2OEPA

Msreca-adp-complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
325
structure length
324
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLEKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 76
structure length 324
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oepA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oepA01
4C2TA 3FPAA 2V55B 3A1SA 2QE7A 1AK2A 2JDIA 2YC2C 3QKUA 4NHOA 2XNDA 2QP9X 4DLXA 1D2EA 1E99A 1ZIOA 1KI2A 1E2KA 5A5GA 2WBLC 1IOZA 2VSFA 4V0OA 3IO3A 2X19A 2EU8A 1Q3TA 2JLVA 1XTQA 1HT2E 1YR9A 2IXEA 2IHYA 5TXGA 1E0AA 5IRCD 3MAAC 2Q9CA 4PAQA 4DLZA 2KBEA 4MKIA 2L0XA 1NMYA 2B7BA 4IOMA 4NE2A 1QBKC 1SVKA 2Q0HA 3RRZA 1W36C 4A92A 1GDDA 1OIVA 3DKVA 1IXZA 2IUUA 2FEOA 2YKGA 4AKIA 1WP9A 1NY5A 2GWHA 3AVTA 2D06A 4RJLA 1J7KA 2HCJB 4GP7A 4BLOA 1SVOA 2W2XA 4KITB 4Q4JA 4KSBA 2QTVB 4PZLA 1ZJ6A 1E69A 1OXTA 2D3WA 3X1WA 2GA8A 4NTZA 4Q1DA 1A2BA 4B3BA 4BLQA 5F9FA 1YRBA 2GEDA 4HB2A 5D3MA 4IOLA 3TMKA 2MSDB 3CKLA 3KB2A 4TQAA 1OFHA 2CLCX 4N3NA 2IF0A 4B2IA 4TMWA 3B82A 1TF2A 4Q9JA 5G3ZA 5CITA 3DKPA 4EKDA 2WSSA 1ZD1A 4Q03A 5E4FA 3THYA 2VHCA 3E5HA 2OM2A 2PZEA 3WNDA 1OH5A 2D62A 1YZNA 1Q0UA 2QE7D 1IXSB 1K5DA 4LHYA 2JDID 3NTUA 4I81A 3RANA 2XNDD 3EPJA 3X1YA 2BMEA 1F2UA 2ORWA 1YHNA 2W0SA 2KBFA 4B3FX 5BN4A 3T35A 4ZCIA 4MRSA 4RCYA 2V1XA 4L8GA 4I99A 1KAGA 2P65A 4URZR 2V3CC 1NN0A 3GPLA 4TTRA 2IS4A 4MUBA 4HLQB 3P20A 3EPHA 1GZSA 4A2PA 2CLDX 3AKYA 3LVQE 1NSFA 1W5SA 3CNNA 1IJEA 2J0QA 4IRUB 4LPKA 1E2QA 1KDTA 3LV8A 2SHKA 1VHLA 3SJCA 4JLBA 3B9PA 3M1IA 2F3RA 3R8FA 4II7A 1S0UA 1VCIA 1G3IA 4DDVA 1XTRA 4B75A 3CIOA 1MO6A 3CPJB 2BMDA 3WNBA 4UNQA 2R9VA 1VCNA 3A37A 2W2TA 3NG1A 4NYIQ 5HR5A 3PUXA 4WOPA 4BLTA 2VF8A 4FN5A 3EASA 4GRAA 3VU9B 3TJZA 3CM0A 3NC0C 3BE4A 3UWOA 2CE7A 5C1BA 4RY2A 4OL0A 4TSFA 4F93B 2FWRA 1R7RA 2OSBA 3VMFA 1I4TD 4O2RA 4TYWA 2WJJA 2PJZA 3FYHA 3F5FA 2WSSD 3UMFA 4ZDKA 3OF5A 3A4NA 3U6KA 1FP6A 1X8JA 2I4IA 4GPTA 5KDDA 1VKJA 1P2SA 3Q3JB 3B85A 2IYLD 1DARA 2ZIAA 5J4YA 5M04A 4NKRA 1EG7A 1J70A 3V4FA 2CXXA 1TX4B 2GBLC 4LI0A 1E96A 2AHOA 1E2IA 3NDPA 2O8BB 2BMJA 4IEEA 1Z6AA 1ZNYA 5JWHA 3U3RA 5JS7A 3AKEA 5JJKA 2B6HA 4BFWA 3KXLA 3U6BA 3C4JA 3EG5A 5J4KA 3ZD7A 4PC6A 1QZXA 4U7DA 4NYJQ 1KHTA 4PHHA 1KO5A 3RVBA 2ZRKA 2J0VA 3TVDA 2GAAA 1Q3HA 1A7JA 4LYAA 2EYUA 3K9HA 2O8DA 2Z4SA 3EIEA 5F2EA 5DYIA 1TTTA 4TLBA 1UAAA 4U5XA 3PITA 1CJUC 1K6MA 2F7SA 3WHKA 3K0AB 4HUQA 3MMPA 3IDQA 2YWFA 1Y63A 2P2LA 4D4JA 4TLEA 1P5ZB 1QG2A 2BBTA 2ZYTX 3IO5A 5EP2A 2V6IA 1P9NA 3W8NA 1TU3A 5CIQA 4DT1A 1P4SA 5AJXA 3O8CA 1C1YA 2G88A 121PA 2J7PA 2XOKA 1G8GA 4YXWA 4TSFD 1XPOA 2CHGA 5E3HA 5JMTA 1UPTA 5FPTA 5HCNA 2HDNB 4DCVA 3ZGXA 2WHXA 4EPRA 4KJZA 2ZVQX 3ASZA 3AB3A 4GT1A 1Y3AA 1MO4A 4KO8A 1RRPA 3I92A 5C4MA 3KXKA 3RWOA 1M7HA 2X8AA 4LJ5A 2OAQ1 3EZ6A 4M1SA 2B7CA 4HZIA 4F92B 4BZQA 4M2LA 2GZHA 3OIUA 3W9YA 3F8TA 2AWNA 1XZPA 3B1ZA 1SKQA 1EX6A 2ODWA 2QL6A 3U5ZB 4DC9A 3EA0A 3Q7QA 1FL9A 1GKIA 1E9SA 2GJKA 3LWNA 4MDFA 3EC2A 3IHWA 4YDHB 4EJSB 2LKCA 1NMZA 1HV8A 1X1RA 2AX4A 1IN7A 2GAOA 3CRW1 3PIRA 4HLUC 5JLJA 4PC2A 2R2AA 4Q4LA 3MUFA 2AD1A 4Q7MB 5KDOA 2FJUA 2QSZA 3CR8A 3B5JA 3K53A 4URXR 2QM7A 2FZLA 3Q5DA 3UWKA 5B30A 3RSLA 5K8LA 4X8OA 3K70C 4KFUA 4BZPA 3SHFA 5FR1A 4GOKA 1XD2A 2XZPA 2OO7A 2J7PD 2XOKD 2QQ0A 4DSTA 2ZI4A 1Z08A 4IXNA 2FPLA 5EE1A 4LBWA 1Q20A 4YXWD 2IL1A 3ZZTA 2HF8A 4HB0A 2YOGA 4KAXA 1KIMA 3A58B 1GNQA 3AKCA 5C46F 3CZQA 1G20E 3FGNA 4DKXA 1FNMA 4MH0R 1W4AA 1Z6TA 2K5UA 1II9A 4Q9LA 3CNOA 4HDQB 1ODFA 1OW3B 2ZI7A 2D2FA 2ODBA 5FTNA 4PO9A 2RHDA 2RGCA 1E1QA 1XXHA 2BC9A 5CDFA 4JYBA 3AUXA 3X1ZA 2VBCA 1R5NA 3TQFA 4URVR 1S2MA 4KI0A 1WQ1R 3A1WA 2ZROA 4TMTA 5JFGA 1DEKA 1OYWA 2EFGA 1Z5ZA 4G5GA 1OB5A 2OBMA 5GVSA 2IYUA 3V00A 4QL3A 3CX7A 1YU9A 1WBBA 1OLOA 4GNKA 1P60A 2WOJA 1EWRA 2O5VA 4LJ6A 1N6HA 1GNPA 4KLNA 4LC1A 3UIEA 1DTSA 3B1XA 4B76A 1OFIA 5L3QA 5L3VA 5JEDA 1ZD8A 2C98A 2ZSBA 1JAHA 2C5LA 2PT5A 3ZDQA 4NL4H 4CT4B 5BN5A 1MABA 1OYYA 1WCV1 1SXJC 5JEEA 1NLZA 2FGJA 1NY6A 2XZOA 1KJZA 4F91B 2YOHA 3P26A 2GNOA 3T1TA 3B8HA 3KZ1E 2NOAA 3BERA 2UKDA 3CB4A 1YKSA 1D9ZA 4XJXA 5CB8A 2I1VB 2FU5C 4JLVA 1LNZA 1FZQA 2RGEA 3U4QA 1KO1A 4M1TA 4FCTA 4P4TA 4JBYA 1RVDA 4FMCF 1XPUA 2AFHE 2ASEA 3OEEA 3W3AA 4M1WA 3DM9B 1VIYA 3B78A 3K9LA 4QM6A 4PANA 4TLCA 3RS2A 5SZJA 2ZS9A 1CR1A 1XTIA 3CBQA 3LRPA 2J0UA 1LS1A 2BVNA 2JLUA 4F38A 2WM9B 1XRJA 1M7GA 3HPRA 3TE6A 2ANBA 2WWFA 2HF9A 1HA3A 3LLMA 2XAUA 3LO5A 2RH5A 1P73A 3QPWA 4EPTA 2GZAA 2JLWA 5C4GB 4ZDIA 1NVVR 1E2EA 3C16C 3GFTA 3GLHE 3VTKA 3UATA 2V8OA 2J59A 4DLYA 1G17A 1E32A 1Z07A 2FFQA 4OQLA 2XB2A 1XDBA 4CEIA 1JBKA 3KKMA 1KNQA 1IM2A 3DO6A 4MITA 1ZUIA 5HPYB 4PQYA 3A6PC 3MG9A 5CYPA 4B2LA 4TZ0A 3BRWD 3CH4B 4R2HA 1BIFA 3BS4A 3AGPA 1Q44A 2VTKA 5HCIA 1HTWA 3BGWA 3JZAA 1NNEA 3VKGA 3KJIA 2ZRAA 2BM0A 1KI6B 4JBWA 2IA5A 1KDOA 3DM5A 5EXSA 1Z0AA 4JLNA 1RRCA 2ODNA 1E0JA 3I5YA 1NN3A 2A30A 4R2IA 2BIFA 5CM8B 4QM7A 5DIFA 2GCNA 2ZS8A 4HLDA 1KJWA 4N1AA 4P3YA 1AS2A 3KTAB 1NBMA 3T1QA 4NCIA 5FI0B 3OEED 1R5BA 5JRJA 3C14C 1FPMA 1G8YA 3GLHB 2XITA 1G1MA 5J40A 1P2VA 2G0TA 5FPHA 5EE9A 2FF7A 1KK1A 3SU8A 