15C 3EPJA 3CRQA 2VQSA 4Q02A 1X1SA 1ZD8A 3CIOA 4IVPA 1EK0A 5DN6A 4CRWB 2JJ2D 4G5OA 1KO1A 3QXJA 3V4RA 2ZVQX 2KBEA 2ZROA 4LC0A 2QROA 2VHCA 4MKHA 2WJHA 2IBMA 1E9AA 1ZBDA 4OQFA 3WHLA 5FTJA 1XD2B 3LD9A 4OHVA 4Q9KA 3ZVLA 4W7SA 4DCSA 1YE8A 2HYDA 1F6BA 1ODFA 4JKYA 4TYQA 1N25A 1GKUB 1XCPA 1DO0A 4TYYA 1IM2A 3W3ZB 3DM5A 2Q3MA 4MYHA 4QBFA 1GSIA 1A82A 1KO4A 1Z29A 4O0MA 3VTKA 2FOLA 3HU2A 5M04A 2B21A 2OBMA 1D9ZA 1W49A 3NDBB 2D7DA 4PQFA 1G8PA 3DMDA 1R0ZA 1NBMD 4LOAA 1IJFA 1SVKA 5BXQC 2A5FA 2GK7A 2Z4RA 1N5JA 4PC7A 2RGNC 4P4SA 3N5CA 4NYJQ 3U3MA 2IYVA 4JLVA 4XD7D 1LFDB 3FHTA 1IXSB 3IEUA 3A6PC 1CLUA 1OIXA 4MQBA 5JWRA 2AXPA 3JVVA 4EFMA 5H8WA 2CLCX 5FPTA 3F8TA 3LW7A 1T0HB 1MO3A 2JLRA 2RGNA 4TLCA 1G19A 5F3WB 4AKGA 4MUBA 3ZS9A 2F1HA 4YXWA 4LPSA 2D62A 2I3BA 2ZI5A 1NBME 3LW8A 3Q9LA 4PC6A 4TLAA 3UG6A 3ICQB 4ZKDA 4PZLA 3LFUA 2ZTSA 4YQFA 1G7RA 1N5LA 5F9FA 4TT3A 3W9YA 1Y3AA 2ZYVX 4AKIA 4Q9LA 2NQ2C 1DAEA 3O8DA 621PA 5G40A 2OCBA 2JLWA 1E69A 3U3RA 4BZXA 1CBUA 3DMNA 1JEEA 1BH2A 4QGFA 3R9IA 1II0A 3GLIA 3CNLA 4IOLA 3SFZA 4OI2A 3L0OA 1Z2CA 3LVQE 1FNNA 5KU1A 1RPZA 4D25A 2C96A 1YZKA 5EE9A 3TBKA 3ZYCA 4Q4HB 1E9EA 5KNDA 2WTUA 5FTMA 2JLVA 1E94E 1N6IA 4E5UA 2O0KA 5KSPA 4BASA 1RJ9B 1ZUNB 3HU3A 2AFIE 4XTRA 4PHHA 1KKMA 4GDFA 3ECCA 1CRPA 4TZ6A 1ZIOA 4IOKA 1AM4D 2IYZA 3VFDA 4YMTA 1UBCA 4FCVA 4KO8A 2GVZC 2VP0A 2LKDA 5UKDA 2ZRDA 1N6HA 4G5GA 4EQ6A 4EPTA 1TPZA 3NEYA 2X19A 1KI2A 1S1CA 1YZTA 3X1WA 2I1QA 4EJSA 3RWOA 4RJLA 1SXJB 2BBWA 2VSFA 3OEHA 1RYHA 1X86B 4DB2A 2ZM5A 1GRNA 1OYWA 3FE2A 1ZJ6A 2VP9A 3P1JA 4Q66C 3BB1A 1HH4A 2MMCA 3RHFA 4CT4B 1AA3A 5DYIA 1IONA 4EPVA 4TTPA 1ZCAA 3LRPA 1M7HA 1UF9A 2R6AA 3MMPA 2DWOA 4MYUA 5TXGA 1SGWA 1Q1QA 1G5PA 5CM9C 3MD0A 4L9SA 4JZKA 4C0LA 2XZLA 4B3CA 4PAOA 3KJIA 3TQCA 3UATA 5JRJA 1A4RA 1J90A 4KHZA 3EIHA 2QE7D 1NLYA 1NN3A 3SJCA 1P73A 2Q0HA 5E7IA 4DLTA 4DSTA 1TF2A 3RDPA 5HZHA 4TTQA 3S1AA 1Z83A 5J4YA 4DIEA 1JQLB 1VG9B 5FOSA 2C9OA 4BEBA 2O8BB 2J0VA 3SOPA 4Q1FA 2ZSFA 3WRYC 2VH5R 3AEZA 3Q7PA 3BOSA 1OH7A 4B71A 4EPWA 1KDOA 2GA8A 2WSSD 1XTQA 4V02A 4QGAA 2YKGA 2YZ2A 2XNDA 2IYWA 3CO5A 3QBVA 4LHXA 3RVBA 5FPKA 2ZI3A 3ZQ6A 2O0JA 2VP4A 1ZMXA 2F55A 1Z0KA 1W5TA 2QA5A 1E79D 5L3SA 1CJKC 1Z5ZA 2C8VA 3MSXA 2OV2A 4TSFA 1G9XA 3VKGA 3GJ6A 4PPQA 2H16A 2RGAA 1W2GA 2J0UA 2R62A 3SYKA 4ESHA 2VHUA 4JT4A 5EXTA 1YVDA 2GJSA 4M53A 421PA 4Q1EA 5FOVA 3AKYA 3ND8A 1KGDA 5E3HA 4DDUA 1ZRHA 2CLSA 3UPUA 1D6JA 2FN4A 2JASA 4DKXA 1XMIA 2ZSDA 4GP7A 2WJJA 3A36A 2ZIAA 2AKYA 2J0QA 2WWIA 3U7EB 1HA3A 4G0NA 1T9HA 3VR5A 4LDJA 5FUYA 4XIGS 1HQCA 3HYTA 3KKOA 2C5LA 3QXCA 1XD2A 5SZJA 4GOXA 4HUQB 4YMSA 5AJWA 2IHBA 3IILA 4PC1A 4ZI3A 1IY1A 4NYMQ 1KI3A 2RGGA 1OYYA 3THXA 1J8YF 4Q1BA 4C2UA 1M34E 1NLZA 3IO5A 1JAIA 4Q00A 4W5WA 3OF5A 4B73A 1BIFA 2NTYC 3ADKA 4QG7A 3NKVA 5KSOA 1F2TB 3QI2A 3B2EA 4BFUA 3M0EA 1GRQA 1NSFA 4QHTA 2G77B 4PO9A 4TLDA 1M7GA 2GAOA 1E2EA 1EX6A 5JI3E 1E2IA 4P31A 4LSGA 4TMXA 5LBIA 2OCYC 4NP6A 1A2KC 1PJRA 1QHHB 1QHNA 1W0KD 1VCIA 1CJTC 3QBTA 1Z8FA 2ZYWX 2PZGA 4XJXA 4OJKA 1TMKA 4QBGB 4Q9JA 5JECA 4URZR 1G8YA 1NVWQ 1ZC4A 1V43A 3SHFA 2DFLA 1NIPA 3HWSA 5IDVA 1L2TA 4BFTA 4JJZA 3K70B 5IHPA 4AWXA 3GLFB 1A2BA 3BXZA 2GCOB 2VHJA 2OE2A 1R0WA 4X8MA 1E0AA 3AKCA 3CF0A 1OIWA 2QP3A 1VHTA 2FJUA 2OXCA 1Z0FA 3AF0A 4WVFA 3CWQA 4TMWA 4URWR 3KJEA 4BUJA 3BJIC 3BFKA 5FOTA 4D6PA 3HPRA 4DLZA 1N2CE 3WMGA 3U2QA 4GT1A 3MWYW 1VIAA 3P4YA 4DZZA 2QTHA 2IT1A 4Q4HA 3QG5A 1E98A 4KAXA 1ZM7A 4Y0VA 4HDCA 1U98A 3MAAC 4JLAA 4CYMA 1FZQA 1YRAA 4AG6A 3TNFA 3CR8A 4OHXA 2WWGA 2CE2X 3ZJYA 4QKQA 4RCZA 4CEJB 4NU0A 5FH9A 4B43A 3R8CA 3NWJA 1JAHA 3OIYA 3Q85A 1NN5A 2IC5A 3X2SA 4YONB 2ZJOA 3TVDA 2XB2A 3EZ7A 3W5JA 1TAGA 2OFOA 2AD1A 4HDOB 4XD7A 4OJQA 1SXJC 4DVGA 2P5TB 1FW6A 2RGBA 3I32A 2IF2A 2H92A 5FBLB 2X2FA 4A8JB 1ZVQA 2AR7A 4F4CA 2C9YA 5GJWC 3VHLB 2EU8A 4A2WA 1KI9A 3R9WA 1JR6A 3L8YA 4CEIA 2ZEJA 2V3CC 3B82A 2N1BA 1G4UR 2GAAA 1KK1A 1IN4A 2WIBA 1YU9A 1U9IC 4K81B 3E2IA 3QPVA 1GZSA 1F2UB 3GD7A 4M1YA 2DWPA 3LX8A 4TMKA 2VF7A 4N1AA 4ESVA 1LF5A 2JJ1D 2X1VA 2WSMA 5FBRB 4DBLC 4CGZA 4AYWA 2R6CA 1XZPA 5KSZA 3PUXA 3BB3A 2ECKA 1KAOA 1A7JA 4HAVA 1XEXA 3EZ9A 3ZVNA 4KFUA 1ZNWA 2HXSA 1GITA 1FNMA 1NVXQ 4P3YA 1MOZA 4HB3A 3QOFA 2G83A 3V9PA 4CEHB 2BDTA 5CYOA 2R6GA 2JGNA 1W5SA 1XJ0A 4NCHA 5DN6D 1W0JA 1KSFX 2FX3A 1N6LA 1JBKA 2FGJA 4DLVA 1VPLA 3FVQA 2FPLA 1U81A 2XNSA 3TAUA 1E2GA 2RH5A 1Q3HA 3UWOA 4KFSA 3DOFA 3RRZA 3LQRA 4DJTA 5FTLA 4MDEA 3CWZA 3IBYA 3D6TB 3LXRA 1P2VA 1P75A 2W83A 3R7WB 1IN7A 2QTVB 3AKEA 4Q4JB 1OB5A 1XFAA 4JYBA 3NTUA 3PXGA 2BEKA 3W6PA 4KLZA 1KHTA 2FSGA 2KE5A 3CBQA 1VCMA 4QRHA 2RCNA 5KO2A 2J0SA 2J87A 4L16A 4RZXA 1XB2A 1I4DD 4R7ZA 4DLXA 3VNVA 1GUAA 2OILA 3F5FA 1E99A 2V1UA 2BMEA 2GEDA 5FTNA 3OHMA 2TMKA 3AGPA 3KQKA 3GCGA 4U02A 1F3OA 4QXAA 3RSLA 1H8HD 2W2VA 4FN5A 3REFA 4UNQA 1NIJA 2GXAA 2NIPA 4HUQA 2CCGA 4Q7JB 5EP2A 4HZIA 3VQTA 5G53C 1AQYA 1NI3A 1OLOA 2CCKA 3OEED 2W6ID 5HCNA 3SC3A 2BHRA 2IUTA 5F9HA 4V0NA 2QT0A 