2OEPA

Msreca-adp-complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
325
structure length
324
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLEKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
total genus 76
structure length 324
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oepA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oepA01
1R0YA 3RHFA 4JVMA 1BYUA 1W1WA 1P5ZB 2VP2A 4RSGA 1KAOA 4EQ6B 2VHTA 1EFTA 1EFUA 2D4HA 4FN5A 2Q3MA 2Q9BA 3EC2A 2BC9A 1N6OA 2ERXA 2IYTA 1F60A 4BZQA 4EQ6A 1SZPA 4XIGS 3A1VA 3IEUA 2WPDA 4DSNA 1DS6A 1E94E 2FFBA 4HLCA 1OB5A 2GAAA 2OFOA 1CR1A 3DO6A 2XEXA 3HR7A 3L2OB 3CX7A 4QM6A 5CYPA 5EXXA 4LX0A 3HR8A 1YZQA 2ZRHA 3ND9A 1UJ2A 3GLIE 2XAUA 5DIFA 2RH5A 3C5CA 1M7BA 4D81A 3I5XA 1VYVA 4MRNA 1FMJA 2ASEA 4GOJA 5EP1A 3RS0A 4DCUA 4A0FA 3CRVA 2ZEJA 1YQTA 2WAYA 2A78A 3ASZA 4OHXA 4AWXA 1E9SA 3TMKA 1OW3B 4GI7A 1EWRA 3KB2A 3PQCA 2IL1A 5DHFA 2IUUA 2PX0A 3ADKA 2C98A 3ZDQA 3C7KA 4NKRA 2QPTA 3EARA 1T8UA 1U0JA 5DISB 4ABYA 2ZI9A 5DI3B 2XITA 2R2AA 4JYCA 1VG0B 3WRYC 1T5LA 3KQNA 1BIFA 4RCYA 1GL9B 2GJ8A 2NPFA 2VF7A 5DI3A 5EXSA 3EG5A 3HPRA 2WJGA 1TQ2A 3GJ7A 3TE6A 2XTZA 1S0UA 3KXIA 1OHHD 3WBKA 2J0VA 3HYTA 4RD0A 1RC8A 1S4QA 3GJ5A 4QGAA 1GL7A 2WPDD 2ZU6A 2ZYTX 3KQLA 4M1SA 1KK1A 2ZI7A 5DE3A 4DLVA 1VIAA 4NYJR 3LW8A 1F5NA 2FFQA 3I61A 1LNZA 1KZ7B 1CJTC 4QNRA 4ASUD 1CIPA 1L2TA 1QG2A 3TH5A 4I1UA 3SS8A 1T3SA 1LVGA 3FGNA 5EP2A 5KNBA 4TQAA 2HEIA 3CONA 3THYB 4OQXA 2F1HA 3M4YA 4D0GA 3W34A 1PLJA 2F43B 1DOAA 1FPMA 3I72A 4TTRA 5C18A 2XZOA 4U02A 2F3RA 3EPJA 3THYA 3W5IA 3GEIA 1Q12A 3AVUA 2F43A 1M74A 1GVNB 2VTKA 3UATA 4XSGA 1W2GA 3A8TA 2XGJA 1ZRHA 1ZCBA 5DHAA 5EUQB 3EC1A 3SEAA 1JEDA 1ZBDA 3VQTA 2VF8A 1QHSA 1E99A 1Y63A 2IYYA 5FOTA 3A36A 3GLHB 1K8RA 2WV9A 2CBZA 4MYTA 5G40A 1DTSA 2OSBA 1CR4A 3TGPA 3UWKA 3FKSD 3MWYW 3GLHA 3Q7PA 4M21A 4D4JA 2FZ4A 5LB4A 4C0KA 1R0XA 1SXJD 1DVRA 4NYJQ 5JHHB 4DIEA 2R6AA 1LS1A 4LSGA 4EPTA 1E4VA 6Q21A 3L8YA 4LDJA 1T9HA 1ODFA 2G88A 2GEUA 4IOMA 1W36D 2G83A 1WDTA 3WHLA 4DDVA 1KZGB 3K1JA 1CS4C 3LBHA 4NU0A 4V02A 1G9XA 4B76A 4LBYA 4Q18A 2Q9AA 1P9RA 3DMNA 3LLUA 4RKEA 3T35A 3MWJA 2FPMA 2QQ0A 4LJ9A 4PO1A 1ZC3A 3UG6A 3KJIA 2BVNA 2G1JA 3K09C 4AI6A 4TL6A 1P7CA 1NIJA 1D2EA 4JMPA 1NBMD 2WIAA 4D6PA 1XPUA 4P33A 3TKLA 3NWJA 4DEYA 1KSHA 3A4NA 2WAXA 4KU4A 3BB4A 4I99A 1JB1A 1KOFA 4AC9A 3B1ZA 3NDPA 5DH9A 2Z4RA 4AG6A 3WP0A 1SVOA 3WYGA 2W6IA 2ZETA 4BFVA 5TY0A 2A5FA 4JVLA 4I4LA 3K9HA 1U98A 4KFRA 2P6RA 2ZRAA 4IJMA 1NP6A 2ZS9A 1XZQA 3KUCA 1NY5A 2XOKA 4G5GA 5BN4A 4XVRA 4EFMA 5J4HA 1NKTA 3K70C 1US8B 5KSYA 1TEXA 4QBIA 2VP6A 3WRXC 1Z2AA 2GK7A 1YE8A 2Q21A 2RHDA 1RYFA 3SZRA 3QOFA 1US8A 4PO9A 2QORA 3MJHA 5FOSA 2OBLA 4A0GA 4BGDA 5EP3A 1JNYA 1HTWA 3B5JA 4NCJA 4GL2A 3W6OA 1KDRA 2VSFA 2GZDA 2O5VA 4Q4JB 4EPRA 3QI2A 3UXMA 1IXSB 1IJEA 3AP2A 4BFUA 4E5UA 2BIFA 2WM9B 3BH0A 4BUJA 2NO0A 2BKUA 1RKBA 2IT1A 4IEIA 3N2EA 4Q4JA 3P4YA 3SJZA 3GPLA 1MO4A 4BRUA 4LHXA 3J81k 4C30A 3FHTA 5AWFC 1DO2A 4EPYA 4PPFA 3K09A 1XJCA 2KJQA 5P21A 3A1UA 1KHTA 4YMTA 2FFHA 4UKDA 1Z06A 4X8HA 2RGAA 4IW3B 4D82A 4PTLA 3U7FB 1OB2A 1SULA 2D62A 4LV5B 1E1RD 1IJFA 1KI2A 2CNWA 4RZXA 2HYIC 3WBJA 2UKDA 1UBFA 5EE9A 1VMAA 4CT5A 2G6BA 3TAHA 1GTVA 4M1TA 3VHXA 5E7MA 2BBSA 1KY3A 4OJQA 1DEKA 3EX7C 1JR3A 3K70B 4JJZA 2WOJA 4E09A 4KJZA 1TNDA 5G3YA 1R5BA 1DAKA 3TUJC 2J9RA 2NPIA 2CL7X 2E1RA 4DIDA 4XWKA 1LS6A 4OHYA 4B43A 1KI7A 4TYPA 4W7SA 4B6FA 4D4MA 3Q72A 5KNCA 1E2NA 2W83A 3ADDA 2BBWA 5JEDA 5K8TA 4TYYA 2VHCA 5FBQB 1MRNA 3CIOA 4R9UC 1HH4A 3R8CA 1AS3A 4BEBA 2BOVA 1VYTA 1HE1C 4I1SA 2OBNA 2JJ1A 5DI9A 3K0EA 4IDPA 2WWYA 3VNVA 4LWZA 2QA5A 3EZ7A 3SR0A 3F3YA 1CKEA 4A6PA 2QGZA 2V7QA 2AFHE 5D3MB 3W90A 1XMSA 4KI0A 2V1XA 3VKWA 3TUIC 3AVPA 1KSGA 2KB0A 2FPKA 4XTRA 5DN6D 1W4RA 5FTLA 5D3MA 3EIEA 1TU3A 2YOFA 5LDDC 2H57A 2QG6A 2V54A 2QROA 5C46F 4BLQA 2RGNC 1WBBA 3RLFA 3O8CA 3U61B 3U3OA 4UXJA 1FMLA 2WKPA 2CE7A 1FTNA 4V0OA 1P73A 2JLQA 3BS4A 3OEHD 3VKGA 1A7JA 4O2LA 4JL5A 1KO7A 1S1CA 2J59A 4NCHA 5FUVA 4C0QC 3QSYA 4D4LA 1A4RA 1LF0A 3CR7A 3HWSA 4ON9A 2Z5FA 5LB2A 1UADA 2FH5B 2IWHA 1G6HA 2TMKA 1Z63A 3P32A 3THOA 3ZYCA 4DKXA 3NC1C 4KFUA 2FSHA 4DLWA 4ERNA 3AVYA 2FV8A 1Z6YA 4RZUA 3UK6A 1XTQA 1M7HA 4CDGA 4M1KA 3BGWA 4LYAA 2B6HA 1XTJA 4JLDA 3ZJYA 2V7QD 1Z83A 2CL0X 3EA5A 8OHMA 1U8YA 3THWB 2EW1A 2CK3A 1KDPA 3NVAA 2X2EA 4PQRA 5FOVA 3CUEF 3VU9B 1C4OA 4WZBE 3X2SA 3THWA 4PQYA 5C2JB 3VU9A 2J7PD 2LKCA 1NRJB 1E2DA 4TLDA 2BBTA 4B3FX 1NSTA 2RGNA 4B34A 2G0NA 4OBEA 4UJ5A 2HV8A 3MMPA 4BE7B 4Q48A 5AK0A 3NBXX 1NLYA 2ANCA 2OFWA 1OIWA 2WZQA 4F4JA 1IBRA 1NI3A 4FCWA 4C7OB 3MCAA 2R44A 4BLPA 2BEKA 4B44A 3LD9A 3W5JA 2XNSA 4TL8A 4IVRA 4URVR 1OXUA 4G5QA 4C7OA 4P3YA 4FW9A 4LYFA 2GJKA 4HDCA 2ZPTX 3IQXA 1ZD9A 4JSTA 1GIAA 4US1R 1QHXA 2HT1A 3ZZUA 1WXQA 2IC5A 4HLQB 1W5TA 1TAGA 4JBWA 5FTKA 2QI9C 3CNOA 2ZROA 5CITA 1II9A 4BPBA 4M1WA 1F2UB 5F3WB 4S2EA 4MGZR 4LJ8A 2WWXA 2RGXA 1AA9A 1F2UA 2DFTA 3JZAA 4P4TA 4UJ3A 1IM2A 2WHXA 1Q3HA 1PLLA 4TSFD 2D7DA 2I3BA 1QVRA 1KAGA 3BFVA 4A36A 1RVDA 2HYDA 2ZR0A 4QRHA 4DWJA 4F92B 2QU8A 1R6BX 1ZNWA 4HEJA 1IQPA 