2OEPA

Msreca-adp-complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
325
structure length
324
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLEKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 76
structure length 324
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oepA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oepA01
4D25A 1Q3TA 4JLJA 4BASA 1WBBA 3C5CA 1N6NA 2IYTA 2JLSA 2QT1A 3TRFA 1NL3A 1QRAA 3U3JA 3PUVA 5TMPA 2KSQA 1JPJA 2QRNA 3GJ3A 5FUVA 3NBFA 2WMOB 4XWAA 2FFQA 2PJRA 2ONJA 3AVOA 5CM9C 1XTQA 1F3OA 4NCJA 1U9IA 5TARA 1IY2A 3IPYA 5GJCA 3BH0A 1W4CA 4R2IA 1M7HA 3RABA 2JATA 3C41J 5EE5B 1KZGB 1OT3A 1E2FA 3OIWA 1E2MA 2F55A 5IHPA 1L7VC 4BFTA 3U5ZB 2FZ4A 3DKPA 4CT4B 5P21A 1NG9A 1SVSA 4IKEA 2ZEJA 4FW9A 3BB1A 4M1SA 4MYUA 2Q9BA 4L16A 1ZUIA 4XSHA 2ERYA 2XITA 1OPXA 3BD9A 4HAUA 3THXA 1BOFA 2ZE7A 1XTRA 2FG5A 4IXNA 4C0BA 1S4QA 1XB2A 1VCOA 1M2OB 2VBCA 5EE3A 5FL7A 3OEEA 2J0UA 1A82A 1ZNWA 2CVFA 2BKUA 4OHZA 2B8WA 1G1MA 4HLUA 3SYKA 3V4FA 2VYFA 1FMLA 5K8TA 1IN6A 1V5WA 5FBLB 2AD1A 2OXCA 3AKYA 3K09C 1IN4A 2WICA 4LRWA 2ZRDA 2IYZA 3KJHA 1IXSB 1EWQA 2H92A 4W9MC 1OJLA 3EWSA 2JLZA 2J7PD 2NPFA 1Z47A 1BMFD 5FOXA 2NPIA 3MJRA 4WXRA 3WNBA 2HYIC 1JAIA 4DXAA 1SVKA 2ZI5A 4D0GA 2MMCA 3JZAA 3QXJA 3X1WA 3BORA 3MG9A 1G7SA 4O2RA 4D4MA 1YR7A 1JR3D 4DDTA 1Q1BA 1LS6A 5AJXA 3L82B 4RVCA 1GFIA 3GLHA 4YMUA 4H1VA 2QBYA 4UJ3A 1F6BA 3TLXA 1DAEA 2B21A 1CTQA 4Q4HA 4QM6A 1Z3IX 1TQ2A 1QHHA 2FSGA 5E7IA 4US1R 2YV5A 3KJGA 3SYLA 4TLEA 4A6XA 4XVUA 1W0JA 3WXMA 4LSGA 3C14C 4RZUA 1E9RA 4OQMA 3D31A 3ZVLA 5C46F 4PR0A 5JSZB 2GKSA 3EC1A 4JLAA 4OQLA 1P62B 4GFDA 3T1QA 4Q66C 3ZJYA 4Q1CA 2O8EB 4A0FA 4AKEA 3V00A 1AIPA 1CJTC 1NRJB 1SULA 1CLUA 3QXSA 4Z8YA 2JJ1A 4DLTA 1ZJ6A 4HUQB 4DRZA 1KNXA 1MT0A 3B6EA 2ZROA 1KMHB 1JECA 4NL4H 1E0JA 1Y63A 4ZI3A 4A6PA 1TEXA 1G9XA 2DHRA 4GP7A 4MH0R 4Q03A 1OSNA 3MFYA 5F98A 3QE0A 3EPJA 2MSCB 2ZITA 1FQKA 3Q5DA 3WHKA 5JEDA 3TK1A 5JWOA 3PIRA 4JLMA 2ATVA 4NKRA 3WBJA 5IK2A 2C5LA 1HY3A 2QAJA 5KSOA 2O8DB 5B30A 1LF5A 3B60A 3MCAA 1EK0A 3W6NA 1E0KA 5JBQA 3MWKA 1ODFA 1OB5A 1GNQA 4RJLA 1KI2A 4X8HA 3TE6A 4PFSA 3GP8A 1DE0A 3K70D 1Z2CA 2ZRAA 1AS0A 1AS3A 4OQXA 3HU1A 2GILA 3I1FA 3B1ZA 3TH5A 3HYRA 1P2SA 2V3CC 1XF9A 3LBHA 4E5UA 5EZ5A 4GRAA 1OH7A 2P3SA 3QIAA 4A82A 3ZDQA 3U44B 1Z83A 2CJWA 3KUDA 4QXAA 1TX4B 1AGRA 1J99A 2RGEA 4DBLC 1IJFA 1SVLA 621PA 2J7PA 3AVXA 3LO5A 4G3XA 4HAYA 3QUSA 2JLYA 4HLDA 3AF3A 2QROA 4LYJA 3T12A 1J90A 4JIMA 2FX3A 4NPHA 5HKKA 4IFBA 3WNCA 1SHZA 2IS1A 2REXB 2UVQA 1AZTA 4ZPXA 3V4RA 1XMIA 4MITA 3BWDD 4LPSA 3VX4A 5FR2A 3ZD7A 3EZ6A 1WMSA 2ORVA 3CZQA 2GESA 1GITA 4GOJA 2ZI4A 1RYFA 3KQHA 1CF4A 1P72A 3PUXA 2GCOB 5CK5A 2KE5A 4Z54A 3AVWA 1P3JA 1LS1A 3GCGA 4OJKA 1E2LA 4YMSA 4O2LA 1RPZA 2HDNB 2QN6A 4JL6A 2GDJA 3W90A 4RFSB 1UBFA 4YONB 4EDHA 4F4JA 2IF2A 3VR1A 1E98A 1E2GA 3RDPA 1L4YA 3EX7C 2I1QA 3O8BA 2GRJA 3CRVA 4F92B 1WBDA 3THXB 3C4JA 3TNFA 1AA3A 4EIWA 1JQLB 2WJVA 2ZSBA 1NJFA 4FIDA 2EWVA 4EPYA 3ZVNA 4CYMA 4FWIB 1CRPA 1DAGA 3TR5A 5KSPA 1DS6A 1E96A 4UXHA 4UNNA 3W3AA 1OLOA 1JJ7A 1VHTA 3CWQA 3D7MA 4R98A 4M22A 1F2TB 3K0CC 1UEJA 3IIMA 4CDGA 2QP4A 4DCUA 1MO5A 1DADA 3QKRB 3TUIC 4GL2A 1T0JB 3P4XA 2OFOA 2HT1A 3L2OB 1DARA 1OF1A 2ZJYA 4MDFA 3SE0A 3LBIA 2WWXA 5E95A 4BGDA 1I4LD 5LB4A 4MRSA 3ASZA 3GLGB 1HQCA 1KI3A 3GLHB 4U02A 