4PPNA

Mycobacterium tuberculosis reca citrate bound low temperature structure iia-bn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
327
structure length
311
Chain Sequence
TPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on Mycobacterium tuberculosis RecA: Molecular plasticity and interspecies variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Protein RecA, 1st part, 2nd part
total genus 95
structure length 311
sequence length 327
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 4ppnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ppnA01
1RVDA 2ZRHA 1AQYA 3GLHA 2GDJA 1BOFA 1GKIA 1ZM4A 2BMEA 2O0KA 3I32A 3ZJYA 4IVPA 3GD7A 2QA5A 1BIFA 4URYR 1NBMD 4V0NA 3SJZA 2ZSBA 4A8JA 5E3HA 1E0AA 1YR9A 2QPAA 1HV8A 2QAJA 5EXXA 1CTQA 5LD2B 1GZSA 5CLLA 1E9BA 2GCNA 4TL8A 4FCWA 3BB4A 1UEJA 1BYUA 2GAAA 1JJ7A 4GP7A 1G7RA 4Q1BA 2N1BA 4D4LA 2VF7A 1CR4A 5KSZA 3LFUA 4DIDA 1P73A 5FPKA 4I1SA 4DCNA 1X1SA 4NYJQ 3A1WA 1DAGA 3MGCA 4DB2A 4Q21A 4US0R 1G7CA 1TEXA 2CBZA 5TARA 1F2UB 3HYTA 4G5OA 3UG7A 3WHLA 121PA 1OF1A 2AXPA 2YC2C 3NG1A 4BASA 1OB5A 3L0SA 4TMVA 3A1VA 4TQAA 1ZD1A 4LHXA 1G291 3BC1A 1EESA 1DAFA 3BH6A 4NCHA 3THOA 2ONJA 5DISB 3VKHA 3TUZC 3K70D 4WA7A 3K0CC 3WP0A 5AWFC 3WXMA 1G8HA 2FE4A 1ANKA 1NBME 2ZEJA 4BEJA 4KYUA 3TSZA 3VKWA 1T3SA 2QZ4A 4OK5A 2VA8A 1YRAA 3NBFA 1W46A 4U00A 5ANRB 3W9YA 1IJFA 1Z0IA 1XMIA 2V1XA 4FMCF 3TRFA 3ZZTA 4CIDA 4F38A 3AM1A 2IXFA 3P1JA 4ACAA 4DJTA 5F98A 4OQXA 2IS4A 2Q9BA 1R5BA 1DOAA 4P33A 2FMXA 4AWXA 2ZJ2A 1AGPA 4S35A 1R0ZA 5EP2A 1ZNZA 5DNYB 5BN4A 3BAFA 3CRMA 3K0AA 3U4QB 3BB3A 4AK9A 3U7EB 2ZJAA 2XITA 3ETLA 5J4KA 3E5HA 3RWOA 3DZ8A 5K8TA 3O47A 2BKUA 3UWOA 4BLSA 4Y0AA 2GAOA 1OHHA 3KZ1E 2IL1A 2CCGA 2WIAA 2BJVA 3T61A 3RRZA 4TZ6A 4TZ0A 4AI6A 2CVFA 3ZS8A 1M34E 4MDEA 1EWRA 4HAUA 3DKVA 3J81k 2C8VA 1D2MA 1LTQA 4A36A 3LRPA 2EFCB 1NN5A 3B1ZA 1NLZA 2ZS9A 4LWZA 2NOAA 1M8PA 4B3XA 2ZS8A 5BQ5A 4NCIA 1U9IA 4LCBA 3CO5A 1GWNA 1E2DA 5C4GB 1N6IA 3L0PA 3LVQE 3AVWA 4ZKEA 3LV8A 3N2IA 4RZ3A 4ZDWA 1E2QA 1T8UA 2QMHA 1UBCA 2N46A 2R6AA 4OI4A 2OILA 2J9RA 4U5XA 3OE7D 1SULA 4A2PA 2NO9A 3TMKA 3C8UA 1G9XA 4HYYA 2FFAA 2VP2A 1EXMA 4ILEA 3SOPA 3W8RA 3PXGA 4NYMR 1T0HB 3NC1C 4CF7A 1SVKA 2NGRA 3MWYW 1ZAKA 4NE2A 2JLZA 2GXQA 5EP1A 1FMJA 3ZS9A 4BFVA 1XEXB 4U02A 3VMFA 3QKRB 1G4AE 4AIIA 1U99A 3N70A 1JJVA 4CYMA 2ZRFA 1U9IC 1E4YA 1G1MA 4UNPA 4Q4JB 2OSBA 3EAQA 1P9RA 2FFQA 2D7DA 4Q19A 4WIAA 2IXGA 2VPPA 2QPOA 1EK0A 1NSFA 2ZI4A 3TQCA 1Q3HA 4TYWA 1CP2A 3Q5DA 1D8TA 2QP4A 1B23P 2VO1A 2JJ2D 3CPHA 1Q1BA 4QJ3A 4EPVA 1OFHA 3BWDD 4G01B 1TEVA 1I4LD 1G5TA 2JJ1D 4OHVA 3PIRA 4HAYA 3D31A 3KQNA 3PUVA 4E07A 2DPXA 1IM2A 5GVSA 2JA1A 4YONB 4Z8XA 4G3XA 3DL0A 1W44A 3SC3A 1ZRHA 4US2R 1N5JA 4WOPA 1G3MA 1XJCA 3TAUA 4EPXA 2WKPA 1N6NA 2A2ZA 3P4XA 4HUTA 1EX7A 2IYXA 4R98A 3U6KA 3U7HB 3LLMA 4URWR 1FUKA 1W2HA 1NG1A 1LV7A 1OJLA 3TBKA 2WJIA 2RMKA 4D4MA 4JVSB 3BXZA 3O8BA 4JYBA 4JLDA 4R71A 2QGZA 1MH1A 4M8NE 2QAGA 4CVNA 1NRJB 3H84A 1O3YA 4WXRA 4CEIB 3HYRA 1OYYA 4HB0A 1NY5A 1GVNB 5AR1A 4DLVA 4DDUA 3MWLA 5CJPA 1G6HA 4Q1FA 2VHTA 1QHXA 2UZ3A 3FFAA 3KQHA 4I99A 4BFZA 4XSGA 4YMUA 5KO2A 2D62A 4PSKA 1T5IA 2D7CA 5H68A 4TWZA 1ZIOA 4LJ7A 4RCZA 5FFMA 4PHFA 2R6DA 3KJHA 1FP7A 1HUQA 4JS0A 4NCKA 3X1ZA 1KDRA 3QY0A 5AUPB 4EPWA 1CXZA 3EC1A 1II8A 2DCUA 4B3DA 1QZXA 2WVJA 4DLUA 3OEEA 2J7KA 1ZVQA 1P9NA 4W7SA 1R8QA 3T1VA 2DBYA 1N6OA 5KDOA 3I5YA 3MG9A 4GZMA 3FMOB 4NZYA 3CIOA 2H5EA 3IO5A 2ZRJA 1KI6B 4MGIR 4A1FA 4IDPA 4P3YA 4A0HA 4UNNA 3UANA 1MO5A 3CWZA 3EW9A 1MABB 3C5CA 3IDQA 5BW8A 4KSCA 1GM5A 4B2IA 4TN1A 4TMZA 2JGNA 1BMFA 1QDEA 3KTAA 3LY5A 5JCZA 1ZBDA 5JCPA 3TUIC 2RGBA 2W6JD 2W0MA 3CPJB 2JDIA 5IHPA 5A5GA 4GBMA 3UIEA 5FTKA 2NG1A 4MH0R 1YJ5A 1G41A 1T91A 2P6RA 1TU3A 4TLCA 4DDTA 4YMWA 4B47A 3WP1B 5DN6D 3T34A 3B1WA 1N0WA 3MCAA 3PEUA 4OHZA 5CYPA 5CB8A 2CNWD 4AURA 1VG0B 1IJEA 3FMIA 3P26A 3Q5EA 5KDDA 2DY1A 4KFSA 2W6JA 5LB4A 4LC1A 5JWHA 2Z6VA 2R6FA 2FEOA 2V9PA 2GVZC 4DLTA 2HYIC 1FQKA 2RGGA 2GKSA 3KQKA 2O8FA 4GL2A 3GJ4A 4GOKA 1IHUA 4KITB 3Q7PA 2IHYA 1J90A 1BS1A 3V9PA 3TKLA 2B21A 1DO0A 2C2HA 2G1JA 3ZYCA 2ZRKA 4BFYA 2CMKA 3EPKA 2Z43A 2R65A 4OQLA 4TYNA 1ZNXA 2PL3A 3MWJA 4CT5A 4FINA 1PJRA 4D26A 3E70C 1SKYB 3LH5A 1OIWA 1G18A 4QBHA 3KXKA 3CW2A 4MKGA 5JMTA 4PPFA 2GZAA 4FI3C 3QXJA 1KK3A 2C9OA 1RRCA 4L15A 4M1OA 1CF4A 2ZS7A 4Q03A 4X8HA 3C16C 1YZQA 4V0MA 2PJZA 3L2OB 1Z2CA 3PENA 2ZYUX 1SZPA 4M22A 2AD5A 3AGQA 1KI3A 2W83A 2VLIA 2YZ2A 1R0WA 4PTLA 4PQRA 3VHXA 3QOFA 3GJ3A 4B3FX 4Q9LA 3AF1A 2V3CC 4QJ5A 4RSGA 1HYQA 2YJTD 1UFQA 2W6ID 3C14C 3F5FA 3NKVA 4AKIA 2CLCX 1W4BA 3TR0A 3VR1A 3EPLA 2CL0X 3GEHA 1ZM7A 1D5CA 1P75A 1DAMA 2WSMA 2A5FA 2ZJOA 2Q3FA 3GFPA 2ORVA 4IXMA 3WHKA 1C1YA 3K0SA 4M1KA 2BDTA 2DB3A 2G3YA 2G0TA 4DWJA 5EZ5A 3THYA 1ZP6A 5K8IA 4BQSA 5G3YA 2PEYA 4B2PA 3Q9LA 3CUEF 2ZRNA 4M1YA 1Z22A 4JIMA 1JALA 4Q48A 4HLDA 5FUWA 4W5JA 3ZVRA 3B1YA 4TLEA 3LAWA 4Z1MD 4KLNA 4CDGA 4JJKA 2NIPA 2NQ2C 5CDFA 2XXAB 1RYHA 2ORWA 1EFTA 5EP3A 4C7OB 1JAIA 4BFSA 1EFCA 5GJCA 3DDCA 4P4TA 2KBEA 3FWYA 4ZDKA 3D3QA 4B35A 2UZIR 4HAZA 4EDHA 1KMHB 3KKNA 2DFKB 2FSIA 4MYHA 1DG1G 2RB4A 