4N0DA 2VEDA 1LW7A 4C0SA 2H17A 3RAPR 3S1AA 1DAKA 1XD9A 1NVUQ 2OXCA 1AGPA 1UEIA 3KQLA 5KPJA 1OFTA 1U94A 5KSOA 5FUYA 4B71A 5HZHA 4NCKA 3FHCB 1TEXA 5E7JA 1BS1A 1XF9A 1Z28A 4M22A 5CM9C 4ZPXA 4FMCB 2ZRGA 3UANA 4DSNA 4IDQA 4ARZB 1P72A 1EFUA 1NI3A 1EFCA 3BXZA 4F4JA 1I4LD 2ZEJA 1Q12A 1CS4C 4TQ9A 1U0HC 4Z8YA 2GXUA 1XWIA 2YV5A 1W47A 3EPLA 3LBIA 3QKRB 1KY2A 1T5IA 2PCLA 1UDXA 3C7KA 4EPVA 2W58A 3WNCA 1W36D 1W44A 3ZJYA 4LYHA 3AF1A 2O8CA 4KVGA 3IBGA 1NBMD 2OFWA 3ECCA 5HTKA 1QVRA 5IK2A 3RS5A 4Y0AA 5AUPB 2JLRA 1R0WA 1KO7A 2DFKB 4KSCA 4Z8XA 2WMNB 1IN4A 2QBYA 1OB2A 2NQ2C 3K0CC 5HE8A 4EPYA 2OXRA 4Q18A 2C95A 4AKGA 4Q9KA 3GCGA 4X8LA 4XTCS 3IPXA 2IW3A 2GXSA 1VTKA 4WW0A 1E9DA 1G16A 1GUAA 3AP3A 4LJYA 3OFNA 4RD2A 2QP4A 2O8EB 3JVUA 2I3BA 4DIEA 1CKEA 2RGBA 3CF0A 5H8WA 2FEMA 3LVRE 1MRSA 3GD7A 1L8QA 2FFHA 3QF4B 5JI2E 5IHPA 1EFRA 2VYFA 4HI0E 2F9MA 1KSGA 1EXMA 1Z3IX 5TY0A 4JL5A 4RD1A 4D80A 1JI0A 4G3XA 2FA9A 4PHTA 2ZJOA 1R0YA 2JJ1A 2VP5A 1C4OA 3UG7A 2FH5B 2YYZA 1VG9B 2BCGY 4MKHA 1X6VA 4DCSA 1F48A 4AKEA 2C78A 2VL7A 2ZRLA 5FUXA 4UNRA 4LBYA 4CIDA 6Q21A 2B92A 4F4CA 3KDSE 4KLZA 3T61A 4JVSB 3SFZA 5TV2A 2IS6A 4LV6A 5DI9A 1A1VA 4FIDA 2NG1A 2RGDA 4Q9IA 5CK4A 1GL9B 1A5TA 4A2QA 3NH6A 2QRZA 4Q48A 1IN6A 5FPKA 3WBJA 1XB2A 1F3OA 1IN8A 4AC9A 1Z22A 2PH1A 3BH7A 3LXXA 3L8YA 4HATA 4NONA 621PA 3PEYA 2OFOA 4JZKA 3EPKA 2N42A 3TR5A 5B57C 1PZNA 5J4LA 5KNDA 5GJCA 1DO2A 4UJ3A 2BDTA 1OFUX 3KQKA 4C2UA 2HCBA 3R7WB 4OHXA 3NWJA 5BW8A 3CLVA 1PV4A 3OFND 2ATXA 3LAWA 4CVNA 1JR6A 3KKNA 2EWVA 2VP4A 4IDNA 3ZS8A 4KFSA 1ZRHA 3PR1A 3GJ4A 1EFRD 4B35A 4DIDA 1N5LA 3IKJA 4TN1A 3DOFA 4KXFB 4OI4A 4FWIB 2VHUA 2JJ1D 4LHVA 1KI1A 1HH4A 1IY1A 3AV0B 2F1HA 1ZNXA 3T12A 5DO9A 3U3OA 3EZFA 5GVRA 4B47A 1IBRA 3OIVA 2F3TA 1H65A 3GFOA 3D8BA 2ECKA 4JKYA 1UKZA 4GZLA 4X8MA 1CTQA 2OUKA 4C0KA 3EZ2A 5LD2B 1ZUNB 1P61B 2QSYA 1P6XA 4BLRA 4AG5A 2ZJ2A 1G291 3F0TA 4PC3A 2ZE5A 4OQXA 2RB4A 5H70A 3TH5A 4HLUA 2ZRMA 3EWAA 3RS4A 1G7CA 1Z0IA 1N5IA 1K8RA 221PA 4GMXA 4QHSA 4Q4HB 5DH9A 4Q7JB 4EDHA 4UQOA 2KE5A 2O0HA 1CU1A 2VLIA 5LB2A 3W6OA 1KTVA 2GXQA 3C15C 1XFAA 1U81A 2F1JA 5EUQB 2JAQA 5JSZB 1PVOA 2CCGA 2WOOA 3K1JA 4IVPA 3PEWA 4B3CA 4LX0A 2WWXA 1CRPA 1SVIA 2D7CA 1ZC4A 4P4SA 4QGFA 3GEIA 2LKDA 3I5XA 1RZ3A 1D2MA 4NYMR 5BYKA 3SE0A 1KK0A 1NP6A 1BO6A 4QHTA 5EQTA 4XSGA 1DG1G 1FTSA 2UZ3A 2E87A 3GLGB 3SQXA 4GDFA 4PZYA 1XNJA 3NC1C 2IBMA 3RSOA 4KBGA 1E4YA 3D6TB 4OHZA 3FDIA 4RCZA 3LW8A 3TSWA 1G5TA 3K0SA 1R10A 5JS8A 2QG6A 1Z6GA 2FMXA 2HXYA 3SN6A 4LPSA 5GADl 1TQ4A 2GILA 1T3HA 3D7MA 2AN9A 4MGKR 1AZTA 3QSYA 2IEZA 2XX3A 1DAHA 1YZQA 4O25A 1AKYA 4HAYA 4QBGB 1DS6A 5FOUA 4RFSA 1AQUA 3EAQA 2C77A 1DAGA 2OEPA 1II8A 1XEFA 1AS0A 1YQTA 2LCFA 2ZETA 4BFVA 3LD9A 3VR3A 5L3SA 4ACBA 4US2R 1TPZA 2H18A 2F55A 3KQNA 2A5DA 1KMHA 4Q1EA 1CF4A 1BH2A 2XJ9A 3W3ZB 2A5GA 5J5CA 1DAEA 2OT3B 1VHTA 4M1KA 3G0HA 1EESA 4UNNA 1CEEA 1JR3A 1U0LA 1SXJA 3K70D 1FUKA 4MRPA 4AKHA 3RC3A 4V03A 2NGRA 4UKDA 3SYKA 2EW1A 3EC1A 1WMSA 2P67A 1XCGB 1VCMA 2ZJBA 2VHTA 5LB4A 4XTRA 2OZEA 4WAUA 3WYAA 2IUSA 1GTVA 1HYQA 4Z51A 1FUUA 2ZJ8A 1OPXA 1DBSA 2O8DB 3I73A 1OIWA 1ANKA 3QKSA 1DAMA 3RWMB 2RGGA 4S2EA 2ZRCA 1AS3A 2BJWA 2DCUA 2F1IA 4WXPA 4OQFA 3M0EA 4HUQB 4YONB 2Q9BA 2OG2A 4GI7A 1SQ5A 1NIPA 2Q21A 1J90A 3P1JA 2P3SA 4LHWA 2ZJ5A 4URWR 1KKMA 2YWHA 2ZANA 4GZMA 4PC7A 1AA3A 4PO1A 1UKEA 4M9SA 4DT1B 1NVVQ 5KHOC 2R6FA 4QGGA 4EFLA 2IS1A 2DWOA 4XWAA 1G3MA 4ZO4A 2QPAA 3FMOB 2QAJA 3PFIA 4LJ7A 2R65A 3LY5A 3A4MA 3FMFA 2HJVA 3W90A 3QG5A 4RKEA 4G01B 421PA 2C04A 4P33A 4B73A 1FX0B 2CJWB 2ZJZA 1Z2AA 1OH6A 1NL3A 2IYTA 3WYFA 1JR3D 3TR0A 1SXJD 2XSZA 2ZI9A 3LNCA 4ZI3A 1HQCA 3PEVA 1U98A 3QXJA 4A8JB 1XEWY 4E09A 1ZIPA 4JBXA 2ZUCA 1EFTA 5F98A 2O8FA 1YZTA 1P2TA 4TLAA 2AXNA 1S1MA 1UFQA 5DI3A 5EP4A 4MYTA 2B8WA 1F60A 1YJ5A 1E2LA 3NBFA 3PVSA 1RW4A 3W6NA 1PLKA 1XXHE 3KUDA 5CDFE 1VYUA 3HJNA 4E07A 2X2EA 3QJYA 3UPUA 3W6PA 2P6UA 4BQSA 4QNMA 5G41A 3IPYA 4BPBA 4NCHA 5B64A 3UG6A 1QHHA 1QHGA 2XTZA 4MRRA 2FSFA 1AM4D 2PCJA 1ZNZA 5FTMA 1AJEA 1G64A 1KZGB 4TT3A 2FSIA 3IUYA 2CK3A 1FNNA 4XWOA 5K8IA 5KU1A 5G40A 4BFUA 3C5CA 3QIAA 2EQBA 2HJGA 4HLCA 5SZHB 3CW2A 2JIZA 5GJWC 3BIFA 4D26A 2GESA 1N6RA 1AGRA 3KQUA 2XGJA 4L5BA 4GBMA 2XSZD 1EK0A 1OKKA 1GKUB 4PTLA 1PUIA 1KKLA 2QORA 3H84A 4DLSA 4PPFA 4D4MA 2PJRA 1XXHB 1KO8A 3GLFA 4LCBA 3I1FA 3AVYA 1ZUHA 3MWLA 5AUOB 3QF7A 2AKAB 4RZXA 3BH0A 4A82A 5L8VA 3TKLA 1OXUA 2JEOA 3DVLA 2ZS7A 3CF6R 3VQTA 2Z0MA 1GIAA 1N6OA 4PO8A 4G5OA 1W5TA 5DGXA 4OQNA 5G53C 3M4YA 3QPVA 4DUGA 2AKYA 3LBHA 3I4LA 5FTJA 3QUSA 3K0CA 721PA 3CRVA 1UBGA 2PLFA 1OH8A 5L3QB 3THXA 4Q1BA 2H8KA 1DADA 3U61B 4PSVA 5TDHA 2NZ8A 3TUZC 2GJ8A 1XZQA 5FFMA 3FWYA 5FUWA 1MABB 3M6AA 2GJAA 3NDBB 3AVWA 4EPXA 4M4SA 4B43A 3R8CA 1G3UA 1I4DD 2HLDA 4PPNA 3CX8A 4FI3C 4D2IA 4Q7LA 3QI2A 4C30A 3WXMA 4TT3D 3L43A 1W0JA 1F6BA 2CK3D 5CYOA 1HUQA 4ACAA 2YINC 4WVFA 4D4LA 1Z0JA 3NIBA 3B1YA 2R62A 3QBTA 1SVWA 2OLKA 4B34A 2QEQA 5JWRA 2JIZD 3U4QB 3A36A 2ZRPA 3NHBA 2WZQA 2O52A 2F1RA 5KSZA 4PZZA 2ORIA 4YMTA 3U3KA 5FPYA 3OAAA 2CEAA 2QAGC 1OKKD 3MCAA 5FOTA 3ZZUA 4C7OA 1G6HA 1DE0A 4RD4A 