3SS8A 3Q8XB 4XTRA 5EXPA 1HTWA 3CRQA 2A3RA 2GAOA 3AB3A 3WNDA 5G40A 3B9PA 1DBSA 2ZJZA 4QGFA 4PHHA 1Q1EA 5K8LA 3NC1C 1OIWA 4UJ5A 1WB9A 2CJWB 2Z43A 4MGKR 3NEYA 1G8FA 2FSFA 2VP5A 1MABB 3AKEA 1E79D 2GETA 3QKSB 4QL3A 1HEIA 1X6VA 2X77A 1J8YF 4Q19A 5AJWA 1P9WA 1MV5A 1G16A 1XTSA 3P1JA 3DZDA 4IEEA 1PUJA 4NCHA 1P9NA 4F4IA 5KHOC 1IY1A 4HATA 2FE4A 3W9YA 1PVOA 3W34A 4HDQB 4HI0E 1DTSA 1E2PA 3DM9B 2G9NA 4UNQA 3THWA 1N3BA 3ONWA 3PFIA 1FUUA 4Z1MD 2O8BB 1KK2A 1LV7A 3ZIAA 2GTPA 3B5JA 2RGXA 5FOWA 1NN5A 4X8LA 4GMXA 4Q9IA 1W47A 1ZNXA 3SJBA 5DN6D 1E9BA 5E7JA 1RC8A 3RHFA 4ZV4A 1G6HA 3PUZA 2ZE5A 1VCIA 1RRGA 1YZKA 2IUTA 4BLSA 4ZDJA 5EXXA 4YC7A 2O52A 5KNCA 2WVJA 1AKYA 3SHWA 3U4QB 3B82A 4V0MA 2QZ4A 3I5YA 2F9LA 4HUQA 1JXMA 1RE0A 3PEYA 4XTCS 2H7VA 1UDXA 1FP6A 2HLDD 4PPFA 2V1UA 2BEJA 1EXMA 2GK6A 5L3SB 2BBTA 2IXFA 1NLZA 3K9LA 4QOSA 1R10A 4B3CA 3CR8A 1E9SA 5DLQC 1Q57A 2ZSAA 3RRZA 5LPNA 3LDAA 3Q7PA 5JHGB 1Q20A 4UNRA 2O8CB 1NMYA 2Q9CA 2BKEA 2YWGA 4LYAA 2F1HA 2RGNC 4GSYA 5LBIA 2BM1A 3EXAA 1BYIA 1NVXQ 2PMDA 1GNRA 1T8UA 1UKVY 3SFVA 1HT1E 3LLUA 3A1SA 5G3YA 3UWKA 1A1VA 2QRZA 3AVQA 1JR6A 3GEIA 2ZRIA 3A8TA 3LY5A 3IHWA 4OJQA 2VH5R 3GLHE 2NO0A 3B1VA 5HCIA 4B34A 2C77A 2P0EA 3K70C 1YVDA 4C0SA 4DJTA 4JKYA 4JLNA 1E9EA 2PX3A 2RCNA 4P4TA 4C2TA 3EPLA 1XPUA 2VIIA 2QORA 3BJIC 4UNPA 4DLRA 1MOZA 2NZ8A 3RRYA 4C9BA 1JAHA 1OHHD 3CX7A 1G291 2OCAA 1GL9B 3QF4A 4PQFA 2ZAMA 1PLJA 2YWEA 1DEKA 1TQDA 5CYOA 1OFTA 2OM2A 2CCKA 3A1UA 3B78A 2IL1A 4YMTA 1P6XA 3MRSA 4MKGA 1ETUA 5TVKA 1X1RA 1VECA 3CPEA 5EE0A 4EPRA 4WXPA 3FE2A 1ZAKA 4Y0AA 1KO8A 3FB4A 2GBLC 2G3YA 3EZ9A 2ZQ5A 3NIBA 4TQAA 2PX0A 2J0UB 1W4RA 3FMOB 1YE8A 3OAAD 4ZDIA 1XBTA 1GP2A 2WSMA 4Q1AA 4OYHA 1P9RA 2AK2A 1C4OA 1DOAA 4G5OA 2JIZD 1AKEA 2IEYA 1SKYE 3SOPA 5IK2D 2PJZA 3FWYA 3TW4A 5LB2A 2J1LA 1W0KA 3K0CA 1PV4A 4A2PA 5HE8A 1VYUA 1U8YA 5DIFA 2B7CA 2KJQA 1CJVC 2UKDA 2MSEB 4M2LA 5FOTA 5SZKB 3HU2A 4PPQA 4AI6A 4IJMA 4LYFA 4PC6A 1CJKC 3HJNA 4M9SA 1F60A 4KYIB 1X3SA 4CEJB 2QTVB 2ZRMA 4AYTA 3SJAA 2QPTA 3OEHA 4TYQA 2JJ1D 5GJWC 1IM2A 4DSTA 2ZJ8A 3SQXA 1N0UA 2RH5A 4RFVA 5EXTA 5CIQA 5FH9A 2DFKB 4GPTA 5BYJA 2QU8A 5FUWA 2Q9AA 2Z6VA 3PVSA 3T1VA 1RZ3A 2AL7A 1NIJA 2OLJA 1H8HA 1VKJA 1Z0IA 2IYWA 4WOPA 4B44A 3LH5A 2AXNA 2BC9A 2C99A 5CLQA 4PQRA 5IDVA 2FWRA 4OK3A 4W5WA 1EESA 1VIYA 2DWPA 4URZR 2A7QA 2GK7A 1E94E 1UKYA 4IDPA 3SYNA 1L4UA 2J87A 1T3HA 4QNMA 4FMBB 2IWHA 5C18A 5KSYA 4D82A 1G5PA 3P32A 1OH5A 3EIHA 5SZIA 4FCTA 4KYUA 3U6BA 2GJ9A 3ZZTA 2CNWD 3OIUA 3UMRA 1KO7A 2QTHA 4E07A 2W0SA 2V4ZA 3CBQA 2NOAA 4B76A 3TIFA 2ZR0A 1NY6A 1VIAA 2VEDA 2PH1A 2CE2X 1GAJA 4FMDB 2QMOA 4CIDA 3KJEA 2R62A 3K0AA 2L0XA 3UG6A 1E32A 3FFAA 1VG1A 5L3QA 2Y8EA 1KAOA 2TMKA 5JLJA 3IKJA 4CZ2A 2WJHA 5L8VA 3FMIA 4RD1A 2ZSDA 3AF1A 2NG1A 2WTUA 1XCGB 1Z63A 1P75A 2PT5A 1D8TA 1T9HA 3DOFA 3NTUA 3OE7A 4Q18A 2A78A 4KXFB 1T8TA 4QGGA 1T3LA 1G20E 2VLIA 2QA5A 1U98A 2Q3HA 4LBYA 1LNZA 4NYJQ 2IA5A 3BK7A 1JR3E 2DWQA 2HJVA 1V43A 1XTKA 2W58A 4PPNA 3KXKA 3GLIA 2CHGA 1P4SA 3AV0B 5IRCD 2XSZA 3A37A 3KFXA 4KFRA 2F3RA 3ASYA 4F38A 1MO3A 1W4BA 2YJTD 4IDQA 4KFSA 4RKFA 2DCUA 4NYJR 3P20A 8OHMA 5GVSA 5GJBA 2PCJA 2W2XA 3HR7A 1KGDA 4CEIB 4KV9A 1S8FA 1AK2A 4JKIA 4LCBA 2ORWA 4BZPA 1FZQA 1D6JA 3H4MA 1E9CA 1VCNA 3EA0A 3OFND 4DUGD 1KSFX 1W5SA 2C04A 1G3QA 2IC5A 2VP9A 5FBVB 1Q1QA 2ERXA 4LWZA 2RMKA 3PXGA 