4Q5IA 3ZH9B 2W0MA 4ARZA 2WMNB 4FMCB 1ZP6A 2OEPA 1F2TA 1GKIA 5B30A 2ZQ5A 1GAJA 2H17A 5JJIA 2GBLA 3DVLA 3THYB 3MJRA 1G3IA 1KNXA 2WSSA 2XTMA 4A92A 2CMKA 4LI0A 2ATXA 2D74A 1BOFA 1L4YA 1U2RA 3TR0A 4EUNA 2ZSEA 4KBGA 4CZ2A 5DYGA 1E2HA 4KSBA 1N5KA 1W48A 2F43B 1LB1B 1ZU4A 2NOAA 3QNUA 1R5OA 3GLIE 1QHXA 3G5UA 1FQJA 4AKEA 3TIFA 3ASYA 4WZ6A 2WJGA 4M4SA 4R71A 2EWVA 1KI8A 1R2QA 3NHBA 2RMKA 3GLFA 3JZAA 2ANCA 1VYTA 1Y63A 121PA 3LH5A 3CH5A 2JLSA 3QKRB 3LY5A 4A9AA 1UDXA 2H18A 3THWA 2ZITA 4BFZA 2VO1A 2P65A 3CM0A 1ZM9A 1OW3B 3LWNA 4KXFB 2ZJ2A 1GWNA 4ILEA 4KU4A 3MWKA 1Z22A 4M1WA 1AK2A 2ZUCA 2YC4C 1F60A 4KITB 3KJHA 4JT2A 4A36A 3SDZA 1S1MA 4P33A 4IDQA 2QPTA 1YZLA 2XZPA 4IVRA 3WBJA 1E4VA 3O8RA 1KOFA 4A82A 1CJUC 1G7CA 1S9DA 1CS4C 4LX0A 1DAGA 4RKFA 2MMGA 1VMAA 4F4JA 2FZLA 1HE8B 2FFQA 4A8JC 1XPUA 4B3BA 2FSHA 2IWHA 4A0FA 1FTSA 2F3RA 1ZM3A 1Z07A 1FTNA 4DIDA 4L8GA 4RFSB 3QKUA 3PV0A 1W0KA 4R2IA 1NMYA 3O8CA 5ELXA 1T3HA 3RS3A 4E09A 3T1OA 1JALA 1KMQA 1T5LA 3IPXA 2WWXA 2VA8A 4JVSB 4NCIA 3OIVA 4P4TA 4V0OA 2WPDA 4NYIR 3RABA 2BMDA 3L43A 3CRRA 2F3TA 4BRUA 3TSWA 4NBSA 3BORA 1E2DA 4PHGA 3TKLA 5F98A 3PUWA 1VDZA 3CRW1 5DHFA 1XMSA 2QMOA 1ANKA 1Q57A 2PMDA 4BLTA 2JA1A 4TSFD 2DR3A 4D80A 2OO7A 3FTQA 1QHGA 1XZQA 1VHLA 2A2ZA 2XJ9A 3WNBA 4B2IA 3RS2A 4B75A 4DT1B 3SQWA 3R9XA 3EPKA 4K8OA 4BFVA 2ZRAA 4BWYA 1FX0B 5EJEA 2Q3HA 4QGHA 4F91B 5CDFA 2BJVA 4MRSA 4C0KA 5J40A 2LKCA 3GFOA 3CF6R 3CUEF 2XJ4A 2CL0X 3A37A 1FOEB 3AF1A 2ZSBA 1KI1A 3T5GA 5EQTA 5HPYB 3FDIA 2WWYA 1G5RA 1NLFA 2HT1A 1ESMA 2SHKA 1MRSA 4P0TA 3RS5A 3KQLA 2GXUA 2IYXA 4PPFA 1JI0A 3P26A 4MKFA 5GVSA 1KNQA 3AVVA 1R0YA 2O8CB 4BE7B 4KLNA 4C3ZA 1OIVA 4JIMA 4F92B 3BD9A 3MUFA 3U4QA 3QXSA 4BQSA 3A1WA 3JVUA 3WYAA 3GLGB 3B1ZA 4ABYA 1JECA 2QM8A 5BWMA 4Q4JA 2E9SA 5L3QB 1OXTA 4IVQA 1AGRA 4KFRA 1MO6A 1S9HA 3AVYA 3GJ8A 4DHEA 3QEOA 1ZU5A 1UBEA 3K8YA 3UKDA 1J99A 4PAMA 1IN6A 1TUIA 1G16A 1ZUHA 3PIRA 3QPUA 3X1DA 2VLIA 2O5VA 1P62B 3BGWA 3IHWA 4BLOA 3T35A 5J4VA 3CONA 3AP3A 2AWNA 2PCLA 3L0SA 3H0KA 2B8WA 3QE0A 4LK2A 4LZZA 2JJ1A 1AKEA 3W8NA 3THOA 4GOJA 1G5TA 1N6KA 3CZQA 2WAXA 4NZYA 3OE7D 4ZPXA 4N3NA 2BJWA 2CBZA 1U90A 3BERA 4PXAA 5AUOB 2CE7A 3EXAA 3TJZA 3VHXA 4ZIRB 1HV8A 2EFEB 3WRXC 1VCNA 1SVIA 2QG6A 3ZGXA 221PA 1OJLA 1OFTA 3CPHA 4Q47A 4B35A 2A78A 1UKYA 4LBYA 2CCJA 1G8GA 2GJ9A 5HE9A 3IPYA 2G0NA 1FFHA 1XMVA 2OAQ1 3IBGA 1Q3TA 3W90A 1KMHB 1SHZA 4DLSA 2ZRMA 5CLLA 1E2NA 4HAZA 5A0FA 2QSYA 3K9HA 4KJZA 1MABB 4DLUA 1E6CA 2OBLA 5AJZA 2IYRA 4B76A 1H65A 3TRFA 4NYJR 1L7VC 2IW3A 2F43A 2O8DA 2GKSA 2X8AA 4BEJA 3TUZC 4LYJA 1CRQA 2ZE7A 4Z54A 5J4LA 4JVLA 3ADBA 1QRAA 1DOAA 3TR5A 2JDID 1OPXA 3T1VA 4Q9HA 3NDPA 3U5ZB 4TZ0A 1XTKA 4DDTA 5L3VA 2H1LA 2JEOA 1GNPA 2ODBA 4V03A 2ZE6A 3LBIA 2GJ8A 4XVQA 1XU4A 3NBZC 5TVKA 4H9GA 3EIQA 5E7MA 2OAP1 1ZM4A 3VAAA 5LDDC 3U6BA 1WMSA 1G8HA 1OXXK 3AV0B 4OI0A 2PX3A 4DSOA 3B1YA 3VU9A 3LAWA 4B3FX 3K0FB 1SXJD 3EZ2A 3WMEA 1OE0A 1H8HA 5DH9A 3I5YA 2QP9X 4QNRA 2WM9B 2HXYA 1N0VC 2CJWB 1W46A 2PLRA 3QG1A 1W7AA 2MSDB 3OEEA 1Z0DA 2W6IA 5JEEA 4A1FA 1VYVA 4UXIA 4C4PA 2J7KA 4RZUA 2J7PD 5JEDA 2UZIR 3PEVA 1G6OA 1XX6A 1CP2A 4CF7A 1SXJE 2H7VA 4AK9A 2AN9A 3FMFA 1MH1A 1YR9A 1XP8A 2ZS7A 1NJGA 2BBOA 4PSKA 4C7OB 2YWFA 1PLLA 2IEYA 4FMDB 1B0UA 3LBHA 1GIAA 2IYTA 1P5ZB 2GK6A 4JBYA 5AK0A 2GRJA 2G3YA 2XSZA 5HTKA 1XXHB 2HT6A 2K5UA 2PBRA 1M1YE 3D3QA 3QXXA 4IOMA 4Q18A 1KI6A 4ZDIA 1E1QA 4BLSA 1SVOA 2KWIA 2WMOB 4I4LA 4C0JA 5KTYA 2QAGB 3DZ8A 5FTKA 1DAFA 1W0JD 4LJ6A 3T34A 4JSTA 3SJBA 3SYNA 3WXMA 3KQNA 2D2EA 4WA7A 3U61B 4UNRA 5FOXA 3UMRA 2C2HA 5J4KA 2YWGA 1IJEA 2W6JA 2CXXA 5B57C 1JB1A 4XTCS 1NVUQ 5DE3A 3X1XA 3SI7A 1WBBA 1G20E 2VF8A 4LJYA 5G3ZA 2ZJYA 3E70C 4AKHA 1I2DA 1M74A 5HE8A 2F1RA 2REOA 5B58C 2OHFA 1LF0A 3BAFA 2PJZA 5TDHA 1EFUA 5EE3A 4Q1DA 4JYCA 3B78A 3BB4A 3SU8A 2IK8A 1FX0A 5CK4A 4EDHA 2O0HA 3FGNA 3GMTA 2J1LA 4OI4A 1ESNA 2GDJA 4OKSA 4FW9A 2EQBA 1NL3A 4XVRA 4LJ8A 5EE1A 2ZUDA 1G4AE 2ODNA 1TQ2A 1R5NA 4DEXA 4G5RA 1TADA 3JZMA 4EPYA 3FFAA 2JLZA 3ZLJA 2L0XA 1ZNYA 2WKPA 2YINC 4XWAA 1S0UA 2VBCA 1AJEA 4HEJA 3GJ7A 1OB2A 1H8EA 1G8FA 3TQFA 1X8KA 1J2JA 2Y8EA 2IX3A 1VKJA 3KKNA 4QFMA 3GLGA 1DELA 3A1UA 1Z06A 2GETA 2NPIA 3KKPA 3QF7A 3DM9B 4C0SA 5C4MA 3IO3A 5JS7A 4NKRA 4WBSA 2ZS8A 2GTPA 3PFIA 4Z1MD 5TV2A 3LA6A 5KNBA 2F6RA 3RS7A 4D26A 5JSZB 1Z63A 1NMZA 1XMJA 1GRRA 2QMHA 2QQ0A 2QQEA 2UKDA 4I1UA 4QM7A 5JWHA 3U3KA 4G3XA 3AVOA 4TYWA 2I1VB 1D2EA 4XWOA 5FOUA 4A0RA 1TUEA 5JJLA 1R8QA 3TMKA 2JJ8A 3A1SA 5EZ6B 3VR2A 1GTVA 3K70D 1BMFD 3NG1A 3QIAA 4CDGA 2OM2A 4ZIRA 3I4LA 1T3SA 2P6NA 2WZQA 2OUKA 1P9RA 4FIDA 3ZDQA 4M1SA 4ZCMA 4H1UA 4US2R 2BMFA 3PVSA 1W36B 2HV8A 2W58A 2Q9BA 3ASZA 3K53A 2GEUA 5FPSA 5J5CA 4JBWA 1US8B 3H86A 3P32A 2ERXA 4N0EA 3AVWA 2QAJA 2FPMA 4BGDA 4HSEA 3GLFE 2MSCB 4O2RA 2O8EB 1K8RA 2ZJ8A 3AUXA 5JCPA 4DLYA 1ZCBA 1E1RD 3BFXA 2J41A 4M9ZA 1JEDA 3EAQA 2IYQA 4MYCA 4W5HA 2ZJ5A 1WRBA 3IQXA 1G21E 2FSIA 2YHSA 4UKDA 1K6MA 2B6HA 3FMOB 5FR1A 1ETUA 2QMEA 