3ZD6A 2BJVA 2H7VA 3VHLB 1JNYA 4B48A 4CDGA 4D0GA 3ADKA 4UXJA 4IOKA 3MWJA 3CUEF 4IHQA 2G77B 4DLWA 3EWSA 1NBME 3B1WA 1T8UA 2ZRDA 2PLRA 3NBYC 4G0NA 5FL3A 4C9BA 4HAZA 3BB1A 4XH9B 1TF5A 2WV9A 3IHLA 1IXRC 4DUGD 2Q3MA 5CK5A 1E0SA 2CHQA 1KJYA 2H92A 3H0KA 2IWHA 2CDNA 4A6PA 4F7WA 1CR0A 5KOYA 4C0JA 3P27A 3HYTA 3NXSA 2AK2A 2C2HA 4JT2A 1T4GA 4D0LB 3QPUA 4TTQA 3EW9A 4AY2A 1ZYUA 3VU9A 1Z6YA 1NKTA 1KI7A 1UJ2A 2NO7A 1Z2CA 3FB4A 4V0NA 1US8A 5DE3A 2HLDD 4I1OA 4FWTA 5F9HA 3CPHA 4X8HA 1W0JD 2QRNA 4JYCA 1LFDB 1Q1BA 1E79A 4HDCA 4KYUA 1BOFA 1IQPA 2GVDC 1XD8A 2GEVA 2OLJA 4ABYA 2VQSA 3AVXA 5EP3A 1W36B 2FGKA 3VR2A 4BZXA 2HEIA 4AYXA 5CB6A 2O0KA 3AVPA 2O8BA 1KGDA 2GCOA 4B6EA 4HB3A 3OAAD 2DHRA 3ICEA 5B2ZA 4AK9A 3RRYA 3FFBA 4LOAA 3KUCA 1KY3A 2VHQA 5EXXA 4DWJA 2KJQA 1NG1A 1MR3F 1LF5A 1Q1EA 1UBFA 2A5JA 3EARA 3GJ3A 1ETUA 2PZGA 2VHJA 3S1AB 1KK3A 1XJQA 3HU3A 2ZAMA 2ODEA 3QQ5A 4J0QA 3DL0A 4MRNA 4RVCA 2TMKA 5E7IA 3AF4A 5EE0A 3BBPA 3K0AA 2JLZA 2DWPA 1IJFA 3AF0A 2OCPA 4M9QA 4OHWA 4BRUA 1DG3A 1DPFA 1ELOA 3I62A 1X3SA 4D0NA 2XXAB 4TYPA 1VIAA 4NYMQ 3PG5A 4BECA 2QROA 2VP6A 4POAA 4UNPA 3IIMA 3KL4A 3SR0A 4DB2A 1YZUA 4V0ME 1SKYE 1RFLA 1JPJA 2IEYA 4HUTA 3NKVA 4P4UA 4AURA 2C9YA 3BB4A 2A9KA 1IAQA 1NJGA 2CL0X 2PX0A 1E79D 1ESNA 2W6JA 4MA4A 2PEZA 1E9AA 2ZRFA 1E1QD 5JCPA 4PSKA 3R9IA 2O8CB 3QXSA 5JRZA 1VG8A 2IF2A 4URUR 1HE8B 1QHXA 2ZSFA 3O8BA 3RABA 4RFVA 2A78A 4I4LA 4QNRA 2WWYA 3SEAA 2QBYB 2CHVA 2QGZA 2ZSDA 4BFXA 1S96A 3GJ6A 1SVLA 5FL7A 5LD2C 3LXRA 4JLOA 4R7ZA 2W0MA 2R6AA 3I8XA 1KDPA 5J47A 2VP9A 4QJ5A 3GEHA 3VKWA 1SKYB 1IY0A 2WJHA 4OHYA 1OJLA 1DVRA 4ESVA 5KSYA 2RGXA 3KFVA 3A1VA 3AEZA 3MLEA 3LH5A 4Q7KA 1U8AA 2RAPA 5LBIA 2FN4A 1KI8A 2NPIA 5FOVA 4BRWA 1AQYA 2RHMA 4TMVA 1Z29A 4CF7A 3U44A 4JSYA 4OKSA 1Z06A 4LBZA 2A3RA 2QA5A 2EFHB 4Q5IA 2GCPA 2C96A 4LDJA 1VPLA 4KU4A 5AJYA 4ZDWA 3PJRA 1KSHA 3AVUA 3HR8A 4OYHA 1XPRA 4NH0A 1KO4A 2WJVA 1QVAA 5DN6A 1UF9A 1OSNA 1W2GA 2PEYA 5BYJA 3ZQJA 3K0EA 1ZM7A 2ERYA 5JJIA 2EFCB 5KUTA 5AUNB 3DZDA 2W6JD 2ZYUX 3EA5A 5C2JB 3T34A 3KJHA 4P32A 4CEHA 1Q22A 1XMJA 4PAOA 2QMHA 1R0XA 3WMGA 2V4ZA 2VSOA 5DHFA 3T5DA 1R8SA 2QI9C 4G1UC 4XOIA 4OI1A 1XEWX 2BBWA 4TYNA 2VO1A 1OIXA 2Q3FA 3TRFA 3PQCA 3B13B 2HYDA 1CXZA 1YZLA 2QU8A 3C5HA 2AFIE 3DOEA 4YC7A 4C4PA 1C9KA 4K8OA 1E9RA 1CJTC 3UMSA 1FMJA 2O0JA 3LX8A 5FL7D 3I32A 1R4AA 2WWGA 3KJEA 1W48A 4B3GA 1F2TB 1OXXK 2ZPTX 1G4AE 3QEOA 3FTQA 1G9XA 2ZVPX 4IVRA 4G5QA 4O2LA 4FMBB 3CX6A 4ZCMA 1E0KA 1L7VC 3ADBA 1G3RA 2PL3A 2WJGA 2YWEA 3X1XA 1DOAA 5DSZA 1RJ9A 2KWIA 5FUVA 1FP7A 2DPXA 4DLVA 3L0SA 5CJPA 1N5KA 2AR7A 2ZTSA 4DCNA 3TK1A 3ZYCA 2ZUDA 4Z54A 3J81k 3HR7A 1ZU4A 3RS0A 4CYMA 2B8TA 4V02A 3MGCA 3AQ4A 4ITRC 4DDUA 2ATVA 3OESA 3EZ9A 1E3MA 3IGFA 2DWQA 3IQWA 2P6RA 2WPDA 5KNBA 1E94E 2FE4A 4BLPA 5DN6D 3E2IA 4CEJB 3R9XA 1KZ7B 2X77A 2JATA 2BHRA 1QHNA 4DDWA 4UXIA 4XVQA 2GJ9A 4EUNA 1WB9A 5UKDA 3CPEA 4NYJR 5AJWA 3FMPB 3C41J 1VYVA 1XMIA 4Q4AA 4OI0A 4P0TA 4O0MA 2FFBA 4JS0A 1G6OA 4MGIR 4V0MA 4RZ3A 4B6FA 1KNXA 3U3JA 4NCNA 4L16A 5EJEA 3N5CA 3K70B 4ZV4A 4P4SB 3N2IA 3QXCA 5FTKA 3N70A 2JJ2A 1RC8A 1Z83A 4MDEA 3SBDA 4DEYA 3D31A 3NH9A 1R8QA 1LVGA 1W49A 4XVUA 1UEJA 5K8UA 1NLYA 2HXSA 2JA1A 2QM8A 2ZYVX 3UK6A 2IT1A 1N6LA 1P62B 1J2JA 2YJTD 1IONA 1SHKA 3SC3A 1V5WA 3PCRB 5AWFC 3TSZA 2I1QA 1JR3E 4JLAA 4MGYR 2ZR9A 1SXJE 4YQFA 3FE2A 4ZIRA 1OF1A 2QP3A 1G5PA 3KB1A 1XMSA 4E03A 4FXPA 3VX4A 1S3GA 1TUEA 2ZITA 4MQBA 4A8JC 5IT5A 1XBTA 1IHUA 2F9LA 3F3YA 1KI6A 3B60A 4HSEA 4TMKA 3CF2A 2YHSA 5JHHB 5KNCA 3HDTA 3OE7A 2WPDD 4B32A 4QHYA 4BLSA 4LJAA 4FCWA 5HZKA 5IK2D 1D2NA 1FFHA 1XMVA 4JJKA 4NDZA 1UKYA 1N0VC 4ESHA 4Z1MA 1RYHA 3RNLA 3FHTA 2QT1A 2GXAA 4ZDJA 3K9NA 3RS7A 2QPTA 4L4UA 3WHLA 4LYFA 1JJ7A 5L3SB 4QJ4A 4HAWA 3PUZA 2R6CA 3KKQA 3T15A 1Z47A 5DLQC 3DDCA 4GP6A 4Q66C 4NP6A 4CRWB 1X8LA 1KSJA 5AR1A 4BE7B 5EXTA 2WWIA 3X2SA 3BORA 2BKEA 3EZ7A 4LBVA 5KDLA 2KSQA 2F43A 3LLUA 4OQMA 1M74A 1X86B 1CBUA 1ZC3A 3AP1A 3P4XA 1EFHA 2JJ2D 4FMDF 4K46A 2C99A 4EFMA 1TNDA 2ZYWX 3BJIC 5L3RA 4RZ2A 1VG0B 4TL8A 4TYQA 5FOSA 4A0GA 3RS3A 5GJBA 3AH8A 3REFA 1KMQA 4OI2A 2VIIA 1G21E 2MSEB 2JLQA 3VFDA 2OV2A 4WA7A 2MSCB 3VX3A 1J8YF 1N2CE 2YOFA 4Q4JB 4ARZA 2QENA 3Q7PA 3IIJA 4LJ4A 2WIBA 3C8UA 3E1SA 4PXAA 2QAGA 1NRJB 3QKSB 2G6BA 2V6JA 4R98A 4QKQA 1QDEA 5A4JA 5D3MB 5LDDC 3JVVA 1H8EA 5LPNA 2F6RA 4GFDA 1EWQA 3RC8A 3OE7D 1WXQA 1GSIA 1YRAA 2E9SA 2Z83A 3DPUA 1TEVA 1S8FA 3CZPA 4EIWA 1XEXA 3THYB 4Z1MD 4HYYA 1E4VA 1QG4A 3L8ZA 3RRMA 3L0PA 4TQUS 3T1VA 4AYWA 3PUYA 3R20A 5TARA 3GJ7A 2UVQA 2YC4C 4PQFA 2MMGA 1F2UB 1TMKA 3B9QA 4DVGA 3CO5A 3GJ0A 1NG9A 2QT0A 2KI5A 3A1TA 4NPHA 2O8EA 4A15A 1AN0A 2J45A 2WJIA 3B6EA 3A1UA 3I8SA 5DYGA 1GNRA 3U7GA 2JASA 2PZFA 1HQYE 3QF4A 1T5LA 4JLJA 1TQ2A 2O8FB 1N3BA 4Q1CA 1UM8A 4XIGS 4MRVA 4NZYA 1YZGA 3ZLJA 3MWYW 2C9OA 4DLRA 1TQ6A 4YMWA 4LSGA 3P4YA 3TQCA 4C3ZA 3K9GA 1M1YE 2IXFA 4PHGA 5FBWB 3TW4A 3GLFE 3ND8A 1FQKA 2HYIC 4ZI2A 5JCZA 1GVNB 4EJSC 1H8ED 2YWGA 1E2HA 1ZMXA 3QKTA 3OIWA 1JXOA 2RGAA 4AI6A 2A5FA 1ZM4A 2FSGA 1CIPA 4L9WA 1UKVY 1QHHB 4FMDB 4C0HA 3NBXX 4HEJA 5FH9A 1YR8A 1MOZA 3LX5A 2J9RA 4JVLA 1T91A 