3TW8B 1E4YA 4A0GA 1IQPA 3E1SA 4BZXA 1PLKA 3R9XA 1J2JA 1KI6A 3ECCA 5F9HA 3W6OA 5HE9A 1HA3A 4DIEA 4B6EA 3RRNA 4J0QA 4DLXA 5AK0A 4LJYA 2ZM5A 2XJ4A 2FEMA 1FL9A 2WWYA 2Z83A 3I5XA 1KDOA 2BMDA 3F5FA 2F6RA 4URVR 4HDCA 4YXWD 4F4CA 1YZGA 4MGYR 1QZXA 3C15C 1JALA 1BS1A 2FSIA 4JT4A 4AKHA 1J70A 1R0WA 2IYSA 3LQRA 2GXUA 2NIPA 3KB1A 4KCGA 3ZYCA 2VP6A 1BIFA 1MRSA 2ZPTX 3RLFA 2XXAA 4MYHA 4XOIA 4B2LA 1U8ZA 2JIZA 3AQ4A 3EZFA 2XXAB 4WIAA 2ZR7A 4PC1A 3GLIE 4QHYA 1R8SA 1FUKA 5DYGA 1NVUQ 3U60B 3P27A 2D4HA 2WSSA 3RS5A 1VG8A 2YKGA 3MMPA 3C16C 4DDWA 4JSYA 1YHNA 1T91A 3OAAA 5EJEA 2XNDD 1G3UA 1YU9A 4BPBA 4UKDA 1J7KA 3MJHA 121PA 5EUMA 4ARZB 1R8QA 2GJSA 2V8OA 2C96A 1EFHA 2BMEA 4MUAA 4URYR 3AKDA 1UJ2A 2I1VB 4QKQA 2O8FB 2BVNA 1CS4C 3VQTA 3K70B 3LBNA 4PAQA 4KSBA 1SHKA 3ICEA 2OUKA 3QXHA 4BRWA 4FMCF 3Q85A 2IWRA 3ZZ0A 3O8RA 4RZXA 3K9NA 1AM4D 4RY2A 4UQOA 3S1AB 4B71A 2H18A 3DVLA 3ZLJA 1XRJA 1W49A 4WZBE 3VR2A 1W36C 1XMSA 5KTYA 4QBIA 1ZP6A 1ZBDA 1W48A 1US8B 3UATA 4N3NA 1KYIA 1U90A 1VG9B 5DI9A 2FFHA 2KBEA 3T5GA 2ZUBA 4GNKA 1SVMA 1YR8A 4TLDA 5FL7D 1OIXA 3VU9B 1LY1A 5JCZA 2ODNA 3FOZA 4L5BA 2HF8A 4Q21A 1ZW6A 2V7QD 5A5GA 3BRWD 4PO8A 1XZQA 2A5DA 2R6FA 3OESA 2IUUA 3PENA 1Z0DA 2WZQA 1EFTA 1UM8A 3I4LA 3T06B 4FI3C 3VHXA 3CNLA 4Q4LA 2FFAA 3T1TA 3SR0A 1U9IC 2RGGA 1SVOA 2BWJA 2WJYA 3QF7A 3TSWA 3W6PA 2J0SA 2IS4A 2QL6A 5FBWB 4LJ6A 4PAOA 1JEDA 1U0LA 4HZUA 4TL8A 5BWMA 3IBGA 3K0AB 1ZM7A 4PTLA 1SXJD 5EP4A 3CPJB 3FTQA 2JASA 1AGPA 2FN4A 4QBHA 2A30A 1A7JA 3IO5A 1SGWA 1CJMA 4CEHB 2GVDC 3MD0A 3IDQA 4K81B 4CT5A 1YQTA 4ERNA 3U7FB 3ZS8A 3ZIAD 2IYQA 3NBYC 3QG1A 2ZUCA 3LXXA 1X8KA 1E2JA 3H1TA 3VU9A 1RW4A 1XNJA 1ZNYA 1VHLA 3I8XA 3R9IA 3RS4A 1KI7A 3GFOA 1L8QA 2OO7A 3CRRA 4PPGA 1Q12A 1Z0FA 2QI9C 1E79A 3K8YA 3FHOA 5KO2A 1G8HA 1N5JA 3LFUA 2XEXA 4G5QA 3QPUA 1DAFA 2GA8A 3S1AA 2REOA 4D6PA 3R9WA 3ADDA 2P6NA 2ZYUX 1SXJE 2ZIAA 4NDZA 3KDSE 4DZZA 5GJVC 3H2YA 1NN3A 4E22A 3CR7A 4GZMA 4GZLA 4QBGB 2EVWX 3AVUA 3K0SA 2RHDA 3ND9A 4TMZA 4BFSA 2CK3D 2P6UA 2QPOA 4Q9JA 4KITB 2VHUA 1HH4A 3I92A 4C30A 1XWIA 2WWFA 3QEOA 1GIAA 1Z06A 4LUCA 1OXXK 4OQFA 1SXJC 2EFDB 2OESA 4IVPA 4I81A 1XXHE 2ZI9A 2QP9X 1NY5A 4IRUB 5BN4A 3BH7A 3IHLA 2NO6A 1OB2A 4DLZA 1P5ZB 4IXMA 2C8VA 2P65A 4DLYA 2P5SA 4S35A 3OF5A 3WYFA 1GKUB 1VG0B 4QG7A 4Q7JB 5JWHA 4F93B 3EIQA 2ZI3A 4GDFA 2WKPA 2ZU6A 3OFNA 4NP6A 1AS2A 4PAMA 1OFIA 2BIFA 4L9WA 1C9KA 3AGPA 4N1AA 4B2PA 4MA4A 2W6ID 3SI7A 1KY2A 3J81k 4Q7KA 3RNLA 4TYYA 2VHQA 1FPMA 3MWJA 3LRPA 2R6AA 4BLTA 2DFNA 1Q1ZA 4ON9A 4Q47A 4EAQA 3EIEA 4NYIQ 1JI0A 2CHVA 1WE2A 721PA 1R7RA 2QAGA 4BEBA 4LC0A 3AP1A 4QNRA 5JI2E 3U61B 4Q7LA 2JLWA 1J8MF 5FOSA 4EQ6A 2VO1A 1Q44A 3OE7D 1LF0A 2QGNA 1XEXB 4IOMA 4NMMA 4OHYA 3IEUA 4ZIRA 4P32A 1PUIA 3LX5A 1KHTA 1KO5A 2G88A 1QHSA 4Q7MB 3OEED 3KFVA 4PSAA 1ZVQA 1KSHA 3X2SA 2N1BA 4I99A 1XJCA 3LX8A 4TLCA 4BZQA 4MRPA 5L3VA 2YOGA 1JB1A 4CEIA 2RAPA 3HR8A 5HKKD 5JECA 4W7SA 1P60A 2WJIA 3DO6A 2BJVA 4JLKA 1KJYA 2DBYA 2ZANA 1EGAA 3LWNA 2YOHA 4C0AC 2VF7A 4RD0A 2O8FA 3N2IA 2AR7A 1RRFA 2ZVQX 4S2EA 3GJ5A 4MKFA 3GLFE 3TVTA 4B6FA 5E7MA 1K5DA 1QVAA 3K9GA 1DAHA 1G8PA 5KOYA 4B73A 3U2QA 4ARZA 3QJYA 1S3SA 1TF2A 1UEIA 2D62A 2GEVA 4BFWA 4V0LA 4PANA 3MLEA 1W36D 1YZLA 1UFQA 1Z0AA 2K5UA 5KPDA 3U4QA 2QM8A 3PG5A 5C4MA 2FZLA 3HPQA 4LYHA 5HZHA 5HPYB 3AKCA 1G41A 5CB6A 1KI9A 5DE3A 4DHEA 