4PHTA 4JLPA 3MJHA 2D3WA 2BBSA 3KXIA 3DZDA 4B44A 1WE2A 4GP6A 2R6FA 1N6OA 1IN5A 1SKYB 4ZV4A 5KNCA 3OFND 1Q44A 4A6XA 1KZGB 4DSUA 1JR3D 4HLDA 4KCGA 3EC1A 2BKUA 2OCAA 2ZREA 2J9RA 2ORIA 4YMVA 3AVTA 3CF2A 1O3YA 2ZJBA 4XSGA 2XB4A 3A4LA 2GHIA 2IYSA 3RC8A 3K0FA 1FQKA 2P2LA 3KUDA 3ZZUA 2XZOA 3GPLA 3VKHA 5EE5B 1N0WA 1Z6YA 3OE7A 2IXEA 3CX8A 2DFTA 2PH1A 4V0KA 3T61A 1N6NA 3AH8A 2OXRA 4ZDKA 2WPDD 1EX7A 3L2OB 1XCMA 1JR3E 5CJ2A 2V8OA 4DRZA 2PCJA 4L9WA 1BYUA 4JMPA 3C14C 1KDPA 3FOZA 4BZQA 4ACAA 2D4HA 3TK1A 5FI0B 4MGZR 3BWDD 5IRCD 3U3JA 3NIBA 5B2ZA 1KO8A 4LHYA 2ORWA 2QN6A 3NBXX 4QNMA 4UQOA 1AZSC 3C7KA 4HAWA 3QUSA 1XF9A 2G1JA 2QAGC 1WBDA 1UDWA 1UJ2A 4PSAA 3PUVA 4PHFA 1FUUA 1TEVA 2W0SA 1RRCA 2GF9A 1I4TD 1RJ9A 2QAGA 4TYNA 2QL6A 2I4IA 4EPRA 4AI6A 1T0JB 2FDCA 4RKEA 5EXXA 1MT0A 3E1SA 2JDIA 3FKSD 4IFBA 2P67A 4NTZA 3UIEA 2XX3A 5EP4A 3K9LA 2YWHA 4JBXA 3NBFA 1P3JA 2GILA 1TQDA 3PUZA 3QF4B 3UMFA 2WWFA 1SZPA 5CDFE 3LQQA 2JLQA 5AUPB 1AQUA 2FFAA 2VP2A 2V54A 3T06B 4UJ5A 1OFIA 2AK2A 2WKQA 1G1MA 2F1JA 1G64A 2ZRGA 1W4CA 3VKWA 3QVUA 1SXJA 3NH6A 1I2MA 2NO0A 1VTKA 4QC2A 4BFXA 1MRNA 3O8BA 2BOVA 2IA5A 3LLMA 1NSTA 3IIJA 4PZYA 1A5TA 5DISB 3SHWA 4LYAA 2WV9A 3MRSA 4TL7A 2ZRFA 3PENA 4I1VA 1S2MA 3LX5A 1K5DA 4RZ3A 5CK5A 2IS6A 3EIEA 2J7PA 3P27A 2B92A 2XTNA 1U9IA 4JLOA 3QJYA 2D7CA 1GG2A 1P2SA 2RHDA 5E7JA 4UXHA 1Q1BA 2A3RA 2NZ8A 2H57A 2IHYA 1XDBA 2ZRLA 2EFCB 2AHOA 4OK6A 5DI3B 1N0UA 1SVWA 3AVXA 4OQXA 2NO6A 4KFTA 5H68A 1NRJB 4LRWA 1U8ZA 4OI1A 4TL9A 2QENA 1DVRA 1KI7A 2BC9A 4XH9B 2ZVPX 4UJ3A 5LPNA 3KQUA 3U7HB 2PZFA 2BKEA 3KFXA 2RGXA 2OZEA 3OESA 2XTZA 4DUGD 2ASEA 4BFYA 5GADl 2ZRCA 1D5CA 1VYUA 2QP4A 2O8BA 1KIMA 3DPUA 1TQ4A 1YR7A 3B60A 3PEWA 1N5IA 4FWTA 2PT5A 3FPAA 5DLQC 3GP8A 4M8NE 1TQ6A 2BCGY 2JLYA 3C4JA 5JHGB 4OHYA 3B85A 3V00A 4RD2A 1QBKC 5FBVB 2R65A 5FUXA 2RB4A 4EPXA 3SEAA 5JFGA 2AX4A 4Q21A 4GMDA 4WOPA 5FUVA 3BIFA 3UANA 5JWOA 3PJRA 1IY2A 3CX7A 2EWWA 4URXR 3GLHB 3FFBA 1CR4A 3KKQA 4HB0A 1W36C 1C9KA 1T3LA 2R2AA 5KYKA 4O3MA 3TW8B 5K8IA 3KB2A 1KO5A 4LYHA 4M2LA 5TMPA 1GM5A 2YYZA 1TU3A 2ZAMA 6Q21A 4LBZA 2A5YB 3SNHA 3UK6A 3U44B 4LV6A 3QKSB 1RRFA 2A7QA 3B1WA 4NH0A 1D8TA 1CULC 3TSZA 2F7SA 4HLQB 3A1VA 4OQLA 4ZKEA 3AF3A 1DEKA 2V7QA 2XXAB 1UKVY 3BH7A 1JXOA 4B2PA 3EARA 2FGKA 3RC3A 4Q7KA 1IAQA 3W6NA 2O8EA 4ZDJA 4NMMA 4B74A 1A1VA 4RD3A 5G3YA 3BC1A 2WJYA 3A58B 2D06A 3LXXA 1M7BA 3W3AA 4LY6A 1KO7A 3L0IB 3GJ3A 5JLJA 2FG5A 1R0XA 1U0HC 5KDLA 3RANA 2WJIA 4C0HA 1NG9A 2O8FB 5FBQB 2ZYUX 3SFVA 3ZQJA 4G01B 1Z6GA 3EWSA 1P6XA 2DBYA 5CIQA 4Z1MA 4KYUA 5C46F 2IYLD 4B2LA 2AL7A 4LUCA 3Q7QA 2WKRA 4BLPA 821PA 1RW4A 3SJZA 1RZ3A 1E2JA 2XSZD 3GEHA 1M6NA 5BN5A 1QHHA 2XAUA 4JLJA 1E1QD 3IGFA 4IEIA 1DS6A 4PQRA 3K70C 1MR3F 1ZNZA 3TLXA 4FMBB 4GFDA 3WYFA 2RKOA 4NPHA 2GWHA 4V0MA 5GJCA 4OK3A 2QPOA 1TU4A 4EFNA 1KAGA 2ODEA 2W6JD 3ND9A 3QVVA 5F2EA 3LVRE 1BMFA 1LTQA 1P7CA 3CX6A 5FL3A 2GCOA 1FMJA 4YMWA 4IW3B 1GILA 1NY5A 3GJ5A 3WY9A 1LNZA 4WXPA 1KZ7B 1QVAA 1KYIA 1G291 4BRWA 4HB2A 2NO1A 1T6NA 5CJPA 3A4MA 2BEJA 1Q1EA 1HTWA 1LS1A 4PZZA 1GNRA 4DCVA 1COWA 4Q7LA 3BFVA 1NVVR 2R8RA 1R7RA 2FWRA 3HDTA 4I1OA 3F3YA 2CHQA 4G5QA 3Q5DA 3NVAA 4Q01A 3B9QA 2WWWA 4FD2A 4P4SB 1U8YA 2DCUA 1IOZA 1E1RA 2BV3A 2E1RA 2WJVA 4NCNA 4A0HA 2QGNA 4NE2A 4WIAA 3T15A 3WNDA 4ERNA 1WA5A 1UPTA 1OH6A 3KUCA 4CEJA 2ANBA 1G3QA 2Q21A 4MUAA 1CR0A 2UZ3A 3FKQA 5BN3A 1LVGA 1UADA 2OT3B 2A5GA 1P2UA 3OFNA 3DEFA 1JR3A 4LJ4A 4XOIA 3RNLA 1H8ED 1GL6A 4WZAE 2P0EA 4A8JA 1IQPA 4POAA 4FMCF 4LJ5A 1FP6A 3KXLA 4KVAA 5AJYA 2ZRHA 4AURA 4IKEA 2HF8A 1WXQA 1SVLA 1T91A 2NZJA 2CHGA 4PPGA 3GLIB 4JVNA 5KDOA 3T1TA 2VHQA 4FXPA 4OHZA 5C4GB 2HF9A 2WAYA 1F2UA 4MRVA 1GNQA 1SHKA 3K0CC 2J59A 3D7MA 5JCZA 4JSYA 4RSGA 4O25A 4BFWA 3GLGE 4K46A 4JS0A 2GZHA 3D31A 3R8FA 2QUZA 4XVUA 3MG9A 5FL7D 3K0CA 5C2JB 1RC8A 5DI3A 4WXRA 1TNDA 1IY0A 3CPEA 4MRRA 1JPJA 4HATA 4LGMA 3RRYA 3VR3A 2J5XA 4OHWA 1Q21A 5AWFC 3NC1C 4HB4A 4R9UC 5CLQA 2CEAA 1T8UA 1ZC3A 4EQ6B 5KPDA 5BN4A 4JL8A 1KDTA 3QENA 4TQUS 5JRZA 3DOEA 2KI5A 3BRWD 1OF1A 3CH4B 3UMSA 3EPLA 4CEHA 2NO9A 5FPYA 4DSNA 2G88A 4DXAA 4EJSB 5EZ5A 1L8QA 3TH5A 521PA 2N46A 4ZCLA 1XJCA 4A6PA 3FKSA 2ZU6A 3CRMA 4NYIQ 3M6AA 3SN6A 4RZ2A 2P6UA 1P4SA 2ZSAA 1XTSA 3SS8A 1ZAKA 3VMFA 1OH8A 2JATA 2ZI4A 3H1TA 2A5JA 1Q20A 1S8FA 4HI0E 4OL0A 3AKDA 1W44A 3U7FB 3R7WA 1Z6XA 2F1IA 1AZTA 2PL3A 4Q1CA 4WZBE 3A1TA 5JBQA 3FMIA 3NHAA 1XPOA 5BYKA 1OXVA 4TQAA 2PZEA 2FZ4A 2HJVA 4PX9A 1LS6A 1GL7A 4Z51A 1P9WA 3H2YA 2VP6A 3IEVA 1AGPA 1XEWY 4U5XA 1E9CA 1QHYA 4GBMA 1EWRA 1TL7C 3QKSA 4J0QA 2NPFA 5CB8A 3S1AB 4JLBA 2B8TA 1RRGA 1R10A 1R6BX 1ZNXA 1CEEA 1KKLA 2XXAA 3SBDA 2PEZA 1DAMA 3EW9A 4TLEA 2C9CA 3HR8A 1WQ1R 2FNAA 2CHVA 2F9MA 4WW0A 4D82A 1DADA 3EC2A 1CJMA 5CB6A 1PV4A 3B8HA 3B13B 2W2TA 1OV4A 4DUGA 3TE6A 1EGAA 4LBVA 4DLRA 2AD5A 1DG1G 1T5IA 5ANRB 4DCTA 5L3SB 3I8SA 4YLGA 1TF7A 2CDNA 2AFHE 3W5IA 2EFGA 3KX2A 1TTTA 3CNOA 1N6PA 3KB1A 4QL3A 4HYYA 1E32A 1RIFA 3RS4A 1OSNA 4PQYA 1EFTA 