2HXSA 1XJ0A 2QP3A 2XB4A 3B1XA 2EQBA 2YVUA 4ARZB 2OLJA 3A4NA 4JMPA 4B44A 1WB9A 4V03A 1ODFA 3OESA 5E95A 1OH7A 1QRAA 4I1UA 3SDZA 4HDOB 3BRWD 2GJAA 4CZ2A 3GLFB 3CLVA 4NYJR 1AS0A 4TT3D 3A1UA 1EWQA 3SS8A 5JEDA 3MFYA 4GZLA 2PCLA 3QXHA 3ZIAD 5IF9A 2XX3A 1S1CA 2FGJA 1ZU5A 4Q4HA 1CR1A 2EW1A 4YC7A 3DKPA 1GRQA 1SVSA 1MV5A 1KSJA 4DCSA 2FDCA 1GNRA 2JDID 2QAGC 3SBDA 2ZU0C 3K9NA 4GFDA 3PEYA 2IYUA 2OCYC 4B6EA 3GFOA 4PZYA 4RZXA 2ZRAA 1N6RA 3JVUA 4N0EA 2VH5R 3K1JA 1YR6A 3IBYA 1UPTA 3LBIA 4YMVA 2CNWA 3AQ4A 1GNQA 2WBLC 2ZU6A 3PITA 2YV5A 2BEKA 1XD2B 5TB5A 3SNHA 3PJRA 1IN5A 1R2QA 3LA6A 5H70A 4EQ6B 1XTJA 1LB1B 3EARA 2JLUA 2EFEB 1OE0A 1ETUA 1VTKA 1Z6YA 1WCV1 2RGNC 3QF4A 4NH0A 5JECA 3O8RA 5LD2C 5JS7A 1G7SA 3C41J 4LBWA 4M21A 4XIGS 4MRPA 5CIQA 1KDTA 1P2VA 4M9ZA 4ZDIA 1SXJC 2FA9A 1UM8A 3QF4B 4HLUC 3VAAA 3Q3JB 2QQEA 3RRNA 4JLVA 3ZQ6A 4BZQA 3OIUA 5A0FA 5JJIA 1PUIA 1GTVA 3JZAA 3QUSA 3SYKA 1K5GA 5HKKD 1XTIA 5K8UA 2F1IA 3W34A 2BHRA 2NO6A 4C30A 4BUJA 1Z0DA 5J47A 621PA 2GESA 2IUSA 1SVOA 4PAQA 5SZIA 1S3GA 4F4IA 4TL7A 2XTNA 3U3KA 3FPAA 3DM9B 5FPHA 3ZZUA 2WWYA 2IC5A 3BFKA 5K8LA 3RC8A 1E1RA 2C9CA 2R6CA 3IIJA 4R2HA 1IXRC 5KPJA 4DCVA 4TLAA 1ELOA 2Q0HA 4A4DA 4GDFA 2TMKA 4MRRA 1ZUIA 4EJSC 3RNLA 4QHYA 3UKDA 1SKQA 5FPSA 1DO2A 1W0KD 4C0QC 1KAOA 4D6PA 2F3TA 4CGZA 1OKKA 3GLFA 5JJKA 3GLIA 3P4YA 1E0JA 3LXRA 1OXTA 3BIFA 4POAA 2CE2X 4A0RA 1X1RA 3GLGE 1AGRA 1KDOA 2ZRDA 3CH5A 3CB4A 3U44B 3FVQA 2OFXA 4EUNA 5IRCD 4YDSA 2GZHA 1G8GA 1NP6A 1XCGB 2OCAA 2VEDA 1RRPA 3SJBA 4PC3A 5IK2D 3EXAA 4IOKA 4KJZA 2CLSA 4NYIQ 3JZMA 5L3SB 3EG5A 3NEJA 1GP2A 3QEJA 2X1VA 3B9QA 4XTRA 2BV3A 2B6HA 5HR5A 3IQWA 3QBVA 4LBVA 1O87A 3CONA 3H0KA 5EUMA 4CRWB 1HT1E 1SGWA 3EZ2A 2AK2A 2QT1A 3UMSA 4RJLA 4HB3A 3CRW1 1A4RA 4PHTA 3OIWA 4C4PA 3R7WA 3U7GA 5EJEA 2JJ1A 3U5ZB 2NZ8A 3F0TA 2GHIA 1KZ7B 1NL3A 2HEIA 2E9SA 2WMOB 2Z83A 1HEIA 1PLLA 5C18A 3AB3A 3ZD7A 2IS2A 1UKVY 1T8TA 5BYJA 4OBEA 2GBLC 3I62A 4LZZA 4B3CA 4QGAA 3CF6R 1XBTA 3PCRB 5LDDC 4YMTA 3OAAA 3CX7A 4KXFB 4DSOA 2QY9A 5JEEA 4AD8A 2ZI9A 3I1FA 1E2PA 2PH1A 1XJQA 1T5LA 4A9AA 1E96A 4NYMQ 2J7PA 1R8SA 1II9A 5CJ2A 4CT4B 1Y63A 3OFNA 1KSGA 5FUYA 2RGAA 2HV8A 3MSXA 1OV4A 3OEHD 5CM9C 1ZIPA 2IA5A 3AP1A 3F8TA 521PA 2IUUA 1GITA 1L4YA 2R6GA 2GTPA 3RLFA 3VR6A 4LHYA 2VBCA 2J59A 2I1QA 3GJ7A 2BMJA 3AF3A 1NKSA 5A4JA 5FOWA 1TPZA 4IDHA 1DAHA 1W2GA 1Z6GA 2ZR9A 3ND8A 2CK3D 4WAUA 5JLJA 1E94E 1EG7A 1ZC3A 2WSSA 4LRWA 3ZD6A 5J4YA 2CHGA 2FPMA 3AKCA 1BH2A 2EFDB 2GEUA 3DM5A 4OJQA 3VFDA 3NDBB 1XB2A 1G20E 1Z06A 1ZCAA 3WBJA 1VMAA 1U8YA 1TQ6A 2GNOA 1GAJA 2W6IA 1CR2A 3KQUA 3RYTC 5F3WB 1P2UA 1EFRD 5FR2A 4XOIA 1J99A 4FMCB 4CEHB 3U4QA 3NVAA 2CJWA 2JJ2A 2XGJA 1NKTA 1Z6AA 2JLRA 2ZI5A 2AKYA 4TMXA 4PFSA 3W3ZB 3VTKA 3NIBA 2CXXA 4RD3A 3KB1A 4JJZA 1XP8A 1FFHA 4DKXA 1G5RA 4LGMA 3W5JA 1P3JA 3ADBA 1GKUB 1CS4C 2JLWA 3UATA 2QU8A 3X1XA 2CEAA 3HU1A 2ZITA 1T3HA 4D0LB 1SVLA 1T4GA 3PQCA 1T0JB 3RAPR 1JR6A 2DHRA 1S3SA 3L8YA 3GPLA 4MGYR 4PHGA 2HT1A 1DAKA 2QMUA 5FTNA 1QF9A 2BJWA 1EFHA 4XTCS 1JR3E 2R8RA 3A4LA 3SFZA 1OXVA 3EZFA 2NO1A 4NDZA 2GXSA 4V02A 2JATA 4GMXA 3TSWA 1VCMA 3H1TA 4MRNA 3AVPA 2ZIAA 1ESMA 2Q3HA 1AS2A 1ZM2A 3RANA 2IYVA 4IOLA 4TTRA 4LYJA 2V6JA 1XMJA 3AVUA 2C96A 1XEWX 1S4QA 4JT4A 4DLZA 4IDNA 3DMDA 3WRYC 3D8BA 1N6LA 3CF2A 5DYIA 2O8FB 1Z83A 4LV5B 5FPTA 3OIVA 2AD1A 1ESNA 1G64A 1E2HA 2J45A 3GFTA 2CDNA 5DGXA 4A0GA 2QORA 4IRUB 2XTMA 3WNDA 4UNRA 2ZSEA 2P6NA 2F1JA 1IOZA 5DN6A 2VTKA 2VHUA 2Z5FA 4MKIA 4QM7A 1JNYA 4XVQA 5J4LA 2IS6A 2PMKA 2IWRA 2GBLA 4WZAE 4RCYA 5FH9A 4QHSA 2YOFA 2P67A 4MGZR 2YWEA 3RC3A 1N6KA 5JBQA 1GSIA 4KCGA 5JRJA 4RD2A 1PV4A 1S9HA 5FOUA 2C98A 4BZPA 2EYQA 3K53A 1S9DA 4ESVA 3IPXA 1JAHA 4EAQA 2AN9A 5JWRA 2AXNA 2FEMA 3CZQA 1WMSA 5LBIA 3S1AB 2DFNA 2XZLA 2JLQA 3TAHA 3GJXC 4G1UC 1Z29A 1E9FA 4LHVA 1ZNYA 3OEED 4PAOA 2BOVA 3Q8XB 4QOSA 1N3BA 1E4VA 4RD0A 5HCNA 1QBKC 3MRSA 4LSGA 1H8ED 4B32A 2MSDB 4X8MA 3QVUA 4QBIA 3W90A 3B1VA 3IBGA 1IXZA 3U3RA 4NHOA 4M1WA 2ODBA 1E1QA 1XD9A 3OF5A 4OJKA 1KK0A 1AKEA 3B9PA 3SBEA 2ZUDA 3CX6A 4V0LA 3AVYA 2BBSA 1GNPA 3A8TA 2IK8A 2DYKA 4B33A 2H7VA 4K46A 3SYNA 1XPOA 1S0UA 3KJGA 2ORIA 3K09C 4FW9A 1W5SA 4RD6A 1A5TA 1FQJA 3CKLA 3AVVA 4W9MC 1V5WA 4KSBA 3U7FB 4X8LA 1KI8A 2XJ9A 2QAGB 2VRWA 4NMMA 1D6JA 1IN8A 1FNNA 2RGDA 1TADA 3G5UA 4K81B 3IHLA 3QXSA 4AKEA 3K70B 1XRJA 2OLKA 2WKQA 3B82A 3KXIA 1N2CE 1U81A 2O5VA 5CITA 2XOKD 4A0FA 1E99A 1N25A 4W5HA 4EPYA 4LYFA 2C95A 4C0BA 2ANBA 3UMFA 1OXXK 3EIHA 1KMHA 5CK4A 1L7VC 1J8MF 1YRBA 1JR3D 3NH6A 4AC9A 4X8OA 4F91B 4FCTA 2WJHA 3MJHA 3ND9A 1PVOA 3KFXA 3B13B 3LBNA 4JBWA 1NMXA 2KWIA 1CJTC 2QT0A 3PVSA 4HDQB 1II8B 2GEVA 4R9UC 4JSYA 3D7MA 2JLVA 4D2IA 1FMLA 2F9MA 1SKYE 5JSZA 2FFBA 4M1TA 1G3IA 3LQRA 1Z08A 4A6PA 2ZRCA 3KFVA 1SHKA 4JVLA 1J7KA 2QM7A 1X8KA 3GLHE 4A82A 1P61B 1DE0A 4UNQA 1M7GA 1XXHE 2HLDA 1ZUHA 1AN0A 3GJ8A 3I5XA 5EE0A 5EXSA 4A8JC 2P5TB 1GOTA 1U0LA 1PUJA 2H92A 1JEDA 2IYTA 4EKDA 1IY2A 3I72A 3QXCA 3SHFA 4NPHA 2GK7A 2OUKA 3DEFA 5DIFA 2XZOA 2ZVPX 2HT6A 1XFAA 1Z0JA 3QKSB 2QSYA 3WBKA 1R0YA 1F2UA 2O0JA 2HLDD 4BLOA 1P72A 5KTYA 3ZVNA 2F6RA 3BE4A 3SQWA 4OK6A 1COWD 4R7ZA 4HLQB 4M2LA 1E79A 