521PA 3ZS9A 4KJZA 2D7CA 3IBYA 3LNCA 2VTKA 2NZJA 4II7A 3EWAA 1D2NA 3SU8A 3VNUA 4RCYA 3UMSA 5L3QB 1CBUA 2ATXA 1B23P 2V6JA 5DH9A 2R44A 3THWB 1TF7A 5BXQC 4IOKA 3PQCA 3QKUA 5AR1A 2IEZA 2V6IA 1W46A 4JYCA 4KLZA 3RVBA 3O47A 1H65A 4OHWA 3KL4A 3TVDA 2ZYWX 3OZXA 4KVGA 5CITA 5TY0A 1AN0A 4DT1B 3AM1A 1XMVA 1P2UA 2OG2A 1GOTA 3CZPA 3FYHA 4KI0A 2BCJQ 4WZAE 2RGDA 3FHTA 4M0LA 4XVQA 4HUTA 4OK6A 4KU4A 1XCPA 5JI3E 2JJ8A 2GWHA 4F91B 2NMVA 1KI6B 2QY9A 2WJGA 1XD2A 3L8ZA 1YZQA 1T5IA 2CEAA 1E2HA 3EPHA 2KI5A 1GKIA 5FTLA 2OCYC 4LV6A 5ELXA 4M53A 4L15A 2BEKA 2KB0A 4GT1A 1G5TA 4MQBA 3M1IA 4PZYA 3EPKA 1KK3A 2V9PA 1Y3AA 4IOLA 4BUJA 2C9YA 5FPKA 3JVUA 3L43A 4UNSA 3ETLA 3THOA 2NO7A 1CR1A 1M7BA 1G5RA 1TQ6A 1E2DA 2P6RA 4ABYA 2ZRPA 1MO4A 2CE7A 3BB3A 3QKRA 3K9HA 3KX2A 4GOKA 4AURA 4DEXA 5FBQB 4B3GA 3O8CA 3DEFA 1E9AA 5KPJA 3E2IA 5KDOA 4Q4AB 1SXJA 2IT1A 2ZRKA 1BMFA 3GFTA 1E3MA 5KUTA 1TUIA 4JLDA 3MWLA 4RCZA 5CIWA 1KK0A 5EP3A 1OXUA 4LBWA 2C98A 2VL7A 3RC3A 4IOJA 2IYRA 1II8A 2AKYA 1XU4A 2JEOA 3OIVA 2OLKA 3FGNA 4NCKA 1IJEA 1CR2A 1N6IA 2QSZA 4B3XA 2H17A 1NKTA 2FEOA 3JZMA 1GUAA 2EW1A 3WY9A 4RFSA 4HLCA 3H86A 3TBKA 1ZM9A 4JMPA 4JT2A 5EP1A 3IIKA 3OIYA 1EFCA 5JJKA 3GJXC 1E1RD 2GJAA 4TN1A 1S2MA 2A5JA 1N5IA 4HEJA 3I73A 4B48A 2ZUDA 2IUSA 4RKEA 1Z07A 3VMFA 2J9RA 2HLDA 4URUR 5FTNA 5JCPA 1TU4A 2KWIA 4QGHA 3QF4B 4W5JA 2NO9A 3C5HA 3DMNA 3G0HA 3N70A 4BLOA 1XPOA 4B3FX 5FPHA 3FVQA 1W4AA 1R4AA 2GCNA 1NBMD 3CF2A 1SKYB 5ANRB 1W1WA 4E09A 1G3IA 2FPLA 1E9DA 3NBXX 5AJYA 1TEVA 2ODWA 1U0JA 4M9XA 5D3MB 4MYTA 2PMKA 1RVDA 1ZM3A 4Y0VA 2Z4SA 2N46A 5F9FA 3V9PA 2C2HA 3KQNA 2CVHA 3UIEA 2FMXA 4D80A 1FX0B 3GLGA 4FN5A 4C2UA 2G83A 1H8HD 2JLQA 2Q21A 4BLQA 4Z8XA 5DYIA 2DFLA 2XNDA 4FXPA 1MO6A 4MRNA 4JLOA 4M21A 1SKQA 4AG5A 4KODA 1YRBA 4PXAA 1Z6TA 5BN5A 4XH9B 4CEJA 4M1MA 2Z5FA 3CX6A 2IS6A 3PV0A 3AVYA 421PA 4O25A 4PO9A 4KFTA 2ANBA 3CM0A 2XNSA 2ZRGA 2OBNA 4Q01A 2E87A 4B3DA 3UXMA 2HCJB 4TQUS 1Q21A 1E2IA 3QXCA 221PA 5EE9A 4ASUD 4WA7A 3T1OA 4LOAA 1TQ4A 2J0VA 4GBMA 1KO4A 1R6BX 1F2UA 1QHIA 1OXSC 2ZJOA 4C3ZA 1NBME 2FSHA 3BGWA 4AWXA 2BMFA 4EPVA 1MH1A 1U81A 3TUJC 5LD2B 4GP6A 1P7CA 4TL9A 5HR5A 4LHZA 4XSGA 4DDUA 4KBGA 3GMTA 4H9GA 1VMAA 2O8EA 1XP8A 2YINC 3FFBA 4TT3A 1JQJC 1ZUHA 1LFDB 2ZI7A 1OYWA 2QUZA 5CM8B 2FNAA 1CULC 1XZPA 2JLVA 1DG1G 2R6CA 5H1YA 3F8TA 1TADA 4LHVA 4DUGA 3I32A 1FNNA 2ORIA 1CKEA 4Q4HB 2Q3FA 5BYKA 2A5GA 4LV8B 4DCNA 1RIFA 3ICQB 4HB4A 2GZDA 2A2ZA 2G77B 1II0A 3R20A 1F48A 2X2FA 1KO1A 3DL0A 3NKVA 5C4GB 3CO5A 3RS3A 6Q21A 4MUBA 4ZCLA 2ZSEA 1XPRA 3UG7A 3T34A 2AWNA 4O0MA 2OXRA 1N0WA 2VQSA 4Q1BA 3WP0A 4NH0A 5UKDA 1GVNB 3EG5A 3QKTA 4DLSA 1E2NA 4JBWA 4UXJA 3FMPB 2OEPA 4BFUA 1E1RA 1E6CA 4MGZR 5FUYA 1CR0A 4AIIA 3QG5A 2O8CA 5J4KA 2PT7A 4IW3B 1ZNZA 2OZEA 3KKOA 3TGPA 2J0QA 4DC9A 3RC8A 2C03A 1AA9A 3I3SR 1DELA 5J47A 1LW7A 2J5XA 3DPUA 1ZC4A 4NTZA 2WMNB 4YDSA 4TTQA 1JEEA 1NP6A 1F2TA 4PSKA 3W3ZB 1E99A 4B35A 1HE1C 4C7OA 3KZ1E 4TZ6A 2O8DA 3HU3A 1OYYA 2R9VA 1T4GA 1GDDA 1XXHA 2GZHA 4D4JA 4TMTA 1D5CA 1K5GA 1Q22A 1HQYE 4OQNA 4D0NA 4RD6A 2ZRLA 2ODBA 4AKIA 2C9OA 1WF3A 1XXHB 3VKGA 1GTVA 2XZLA 1MRNA 4LBVA 3U7GA 4PC7A 2AFHE 1X86B 2WPDD 3IILA 1U94A 2ZRBA 2GJKA 3G5UA 4JS0A 4G1UC 4IEIA 5E3HA 4V0KA 4ZDKA 4AKGA 1SZPA 5FR1A 5FTMA 1LB1B 2QE7D 3F3YA 2O8BA 1K8RA 1KZ7B 4IDHA 1YZTA 2NTYC 1IOZA 4ZCMA 2MSDB 1OW3B 1NSFA 