3PENA 2PBRA 1PLLA 2JLSA 4LUCA 4MYUA 4IVQA 2ZR7A 3EIHA 4OK6A 3HU2A 1XX6A 4TWZA 1TUIA 1YR7A 3SQWA 2J46A 3R7WA 1JEDA 3GP8A 3IBYA 1ZBDA 1MO5A 2ZUBA 4MYCA 2QNRA 1U8YA 4JIMA 1WBDA 4XD7A 1ZVQA 2HV8A 4WXRA 2R6DA 4DSUA 2H16A 1R5OA 3SHWA 2ZR0A 4MKFA 1O87A 4I1SA 3GLFB 3GLIA 4PQRA 2GKSA 4B3XA 1U99A 2CMKA 2V7QA 1EGAA 2WAYA 2FV8A 1L4UA 2FOLA 3CNLA 3GEEA 3WYGA 1N6PA 2QMEA 4JL6A 2D4HA 2G1KA 2ORVA 1QHIA 4DBLC 1PJRA 4G5SA 4AWXA 1LY1A 2NPFA 1D8TA 1ZINA 5B58C 4YDSA 2GETA 3H1TA 3BH6A 3O8DA 3V9PA 2OCBA 4RD6A 5ANRB 2WSMA 5FTLA 1RIFA 2BOVA 4HZUA 2FG5A 4A2WA 1GM5A 3THXB 5EP1A 1ZAKA 4JLMA 2GTPA 2GVZC 1ZM3A 1D6JA 1COWA 2ZE7A 4FCVA 3SJZA 1GRRA 2J5XA 4W5HA 3T06B 1X8KA 4WBSA 1I2DA 1O3YA 1B23P 1OH7A 4TTPA 3QBVA 4ZCLA 2IYRA 3BFXA 4Q4HA 2IX3A 5KPDA 3MWKA 4QG7A 3V4RA 2VP2A 4DJTA 1Z6XA 1EX7A 1NN5A 2QQEA 4LWZA 4TLDA 3THWA 4QBIA 2HUPA 1CRQA 5EZ5A 5JSZA 2Q6TA 4OJQA 3DHWC 4A1FA 1CJVC 1MO3A 1KK2A 4BEBA 1Z0FA 3K0FA 2CCKA 2Y8EA 2FPMA 3ZIAA 2BM1A 3VAAA 3VR1A 4XD7D 3TVTA 2ZRBA 4GOJA 4C7OB 1G3QA 4TMXA 5K8TA 1RPZA 1T6NA 4TYYA 2IWRA 4LJ9A 5E7MA 2QN6A 3GLGA 3HPQA 2OCAA 3ZZ0A 1E2FA 3AF3A 3RYTC 1G41A 4KV9A 4AG6A 2NMVA 1GITA 1ZCBA 3CRMA 2G1JA 2V7QD 3Q9LA 2WMOB 4LK2A 4NU0A 4QBFA 3T1OA 3NEJA 4MKGA 4QGHA 2NIPA 2R6GA 1U0JA 1Z8FA 4V0KA 3K09A 4A0RA 1V43A 2VF7A 3SFVA 3SOPA 2D74A 2NO0A 1U90A 2VPPA 1WDTA 5J4VA 2CNWA 1XD2B 1QHYA 2GRJA 2OCYC 1U9IC 1S3SA 4PPGA 1BYIA 3GFPA 3Q85A 5A0FA 5HKKA 1AKEA 2A2ZA 3ZVNA 4EQ6A 1K5GA 1WA5A 4BFZA 4LHZA 1ZNWA 1NF3A 1KYIA 4FINA 1G7SA 3OZXA 1QRAA 3VNVA 1COWD 4PPQA 1W0KA 2BKUA 3L2OB 2ZRJA 3AM1A 1CP2A 1US8B 2GDJA 4C0LA 3IEVA 1WF3A 4M53A 2C03A 3QNUA 4Q19A 2QTFA 4EAQA 1E2NA 4M1MA 4TL6A 4TL7A 3AP2A 5FOWA 2IC5A 4URYR 2LWIA 1S1CA 3RLFA 2CVFA 4DCUA 2IK8A 4YMVA 2DR3A 1E1RA 3DEFA 2QY9A 4R9UC 1E9FA 3FMIA 2V54A 3GMTA 1G4UR 1YVDA 2RGNC 1XJCA 4JVNA 3VNUA 3ICQB 2AK3A 2IXGA 1U2RA 4WIAA 2GCOB 3ZIAD 3MJRA 2CLSA 2DY1A 1B0UA 1LS6A 1AZSC 1Q1QA 1XTSA 4PX9A 4Q01A 2EVWX 2GJSA 3TGPA 1OV4A 3CH5A 3CONA 2H57A 5HE9A 1ESMA 1S9DA 1MV5A 3JZMA 3VR6A 1Z63A 2ONKA 5FBLB 1NMXA 2QPOA 3EIQA 1W46A 1G8PA 2PT7A 2PX3A 3IILA 1Z0DA 2ONJA 3PUVA 5BN3A 4OHVA 3VKHA 2NTYC 1E2GA 2ZI5A 1CJMA 1G8HA 3FVQA 3ZH9B 2XTMA 1BKDR 1JQJC 4MUAA 4RZUA 1CR4A 4A0FA 3D3QA 5KO2A 2CNWD 3CWQA 3TUJC 2YVUA 4IDOA 5HKKD 2G83A 3OEHA 1XU4A 1J8MF 4JVMA 3AVOA 2WWWA 1KOFA 4B44A 2JLXA 4US0R 4LYJA 4D81A 1W0KD 2OBNA 3TIFA 1OHHA 2NO1A 2BBSA 4TMZA 3R9WA 4OJKA 3O47A 2XEXA 2AL7A 1E2DA 3SJAA 4UJ5A 4U02A 2P6NA 1YZKA 1ZU5A 2NO6A 1FX0A 1GRQA 2CJWA 8OHMA 2DBYA 2J1LA 5BWMA 4CT5A 1E1RD 2J0UB 4D4KA 2VA8A 1ZM9A 4QJ3A 5FOXA 3SBEA 1D5CA 1TU4A 1E6CA 1TADA 1S4QA 3MRSA 3SZRA 4A6XA 4A8JA 2AWOA 4PHFA 4Q21A 3ZVLA 4BFYA 2J3EA 5F3WB 3TLXA 5BXQC 1M2OB 3KX2A 4I1VA 2FSHA 2FFAA 3U60B 4JSTA 1P3JA 1E98A 2CL7X 3TUIC 2FNAA 4L15A 4JMPA 3W34A 4DCTA 3U2QA 1OE0A 5FBVB 5ELXA 3QOFA 3BAFA 4PFSA 2WIAA 1TL7C 3DZ8A 4H1VA 4B33A 1UADA 2CE2X 2CL6X 5P21A 1VDZA 5BQ5A 3WP1B 4CEIB 1HEIA 2REXB 1DO0A 3MD0A 1TQDA 1NLFA 1ZP6A 3TAUA 5FPSA 5CLQA 3SJBA 3TSOA 1E9CA 1GP2A 4DHEA 1KI9A 2BWJA 4IEIA 4IDPA 1E2PA 1LB1B 1XJ0A 2BEKA 4JJZA 5DISB 3OEHD 2DB3A 821PA 1UDWA 1DAIA 4QFMA 3CRRA 3U44B 2IS2A 4BASA 4IXMA 4BUJA 2P5SA 4BWYA 3EX7C 1G5RA 2WKQA 1JEEA 4B3DA 1OHHD 2AD5A 5JZVA 4QOSA 4M8NE 3WY9A 2J87A 4D82A 1XCPA 2OHFA 5TB5A 2ZRNA 1DAFA 4BFSA 1M6NA 4JLDA 1T0HB 4QGAA 4AYTA 2WKPA 2FX3A 4U00A 4CEHB 2VP0A 3WBKA 5JBQA 4JKIA 1NVXQ 2AXPA 2IYVA 3CR7A 4EPWA 3L82B 2IUTA 1UBCA 2XJ4A 3WMFA 1PUJA 4KVAA 3L0IB 4N0EA 3U3MA 1W4CA 2FZ4A 2N1BA 3E70C 1CULC 2PMDA 3IIKA 4KCGA 4QBHA 5CIWA 5H1YA 3SS8A 4TZ6A 1W2HA 2IYSA 3TAHA 4KFTA 2NO9A 3FKQA 1WE2A 5G3YA 2G3YA 3AGQA 1GAJA 5C18A 1NSTA 4MYHA 1BMFA 1GILA 2ZU0C 4Q47A 1GRNA 1SGWA 2W6IA 4FD2A 4NBSA 4XWKA 1RJ9B 3MFYA 1JXMA 1Q21A 2CCJA 3QE0A 4OBEA 2JJ8A 4ERNA 2GF0A 2IHBA 4RSGA 4C0AC 4DLTA 1RRFA 2GK6A 3HYRA 3KXIA 2WAXA 4DSOA 2H1LA 2DYKA 2W83A 4RD0A 1HE1C 3SDZA 3L0OA 4I1UA 3ZVRA 4V0LA 5CLLA 2C9CA 3BD9A 3T5GA 1NVWQ 2REBA 3AVQA 4M0LA 4JLPA 1T3SA 4US1R 5EE3A 1SZPA 5EE5B 1GOTA 1XTKA 2J7KA 5DNYB 2ZJAA 1ZM2A 1RE0A 4S35A 5EUMA 3ADDA 4DXAA 4QRHA 4W5JA 3KKPA 2D7DA 3BB3A 1DELA 1JAIA 4E22A 1IN5A 1LF0A 3KQHA 2EWWA 3U7HB 4Q4AB 3NHAA 4ZKDA 1FMLA 1S9HA 4LV8B 4DEXA 1NJFA 4EJSA 5IDVA 1MKYA 3ETLA 3AUYA 5JJLA 3FKSA 2DFTA 1W4BA 3Q5EA 1N25A 1P2UA 1WRBA 5D3QA 3B1VA 3WMEA 1W4RA 2PMKA 3LBNA 3G5UA 4CGZA 2GF9A 4W9MC 5FBRB 4PC1A 5JI3E 1RYFA 3AF2A 2N46A 1BMFD 1N6NA 4WZ6A 1M34E 2IYXA 1Q57A 2ZE6A 2ZQ5A 4D25A 2W6ID 1XP8A 2WKRA 2Z5FA 4IJMA 3PEUA 4Q02A 4G5RA 1ZD9A 2R8RA 2Z4RA 4XVRA 1E9EA 2ZU6A 4TL9A 3RRNA 5AUQA 1SVSA 4ZIRB 3LW7A 3CRQA 3GQBA 1QHSA 4JT4A 5KYKA 1FTNA 4M9XA 4BFTA 5EZ6B 1GWNA 3CWZA 3LA6A 1X1SA 1GG2A 4RKFA 1HURA 1T9HA 4IKEA 5FI1B 2P0EA 2ZXUA 2ANCA 3B2EA 2DFNA 3REGA 1YR6A 3K09C 4OK3A 3ADCA 2ZI6A 4FW9A 4GOXA 5JWOA 2QZ4A 4KYIB 3QEJA 2BV3A 1T8TA 1P9RA 2ZE8A 2QGNA 2P5TB 3GJ8A 2QMOA 3BK7A 1G7TA 3B7GA 1AA9A 4PR0A 5KSPA 1GKYA 1MT0A 3WP0A 4NYIR 1A2KC 3QG1A 4F4IA 2XTNA 3BFKA 4PAMA 4AIIA 3SNHA 2WICA 3FKSD 3A4LA 5KTYA 3OHMA 2F43B 4LY6A 2XNSA 3HU1A 3O8RA 2VSXA 3TNFA 3TBKA 3LFUA 2RMKA 3QXHA 1Z0KA 