3UMRA 1VCOA 3EWAA 4Q4HB 1XDBA 5EUQB 3AUXA 4JVMA 3SJAA 4TL9A 2ODEA 3IGFA 1IQPA 2J0UB 1TF5A 3P27A 2QE7A 1I2DA 3KB2A 3T15A 1KTVA 4KYIB 2FG5A 1ZM9A 4A8JB 1FTNA 1UDWA 3KL4A 1U90A 3QF7A 3I3SR 3HDTA 4OQMA 1IXSB 1VG9B 4TYQA 3RS4A 4NU0A 3TGPA 4ZIRA 1MT0A 4N3NA 4MYCA 4UXIA 2PZEA 1F48A 1NVXQ 4V0ME 3BORA 1G21E 3NH9A 1HT2E 1GIAA 3WYAA 2NO0A 4LV6A 1E3MA 1N0UA 2WPDD 2I1VB 4RFVA 2I3BA 4QFMA 1EX6A 5CDFE 4FWIB 1E9DA 4IEEA 4K8OA 3LD9A 3SN6A 5GJVC 4XVUA 1X3SA 5M04A 4IOJA 4FCVA 2KB0A 5B64A 2VSXA 4HB2A 4JL6A 4OHXA 3X1WA 5BN5A 2OT3B 2YYZA 1XNJA 2QM8A 4KI0A 5DE3A 1NLFA 3B2EA 1G3RA 2JIZD 5FOVA 3U3JA 2BCJQ 3BH0A 1VYVA 2GXAA 3QKUA 4B48A 2A3RA 1R6BX 2JAQA 1JQJC 2DFTA 4JYCA 2NTYC 3B7GA 3FHOA 4I4LA 3QNUA 2YINC 4FMBB 5B58C 2ANCA 2E87A 2IBMA 2OZEA 1ZNWA 5FL3A 3WNCA 1T6NA 3G0HA 2GJ9A 1WRBA 4MGKR 5EZ6B 2ZUBA 5FR1A 3O8CA 5C2JB 2V1UA 1NMZA 2B8WA 3DOFA 4YQFA 1HH4A 1Q1EA 3TVDA 3AVQA 3PEVA 4MQBA 5DSZA 2RAPA 1E2FA 3QSYA 4D25A 1LW7A 5CB6A 4AYXA 3R8FA 1ZYUA 4RD1A 3FGNA 3TNFA 4P4UA 1KI4A 5KNCA 1KOFA 5AJVB 3AV0B 4D4JA 4TMWA 1S2MA 2G0NA 2W2TA 4DHEA 4XH9B 4WZBE 2VSOA 3T12A 2D4HA 2XSZA 3IKJA 1KKMA 4LK2A 4XJXA 3THXB 1NJFA 1F6BA 3AP3A 5TVKA 4ZI2A 4LY6A 2P3SA 1DELA 5FBWB 1IY1A 4Q9IA 2FSHA 2F7SA 1W47A 6Q21A 1KKLA 1TX4B 4QL3A 2WPDA 5HE9A 2R9VA 3FYHA 1E2LA 1IONA 2ODWA 1J2JA 1F3OA 3NBZC 4D81A 1W36D 4PO1A 3X1YA 1IY0A 3BBPA 3HPQA 1TF2A 4RZ2A 1ONBA 1JPJA 3A36A 4Q1EA 3A1SA 4ZKDA 1E9EA 5AJZA 4DSUA 5KSYA 3DO6A 2KJQA 3TW8B 3EA0A 1XZQA 2J0SA 2O8CB 4QGGA 1D9XA 2ZYTX 3ASZA 5IK2A 2XSZD 4DEYA 2WJVA 1AA3A 4OI0A 1E2NA 1UKEA 3H4MA 3H2YA 1NN3A 3ZLJA 1MRNA 1KJWA 1XF9A 5B2ZA 1COWA 2VP4A 2GRJA 1UBFA 1XMVA 2WICA 3CNNA 3GLHB 4PZLA 1KK2A 1XXHB 4LJ6A 1N6HA 2O8EA 1F60A 1QHGA 1K5DA 2QUZA 4L8GA 1LY1A 3TJZA 2BIFA 4TQUS 2J0QA 5DI9A 1NY6A 4KFTA 1W48A 1Z0FA 3SJCA 5GADl 3C7KA 3A6PC 2F43A 4IEIA 4I81A 1W5TA 5EE5B 1TUEA 2ZROA 3Q7QA 1WDTA 4OQNA 5CLQA 5D3MA 1UEIA 4ARZA 1YQTA 3EZ7A 4URXR 5LPNA 3WMGA 1YVDA 4KO8A 2MMCA 2O0HA 2SHKA 3AF4A 2PZGA 2DWPA 3AKDA 2P0EA 2C9YA 4IHQA 4EFMA 1RKBA 5FUVA 4MYTA 3AUYA 1II0A 1JB1A 3AKEA 3DVLA 3K0AB 4O2RA 2ZE6A 1M6NA 4PO8A 3GJ6A 3EIEA 3VQTA 2OBMA 4B2LA 4S2EA 1UF9A 2HJGA 2IX3A 1E79D 2GF0A 1G16A 1JR3A 3CR8A 1QHSA 1YE8A 1RIFA 4TTQA 1U8AA 1XEXA 3QG1A 2EWWA 4IXNA 1OH6A 1SXJE 2CHQA 3AVOA 4BECA 5KSPA 2PT5A 1BKDR 3NDPA 1N5KA 4M1SA 3HWSA 4UQOA 2DR3A 1ZD8A 1CRQA 1E2KA 4O0MA 1KI1A 3N5CA 2ZAOA 4BRUA 1E2GA 1FPMA 4H9GA 2RHMA 4PPNA 2GVDC 3CPEA 4DSTA 1LF5A 2FF7A 1HTWA 4JLBA 3RS7A 5DO9A 3RSLA 4Q4AB 1GDDA 3IEVA 4YXWD 2BEJA 3M6AA 4Z54A 1W4CA 4R2IA 5KHOC 1G8YA 3E1SA 1NVVR 3UG6A 4OKSA 3U60B 5F9HA 1UKYA 5EQTA 3VR4A 2ZR7A 3NHBA 2N42A 5B30A 4LUCA 1H8HA 4JLKA 2GK6A 2CK3A 3TUJC 3ICEA 4TLBA 1AK2A 1OH5A 3EASA 2FFHA 1VCNA 1WBDA 2BBWA 4QXAA 3SQXA 5FOSA 5HPYB 2AWNA 2ERXA 1DTSA 3RS2A 2Z4SA 1NVWQ 1MOZA 3REFA 2BBOA 1G17A 3PUWA 2IXEA 1B0UA 2WMNB 4D4KA 3BH7A 3IILA 4B43A 2FPKA 4ASUD 4P4SA 4F7WA 2G9NA 5D3MB 5DH9A 2ZYWX 5KPDA 3T5GA 3QI2A 3NEYA 2O8DB 4M4SA 5FBLB 4IVQA 4XWAA 4M1MA 2QEQA 4LYAA 1GFIA 1KNXA 3W6PA 1QHHB 2JLXA 2IYYA 2ZRBA 4LBYA 2EYUA 1XXHA 721PA 2AFIE 2PT7A 1VIYA 4KODA 4M9SA 1NNEA 3VR3A 1E6CA 2GCPA 1N5IA 4PHHA 4DDWA 2YC4C 3FFBA 1U8ZA 1XD2A 2J41A 4LDJA 1HA3A 1I4DD 1G19A 1ZJ6A 4FIDA 4BLTA 3RRYA 1XZPA 2FGKA 3IIMA 2A5YB 5L3SA 3SR0A 3CRQA 1SVMA 2G1KA 4UXHA 4AKHA 3HP1A 3R9XA 2W58A 2X2FA 3EIQA 1E2IA 5AJWA 2QQ0A 2HCBA 3QJYA 4TL6A 2KBFA 5AJYA 1XU4A 3QENA 3W6OA 1KI6A 1T3LA 1EFUA 2KSQA 3QPVA 4QGHA 2K5UA 2LWIA 2ZJ8A 4DEXA 4DZZA 4BEBA 1HQCA 3C4JA 1DG3A 3CM0A 4O2LA 2J7PD 2XEXA 2BM0A 1XCPA 2ZSAA 4DRZA 3O8DA 3T1OA 1XWIA 1FX0B 1TAGA 2ZPTX 5KOYA 3FMFA 5JRZA 3K9GA 5AUNB 1OFTA 1S8FA 2IS1A 4V0KA 4C0LA 1Z6TA 4P32A 3T1TA 2VIIA 3LX5A 3B6EA 2ZSFA 5L3RA 2NPFA 3RRMA 3THXA 4B3GA 1NMYA 3AF0A 5HZKA 5SZJA 1R0XA 5HZHA 4FN5A 1AZTA 1U0JA 4HDCA 2WWWA 4GSYA 1Z2AA 4MUAA 4I1VA 2V8OA 3FE2A 1CLUA 3EA5A 3FTQA 4HAWA 1XPUA 1NVUQ 2GJ8A 3K0EA 1XPRA 2EU8A 2AL7A 4XD7D 1TTTA 4OL0A 1FX0A 2FPLA 4PQYA 1YKSA 2B7BA 2IT1A 2D3WA 2A9KA 1OB2A 1DADA 3MJRA 4JKYA 1YZGA 1L8QA 1RJ9B 3LDAA 5FI1B 1X8LA 4OHYA 3GEEA 2QENA 2ZJZA 4LJ9A 3P32A 2E1RA 1YZLA 1GILA 1FP6A 1ZINA 2ZTSA 1WBBA 2QRZA 3JVVA 4Q5IA 1OIXA 1UJ2A 2AX4A 4HUQB 4C2UA 3ZGXA 3LNCA 2AHOA 2UKDA 2UVQA 3CF0A 5IT5A 1KO8A 1L2TA 4ZIRB 3AVTA 2O8BB 3BOSA 4HATA 5L8VA 4YDHB 4IKEA 3L43A 3V00A 2Z4RA 4D80A 3ZVMA 5JHHB 4HSEA 2XNDA 5FBQB 2OHFA 4GRAA 4CEIA 2FZLA 2LCFA 5EE1A 2QN6A 3ZQJA 2L0XA 2GF9A 4Q18A 4EJSB 3OHMA 2WSSD 1N6PA 2WAXA 2IYZA 1YU9A 4JSTA 4A2QA 1WP9A 2CL7X 3KTAB 3T06B 1VPLA 5EXTA 4F4JA 5FOTA 1W0KA 4FMDB 5CM8B 4TQ9A 1KDPA 3FKSA 2QL6A 1QHYA 4PQFA 1LS1A 3OEHA 1CEEA 4ERNA 2QTVB 1VYUA 5FPYA 3TQFA 3VHLB 1JBKA 3V4RA 4UNSA 1E2MA 2KE5A 1TNDA 1CJUC 3IUYA 4TLDA 3WRXC 4PAMA 3IO3A 3WYFA 4GP6A 1Z0AA 4BE7B 5KNBA 2IUTA 1FZQA 1SXJA 2AKAB 2WZQA 2OEPA 4YLGA 1IN7A 1Q21A 3I92A 4LJ8A 4CEJA 1YZTA 1GRRA 3LO5A 4I1OA 1VIAA 4MUBA 4RKEA 3UXMA 2D2EA 2LKDA 1IN6A 4LPKA 1A2KC 4DDVA 1X6VA 1KGDA 3EZ9A 1LF0A 1EFRA 5JZVA 2C99A 4ON9A 4UXJA 4HZUA 2ZYVX 3MAAC 4LJYA 2YOGA 2ZQ5A 3I73A 3RABA 2P65A 2O8DA 4LYHA 1ZCBA 3X1DA 3PEWA 2BMDA 2REBA 3IHWA 4Q4JA 1WXQA 3NBYC 5L3VA 2G88A 