2P2LA 3CX8A 3QY0A 4BQSA 2VSOA 3ADKA 1UDWA 4A8JB 5J4VA 1YRAA 2HYDA 5F2EA 4QJ4A 1S9HA 3CRMA 1T3SA 1FP7A 4JLVA 1N5LA 5IT5A 2RGBA 5A4JA 2GVZC 1MABA 3P4YA 5EP2A 2RHMA 1NVVR 1SQ5A 3QPVA 1G4AE 4P33A 3CWZA 4DSNA 1EFRD 2DR3A 1II9A 2C78A 4TSFA 3QNUA 4TWZA 1ZMXA 2PCLA 4YXWA 3L8YA 4EPWA 1N6OA 1DO0A 4FMDF 1O3YA 1EFRA 1XJ0A 4TYPA 5CLLA 1FTNA 5JMTA 2VA8A 3IEVA 3VR3A 2WOOA 2IBMA 2BBSA 5TV2A 2YWHA 4A8JA 3KKQA 5M04A 3U3KA 3LLMA 2QP3A 1KNQA 1OFHA 4BECA 3H84A 2ZU0C 2B7BA 1ZD9A 3DDCA 3GLFA 5CJ2A 1XDBA 3REGA 5E4FA 4ZKEA 3BH6A 2QPAA 1GZSA 1G21E 1N6KA 4ASUA 2IYVA 3F0TA 1ESNA 2IXGA 1KMQA 1TTTA 2B6HA 3A4NA 1XEWY 4LHWA 3EASA 1JR3A 1ZIPA 4Q1FA 4QGAA 5KNDA 3PEWA 1W2GA 2HXYA 1UBCA 1WXQA 1X8JA 4P31A 4WAUA 5L3RA 5GADl 4JL5A 1F2UB 4MKIA 2CCGA 4PC3A 4JVLA 4LJ8A 3PJRA 1QG4A 3AGQA 4ZO4A 4CGZA 1IN5A 1KMHA 2WPDA 2RGNA 1OFUX 2P67A 2HCBA 1SXJB 3MAAC 3RRMA 4A2WA 4YLGA 1NMZA 2X8AA 3RS7A 3GEHA 4TL7A 1DAKA 3AF2A 4A9AA 3GLFB 2V54A 5JSZA 3NWJA 4XD7D 2IS2A 3BXZA 1XEFA 2GCOA 2J3EA 3VHLB 3TR0A 4NCIA 2J7KA 2OILA 2EFHB 1F5NA 2CLCX 4QFMA 1NLYA 4ACBA 5DO9A 1KOFA 1AQUA 3AP2A 1G7CA 1QHHB 4RSGA 2GEUA 4TMKA 5DHAA 1DAIA 4CVNA 1XJQA 4MKHA 2LKCA 4YMWA 3U7EB 4A92A 3BERA 4ACAA 4IFEA 1D2MA 2HV8A 1UAAA 2RGAA 3R8CA 3TQFA 1Z08A 3BE4A 2CLDX 1TF5A 2VP4A 2WWWA 3DMDA 3PCRB 3SJCA 4XJXA 2OV2A 1NLFA 2IK8A 2GXAA 3TMKA 3U44A 3NHBA 2D2FA 2VSFA 2YHSA 4OK5A 5TDHA 4BRUA 2D7DA 1YKSA 2ZJ5A 3WMGA 3FKSD 5DNYB 1WP9A 3PEVA 4GOXA 1JNYA 3CONA 4G5SA 4C0KA 4D2IA 2G1KA 2R2AA 2ZRCA 3GFPA 3WRYC 4V03A 2IYXA 4O3MA 1S9DA 5FOVA 1H8ED 1Z6YA 2I3BA 4TMVA 3M0EA 1JXOA 3FKQA 2ONKA 1MKYA 4P4UA 3A58B 2VRWA 2F1RA 4U7DA 1YZUA 3SBEA 3GQBA 2HUPA 1EFUA 3IUYA 3DZ8A 2W2VA 2F7SA 3NH6A 5EUQB 1JBKA 2DYKA 3A6PC 5EE1A 1WQ1R 1GNPA 1ZM4A 4MRVA 4DEYA 2CL0X 1E9FA 4HSEA 1W7AA 1GL6A 1C1YA 2CLSA 2FGJA 1ELOA 4AYXA 2WWGA 3LW7A 1RKBA 2WSSD 2EU8A 2AXPA 1G7TA 2MMGA 1XFAA 4C7OB 1GG2A 3ZD6A 3LVRE 1AZSC 2OSBA 1XMJA 4YDHB 2CXXA 4M1TA 4D4LA 3VR5A 3AEZA 1OH8A 2EFCB 4DB2A 1TU3A 2LWIA 1HUQA 3LXRA 3U6KA 1R0XA 1NJGA 4AYWA 2Q6TA 3HYTA 3O8DA 1TUEA 4BE7B 5J4YA 3QEJA 2ZRJA 3QENA 2RKOA 1N0VC 1X8LA 4KLNA 1NG1A 2FU5C 4KO8A 1CIPA 3LV8A 4NYIR 3CH5A 3A36A 4EKDA 5KDDA 1D2EA 2ZJ2A 3WP1B 5FPTA 4R71A 2QBYB 5DHFA 5FOUA 1BYUA 1T6NA 1Z6GA 4LJAA 3M6AA 1OV4A 4N0DA 5SZJA 1BKDR 2NQ2C 5LDDC 1XD2B 1XCMA 5D3MA 1E69A 1S1MA 1W44A 2FH5B 1O87A 4KHZA 3TSOA 5C2JB 5B2ZA 1I2DA 2OE2A 2EFEB 1Q3HA 4LV5B 3QBVA 2BHRA 2GXQA 4ILEA 3SHFA 1G3RA 2VF8A 4DT1A 3I61A 1AJEA 4V02A 4KAXA 4TYNA 4MGIR 3THYA 3RAPR 1VYTA 2GAAA 4B32A 2GF0A 2PZGA 3BOSA 3GLGE 2OFXA 1KSGA 1QG2A 2HEIA 3KXIA 3IPXA 5HCNA 2VPPA 3D3QA 2B8TA 3IQXA 4YMVA 3PUWA 4M1OA 5FPYA 4PZLA 3EA5A 1ZU5A 2OCBA 4OHXA 4R2HA 3ZVMA 2XSZD 4HLQB 4TL6A 1IN8A 4LK2A 3AUYA 2O5VA 4ESVA 1QVRA 1Z2AA 1IXRC 4LZZA 4NYMR 1NIPA 2ZE8A 4PC2A 2A5FA 1YR9A 2OBMA 1I4TD 2QE7A 1JJVA 5AJZA 3SZRA 2WAXA 4R7ZA 2R6GA 4F7WA 2XOKD 3KTAA 1DVRA 3Q3JB 4AG6A 3KQKA 2GHIA 2WJJA 1G8YA 1S96A 1NKSA 4Q4JB 4LHYA 4JZKA 4Q4AA 4RD3A 4EFNA 3IIJA 4B75A 3KUCA 4JYBA 1HE8B 5FI0B 4BLPA 2IYUA 3L0PA 3HPRA 1RRCA 2QQEA 4LC1A 1KKMA 2QGZA 3SQWA 2HT6A 3EAQA 1ZU4A 3OHMA 2D06A 2H16A 1N2CE 3PEUA 1QF9A 1ZM2A 2BJWA 5DI3A 1A4RA 1T5LA 2YC4C 4US2R 4ZKDA 2Q3MA 2GZAA 3UMFA 1TAGA 5HZKA 2GF9A 3T61A 4JLPA 2F1JA 1FNMA 5DN6A 1FX0A 3QBTA 5FI1B 3L0OA 5H70A 1KI8A 4TTRA 3WMEA 1UBGA 1KI4A 3N5CA 