3VHXA 1N6IA 5E95A 4KHZA 5CJ2A 1G18A 3FOZA 1H8HA 3VR5A 4GMDA 2W2VA 2V1UA 4Y0VA 1ONBA 3Q8XB 1L2TA 1Q1ZA 4LZZA 3TW8B 2XXAA 1KSFX 3ZQ6A 2OE2A 2EFEB 2CVHA 4Q00A 1VCOA 2WJYA 2QAGB 2OESA 2ZM5A 2Q3HA 5TMPA 3MSXA 2EYQA 4YMSA 2IYYA 2BEJA 5JHGB 1II0A 2YZ2A 4H9GA 5AK0A 2QTHA 3LDAA 2QUZA 4QXAA 1OT3A 4GSYA 4LGMA 1NIJA 5GJVC 1A4RA 4RD3A 4WZAE 2ZRIA 2QMUA 3ONWA 3U7FB 3NVAA 2X2FA 4HAVA 521PA 1XEXB 4E5UA 1P75A 4M21A 3OIYA 2BMFA 2C8VA 2NZJA 2OILA 4W7SA 4YMUA 4CZ2A 1JQLB 1E2JA 1MH1A 2WWHA 5FR2A 4WZBE 4PSAA 1R2QA 2Q9AA 3LQQA 2FPKA 1F5NA 4M1YA 1AIPA 1U9IA 4A4DA 1NN1A 2OBLA 2GHIA 2Z43A 3H2YA 4JLKA 1N5JA 3GJXC 1ZCAA 3QENA 4C0QC 4UXHA 2IYWA 2MMCA 3QY0A 2ZRHA 4A9AA 2OAP1 4KFRA 3HWSA 1A82A 2B21A 2R44A 4ASUA 2KB0A 4C0BA 1KAOA 4NMMA 2Z6VA 1GL6A 4QC2A 4R71A 4JL8A 4DDTA 3BOSA 1RRGA 2H5EA 1E2MA 3WRXC 1OXSC 2VRWA 1H8HD 3P32A 4ILEA 2BBOA 3MJHA 4HAUA 4LC0A 4DZZA 2RGNA 1J99A 3G82C 4HAXA 2GBLA 5JECA 3LQRA 2WVJA 4MGZR 4ZKEA 2IYZA 2REOA 4RFSB 3AKDA 1W1WA 3K8YA 1P7CA 1CLUA 1FQJA 1II8B 2UZIR 2YNMA 3KTAA 3ZS9A 3ND9A 3GLIE 1CJKC 1SVMA 3EXAA 4IFEA 5DHAA 5J4HA 2JCSA 3GLHA 4A0HA 1W7AA 1HT1E 4M9ZA 1KMHB 1N0UA 1RKBA 1MRNA 4IDHA 1LV7A 4IFBA 5AJVB 3QXXA 1P9WA 4LRWA 1KDRA 3H86A 3NBZC 1SULA 1G7RA 3WRYC 4LHXA 2GZDA 4YLGA 1TF7A 1R6BX 4B74A 1KI3A 1SHZA 2JGNA 1N6KA 1T0JB 1SXJB 2ZAOA 1T3LA 3PUWA 4B2PA 3VR4A 3I72A 4ON9A 1L4YA 3I3SR 4DRZA 2ERXA 2CBZA 2XB4A 3KKOA 1M8PA 4UNSA 1F2TA 1I2MA 2ZJYA 3W5JA 4O3MA 4Q1FA 4ASUD 3PV0A 4KODA 3IEUA 1R0ZA 1CR2A 2GK7A 4AD8A 1HY3A 3FHOA 4EFNA 5EXPA 4HB4A 3GLIB 3FFAA 1M7BA 2G0NA 3SI7A 1NKSA 3AVVA 5SZIA 3KJGA 1JJVA 1VG1A 1VMAA 2DFLA 3GJ5A 3QKRA 4Q9HA 3N2EA 3QVVA 5AJZA 3SYNA 1PLJA 3KFXA 3GLGE 3PXGA 4HZUB 5FBQB 5SZKB 1XCMA 1U8ZA 1KI4A 4BGDA 2FDCA 2WTUA 4CEJA 3HP1A 3BFVA 3W5IA 4M1OA 4DB4A 1LTQA 2RKOA 1GL7A 4Q1AA 3DMDA 1TAGA 2HT6A 4IW3B 2D2EA 1ZW6A 1VYTA 4CW7A 4LV5B 1XTJA 3UKDA 2EFDB 2ZREA 3I61A 2ZSEA 1VECA 5H68A 4K81B 2BCJQ 2J41A 2V9PA 1BYUA 4D6PA 3THWB 1D9XA 4IOJA 1GFIA 2VH5R 1FOEB 3ASYA 2JLYA 2ZI3A 1G8FA 3RDPA 4KBFA 4P31A 3K0FB 1JALA 4L9SA 5DI3B 4OK5A 2G9NA 3BC1A 1OXVA 4H1UA 2X1VA 1QF9A 3UXMA 4BEJA 2RCNA 3X1DA 2A7QA 2HT1A 2GEUA 2XZLA 1JB1A 3U7EB 1UBEA 1G19A 3THOA 1N0WA 1YE8A 4XSHA 2ZSAA 3BWDD 3IQXA 3RHFA 1E9BA 4W5WA 4LJ8A 1FW6A 4GL2A 4A36A 4NCJA 3A8TA 3QVUA 2W00A 2E1RA 3H4MA 3UMRA 3W8RA 2OFXA 1JPNA 3SYLA 4HDOB 4DLUA 1JECA 2J0SA 5TVKA 3DMNA 5IF9A 4EQ6B 1IY2A 3NEYA 3ZVMA 2A5YB 3Q72A 2IYQA
chains in the Genus database with same CATH superfamily
4C2TA 1BHJA 3FPAA 2O8NA 1HLPA 2PYIA 4BCCA 4ENVA 1BD4A 1RZRD 2JDIA 2YC2C 5JNUA 3PPWA 1E3WA 2AG8A 3DAOA 1NVBA 4BTEA 2I6FA 5EQDA 3TTXA 5IZCC 1ZIOA 2PBZA 4IF4A 3TGLA 1E2KA 2VSFA 1W5AA 3H1FA 3QX9A 4U0KA 5K5EA 2X19A 1USKA 1QR2A 1Y82A 1ZK2A 3R4CA 2JH3A 5A3SA 1JAYA 3BCUA 3KT8A 1OPRA 4FEGA 3U17A 4EP1A 1U7PA 2IHYA 1E0AA 2AE2A 4RA9A 3P0FA 5JO9A 1ZGGA 5M7EA 5IRCD 5KJEA 4PAQA 3FUXA 3GUUA 2KBEA 3HKEA 1PGJA 3A4IA 4X1IA 4ES6A 2Q0HA 3RRZA 4HNGA 4JUIA 1AKTA 2V3WA 4R2KA 4XW2A 5DEOA 1TGVA 4YBRA 1CPYA 4ZEVA 1ZI8A 2VUHB 3ANYB 3H97A 3KHKA 3DKVA 1HFKA 4KPUB 3RREA 2I87A 4X93A 3FHJA 5EJGA 3O2JA 3AVTA 2D06A 4MARA 3TD9A 1MVOA 2PVPA 3TFWA 2W2XA 2G71A 3TZEA 4ZZ0A 1FK8A 5JTTA 4QYIA 4Q4JA 4WFIA 4PZLA 3FNBA 5A03A 4MV9A 1ZJ6A 3KCQA 1E69A 1OXTA 1SK9A 2D3WA 2VNSA 4TLMB 4JQSA 2QTWB 3G7NA 4Q1DA 1A2BA 4LF9B 1W9HA 2PSSA 3NHWA 4L5JA 3WGIA 1A8UA 2GEDA 2MSDB 2WJ4A 3HR4A 3KB2A 1KF0A 1NUQA 4ZV9A 2QD5A 3O4JA 3ROFA 2IF0A 3ZQ4A 3TIXB 4B2IA 2MINB 4PCLA 4C1BA 1E8NA 1T8PA 3NETA 5CITA 5G3ZA 2A58A 4C7VA 3G68A 3WGKA 1VOTA 2WSSA 1ZD1A 1P77A 3E7PA 5HWSA 1YRWA 3BHNA 1ZITA 1RKVA 1ADJA 2B25A 3QMPA 4DQ0A 1GQRA 1XYGA 1YZNA 2QE7D 3E0XA 4KRXA 4N5MA 1LPOA 4I81A 3P4UA 4K9DA 1NJ5A 4MVXA 4XAQA 4MQFA 2ORWA 2FSVA 1ADCA 1FUIA 3O5AA 3ETGA 3T35A 4EX7A 4MRSA 1E18A 2V1XA 2J0EA 1JZQA 1D0SA 1WPXA 2MYPA 3HCFA 1KAGA 1MC5A 4GEGA 5IKMA 3M82A 2V3CC 5I48A 2X6QA 1UK7A 1UP6A 4CI0B 4HLQB 3EPHA 5WRFA 5E6UA 2YIDA 3KQPA 1XZFA 3VOTA 1RWKA 3CNNA 4HDMA 4S0ZA 4D9KA 4DZRA 4JITA 4RL4A 5JBIA 1NW9B 3T7RA 2CNNA 1E2QA 3ER9A 2VYND 1KDTA 3LV8A 3SX2A 2PV7A 4XIYA 5C52B 3E7FA 3MELA 1R0KA 3M1IA 2R7NA 1SKMA 2JGLA 2F3RA 3DXZA 1BQEA 5TMBA 3ANNA 1ST2A 1G3IA 1I7PA 1PGNA 5TR9A 1QCDA 4B75A 1VSTA 3CPJB 4ADSG 2NZYA 5IEBA 4RIGA 4UE6A 2ONZA 1OLUB 4P36A 5A4MS 4W1SA 1Z5WA 3QM1A 1VM6A 3S81A 5K0SA 3PUXA 4TLLB 2VF8A 4M0FA 1DHTA 3EASA 2VRCA 3A9UA 1CUYA 2WYWA 2XZDA 8MHTA 4KR7A 1C9NA 4OGKA 2NU8A 2E6UX 3DAYA 3PZBA 2GAJA 1SUPA 3UWOA 1EUDB 4D57A 2Z98A 3BSYA 4OL0A 4L8VA 4BP9A 4ITVA 2PY6A 2ESRA 4O2RA 3J7TA 1OILA 3DBIA 2F3UA 1LQTA 4UBKA 2WLTA 2XGSA 3DEYX 4XCVA 1FP6A 3U6KA 1Y1TA 3L49A 4K9QA 1P2SA 3NHZA 3Q3JB 3IEKA 4F97A 5CLJA 5J4YA 3D6FA 3RVOA 3JWIA 1EG7A 4NKRA 1J70A 5FWDA 2FMHA 4MWZA 4LI0A 1E96A 1HYHA 3NDPA 1YWGO 1K86A 1RLIA 1UT6A 3E2MA 1BXKA 3P9CA 1Z6AA 1ZNYA 2HJ9A 3BWEA 3ENNA 4HYTA 1N7HA 5JS7A 1QRUA 1SY7A 3CA8A 2JIBA 5FLYA 4LN1A 5FORA 3RSCA 1B7GO 3JX9A 4GPBA 4BNXA 5J4KA 3ZD7A 2G8NA 1J0AA 2Y1DA 4U7DA 1T2UA 2GQ0A 2ZRKA 1WMFA 1Y8CA 1O94A 1A7JA 4YRKA 5B53A 4RHXA 3RJ5A 3EIEA 2IFTA 2Y99A 4QUKA 5AIAA 5F2EA 1WX1A 2GZ1A 3HEAA 