4H1VA 1P7CA 3R8CA 3K0FA 4L5BA 3M1IA 5EP4A 1S1MA 1ZW6A 1W49A 2P5SA 3LXXA 1NLYA 4LX0A 1Z8FA 1P2SA 1KHTA 4PR0A 2OCPA 2FN4A 2OAQ1 3TR5A 4BPBA 1HQYE 3LW7A 4GOJA 5SZKB 3MUFA 5DHAA 4Q66C 1ZC4A 1ZUNB 3OFND 3RSOA 4WXPA 4LI0A 1E9CA 3ADDA 2J46A 4Q7JB 2AK3A 3VR5A 2ZE7A 3GEIA 3NHAA 2ZSDA 5FL7A 3K0FB 1KSFX 2ZRLA 2NZJA 1KO1A 3I4LA 1PLKA 3QPWA 5FTJA 3OAAD 4C9BA 4AG5A 2H17A 3ICQB 2JCSA 1FOEB 2BC9A 1TF7A 2CCKA 5FOXA 2Q6TA 2X77A 3NWJA 4TT3A 2OAP1 4U7DA 3KJEA 1UBEA 1NN0A 4A2WA 3QIAA 3ONWA 4PC2A 4GI7A 4B6FA 4DC9A 3U2QA 4QBFA 3AVXA 5FUXA 1ZD9A 3R7WB 5KDLA 4G5GA 4BLRA 3CBQA 5DHFA 1LFDB 3T1QA 4EFNA 3SHWA 4PPGA 1JECA 1FTSA 3DOEA 1E69A 3I8SA 3K09A 2W0SA 3BK7A 5HCIA 4DT1A 5J4VA 2DWOA 1WE2A 1DPFA 1RRGA 2VP9A 3RDPA 1W0JD 1OW3B 2A5GA 5DLQC 3A58B 2H16A 2F3RA 4TSFA 2JLSA 2YHSA 2MSEB 1TUIA 1T9HA 1MO6A 1VYTA 3K9HA 4N1AA 5H1YA 5HKKA 1Z6XA 3DHWC 4GMDA 1Z0KA 4QHTA 2ODNA 1OLOA 3S1AA 3V4FA 4CW7A 2QBYA 2HYDA 1A2BA 5GVRA 4QG7A 3GCGA 4LHZA 3FKSD 4GT1A 4L9WA 1JEEA 2CVHA 1DAEA 1LNZA 4KBFA 3FHTA 3OE7A 4G5RA 4CEHA 5L3QB 4OI1A 2HUPA 4Q4LA 1KK1A 3QKSA 3HU2A 5SZHB 1KI7A 2ZANA 5P21A 1S96A 3PUXA 2G77B 1XMSA 3DZDA 3R9IA 2GZDA 3QKTA 1Q1ZA 5TMPA 1U98A 2XNDD 1CJVC 2V4ZA 4AG6A 4TMKA 5C1BA 5J4HA 2ZETA 3OIYA 1CULC 4LJ5A 1GUAA 1BMFD 3TLXA 421PA 2J5XA 2R2AA 2GILA 4PPQA 4G0NA 4L9SA 2H1LA 3TVTA 2IF0A 4ZDJA 1G3UA 2J1LA 4Q1DA 3K0CA 1RJ9A 4RZUA 4E09A 3CZPA 2QPTA 4TYPA 1FW6A 4Q00A 2VQSA 3LBHA 1RPZA 4MKHA 1XTRA 1CIPA 4JBYA 1RYFA 1XD8A 4NL4H 5HTKA 3FDIA 1AQUA 1OKKD 4WZ6A 3U6BA 2WHXA 2VP0A 5B57C 3U44A 2G83A 3SZRA 1OXSC 2RGCA 2QTHA 1TQ2A 1A82A 1Z47A 1R10A 1XEWY 3EC2A 4UJ5A 5KUTA 3KUCA 2ZJ5A 2H18A 4DLWA 2X2EA 1H65A 3K9LA 4Q7LA 2RGNA 3TK1A 1E1RD 4Q47A 1HY3A 4LJAA 1DARA 2F43B 3B85A 5KSOA 4DIEA 4TYYA 4Q1CA 2HF9A 2REXB 3CR7A 4BFUA 3N2EA 4G5QA 2Z0MA 3SYLA 3RHFA 4Z1MA 4Z8YA 1DS6A 3AGPA 4IW3B 2D06A 1QHNA 3AEZA 1P4SA 3CNOA 2CHVA 4NKRA 1CU1A 3RWMB 4DLYA 3LWNA 2MSCB 2PMDA 3MMPA 1YZKA 2BKEA 5E4FA 4J0QA 4OI2A 1UKZA 2B8TA 1QG4A 2HDNB 3UWKA 5J5CA 4PSVA 3B5JA 2YOHA 2ASEA 4TMTA 1W1WA 2J3EA 5BWMA 2ZE8A 2PLFA 2WJYA 1QHIA 1GG2A 4PX9A 3ZIAA 4O3MA 2D74A 2F1HA 2BMFA 2OXRA 1N5LA 4DXAA 4FMDF 2ONKA 3QXXA 4JLPA 3X2SA 1MKYA 4GOXA 4OK3A 1SHZA 5E7IA 2C5LA 1G3QA 2PX3A 1XEFA 4BFXA 2GJKA 1IAQA 4XSHA 2WJGA 4GNKA 4F4CA 5CK5A 3EPJA 1AJEA 2WJJA 2W2VA 5FTMA 4QKQA 4KVAA 2HJVA 4UJ3A 5UKDA 2ATVA 2FSGA 4A6XA 3EPHA 3VNUA 2QROA 1G4UR 2QTFA 4JBXA 1W36C 1PLJA 1UBGA 3L0OA 1CKEA 3IPYA 3GQBA 2QMOA 1KIMA 4HB4A 4O25A 3CNLA 2HCJB 4B3BA 5AK0A 1JQLB 2VL7A 1TU4A 1SVIA 2VHJA 1KJYA 2WKRA 2OV2A 4IFEA 1NN1A 4JL5A 4LC0A 2PZFA 3RVBA 4QGFA 4DT1B 4LV8B 2OESA 1K8RA 4PANA 2VSFA 3PG5A 2NMVA 5BXQC 2OFOA 4DB4A 3E2IA 3QQ5A 4C7OA 1KI9A 1IN4A 1Q12A 1DAIA 2ERYA 2PX0A 2ZI7A 2ZI6A 3QVVA 4JL8A 821PA 5FBVB 3WY9A 3G82C 5BN3A 1XTKA 3THYB 3KX2A 3HR7A 5JI2E 2J0UA 5G53C 4HZIA 4YXWA 4E03A 1WA5A 1Q57A 4MA4A 5FL7D 2IEZA 2VYFA 1R5OA 4E5UA 3P20A 2OE2A 1NIJA 3QPUA 2Q9AA 2XB2A 3ZDQA 5AJXA 1W36B 2ECKA 5CIWA 5EXPA 3SEAA 1NF3A 3LQQA 4V0OA 1US8A 2G6BA 2XTZA 2JEOA 1E0SA 2A5JA 2VF8A 1GL6A 1M2OB 1DEKA 1OYWA 3IEUA 4ZI3A 2YNMA 4NCNA 4EIWA 1NVVQ 1H8HD 4KAXA 4DCTA 4M9QA 3GLGA 3AP2A 3F3YA 3EZ6A 4LBZA 4QBGB 3GLIE 2BM1A 1X86B 3GLFE 4OYHA 2QBYB 2CL6X 3PUZA 2VHQA 2ZRGA 2C04A 3ZVLA 2R44A 2DWQA 1BYIA 3K8YA 4LHWA 3WMFA 4M9XA 2BBTA 4BGDA 3A37A 4KVGA 4PZZA 1BO6A 4EPTA 3R20A 4KU4A 4PC6A 3PR1A 4QM6A 1NI3A 3LVRE 3BFVA 1L4UA 3C15C 1P62B 3CRVA 3REGA 1SXJD 3H86A 2BVNA 2RGXA 2XZPA 2OCBA 4NTZA 2PCJA 4D0GA 3MD0A 1OFIA 1QVAA 5AUOB 2ZJBA 2A30A 4XD7A 5FI0B 3ZH9B 1R7RA 2RCNA 3LLUA 1TL7C 2QMEA 2WWHA 1UDXA 2VP5A 2F9LA 2F55A 2QE7D 5BYKA 1E2EA 3KKMA 4URZR 3MWKA 3TIFA 1J8YF 1OH8A 1W4AA 1V43A 3ASYA 5C4MA 2XAUA 3DMNA 3CX8A 4JLAA 4MDFA 1AS3A 2FJUA 3CRRA 3VNVA 1Z5ZA 3VKGA 2OBNA 1KAGA 4DLRA 3HU3A 1N0VC 1P9WA 3L0IB 5JHGB 4JVNA 3CH4B 2FZ4A 3KUDA 2FWRA 4W5WA 4EFLA 1YHNA 3KDSE 4BRWA 1C4OA 2A5DA 3TH5A 5LB2A 3L82B 3ZZ0A 3K70C 5GJBA 4NYIR 1GL7A 4II7A 1LVGA 1YZNA 2WWGA 4KV9A 4KFUA 5JS8A 4BLPA 3VR2A 2XNSA 1U0HC 5AUQA 1EGAA 3M4YA 3QBTA 4NBSA 1TQ4A 1OHHD 1Q20A 4TTPA 1US8B 5KU1A 3VX3A 1G8FA 4F92B 2PBRA 2WIBA 2ZRIA 5L3QA 2WTUA 1CJMA 1AA9A 2J0VA 4JT2A 4C0JA 1SQ5A 1DVRA 1PZNA 5F2EA 2EFHB 4F93B 2OM2A 1OIVA 4PXAA 4Q9HA 4Y0VA 4A15A 2OG2A 1U94A 1YR7A 3OZXA 2H57A 4ZCIA 3THWB 4JLJA 1MO4A 4P31A 4Q9KA 2GWHA 1RFLA 5HE8A 1XX6A 3T35A 2RH5A 4MKFA 4B76A 4RFSA 4C3ZA 1M1YE 1TMKA 4GPTA 5DI3B 2OFWA 4Q01A 1VHTA 3C5HA 1UADA 3ADKA 1OFUX 1E98A 3BS4A 3PUYA 1RC8A 1F2TB 2YWHA 2ZREA 1W7AA 1GKYA 4TSFD 3T5DA 2O52A 4IJMA 3KQLA 2YKGA 2P2LA 1XCMA 1W0JA 4MRVA 4IDQA 3QKRA 1CBUA 4QNMA 1FNMA 1IBRA 5E7MA 1MR3F 3VU9B 4JLMA 3RS5A 2NPIA 1Z63A 1Z3IX 2W2XA 4AY2A 4IOMA 1XTQA 2ZI3A 3R9WA 2WV9A 1G8PA 2VP6A 4ASUA 1SVWA 2A7QA 2JJ8A 2C77A 2RGEA 3B8HA 4Q7KA 3W6NA 1KO7A 2WAYA 4RFSB 4C0HA 4DUGA 4CEJB 1K6MA 4DLXA 2B7CA 2IHBA 3NC0C 4M53A 4EQ6A 4L16A 5IDVA 2IEYA 1R4AA 3BGWA 1TQDA 1ZMXA 2XXAA 5KYKA 4FWTA 2WWXA 4Q9JA 2P6UA 3CWQA 1KSHA 5E7JA 1P6XA 2YWFA 2RHDA 2H8KA 3B60A 2FH5B 1P2TA 2OBLA 4RKFA 5TDHA 1KYIA 4DSNA 3VX4A 3WNBA 4YMSA 5TY0A 2D2FA 3ADCA 3GJ0A 3KXLA 4FD2A 4XVRA 5C46F 3NXSA 4PC1A 3FKQA 4AKGA 