4Q00A 1UBEA 4ZIRB 1Z6XA 2HXSA 2CMKA 4M1KA 4I1VA 2G1JA 1XEXA 3SFZA 1QDEA 3BFXA 4FWTA 3KQUA 4Q02A 1NN1A 3N2EA 1X1SA 4JVSB 2PEYA 4P4SB 2XAUA 4DWJA 2F43B 3PUYA 2GEDA 1Q0UA 1KDTA 4P0TA 2J45A 4LJ9A 2QM7A 3RWOA 1Z29A 2ZSFA 1S1CA 1TMKA 2QG6A 4TLAA 5K8UA 5JJLA 4NCNA 5JRJA 4WW0A 4ZCIA 1ANKA 1CXZA 2Z4RA 4LDJA 3FPAA 4FCWA 4K8OA 3AF4A 4HZUB 1DO2A 2W2TA 1RFLA 4HB2A 4WZ6A 3CF0A 4GI7A 4B33A 1M1YE 1E2QA 2C95A 1KY3A 2P5TB 3NG1A 3EW9A 2IX3A 1R0YA 2PEZA 4OI4A 3KB2A 1N5KA 1OE0A 1NNEA 5CDFA 2PLFA 3CPHA 1TNDA 1NMXA 2W6JA 3PITA 1OXVA 1IONA 2AX4A 3QVUA 2PLRA 1VPLA 1CEEA 2O0JA 2PZFA 2WOJA 4Q48A 5CB8A 5J4LA 4KVAA 1GRNA 1II8B 4IVQA 5F3WB 2X1VA 1ZUNB 1A2BA 3K0FB 1KAGA 1UPTA 1RYHA 2RB4A 4R9UC 3KKNA 3MUFA 3SJZA 3GJ0A 3ADBA 4QJ3A 3QVVA 2XJ9A 3BB4A 1R0ZA 3ZVRA 3CKLA 2GBLA 2ZVPX 4WVFA 1YZNA 4HB3A 3A1WA 4EPTA 3AH8A 4XVRA 1E1QD 3A4MA 1US8A 4LJ7A 4PSVA 4HAVA 5J4HA 3CNOA 3UANA 3NVAA 4DLWA 4X8MA 3TUZC 3EC2A 1CR4A 1R5BA 1UADA 4NE2A 3VKWA 4L4UA 3IO3A 2ZR9A 3IQWA 3WMFA 3Q9LA 4URWR 1XD9A 2QENA 4PZZA 3SDZA 3RYTC 3B9QA 3R7WA 1OHHA 4ITRC 2QSYA 2YC2C 3I72A 1YR6A 4I4LA 4D26A 5CDFE 1FW6A 2FPMA 1PZNA 2H57A 2XGJA 4JLBA 5J5CA 4CRWB 1KSJA 2IHYA 2XB2A 2E1RA 2AFIE 1WA5A 4G5RA 1FMJA 1TPZA 3AVTA 3DM5A 4AY2A 1IXZA 2IYYA 1CU1A 2D74A 3U3OA 3GJ6A 3NDPA 1EG7A 3P26A 4D4KA 5FPSA 4DKXA 3ADCA 4IHQA 3WHLA 1SVWA 2IW3A 2SHKA 3T35A 3E5HA 1I4DD 4M9ZA 5JS7A 4FCVA 2JLXA 2WHXA 3WYGA 3W8NA 3X1XA 1NBMA 1QHGA 1XTIA 4H1UA 4QRHA 4CEHA 1AQYA 4IDNA 5FTKA 3LAWA 1I2MA 3GJ7A 1QHYA 3B1WA 2QEQA 4I1UA 4LJ4A 3X1DA 4EPXA 4QBFA 2WKQA 2W00A 4KSCA 5TXGA 3AVVA 5KNBA 2CL6X 2QT0A 4PHTA 1DPFA 4TYWA 4Q9HA 1PJRA 2ZXUA 4OI0A 3DOEA 4JSTA 1WDTA 2ZRHA 4A2QA 3KKPA 4A4DA 2WKRA 2EYUA 5FFMA 2WWIA 1A2KC 2O0HA 2FGKA 2N42A 1JPNA 2VHJA 1NI3A 2VSXA 2YOFA 2H8KA 1CP2A 5G41A 1DAMA 3K0EA 1IHUA 1WCV1 2DPXA 3B13B 2ZS8A 2CBZA 3Q5EA 2WBLC 3FHCB 3KXLA 4C0LA 2PZEA 5J40A 3NDBB 2XX3A 5AUQA 2F3TA 4TZ0A 2ZRFA 4JL8A 4XD7A 2UZ3A 4LBZA 3VNVA 2R65A 5CYPA 4U5XA 2UZIR 4Z1MA 3R8FA 3HWSA 4ZDWA 3MGCA 1LTQA 3ND8A 5DISB 4EFMA 4EUNA 4G5GA 3UPUA 1GRRA 5KYKA 4RZ3A 3DHWC 1PLLA 1BH2A 5B58C 3VKHA 4I1OA 2CK3A 3FDIA 4G01B 3I62A 4WBSA 3R7WB 4DVGA 1OKKD 3LW8A 5BW8A 3AUXA 3X1ZA 3MWYW 3W5JA 5KU1A 3B8HA 2ZRNA 4C0QC 3X1YA 2QMEA 4DCTA 4EJSB 3LA6A 4L9SA 5AWFC 2CDNA 1W0KD 1E1QA 4OKSA 5AUNB 2ZAOA 3HDTA 3NEJA 4DLUA 4NYMQ 2GNOA 5CK4A 5G3ZA 4EQ6B 2ZTSA 1W36B 5A0FA 1NN0A 3JVVA 5G53C 5GVRA 4FMCB 5JZVA 2F9MA 4DCSA 2YVUA 3REFA 2QAGB 2QNRA 3VTKA 5JFGA 4BFZA 3U3RA 2OAQ1 4JBYA 4UXIA 2EQBA 1U8AA 4HB0A 2DFTA 5EQTA 3T15A 1KJWA 4PHGA 3NBZC 2E9SA 2W83A 2W6JD 3A1VA 4B43A 1KDPA 2QAGC 3SEAA 3VX3A 1Z0KA 4KBFA 4A8JC 2D3WA 1ONBA 1ZINA 4LY6A 4TSFD 1RJ9A 2H5EA 3EZ2A 1NSTA 1HYQA 1OKKA 2D2EA 1FFHA 1RRPA 3SC3A 2A9KA 4DSUA 4ZI2A 3WRXC 2OHFA 2DWOA 4LGMA 5H8WA 2EYQA 3SNHA 2G0NA 4QM7A 4DLVA 4BEJA 3CH4B 2VP2A 3C7KA 3ZH9B 2OAP1 2WIAA 1E2EA 3RS0A 4EFLA 1ZD1A 3BS4A 4C0JA 4Z51A 2ODEA 3CB4A 4P4SA 3ZZUA 1OH6A 1EX6A 2A5YB 2F1IA 2JDIA 4K46A 4HAWA 4NU0A 2WWHA 5D3QA 3MSXA 3SN6A 4JJZA 2V7QA 1H8EA 3E70C 3LQQA 5JS8A 1KK1A 2GXSA 2ZETA 4OI1A 1NVWQ 4Q5IA 1D9XA 2G0TA 4G0NA 2BV3A 1U0HC 3L0SA 3UK6A 4LHXA 5DGXA 3SBDA 1E2KA 4DSOA 1XEWX 1GILA 2OCPA 1HT2E 2PL3A 3FMFA 5EZ6B 4URXR 1KDRA 2FFBA 4D81A 2W0MA 3D6TB 1WRBA 4V0OA 4MDEA 4TMWA 4D0LB 4TTPA 4Q9LA 2CCJA 1R2QA 3GD7A 2Z0MA 2JDID 3D8BA 2QMHA 