1DG3A 3QKTA 4OK5A 4DCUA 3I92A 1E2MA 4OYHA 4AYTA 4TYPA 4UXJA 2Z83A 4MGYR 3T5DA 5JMTA 4IEEA 1OH5A 1PVOA 1ELOA 1NG1A 4I99A 1KK0A 1QDEA 1CR2A 4QOSA 2BM0A 2IS2A 1G17A 3ETLA 1XJQA 2ORVA 3GEIA 4GRAA 1S96A 2QBYB 4BPBA 3H4MA 2RAPA 1AKYA 2WVJA 5AJVB 3HJNA 1OHHA 1XXHE 5EP3A 1XNJA 2P5SA 4GMXA 4TQ9A 1XTRA 1N3BA 3BS4A 1SQ5A 5SZKB 3KJGA 3T1QA 3K0AB 3WP1B 4C0QC 3V4FA 5K8LA 1VG1A 3QKRA 3THXB 2QTFA 4EAQA 2QGZA 4AG5A 3SZRA 2X2EA 3OZXA 4AIIA 2GXQA 1C4OA 4YMUA 1YKSA 1D2NA 4HAUA 4R2HA 1EFCA 1JXMA 2ZRPA 3MGCA 4LYFA 3B7GA 3U3OA 4QJ4A 4Q1AA 1DAIA 2JCSA 4LPKA 4Y0AA 2NG1A 3BE4A 2VIIA 2IWRA 1JQJC 2DPXA 5FBWB 1Z47A 1YJ5A 5H70A 1UEIA 1HT1E 4MA4A 2CVHA 1E4YA 5D3MB 5G41A 2FFBA 3LNCA 1BYIA 4B33A 3C8UA 3CLVA 3HPQA 4RFSA 5KDDA 4FWIB 1XCGB 2YVUA 3IIKA 4Q7MB 1G7TA 4F93B 1E9FA 2GESA 3K0SA 3R20A 3RRNA 3G0HA 3WYGA 4L15A 8OHMA 1EFRD 4M9XA 1E2FA 1Z08A 4LV8B 2F9LA 4GL2A 2A30A 3PEUA 1DAKA 2X77A 1Z2AA 2ZRIA 1FP7A 3UG7A 2JLUA 4NCKA 5CM8B 1KSJA 1W4AA 2IYYA 2ZU0C 2JAQA 2BVNA 1C1YA 4GSYA 1ZD1A 2QMUA 3AF2A 3T12A 4YC7A 3L8ZA 1DE0A 5FUWA 3AVQA 4U7DA 4G5SA 4M1MA 4DT1A 3AVUA 5DHAA 2ZPTX 1MO5A 4KI0A 4S2EA 4IXMA 2HUPA 1NN1A 4MRNA 4X8HA 1KDRA 1YZQA 1YZGA 1P9NA 2REXB 3OIUA 1AS2A 1NN0A 4B47A 4EJSC 4NCJA 3BK7A 1HURA 2IEZA 3B9PA 4TMZA 5L8VA 2IS1A 1W36D 2LWIA 5A5GA 4QGGA 1J7KA 2DFKB 2V6JA 4M9QA 4US1R 5HKKD 3N2IA 4A2PA 5FFMA 1NP6A 2V7QD 2W2XA 2AK3A 4BLQA 1EESA 1KJWA 4CEIB 2BCJQ 3PITA 5AUNB 3WBKA 3H84A 3REGA 1E2PA 3DO6A 2IYUA 1G18A 3AM1A 3EWAA 2O8CA 4EFLA 2BBTA 1YHNA 2VTKA 5EXPA 2C04A 2HCBA 3QXHA 4F4IA 1WB9A 1DPFA 2O52A 3IUYA 1KK3A 2YJTD 3KTAB 1CKEA 2HLDD 4HAXA 4M0LA 4U00A 1RFLA 5DI9A 2CL6X 4IOJA 1W47A 5L3QA 1JJ7A 4CW7A 3ZVMA 1R8SA 3FB4A 4UNSA 2Q9CA 4HLUC 1U99A 1Z6AA 1LV7A 4P4UA 4FMDF 4B32A 2G9NA 2EFDB 3HR7A 4AYXA 1XPRA 1CU1A 5KPJA 1V5WA 3X1ZA 4O2LA 3I1FA 1XEXB 4PFSA 1XBTA 3EZFA 2Z5FA 2EYQA 4MITA 3PR1A 4HLUA 4NONA 721PA 4LHVA 4TMTA 5FOWA 4B6FA 1MO4A 4IJMA 3KZ1E 4FINA 3FHCB 5AR1A 2NGRA 2ZE5A 5BYJA 2REBA 1II9A 3AQ4A 4BECA 3MWJA 1XRJA 3RSOA 1RE0A 5FL7A 1OFUX 2QPAA 2W00A 4LBWA 1UFQA 3SQXA 3LDAA 3O47A 2JLXA 2RHMA 1SKYE 2WICA 2KB0A 1E9BA 1Z3IX 3CR7A 1ZYUA 2GZDA 2OCPA 4V0LA 3SJAA 2QNRA 4M1OA 4YDHB 4JL5A 1OKKD 4A4DA 1ZUIA 3SYLA 4DB4A 5K8TA 4F38A 2IUUA 2BMJA 4AC9A 5HZKA 4W5JA 3WNCA 1AS3A 1UAAA 4NYMR 4TL6A 4CVNA 3MLEA 5EP1A 2OBNA 4M1TA 2EFHB 1UKEA 3QSYA 2GEVA 2ZR0A 4V0ME 4RD0A 4DDWA 4PPNA 5JHHB 2QSZA 3OAAD 1COWD 2Q3FA 3EZ6A 5LD2B 1KMHA 4PR0A 1DARA 2FSFA 3IQWA 1R4AA 2ONKA 3Q72A 3WP0A 5J47A 1MABA 1XD8A 3AF4A 3WHKA 2J3EA 1VECA 5JS8A 1J70A 2G0TA 5H1YA 1E0JA 1D9XA 3M4YA 1LY1A 4Z8XA 3Q5EA 1E2LA 1MKYA 5JI2E 2AKAB 2PX0A 4IFEA 3P20A 4RVCA 3N2EA 1X1RA 4XWKA 3DL0A 4HZUB 2QBYA 2OLKA 4DWJA 1X3SA 2VPPA 4OQNA 3LLUA 1SVMA 4EIWA 1OFHA 2WIAA 2XITA 2YNMA 3K0AA 4UNNA 4CT5A 4RFVA 1AS0A 3I72A 3W8RA 3IHLA 4E03A 1HUQA 1E3MA 1Z0JA 2YOFA 2PLFA 4GOKA 3NH9A 2YC2C 1RYFA 1VCOA 1XTIA 2QY9A 4ARZB 3GJ0A 3D8BA 2ZYTX 2DHRA 4RD1A 1MV5A 2C03A 2ZJAA 3TVTA 1U94A 2VHTA 4M22A 1F48A 4QJ3A 1KSGA 2CJWA 2OSBA 4QBIA 4ITRC 2G1KA 4LV5B 1Z28A 4I81A 2OG2A 4N0DA 3AGQA 4E22A 3EX7C 3EASA 4LJAA 4L4UA 1U0JA 2CNWA 1T4GA 2RGEA 3OIWA 3E5HA 2ZRNA 1N6RA 3KFVA 4PO1A 1NKTA 1UKZA 1KSHA 2LCFA 3Q8XB 5IK2D 2NMVA 3MCAA 2P6RA 4IDNA 1YR8A 4KBFA 5D3MA 1NKSA 4C7OA 5TY0A 2Z43A 4C0BA 3C16C 3GEEA 1S3GA 1YZUA 2YOHA 1AA9A 2HEIA 3KL4A 1PUJA 2IXGA 3TGPA 3I3SR 1XXHA 3ZZTA 1J8MF 1XEFA 3TAHA 2VYFA 3FYHA 1T8TA 4WAUA 2CK3D 2WOJA 5BW8A 3THWB 4M9SA 2JJ2A 2Z4SA 1FMLA 3VNUA 4C2TA 4X8LA 4URVR 2JIZD 2OESA 4PTLA 1E96A 2GVDC 1NY6A 1DTSA 4M1KA 5E4FA 1R5BA 2C78A 4W9MC 2CL7X 2FMXA 4PAQA 4A2QA 3ZVRA 2V1XA 1QZXA 2VL7A 3F0TA 1ZM2A 3EA0A 4B3XA 4X8OA 1UBFA 4GZMA 4OBEA 2QT1A 2XGJA 1ZD9A 4HDQB 4D0NA 2ZAOA 2PT7A 3FWYA 1P60A 2XOKD 3B1XA 3VX4A 4C0AC 4MRPA 1E2KA 1NBMA 1QVRA 1E9SA 2FE4A 5FR2A 3AVPA 1CIPA 3I73A 5DIFA 1CJVC 2VP5A 3QQ5A 4TLBA 3IKJA 1VG8A 3RAPR 3CB4A 4L5BA 3VX3A 4B3GA 1NF3A 4MH0R 4LJ9A 3ADCA 1KY2A 3I61A 2IUSA 3GLHE 1TX4B 4PO8A 5TARA 1HEIA 3C5CA 2AWOA 1CF4A 3PQCA 5C18A 4KSCA 1Q0UA 2HYIC 4PSVA 5KUTA 5EXSA 1P2TA 2QEQA 4E07A 2QORA 1E2QA 2ZXUA 1BS1A 3KTAA 3ZIAD 3AP1A 2DYKA 2FEOA 1XEWX 4ASUD 1UM8A 5FI1B 5D3QA 3I5XA 1GL9B 1EG7A 1EFRA 4LHZA 5DSZA 4A0GA 4EKDA 2UVQA 4MDFA 4IDPA 4TN1A 1PUIA 1Z0AA 1M2OB 5JSZA 1W4RA 1HT2E 3BH6A 5HR5A 1D2MA 3Q3JB 1E9DA 1W4BA 2VRWA 2GCNA 3KXKA 2DB3A 4F7WA 2ZUBA 3HYRA 2YV5A 5A4JA 1Q22A 2HJGA 3BBPA 4RCYA 2WOOA 3DDCA 4XSHA 4ZDWA 4D4JA 4A15A 1XD9A 2MSEB 4BFSA 2H8KA 4IXNA 1OHHD 1L4UA 5GJBA 1HYQA 4B3DA 1KJYA 3U4QB 1VG0B 5LD2C 1Z0IA 1KI4A 5HKKA 1YR6A 1E0KA 3EA5A 2GF0A 4HUTA 4QHYA 2ZETA 1II8B 3PCRB 4NHOA 2V6IA 1US8A 1VIYA 5CIWA 3RRMA 4LC1A 3I8XA 4NDZA 3ICEA 2B7BA 2ZR9A 4OQMA 2FH5B 2FV8A 3FMPB 1UBGA 5DO9A 5IF9A 3KQHA 1O87A 3W34A 4RD6A 4ZO4A 4D4KA 3GJXC 2C77A 3ZD7A 2B7CA 1AIPA 1CXZA 2HLDA 3W6OA 1K5GA 1P61B 1HQYE 2R44A 2OLJA 5GVRA 2VSXA 4Q4AB 1KY3A 4LJ7A 2ZRJA 3NXSA 3TUJC 2ZI6A 3EG5A 4YXWD 1RKBA 3QY0A 5EUMA 4HZUA 2ONJA 4C9BA 