3MD0A 1E79A 1N25A 3R7WB 2CE2X 1M6NA 1YU9A 1DPFA 4RZ3A 4TYQA 4YLGA 3FVQA 1J70A 1GP2A 3BAFA 4QL3A 3R7WA 4DZZA 1JI0A 1E0KA 4GFDA 3R20A 5KSOA 2GBLC 3LV8A 1DAGA 1N0WA 1MO5A 1VHTA 4KO8A 4B2IA 1Z6XA 2W6JA 2HF9A 4C3ZA 4QGFA 2REBA 4UNSA 4PPGA 3THXB 5DYGA 3NG1A 4KYUA 1YR7A 5L3QB 1NVWQ 4BFXA 3THXA 3RWMB 2QPAA 2OZEA 4DBLC 5FUYA 1WA5A 4AYTA 1JR6A 1JEEA 2GCOB 3H2YA 3LQRA 5TARA 3TW8B 4OKSA 5B30A 5L3QA 2JIZA 1E2FA 4BFTA 1E98A 1SHKA 1XRJA 4LBVA 3KKNA 2C77A 1N5LA 2GCOA 3BRWD 3N5CA 4MYHA 4KV9A 1ZNXA 2H18A 221PA 5L3SB 2A9KA 2AR7A 4B6EA 3SE0A 5CIWA 3LBNA 3BC1A 2QTHA 2KBFA 1GRRA 5L3SA 3OAAA 3QNUA 2XNDA 2UVQA 1IXRC 5F98A 4E07A 2F1IA 3GLGB 4HAYA 5K8UA 4MGKR 5KSPA 1YVDA 3SJAA 4B75A 3GLGA 1YZKA 2R62A 4LRWA 4D80A 1ZM9A 1LY1A 2HDNB 5EXPA 1CJKC 1COWA 2HCBA 3AKCA 4F91B 3K0FB 1AKEA 1R5OA 1EXMA 2Q3HA 4ZDJA 1A82A 2GBLA 2ZQ5A 4ZV4A 1ZM7A 2UZIR 2OM2A 1CTQA 2V3CC 1NY6A 3K0FA 3WYFA 4QG7A 1GKUB 1Q57A 1OH5A 1F48A 3KFXA 2JEOA 1T0JB 4X8LA 1E9RA 2Z6VA 2YC4C 1G3QA 3U7GA 4HB4A 4RD2A 2JGNA 4RD4A 1HV8A 2ATXA 3DPUA 3SQWA 4M9SA 4WVFA 1SVMA 4EPWA 4UNPA 2XTNA 5B64A 1XPOA 1E96A 4DXAA 4AD8A 3KXKA 3NEYA 3SHWA 5L8VA 1UDWA 3EPHA 1ZINA 3HP1A 5ANRB 1A5TA 1IN6A 4BZPA 4BECA 1OH7A 1Y3AA 2VBCA 3B60A 1G3RA 2EFGA 2FEMA 3HU3A 3KFVA 4JLBA 4W5HA 1ZNYA 3SFVA 2XNDD 5JRJA 3BB1A 3GJ3A 5J4KA 2Q6TA 2JLXA 4Q03A 2IX3A 1Z3IX 1P2VA 5JSZB 2DB3A 2FU5C 3VX3A 3WMGA 4CEIB 2QRZA 4MQBA 4LUCA 3FHCB 1YR6A 2AWOA 2IXEA 4C4PA 5JSZA 2B7CA 3AF0A 1GNQA 3WNCA 3WP1B 1QHNA 4EDHA 4CEIA 1IY0A 4RD1A 1KI9A 3C8UA 1HA3A 2P5TB 4RZ2A 2GEDA 4EAQA 3W3ZB 2XTMA 4M22A 5HE8A 5TV2A 2GF0A 3LBIA 5D3QA 1G17A 5AJXA 4YXWA 4JZKA 1NIPA 4WXRA 2P2LA 3QF7A 3TQCA 3FWYA 2ZAOA 3NXSA 3DKPA 2B7BA 3CH4B 1P2TA 2IYZA 4HAVA 5JHGB 1OV4A 1Q44A 2XSZA 4B2LA 1R8SA 1RYHA 5H70A 2ZR7A 1FNMA 3CR8A 3FE2A 2XB4A 1BH2A 3MGCA 1G3UA 1F2TB 4JBYA 4M4SA 2FE4A 1Z6AA 3D8BA 1TU4A 2GTPA 4TMVA 2ZXUA 2IYSA 2QMEA 3SC3A 5LD2C 2IHYA 1F2TA 3SOPA 1DAIA 1ZYUA 3KKQA 2RGEA 1GKIA 1T0HB 1ZCAA 4Q9LA 2ZRLA 1AA3A 1KY2A 4QKQA 3PUVA 1R8QA 3QXJA 1EG7A 1ZAKA 1JJ7A 4B73A 1N2CE 2GWHA 3I5YA 3PFIA 2Z0MA 1N6LA 1E9BA 4R7ZA 1OH8A 5HKKA 3AB3A 5M04A 1E2HA 1OXVA 2CCKA 2P67A 4G5OA 4JLAA 3CNNA 4GMDA 2EQBA 4MYCA 4DUGA 3WMEA 1A1VA 3HYRA 3PJRA 2ZI3A 2IF0A 2NG1A 3BK7A 4WAUA 1HT2E 1KNQA 1X6VA 4LHZA 2AL7A 2IA5A 4Q01A 2ZJOA 4M9QA 3DM9B 1KJWA 2XSZD 5SZHB 3VX4A 2GHIA 2KWIA 2Q9CA 5CK4A 3WYAA 1QZXA 5FL7D 4NE2A 2OAP1 4Q9KA 3RSOA 4DB2A 2BJVA 2W0SA 1E2IA 2EFDB 1NN1A 3DZ8A 3B9QA 521PA 1F6BA 3RRZA 3TIFA 3A6PC 1NSFA 2V9PA 3IILA 3WNDA 2VP4A 2G3YA 4URZR 4WA7A 4OI4A 5LD2B 1NN3A 4ZCMA 1CJMA 1OPXA 2BM0A 1OFHA 4GOKA 3BXZA 2YYZA 4UXIA 1NL3A 2VSOA 1RPZA 1OXXK 3RC8A 5B58C 5CDFE 1TQ6A 2ZRDA 4L16A 1E9DA 2PX3A 2X1VA 1Z29A 2F3TA 3LVQE 3GLIB 1W48A 1I4DD 4V0KA 2C95A 5KDLA 4OQLA 1U81A 1FZQA 1MABB 4JLMA 3RWOA 3GLIA 4JLPA 4ZI2A 1B23P 4IXMA 1TQ4A 2C78A 2W0MA 2WJJA 1N6HA 2ZE7A 4G5RA 2O52A 4PAOA 1MABA 2ZJBA 3U6KA 3I62A 2X2FA 4NTZA 2NOAA 3LLMA 2WSSA 4ACAA 3AV0B 4L8GA 5AUNB 3GLFB 2OCAA 4YMSA 4LC0A 2ZS7A 3GFTA 3SI7A 3GLFA 1E9FA 2F9MA 1X8KA 3CNLA 4JLJA 1XEFA 2AN9A 3RC3A 1GOTA 2VO1A 2OCPA 2ZE5A 2IYXA 3FTQA 3UG7A 3IPYA 4EJSC 3BJIC 1E2GA 3FMPB 2HCJB 2X19A 3EXAA 2IEYA 3NC0C 4CIDA 4EKDA 5JCPA 2ZJZA 3CW2A 3IHWA 2MSEB 4N1AA 1AS2A 1FQJA 1XEWY 4ZCLA 2IYUA 1E9CA 3BFKA 4US2R 4TL9A 3VNUA 2J0SA 2ZRCA 1ZUIA 4JLKA 1G19A 5C4MA 5JRZA 4R71A 1T3HA 1NG9A 1QHGA 2FSGA 4PZLA 4V0NA 4UXHA 3JVUA 4JIMA 4GP6A 2Q3FA 3MFYA 1PLKA 5FUXA 1JAIA 5BXQC 5FTNA 4M9XA 4KFTA 3PUXA 4HZIA 3ASYA 1OXSC 3L0PA 3W6PA 2FSIA 2JAQA 4B3GA 2WSSD 3K53A 1MH1A 3AGPA 1P6XA 1UFQA 1U94A 2B8WA 4KAXA 3E5HA 3KJEA 3NHBA 4IRUB 3W9YA 5HCIA 3VR4A 4LPSA 1N0UA 1Q20A 4PPQA 1UPTA 2OLKA 4B71A 1EFCA 1CU1A 2BMFA 1Z5ZA 1DE0A 1IAQA 3ZZTA 4A0RA 1UKYA 1X3SA 2PJZA 2O0JA 3SU8A 4LJ4A 1VCIA 4G1UC 4NPHA 3RDPA 1D2NA 1FQKA 2GKSA 4LV6A 3AKYA 3FMOB 2BMJA 4EJSB 1P72A 4Q7KA 3V4FA 2R6FA 1GL6A 3F8TA 4DCTA 4LJAA 4NYIR 4Q7MB 4GSYA 4NL4H 1YR9A 2IXGA 1ZU4A 1P2SA 4EJSA 3LY5A 5IDVA 2DCUA 5GADl 4IOLA 3PCRB 1SXJE 1Q0UA 2A5GA 5H1YA 1KDTA 2ZSBA 2BMEA 2EWVA 1SKQA 4JKIA 2AHOA 4BFZA 3VAAA 5SZIA 1KJZA 2HJGA 1P61B 5FOWA 1U9IC 3KL4A 4FMCF 2W00A 1OSNA 4NMMA 5J47A 4DDTA 2WWFA 4K46A 5KNDA 2KE5A 2B8TA 2FSFA 2YNMA 4L9SA 1TPZA 5GJCA 1Z0KA 3ZVNA 3DOEA 4PC1A 1M1YE 1KSFX 3IIJA 4F4IA 5JECA 4LHVA 1NN0A 4BRWA 5C4GB 4DLRA 4B2PA 5GJBA 2DFLA 3FFAA 4JL8A 5AJVB 4V0LA 1G291 4RD3A 1T8TA 1AZTA 4L15A 4DSOA 1NBME 4KYIB 3PENA 2OXRA 1Z2CA 3A4MA 1G7TA 3G82C 1TQDA 2CLSA 3EZ6A 4FMBB 4A82A 3QQ5A 1T5IA 4Q9HA 1LF5A 1W2HA 1RZ3A 2RGBA 1QRAA 1R4AA 2GDJA 3EASA 1BOFA 2AK3A 2WJYA 2FG5A 4MDEA 1Q21A 4Y0VA 4Q1EA 2CCGA 4TMZA 4URUR 3OE7A 2CHVA 2WJHA 3GLHE 4CF7A 3TR5A 2XXAB 3H4MA 2ZTSA 1XMJA 1OLOA 1S1MA 1FFHA 4QHSA 3R9XA 1S9DA 1T3LA 2J5XA 3NIBA 2EYUA 1IOZA 2ODEA 2G77B 2VPPA 2XXAA 2E87A 3C14C 1HEIA 5EZ6B 3OIUA 1HE8B 2GAOA 5DNYB 1II8B 4TLAA 2ODNA 2WMNB 4TYWA 2QSZA 2K5UA 4DLYA 4Q21A 5AUPB 2ZE6A 1KI4A 1U9IA 2OE2A 1II8A 4D4KA 2REOA 1KTVA 2YC2C 5FR1A 4A6XA 4HB2A 4B32A 3QVVA 3FOZA 4D25A 2C9OA 3AUXA 2CJWB 1RIFA 2FNAA 2CLCX 2F55A 4WXPA 3QBTA 4TQUS 1KO5A 1AK2A 1EK0A 3GEHA 2CJWA 