4RDXA 2QLTA 1I9CA 5EIEA 3EXG2 1U4NA 1K6MA 2F7SA 3KTDA 2EJVA 4G2NA 1AOXA 5DJ5A 1C41A 3IDQA 1E3JA 3S2ZA 1P5ZB 2ZDGA 3WNVA 5JH7A 3IO5A 5B1SA 1P7YA 2Y66A 4KAAA 4BGUA 3QPDA 5D86A 4D9FA 1K88A 1NJSA 3TFQA 2FP4A 5FUBA 2AMVA 5JT1A 1WO8A 2GHRA 3ZHCA 5GGXA 1QQTA 3DKRA 2OP1A 4OYLA 1SHTX 2Q1TA 1J5EB 3BHIA 1G8KA 1IFXA 5AVYA 4NEQA 4UHEA 1PNRA 3N6XA 2Y1CA 3OM0A 5EJ4A 4AY3A 1I94B 2CLIB 4C3OB 1CC1S 4LDNA 4MUHA 5AW0A 4PU0A 4DCVA 3ZGXA 2WHXA 4Q12A 4EPRA 3UHFA 2IOFK 5EKXA 5A0TA 4DSZA 4G4SO 4F3KA 5KHLB 1E5DA 2BLNA 4JR0A 4OLBA 1W581 3AU8A 3I92A 1N3YA 5L51A 2ZJFA 4W8GA 3RFTA 4L6IA 2X8AA 4NARA 4ECAA 1GGMA 3WRXA 4ZQCB 3AFNA 2VYVD 3BXFA 2HWUA 2VTEA 3BXHA 4JVOA 1NYTA 2B6NA 2B7CA 4KNWA 1B93A 4N5IX 4B80A 2ECQA 5GOZA 3ROXA 3PC8C 2WIFA 3MIIA 3G1TA 4UATA 4M2LA 2Z2JA 3IQFA 4LX8A 4FHFA 3SLGA 4BQFA 1FU7A 2XNCA 4ISBA 3B1ZA 2JLXA 4LISA 3OWOA 5LN1A 4I50F 3E7DA 1V16B 3PSAA 5A7GA 3QK7A 4D25A 3FMVA 2FKNA 5I9NA 3GFGA 4D3FA 3UYKA 1GPH1 4BO8A 4RGQA 2H1WA 1UJ4A 2CBGA 2YMQA 1A8IA 4EJSB 5EIHA 4RXTA 8ATCA 4DVJA 2HB6A 3JASB 4O0LA 1NMZA 1HV8A 1X1RA 2RHOA 1IN7A 4HLUC 3TXAA 5IXJA 2J4FA 3KPWA 4Y1EA 3EVDA 3VSEA 4EUSA 2X9QA 2V7XA 2XNKA 3MZ0A 2QSZA 3CR8A 1S2DA 4URXR 4TS1A 3Q5DA 4U2DA 3UWKA 2GM4A 3RSLA 4IIEA 4BFLA 3QHAA 2C84A 1KP2A 3EGIA 1GPBA 3SHFA 4BZPA 3FVVA 4D41A 1NT4A 2XZPA 3QU5A 2WTBA 1TA0A 4DM4A 1NC3A 1Z08A 1QOZA 1MEOA 2NSDA 4N03A 5FI3A 1D03A 4DOMA 1P44A 4YXWD 5ADHA 2HW8A 1XHFA 1GL3A 4N49A 5SV2A 3TNDA 3WKAA 2YOGA 3ZYZA 1IOLA 1YFKA 1GNQA 4RL6A 2NTVA 4UDNA 3GRVA 2FZ5A 4MB0A 5FBHA 4DKXA 1W4AA 1GD1O 1Z6TA 4I19A 1II9A 1SA0A 3I2KA 4Q9LA 1RYZA 2G82A 4H2DA 1HNXB 3KE8A 1R0RE 4HDQB 4FDTA 4NF2A 1QYCA 3QMVA 5CIYA 1U5BA 3DEIA 3WL7A 5A0VA 1VKZA 1DIOB 3H99A 5FTNA 2RHDA 5IX8A 4P0QB 1ACJA 1E1QA 4CF4A 1OBCA 4F7DA 5IPFA 2R1VB 4TMYA 3AY6A 1A4XA 3EGVA 5EIWA 1H23A 2FWMX 3AUXA 3X1ZA 2ZWAA 3MB5A 4GMFA 1NX6A 1R5NA 1B0ZA 2M2IA 3G2MA 4E12A 3N7AA 4URVR 5BNIA 4B4VA 1S2MA 3NIDB 4MW1A 3A1WA 2HU8A 1Z5ZA 4CU2A 2OBMA 4QL3A 3CX7A 3OMLA 1DKQA 1YJCA 1FJ2A 2Y6UA 2WOJA 4J0FA 1EWRA 4UE2A 2O5VA 4J7CA 4LJ6A 1UBRS 2WF7A 2P9TA 1V7PC 2FR0A 4GPIB 1VSVA 3G2OA 4HNAA 5K3AA 3E61A 5L3QA 7REQA 1PJAA 1TO1E 2VQEB 5F98A 2V4UA 2C98A 4PZPA 1Z38A 2QLBA 2PT5A 1N4DA 4I4IA 3ZDQA 4CT4B 1MABA 3I0NA 3Q98A 2X0IA 5JEEA 1O0BA 4MUJA 4O4JF 1NY6A 3G7UA 1EIZA 3CQ9A 3KEQA 4AF6A 2XZOA 1WZNA 3IA2A 4FT4A 5M3BA 1R88A 1RXWA 4OF4A 1ISPA 1EX1A 2XQIA 4RVGA 3O82A 1L5LA 1V8OA 1YC2A 1T2NA 3F2VA 1PIWA 4C1NA 4IS2A 1RWPA 4R1MA 5ALEA 1TW3A 2FU5C 3MIZA 3O4GA 4BQQA 4ZAVA 3AR8A 4WACA 4FDLA 1KO1A 2F17A 1GZUA 3OY7A 3EVEA 1PT8A 1FTQA 5AVKA 3ED1A 1R4NA 3JVDA 4C4XA 4XB2A 4R7GA 2XCRB 1U7TA 1VIYA 1OR8A 2P40A 5ENDA 3K9LA 3BXGA 3EZGA 3R5FA 4TLCA 4ZU1X 3RASA 3RS2A 4BCBA 1CR1A 2GSDA 4UZSA 2X15A 3WWCA 1TGYA 1U7ZA 3H5TA 2VQFB 4D6XA 3F6YA 2I3DA 4RU1A 2FW1A 1S7GA 3KYJB 4X0EA 4F38A 1H2EA 1JSZA 2UUCB 5GZ3A 2X0JA 3IVGA 1M7GA 3IULA 4C4AA 3HPRA 4O1MA 4OH7A 2ANBA 2WWFA 2HF9A 3GFFA 1HA3A 2R3SA 4NWIA 3ZKWB 1IBMB 3LO5A 2RH5A 3AK4A 3A6DA 2N9UA 2GZAA 2A33A 3AJ8A 2JGEA 1E2EA 1E8DA 1X80B 3R3VA 4ZZ2A 2V8OA 4W63A 3RIHA 3PCXA 4OQLA 1M2VB 5LCXA 2A9QA 2OG1A 2ZG6A 4R83A 5F21A 4XASA 1NU6A 1PT9A 4DC0A 2Z1MA 2HOQA 3C3AA 3TTWA 1IM2A 3DO6A 1REQA 4IIDA 4PQYA 1SFRA 2PSFA 5CYPA 4B2LA 3CH4B 4ML3A 4RTRA 5GM1A 1SOVA 3MCZA 4F06A 5JZOA 5HCIA 5CVJA 1HTWA 2G9VA 2BFDB 3BIWA 4YP0A 3KJIA 5M29A 3PDIB 4XUGB 1MH9A 3DM5A 3DWEX 1UCFA 4ALLA 2IXTA 2YTZA 1RRCA 3I1JA 2ODNA 3NCTA 3FTEA 4LYEA 1SKBA 2VZ8A 1T5HX 2GCNA 1ECCA 1NOJA 2XVZA 2XGOA 4N1AA 4F8EA 2WT8A 3P9ZA 3KTAB 4GWLA 1SQGA 4PG8A 4LXIA 5AW7A 1ZGCA 1I9GA 3IMGA 3OM1A 4TV9F 3OEED 3W3AD 2C54A 5I5EA 3VNVA 5JRJA 2P78A 3ZW8A 4Z4GA 4CCWA 2J9FA 1G8YA 3WFJA 5ERXA 2XE4A 2YXEA 1NAIA 1W4ZA 5EGSA 3WFIA 4OQQA 1W6UA 4N54A 3KVOA 3PQDA 1KK1A 2Q0XA 3R40A 2EHDA 1C14A 2C58A 4QECA 3WXBA 4WJLA 2OOSA 3FLAA 3VUEA 4E5YA 5AW1A 2VF4X 3RK1A 2VHVA 1YBFA 1JLMA 3SM3A 3UOWA 4L27A 4DGQA 3T1YB 5MHTA 2VI5A 3NTOA 1RI2A 1EHCA 2QMZA 1YV9A 3FCUB 3HRKA 3QVOA 4L2IB 4O4LF 4P58A 5C35A 4ZAXA 1DBRA 4EF4A 3C5WP 1L5MA 1CJBA 5E3JA 4HGNA 5J2UA 4JAVC 4QEKA 2W6QA 3GN1A 2BE9A 2R5WA 1QAMA 4UHBA 2WYUA 5CM9C 5EG5A 1MZVA 3UANA 2Q99A 1K6EA 4AXXA 4KTTE 2FMKA 1UODA 4ARZB 1IVSA 4EKGA 2H1RA 4N6GA 3N39C 3WL4A 4GGMX 5DHUA 4N7BA 4KXUA 4F4JA 4GGOA 2ZEJA 4F4DA 1CS4C 5T57A 4IIJF 3FUTA 1H6BA 1BE8A 2D00A 4TQ9A 4LNHA 2E82A 2YV5A 1ACLA 2AUTA 2I5PO 2QZZA 3EPLA 4DV7B 3ZLTA 3G5MA 4FZ5A 2YXBA 3C85A 3CB2A 3KWJA 1UZUA 3K9BA 3WV5A 1IOVA 5CFOA 1J5PA 2PCLA 1UDXA 2XA1A 4IGKA 2W58A 1QYDA 3F67A 4H31A 3WNCA 3ZJYA 2PFKA 5E0OA 2F67A 2O8CA 3IBGA 5DULA 2ZUVA 2NWQA 1NBMD 1Y7TA 3IJ5A 5AKLA 4X94A 1NBOA 2XUAA 2QM3A 4UZFA 5DPMA 3ZC3A 4BVHA 5BVGA 1HO3A 3SLKA 2OHJA 1UWVA 4MGEA 5AUPB 3WHPA 1MQSA 3AC0A 1CUAA 1IHDA 4YTEA 3ZUGA 4M3NA 2C31A 1AQIA 1OB2A 5EIBC 1TIKA 3OQMA 2W6ZA 3ONEA 4RK0A 2YFYA 4RKYA 5LZ4A 2PUAA 2P91A 4WW0A 1C9YA 1E9DA 1JDSA 1ZJYA 5EKDA 1TVCA 3JVUA 2I3BA 1W85A 2VJYA 2X5NA 1P1FA 3EIFA 3OZGA 3V80A 4KOAA 2NNWB 2J5BA 2BEUB 2O2JA 4NR0A 2OZPA 4Z4EA 1MRSA 1BKYA 3KKKA 1L8QA 3QF4B 4Y6RA 5IHPA 3U31A 2LVBA 2VYFA 1E5TA 1N1DA 4CMIA 2I34A 1SRQA 