4JJKA 3EPHA 3KDSE 1SULA 4ON9A 4ZCIA 3I62A 1ZW6A 1CR1A 1RVDA 1QG2A 2QE7A 1JJVA 3K9NA 3P4XA 4YDSA 3TW4A 4TT3D 2QRZA 5SZIA 4D0LB 2XEXA 2GBLC 4I1SA 1EXMA 2GJAA 3HU1A 3LO5A 4LCBA 2G6BA 2P3SA 2ZE8A 3FHOA 3RWMB 2V55B 4AY2A 4DDVA 4PANA 1NMXA 4TTRA 5C1BA 3KKMA 3IDQA 4JLKA 5AUQA 1ONBA 2KSQA 1OKKA 2BM1A 1UEJA 1SVSA 3L82B 3K1JA 1W1WA 2ATVA 4QM6A 3VR4A 1AN0A 4ACBA 3CPJB 1GVNB 2PEYA 2Q6TA 5AJXA 1E79A 3ONWA 4QJ5A 1LW7A 4MKGA 2J46A 1CTQA 1GDDA 5EE0A 1E9RA 2O8DB 4MGKR 1Q1ZA 3TUIC 3NC0C 4B48A 3GFPA 4NL4H 3OAAA 4QBHA 4IDOA 1M8PA 4D0GA 3NBYC 2ZRKA 3IIMA 5K8UA 2IF0A 1X8LA 2C99A 2WHXA 1PLJA 4D81A 3DKVA 1U0LA 4MKIA 4DLWA 2GCPA 3ZS8A 1IBRA 1U8AA 1NNEA 2N42A 1NJFA 4JLNA 4LWZA 2NO7A 3LV8A 4Q48A 3CZPA 4II7A 3VU9B 2ZI7A 3AP2A 4KODA 2ZR7A 3OEHD 3DHWC 2V9PA 4S35A 3QF4A 4Q9IA 4JL6A 3K0EA 4AD8A 1P72A 5LB2A 4D4MA 4B34A 4Z8YA 3QEJA 1X6VA 4UNPA 2IXFA 4M21A 4JKIA 3CW2A 4GZLA 1BKDR 3SBEA 1WCV1 1SKQA 3L0PA 4PC2A 3SR0A 2VEDA 3GJ4A 2Z0MA 1NVVQ 3PG5A 1G41A 2QZ4A 1YZNA 2GXSA 2VSOA 4DC9A 1X8JA 2EVWX 4Q19A 2D2FA 2IS4A 2C95A 4QHSA 3PEYA 2BWJA 1E0SA 2RGDA 2A5DA 1OXUA 1PLKA 5KHOC 2FF7A 4FCTA 1W2HA 4TWZA 2QI9C 4US0R 1KI6B 3THYA 3UWKA 2ODWA 1IXZA 2A9KA 5IK2A 2GNOA 3X1YA 3U7GA 2CLDX 1ZINA 1OXSC 1YRBA 4TL8A 3M1IA 3ADDA 3BH0A 2ZRBA 4R98A 4DEYA 1YQTA 2BIFA 4IDHA 3A4NA 4RD4A 1WF3A 4TMVA 2IL1A 3VR1A 4CIDA 3U6KA 3PUYA 4B6EA 2H5EA 1G3RA 4D2IA 3U60B 3MWLA 1GP2A 3ZZ0A 1FPMA 1WDTA 1ZIPA 2XNDD 3J81k 2HCJB 4IHQA 2CVFA 2ZJZA 2FFHA 2CK3A 4JLDA 5B64A 2R9VA 2DWQA 1KTVA 4HAYA 5BQ5A 1JPNA 4MGIR 1FL9A 4BLRA 1EWQA 2GJKA 3SE0A 1QHSA 2J45A 2JIZA 1G3MA 1HE1C 4RY2A 4ZI2A 1I4LD 1PZNA 2V4ZA 3GFTA 3HP1A 2WWHA 3MFYA 1KK2A 5KOYA 1TF5A 4URYR 2QM7A 3CRVA 4URUR 1IN8A 2FA9A 2ZI9A 2QRNA 3CKLA 3CNNA 4JLMA 2RGCA 5P21A 5J4HA 1JNYA 3DKPA 1XWIA 4Q03A 3C41J 3GLHA 2XOKA 2EYUA 1KJZA
chains in the Genus database with same CATH superfamily
1GOTA 1MC8A 3QZUA 3USCS 3GH3A 1I8TA 4BTLA 1CPYA 1F6WA 5BW6B 4IWXA 1GFIA 1PK9A 4RF4A 3VV2A 3TW8A 4GPTA 3D1JA 3MWDA 4D3YA 1K6EA 4QXMA 2Z3WA 1PG5A 1N9GA 2NSDA 2KBFA 3KETA 4X6YA 3WK9A 1VJRA 1G3UA 4H1VA 4F86A 2F8MA 4P32A 4X3OA 3U44A 4PC3A 1L7MA 4UFNA 1E1YA 2RBKA 3ILVA 2NZ2A 4JLSA 4DV0B 4CN9A 5CYPA 4J16C 3HUUA 1II8A 3I01M 3B6EA 4D9IA 3PC4A 2VPXA 4JVMA 4EO7A 2G8LA 1I32A 3GEBA 3BSSA 3EY4A 3NEJA 1E9VA 4LHWA 4KV9A 2JJQA 1G0NA 3OPYB 4GI7A 4TXLA 4U7TB 3C5HA 3DWGA 5C1PA 5IKEA 1OV6A 1VSQA 1SC4A 1IXRC 3LHFA 1Q12A 3QTBA 1SM4A 4E0BA 4YIHA 2CN1A 3C8HA 5KAPA 5CFNA 2ZANA 2PQ6A 4ZALA 2OP1A 2R11A 1WM1A 2A14A 4MKZA 3RYCA 5J5AA 1USKA 3ORHA 3OU7A 2PY6A 3N76A 4DCNA 1F5NA 1TUGA 2CNWD 1RLMA 4G1BA 5DHUA 3WO0A 3IJ5A 3OTOB 3DHVA 1S4QA 3E05A 4RVDA 3LBNA 1C2YA 2HDNB 4GNKA 4MV7A 1QG4A 3IT3A 3VTZA 4PN3A 4HVCA 3FGZA 1DX9A 4J0EA 5DGXA 1PR0A 2WTMA 3QHPA 4IRUB 2W2KB 2AXNA 2F64A 4YRCA 3VTFA 2CB0A 1TMOA 2OO5C 2VHEA 4I19A 1UT8A 4Q3NA 3TL6A 1LPNA 1KJJA 2EZ9A 4PYMA 6YASA 5GJVC 4D3SA 5KSYA 2EW1A 2V8BA 1DQNA 3EISA 3K9GA 2BFOA 4CG3A 5EUQB 4I5DA 4PFQA 5HCIA 5SYMA 2JHGA 3S2IA 3UMBA 4RH0A 3DT9A 4FKBA 5JISA 3TEJA 2HSWA 4MJ7A 4MLPA 5C1OA 1AUVA 2J5QA 2JJ2D 4G5OA 3OQBA 1E61A 1RI5A 2ZIWB 3QXJA 1PFKA 3BXOA 2GO1A 4GLFA 3VC1A 1ZJ5A 2IBTA 3BZWA 2OMKA 4OMUA 3K70B 2WJHA 2WZCA 1ESZA 2IBMA 1E9AA 5C51B 2FRDC 1SB8A 2H54A 3SIWA 3OWOA 4OHVA 4Q9KA 1LDGA 3ZVLA 2NVBA 3FZQA 2CFRA 3H2GA 4DCSA 4HPJB 3JYHA 4UMVA 2HYDA 3S3TA 4MAAA 3TSCA 5KX5B 2Z3ZA 2LW7A 3TB4A 2JAUA 3PNBA 4FLEA 3T7IA 3P2YA 5AKLA 1A82A 1QE3A 1Z29A 3D2LA 4B6GA 2ARKA 4RYLA 2ENWA 5M04A 4EL0A 1D9ZA 3SICE 5BUSA 3DMDA 3HCNA 1Q0LA 3LKVA 3M6MD 1T1GA 3DT6A 4WKCA 4LOAA 4C3OB 4Q3KA 2P4SA 2XNKA 9ATCA 4BNVA 4FGLA 2RGNC 1XE3A 2OHJA 2XIQA 2RHCA 4NYJQ 2ZBFA 2IYVA 1J2UA 3EJWA 4JLVA 4PG6A 4XD7D 5JMPA 2EDAA 5K3AA 3STXA 2BUBA 4E46A 3MBOA 1MXFA 4MQBA 3H9CA 4HRAA 5EHGA 1NKVA 2FSPA 2CLCX 4UAVA 3RFCA 2MYTA 5FPTA 1X15A 4FUQA 1T0HB 1WXXA 2V0CA 1PEDA 5F3WB 2HNBA 1LSOA 4FB5A 1TFUA 2BMWA 1AQNA 1BJRE 2D62A 3S44A 4DDHA 1S89A 4PC6A 3AESA 4LQDA 1CY6A 1EMDA 2RJ3A 1RAFA 3I34X 5KQSA 1ZRSA 1GRCA 2YH2A 1QZ3A 1D6SA 3VYWA 3F3MA 5AICA 1LLDA 4YQFA 1N5LA 3SC4A 1EVZA 2H1SA 2VHWA 3NVDA 4P82A 4TT3A 3V8QA 5IBCA 3DAOA 4X9XA 3W9YA 2PUEA 1V2HE 1GLVA 2IEDA 2FE1A 3F5SA 2DPYA 3NAQA 4IXDA 5HEKA 5B37A 2JLWA 1G5QA 4UTPA 4QGFA 3R9IA 2VDMB 3LXUX 1ZD3A 5BSFA 1D1PA 4G23A 3CNLA 3NGXA 3N8KA 2G4VA 3SGLA 4BN4A 2Z56A 3SYMA 3TPFA 1E5XA 4EJFA 5I9TA 2BR3A 3U4GA 1FNNA 5KIAA 1RPZA 4IVNA 5EE9A 1E9EA 4ES6A 3USES 3KQPA 4GM4A 4RC9A 2G40A 2JLVA 1OILA 3W1WA 3TTXA 4F4FA 3MA0A 1AV6A 3UH0A 4OJMX 4C4ZA 3HCAA 2HRCA 4BASA 3IB6A 1HDYA 1ZUNB 1YK0A 3N0XA 3K5WA 2CFCA 4GDFA 2X8LA 3ECCA 3MCWA 1CRPA 3QEMB 2GZMA 5AXAA 3EUWA 4M1QA 4YI5A 1KEWA 4IOKA 2W6CX 1FXSA 1AM4D 3PJGA 3TIXB 2ZCUA 3GFSA 2V96A 4YEDA 4G85A 2VP0A 3OJLA 3I9JA 4EQ6A 2V74B 2XXBA 3F3SA 1TPZA 5B1IA 1SRQA 2NUBA 1UMKA 2RK3A 3BMOA 4QU5A 3ENKA 2ACWA 3IE1A 3X1WA 2DTXA 3KWMA 3HKBB 1J20A 1ZESA 4DILA 3LI2A 1JT2A 1MAHA 2PL1A 4RVFA 5TC4A 4MUYA 5GV8A 1NOJA 3W5UA 4CHGA 3IELA 