2YWFA 2H92A 5G3ZA 2IS1A 2AKYA 3D6TB 3X1DA 3SQXA 1E3MA 3D3QA 5DGXA 4DDUA 2VRWA 3LX8A 4ZKDA 4AY2A 3TK1A 4WBSA 4NDZA 2V1UA 3VTKA 3Q9LA 1OIVA 4LHYA 4BFWA 2W2XA 4XWOA 5IHPA 2IUTA 1Z0FA 3BWDD 1CP2A 2EVWX 3SHFA 2HLDA 5EE3A 4DC9A 4UQOA 1Q22A 2ZS8A 1JPJA 4MGIR 2WMOB 2W6ID 2PJRA 5AJYA 2AD1A 4DEXA 3B2EA 2DBYA 3TUZC 2BDTA 2XX3A 4POAA 2FN4A 4DLTA 3OEEA 1CEEA 1E4YA 2R8RA 2CLDX 2XOKD 4PC7A 4EFLA 2UZ3A 5BW8A 3W3AA 4FMDB 5BWMA 2PCLA 3BD9A 1S2MA 3DMDA 5LPNA 1KK3A 3EZFA 4F38A 4KVGA 1I2DA 1KKLA 1G5PA 3CPHA 1AZSC 2OAQ1 1MV5A 3KZ1E 2WICA 4NP6A 2ZSFA 2A2ZA 5FPTA 1CR0A 1GAJA 1VG9B 2ZRNA 3IIKA 3U6BA 1ZM2A 3AF3A 2GJ9A 4KHZA 2QT1A 2ZR9A 5KUTA 3ADCA 3KX2A 4NCKA 3WMFA 5CIQA 4LY6A 2E9SA 2LWIA 4JT4A 4MKGA 2ZVQX 4FWTA 1G4AE 1Z6TA 2AD5A 4DJTA 3CKLA 3I32A 2IS4A 1FX0B 1CRQA 2ZRGA 1NMXA 4PPNA 2ZUCA 3AGQA 1IN5A 3GJ0A 1CXZA 4XVQA 3T1QA 2NTYC 4Q02A 2WIBA 2OO7A 1FX0A 5AUQA 5AR1A 3AKDA 4M0LA 3EAQA 5CB8A 2ZRIA 4KLZA 1AQYA 1JALA 1IY1A 3R8FA 2WJIA 3EW9A 2CNWD 2DPXA 3BH6A 4DCNA 3QIAA 1XXHE 3OEED 1P4SA 3NTUA 2OBMA 3L8ZA 4PX9A 4X8OA 1JR3D 1OFUX 4ESHA 4LOAA 3OFNA 3QXSA 3TBKA 2QMUA 4JLOA 3AF4A 3K70D 1OKKA 1N0VC 2OV2A 1XD8A 1AS0A 2QENA 2JLYA 3T1OA 2DWOA 4M2LA 3FMFA 2JJ8A 4JL6A 3ZD6A 2ZJ8A 3BE4A 3EZ2A 3X1YA 3QKUA 4NHOA 3AVXA 1G16A 3VR5A 2D7CA 1UAAA 4QFMA 2IXFA 3DKVA 2JJ1D 5CK5A 3KTAB 3SYLA 1TF5A 4DRZA 4HDQB 4H9GA 3UWOA 1XF9A 1M8PA 5JJIA 1R7RA 3KTAA 4PSKA 1CJUC 1IY2A 1KYIA 1KO8A 1UF9A 3T06B 3KKMA 4RD6A 1U99A 3T1TA 1TMKA 4XTCS 1N6KA 4IXNA 2WKRA 2IYRA 4QHYA 2F1JA 2VQSA 1QF9A 1GSIA 5KOYA 1GILA 1XDBA 2EWWA 4S35A 4L4UA 4ARZB 4IDHA 1ZD1A 4A8JC 4B3XA 3O8DA 1RRFA 2QE7A 4OHWA 5J4VA 4TTPA 4D2IA 2FOLA 4IDQA 2QQEA 1E9AA 4ARZA 1G3MA 3A37A 3L0SA 1D2MA 4TQ9A 4U7DA 1CLUA 2PZFA 4B3CA 1WRBA 2ZSEA 2N46A 3EIQA 1OKKD 2C99A 5GJWC 1CF4A 2HXSA 5EE5B 3RS4A 3ZGXA 2IYLD 3CH5A 3D7MA 4PZZA 3AUYA 4ZO4A 3RS2A 3A1SA 2ZJ2A 3OIVA 3QKSB 1MO6A 4IFEA 1E1QA 4AKGA 1JXMA 4TT3A 3RRMA 4DHEA 1Q1BA 1VTKA 1KIMA 1NMZA 2J45A 2RKOA 1KKMA 3QKSA 2Z83A 2ZI6A 2QAJA 3SYNA 3QG5A 1C1YA 5JS7A 4Y0AA 1KGDA 1TF7A 4HLDA 4B47A 1J90A 1GNRA 3ZZ0A 3IKJA 1GNPA 3MRSA 4ZIRB 2L0XA 1G8YA 1EFRA 2CVFA 4RVCA 5DSZA 3O8RA 2CK3D 3VFDA 3QXHA 2YWGA 4CEHB 4URWR 2JLVA 2QTVB 4ZIRA 5JMTA 3AF1A 2P5SA 1HYQA 4A2WA 4CEHA 4A8JB 3DZDA 4FMCB 1VKJA 4Q1FA 3Q5DA 1YKSA 1KK0A 1G7CA 3AVOA 1IXZA 1ANKA 4DB4A 2OLJA 1OFTA 4A8JA 5ELXA 1FUKA 4LYJA 4V03A 3RABA 2ZJAA 5CM8B 3H1TA 3PEVA 2OILA 1A2BA 2JJ2A 2QP9X 4JJKA 5KDDA 1SKYE 4JS0A 2ANBA 4PHGA 3C4JA 4Q66C 5JS8A 1GFIA 2AK2A 2VP9A 5H68A 3EWAA 3VR2A 4RJLA 2R65A 2KI5A 2XZLA 5BN3A 2B21A 4DSTA 3K8YA 1T6NA 4Q1BA 2PLRA 3L82B 2PL3A 1MT0A 1SVWA 2JCSA 4Q4AB 4MKFA 1X8LA 2FEOA 4HI0E 2D2FA 2YWHA 1TTTA 4TZ6A 3WHKA 1KSJA 1YZUA 3NBFA 4PC2A 4Q4AA 4RY2A 2PCJA 1EX7A 1G7RA 3RNLA 4CGZA 2W2VA 3K0AB 1IN8A 1N5KA 3KQHA 4PQFA 2WBLC 3I4LA 4LI0A 1VYUA 1G5RA 3K0AA 1GG2A 1E79D 3PEUA 2ZRMA 4LBZA 3S1AB 4A92A 2FDCA 1FOEB 3FFBA 4LV8B 4ZCIA 1W44A 2FGKA 2C5LA 3CLVA 3KUDA 4W9MC 2C96A 4I81A 3S1AA 3EPKA 2JJ2D 4JKYA 4JYBA 1G1MA 1HURA 1H8EA 3RANA 1VG1A 1OYYA 1Q1ZA 2ZYUX 4CYMA 4XH9B 4UNRA 4TZ0A 2GJSA 3QXXA 2BMDA 3KXLA 3RS3A 3WXMA 4XJXA 2OG2A 2W6JD 3SBDA 5AUOB 3GQBA 3M6AA 1L8QA 3KDSE 2CXXA 1ZD8A 4LJ6A 4B35A 2ZVPX 1JXOA 3IBYA 3AM1A 4M53A 3PG5A 4QGGA 3W8RA 2OUKA 1J7KA 5JWRA 1T4GA 2IHBA 3CO5A 3Q5EA 2JIZD 1TUIA 4Q19A 3NBYC 3CF0A 4RCZA 3TJZA 2OCBA 2MMCA 1JPNA 1XJ0A 2NO7A 3EZ9A 4QJ3A 4YMVA 3B1WA 1PV4A 4C0LA 4V0ME 2VHQA 4YONB 4AYWA 2ZRKA 1VECA 3JVVA 4EPVA 3OAAD 4P32A 3MLEA 4IHQA 3LDAA 4LK2A 4BASA 4IEEA 2FZLA 5J4LA 4C2UA 2I1QA 2JLRA 1F3OA 1S3GA 1Z08A 3ADBA 1II0A 1DO0A 4P31A 4TN1A 5A0FA 1TUEA 2VHJA 1DAMA 1DARA 2AX4A 1N3BA 2BHRA 5IK2A 1TF2A 3UPUA 1R10A 1U8ZA 1XWIA 1I2MA 1E2EA 1COWD 1XMVA 1UDXA 4L5BA 1G8FA 2IYVA 2IBMA 2ONKA 1ZUNB 2V4ZA 4BLRA 1EGAA 4JVNA 4F7WA 2GJAA 3A1WA 1ETUA 1TEVA 1D9ZA 5EXTA 5A5GA 3CWQA 4AKEA 4DLZA 3OF5A 4A4DA 4N0EA 2AXNA 2JDIA 1MKYA 4BFSA 5KDOA 2C03A 1VCMA 1N6PA 5HCNA 1IHUA 4Q9JA 3X1XA 4AIIA 1ZIOA 3OIWA 4H1UA 3ICEA 2GEVA 4TLBA 3ZS9A 4OL0A 1XCPA 3TQFA 4UNNA 1VIYA 2P0EA 3MUFA 2QUZA 4IOKA 4GRAA 5JJLA 3HU1A 1G8PA 1U90A 2NQ2C 1XBTA 4CW7A 3K0SA 3Q8XB 3U3JA 3FB4A 2GRJA 2CL6X 1E2MA 1XJQA 2DY1A 4US0R 2W2TA 3WNBA 4PAQA 1WCV1 4EUNA 2YZ2A 3AH8A 4HB0A 1XTKA 1XD2B 3Q85A 2H17A 3QPUA 5FPYA 1HT1E 5KU1A 5IK2D 1XNJA 5E7IA 4Q4LA 1XD2A 4EPXA 1BS1A 1NNEA 1OIXA 2DWQA 5FFMA 1MRSA 3NH6A 1CJVC 1GDDA 1P2UA 3T5DA 1NMYA 3IIMA 2VEDA 4OYHA 4AG5A 5KHOC 4W5JA 1PVOA 4B33A 4FXPA 1FW6A 5KPDA 5FPSA 4DCVA 1ZJ6A 2DWPA 4FMDF 5J40A 4YXWD 2X8AA 2GILA 5IT5A 1GKYA 3PUYA 3QBVA 3ETLA 2J41A 1NVXQ 5JI2E 1NVVR 4RFVA 5DYIA 3LA6A 3HPQA 1W5SA 2AXPA 4OJKA 4ZPXA 3GD7A 3QXCA 1P9NA 1G4UR 1XPRA 4D0LB 2KBEA 3GFPA 2VHUA 4OK3A 3MG9A 4LJYA 1JBKA 2ZE8A 5DLQC 4GOXA 2QP3A 1YJ5A 1WQ1R 3LVRE 1AGRA 1E2LA 4OK6A 1E0SA 4A0HA 1P3JA 5CDFA 2O0HA 3U7HB 121PA 5GJVC 1U0HC 3L43A 2QEQA 2GNOA 2EYQA 2B92A 4ZDIA 4NH0A 2EFHB 2ZM5A 3VR1A 2V6JA 1KMQA 1CULC 3PIRA 1CRPA 1Z07A 2EU8A 3RAPR 5SZJA 3TW4A 3B8HA 4YQFA 3ONWA 4TMKA 5BYJA 2AKAB 4OK5A 5HKKD 1RJ9B 3IHLA 3AP3A 1H65A 2ZAMA 2QP4A 1NG1A 1M34E 1SGWA 3N70A 4DUGD 2FGJA 