3U3MA 4Q4JA 5JRZA 4PHFA 2R8RA 4PQYA 4BFYA 4MYCA 1BO6A 3HP1A 1HV8A 2J41A 5FUXA 3VFDA 1EX7A 3CUEF 4M4SA 3K0FA 4XWKA 5KDLA 1UKEA 4X8OA 3BFKA 1FQJA 4E03A 1GRQA 1W5TA 1KJZA 2WAYA 2JGNA 1G19A 1XTJA 2FJUA 2ZJBA 2LCFA 3CLVA 2ASEA 1S3GA 2FPKA 5TB5A 5JEEA 1ZCBA 1ZD8A 1FTSA 1ZIOA 3QXXA 5HTKA 3NC0C 3RSLA 1RJ9B 4GMDA 3K53A 1A5TA 1VDZA 2QTFA 4TMXA 4YQFA 2CNWA 2ECKA 3ZQJA 2IHBA 2YWFA 2ZS9A 3TSZA 3GPLA 1W2HA 4NBSA 2XZOA 4US0R 3B85A 4HLUC 1KKLA 4KFUA 1E0SA 4JVNA 1T0HB 4BLRA 2RGCA 1ZYUA 2JJ2A 1L2TA 5H68A 1Z8FA 3T5DA 2XTNA 3THYB 2AN9A 1E4VA 3VR4A 4RZ2A 1OXTA 3Q72A 3L0IB 2F43A 4M8NE 4HYYA 3VAAA 1U2RA 2DY1A 1P2VA 4QJ5A 3C8UA 2G6BA 2VHTA 1S0UA 2I4IA 1GL7A 4A0HA 2IXEA 2JA1A 3KJIA 2VP0A 3I8SA 1K6MA 2HF9A 2JLRA 3G82C 2QMUA 4FD2A 2YYZA 4EJSA 4JJKA 3B2EA 4LJ5A 3KQLA 4NZYA 1HURA 2AHOA 1P2TA 3RS2A 1W0JD 1GM5A 2OBLA 3K1JA 3OEHD 1N25A 2VHCA 1Z6AA 4A15A 3BFVA 1TL7C 2ZE6A 1R5OA 5BN3A 4QHTA 2DB3A 2JCSA 4Q1EA 2BOVA 3H0KA 3IGFA 4MRRA 2JJ2D 3BIFA 1N6RA 1SVIA 4XWOA 1KTVA 1M7GA 4JBXA 4LPKA 3TKLA 3GLIB 3CRW1 4JVMA 1OIVA 2XTZA 1UF9A 4AC9A 2WM9B 5JWRA 1N6HA 4XIGS 2LKDA 3TJZA 2BCGY 1G7RA 3QSYA 2FF7A 1Z28A 1B0UA 3KTAB 4P3YA 3UKDA 821PA 2JLUA 3PR1A 3LD9A 4M1YA 1ZCAA 3B7GA 4A0RA 3DKVA 2CL7X 1QHNA 1GSIA 3NHAA 4LX0A 3W8RA 2BBOA 2FA9A 4M1WA 4HAXA 2NGRA 3QI2A 5SZHB 4HZIA 1LVGA 3AP3A 1IBRA 3B1XA 1DG3A 3EARA 2AKAB 2JAQA 1MR3F 3M4YA 1G3MA 3GJ8A 4V0NA 2OFWA 4POAA 4PX9A 2OT3B 4OBEA 1VTKA 2NO1A 2GCPA 2Q0HA 1FOEB 4AK9A 5JHHB 1Z5ZA 2J59A 3TAHA 1G4UR 2XZPA 3CF6R 3FKSA 4DB4A 4M9QA 3NXSA 1M6NA 2WV9A 3QKSA 5AJVB 3VR6A 2EFGA 4BFXA 1U99A 4Q9KA 2J46A 2XOKA 2FDCA 5FL3A 4OI2A 3RWMB 4EJSC 4IDOA 4DCVA 1CJUC 1ZC3A 4OL0A 2ZYVX 4B3BA 5AUOB 4OHVA 2BMJA 4RD4A 4N0EA 3NH9A 3BAFA 3KKMA 4A1FA 5B64A 2BDTA 2ZYTX 2XTMA 3RSOA 1KI1A 1CRQA 1G17A 5K8IA 1E0AA 4I1SA 4TLBA 1GKYA 1GWNA 2BM0A 4PO1A 1IN7A 1M8PA 3EZ7A 5CJPA 5KSZA 3QPWA 2FOLA 2IF0A 2QQ0A 2YNMA 3QOFA 5DI3B 4DIDA 3BBPA 4L8GA 3WYAA 5FBRB 2W6IA 1NVVQ 1YJ5A 4U00A 4QHSA 3A4LA 1N6PA 1XX6A 1VYVA 2BBWA 3ZGXA 3UWOA 5FTJA 5L3SA 3TQCA 4NONA 1EWRA 1G64A 3CW2A 3GEEA 5DSZA 3A1TA 4C0HA 5AUPB 5EXSA 1KIMA 1NF3A 2REBA 1QBKC 4C4PA 4HDOB 1R5NA 2O0KA 2CHQA 4B47A 3B1YA 2YZ2A 2X19A 2GJ8A 1COWD 1ESMA 5JJIA 4V0ME 2AK3A 2XB4A 4TQ9A 5LD2C 2FV8A 3AVPA 4ESHA 1D9ZA 1P73A 4LI0A 1Z22A 2ZI6A 1M34E 2ZS7A 1IY0A 5BQ5A 4B2IA 4TT3D 4A36A 3LVQE 2ANCA 3TAUA 5C1BA 4W5HA 1IAQA 1G18A 3CIOA 3U7HB 3Q7QA 2AWOA 5IF9A 1XD8A 2ZJAA 2V55B 4HAZA 2WIBA 3ZQ6A 1Z0JA 4BFVA 3WBKA 1P61B 1QHXA 1UKZA 2PBRA 2ZREA 4Q1DA 4AD8A 2C9CA 2H1LA 4FINA 2IYLD 2HJGA 3BC1A 3QQ5A 2R6DA 4BWYA 2KBFA 1M74A 2V1XA 4IVRA 4DDVA 4RD2A 4CF7A 1G6OA 2EWWA 4CW7A 1G8GA 1N6LA 1COWA 2AD5A 3AF0A 4QC2A 3K09A 5B57C 1VCMA 2B92A 3W5IA 2X2EA 3GJ4A 3CNNA 3RANA 4NHOA 1ZRHA 4B74A
chains in the Genus database with same CATH superfamily
4LMBA 5JAIA 3K3PA 1WXIA 3FNEA 4BASA 4H6VA 4ZVOA 4CTNA 4IDGA 2WI8A 1QRAA 4PWYA 3DVSX 4L0MA 3K30A 3BMNB 5FORA 2KSQA 1U9YA 5FUVA 4UM9B 3NBFA 4XWAA 1ENOA 2HCFA 2P91A 3RVPA 2FFQA 5JJCA 3UWMA 4LTDA 3ULKA 2PJRA 1CDEA 4FZRA 3G49A 4IPTA 1EUQA 4B4KA 3TEJA 2RK3A 2XMRA 5JAZA 1U9IA 2WHYA 2WILA 2WIKA 2VHZA 2VHYA 3O8QB 5TARA 5E8RA 4OFXA 1W4CA 1WDKA 4WK4B 4ABTA 2PSEA 2VP3A 3M9XA 2WYUA 3RSZA 2H2FA 2CXSA 1VKRA 4NULA 2PAAA 3D5EA 2Q5QA 3U5ZB 3L8EA 3DKPA 2LTAA 1C2YA 4N5NA 2CB0A 5J5VA 1U5BB 3UQZA 