4OA8A 4YT4A 1YGPA 5BVGB 4U2GA 4DB2A 5CNMA 1SFRA 1GRNA 2ZM5A 4UU0A 4CQNA 3LNTA 5CVCA 1B7GO 1SPBS 1AKQA 4KB5A 3L7BA 1XQXA 2GEKA 4R4JA 1NUHA 3H5LA 5EPUA 5K6TA 3QLTA 1NW7A 2AR0A 4JODA 1QFYA 3ICPA 5BV0A 4AUKA 2A92A 2FUNB 1QUFA 4JWTA 1AQLA 1AA3A 1M1YB 1ZH8A 4Y2VA 5DYIA 2H2IA 1H3EA 4MAMA 1IONA 1I4WA 4TTPA 3LRPA 2GBIA 1M7HA 3GDFA 1UF9A 4MR7B 3PB3A 3UJ7A 1SD2A 1Q0TA 1RP1A 5JSHA 2ETVA 1SGWA 4Z3KA 3A4YA 4V1CA 3JATA 5KYWA 1G5PA 2NT3A 2M6SA 2IEBA 3MD0A 2AS0A 3HB4X 4PNZA 4UBMA 4WCDA 5EWJB 1PD1A 4JZKA 4XASA 4B3CA 3DVSX 4PAOA 2PMWB 3LPMA 1U02A 2E5FA 3MBKA 1Y7HA 1QYCA 1WLSA 3NJ8A 1NN3A 1I2BA 3H4VA 1RAAA 2Q0HA 1JKXA 3H7AA 2CHFA 3UHJA 1TF2A 5HZHA 3TNJA 4AJ9A 5JJBA 1Z83A 3ZJTA 3GN1A 5J4YA 4DIEA 4PYLA 1QTQA 3BCRA 1PW5A 4PLVA 4EG6A 2UUBB 4BEBA 4H3HB 1NRWA 3DMTA 3AR4A 2PKXA 3ECSA 4Q1FA 5AHXA 5BWBA 5TEVA 2D00A 2LUOA 2VAPA 3WRYC 2ZUEA 3AEZA 2H9IA 3BOSA 4X3PA 2AFVA 3ICWA 3EVZA 4JWKA 4KK3A 2RE8A 1ISGA 3HC7A 5AO9A 3WWZA 5MGNA 3KHUA 1KDOA 4ZI7A 2W8BA 4QOHA 3EZXA 3BE6A 4V02A 4ZOCA 2VDUE 1XVIA 3ZGYA 3SK0A 4K9LA 1XWWA 3ESDA 3UF0A 1BSVA 4P98A 1MUUA 4BNDB 2F55A 4EBFA 2QA5A 3VR5H 2PXCA 3AR3A 3T3GA 5L3SA 4MVJI 3GRZA 2O7NA 1DC3A 1NUAA 3VKGA 5JFTA 2NXJA 3SLGA 3M6XA 2AR9A 4PPQA 1SXHA 4OYYA 1W2GA 2J0UA 5KKNB 3Q10A 4XAQA 2EQAA 4ZT7A 5CA0B 3FTCA 4M53A 3ESCA 2ZDHA 3ND8A 1KGDA 2W2QA 4DDUA 5AVSA 3PQEA 3UPUA 2FN4A 4RHXA 2FPXA 4WTOA 5E1OA 1XMIA 2Q1YA 3RBVA 3A36A 4JU9A 5BMVF 1Q14A 2AKYA 2FKNA 4BMPB 2WWIA 3FGPA 1ZH4A 2L82A 2R1VA 4DCPA 1U0TA 1OOEA 1T9HA 2ODTX 3EQ6A 2D54A 3VR5A 1I7LA 5JH7F 2GPBA 1DQSA 1IYZA 1WIWA 4MVJH 3HYTA 1XA3A 5FEMA 1AB6A 2QRJA 1Q1GA 3HWWA 4GOXA 1YVRA 1T1JA 2CXQA 2JH3A 2J3HA 2WC1A 2IHBA 2X3UA 1F4LA 2DT5A 1UPAA 3IILA 1GGEA 5HF6A 1CT9A 1KI3A 2RGGA 4C2UA 1TCUA 1QRDA 3CJQA 1CW2B 2HO4A 5DNWA 2R7MA 3BQNB 3DE7X 4JSRA 1GQYA 1O9GA 2P0YA 5DZSA 1Y6GA 1HL3A 4UEOA 1WXWA 5TQJA 5JNUA 4BFUA 5M3BA 3M0EA 5B7NA 5ICSA 2G77B 1PJBA 2I7TA 4TLDA 4YBZA 1EX6A 1E2IA 4JX9A 4LSGA 3P0RA 3FH0A 3OZSA 4TMXA 3RTAA 2OCYC 4NP6A 1A2KC 4HEQA 5D86A 4MVJA 1TYDE 3QVKA 4HLNA 1QHHB 3WLMA 3SXUA 1W0KD 3WSTA 2XBLA 4LNAA 1G63A 1Z8FA 2C8KA 3ZWXA 1PFVA 3WK8A 1KF0A 1T2NA 2X41A 1YVUA 1QFMA 2QZ9A 3MLBA 2N75A 4Q9JA 5I7SA 1A5AB 1RAGA 2QUIA 1D8AA 2DFLA 4BX0A 5IDVA 1C1XB 5LCXA 1L2TA 3ENVA 3Q0EA 1A5SB 1R8XA 4PS1A 4GOOD 4BFTA 3GLFB 1E3QA 2XNHA 1T29A 3ZG6A 3BXZA 3LCRA 2JFWA 5ED4A 1L3IA 4E12A 3AKCA 3VZPA 3OLWA 4B4WA 2QP3A 3TFOA 1CE8B 3K96A 2EF1A 4J2TA 4OREX 2FJUA 3ENZA 3WMRA 1VI5A 3AF0A 3CVXA 2X8BA 3CWQA 4TMWA 1QGAA 4HQFA 4URWR 1IUKA 2Q6LA 3H13A 4IHAA 2I71A 4UUAA 4M83A 4BUJA 2R97A 5FOTA 1USWA 3HCCA 4EBBA 3ENWA 1JAYA 3ROMA 4DLZA 5JOQA 3U2QA 1GCGA 3P4YA 1GPDG 1VIAA 4O4JB 4RLSA 3TGWA 3E5NA 2XKBA 1IQUA 3NDIA 1JHZA 2WDZA 1KL7A 2NO5A 4MXDA 4Y0VA 3A4VA 2WG2A 2VBFA 4JUFA 4M37A 1O4WA 4YCBA 7AT1A 7YASA 4INJA 3ZQ4A 1Y8QB 3R7AA 1S5PA 3INYA 4CYMA 5EZQA 5JSFA 2VI5A 3JQ9A 1JPUA 3OT1B 2CE2X 3DCNA 3GFVA 1EBBA 5JLAA 4R8VA 1N2SA 4NU0A 1EE1A 5F2KA 4B43A 3NWJA 1JAHA 3OOJA 3PHIA 3ZWAA 5IYZA 1KQNA 5KQGA 3G23A 4JNCA 2W4IA 3TVDA 4J0JA 3EEFA 2AD1A 3W5JA 5I3ZA 1SHJA 1EX9A 3JAKB 4G86A 4JHXA 5LQCA 5IBPA 4JEHA 3F6BX 4W8HA 3I32A 5FBLB 3I9NA 2AR7A 4P1ZA 2C9YA 3ZGLA 5GJWC 1YVEI 3D3JA 4N7BA 4E2YA 4ZCTA 2EU8A 2TMDA 2QXUA 4A2WA 5L6MB 1VJCA 4HJRA 1JR6A 2A1UB 5BV8A 2G17A 3O4HA 3B82A 3FUTA 1C0IA 1MIHA 2VWHA 2GAAA 1JDUA 3DFMA 2DM6A 1IN4A 4HXYA 4NZZA 4YRTA 2CF6A 3DB2A 1E1CB 3COPA 1R74A 5IVKA 3E2IA 1I14A 1TQ8A 4YAFA 1GZSA 4O5AA 1F2UB 3GD7A 3EIFA 1SXQA 1JFFB 1YMQA 4DANA 1YZVA 4IDBA 5E2IA 4K9RA 2VF7A 3WK5A 1P1CA 2EZUA 4IJWA 4MLCA 1MMFB 3UA3A 2WSMA 4L8LA 4RJTA 3ZTTA 5LUAA 3RNOA 2Y1OA 5FADA 3W8DA 2C9ZA 4Q34A 1NZFA 3DKKA 4JJ4A 3WSVA 5LQJA 4O2BA 1UWCA 2QTRA 1H9BA 3CUWA 1L7PA 4GX0A 1M67A 4QUHA 3T3EA 4LWQA 2Y1DA 2JHAA 4P3YA 4QDTA 1MOZA 4CEHB 5LP6C 3P9CA 3TM5A 1G20A 2C20A 5F4ZA 3CXUA 1Q1AA 1NTRA 1C9EA 3V4OA 1MZPA 1JYSA 2DMRA 1MB0A 4NCHA 1W0JA 5DN6D 4HQRA 1S2IA 3FA2A 1JIXA 1NP7A 1VBNA 4RV9A 4F56A 1JBKA 1FJGB 1BD3A 1EZ1A 2J3QA 2V5UA 2FGJA 2ZIEA 4MVYA 1A5BB 5ECGC 2KYRA 2G1PA 3AF6A 1CUUA 2RH5A 2JIBA 3FWNA 3UWOA 1A97A 3V46A 4X91A 5CGZA 3CUVA 3TFQA 3K94A 3PL1A 1NULA 3H04A 4INPA 2GF2A 4TMFA 2QAIA 4KLRA 1I3NA 1GU0A 2D2XA 2XWSA 1P2VA 3DMFA 3L8GA 1QTIA 1JN0A 1XL1A 3LXRA 4M1EA 3R7WB 1YR2A 1IN7A 1WY7A 3AKEA 1SEPA 1Q6ZA 3G5TA 1OB5A 4LEIA 2VSNA 1K2VN 4ZQFA 1TZKA 3PXGA 2BEKA 4YRDA 5TNXA 3RFXA 4NOJA 1G38A 1YUMA 2X42A 4UUPA 5ITWA 3PHLA 1TVKA 2FPOA 3IUPA 4KDFA 3V7WA 5LR6A 4IJ5A 2IUEA 3VZSA 3G0BA 4R7ZA 2GD0A 5EINA 1QC5B 1GPAA 3DDUA 1U0GA 1YNOA 4ZOLF 2FEXA 1X1BA 4KTTE 5B4TA 5IJ9B 2V1UA 2VNJA 2BMEA 2VOJA 3WL4A 1BVYF 1XLTC 2WFLA 2XKKA 1FP2A 1YUBA 2AXEA 4X24A 3HCRA 4CL8A 1HEUA 2IDMA 1BX1A 5CVEA 3TW6A 1MB2A 1H8HD 2W2VA 2VT3A 3DE2X 2PVSA 3RSLA 2ZYDA 3T3HA 4BP1A 1NIJA 1UXKA 1ODCA 4GZ5A 1L5YA 5A4DA 3C5VA 1EUQA 4RE6A 2CEKA 2OK7A 4QASA 3VQTA 3LSYA 1QLHA 5G53C 1K6XA 1AQYA 1NI3A 1HXHA 1OLOA 2W6ID 5HCNA 2PUHA 1RQ7A 3CJRA 5FCDA 1XNGA 3IXLA 