4C0AC 1HURA 5F9FA 3BD9A 4DVGA 2VHCA 4Q1AA 3UK6A 8OHMA 3DPUA 1KZGB 4P0TA 1D2NA 2EWVA 4JKIA 1P5ZB 2X19A 3SFVA 4HEJA 4BZXA 4JZKA 2PJRA 3HPRA 3RS3A 2IYRA 4QNRA 1M7BA 2Q3MA 2REOA 2QG6A 4Z51A 1CR0A 2GCOB 2O8CA 2DFLA 1KMQA 2WWIA 2W00A 3BB1A 2OXCA 4WW0A 3A1TA 3GJ5A 4Q02A 3KKOA 4BFTA 3L8ZA 4L4UA 1HE8B 4RY2A 3TW4A 1MO3A 3Q72A 5JI3E 1HE1C 2ZE5A 1OPXA 2IYWA 1Q3TA 4KFRA 2EVWX 2C03A 1GRNA 1LS6A 5EE3A 1M74A 2R62A 2QI9C 1E9SA 2Y8EA 1G7TA 1NSTA 4HLCA 3GLGB 1F2TA 3ECCA 4FXPA 3I8XA 4B75A 3UPUA 4ZCMA 4RVCA 3FHCB 4OHWA 2QSZA 1Q22A 3EWSA 5FBRB 2IYSA 2GEDA 3FB4A 1NJGA 2ZXUA 2ZJYA 5ELXA 4US1R 1Y3AA 2ZRMA 1YZUA 2HXYA 2AWOA 2ZUCA 2GXUA 3RS0A 2IYQA 3LX8A 1RW4A 2KI5A 1A7JA 3THWA 3BERA 4N0DA 1Q44A 4A92A 3TSOA 1KY2A 2FOLA 2Q9CA 4MRSA 3W3AA 1Q1QA 3A4MA 1VG1A 4C0KA 4WVFA 2C78A 3SI7A 2ZM5A 4Q7MB 1VCIA 3KJIA 1NIPA 4HAXA 4BLQA 1VECA 4LOAA 2JASA 2WM9B 3IQXA 1YR8A 3PFIA 1AKYA 4MYUA 2CE7A 1DBSA 5G41A 1GL9B 1M7HA 3AKYA 1JPNA 3SE0A 1JXMA 3BFXA 3U3OA 2IWHA 1XTSA 4B73A 1QHHA 1CRPA 2A78A 3LW8A 1Q0UA 1JI0A 4M0LA 3BJIC 3U3MA 2FNAA 2GJSA 4WBSA 1E32A 2Q21A 4UKDA 4XWOA 4HLUA 1ZM3A 2V55B 2ZRPA 2ATXA 2YWGA 3W8NA 3GLIB 4NONA 4LPSA 4NP6A 5JSZB 2FU5C 2MMGA 1QVRA 3NTUA 1SXJB 4KLZA 1RZ3A 3D6TB 1R5NA 1AZSC 1X8JA 1A1VA 4P4SB 2OO7A 5JJLA 2GCOA 2O8BA 2QGNA 2V6IA 3TE6A 5FTLA 2B92A 2LKCA 4DCUA 2AR7A 1U2RA 2F1RA 1FL9A 3PV0A 3QG5A 3HR8A 1D9ZA 1OT3A 1AM4D 1G6OA 2QNRA 3FMPB 2V7QD 5CYOA 2WOJA 4MITA 2WOOA 1E9AA 4JLNA 5J40A 1RRFA 3VU9A 3W5IA 2BCGY 2ZAMA 5DYGA 4G5SA 2I4IA 1P60A 1KNQA 2WWFA 4OQFA 2CJWB 4XWKA 1CJKC 4ZPXA 2JLYA 2X8AA 3AH8A 4HZUB 2ZVQX 4Q4AA 4BWYA 3U61B 4E22A 1ZU4A 2NO7A 2RKOA 4H1UA 5TV2A 3MLEA 4ACBA 1I4TD 4IDOA 3IIKA 1KO5A 2GA8A 4B34A 3Q85A 4DLSA 4QJ4A 3M0EA 1NBMA 3GP8A 2BWJA 3QEOA 5GJWC 3KKQA 2O8EB 4D82A 2EFGA 3NBXX 4ZO4A 3AF2A 5EE9A 1C9KA 1J70A 3EX7C 5JFGA 4DBLC 1KO4A 1VDZA 4DUGD 2CLDX 2V54A 2PEZA 4JLOA 221PA 5TXGA 4B71A 4D0NA 5D3QA 1MRSA 1WF3A 1E0KA 4B74A 3WYGA 5G40A 4KBGA 2FX3A 2FV8A 4HUQA 1JXOA 1KJZA 2J87A 3QE0A 2JIZA 2QP9X 2XJ4A 1VG8A 5JWOA 1W4RA 1E1QD 5DI3A 1OSNA 4HAVA 3FOZA 1D2EA 5KNDA 4PC7A 1WQ1R 1QG2A 1KY3A 1AIPA 2IW3A 1G5PA 1I2MA 1Z28A 3GMTA 4C0SA 3HJNA 2CCJA 4ZV4A 2HF8A 4NCJA 1NG9A 5H8WA 1OXUA 5G3ZA 4PSAA 1F5NA 3SU8A 1H8EA 4EPRA 1UAAA 1Z07A 2FSFA 4C2TA 4RD4A 2QRNA 4EJSA 2ZR0A 4AYTA 2V7QA 1VHLA 2AFHE 4PO9A 3KKPA 2PLRA 4HI0E 3WMEA 1VKJA 1FUUA 1KI2A 4URVR 4URUR 4ABYA 4ESHA 1E2JA 1E9RA 4BFWA 4QC2A 1MABA 2GETA 4IVRA 3I61A 2IF2A 2IYLD 1RE0A 2XOKA 4AYWA 4ITRC 4ZCLA 3B78A 4QRHA 4KHZA 4IFBA 4LJ4A
chains in the Genus database with same CATH superfamily
4WX2B 3ZTWA 4QOIA 1RKVA 5IU6A 5DLYA 3GAZA 2PGXA 1ODLA 3GNQA 5A6SB 3CY6A 1Y6GA 5AOVA 4PW0A 3WJ1A 2DQ4A 4GMKA 1BIFA 1E0DA 2AFIB 3IT0A 3T9FA 4V0NA 2ZSBA 3FF4A 1E0AA 1QANA 2OLEA 1DT5A 4DJDC 1CTQA 4U2BA 2GHTA 2FN9A 2RHJA 4GSKA 1GZSA 1NBWB 2GCNA 4BO0A 4LZWA 3UAGA 2AV6A 3O9VA 1KZYC 2EXXA 1UEJA 3NEPX 4FCWA 1JJ7A 4FK8A 4L74A 1M34B 1OMOA 3DLBA 1G7RA 4G0XA 2QTLA 5KSZA 1OQAA 1CDZA 4UCFA 4DIDA 1USIA 4U9HS 5IEJA 3CLSC 1DC3A 4DNQA 3TLYA 1X1SA 1ZR4A 1TA4A 2VPTA 1UANA 2PRJA 3GH3A 4MTCA 1B74A 4FFLA 4QNNA 5BV8A 3MGCA 3IVMA 4US0R 2CBZA 5TARA 2Y2UA 2OFPA 121PA 1KF0A 3KKLA 3I9FA 3F3MA 4TMVA 1L7RA 1OBOA 3F6SA 5FUBA 4AF8A 4F6RA 2JCYA 2I0FA 3BH6A 1ACMA 4MZDA 4NCHA 4R7TA 4YO7A 2G7ZA 4EGQA 1V7CA 1H4VB 1ODCA 4GPZA 4IIVA 3OZUA 5DISB 3R7DA 5DWDA 3TUZC 3IX7A 4WA7A 4DA8A 3K0CC 1O95A 3WP0A 1JDJA 2DUUA 1JT9A 3R0VA 1OA0A 3GJQA 4FILA 5AWFC 5A2GA 1MAUA 5BSVA 3DT8A 2DUJA 3ICWA 3VKWA 4UUNA 4KXUA 3S28A 1T3SA 2BEUB 4OK5A 1DTEA 3NBFA 1A9QA 1T2CA 2AN4A 4AZVA 3ZZTA 1IJFA 3TRFA 4CIDA 4FMCF 4CL2A 1TYEB 3L7BA 2TRSB 3AM1A 5BORA 4OGKA 1K86A 2IS4A 3KVRA 4IBOA 1OXMA 4C0XA 5C7IO 1F0KA 1HYEA 5DDIP 2ZBDA 5DX0A 3FI9A 5LUBA 1XPJA 4S35A 3GP3A 13PKA 4I50B 3BAFA 1I4WA 1MB4A 3JQ7A 1L9XA 5LN1A 3GDGA 3U7EB 4RNDB 1C4XA 3ETLA 1BHQ1 3DFKA 4DM3A 1VM6A 3Q2IA 4GMHA 3FF1A 4KOEC 2BKUA 3UWOA 1P7YA 4KTVE 4F9EA 3DQQA 4YQZA 1G9TA 5BUQA 2ZBQA 2WIAA 2BJVA 4HMQA 3RRZA 1DHRA 4AI6A 4DJJA 2C7RA 3ZS8A 2ZGVA 1F12A 1QCCA 4HAUA 4BNIA 1O5OA 2XAAA 1IEWA 5EKDA 3UPDA 2C8VA 1D2MA 4PPYA 4A36A 2EFCB 1NN5A 3CVVA 3DTVA 4E2FA 1QG6A 3KPVA 1UFOA 2Y27A 2O2YA 2XE6A 2WT9A 3CO5A 1UBNA 1A88A 3L0PA 3LVQE 5IXYA 3AVWA 1NC3A 1WSAA 1WLYA 1D07A 3F96A 3FVTA 3N2IA 4RZ3A 5IAKA 4EHJA 3IUBA 5A1JA 2V59A 1Z74A 2R6AA 1XU9A 3PYXA 3OZCA 5T3UA 3EFOA 1L1FA 1L4BA 3L6DA 3TNJA 4A2PA 4E94A 1VSTA 2XUHA 4EYGA 3T5TA 1IJKA 3DAGA 3UAXA 1SHJA 2VP2A 4ILEA 4LEIA 5KEIA 3D7KA 1QK3A 1O0SA 1RS0A 3MQ2A 5H9VA 2JFOA 2Q6IA 2ZTLA 1LWNA 3HY6A 1U8UA 3N8NA 2C5SA 4WUTA 3HCWA 5IFKA 1SZDA 2GJ4A 3D8NA 3VR6H 4J6FA 1L5RA 1ORDA 2EGGA 4QICA 3ZS9A 2O8VA 4BFVA 4C4SA 2J3JA 4LF7B 2VHZA 3IUEA 4CYMA 3LOPA 1VB3A 4UNPA 4J16A 3EEQA 1WQ3A 1BSVA 2OV4A 4KPGA 3IDOA 1P9RA 2D7DA 2WIFA 3MQFA 1O5TA 3PEFA 3RTCA 2IXGA 2RH8A 1NSFA 3D0RA 1X7YA 1Z17A 2P9FA 1JKMA 1RE1A 1CP2A 1YDFA 4PQEA 4RAOA 3HN2A 2XMDA 3IP6A 4EYEA 5H16A 4ZEOA 2E21A 4UD6A 2VO1A 1M0TA 1RBMA 2OM6A 3CPHA 1Q0ZA 5DK4A 3H5LA 2SKCA 1EVIA 1H1LB 4QJ3A 3L1IA 1NVEA 3NTLA 1GQFA 1I4LD 1RHJA 3KEFA 1U0SY 2GZRA 4AMYA 4OD0A 5AP9A 2C3OA 1JEQB 1IZ0A 4Y2RA 