3AM3A 3EUWA 3OTQA 3BJRA 1V11B 2FA9A 4PHTA 2ZJOA 1NVTA 4IH9A 2ZSUA 5J63A 1NUTA 2I6QA 1SXGA 3RVKA 3ZI4A 4YRRA 4EA8A 2BM8A 3KBBA 5B7GA 1EWYA 3IXQA 3QFSA 5AW3A 1T2CA 1F48A 4LWOA 2VP3A 4MW7A 4RWZA 5EWLA 4DCSA 4BWGA 1OXMA 4DV6B 3EZXA 2DMRA 4WZBB 5EIAA 3IUQA 4E1AA 2ZUEA 4XX0A 1OLXA 4Y9SA 1Q16A 3MPUA 1LCIA 3NTXA 3TLKA 4FD3A 1V0JA 4CIDA 3W7BA 3D7KA 1QIKA 3SFZA 2HHJA 3S8MA 2IS6A 4C43A 1FTWA 2HPHA 2JFWA 3VO1A 1FQOA 1GGJA 2RGDA 2Z8YA 3OLVA 4XM2A 2P35A 3BMQB 4JYPA 4Q48A 1WSDA 4KRFA 1IN6A 2GM5A 4JNCA 3WBJA 1LEHA 1DRKA 1XB2A 1IN8A 4OUDB 2GZMA 3ETEA 5IFKA 1L7MA 3BH7A 3LXXA 4HATA 4NONA 2XGGA 3L8YA 4BN5A 1ULTA 4JZKA 5JFOA 2MYTA 2O4UX 4LRYA 1KQ3A 4W5TA 3EPKA 1I5OA 1MA3A 1ZK3A 2AW3A 1EZ4A 4G0OA 3I05A 3FAZA 4MINA 5IVKA 5GJCA 3NDIA 2LZ0A 4UJ3A 5ISMA 1OFUX 4TXMA 2EG9A 4GKKB 6REQB 1O03A 2G17A 5K8JB 2M6KA 3GZNA 1DX9A 3NWJA 5BW8A 1WV1A 2O3UA 3I3OA 1QFMA 3K6JA 1RACA 4RENA 3T5BA 2GA9A 3WGGA 1WJGA 4H6VA 5KYWA 1ABBA 1DHRA 3KZOA 1FDIA 3GPIA 1BFUA 1VGVA 3FRJA 1V45E 5F52A 3ZS8A 4KFSA 1ZRHA 4MHSA 3M4XA 3GJ4A 4B35A 3DV2A 3JALA 4G0ZA 3BCSA 1FU4A 2D5LA 2I7DA 1OGJA 2DJIA 3HXPA 4J1QA 4JBLA 4TN1A 3DOFA 4UDYX 4X97A 2BFNA 4WE3A 4BMPB 4FGWA 4LHVA 1L9XA 2E55A 4QPJC 3OQOA 1IY1A 1RWMA 4DNQA 2J9XB 3EVFA 2F1HA 1ZNXA 4LXYA 3EDQA 1XHEA 3MWGA 1GAWA 1JDBB 2GKGA 4B7ZA 3DLHA 4ZHQF 2GYVA 1H65A 1ZOLA 1DX4A 4ZODA 3HO6A 3PWTA 1GA4A 1I6KA 1OVMA 4PYJA 2VDNB 4OQDA 3C39A 4AN0A 2R8BA 4GZLA 1FLNA 2X5KO 2OLEA 1GQSA 2AFIA 2JBAA 3ASUA 3EZ2A 3EBPA 1ZUNB 1P61B 5F9MA 4YRGA 1U0TA 5IVHA 1WZ2A 2TMYA 1M1ZA 3DZBA 3MUOA 3OT1A 3N8HA 5F5XA 1Y4DE 2IIPA 3F0TA 4PC3A 1L5HA 2ZE5A 4OQXA 2RB4A 5FFFA 2QK4A 2ZRMA 2ZBEA 3CLSD 2HZ7A 1QRRA 3LJKA 1A1SA 1Z0IA 3RS4A 5ITZB 4GMXA 3V8RA 1YBAA 2DLDA 2QR3A 3SYMA 4Q7JB 2NV0A 4P54A 2NUAB 1QGOA 2KE5A 4TT8A 2Z30A 1CU1A 1HLGA 3W78A 2GXQA 2NUTA 2D13A 2H2GA 4JI7B 3QVTA 1XVUA 3A2KA 2ENUA 3K1JA 3BHMA 5LNK6 4XWTA 3WLIA 4OAOA 4Q1EA 4QGFA 1SU7A 2ZYIA 3LPNA 3AIIA 4OYYA 1LX7A 2X4GA 4OGFA 1DXQA 4YAUA 4IHJB 3SE0A 2Z1DA 1K68A 3ISTA 1E6KA 5A4FS 3KSBC 4QHTA 3GDFA 5EQTA 1MRZA 2VJCA 3T5CA 1FTSA 2UZ3A 2E87A 4INAA 5BW4A 3FGZA 3Q10A 3CZMA 4AMGA 1XNJA 3NC1C 2B82A 4G89A 3NHJA 1HL7A 2VG8A 4M9UA 3OJEA 4OHZA 1PJ8A 1RAEA 4GEKA 3ZHSA 2YRWA 3V7NA 1LDMA 2MYNA 1WCIA 3JQFC 3MTEA 4IJKA 1DKOA 2PSHA 1DC3A 2FMXA 3EFHA 5LA6F 4EF6A 4LPSA 2A8YA 4DPLA 2HSEA 3PDCA 4TWBA 3VH1A 1YS1X 2HDHA 5LQNA 2GILA 1CQWA 3N8KA 1RSZA 2R8ZA 2XE7A 1QTQA 4HDKB 3QSYA 5EMHA 2IEZA 4B45A 3F7TA 3S5UA 3KJFA 4F2GA 5CGZA 4KGZA 4B3SB 3ZOZA 1Y34E 1UKBA 1JIXA 2RHTA 4PVCA 2SCUA 5JOQA 2QUIA 3QLJA 3NT4A 3D9QX 4JIGA 1XEFA 2YN4A 3FBTA 1B3RA 3KT3A 1YRLA 3P97A 3QFRA 1GG5A 1YQTA 2LCFA 2QF7A 3LHDA 4GP9A 3EGOA 5HQJA 1YC5A 3LD9A 1ZDMA 3VR3A 2XUQA 4ACBA 4US2R 4KVFA 2H18A 2I3GA 1QYIA 2M98A 1GZDA 4RLQA 5EGNA 3SNKA 3V8NA 3WBFA 1F0KA 1KMHA 3H3FA 1F1JA 1BH2A 1NVFA 2JFQA 2XJ9A 3GGOA 3OOJA 3FOWA 1WKCA 1YJXA 2V9ZA 4MWTA 3USCS 1XRSB 1DAEA 1V8BA 2EAUA 3LU1A 2OT3B 4NBRA 4NG5A 2OO5C 4JI3B 3G0HA 1EESA 2AFVA 1CEEA 1JH9A 2RH9B 1JR3A 3DZJA 4PSDA 4YRCA 4MRPA 3RT9A 3A6KA 5IN5A 3RC3A 2HBYA 4V03A 3RVNA 3VO2A 3K9FC 1NNLA 1K2WA 2NGRA 3P8ZA 4WBNF 4YT5A 1KQGA 3EC1A 1EUZA 4IYRA 3L4SO 1WMSA 3ED5A 2CC2A 2H7XA 1Y6FA 2PD3A 2AV6A 2ZJBA 3GAMA 1M0WA 2YHBA 5LB4A 3VZRA 3V8QA 5KOHA 4L7QA 1RYMA 3LQ2A 3CUYA 2RKBA 4MW6A 5ETJA 5JMOA 2DPLA 3ITEA 4YWHA 2ZJ8A 4F3RA 3KV1A 3KPJA 3DOCA 3WK6A 3BX1A 4IIHA 1NHGA 1EFDN 2I3AA 4LRTB 4Z2YA 5BQXA 1OIWA 3SWWA 3ELWA 1RHQA 4G5HA 1I0LA 5E38A 3M6IA 1QB7A 3PJEA 5DYWA 1SQ5A 3BILA 1EX9A 1AUQA 2BTQA 3P1JA 5K3DA 1QKKA 3DV0B 1HM5A 4I36A 3DWFA 1U7WA 4RKRA 4EL0A 3EDCA 2R86A 2FX2A 2GYUA 4JCCA 4MKZA 2PLAA 4QGGA 4JJFA 4FVTA 5ALIA 3RQSA 5JMPA 1C8VB 3IAXA 3SC2A 1JFTA 5GGYA 2OM6A 2DWOA 2B37A 4DCOA 3LUGA 1XF1A 4BNVA 1XZ8A 4KWHA 3G2NA 4YIKA 3WVNA 4AY6A 3QE3A 3EEIA 4EB6B 3PFIA 2VC2B 2H5LA 1XXLA 3FPHA 3T7EA 1M10A 2HJVA 4TVOA 5M5BA 1DZIA 1XWWA 4S1PA 2NW6A 4KQIA 3SHVA 3B7WA 1OH6A 1X0XA 2BZSA 1OU4A 1Q84A 3UJNA 2BTEA 1TAHA 1N2CA 1EHIA 3CKKA 4PZAA 5T41A 3RTDA 3TR0A 3HUDA 3ZE6A 2XSZA 7ABPA 1TE2A 3QEMB 4EZIA 1HQCA 4CNQA 3QXJA 4AJKA 1XEWY 3ORQA 4CMBA 1JR2A 1ZIPA 1UXGA 2ZUCA 1N2JA 2OCXA 1EFTA 2IPMA 2OL4A 2SBTA 3CMCO 3F3MA 1IZZA 1YZTA 3G0CA 4IJUA 3R0IA 5F1OA 1E1CB 3F98A 1Q7GA 1S1MA 2IYFA 4OB7A 3VXKA 2AOTA 5AT1A 3NNSA 5KNCH 3IOCA 4TRNA 2B8WA 1XNGA 3AY7A 1WQ4A 3IAS6 3NWBA 1TD1A 2BFEB 2PMEA 4RDCA 3WDMA 1WMBA 3GO4A 3KUDA 4JQZA 5D51S 3M9XA 2GM3A 3V2UA 1DUVG 1N2SA 1P7WA 3ICWA 5E6SA 1NBAA 3AJRA 3OQIB 3UVEA 4AZSA 3W6PA 1QWSA 1RPAA 2P6UA 2YVLA 3FYUB 3KWMA 3V4PB 3LUDA 3DLTA 3ZWAA 2ZIXA 4NEGA 3JTMA 4UEJA 2XYVA 5KCZA 3DT6A 3UG6A 3HVHA 1HDCA 3RF7A 4BV2A 4EA6A 2UYCA 2VT7A 2F48A 1AM4D 2QHXA 1RAHA 3VVBA 4G84A 2Y77A 3HUUA 1TYDE 5ESXA 2PUTA 3IUYA 2CK3A 3E53A 3EFOA 4XOUA 1SWWA 3CUKA 4YMHA 1W76A 5G40A 5KU1A 2UZ4A 1ATZA 1YXMA 3FNHA 3CEPB 1DPGA 4KK3A 3TBHA 3BREA 1IG0A 3OOYA 1R4ZA 2O3RA 1CYEA 2JIZA 5GJWC 1EG2A 3EOBI 4DB4A 3NW9A 4LSWA 2YFKA 5JARA 2O7QA 1PBNA 1S2NA 3A9SA 3A27A 4AY4A 1EK0A 1OKKA 2QORA 4PTLA 1PUIA 2F62A 2OK7A 2DUUA 4N5HX 4OMCA 4EHLA 3NHPA 4FFBA 3CXUA 2PJRA 2Q1XA 4LCBA 3PTLA 