1FTSA 1NVVQ 1X86B 2WVJA 4XSHA 4LBWA 1RJ9A 4HZUB 4YMUA 3LFUA 3QKTA 1G3IA 1EFHA 3EPLA 3CB4A 4R98A 1I4LD 4O25A 1TL7C 1L4YA 4URYR 3ICQB 1E6CA 4HZUA 4LHWA 5JCZA 1UBEA 4KODA 1VCNA 4O2RA 2C9CA 3K9GA 3UKDA 1SXJC 3W8NA 1IN4A 2CHQA 3LWNA 3EWSA 5GVRA 1D9XA 5GVSA 5LBIA 1OHHA 3D31A 1Z0DA 1NJGA 3CPJB 3FPAA 3MWLA 1XD9A 1W36C 2I1VB 5CLLA 3V9PA 4PSVA 1V43A 2JASA 2X77A 4GP7A 3U4QB 4O3MA 1CR2A 3U44B 4MKHA 2IEZA 4TMWA 1N6IA 2D06A 2J0UB 5FBWB 4ASUA 5KSZA 3U4QA 4OQFA 1WF3A 5CLQA 3FHOA 1XZPA 3U44A 1LFDB 2J0UA 4PHFA 4R2HA 1RRCA 3LH5A 4L9WA 4FI3C 1LB1B 3NDBB 2I4IA 4TYNA 1YZGA 3IEVA 5EE1A 3OIYA 1MO3A 5E95A 3CX8A 1W4AA 1PUIA 4B3BA 4G3XA 4GT1A 4MRSA 1E2KA 2AWNA 3GLFE 5E3HA 4C2TA 4JT2A 3MJRA 3LX5A 4MRRA 2ORVA 3HU2A 5TVKA 4DSUA 3LXRA 4II7A 1OH6A 1XX6A 2OFXA 3CPEA 1XU4A 5FI0B 3LRPA 4PXAA 1SXJB 4JLNA 1FNNA 3FKSA 2GVZC 2WTUA 1BKDR 2OXCA 3O47A 4OI0A 1XTRA 4M9ZA 2YOHA 1SXJA 1GRQA 1YR8A 4Z54A 3KQKA 1W36B 1E0AA 3SJCA 4KSCA 1ZIPA 4KSBA 3QJYA 3PEWA 1XTSA 3AVQA 4ZDWA 1XEWX 2IS6A 5FL3A 2F6RA 1WB9A 3AF2A 1VHLA 2ZREA 1X1SA 2YHSA 4QM7A 1ZM3A 2BKEA 4DLUA 3U5ZB 3RRNA 2ATVA 3BORA 2LKDA 2QBYB 3Q7QA 1ZUHA 3SBEA 4TMTA 621PA 5FR2A 3KJHA 3T12A 1VDZA 2GCPA 2JATA 2ZYWX 4NYMR 2C2HA 3QKRB 2OEPA 1X8JA 2QBYA 2ZJYA 1SVIA 4WZAE 4FD2A 4X8MA 1UBGA 4IDNA 1NBMA 3QKRA 3I8XA 1Z6GA 1Z0AA 3OZXA 1E0JA 2C04A 2V6IA 3K9NA 4HAZA 2O8DB 3AVWA 1P62B 2IYQA 4Q1DA 1ZVQA 3GJ8A 1QHHB 2O8CB 2O8DA 1J99A 2RGDA 5KTYA 4C0AC 1ZMXA 2MMGA 2IK8A 4Q7LA 3KKPA 1JECA 3NHAA 3GJ4A 3N2IA 4ILEA 1LTQA 3CM0A 1QHHA 2IW3A 2O8CA 4AKHA 2F1RA 4A2QA 4K8OA 4NYIQ 2H1LA 3DOFA 1D5CA 3C41J 4BLSA 4PC6A 1JQLB 2ONJA 1W47A 2Y8EA 5J4YA 3UMFA 3NH9A 2PEZA 3SDZA 4Z51A 1XFAA 5JI3E 3B1XA 2Z4SA 3I73A 1KO1A 3SYKA 1YZTA 2YV5A 2BBOA 4U00A 2QSYA 4P0TA 4NYMQ 2G0TA 4D0NA 4GBMA 3AQ4A 1ZC4A 3B9PA 3GMTA 2GXUA 3NKVA 4BZXA 1DG1G 1Z8FA 1GRNA 4I1VA 3CRW1 4J0QA 1UBCA 2C9YA 5AJWA 4Z1MA 5TB5A 3QF4B 3P27A 2P3SA 1C9KA 4C0HA 1SHZA 1PUJA 3GCGA 5EZ5A 4LZZA 3QF4A 1W0JA 4KFSA 4G0NA 3IBGA 5HE9A 2GCNA 1E1RA 3IPXA 4LJ5A 3ZS8A 4F4CA 3NEJA 1G21E 2JLWA 3ZQ6A 1R0ZA 3ZQJA 3QPVA 3AKEA 1M7GA 2J7KA 4MA4A 1V5WA 4Q47A 2H5EA 4JSYA 3H0KA 4H1VA 4ZI3A 4NCIA 4AURA 2ZRJA 1N6RA 4DLSA 3AVVA 2ODWA 1G8HA 1S3SA 2YJTD 2G9NA 3BB3A 4MH0R 4IKEA 3KJGA 3OE7D 2EFEB 4IVQA 1E2QA 2ERYA 4PFSA 5FPKA 1QDEA 4PZYA 2NZ8A 4C0SA 4HLUC 4NBSA 1DG3A 3KB1A 1NKSA 1O87A 1JQJC 2FF7A 1DADA 3CZQA 1YZNA 4GZMA 3W6NA 3PXGA 1ZW6A 4Z1MD 1G20E 4TLEA 3UIEA 1G7SA 2DHRA 3C16C 3DDCA 3I1FA 5EE0A 3PR1A 1DAFA 2QZ4A 4XOIA 1ONBA 1QBKC 2R9VA 4P4UA 1W0JD 4YMWA 2YVUA 5DN6A 1AJEA 821PA 3TVTA 4PO8A 4HB3A 4W5WA 2V8OA 5FBRB 4KBFA 4ZKEA 2QM8A 3LNCA 1J8MF 4CRWB 1W46A 1NLZA 3G0HA 5FPHA 3C15C 3TRFA 1ESNA 1X1RA 1XXHB 3CWZA 3QENA 3ZD7A 1VCOA 2MSDB 3IQWA 3VMFA 3QVUA 2BEJA 2GETA 3BFXA 3M0EA 1XXHA 1ZM4A 1O3YA 3OEHA 2VH5R 3RYTC 1QVAA 1KI1A 1UEJA 2A5DA 3HDTA 4MUAA 3R9IA 1KJYA 2N42A 1XCMA 1E69A 2HLDD 4DCSA 5JWOA 4PHHA 1JR3E 5F9FA 4G5SA 2O8EB 2D74A 2FFAA 4LPKA 3P4XA 4D26A 4Z8YA 4CT4B 1ELOA 1J8YF 1G64A 4Z8XA 3VHLB 4C0JA 2O8EA 4EIWA 2QMHA 3BBPA 4HLUA 3R9WA 5FI1B 4OHVA 1I4TD 1HQYE 2N1BA 3TSZA 4HAUA 5FBVB 3RVBA 2PMKA 1PZNA 2G1KA 1NVUQ 2CVHA 4LYHA 2Z43A 5EP4A 1XEXB 5KPJA 4LGMA 2RAPA 4TLCA 2GXAA 4YDHB 1R5NA 4NCNA 2ZI4A 5EQTA 1XEXA 2IYWA 3I92A 4HUQB 4GMXA 4HYYA 1XCGB 3BIFA 2J7PA 4KBGA 3T15A 1W4CA 2ZUDA 2J3EA 5JBQA 2O8FB 4HUQA 4AKIA 2OHFA 2A7QA 5C1BA 2NZJA 3E70C 4QHTA 2NO1A 1K5DA 2BWJA 1M2OB 2RB4A 3P26A 5K8LA 2O8FA 4GNKA 1GM5A 1DELA 1ESMA 3BERA 2P65A 5F9HA 1Z22A 1N6NA 2ODBA 1KMHB 4MRPA 5L3RA 4MUBA 2J0QA 2QAGC 1RW4A 2FWRA 4GPTA 5HPYB 4CZ2A 2D2EA 1KMHA 4QJ4A 1WBDA 1U0LA 2GVDC 3UANA 5FBLB 5CYOA 3T34A 1MOZA 3PITA 2GXQA 2PEYA 3IUYA 3RS7A 1ZP6A 2SHKA 3H86A 5FOUA 5EJEA 1DAEA 3OFND 3REFA 5HZHA 1HQCA 1D6JA 2PLFA 2FPLA 1D8TA 2ZITA 2D3WA 4DDWA 5JEEA 3PUZA 4IVPA 4JVSB 5UKDA 2NIPA 3QUSA 2OT3B 3B1VA 3VR3A 3K0CC 1OF1A 3FDIA 4URXR 4I1OA 1LV7A 2WKQA 4TSFA 5KYKA 1R2QA 3TNFA 1N5IA 2XB2A 2JLUA 2NO6A 3NBZC 2OESA 4KITB 4M1OA 4GDFA 4AYXA 4Q4HB 3I8SA 4ITRC 4QGHA 1SVSA 1H8HA 3ZVRA 2VP0A 3V00A 1PJRA 4Q9IA 1P9WA 1KDOA 4OI1A 4BWYA 4Q4HA 1EESA 5JJKA 1J2JA 3SFZA 2QNRA 2P6NA 2REXB 3ECCA 2A5JA 2P6UA 4NONA 3ZIAA 4BFYA 3V4RA 1T91A 3QPWA 1FL9A 1EX6A 3CBQA 1DBSA 1XP8A 4MDFA 1SKYB 1HUQA 1OYWA 2QAGB 3LQQA 4FCVA 1ZNZA 1UKEA 4KXFB 1TADA 3DM5A 5F2EA 2VYFA 3TLXA 3U60B 1DAHA 2ZUBA 2O0KA 4Q1CA 2JA1A 1OE0A 1TX4B 2QAGA 2WWGA 2HF8A 2RGCA 2ZJ5A 2QE7D 3U7EB 1AN0A 2BV3A 3B13B 3Q3JB 2VL7A 4MGYR 2ZSDA 4WZ6A 5HZKA 2Q0HA 1W0KA 3P1JA 4B74A 1LW7A 1G18A 2CMKA 3LW7A 4IOJA 4MITA 2ZI5A 1Z28A 5G41A 5B2ZA 2FJUA 4E22A 4DVGA 3B6EA 3F0TA 1W4BA 1QG4A 5JFGA 5K8IA 1OXTA 1FUUA 5EUMA 1FP6A 4WOPA 1AM4D 2PMDA 1E1QD 2YINC 1YRBA 2QY9A 3OHMA 4TT3D 5FUWA 3SJBA 1YZLA 3B82A 4Q5IA 2PZGA 3K0CA 2CEAA 1NJFA 1G5TA 1H8HD 3K9LA 4PR0A 2LCFA 3U3RA 4C0BA 2JLSA 2BM1A 3ZVLA 2WSMA 4A15A 1SVKA 3TVDA 2VLIA 3C5HA 2PH1A 3CZPA 1G8GA 1Z0IA 3MAAC 1ZU5A 3MWKA 3ZIAD 1WP9A 1AGPA 1EFRD 2GESA 3GFOA 3ND8A 4ZDKA 4HATA 3H84A 2ZANA 4C9BA 1QHYA 4QBGB 1Z0JA 1BMFA 1MR3F 4OHZA 1S96A 4N3NA 2WWWA 5IF9A 4PAMA 1RRGA 2RHMA 1CBUA 4MRVA 4UNQA 3VR6A 2VIIA 