2J9FB 2X2OA 1REQB 3MRXA 4HAYA 4GKVA 4QA9A 4XUGB 4COKA 3VPAA 4Z9FA 1IPFA 1F38A 2DPXA 4BNHA 5GVSA 3Q87B 4MEBA 3F2IA 2PKQO 3INRA 3NTOA 4QAJA 1JW9B 1J5PA 4G3XA 3C3DA 4XA8A 4ZAWA 4JI1B 4B4VA 4E5SA 3SC3A 2WHEA 3GNSA 2R5FA 1KQ3A 1PZFA 4EPXA 4OXQA 3BQ9A 3U4AA 4PCUA 2BR4A 2HIGA 1T1RA 4MW6A 3EODA 3U7HB 3LLMA 1Y5LA 3E1KA 2IV3A 3TBHA 1NG1A 4DR3B 2IRWA 3BK2A 5J2TB 3IUQA 1PBTA 1XVAA 1A8SA 1E7RA 2NU7A 2RMKA 3H3JA 4QPCA 3INNA 3TBKA 4JYBA 3O8BA 4IXTA 4L2IA 4C0WA 4R71A 3COPA 1ML3A 2NZYA 4ICIA 4HVTA 4M8NE 1WB5A 2R1TA 2R4QA 1GA1A 1O3YA 4WXRA 3PXAA 2ENWA 3HYRA 1OYYA 1C9EA 1NY5A 4DLVA 4QG3A 3B48A 4RTJA 3WL3A 4C5BA 2BRUC 1QHFA 1J8VA 2GEKA 1U2QA 4UTVA 3FROA 2HA0A 4J76A 1ZI8A 4R1OA 4YBRA 2PGNA 1GQ2A 4K87A 4XJSA 1YOBA 4BX0A 1AX9A 3U37A 4YMUA 4BXOA 4PSKA 1Y4UA 2D7CA 2W6ZA 2QD4A 1NHGA 2JZOA 3PGXA 1TM3E 3PQFA 1UOPA 5FFMA 1DEOA 1ZNQO 1XTTA 3K15A 1FFDA 4UVGA 2HWYA 1ENPA 3JQ6A 4FEEA 5D87A 3ZBUA 5E3JA 3D4PA 2P90A 3K2EA 1II8A 3FPBA 1FLAA 3G68A 1E1MA 1CFJA 1KL7A 4B3DA 1PDOA 4M1ZA 2H1VA 4HEA1 3GPDG 5M29A 4PZAA 1DIBA 3ONVA 2COEA 4FI3F 4JB8A 2R1ZA 5ESRA 4ZXFA 1FDWA 1H9AA 4RS4A 5F5NA 1EA7A 3MG9A 4IP0A 3FMOB 3ME5A 3CIOA 4P6VF 1N5DA 5EVJA 1KI6B 2O59A 2BISA 4P3YA 4PZPA 4UNNA 3UANA 3G7NA 2QF7A 1ZITA 3EW9A 3C5CA 3QYPA 5BSGA 3LK6A 5BW8A 4FOPA 4WTOA 1FTQA 1DZIA 2XGSA 4TMZA 1JHDA 3P9XA 2F3UA 5JCZA 2AZTA 4OTZA 1W9HA 4F85A 4JENA 5JCPA 4MV9A 2I8AA 1OAOC 3CPJB 1JR2A 1KPHA 1RMQA 1U9ZA 2PJDA 2R7AA 4ZT7A 3B3GA 4BMVA 4EJ2A 1JH9A 3U4MA 2CFIA 3DV9A 1YJ5A 4MPRA 2W2NA 3VC1A 4LDAA 3VYUB 4KLRA 3N2NA 2JHFA 2GN8A 2FEXA 1FS5A 1L8AA 1TU3A 2P6RA 4RLHA 1F8UA 1AKTA 4OIFA 3HBMA 2ZJ7A 4J1NA 4UATA 3TQRA 1X7HA 1N0WA 3T0GA 1VE1A 2GN1A 2C84A 3H5RA 3OCCA 2CNWD 3PEUA 4RVHA 3DQZA 5CYPA 4AURA 4H1WA 4M8SA 3Q5EA 2DY1A 2ZB2A 2MCFA 4BQFA 3FPKA 2BD0A 4NBNA 1NKVA 3R3UA 1LPOA 3IH5A 2K4MA 4WDQA 5JWHA 3WK4A 1TPYA 2FEOA 2HYIC 4DLTA 2YH2A 2PPLA 1FQKA 1Z2EA 2GKSA 3LUHA 3DVAB 1Q7GA 3DFFA 3KYCA 2JRLA 3GJ4A 3RASA 4GOKA 3A2LA 2OUIA 4PINA 4PSDA 4Q6BA 1BS1A 5IKEA 3O3NB 5I9NA 2C2HA 4EELA 1E7QA 4BFYA 2OYCA 3I2HA 1XHEA 1FXWA 3PPWA 2R65A 3TEJA 4YPVA 2NXJA 5CXQA 1ABEA 3DXXA 1ZNXA 3KOOA 4FSXA 1QS0A 2H9AA 2PWPA 2NUAB 3KK0A 2R2GA 4KN5A 1VIMA 1SG9A 4QDZA 3AIIA 2H52A 1T9GR 4MKGA 3QKWA 2FZGA 3QPDA 1XZNA 5JMTA 1F4VA 3CW9A 1L1EA 4FFOA 3MTQA 4LDQA 1KK3A 2C0CA 2FQYA 4JXZA 1FEZA 4M1OA 1X1DA 3I05A 4RPKA 4Q05A 4X8HA 2CF6A 4J4TA 4AXBA 3RSGA 3GARA 2JGIA 3AERB 3C16C 4LSZA 4XCQA 4V0MA 3Q0IA 2PJZA 3GBVA 3L2OB 3M5CA 3ABQB 3PENA 1O96B 1SZPA 3WGIA 4M22A 1W9MA 3VPCA 1JA9A 4OXYA 4W7IA 4ZJUA 2EJUA 3K1YA 4AWAA 1E3SA 4BB6A 1N8SA 5KAPA 4PTLA 4X1KB 1MRZA 3FPHA 4AAYA 3NX4A 3QVXA 2HIMA 3EXHC 3VHXA 5I4IA 2HH9A 1ORTA 1KQGA 4Q9LA 1H1TA 3DH0A 4RSGA 5DTJA 3C14C 1U4SA 4V3BA 1CB0A 1RLMA 1T1EA 5C3UA 1CUDA 3NKVA 3NWEA 4UDYX 3T5MA 1GPUA 4PVDA 5LP6F 4JDPA 1RQLA 2P2NA 3PHLA 3G2LA 2Q4RA 3ILVA 1A2QA 1YNOA 1A8QA 1QH8A 2EJWA 2OCDA 1WV0A 2IYOA 3BIOA 3GFPA 3HXKA 4KG7A 1D4OA 3HABA 4J0HA 3RR2A 1FVHA 3PL5A 2WTNA 1JKXA 4MLPA 1OFUA 3IKTA 1EMDA 1P5FA 1A9TA 2PAFA 5JPIA 3THYA 1ZP6A 1O94A 1AN9A 3ZBTA 2Z56A 4XYBA 4JI6B 4PGMA 4UU1A 3Q9LA 1UR5A 1KOLA 2ZRNA 3NOOA 3P9YA 1QCZA 4ARAA 3IEIA 1XMQB 1VMKA 3JRNA 1J22A 2B2XA 3BXFA 1R4NA 3G13A 2AUNA 1AXGA 1YKGA 2G7MC 2KLBA 1H2EA 4L8FA 1ATIA 4KBYA 4Q48A 4W5JA 5FUWA 5AJUA 4TLEA 1SPXA 1VPDA 3C7TA 4Z1MD 4KLNA 2I6QA 4CDGA 5EGNA 4XVCA 5EP3A 2FYTA 2QIPA 3HNRA 4IJQA 5IT9A 3M8KA 3ORFA 4H7FA 1UJMA 3U3ZA 4ZHQB 1A3CA 3KSBC 1GAEO 2OKGA 3AILA 2Q28A 3QVWA 2ZYHA 1HE5A 2UZIR 4RKYA 1I3OA 4Y67A 3VUFA 1KMHB 5C0OE 4BMXA 3EGIA 2JRBA 4EDHA 5CFPA 1KZ9A 1SCUB 5BNIA 4ZHQA 3A3YA 3E2PA 3K0SA 2RB4A 3H9EO 4O2AA 2PWZA 3ZDCA 2QP3A 2WM2A 4MARA 2Q3EA 2JNWA 2YVUA 4B6RA 2OLJA 2DUNA 4TWIA 3U4HA 3OESA 5E95A 4EBBA 2X9NA 4EG1A 5B37A 2I66A 5JDCC 4ZK6A 3M1LA 4ZYXA 3IE1A 2GJAA 1YB5A 4O4LB 4M8IA 3W1VA 4TT3D 1IHDA 1NSYA 2IOFA 4D56A 8ATCA 4E4RA 3MAJA 2ECFA 4QYWA 1NT2A 3ZIAD 5IF9A 2XX3A 1S1CA 5EZQA 4GRIA 1J0AA 2WHYA 3LVBA 4UVIA 3I2IA 1KEKA 1JDBB 1H2WA 3S2FA 5EYPA 1PZEA 3FSGA 3OT1B 1J0CA 4YACA 1JVNA 2FDCA 1IUNA 1WO8A 1H2BA 3SBDA 2QRLA 4UBKA 3K9NA 1KVRA 1DJOA 1XQXA 3FUWA 3MTGA 1E61A 2PZMA 4GFDA 4OUDB 4R1PA 4S1OA 3HA2A 1MJFA 4OLAA 4I2VA 1A9SA 1VA4A 3GFOA 4PZYA 4LTMA 2ZZNA 3JVUA 1RXYA 2BONA 4I50A 3BWBA 3K1JA 3MJCA 1R3DA 4YRJA 2EJCA 1Y4DE 1ZPDA 1DDIA 1U9CA 2X8JA 4LSWA 3ZDRA 3HKEB 3ZDXB 2PYIA 3C48A 2I2FA 1MU0A 3SNHA 2OGTA 2BFAA 3JQ9A 1YACA 3LA6A 4I1YA 3PJRA 4MCIA 1LB1B 2O2JA 3OPXA 1GGKA 4JC5A 4G8DA 4UBMA 1W4LA 4CLOB 4X1YB 4AKSA 5LD2C 3RC7A 4PLTA 1UK9A 3HXPA 4WDRA 5DZSA 3ZUGA 1EWKA 2FPSA 3R9XB 3SJ7A 4U2FA 3L06A 4M9ZA 5GONF 1SXJC 3AI1A 1JTFA 2W11A 4IL5A 4CTNA 4IJUA 2QQEA 3VZPA 4L07A 3ZQ6A 3TOZA 1CQWA 1Z26A 5A0FA 3DT6A 2BZGA 1GTVA 1VXRA 2X0IA 2QD1A 1K5GA 3CRZA 5AW9A 3SYKA 1IC6A 1EUZA 2G36A 3V2UA 3UTDA 4QRDA 2F1IA 3PPIA 1UMDA 2H1RA 5EMMA 2X1MA 2NO6A 3PB3A 1ZZGA 4C30A 2GD0A 3P5SA 5B36A 4MRMA 2WF7A 4WMLA 1OLXA 1QGZA 3LUGA 1VKRA 2QTBA 2YN4A 3L7YA 1L4EA 4MVXA 3FCYA 1M2VA 1MAAA 3PGLA 3GB9A 1OAOA 3PQ6A 5IH7A 5TRTA 5KQPA 3WLIA 4WKNA 2G6TA 4S0XA 1PJBA 5FPHA 3ZZUA 4BO3A 2IC5A 3BFKA 1NP7A 2JZCA 1E1RA 3C3CA 2XGOA 2IPNA 