1PNQA 1VIVA 1Z4MA 3I28A 4KE9A 4BMYA 4DRXA 5AUOB 5KTRA 2P9QA 2H65A 4UHJA 4ZD6A 4A82A 3VA7A 2B1QA 2BGRA 5DSXA 5DVZA 1JWBB 1SUFA 4MCJA 5CNMA 2F8MA 3DMTC 3G2HA 2V6BA 4B40A 5KKAA 4PO8A 2D0OB 5CVUA 2HRRA 4HNHA 1W5TA 3W4JA 4RTKA 4I5DA 2GO7A 4O2BB 1A77A 2YZKA 6LDHA 3FPSA 1TYBE 1HDEA 3UWPA 4DCMA 1D4OA 1QIMA 1W87A 2WJZB 5FTJA 1U1FA 3TEMA 5E1OA 5KC8A 2PLFA 4B1FA 3U3XA 4FX5A 1K8YB 2WG1A 2H8KA 2JZNA 2NZUG 1CZOA 1GCGA 3QBEA 1V9CA 3TUZC 3U61B 5BUQA 5FFMA 4FNOA 4ZAGA 4HR7A 4KYTA 2B83A 1J97A 2VTBA 4PLVA 3WC4A 3JAMA 3PUHA 1I4DD 2YR0A 4FI3C 1ZQ9A 4QASA 3EXFB 2JIDA 4Q7LA 3SVZA 3U7JA 3WXMA 4LE0A 5ALMA 1W0JA 3X44A 5CYOA 4J16C 3OX3A 2NZWA 4LRSB 3V6MA 1Z0JA 3GF4A 1WDWB 4P82A 5HF8A 2QZSA 2R62A 3QBTA 5AKKA 1SVWA 2OLKA 2Y3IA 1Z0SA 4M0KA 1E3TA 4U7FA 4UVIA 1MF7A 4PAGA 1Y3DE 2JI6A 5KI6A 2QQFA 4ZYZA 3Q11A 2ZRPA 5JD6A 3Q1LA 1NT2A 2HM7A 2WZQA 2WWRA 3DFIA 3L0DA 5KMGA 3JTEA 2ZYHA 1RRMA 2JCYA 5CB4A 4MI6A 4FHCA 4E1VA 3ZZUA 3EF1A 1WUTA 4C7OA 1BX0A 4S1WA 1G4HA 2H7VA 2R00A 3HJTA 4MPPA 3IMEA 3QOWA 4B48A 1JA0A 2I67A 4G4JA 4HN9A 4OQZA 5CM2Z 3NVMB 1H1TA 2IUFA 2HIAA 3CZ5A 4MUFA 2YDYA 1T3GA 3KAQA 4Q39A 4IHQA 3DZKA 4MVJE 2C7BA 4BUZA 3ZY6A 1ULZA 3DL4A 1RU3A 4PYLA 4C9BA 3PQEA 4HAZA 3BB1A 5THKA 4JU9A 1G98A 1DQZA 1TF5A 2WSYB 3BL6A 4XH9B 3WLJA 3NWEA 4AMUA 5JQGA 4FYYA 4GR9A 3PLAE 3I9KA 2O3QA 3ABOB 4TXLA 2Q3MA 2A7XA 1KJYA 3H0KA 3TQOA 3HJRA 1RXYA 1T34A 2QLJA 3KOZA 1XDSA 1FFSA 4LEIA 4B3TB 3TNLA 1H85A 1S01A 5B36A 1JLLA 1T5BA 1VA4A 3AUAA 2VVTA 2CXSA 2OHIA 1LTHR 2D5AA 4HGQA 1Z6YA 1D4ZA 2I22A 2WW8A 3VU9A 2NO7A 3NORA 2REQB 3FB4A 1MB2A 1US8A 4V0NA 2C3YA 2X8JA 2C83A 5DE3A 4XGNA 1ZUWA 3QTLA 1MB4A 2FFRA 4UD6A 1JQKA 4J6EA 1MPXA 3CPHA 5F9HA 2QRNA 3Q2OA 3ER8A 1BXRA 3SF8A 1L5OA 4OD0A 3EXEB 1E79A 4HDCA 4Y7CA 4EI8A 4KYUA 3PDJA 3VZCA 4KI7A 4ABYA 2VQSA 2RI6A 4UBLA 1W36B 1IULA 1LBSA 3WJ7A 5E2AA 3VR2A 4NMLA 3ZGZA 4UM5A 2FUKA 2HEIA 4HZGA 1JG1A 2O0KA 4BO1A 3HMKA 4L8YA 4HH4A 5I6DA 2WJAA 2O8BA 5ALTA 1KGDA 3EQ9A 5K51A 4HB3A 4IWXA 2QL9A 4BMCA 3P9RA 5CCEA 1UR5A 2XAAA 2AVDA 4AK9A 4XPIA 1KVSA 2P1DA 4C6HA 2VHQA 4MLCA 4DR6B 2WSLA 1MR3F 3VPCA 5KTOA 3UH1A 3N07A 4PIPA 1XKLA 4K9SA 1V47A 2IEBA 2B36A 4UMDA 3QWBA 2ZBUA 4UE3S 3D6MA 3HWRA 4WGFA 1M75A 3T7CA 4KAJA 4MV7A 3HU3A 4J0QA 5FWXA 5C8DA 5IASA 2H4HA 3DL0A 4RPKA 1KQNA 1JEYB 1W5BA 1P6UA 2JAPA 1G20B 3PRHA 4EY6A 3AF4A 3BBPA 1H2FA 2ZKLA 3D54D 3N6VA 3VNQA 1QP4A 4W9RA 5ELLA 2WF5A 2Y4OA 3AF0A 4OHWA 4ZGBA 1VL5A 2PWAA 2W9XA 5ALNA 2R7LA 3OMXA 3I64A 5K3OA 4B3RB 3SSNA 3AZPA 3PGKA 3GBVA 4KTVE 1N9GA 2XXAB 1VIAA 4NJEA 3PG5A 1U8XX 2XQFA 1ZMBA 2QROA 1RPNA 4BECA 1FLDA 1DCKA 4OLHA 4BTVA 4C22A 1HNWB 3VZPA 3U9SA 2W2LD 3PL1A 4LOHA 4DC1A 5IH3A 3D6JA 2EZ8A 3SZUA 4C7KA 1RFLA 2IYOA 3QBJA 1VBNA 4ZOBA 4CL8A 4HUTA 4YIHA 1AKVA 1QYVA 2C9YA 3BB4A 1P4JA 2CZGA 2PX0A 4RF5A 2DGDA 5FIUA 2ZTLA 1KYTA 1O4VA 3NHUA 4OJYA 1EM6A 2WFLA 4MRMB 2B9VA 3PVCA 1B8UA 2PEZA 4CM5A 4XVCA 2XMCA 4XEUA 4X7MA 3QXSA 5JRZA 3B20A 4F6RA 2VH2A 3RYIA 1V1RB 2XMBA 1GZ4A 3RABA 4HWTA 1KERA 1ZOSA 4TWIA 5A6VA 2XDWA 1QK3A 1JDBC 5AI0A 3AWIA 2WU1A 2P3QA 1PYOA 4ALNA 4KQ9A 2ZSDA 4Q37A 1BMQA 4BFXA 2IH5A 4XVHA 1SVLA 4GPZA 5FL7A 5KYXA 1GCAA 2C4VA 2EERA 3GZTB 4UFPA 1F6DA 4R7ZA 3L1IA 2W0MA 4GQAA 4B3JA 3VU8A 5CVTA 3I8XA 1JHUA 3L84A 4Y9UA 1M54A 4ZI5A 5HCUA 2WMDA 3OJXA 4QJ5A 3G9TA 2ISQA 4LVNA 3ETCA 1A9TA 3LIPA 3R1IA 4IJVA 1HORA 1DVRA 5LP6F 2P9FA 4RH0A 2RGXA 2YRXA 3COJA 1X7WA 3DOOA 1ZH8A 4H15A 4Q7KA 2WB2A 4FE7A 2PMCA 3U49A 1RXUA 1Z29A 1DWPA 1Q92A 3KTOA 4N9WA 1Z06A 5EPUA 2EW2A 3F46A 5CPBA 5E9AA 3FWKA 4J43A 5AJYA 3LPMA 4CV0A 1N1MA 2OZLA 2VUSA 1M9NA 4KP7A 2LW7A 1KSHA 1G0OA 1RTTA 3LDFA 2G08A 4OYHA 4P7JA 1O6GA 4XWYA 1GUFA 3A26A 5DN6A 1OSNA 4QODA 2ECFA 4BGIA 2ERYA 1BZYA 1K9SA 3NP7A 2EFCB 1W8DA 2N3ZA 1NBHA 3ZI0A 1ECJA 4URFA 3ZWBA 5AUNB 2W6JD 3EA5A 3G0IA 1OZHA 2HWWA 3NOOA 1GNSA 3TIIA 3EHEA 2UXBB 2Z6QA 2QMHA 3IP6A 4H7PA 1D0IA 4Z3DA 3U9LA 4BV3A 4HEA6 4DLAA 5CCXA 3HJAA 2V4ZA 1P0CA 2I1WA 4A8HA 1KEEB 5HOEA 4CI9A 1Y33E 2OGUA 2WZCA 4KMRA 4BQRA 4TYNA 1OIXA 4X9XA 4A2CA 1BTOA 2QU8A 3FPBA 4MJ7A 3ZGVA 1GGFA 3DOEA 1CDEA 2BFCA 4YC7A 4C4PA 1E9RA 2ORYA 3WG9A 2O0JA 2ZQZA 2O06A 2HX1A 2ID4A 2OVBA 3UT0A 1DJMA 3OFJA 3RO7A 2DH5A 1G4AE 5I9SA 2R8XA 1P0QA 1G9XA 5A3VA 2ZWMA 3CX6A 4HXGA 4QLAA 1GDTA 2QUAA 3ZWWA 3L79A 3KZCA 5DSZA 4PYMA 2CSUA 4PZUA 3A2NA 1FP7A 4WHMA 4AP5A 1RYEA 3H2ZA 2I9PA 1FS5A 4DMGA 1N5KA 4ZFNA 2AR7A 3AFOA 1FSZA 4UQPA 4DCNA 4E33A 4Z54A 4P35A 2ZUDA 2PGAA 4HEHA 4J0KA 3A3KA 4QE3A 4OGWA 2ZUWA 2B8TA 4V02A 3MGCA 1H2YA 4TUYA 3LQFA 3OESA 3VDRA 5AVXA 3IGFA 1OLSA 3BMCB 1VPWA 1E3MA 1BDJA 3FWZA 4LNUA 3KOUA 4YVFA 3RBVA 3FDXA 1RRVA 1E94E 1YHYA 5EVCA 2UZAA 4OATA 3E2IA 4CE6A 4F2HA 1QS0A 1KZ7B 2I78A 3OQNA 3E03A 3K6RA 4NJMA 1FUEA 5KVSA 2C5SA 4UXIA 4F12A 3KS9A 4EUNA 5BQPA 2ZUUA 5UKDA 4EI7A 4AUEA 1U6KA 3PEFA 1TLTA 1BFKA 3AETA 1TQHA 1ODCA 3FMPB 3N8NA 5AJWA 4EB8A 5A9RA 1VYVA 1XMIA 1YONA 2K2WA 4EMUA 3BKWA 3G85A 3H7IA 4O0MA 4Z4IA 4JS0A 4MGIR 1EP3B 2GR9A 4V0MA 4OGLA 2HUNA 3VPXA 4C87A 1J22A 1HC7A 1GGVA 3BJEA 5EJEA 4K05A 4DDKA 4RO0A 3GVXA 1WD7A 3ZDBA 3D3NA 4QYXA 4HGRA 3N2IA