1U8AA 1UM8A 3T61A 1HY3A 3LXXA 1Q3TA 2NMVA 1KI6B 3RRYA 1A2KC 1W0KD 1VPLA 2IWRA 2NO9A 3BOSA 5AJZA 2WJVA 4WIAA 1RE0A 1GITA 2ECKA 2GZHA 3U3KA 1BO6A 5KO2A 1KI6A 2FX3A 2IUSA 3B7GA 1N5JA 4TWZA 5CB6A 1E2JA 3FKQA 4QJ5A 3QEJA 3SNHA 2WWHA 3TSOA 3PEYA 1P60A 4PANA 1U2RA 4ACBA 3TSWA 5TDHA 4OQMA 2EFCB 4KLNA 4QNMA 4TTQA 4FINA 3AP1A 2F9LA 3E1SA 3EIHA 1XMIA 4TMXA 1RRPA 1XB2A 2ZIAA 3P20A 3A4LA 3U2QA 1G6OA 2ZYVX 4V0MA 3TAUA 5JZVA 3IO3A 1JAHA 2ZRBA 2J87A 1NLFA 2R6DA 3QEOA 1S8FA 2W58A 1K6MA 5HTKA 1VG8A 2BCJQ 1AIPA 4FIDA 4TL7A 1OT3A 1NF3A 3TR0A 2ZRPA 1BMFD 2ZRFA 3B78A 5SZKB 2O8BB 3PV0A 2WOOA 2QTFA 4GZLA 4R2IA 3UMRA 3GLGE 2A30A 2O8BA 5FOXA 2PBRA 4B3DA 2PT7A 4FWIB 2DYKA 2H8KA 5FH9A 2VP5A 2QMOA 5CJPA 1Q1EA 4XD7A 1KI8A 2FA9A 3FYHA 1EWQA 3JZMA 3REGA 3G5UA 3GJXC 1S9HA 5G53C 1H8ED 2WWIA 3A1TA 4FCTA 3SN6A 3AVTA 5CM9C 4M1YA 2BJWA 2ZSAA 4RKFA 5FTJA 2FMXA 3U3MA 2CHGA 4HUTA 3A58B 1P75A 1RFLA 5CJ2A 1KI3A 2CCJA 5JWHA 4F93B 3WY9A 4B48A 4LJ7A 3X1WA 3ZLJA 4YC7A 5L3VA 1E32A 4HDOB 4KCGA 1UKZA 2V55B 1WE2A 2MSCB 5TMPA 1JJVA 2R6CA 5DO9A 1L4UA 4LC1A 4EFNA 2F7SA 4Q7JB 4XVUA 4PSAA 2IF2A 3AEZA 4LCBA 2RCNA 5TXGA 1OJLA 2H16A 1OFIA 3GJ6A 2YWEA 2QGNA 4HAWA 1KO4A 3IGFA 1AKYA 1UKVY 3KKOA 4N0DA 3ZVMA 5JLJA 3L0OA 1IONA 3HJNA 1Q1QA 4PC3A 5BQ5A 4DT1B 4DLXA 1WMSA 2NGRA 3L0IB 4XD7D 3CF2A 4KVAA 4P4SB 4G01B 1KNXA 2DFKB 4WW0A 1R0WA 4AK9A 4QOSA 4DT1A 4IDOA 4HAXA 5BYKA 4CVNA 4QXAA 2PT5A 2QPOA 4P4SA 2YKGA 3PVSA 2J46A 3QE0A 2QRNA 1L7VC 3FMIA 2QT0A 4QC2A 5FL7A 1W7AA 421PA 2AFIE 2DR3A 3M1IA 4IFBA 3E2IA 3X1ZA 2DFNA 2HT6A 3LO5A 3F5FA 2QN6A 3DL0A 1SVLA 2VA8A 4E03A 2HXYA 3BH7A 3T1VA 4BQSA 3B1YA 2JDID 3QY0A 2JLZA 1W49A 1GZSA 4MYUA 4PHTA 3LAWA 4M1MA 3UMSA 3CX6A 1G41A 2ORWA 4OQNA 3ZH9B 1FP7A 2GA8A 2GZAA 3CRRA 4NZYA 3VKHA 4BLOA 2J1LA 2GF9A 1NN5A 2A3RA 4A1FA 4A2PA 3RS5A 5A4JA 1GWNA 3CF6R 2GK6A 2PZEA 2RGGA 3IDQA 1YRAA 4MKIA 2H7VA 3GP8A 4BEJA 3I3SR 2KSQA 5J5CA 5H8WA 4QBHA 5E7JA 3DVLA 3OESA 4K81B 5B57C 1YHNA 1Z47A 4HSEA 4BLTA 2RMKA 3GEEA 4U5XA 2QM7A 4Q00A 1SQ5A 2C8VA 2HJVA 4YDSA 4JLVA 1GUAA 1K5GA 4OI2A 3T5GA 1E2PA 2XJ9A 1B0UA 3CRMA 1XTIA 2VSXA 2A5YB 2BCGY 2IS2A 1KK2A 2QL6A 2XJ4A 2YOGA 2R6GA 3IO5A 3O8BA 5FTMA 4ESVA 5E4FA 3MSXA 2ORIA 4XWAA 4QBFA 1QHIA 2XZPA 1AQUA 3KQUA 2GXSA 1UEIA 3EA0A 4M8NE 3PUWA 3RSLA 3DEFA 4RFSB 3DHWC 4CEJB 2ZU0C 1E9EA 2HUPA 4O0MA 3CRQA 2CDNA 3B85A 4A9AA 4JBXA 721PA 4RFSA 5HR5A 4CEJA 1BYIA 3QG1A 5BN5A 4Q1AA 1IN7A 5IRCD 2OCYC
chains in the Genus database with same CATH superfamily
4BP1A 5A3QA 2D1RA 2O48X 4R68A 1OMOA 5CH8A 1UXKA 2VP2A 3GNSA 1DRJA 2VHTA 2YN0A 4TKLA 3ETNA 5EWJA 2D4HA 3F96A 4HNQA 5T64A 1JDJA 1V48A 4ZO9A 4BNIA 2Q3MA 2BFNA 2Q9BA 5HIKA 2ERXA 2IYTA 2P9ZA 1M3SA 3CVYA 4XIGS 3BMXA 2A0UA 4I7EA 4ZGBA 4DSNA 5EJMA 1E94E 4HLCA 4OATA 2MT9A 4HRAA 1ODKA 1JEAA 3ZCRA 3CX7A 4GWLA 4QSMA 5CYPA 3T6KA 4QM6A 5JY6A 1H0SA 4FYIA 2I99A 1UJ2A 3GLIE 3BE6A 3F9IA 5LR6A 2LBPA 1R12A 1IBKB 2RH5A 3O93A 5CFZA 2PSSA 1TKAA 2C5SA 4MRNA 5HNKA 4LFBB 5EP1A 1A8SA 4XYLA 2OAGA 4U2GA 4G23A 5FCDA 1X0XA 2A78A 2Y1OA 5IAAA 5TIIA 1V3UA 4GI7A 3GNQA 5DHFA 4L4YA 2Z30A 5D7NA 4M89A 1SU7A 1I3NA 2ZOSA 1FEZA 4HX5A 1HNXB 3ZDQA 3C7KA 4NKRA 2GQ0A 4Z1OA 4Y1FA 1ZOOA 3KZNA 4D8UA 1Y7IA 4BNWA 5IKEA 4UM5A 3DPIA 3DQQA 3G02A 1ZN9A 2L2QA 4IBOA 4J0KA 4FR5A 2ZDHA 4K6KA 4LZWA 3KQNA 4RCYA 2NPFA 3TD6A 1NI5A 3LYHA 1UPAA 1XRRA 1TQ2A 3GJ7A 3SKVA 5C9ZA 2PWYA 2O2XA 2XTZA 4AJOA 1TM3E 1NNSA 5HIJA 3HYTA 4KIFA 4RD0A 1XP5A 2ZU6A 2WPDD 3OHSX 1EA5A 1HQKA 3QQPA 1KK1A 2PBFA 2ZI7A 3H65A 1MCZA 1N2EA 1P4RA 4H4EA 4JELA 5DE3A 2H4HA 4ZQBA 1TPYA 2I2XB 1GCOA 3ODPA 3LW8A 1CF9A 2R47A 2R00A 3PNLA 4BNHA 1B42A 1UC9A 4AO6A 4QNRA 2DAPA 3ID6C 4ASUD 4ZEVA 1BDHA 2BI8A 4I1UA 3SS8A 4HX2A 5FFNA 1NF9A 4BIMA 1GGFA 1LVGA 3FGNA 1VKHA 3ETGA 3E3NA 2HEIA 2F1HA 4ALMA 1M8FA 1PLJA 1FPMA 5J5VA 2M6LA 4R9SA 1C1DB 4H27A 4KI7A 5B6IA 1IQRA 2Q4RA 3EPJA 2VUTA 4Y2SA 4E5SA 1XMXA 4LZOA 1C9EA 2CYCA 2VTKA 1C1DA 2X7XA 4CMHA 2PAFA 3ZD8A 4MYSA 4XSGA 2F90A 3B3QA 1H6DA 1ZRHA 5HFAA 2P9TA 1EKXA 4P6VF 1EDBA 1XHLA 2EKQA 3SOOA 2JANA 2JI9A 4QDTA 3QLEA 1EP9A 2HPAA 4KWCA 1KEVA 2L19A 4CBVA 2UVPB 2XGSA 2CBZA 1DC8A 3GEDA 3NALA 2GHQA 5A5VA 5C51B 1Q14A 4ZAZA 2GCGA 4QPCA 3UWKA 3BHMA 3FKSD 3L40A 3WRYA 5JZBA 2UVPA 4J2OA 1ID8A 4CHGA 2X76A 5JHHB 3K6JA 3FR8A 1KP2A 3QX3A 3PWKA 3PPVA 1E4VA 1MC4A 2ZYRA 6Q21A 2C2OA 3ICOA 3L8YA 1YRYE 2H2FA 3PVCA 1MDFA 1M1ZA 2AE1A 4HNGA 4Q34A 1C7RA 3KV1A 4L2IB 4E2YA 3LBHA 1V8ZA 3IURA 2NV6A 1U04A 4B76A 2YWRA 4OG2A 1T36B 2Q3BA 3DMNA 3OX4A 3T35A 4L2IA 4F8JA 3LUJA 1DJQA 4U5QA 4ZQGA 4YNBA 3D54D 3QW4B 1ZC3A 4DJEC 5I5EA 1T36A 4R3NA 3I9LA 4WOJA 2GCEA 1ZOLA 5TC4A 4L4RA 3PL1A 1EPUA 1E89A 5TS2A 3G1UA 1D2EA 3OLVA 4GP9A 4KX3A 2WQ6A 2F48A 2ZYSA 1KSHA 2OWDA 3A4NA 1GG9A 3BB4A 3VC3A 2GZSA 3E61A 4Y18A 3NIFB 4DADA 3NDPA 1QNLA 4XDYA 1AHNA 1B1CA 2PL1A 2QD3A 4KGDA 1SVOA 4DNFA 2XYRA 2ZETA 5K0LA 3AHEA 5EMKA 4DGSA 3GFQA 3GFVA 3NDIA 5F1YA 1AB5A 3WKBA 2X7JA 5BVHB 4KXMA 4FQ7A 2HHJA 3ZTWA 4CKCB 5M29A 1B2LA 2XOKA 4FT2A 4PZUA 4LN1A 1BRMA 1PR9A 2PLWA 2WKSA 3NHYA 5BVHA 3WLLA 1CJBA 4CKCA 1H42A 2P5YA 3K70C 1SB8A 4QBIA 