3IE0A 3IIJA 4GBED 5D51S 1PF7E 5IH3A 4TTJA 1WXGA 2NTVA 3RC8A 3UAYA 3NM4A 4UASA 1J07A 5F4ZA 2BMWA 2XWQA 3G9ZA 6REQA 3NLLA 3OPYA 1WWKA 5LQNA 3VV2A 5K0TA 1DO2A 4K9QA 4M0MA 1QOZA 2F3TA 4CMHA 2LE0A 2WIJA 2AW5A 1MO2A 1PI3A 2H65A 3G2MA 3QGMA 4K03A 4R1QA 5DT9A 3C6ZA 4WCFA 4JHXA 4CUJA 4POAA 3BCSA 4RE6A 2ZRDA 2YFYA 2C8KA 1EQAA 3CB4A 1DKUA 2OFXA 1EWTA 1KBZA 4C06A 4DWVA 2GZHA 2Q6VA 1G8GA 2FUCA 4QEZA 2UUAB 3OM1A 1RRPA 2HO5A 3DV0A 1DC7A 4AT1A 5K0CA 3EXAA 5LNK6 2OP1A 4KJZA 3HH8A 1PJLA 2QUJA 4NYIQ 4O5OA 4YNBA 2VBFA 3IFSA 5IVPA 4R69A 3EG5A 1JYSA 1Z25A 1IG3A 1EXNA 1JQBA 1REQA 3QEJA 4RO0A 3A9CA 4Y9TA 1K06A 4AJ4A 5AFSA 4WLEA 2I5PO 5CR9A 2GRUA 5F51A 2B6HA 3BWMA 3AI2A 1F9EA 1O57A 5CTJA 3LWBA 3QLJA 4JEMA 5ERGB 2Q0QA 3G59A 3GWGA 1HK7A 4ZJYA 4IHAA 4NAUA 3EVTA 1Z6ZA 4PSUA 5BOVA 3HBNA 4YRIA 1ZHHA 2QT1A 4Q34A 3UMSA 1IHXA 1LK5A 4E2WA 3TTVA 5B1SA 3E84A 2GLXA 5B5SA 4QPPA 3ZLUA 2PKCA 4HH1A 2JJ1A 1EJ6A 4XIYA 3TINA 1ZOPA 5D5QA 1BWQA 1EFPA 2W2MA 3DB2A 4EY3A 2J85A 2Z83A 3AY3A 4RTOA 3PIIA 1EX9A 2IYNA 3AB3A 4QU5A 3IP5A 3TPFA 2B8EA 4CDMA 3GFGA 4OBEA 3UMYA 1DRVA 4BJ3A 4CN8A 3ROKA 4B3CA 2J9GA 5JD3A 4AJLA 3A6JA 3I62A 3ZXIA 1TUBA 2DQSA 3OO0A 1CPYA 1SUFA 4OAOA 3QEAZ 1F7VA 1EJ0A 1XTUA 1BD3A 1OGYA 3T5AA 1O4WA 1SUBA 2GBCA 4DSOA 5JEEA 4KWIA 4H16A 1XDDA 5CDTA 1VRCA 2OC9A 3I1FA 1DJQA 1N0IA 2NW6A 3KOMA 3RVSA 4AJKA 4AJIA 4QZVA 1E96A 1RJWA 2J7PA 4X63A 4CTKA 3ROPA 1BXKA 1II9A 2L2QA 3FNIA 1TOAA 2VSYA 1GNLA 4Q7QA 1TM5E 3ITEA 1E4EA 1U7HA 1G0NA 3A10A 2RGAA 3F1LA 3QFFA 4JP3A 4KC0A 1J21A 1J2EA 2IA5A 2IUUA 1MVNA 3F8TA 1DKPA 1JU9A 2D54A 5C7YA 4NBTA 4CM9A 1WKCA 2VBCA 3LNTA 1KRXA 4BNLA 1NAHA 3OQHA 4IDHA 4NVRA 4ZZ1A 4YHBA 2CK3D 4QYSA 2I67A 5ICMA 4OHBA 1DEHA 1NZDA 4R4JA 3PGJA 3W2TA 2H7CA 1ZC3A 2WABA 3BSSA 3ITNA 3LPDA 2WSSA 5AICA 4DQDA 4YHHB 2AJLI 1F8FA 3MPUA 3AKCA 2GEUA 2K6GA 3DM5A 5LQKA 3MS7A 3NMUF 4OJQA 4AJPA 1S8AA 3LT5A 3VFDA 4YV2A 1XV5A 1XB2A 3TZHA 2WTMA 2VYCA 4INPA 5AI0A 2ZCUA 1FFXA 4XD2A 3SFTA 3UO8B 4ZMRA 1VMAA 2JFXA 5DULA 2J67A 5T8KC 3M6UA 4LZAA 5JJ5A 2FP4A 4H17A 4WKCA 4KQXA 4XOIA 4FMCB 1QU3A 4ZQIA 3NVAA 3U4QA 1NKTA 1Z6AA 2X3UA 1UBHS 2ZI5A 3FRIA 1VL8A 4Y1FA 4YIKA 4ARVA 4YRZA 3WLQA 2EL9A 4AROA 3W3ZB 4J7CA 3VTKA 1KZ1A 5GZ6A 4EVRA 3RO7A 4RD3A 1TCCA 1TJ4A 3PJGA 4JJZA 1Z6PA 4DDHA 1LBTA 3TLMA 2ZUFA 4FHZA 3UW3A 3E9RA 1MAVA 3PT5A 3ZZNA 3WLMA 1GKUB 4DOMA 2JLWA 3IYLW 5E3IA 3PHBE 2X4DA 5BMOA 2I9KA 1R0KA 2DPLA 3DCNA 5K1ZA 1U63A 4K6KA 3E5MA 3O0DA 1EM8B 2BTOA 2GB4A 3UJ3X 4EGSA 6CHYA 1WSBA 4C07A 3OT5A 3AF5A 2A6PA 2PGOA 4P34A 4CQJA 1N5OX 3SZ3A 1UBMS 3WMRA 2IOQA 4KYVA 1KZ6A 1T0JB 2AEEA 4MRMB 3RAPR 4DEVA 2KMLA 1UPUA 2AI3A 2DHRA 5GY7A 2YIDA 4JB0A 4BQEA 4DS3A 4OMUA 1N5RA 2MSKA 4MPJA 1EVQA 4R8KA 2IU3A 2HT1A 2C2OA 3K5HA 4OLFA 1GZ5A 1DAKA 2OMKA 2RJOA 5H80A 5HWSA 3SFZA 1EFHA 2C2XA 3QVTA 3ZHUA 4EKNB 1OXVA 3A14A 3JW8A 3EZFA 4XIFA 5B6IA 2NO1A 3EWIA 4JEHA 5LU9A 5ERXA 1K97A 2GXSA 1JYEA 3VO1A 4DLLA 2BGGA 1VCMA 1BU5A 4YLEA 2LCIA 3AVPA 4NZ9A 1E6EA 3VSCA 2OV3A 1L7AA 1EZ1A 3WGMA 2DHQA 5JXJA 4LYJA 3W04A 3ZWQA 2P8JA 2E4AA 4G84A 4F8JA 4BYMA 4EJFA 2C96A 1XEWX 2H85A 2RKWA 1ECLA 1WF6A 4KR3A 1RJEA 1NTRA 3LYUA 1KYVA 2AX3A 3WRYC 3ZGLA 3UMBA 1JHQA 2O8FB 2XZTA 3OX1A 3IR6A 3HUDA 4FFDA 5BV0A 2AD1A 4BNXA 4NX2A 2GM9A 2I2XB 2V4UA 2VNIA 4IRMA 1E2HA 4MR9A 4RUKA 2ZSEA 1IOZA 3ZK7A 2VHUA 3FPFA 3N6VA 4JITA 5AW3A 4QM7A 3ISJA 1YZVA 2IS6A 1NQUA 5KQRA 3OQIA 4C5AA 1C3EA 1H94A 1X7WA 3HWX1 5BRJA 3T95A 4G4SP 4GX1A 3KZVA 4L22A 3ZIDA 4YALA 2YOFA 3AEUB 3B20A 3I2GA 4MGZR 3RE1A 3RC3A 4MULA 3DG9A 1B8UA 4FDUA 1XALA 2QNBA 1UOEA 4KCGA 1O9HA 4RD2A 1S9HA 3BD7A 4S12A 4M7WA 2IPOA 1YB1A 4ESVA 1JAXA 4ZEXA 3UK7A 4ME6A 4DQKA 1TKBA 3GGSA 3OTWA 5JWRA 3ZLVA 2PVSA 1SCBA 5LBIA 4MWEA 3AETA 2XZLA 1Q0TA 1ODTC 1QYIA 1V96A 1JHPA 2Z9CA 4MMZB 4TV8F 2FPUA 3DDZX 3UKOA 1ZGHA 1ZICA 3ITKA 5F3RA 4C08A 3T7DA 4C3VA 5LQCA 3CO0S 2BOVA 1B43A 2XB6A 3RROA 4WFKA 2QRMA 1GCUA 2NM0A 1OWOA 3JTMA 3OJOA 5BUSA 1V5GA 3MRSA 2FDXA 2TMYA 1ESCA 3IVCA 2O1EA 3L1JA 3LIIA 3V8EA 1EFKA 1H8ED 3KKZA 2ZIXA 3DONA 1WCXA 2PX2A 4FS8A 4D3FA 3Q6IA 1L5LA 3QVUA 1L7MA 2Q3JA 1B2LA 1WMFA 1IXZA 2C88A 3O38A 1YJXA 1QIMA 2ODBA 1E1QA 4Z49A 3QFCA 4B6GA 5JNLA 4DN6A 3S4YA 1QE0A 3TL6A 1CUJA 1UJ5A 5F12A 4F12A 5EXEA 1GNPA 4KAJA 3HVKA 3RAGA 4MPDA 1UQTA 1YULA 3NWOA 2EL7A 4H3HB 1P7PA 1EIZA 1SQ0A 2E1PA 2WF5A 3ESAA 4K46A 1YS6A 4XB2A 5K01A 3FTPA 1CUHA 2ORIA 5JW6A 3G9QA 1W5SA 2Y1LA 3EH2A 2YXLA 5H3LA 4FD3A 4F3KA 2W8BB 3ETEA 2QAGB 3JWGA 4NMMA 1IN8A 3MILA 2RGDA 4A03A 3IB3A 4GO1A 2O3TA 4YUVA 3BE6A 1AH2A 3IHLA 1GPBA 2H7YA 2NU9B 2OLKA 3KXIA 1QP0A 4HWOA 3OPYI 2O5VA 3J80A 1XXLA 1N3LA 1DLJA 2BPOA 2UZAA 4IKPA 4NE7A 2RI0A 2J9ZB 3R7LA 3VUEA 4B7ZA 4C0BA 3UMFA 4D99A 1OXXK 2E5LB 1XA4A 4YECA 1KMHA 4NZZA 5CK4A 2DE0X 1NONA 1XAJA 1YRBA 3SVZA 1QK5A 5LJLA 1H2AS 2CGEA 1PT8A 2XCOA 3MTIA 3MTBA 1RACA 4N5IX 1LRJA 1QOQB 3V1YA 3MJHA 4PM4A 2EZTA 4OL9A 3KFXA 4WY8A 3B13B 2JFYA 4IWYA 2GPJA 4JBWA 3OCUA 1T9AA 1G9SA 2KWIA 3S2SA 3L7CA 3V5NA 1CNFA 4R40A 3VDNB 1HQKA 1PR5A 4UCWA 3T3MB 1NI4B 1IEVA 2GPWA 5L6MB 4C43A 3D7MA 3GXOA 4PGAA 3U31A 5IAGA 2I34A 1C7QA 2F9MA 4N12A 4TVSA 1PR3A 2FFBA 