1QKKA 2ZBDA 4V0NA 4ZAGA 5K03A 4I1IA 4LZLA 5F3RA 1QRRA 1B16A 2GZ2A 2W0MA 3SEFA 3FCOA 5EJ2A 2WMNB 3FG9A 3VNAA 1F2TA 4KKXB 4I5GA 2EP5A 4R7TA 3RJ9A 1KMIY 2ILTA 4L0CA 3NWOA 1DJMA 1I2ZA 3JQPA 1WVIA 4UW9A 4FHGA 3O38A 4GPBA 1BROA 3UJAA 4EUNA 4C21A 1ZY2A 3HN7A 1VHWA 1Y1RA 3NO4A 4KSBA 1N5KA 2F43B 3OE1A 3FD8A 2C3OA 3WL7A 10MHA 3LWDA 3DE6X 3ONFA 4PX2A 1CD5A 1LJ8A 2Q62A 2QNBA 3T7AA 5DNUA 1KRHA 5COBA 1JLSA 3WB0A 2V0GA 1QHXA 5IJ0B 2DFVA 2EKZA 4RAOA 2FPGA 3TIFA 3W2IA 4E6PA 4ALIA 1HE3A 3D6NB 4H27A 4WZ6A 2WJGA 1L5KA 3WYEA 5JDIA 2JD2A 2EWVA 2FXIA 3LQYA 4AO8A 4R71A 3PJFA 4QTYA 2B35A 2UAGA 5TT0A 5HDQA 3JZAA 2D2VA 2ANCA 3ZW7A 3ESBA 3I37X 3SM9A 2W2PA 3KOMA 1GUZA 1K63A 3EXG1 2GD1O 2JFFA 4ZZ1A 4TZTA 4DMUB 1J00A 3FNFA 3LY5A 3QKRB 1K4KA 4A9AA 1CJBA 1GGNA 1M34A 1RHRA 3CX3A 1TM1E 4EI8A 1DQPA 3CM0A 2WMDA 4LX8A 1IMJA 1Y33E 1C0LA 2ZJ2A 1SCDA 1NF9A 3AYZB 4JBLA 1UXGA 3Q41A 1B8VA 1GTJ1 4KU4A 1D03A 2XECA 2AX3A 2B4AA 1RXSA 4M1WA 1NNUA 4FQ8A 3OC6A 5ITZA 1JU3A 4EJ6A 1LRLA 1ZJWA 3GUHA 4JT2A 2M98A 4A36A 2FVYA 1DIAA 1HFEL 1S1MA 2QUAA 2Z3VA 3I05A 2HHHB 1I5RA 2XUDA 4IDQA 4IVRA 4GLJA 4C7KA 1OY1A 1E4VA 1X19A 2FLKA 3DC2A 4A82A 2H2HA 3ET4A 1VLMA 1GR0A 5ALZA 4CDRA 3RO7A 1H2BA 3HA7A 4QA9A 3R0ZA 1IOWA 4BMVA 2DAPA 1B14A 1NPTO 4LX0A 3FOWA 3R0XA 4ER3A 1WPQA 1MORA 1VMAA 2A9RA 3IKVA 2FZLA 5JMWA 1HE8B 2FFQA 2R8OA 2IWHA 3O4RA 1BHSA 3B1KA 4RBNA 5AKEA 1PL8A 3UW3A 4HWGA 1KEZA 3G0GA 5DULA 5GM2A 5SZKB 3KT8A 1MCZA 3RJMA 3X2FA 4C3UA 2PL5A 1QQTA 3K1TA 5FOQA 4MMYB 4DQ0A 1NXXA 1GZ7A 4AJPA 5CBPA 1NQTA 4FI3F 2ZCVA 4LZAA 2OOKA 2D1FA 1JALA 3SHOA 4GNRA 1AN9A 3IPXA 4Q3OA 5CCXA 4KQ6A 5TIIA 2B5VA 1N7JA 3I6QA 3CG4A 1HFKA 4MAFA 3TJRA 2X6TA 4ZU3A 4WKBA 1RRMA 3OSUA 2FZKA 2MYPA 4ZGBA 4TVSA 4O4IB 1GUDA 1ZPDA 1WV0A 1Y5IA 4WNAB 1AD2A 1JS1X 1UMDA 2PFSA 3H17A 1I5OA 4BVBA 2J9FA 2JA2A 1P1FA 4NBSA 2JVKA 3INGA 2OHIA 1E2DA 1NFRA 3NORA 4H17A 2OD7A 5HCUA 3HJRA 5F98A 1XMSA 2QXTA 2VTDA 3LK7A 4BNHA 3HBLA 1SEVA 1FU7A 2QMOA 1QG0A 3QBJA 2JA1A 4QYMA 4RHTA 3X44A 4D80A 1RCUA 4B6SA 4WJLA 2ECQA 1G6KA 1ORDA 1VHLA 1OGJA 1XZQA 2Q1UA 3FYCA 1PT7A 3WNBA 3QJ5A 1DT5A 1KDZA 3TBFA 4NULA 2C2ZA 3JQ7B 3EPKA 4K8OA 4BFVA 1EQAA 5I9LA 3GZNA 1FX0B 4F91B 3VI4B 1MD9A 5J2TB 1LVUA 3PPYA 4C0KA 3SDSA 5BQOA 1ARZA 1WDMA 5DM1A 3GFOA 3TLYA 5CDUA 2QW0X 1ADYA 3KUKA 1JLKA 2FUKA 1EEXB 3KOZA 4I9FA 3AUFA 4YIKA 3JRNA 3A7DA 3BMQB 3NBMA 1N1EA 1T9CA 2C1ZA 3FJYA 1U7UA 2PDAA 3LF1A 1FVXA 1RKXA 3JPYA 4Y2PA 5K3SA 3IURA 1G5RA 4AZSA 3LUCA 1J09A 5LXTF 3PKIA 1GG9A 1MJGA 2NO4A 3PT5A 1G59A 5L3ZA 4PGHA 4M7PA 4MQFB 4GRDA 3KQLA 2PD4A 4PPFA 1JI0A 1P0QA 1PCXA 1WTAA 5TQ2A 5GVSA 1L8XA 1O0SA 2JGDB 1NVAA 4L0MA 4JIMA 3ESZA 1O54A 1QCDA 3DZHA 3MUFA 4JBNA 5FA6A 3PUIA 3K6JA 4NBUA 5JCOC 3CBGA 4P7GA 1YE5A 3JVUA 3QBEA 3WL5A 2GDZA 1U2SA 3HDYA 3NHZA 3TLBA 3V5NA 3QPBA 5BWMA 2P2YA 4CE6A 2E9SA 5DHRA 4P3PA 3QVJA 4ZAXA 4J4BA 4DLAA 4LJKA 4N5NA 3QA3E 5D00A 2F3QA 1LPAB 3OURA 4FDUA 5TPWB 1MO6A 1S9HA 1ODTC 1UH5A 5EJMA 3LKDA 4D56A 3FDFA 3UKDA 4PAMA 1QGUA 1EUZA 2WMYA 3PIRA 2VLIA 2FETA 5M34A 1R3DA 1VPVA 1D0IA 3AP3A 3F6PA 3TRIA 4CNQA 3D1VA 2ZJ4A 4AFNA 2PCLA 4OQ4A 3H0KA 4LZZA 4B5LA 4R69A 3L06A 3W8NA 5DM4A 3CZQA 2EIHA 1A5ZA 2QHXA 3NS7A 1QFZA 1NBEA 4EB6B 4F9EA 4RORA 4YJHB 3NWBA 3VO1A 2CFTA 3JQBA 4UE6A 5TS2A 5GIOE 2GB4A 2GM4A 3EXAA 3GOQA 4ZIRB 4MUKA 2DUJA 3X1MA 5IEJA 1N5RA 2D7JA 3C43A 3V4VB 3SIXA 2P41A 221PA 3ETNA 1SA0A 2PR7A 3CPHA 4WZBB 4JI1B 1KKUA 4K26A 4LBYA 3HA3A 2GFHA 4A7PA 2O8VA 3CLKA 1L4EA 2H5JA 2P9TA 2PSEA 2VDQB 2X58A 1AGYA 5HE9A 4HNVA 1FFHA 1Z8DA 1XMVA 3THYA 3L92A 1KMHB 4RKYA 2ZRMA 2DLNA 3AR7A 1P2FA 4G5HA 3GLVA 3K9HA 3KNZA 3LYUA 4KJZA 1MABB 3Q40A 3NRBA 5A0FA 3S2UA 4HDNB 5K0GA 4GG1A 5AJZA 1Z88A 2ZBQA 1H65A 2X15A 2DE0X 5BSMA 1L7VC 1T25A 1UXHA 3OCWA 4X61A 3H6GA 3UC9A 3UTDA 1CUZA 4KRXA 4UQPA 2XUJA 3I6YA 4YO8A 3TUZC 1NDQA 4LXIA 2NSHA 4ALKA 1CRQA 3EA4A 1B42A 1RZVA 4FOOA 4JVLA 3GEDA 1NVFA 3G2HA 3LC7O 4H7PA 1TDJA 4BNIA 1OPXA 4NXNB 4IH9A 3LQ1A 1FU4A 3PTLA 3U5ZB 2V7WA 3AEKA 2RI6A 4OIMA 5ESXA 1XTKA 1OI3A 2IU4A 1DHRA 3F90A 2EW8A 5D6OA 5K1ZA 4DW8A 4V03A 5CDYA 3NHMA 1XU4A 2GCEA 4YRNA 3MAJA 4H9GA 5E7MA 1ZM4A 3W2TA 4D02A 4E5KA 2H11A 1OXXK 1V6AA 3AV0B 4KXLA 4NV0A 3NJ4A 3B1YA 5DLDA 5C31A 3T9EA 4DSOA 3OQIA 4K6HA 4B3FX 4EG3A 4Q7QA 7REQB 9MHTA 2OGTA 3SMVA 2C84A 4ROSA 4K6FA 2F17A 4QNRA 1QO9A 2WM9B 4ZARA 3WBFA 4ZYUA 3RM3A 1BEZA 1RXIA 4WKOA 1O6BA 1RPJA 1W46A 4R1QA 4ZA2A 5JY1A 1H23A 5JEEA 1JWLA 1CLEA 2JFNA 3P71T 1VYVA 3LHSA 4XFKA 2OHVA 4MULA 3SQMA 3VYRB 4A1FA 4EARA 2LXNA 5A06A 4DGSA 2EV9A 4A8PA 3IODA 2GN2A 4INOA 1JA0A 1IUNA 2XGMA 3D6VA 3TDKA 3FMFA 4JJEA 4NENB 1YR9A 3K8QA 1IB6A 5A3VA 3UV7A 4CWAA 4EKIA 1JQ5A 1NJGA 4XWYA 3JQDA 1RFGE 3L0DA 4WOBA 3Q6NA 1M1ZA 4C7OB 2YWFA 5HG0A 3T9FA 3IVGA 3QVMA 2IYTA 3KB8A 4HBGA 4JBYA 2UXBB 5EKSA 4NZ9A 1ADBA 1XXHB 4IGIA 2PBRA 3D3QA 4GX5A 2VAVA 4BLSA 1Y1TA 5ECYA 3DBOB 4I4LA 4I4IA 4MP8A 4U6NA 4FYKA 3D5QA 1J06A 1DAFA 4D8TA 5CYFA 1ONSA 2CUZA 3KQNA 