2VP6A 1GGEA 1ZG3A 3N7TA 3WDLA 2Q21A 4J0GA 1G20B 2I9KA 4PX5A 3IHKA 3OJCA 1T3TA 1I6LA 1V0JA 3RQSA 4YYEA 5IKMA 1EFKA 1JN0A 2OBLA 4A0GA 1CFJA 1JNYA 1G20A 1HTWA 1TQHA 2DTEA 4CV3A 3HCAA 1E18A 4YA6A 4J3JA 2GZDA 1PBNA 2O5VA 5IW8A 4Q4JB 4EPRA 1YDMA 2I4LA 1A9SA 5HZGA 5FXMA 1HFWA 1K68A 3S2EA 4UEQA 4F3TA 2WM9B 3WLSA 2BKUA 2JPDA 2RI0A 4R51A 3I1IA 3P4YA 4Q4JA 2BONA 5CIYA 4TKVB 3FHTA 4H08A 4E5NA 2CKMA 4EPYA 4L1KA 4PPFA 3TTYA 3VBCA 5BV1A 1UQRA 5P21A 4KRGA 1IK6A 1H3NA 3K8QA 1KHTA 2JAPA 4NR0A 4UKDA 3EDMA 3H8JA 1BXKA 4INOA 4TKVA 2RGAA 4IW3B 1X7GA 2QNIA 3BRCA 3ILXA 5IKPA 1J23A 4BMNA 3R2JA 5FHQA 3WIOA 3U7FB 1SULA 2D62A 3DNFA 4LV5B 4DYDA 1E1RD 1KI2A 3T3IA 5L95A 2HYIC 1NW5A 5ECWA 3CN7A 3WBJA 2NVOA 2NSJA 3LP6A 1O58A 1UBFA 3L7IA 1NKVA 5FORA 4BB9A 4CT5A 2ZXEA 4D96A 3ONNA 4M1TA 3B38A 2BBSA 1E77A 1KY3A 3O2NA 3FFTA 3BF7A 4OJQA 2DE0X 3EX7C 1FVFA 2HNBA 4JJZA 4QASA 4E09A 3WGMA 5G3YA 4BB0A 3EH1A 3ESBA 2B8NA 4MLPA 1WD5A 3WGUA 3VO9A 2V0GA 3D7NA 1ZJJA 3OTOB 1IHDA 1XJWA 2WUWE 4ZRNA 1OQAA 1UMBB 4I1PA 1FZTA 3C70A 3BA6A 3LGSA 4OA5A 4OHYA 1KI7A 4TYPA 3VJLA 4B6FA 5KNCA 2XUZA 3Q72A 3DL2A 5A0TA 5JEDA 1UMBA 3HJHA 9ATCA 3NWEA 4YS6A 1MRNA 3CIOA 3DE6X 4CMGA 4ES6A 2HY7A 1DTEA 2HWYA 3N0VA 4B7XA 1VYTA 4PV7A 3FRJA 4GPAA 4RVOA 3EXG2 1OTYA 3N75A 4IDPA 5DB4A 5DI9A 2YV1A 2G5PA 2PGAA 2VOEA 3EZ7A 1MW8X 2O3RA 3HYNA 2IP1A 2YWJA 5A0VA 4WOCA 4N48A 4FZ3A 3VKWA 4Y2XA 4DJ5X 2VJOA 2E4ZA 1VLVA 3IP8A 4YJ2B 3C48A 4LZAA 3S2FA 2O1EA 1O95C 3ENQA 1TU3A 2QX9A 2PL9A 2YOFA 5LDDC 1U0OC 2QROA 5KSWB 3ICCA 3V8RA 4YJ2A 3E9EA 2BISA 4MQ6A 4D3FA 2L82A 3RLFA 4E51A 3R0QA 4EWLA 4UVHA 4EUEA 3DFKA 3CB2A 3O8CA 1ZGZA 5D5PA 4DLBA 2GTIA 1KH1A 1SXPA 3O6VA 4HL6A 1K3FA 2CE7A 1FTNA 1R4ZA 2WKPA 2AIRA 3A28A 2ZBPA 4V0OA 5ALQA 2JLQA 3BS4A 3VNSA 1A7JA 4O2LA 4AUMA 1D6MA 3NZEA 4UE3S 5FUVA 1PRYA 4OSPA 4E31A 3H8WA 3WGIA 4D4LA 5HGXA 1LF0A 1F6WA 3HWSA 1NT4A 3NV7A 2RG7A 4J0IA 4ON9A 3K9BA 3WGJA 4E70A 2IVFA 3IJEB 2FH5B 4ILKA 5H83A 4E5KA 4GQBA 3SJ7A 2TMKA 3ICWA 3DE2X 3H2ZA 2CBGA 1IBLB 3PRYA 4DKXA 1M6VB 2DJIA 2AI3A 2H59A 1GGJA 1QO7A 2FSHA 5IAKA 2V5UA 2O2HA 1MVOA 1M6VA 1PKEA 2O8NA 5GZ6A 2F1OA 4B46A 2FWIA 2J5KA 1EE9A 1H66A 1BS9A 4JCCA 1ODSA 1YCFA 4TQGA 2DSNA 5KQPA 1YHYA 5KZMB 3THWB 1DAPA 2EW1A 4M9CA 2CK3A 2H7CA 2PSDA 4ZVTA 3PDWA 5AKKA 2X2EA 5B1HA 5AKGA 1SY7A 4WZBE 2BSXA 1XAGA 3THWA 2NTVA 2P9YA 4Q05A 4YREA 2DTDA 1KAQA 1YMQA 5ESDA 1MAVA 4PLCA 5C2JB 3DL4A 3HWRA 3UOWA 2HPVA 2J7PD 2K87A 3H5OA 4WASA 4CTKA 1ACMA 1SBCA 1R0LA 1E2DA 1QHFA 2AG6A 4MWGA 1Y3FE 3L7AA 4OHKA 3WA7A 1J1IA 2G0NA 3BWEA 2HV8A 3IVMA 4KQKA 5JPIA 3WFIA 4GVXA 4J49A 5AK0A 5GGYA 1Q1NA 2JGDB 4RWZA 3GWGA 2QVCA 3C7TA 2OGUA 4ZEOA 1GQYA 3TZ6A 1N32B 2JC3A 1IBRA 5HBGA 2ZR8A 2J6IA 3MCAA 4FCWA 1UK8A 1ZICA 3E9QA 4G8BA 2JGDA 1N2JA 3W79A 5FIUA 2YHBA 4BLPA 4R2LA 2DPHA 2XNSA 2NT3A 1JMKC 3VC1A 1CYEA 2H1OA 4G5QA 1IG0A 1U9JA 3KVVA 4CKEB 4P5PA 1ZD9A 1I1QB 1GIAA 3JYPA 4HNHA 4UEKA 4C6SA 2HT1A 3MJFA 2BM8A 2C57A 1QJ4A 3ZE8A 3IV6A 4RH1A 1J22A 2M32A 3FZGA 4HWPA 4JBWA 4PYRA 2QI9C 4WFKA 1DJNA 4CKEA 3FZYA 4M1WA 4R8KA 4D7AA 1EJ2A 3OIFA 3V4LA 3Q2OA 3TPFA 2WWXA 2GR9A 3T95A 3QUTA 3AM3A 1N8NA 3ZJ4A 1UMCB 4MDYA 1L5SA 1Q95A 1RXCA 4P4TA 4UJ3A 3ZHVA 4FYKA 1IM2A 3QEMA 3X1KA 5F7OA 3EIFA 3NFRA 5AW5A 1TJPB 3UHJA 1UMCA 5CFPA 2I3BA 3VPSA 2PO5A 2B4RO 4RK6A 5DSXA 4C21A 4A36A 4ZHQF 4M8IA 8MHTA 2PA3A 4YRNA 4F92B 1R6BX 1ZNWA 4QLOA 1D7AA 1ADJA 1CY6A 1RBQA 2WFZA 1PFUA 2GOYA 2CE2X 1YU9A 1D6SA 4HJRA 4NNPA 4RX1A 4D9BA 3FVQA 3AEXA 3GBPA 4D9FA 1GP2A 1ENZA 1OBCA 1Y98A 2OENG 4Z0PA 1UPBA 5DWQA 2PFGA 3KHTA 1JI0A 1LJ8A 2DWUA 3PPIA 1QGED 2E4VA 4OHFA 4X24A 1OGJA 3VUFA 4J9UE 2GBLC 4LRUA 4P7FA 2J8ZA 1U6JA 1WLYA 4AUEA 1MO5A 4AJPA 3R5TA 2VFAA 3H1EA 3MTEA 1ZD5A 2HF9A 3M3HA 4QGFA 3TEFA 7GPBA 2QTMA 1TCCA 2D5AA 1RLUA 2X4LA 3B1JA 5ELMA 4M9RA 4V24A 1CHDA 1SQSA 2JBAB 3EGEA 2B1GA 4KK3A 2QPAA 1R64A 4RTJA 3ND7A 5HK9A 4AWAA 2JBAA 2D5LA 4Q9AA 1SBQA 1E1NA 5TARA 3CE9A 2B34A 2WIJA 3IAS1 5EJ5A 2YJ6A 1XRJA 3SQOA 1K7SN 2NZXA 4M8LA 1OX5A 1CEQA 5JQWA 3N5CA 1MX9A 4MYHA 5AM5A 2G9VA 5C5EA 2H18A 1TRKA 1RLIA 4P35A 3OZGA 3UGJA 2A9KA 3G9XA 2AB0A 1UH5A 3CZCA 1CE8B 3LWDA 4GLOA 5NLLA 4B6EA 4CTOA 3OZTA 5E7QA 4B84A 2QTHA 2Y4OA 3ZGLA 1W88B 3V1YA 1CE8A 2XNDA 3UA4A 3UJCA 3PQ8A 1LH0A 3KJQA 4E07A 3D8RA 2F1IA 4DV0B 4UHDA 3GLGB 3HGTA 3RAGA 4YIHA 1W88A 5DIZA 4BZWA 1AK1A 4FZ5A 1PJ4A 2WD8A 3MC1A 2LCIA 5KSPA 4BWFB 1UBMS 3SJAA 1QFSA 3GLGA 2VYVD 1YZKA 3QOXA 4LRWA 1SOAA 1ZM9A 2HDNB 3IAHA 3QW2A 4HWSA 3DFIA 1COWA 1RM4A 3FHJA 5DX8A 3Q40A 1UOPA 3M82A 4R2MA 4P7GA 3JR7A 3GIDA 4G9EA 4RLHA 3GLUA 4N7BA 3P9PA 3RADC 1BC5A 1XTVA 4LF6B 1Q57A 5CNKA 1OH5A 3FROA 3VGPA 2X5KO 1X74A 4P3XA 1XLVA 5IUKC 5JZSA 4MP8A 4BVLA 2XUKA 1AKNA 1L1EA 4O4HF 1L5WA 1Z88A 4RD2A 2JGNA 3PQFA 4RD4A 1HV8A 4RPIA 4WXMA 3BZWA 3PR2B 2EGGA 3DPUA 3WX0A 5FNVB 4XUGB 4XLTA 4COOA 4EPWA 1NXOA 1A9QA 3JS5A 4UU1A 2FZWA 5CRIA 5EZYB 1U65A 1JSRA 1MH9A 1WUJS 3DAGA 3SHWA 5L8VA 1UDWA 5FNVA 5ANRB 1X9GA 2F4NA 3ZHOA 3LE8A 4I6JA 5EZYA 2CWDA 4KLRA 2VBCA 4UQLA 3PC6A 3D02A 4FEYA 4W5HA 3HMQA 3LPAA 3G2LA 4FC6A 2FXVA 4J7XA 2BGWA 2FK8A 