1LNQA 3MCVA 1HLGA 2A57A 4M1TA 4CL8A 4P38A 2YKPA 4D3SA 3LQRA 2EQAA 1MC4A 1R9MA 2J5BA 4LSMA 4DNXA 5BWLA 1SHKA 3IP8A 3D59A 4Q3EA 2HIAA 2QM7A 3AYXB 2VS1A 3O93A 1WCIB 3L41A 4TSRA 3VSDA 4A82A 2HLDA 5C5EA 1ZUHA 2GZ3A 3NIGB 3GJ8A 5JZOA 3I5XA 2X0KA 4IJ5A 3ILHA 4MZXA 3NDRA 3WYDA 2AMFA 1N3IA 4DLAA 1XLTC 1IY2A 1DRKA 2VRCA 2YFHA 4BUCA 3I72A 2AI1A 4XFJA 7YASA 4YCNA 3IIEA 5K45A 3H83A 3U13A 1DOZA 1YQXA 1Z0JA 1JG1A 2C0PA 3IODA 3PI7A 4C29A 2QSYA 3ELYA 4I8XA 3QKIA 3DLTA 1F2UA 2O0JA 4G8BA 5GV8A 4LFCB 3DUFB 5P8WA 5KTYA 1I32A 4O4JA 5DSTA 1I3CA 2C61A 4LZOA 1YZ3A 2MOKA 2FKNA 3K31A 3U49A 5EWMB 1KVSA 4EZEA 1FTYA 1YA4A 5I8PA 2H2AA 2ZUEA 1Q95A 2ZJ4A 3TVYA 1IQRA 5D00A 5ENVA 4CR7A 2AG6A 3EVZA 1KEVA 3VNAA 5AM3A 4Q4HB 3C3JA 1MOPA 3I4CA 3JASB 2J3IA 4FEAA 4TL9A 5K9ZA 1IQPA 2J0UB 3NATA 4N7RA 2FUNB 2ZTMA 3B9RA 4Y18A 4EYQA 5C5DA 3CN9A 3T7KA 1KH3A 1EAYA 3DE4X 3NBMA 1KTVA 4MI3A 4KR2A 1FP4A 3EXFB 4IUDS 4IIBA 3I3SR 1BRTA 1JA1A 4E21A 2MYNA 4WXEA 3RS4A 5CBKA 4TV8A 4WKGA 1VXOA 2G0AA 1PWEA 2J30A 4QUJA 2PWBA 3WL7A 5DX1A 2X4GA 2GBFA 2NUTA 2NO0A 1SUCA 1N7IA 1Z6QA 2YVAA 4MI1A 3B7WA 4WOKA 1N0UA 3E7DA 3ZWCA 4F9FA 2I3BA 4J1QA 1JTVA 2C00A 5CDFE 1BE6A 4KEAA 2E0IA 4RPGA 1JHXA 1YAJA 4WLOA 1R6TA 2YZ7A 3LD9A 3SN6A 3MM4A 1TK2A 1HBJA 1X3SA 4FCVA 1XZAA 2XUKA 1ULSA 3PRKE 3VU3A 1CD5A 1Y9EA 4HB2A 4OHXA 3X1WA 4L0MA 2PL9A 1V3QE 2P7HA 4FOOA 1D4AA 1DIAA 4F2DA 1ZCFA 3K8OE 1Z8DA 3SICE 1G3RA 2IH4A 5EG5A 3ITDA 3GUZA 5FOVA 4AMUA 3G5AA 1MV8A 3O82A 2GN6A 1U1FA 2R8PA 3CG0A 2PA3A 3MXOA 1YS4A 1RHMA 4B48A 4Y9RA 2GXAA 4WLVA 1UT6A 5D3ZA 3DGEC 4RSRA 4PEVA 3LGSA 4FNGA 2DFTA 4M0EA 4CCYB 3GVXA 2WAAA 3B7GA 5F35A 2YNMD 2Z8YA 1MB9A 1GUZA 3QNUA 2BSXA 4FMBB 1SIOA 2QJFA 1EK2A 3BL8A 3H9QA 4FE4A 1AUOA 2E87A 1SO8A 1THTA 3WNCA 1VI6A 4U7PB 5BQFA 4Y98A 3LHDA 1YKFA 2V1UA 2ZUBA 4FFWA 5FR1A 1V3VA 3CZ5A 4JI8B 3JQQA 4RTPA 3WIVA 1Q1EA 2HHLA 1BKYA 3WHIA 4BZZA 3KUUA 2KHZA 4V24A 4MQBA 3OKFA 4B82A 3I76A 2RAPA 4GRDA 4NC9A 2ORED 4UE3S 5DHUA 4CODB 3WQRA 1ZYUA 4JJ7A 1CFZA 3QEBZ 3FJYA 3FKJA 5JCJD 3JQ8A 4A6EA 4U6QA 4RGYA 4Q3KA 3PNSA 4KR0A 5A9SB 1KOFA 4R6WA 1C4KA 4D4JA 1S2MA 5DBIA 5LQMA 2G0NA 3GCDA 1TD1A 3W9UA 2W2TA 2VATA 3MT7A 2PYZA 1I7SB 3T12A 2P78A 5K6TA 2D4HA 2J5QA 2ORYA 4O4HB 2AEJA 4YAWA 2JH9A 2XE8A 1TYDE 5EZSA 3A1FA 3QTLA 4ONEA 1QGDA 2C9MA 1XQYA 4ENQA 5B55A 5K0FA 3JCZA 2P3SA 5FBWB 2PBLA 2JIDA 2FSHA 4ZAZA 2GD1O 2ZQYA 3UCFA 2R6HA 1RYBA 3I9V1 4KR6A 2I7VA 2J3KA 4KXVA 4I4TA 2WPDA 1GLGA 3H87A 5KNBH 2CBXA 1BHSA 2R9VA 1IONA 2ODWA 4KQ6A 1F3OA 5C8XA 4IQ0A 2OYSA 1IU9A 4V0SA 4QJBA 3OZDA 5AI9A 4PO1A 4C7MA 3UJDA 4EHLA 3P45A 4QTTB 1FA9A 4U63A 1TF2A 2CXQA 2BY4A 5AI4A 1HF3A 2WE8A 2Y0DA 1W29A 4L76A 3CISA 2FW1A 2O7VA 5F73A 3TLZA 3V3TA 4JJ8A 3GUYA 5KC8A 4MV5A 1I2CA 4V2IA 2XQGA 3VI4B 1Q6YA 1H3FA 1XDZA 1Z37A 2H11A 4U9IS 2J0SA 1MC8A 1ONPA 3GT7A 3DQPA 5FA8A 2QTWB 3GOQA 5JADA 3CE9A 3K30A 5JZMA 4UBNA 1ZGGA 3UGKA 3ETJA 3ZJTA 4CGYA 3W9SA 2GPAA 3H2YA 1E58A 1TQHA 4P22A 5B2ZA 1COWA 3JU3A 4CM8A 2GRJA 2YICA 1ZL2A 4HNUA 2WICA 3JYQA 3CNNA 2YYYA 4IG9A 4LDNA 2HPAA 1XXHB 3V48A 4P08A 2DHCA 2O8EA 1CZRA 5JO9A 2QUZA 1K5DA 4L8GA 4G65A 3H8WA 4LF4B 3MGAA 4DABA 3AJAA 3DFMA 3PGMA 3TJZA 2VJNA 3F3KA 3UHJA 1G21A 1UPBA 4DJFC 1GGMA 2XTJA 3WDMA 5JS1A 3A11A 4KGDA 3N2LA 4LMAA 3Q2OA 4IEIA 4PICA 2D8AA 5JSKA 4PYRA 4EEKA 5A5VA 1WDTA 3H17A 3VZRA 4B4KA 4Y2QA 2B25A 2EBHX 1LZLA 1JKFA 1LJLA 3LZ6A 3N0WA 4TS4A 5U4XA 4URXR 1A8IA 3WMGA 1YVDA 4RQBA 4KO8A 2MMCA 5AT1A 2PZGA 2DWPA 1SZCA 1XP5A 4JOBA 5AK6A 1HFKA 1G8SA 2O20A 2CFSA 2ZIWB 4GI1A 4EFMA 3M6FA 4KO4S 4MYTA 3Q5GA 4HBGA 2P2DA 3OY2A 5EXDA 5B53A 2IUEA 2RI1A 3GT0A 3KOYA 3QFSA 1VP3A 4DCMA 4O4IA 4BKRA 4BKOA 4IAOA 3BD8A 3D8SA 1DHTA 4PO8A 2I3DA 3GJ6A 1XKLA 3VQTA 2VZ0A 2PMBA 2OBMA 4EKGA 5JNRA 4PS1A 5IDQA 1T6YA 4TMFA 4JI7B 3D8HA 2I22A 1D2RA 1E79D 2Z6QA 1JR3A 3N8DA 4Y2GA 1YB7A 1YE8A 4CQMD 1I9GA 2H07A 1OH6A 4QD3A 1SXJE 5EFZA 5KSPA 2IXDA 1H4TA 2PSDA 3DUWA 4KE6A 4V1CB 5BVHA 1Y1TA 1PDWA 4EJMA 1JJAA 2SCUA 3ELWA 1ZD8A 3L9XA 3MS4A 3WRWA 3D81A 3DE3X 1TKRA 1IQ0A 4JLUA 4RDHA 4E51A 4Y2TA 3DYIA 3GUHA 5CLFA 5ESDA 2C1XA 2ZSIA 3SZLA 1V9LA 1TVMA 4ZVUA 3RSLA 1CQZA 2F2TA 1T9CA 2G70A 2R85A 3H2HA 1ZD5A 3U4IA 4Q4AB 3RIHA 4YXWD 3RRJA 2BEJA 4QBKA 4YJ2B 4AZ0A 2P1ZA 2AJCA 2DGDA 3D3WA 1X1AA 1IXKA 3CUVA 4R2IA 4KE9A 5KHOC 4BO7A 3UJNA 4AVYA 2JEZA 2JFFA 5JXHA 5F9HA 4IM7A 1QFJA 1UKYA 2X6RA 2ZR7A 4ESHA 2N42A 2ODQA 3ER6A 2SCUB 4QX6A 1H8HA 4R2JA 5EIBC 2CK3A 5LBUA 3ICEA 2DP4E 1KE2A 1WZIA 5B6PA 5HDBB 1NFQA 2WSYB 4TLBA 2YR0A 3EASA 4B31A 1HR0B 2YIMA 1P2GA 1WBDA 2BBWA 3HJAA 1PS0A 5KYYA 3H5IA 4AJ9A 2C5FA 2ERXA 2O0MA 3N8KA 5JTUA 1DTSA 2HRBA 2GAIA 2Z4SA 3E53A 3ICCA 4GX2A 4EG0A 1MOZA 1XQ9A 2IXEA 3EH1A 5CYGA 3IILA 3HDGA 4B43A 5M2QA 3QEKA 1ISRA 3TBFA 1LI5A 1N5MA 1T15A 4ASUD 1NF9A 4IPTA 4L57A 4P4SA 4UU7A 4N3BA 5FA6A 1UWCA 4PQGA 5D3MB 2G9NA 4RTNA 3JQAB 1S8NA 3T5GA 1RXIA 4FGKA 1DWQA 3T9DA 4MWOA 1Y42X 4XJTA 3TQOA 4ZI7A 1TC1A 2IKQA 3L8DA 4ZOAA 2XYPA 3HZHA 1YQ9A 2J08A 3JATB 3GT4A 4P3PA 3SEZA 4WL0A 1DT3A 2QEQA 1GFIA 4G56A 4LYAA 2IXBA 4R9RA 1QDLB 3NUQA 3WWDA 3W6PA 2JLXA 2IYYA 5IT0A 2C9BA 3KS9A 3L8HA 4R8SA 3D7NA 5JMPA