2COKA 2D2EA 3DHYA 3PQ6A 4O2AA 4D9JA 4UNRA 5E4TA 5FOXA 3Q9UA 1JVBA 3IAS6 2FDRA 2GUWA 2CXXA 2AJ8A 4XTCS 2BYTA 1XKLA 3F47A 3IYLW 4J1NA 4OLJA 5DE3A 4PTZA 3GAFA 3N0TA 3SI7A 3GGOA 4FS3A 3RE1A 3ZY4A 4BNLA 3C7TA 4C7BA 1OVGA 3E70C 1XK6A 4AKHA 3EFEA 5BV7A 1Z62A 1EYZA 4H0CA 1NV8A 1EVQA 3QUTA 2FP4A 4DMGA 5KVCA 3WNQA 2BH9A 2ZIXB 4LXTA 2QDKA 2H1RA 5EE3A 5JXHA 2TSYB 3H05A 4JYCA 3B78A 2BFBB 3BB4A 3SU8A 4D96A 4J4TA 4DG9A 4UEKA 1UBKS 2VYQA 3GMTA 3CA8A 4QYIA 2UZ1A 4ZVLA 4OKSA 4FU0A 2EQBA 1OR8A 4FOLA 1T0UA 3G8CA 4LJ8A 1MLDA 3EK2A 3G9ZA 4D9CA 4EMSA 1ESDA 4DWWA 3C3MA 3ASUA 4DEXA 2HWKA 2XYGA 3ITDA 5B1YA 4G5RA 4NRDA 1TADA 3MS7A 3HDQA 3FVVA 1C8LA 5F5NA 3FFAA 2UUPA 5HF5A 5JVDF 5K45A 5CT8A 2UU9B 2WUDA 4HDKB 5BO5A 4XX0A 4IDGA 2W6QA 2QL7A 1E5DA 3EAGA 3SSAA 4XWAA 3OMXA 1CS0B 2QRLA 4DWVA 3P9RA 3IT0A 2CV0A 3TQFA 2J30A 3C0KA 3CN7A 4LYGA 4UTRA 1R6TA 3MHPA 4GOND 2QWXA 2A9JA 3KKNA 4QFMA 4DBZA 3EVFA 2NPIA 3EB9A 2B9EA 2VT2A 4GKBA 4INZA 5FEUA 1YWGO 3T9BA 4CM7A 1KFJB 3ANSA 4FE4A 5C4MA 4CM9A 5JS7A 3DAHA 1Z73A 4H16A 3S70A 1CQJB 3N6VA 1BDIA 1U8XX 2R3SA 3BMNA 5TV2A 4ESOA 2DUNA 4RA9B 5K0SA 4TTJA 3LA6A 2IYFA 2ESRA 3JYNA 1PQ4A 1CUIA 3RR2A 1J8DA 1ZI6A 1NMZA 1XMJA 2NV0A 3AW8A 3HCEA 4TUYF 3T7DA 3LLVA 3ESYA 5IMSA 1CFZA 3WLQA 4QM7A 2O3UA 3ZHCA 4AJOA 1TTPB 1WW3A 4TYWA 1W5FA 4AICA 2HF2A 1RBMA 4XUCA 4FGKA 1D2EA 4KIUA 2XUZA 1I10A 2RFLA 4XLZA 1YRYE 2MWMA 2OZLA 2JVIA 4A0RA 1BS9A 2CLEB 1Q0RA 2IHKA 1WDWB 2I3ZA 3K70D 3UOWA 2TS1A 3QIAA 1MJNA 3GLKA 4CDGA 3I4LA 4DADA 1QIEA 2WZQA 2P6NA 4EQZA 3K71B 1P9RA 1SHTX 3AFNA 3QIVA 4M1SA 1U7ZA 2BMFA 1J1IA 2LGJA 1W36B 3LZDA 8LDHA 3K53A 5J5CA 4I08A 1Q7RA 3GMDA 2Z8YM 5C7OO 2OPHA 3RYFA 3H86A 4XM0A 1X7ZA 4N0EA 3AVWA 1CZHA 4N49A 1MHTA 4BGDA 3G2IA 2ZJ8A 1U7DA 1QCCA 3NIFB 1NBAA 3C2QA 3NOVA 3C6ZA 1T34A 1QK3A 4PVCA 4C7MA 1ZCBA 1CYEA 5FX2A 1E1RD 1KS9A 3BFXA 2ZB3A 3OTWA 4M9ZA 1DJOA 3MUOA 3S28A 3EGIA 4WN9A 2HW8A 1BQ4A 5E0KB 1WRBA 3RVQA 1OLSB 1QFJA 1QORA 1Z0UA 2P91A 4A0QA 5ICMA 4E5PA 2XKAA 4S1WA 3FMOB 5FR1A 2GA9A 4LNUA 2QMEA 3UUGA 3HO8A 3JZDA 3MJHA 4OF4A 3SDBA 2ODQA 2ZUWA 5KNLA 4QWMA 4V2IA 1N6OA 1IN5A 1SKYB 2QMQA 3FDZA 4W6QA 2LPMA 4ZV4A 4YRGA 4WOJA 3MILA 1JR3D 2F67A 4X1YA 4KCGA 1USIA 5DDIP 4BQPA 3KP1A 3CT6A 3HXTA 4XDYA 1RIIA 3ZV3A 2WU0A 1UK9A 2PX2A 4B6QA 4E4RA 1NJSA 3U19A 2GX6A 5HNKA 2G80A 1PD0A 1I0IA 5FJJA 5KTTA 3UOAB 3KBOA 1EBFA 3ZIUA 1JL3A 2I76A 1PI3A 4Z5XA 3DTYA 1N0WA 4FBMA 3OE7A 4NE7A 4PGAA 5AVJA 5K20A 2AFHA 3CX8A 2DFTA 2PH1A 3T41A 4RDXA 3O8QB 3S1LA 3T38A 2WPDD 3NX4A 3L2OB 2RI0A 1UJ5A 3SZGA 5KJ6A 5JVDA 1JR3E 1XQYA 2V8OA 3E9CA 5CJ2A 4DRZA 4F4UA 4ZZIA 2OYSA 3FETA 1BYUA 4JMPA 5JH7B 3P9ZA 1IHDA 3TLGB 4ACAA 2D4HA 3P9PA 5HUJA 3I1JA 5FI0B 4MGZR 2PAAA 4LE0A 2BPOA 3U3JA 4MK4A 4OL9A 3DZIA 3NIBA 1CUAA 4LHYA 1NNSA 1QYIA 2HQOA 1QAQA 4L22A 1IZ9A 1ZWLA 3U49A 2H5LA 3O21A 5T7BA 3C7KA 2I2WA 5AHRA 4K1XA 1H22A 4HGOA 3T7JA 1JVSA 3F97A 4BE4A 3OZ7A 4IEFB 1ISJA 2HWUA 1UJ2A 3KAQA 4M0CA 2YXDA 4PBRA 4RK0A 1BWSA 3IEMA 2AE2A 1FUUA 2W37A 4YRFA 1EVYA 2W0SA 3L18A 3AJEA 5AKGA 1I4TD 1JHPA 1RJ9A 2QAGA 1RQGA 1Y8ZA 2QL6A 1CZLA 5AQ1A 2IOFK 3TEMA 3HWX1 2XVZA 5NLLA 1P18A 5ER6A 5EXXA 5E2AA 3QVXA 4IFBA 2P67A 2XX3A 5BN3B 2B94A 5IDXA 2A84A 1ZGBA 2C2YA 2YWHA 3TOSA 3V4PB 1JJFA 1P3JA 2CYAA 2GILA 3UMFA 2J6CA 3PNOA 4B4KA 1IG3A 3BD6A 4FDVA 1SKUA 4GPD1 1BKYA 4NOKA 1JSRA 4YECA 5P8WA 3T06B 5BW5A 3VJRA 4S0XA 1SBZA 2ALJA 4UJ5A 3GK3A 1NE7A 4XB2A 2XW6A 3V1MA 4NBNA 3ZHBA 1T9ZA 1XNHA 1W4CA 3N7AA 1XTUA 1RYNA 1SXJA 1DO8A 3GCZA 5BVHB 3WDKA 1I2MA 2NO0A 3QUBA 4CKCB 2F3UA 2K2WA 3H9BA 1MIOB 1RI1A 3QW2A 3RVLA 3ZNOA 3IIJA 1A5TA 3KSZO 4LYAA 5A7HA 3QWFA 1DJNA 2ZRFA 2L18A 3HRHA 5C5IA 4I1VA 1S2MA 1GLGA 2V97A 4CKEA 2GSDA 5D7BA 1W76A 5LQDA 4AUNA 5AXBA 1FXUA 4HMOA 2XE8A 3ODPA 4DV7B 4X84A 2D7CA 2R4UA 2Z5GA 5E7JA 2BF4A 4R8SA 4RM2A 1YCFA 2A3RA 4Z7QB 4DJFC 1R8YA 1AQ6A 1FYDA 3D64A 2FK8A 4FHZA 4OK6A 4ZOLB 4R0VA 1SVWA 2IXAA 4FFSA 1LKZA 4EB3A 1Y4SA 5EZYA 5KQMA 2XQJA 3K4HA 1EK6A 3G8BA 3GQVA 2HSGA 1CY7A 4K05A 3BULA 3M1AA 5KOJB 1ABEA 1Q2UA 1U8ZA 2EG5A 4LY0A 4WDRA 4YYZA 3L0BA 5KINB 2I1WA 2QENA 2W6PA 3AEUA 3E3LA 3KQUA 1GGJA 2ID8A 3MMXA 1T13A 3PPXA 4N01A 4UJ3A 5IJXA 2FPWA 3VDXA 3OESA 2XTZA 4DMMA 4BFYA 2AG6A 2PA0A 3IE2A 1KIMA 1GPBA 3ZJ5A 3B60A 1X87A 2LNDA 2YWDA 3IUMA 4MRAA 5KYVA 3IRVA 3PEWA 5KZMB 1DUIA 1TZJA 4AKIA 3DYBA 2QLTA 1WZNA 4K6GA 4M8NE 4QEZA 3DA8A 2YCLA 3GP8A 5EPOA 2JLYA 2FEPA 3C4JA 4NIMA 2BGIA 3DOJA 3AZPA 3ZC3A 3G13A 1L7BA 1ZVKA 1RI2A 2EERA 2LR0A 2Z2YA 2YRWA 2JHCA 3B85A 4S24A 5C1DA 4ZEMA 1JFTA 1A3CA 3G1WA 3TBHA 5FUXA 1WDLA 3HB7A 1IWOA 2C61A 4N5HX 5GZ3A 3MQFA 1CEQA 2E49A 4R83A 4GMDA 4D44A 3BIFA 1V11B 1YIOA 5JWOA 3PJRA 1IY2A 1BDHA 5FBHA 4XI9A 2FJPA 4NS1A 4B2YA 2JZCA 2SKEA 5CAEB 1C9KA 4II3A 1ZKDA 3DFUA 3JD3A 5K51A 4S12A 3P2JA 3HADA 2WF9A 5ITVA 1P1KA 2GBCA 2GM9A 2JCGA 1AT1A 2R2AA 2Y4NA 2ZYGA 3AL3A 3AX6A 4OXNA 3SYTA 4NI5A 1K8XB 1SOAA 4CLRB 4LYHA 5BSHA 5K8IA 3DOIA 5JNTA 1XOIA 2Q07A 4HSGA