5JRJA 3FCOA 3GJ3A 4PNZA 3WGQA 2WF7A 2JLXA 3PUHA 4ER5A 1E3JA 2WJ6A 1P2VA 4X84A 2OCIA 2YV2A 3WMGA 2Z1DA 4OYRA 1I01A 2QRZA 3IAUA 4MQBA 1EB9A 4WCDA 1DRWA 3TRJA 3UXEA 5IU6A 3GA0A 2AWOA 2EIHA 3R6TA 5K0BA 5DYYA 2B7CA 2G6TA 1ECFA 3WP1B 1GPYA 2A14A 2G07A 2GN8A 1KI9A 3PNQA 3SMVA 3O2SB 2LV8A 1HA3A 1SC3A 4IXWA 4G2TA 4RZ2A 3VU3A 2GEDA 4DCOA 4RNDB 3U4AA 5ECYA 2AFIB 2P68A 3F2IA 2OFPA 3M7IA 3PVZA 1Z0ZA 2WYUA 1Z18A 1BGWA 3BHIA 1PWXA 1NIPA 1SXGA 1W1IA 2VP3A 3K0HA 1UBOS 4HYQA 3SG0A 3TQCA 2AFIA 2CJFA 4KQFA 5A2QA 2FPRA 3RKUA 3NXSA 2FQQA 3DKPA 2P6MA 3T4PA 3UXYA 4EHJA 3U1VA 1P2TA 3CLRD 2R6JA 1Q44A 2XSZA 2YRFA 4B2LA 1P4AA 1N9GB 2COKA 4N76A 3VDMA 3LK7A 4ZK2A 1L7QA 1RYHA 3JTMA 5JR3A 1GSOA 3H99A 4Y1EA 3V55A 3FR7A 2ZR7A 1N9GA 4CDGA 3FE2A 3H9GA 4LY9A 3DOUA 3KPVA 1G4HA 2LUOA 4GM1A 3GXBA 3I64A 4RVSA 1TTPB 2FE4A 3LWZA 3D8BA 3J7TA 4MYDA 1RM5A 3W8DA 3EFHA 2IYSA 1SPXA 5EL0A 4BXOB 2H3HA 3ROQA 3SOPA 3KKQA 5KAMA 3T3OA 2XE7A 4G2NA 1OZ0A 5J2TF 2RGUA 3PGMA 5H9VA 1K4KA 4QKQA 4BXOA 4KP7A 1R8QA 2R79A 2V5AA 1ZBQA 2A88A 4YQZA 5LQSA 3UKJA 2RAVA 5I7EA 2IP2A 1PNOA 4OFWA 4EY4A 1Q7TA 4P83A 3HA2A 2GWHA 1JF8A 4TVBA 3I5YA 4R5MA 1J06A 2Z0MA 4A3SA 4E2WA 4MV8A 2JCXA 3AB3A 1E2HA 4MS4B 1OXVA 3E1KA 4B0PA 3LUFA 2P67A 3R24A 1JTEA 3CNNA 4MYCA 2EQBA 2AVNA 3EOBI 3H2GA 4C07A 5JD6A 3ZN2A 2IOHA 3BD6A 5GM2A 4MS4A 1L7DA 2IF0A 3NHPA 5KWJA 2NG1A 4WAUA 4X65B 5DBGA 1ZJ4A 1VJDA 3EWNA 3FHLA 2AL7A 4BX3A 2IA5A 3KSBC 2DH6A 2BDUA 5CVEA 1MQ8B 3IEMA 1F0PA 1KJWA 2DP4E 5SZHB 1B15A 6CHYA 2KWIA 3C3CA 3DE0X 1U7DA 4KIUA 4U9HS 2RJ3A 3ND5A 4RDCA 3TLZA 4U2EA 4QQ8A 1P1RA 4PLZA 2BJVA 5GQSA 5KOIA 1E2IA 3ZGZA 1YIOA 3B9QA 1TYCA 3DZ8A 1HE2A 4ZODA 3ZPXA 4IIJF 3VPCA 3QVKA 4KRFA 2C59A 4EB3A 2VK8A 1BGVA 3EEYA 3L05A 3ORRA 2N47A 5EIBC 4DR6B 4KAAA 2C2GA 2PUHA 2H0RA 3HNPA 3SHQA 4WA7A 2HIGA 5LD2B 4BMYA 2BHSA 1I4OA 1GFWA 1VE9A 2BM0A 3MJTA 3BXZA 3K0BA 1PG2A 2AJCA 2I62A 3GFFA 4ZANA 1O94A 1IM5A 1HSZA 2VSOA 3RC8A 1BDIA 5CDFE 2ZRDA 1EE1A 2V6GA 4IRXA 3STWA 1I7LA 1Z29A 4ZEWA 4DLAA 4EM6A 2DSTA 3M8KA 3WAGA 5KYVA 5GMOA 2CXQA 5BSHA 5JAHA 3GN1A 1MABB 2VJAA 1D4FA 4J0CA 2QLBA 4JLMA 3BBLA 1DQYA 2H2DA 2KM1A 3G79A 4F5EA 2EF1A 3T5PA 3VR6H 4XWYA 1NBEA 4IXMA 1HE5A 1KRHA 2NSHA 2WJJA 3GUYA 3RJZA 3WO1A 1B23P 2O52A 4PAOA 1MABA 2FR8A 2NOAA 4F11A 2EAUA 4L8GA 2YFKA 4TT8A 4M7PA 4WA8A 4D8WA 2VH2A 3M6FA 4HGQA 1WF6A 2Y9MB 3K5WA 4ZVMA 4YMSA 4LC0A 4YJDA 1ZUWA 3SSOA 1YKGA 3L7CA 2IV2X 4U7HA 1XNHA 3VVLA 5GINE 1O7JA 5EINA 4EL5A 2AN9A 3RC3A 5F21A 1UXIA 3V8PA 1ADGA 1GOTA 2ZE5A 5EJ6A 4L5AA 2F4VB 1Z3CA 2H31A 2H8GA 2G36A 1A1SA 2QZPA 2X19A 3NC0C 3DKIA 3HCOA 4OUDB 3SIPA 5JCPA 1C0PA 3DMPA 1Z34A 5JNRA 3I8OA 4JGGA 2J3KA 3BFPA 3K1AB 4ZCLA 2IYUA 4BE4A 4BZZA 4UPDA 3NIGB 5KC9A 4KDEA 1RCUA 3QHAA 4OUDA 1NXWA 3IULA 2IKQA 3N6XA 2ZRCA 2BI7A 3NHSA 2J0SA 3K1AA 1DWOA 4FGWA 4L28A 3SK0A 1G19A 1U2QA 1UJMA 3UOAB 2VCYA 4KXLA 1QHGA 2O2DA 1PWYE 4V0NA 3LIIA 3N2GB 5AVJA 4WESB 4ZARA 2JD0A 2AXEA 1EZ4A 1IEXA 1PLKA 5HGJA 1A5SB 3RUDA 3EZGA 1J20A 1SXHA 4JFRA 3ZXYA 1FDUA 1JDZA 3O3NB 2XUGA 4KFTA 4M9XA 4PSCA 4UULA 5A4FS 2ZIVB 3L0PA 3N2GA 4UZFA 4WESA 3RSHA 4ALIA 5I7UA 4B3GA 3I23A 3K53A 1F4PA 1SMKA 2B8WA 2ONYA 4IRUB 5HCIA 4ZCTA 2V7GA 3ZQUA 2B82A 4LPSA 5M2QA 1Q20A 2FK7A 1UPTA 4LEIA 5DGIA 1TYDE 3ZZTA 2HLNA 4WK0B 3FNRA 1V1RB 2IPXA 2X9VA 3KOOA 4UM9B 3AV3A 1YWGO 2GAFA 2P4EA 4H6WA 2ZIXB 1JHAA 4NPHA 4WLVA 5JSHA 3R6GA 1V1RA 3W0LB 1J49A 1QFMA 3FMOB 1JWLA 2BMJA 2XR1A 3PE6A 1P72A 3MEQA 4KYVA 4EG3A 4G4SO 5L51A 3V4FA 2B94A 2ZIXA 4RTLA 1EQ2A 1ICEA 2ZTUA 5FKJA 4CTMA 4XKJA 2V7EA 3V8VA 2JJQA 1B0PA 3N58A 2UU9B 2C82A 3LY5A 2DCUA 4TKZA 1XZJA 2GPTA 1F51E 4D9JA 1SUAA 3KPUA 1Q0UA 2WABA 4L8YA 2VK2A 2ZSBA 1YQXA 4RKQA 3DC2A 5A6VA 5EJFA 3M4ZA 2HI0A 1SKQA 1NVGA 4DIMA 1KJZA 2HJGA 2RI6A 5FOWA 4FB4A 4MQLA 1TDJA 3VO8A 4NMMA 4DDTA 3O8OB 2B8TA 2HRQA 2YNMA 3EGCA 4YGYA 3Q4GA 5KVVA 1TPZA 5GJCA 1Z0KA 2DWCA 3ZVNA 1KF0A 1M1YE 4OJNA 5KJCA 2XCIA 4F4IA 4MHOA 2G4CA 2P9QA 4ND4A 1KYZA 3U7IA 1GARA 1ZFNA 2C2KA 2FHSA 3O8OA 5C4GB 2GO1A 1GZ5A 4JL8A 1LNQA 4LJKA 4RFLA 3A7EA 4RD3A 2WU8A 3MT9A 3W1VA 1ZRSA 4CM4B 3CY6A 3GVIA 4L15A 4DSOA 1NBME 4DLNA 1BFUA 5TNXA 5ILQA 4N3BA 2C2MA 1JB9A 1P77A 5A2GA 5CU7A 4BQIA 1T5IA 3AYXB 4CM4A 5JCOA 4EGAA 4MIOA 3QYJA 3ZJ5A 2PR7A 1W2HA 1X1EA 1RZ3A 3IRVA 4R2KA 1ZXXA 1N9ZA 1P18A 3OQ6A 5EMLA 4QXQA 3P4UA 1BOFA 2WJYA 3NT4A 4WCFC 1UDAA 1XAIA 5JAZA 3WKAA 1GLVA 5FLKA 3ZNOA 3HXMA 1CQWA 5DBOA 5KWIA 5A7FA 4X71A 3OE7A 3RV4A 1P4GA 2WJHA 1LRJA 1CUZA 3ZI7A 3TR5A 1R5JA 1NR5A 3H4MA 2ZTSA 3D6HA 3PFCA 1QZ3A 2V7XA 1CDEA 1BE1A 3L8CA 1S9DA 4K9SA 10MHA 3KQVA 3PEFA 2EYUA 5B1IA 5K3AA 1IOZA 2ODEA 1QCYA 2G77B 4HH3C 1GV1A 1WZCA 2E87A 4JHXA 3SVLA 2A58A 2W5UA 2R751 3WB1A 4FX5A 5I5GA 1BROA 2SKDA 2WMNB 4TYWA 2YZNA 4MAMA 3H3XA 4NPCA 4MK4A 4A26A 5AUPB 2ZE6A 2H4YA 2XGMA 1KI4A 2NZVG 3CGGA 3HY6A 1U9IA 2O3JA 2BF4A 1LEHA 1R0RE 2REOA 2PQ2A 2YC2C 3I6BA 3H2IA 4HB2A 5FR1A 2QM0A 4B32A 3IE1A 4UW9A 1WETA 1FRNA 1I94B 3AUXA 3Q1LA 1RIFA 2FNAA 4CN8A 2YIDA 4MTLA 1W34A 5IAGA 4YAGA 5LN1A 5K8JB 2NTNA 5KB3A 3C1AA 3A6DA 4R5HA 1AK2A 4XASA 1IM8A 4ZZ3A 2X1HA 4U9IS 3ONVA 3PX2A 3NUQA 2E55A 3ORQA 4FLMA 3AWIA 2Z56A 5G3ZA 5LQUA 3HY3A 3R3JA 1K7CA 3SQXA 1E3MA 1X7XB 1U4NA 5ABPA 3JRWA 2FQWA 4X7RA 3TBHA 3OA0A 3CH7A 4DXHA 4DDUA 4OP1A 4FYMA 3EULA 4FQ8A 2V7VA 1UBLS 3N8HA 4WBSA 4YT5A 5G1NA 2GFIA 4JNCA 5AVZA 1X7XA 6ABPA 1AGNA 3A06A 3PTZA 1OIVA 3M6XA 1Z0FA 1WY7A 5B7GA 4UUBA 5EE3A 3GVXA 1KQ3A 1P1BA 4DC9A 1R6XA 4EUHA 1JPJA 4NG5A 3IBSA 3FTCA 4X6UA 4WLOA 2PJRA 3B2EA 1VLQA 4WKBA 2DBYA 2XX3A 1CEEA 3AETB 3OEEA 1E4YA 3B5IA 3AIIA 2R8RA 3QVLA 5AM0A 3VGJA 2CLDX 2XOKD 3V2GA 4II2A 4FMDB 5JU6A 4B81A 5EKUA 2GPAA 3MGKA 5BWMA 1TM5E 1Z2PX 1JG3A 1U8UA 3AETA 3U26A 3BD9A 3P9CA 3NHRA 1OI2A 4H77A 1EWYA 4MI6A 3AY7A 5LPNA 1ZL2A 1KK3A 2RIRA 3IH5A 1Y1SA 1I2DA 1ZAYA 1AZSC 1ZJZA 2WJWA 4AO7A 5FPTA 2IZOA 2NSYA 3DFFA 3HGMA 3QFFA 2YASA 4GMFA 1VFPA 2ZRNA 3MQ4A 5F78A 1LI4A 1L1RA 4KHZA 5JCJA 2ZR9A 3ADCA 3KX2A 1XDWA 1M2KA 2QM3A 3V48A 3GT7A 2E6UX 5CIQA 1VA4A 4JT4A 4MKGA 2IOYA 1WXDA 4G24A 5BWNA 1E7RA 4BL5A 4DJTA 5KQLA 3EIUA 1FX0B 4L57A 1YJQA 1R1DA 5GP1A 5DSTA 4PE5B 5JATA 2AMJA 2Z09A 1QRSA 3T1QA 2JFBA 2VQ3A 4Q02A 4K9RA 1QP7A 1FX0A 3VI3B 4M0LA 2JJYA 3EAQA 4UTXA 5HFJA 5BW5A 5CB8A 3OQBA 5GONF 1SBYA 4TXHA 1PJLA 2ZKIA 1JALA 3DEHA 3IMKA 3TSCA 2WJIA 1QLWA 2DPXA 4L8LA 4ZYZA 3PRJA 3PDUA 3A9RA 1XXHE 3QIAA 4MPTA 1XVUA 1HDOA 4RKRA 4WRRA 2R66A 1UEXC 1VYHA 3L6EA 2H48A 3E9YA 3O75A 5CDUA 1OFUX 2ECPA 4G37A 5ALLA 5F5LA 1KYTA 3U37A 5BYAA 3TBKA 2PTHA 4IP0A 1O77A 5BYBA 5H3HA 3C1TA 1E61A 4C6TB 4F8YA 4M98A 3RVSA 1N0VC 1AHIA 1WXGA 4ZYWA 1RMTA 1AS0A 4HMPA 4QFBA 2FN9A 4CLOB 2JJ8A 3RBVA 4RLQA 4C6TA 4IDEA 5KNCD 3ZD6A 3H97A 3R3VA 4BNMA 3UTDA 5B3LA 2VUUA 1L4LA 3QKUA 2C8KA 2GPYA 4CLOA 3AVXA 2UXBB 3VR5A 1VIDA 3RHTA 4IDFA 5ALYA 3QMVA 2AJ8A 1NBIA 3KTAB 3KZVA 3K92A 3GAZA 4H9GA 1XF9A 2BGIA 1M8PA 4YMGA 5FV4A 3ENWA 2FW6A 2UYGA 2JKYA 1YDEA 4F1JA 1UFKA 1WMFA 1PVVA 1CRLA 1Z8HA 1P74A 2VWGA 2HB6A 2XXBA 1F38A 1KYIA 4AKSA 5IPFA 3KKMA 1IBCA 1UMDB 3S2IA 3T1TA 3NTQA 3FGPA 4LFCB 3EPRA 2HZ7A 1DRKA 5EAIA 2IV3A 4DIBA 3QWFA 1TCBA 4F5ZA 3PXEA 2P78A 1O6CA 5KOYA 1NVKA 1UMDA 4NZPA 1T9KA 2EWWA 4NC9A 4RPHA 4WL0A 4NBNA 1ZD1A 2KYRA 2H06A 4HF7A 4A8JC 4BDTA 4OHWA 1EXDA 3L93A 2C5EA 3EVAA 3V6MA 5B55A 2QQEA 3CTMA 4QT0A 1YF3A 2CWWA 1N5OX 1T1JA 3L0SA 3KVYA 4WEQA 3V4ZA 3RYHB 4EEXA 2AW5A 5BUSA 3I6MA 4B82A 2FJ0A 3IESA 5ELLA 3CLTC 4L8VA 4QPJC 2VJYA 2HXSA 3HG7A 4WZZA 1VI6A 2HMVA 2PTGA 2IYLD 3CH5A 3CYFA 4FR0A 4FYHA 1PR5A 3AUYA 3RS2A 2OB2A 2EJWA 2FN7A 5AK3A 3A1SA 3FX2A 4ZOBA 2QRLA 3PQ3A 4KIGA 1E1QA 2HA4A 4P36A 3L7JA 4UBIA 5IBRA 3WGZA 4Y7CA 3WYNA 3GGJA 3RYFA 1JS1X 2IIVA 2EBWA 3DJYA 3TQTA 2QVXX 3JATB 2JH9A 2RKOA 3I34X 2IELA 1SBZA 3S3TA 2Q8QA 5A71A 4HS4A 2QAJA 3WK8A 5I51A 2QU7A 4NULA 1J5PA 1USGA 4WV3A 4R0NA 3JATA 5BUCA 3IQIX 1J90A 4ATNA 2EX1A 2IYPA 5CDSA 3UNXA 1P0MA 2L0XA 2WUVA 3RK0A 5BV0A 3DXYA 3G85A 3NANA 1SBHA 2CK3D 2CXSA 2CZGA 2WYVA 4OHUA 2YWGA 1JKIA 3VFDA 5I9NA 3RVNA 1V26A 1C41A 3AF1A 4P22A 2QRQA 2P5SA 1HZZC 2WILA 1HYQA 2WIDA 1ZD3A 3E9DA 4I14A 3ZWKA 1G8JA 2Q6LA 4A2WA 2JIQA 3U9SA 5K3EA 4IG4A 3LZCA 4OSEA 1KORA 3DZDA 4FMCB 2H2WA 4MINA 3ESAA 3B20A 4QOJA 1M6YA 2XODA 1MC5A 2Y05A 1FJHA 3G17A 3L8EA 4EVIA 1E2BA 1FS4A 4V03A 3RABA 3QTBA 4RLFA 3PEVA 1ZJ5A 2JJ2A 2QP9X 4KKVA 5IWAB 4HXYA 4NZ9A 4RYLA 3I9JA 4WUVA 1OBVA 5AHOA 5JS8A 1YZHA 4RESA 3F6EX 4H4DA 1PJ3A 2FW8A 2V0CA 2AK2A 2C7PA 5BN3B 3JPWA 4EF6A 2Z6AA 3BPSA 5DASA 3EGDB 4FQ5A 3IBFA 1FTWA 1MB3A 2SECE 5HEKA 5KHLB 1DOZA 1SFRA 1GHTA 4O1IA 2QQGA 3ABZA 3K94A 2B21A 5BN3A 4DSTA 4GRIA 4QBTA 2HCTA 3EGDA 3L4SO 2GI4A 3OH8A 2YDXA 2PL3A 1XQXA 5ALEA 1VSTA 3LPCA 2FEOA 2FUCA 2QMZA 2D2FA 4G97A 4QG3A 3IJPA 1QOZA 5T5QA 4MAFA 3WWPA 1IZ7A 5LQJA 1I3MA 3UT0A 5DTIA 3QLVC 2ADFA 3NBFA 5JISA 5IM4F 1TMYA 3AT1A 1O9GA 1YI1A 5TJ9A 2Z2IA 1HC7A 2WV7A 4N03A 2QX4A 2WR8A 2YY7A 1FSSA 1K8ZB 3M9WA 3GRAA 3K0AB 1YOVB 3AHGA 1N5KA 4PFQA 5IN4A 1ORTA 2HL6A 5ITSA 3NAGA 2FSVC 2VZ8A 3UHAA 1KYXA 1RQ2A 4CL2A 3I4LA 5DPMA 3K0AA 1NW7A 1YOVA 4ZC8A 5IWCA 5EEHA 1U9CA 4GICA 4K0RA 4ZQFA 1K92A 2I71A 3NVDA 1FOEB 2H65A 4LV8B 2VBFA 1BX3A 3HCDA 1ZVJA 1QUEA 1V37A 2JIDA 3CLVA 2C5AA 3KR2A 1N3IA 4MSUA 5EZQA 5ITVA 5JJKA 3I04A 4JKYA 1HURA 1H8EA 3OX1A 3RANA 4PZAA 3I9NA 3GMSA 1I7PA 2EKLA 4X97A 1MZPA 3ANTA 3M6AA 2NTJA 2K4MA 3GLKA 4PYJA 2W22A 3KYJB 6YASA 3V7FA 3REOA 4XYMA 4MHTA 1H2HA 3TSYA 3UJAA 2O5EA 1OFGA 3ZEIA 4MMYB 3HWX1 4QDZA 2ZVPX 3LTEA 1UIMA 3IBYA 4A1OA 3W8RA 3UM9A 2ZDGA 2NV0A 3EHEA 1ZQ9A 3H5AA 4RGBA 4AY4A 3CO5A 5JYCA 3VPHA 3Q5EA 4K7JA 3A6FA 3DZGA 1O6ZA 5CW2A 3WKEA 3KIPA 1TUIA 1DIRA 4Q19A 3GDFA 3DLCA 4EKEA 3DVRX 1E1YA 1RHRA 2OCBA 2MMCA 5F1KA 2OG1A 2YXEA 5B7PA 1GGNA 3EZ9A 3HCPA 1LW6E 4EA6A 4B79A 4QJ3A 4YMVA 2ISQA 4TKUB 4H7PA 5ULLA 4JBGA 4V0ME 4AYWA 2ZRKA 4ZJPA 1RWBA 5E4JA 3VYTB 4G8CA 4TKUA 4IHQA 4LK2A 1LBQA 2PUBA 2HMYB 4GAEA 1OD6A 2FZLA 2OM6A 3THRA 4C2UA 1LLCA 3G8YA 5DBEX 1CYDA 2NYUA 3BXOA 1P7VA 3GC6A 3JYHA 5A0FA 5NULA 4BFCA 4CM7A 2HKIA 4DQ0A 1WPGA 1NVEA 4MQUA 3AR2A 4D9MA 3ACCA 3IA7A 1DARA 4FGKA 1N3BA 2BHRA 1PQPA 4G5HA 2ON6A 1L5HB 3UPUA 1R10A 4WN9B 1XWIA 1I2MA 2C9DA 3WZ2A 1E2EA 1COWD 3G9ZA 3WXBA 1EEXB 3UB2A 5I01A 1AKWA 4DUYB