3WOHA 1NG9A 2CD9A 3K1AA 4M8KA 4JZYA 1E3SA 1JJIA 1A9QA 1U1DA 3DEAA 2ZEJA 3IEIA 4JEMA 4PFQA 4ROTA 4RV9A 3NHWA 4M1SA 3WHIA 1M73E 4HNVA 3EVAA 4N65A 4JI1B 4BKRA 1RQRA 1TJNA 2XITA 4HAUA 4DDMA 5JCJA 1BOFA 5H59A 1W94A 2C97A 1U8XX 3OZ7A 3IS3A 1GCUA 4QLAA 1VCOA 3NM5A 1VPTA 1DT3A 1K0UA 1HOTA 2VBCA 3JQFC 2J5QA 2W2NA 5EE3A 5FL7A 3OEEA 1K8QA 2ZPUA 3DUFB 2I99A 1A82A 4LTNA 2G17A 4RZSA 1SFRA 2BKUA 2VJAA 1AHNA 3C8MA 4WESB 4OHZA 1P74A 2EARA 3OECA 1I6MA 3QWHA 4GM1A 4MQ4A 2BDEA 3SYKA 1QP4A 3K71B 2PGLA 4B4VA 2P8JA 4CLOB 4KHPB 1GXSB 1IN6A 1K63A 5HK8A 4CPDA 1V5WA 5FBLB 2C4HA 1XEAA 2PLAA 2VDOB 4MMXB 3FDFA 3HN6A 5CFOA 1IN4A 1V3TA 4DV0B 1XK6A 2A35A 2FRDA 4ESOA 3JD3A 4UTZA 2ZRDA 1KP2A 1B6TA 1QNFA 3PRKE 4MVJE 4KIFA 4MA5A 2XNCA 1OBFO 4YJGB 1JSZA 5HKAA 3GDOA 2J7PD 3UXYA 5FOXA 2IGBA 4TTIA 4BP3A 4D3XA 2EJCA 5U9CA 3R5FA 2WG1A 5LFAA 1UIRA 2W4IA 2X9QA 1D2GA 2ZI5A 4CG3A 4DIOA 1ZHOA 5A1JA 5ESDA 3EXHC 2A0UA 1Y8QB 1C9MA 1FMCA 3UICA 4FWBA 1NWHA 1EUDB 1JR3D 3Q6IA 3WSWA 4DDTA 3PPYA 4C4YA 2LBPA 1Q1BA 4J0HA 3KLNA 2X6QA 1L1RA 4CMGA 1UMDA 1AZWA 3IT0A 3GLHA 2GN6A 4RLQA 4W7IA 5FA5A 1WDMA 3BWCA 4FB4A 1DFHA 2PS1A 1DAEA 1CEXA 3T5CA 1H3EA 1HLFA 3KVYA 1HGXA 2UVPA 3Q0IA 3BGSA 4FZJA 3TLGA 4ZHQA 2XUJA 3KTOA 4EMUA 1Y6ZA 3TCKA 4TLEA 2Q3EA 4XVUA 1W0JA 2TRSB 4MWOA 4LSGA 4FC6A 4WFQA 3W7AA 4EYSA 3C14C 2I2AA 2W6NA 3OOEA 4PR0A 3T3EA 3AI7A 1JHXA 3UUFA 3L6BA 2H2WA 5FB3A 2RARA 3E3LA 4P98A 1DQPA 4A0FA 3AV3A 1CUSA 4LHEA 5FWYB 5L3ZA 3HUTA 1CJTC 1GEEA 1NRJB 2P1DA 4TKUA 3MXTA 1W581 1JKMA 1RRVA 1P2BA 4MP3A 1B6RA 1D2RA 1MT0A 3B6EA 4X66B 1G98A 5BP7A 2O7QA 3KV1A 1TC1A 1ECJA 4M6WA 3SM9A 7ABPA 1M6YA 4DTIA 4K2AA 4QBTA 5KYTA 3W3AD 4Y1FA 3E9YA 2FMIA 4MP6A 3TI7A 3TK1A 5JEDA 5JWOA 3PIRA 2HIAA 4NKRA 2QIOA 5FHQA 4BBPA 5KSOA 2SBTA 1Y3IA 1PGOA 3DSRA 4JLWA 1QGZA 3HZRA 1PFGA 1E0KA 2ZP1A 3MWKA 3X2FA 1TD1A 2HJSA 4RJLA 9LDBA 2RHWA 3RR2A 2CMFA 5AOAA 3ZLVA 2QRMA 3IPCA 4P9NA 1TK2A 5JXJA 3GP8A 2GK4A 2FSVC 2O50A 1Z2CA 2RSLA 1H1LB 1NI4B 1LFAA 3IUQA 1SHJA 2F8MA 5EKUA 4CQJA 4OSEA 1KORA 1AS3A 4X24A 3H1EA 4OQXA 4DA8A 1JH9A 2XRFA 2GILA 3I1FA 2BFCB 5AXCA 3TLZA 3WXBA 1I13A 4D56A 3AR6A 1A4IA 3HYRA 4W1QA 1P2SA 4Z9FA 3GZTB 4XYMA 5CAEB 5IKXA 4E30A 5LWQA 4CM4A 4DZTA 2JIPA 3OY7A 3QIAA 1IWBB 1FYXA 1TFUA 2X0NA 5BRNA 3ZDQA 4A82A 3HJGA 1Z83A 2O07A 2CJWA 2GJ4A 3KUDA 1TX4B 5I7OA 2RGEA 2FWNA 2W43A 9MHTA 4EMTA 2RHOA 2AE2A 3WSVA 3F9IA 4CUKA 4NCBA 2O1WA 4BAUA 2QROA 4MLZA 4LYJA 3T12A 4JIMA 2FX3A 3A4YA 8LDHA 4JKOA 4LNUA 2IS1A 1THGA 1AZTA 1IBKB 4AMGA 1JMKC 3DZBA 4QLBA 1FJGB 1EVJA 1X87A 3SF8B 4I9GA 4LPSA 4BFCA 2UYQA 4ZD6A 2HL6A 3GPDG 1QIEA 5B1DA 2XQIA 3CZQA 3RV3A 1GITA 2X8JA 1PJ2A 4GOJA 4IL5A 4M98A 1JQKA 5HBRA 1V9SA 2KE5A 1U7DA 2ZUEA 2BEUB 1P3JA 2J5BA 4RE5A 5J2TF 4C21A 4OJKA 2CXPA 4ARCA 1GR1A 4LXYA 4HDSA 4YMSA 3SYMA 1P17A 1F5SA 4O2LA 4GPD1 4IZIA 5EOVA 2WP8J 1E1YA 1APBA 3K72B 4G1BA 2WIJA 4B5LA 1RHJA 5KNDH 3ND7A 2IF2A 3IBTA 3K2QA 1XYGA 1L4YA 3P9NA 4J90A 1KWKA 2XLCA 2YFKA 1L0BA 1J06A 4F92B 4IO1A 1W96A 1FRFS 3ZXUB 1F2DA 1AA3A 1LKZA 2A9QA 5A2QA 4FQ8A 4HGZA 3BF7A 3D6HA 1T9CA 3DEZA 2H3HA 4FWIB 4MW2A 1CRPA 1D4OA 1DAGA 1LPPA 1TYDE 1I7QB 4UXHA 1PTJA 4G26A 4NE7A 4LNAA 3EDRA 4U7HA 1OLOA 3KOXA 3CWQA 2HMAA 3D7MA 3DG9A 4CQMA 4M22A 1F2TB 4MW0A 1UEJA 3CXRA 3TFWA 2QP4A 1R9NA 1RE1A 3NHMA 4I2VA 1MO5A 2R1VB 4ODIA 3I39X 3PIDA 3G2PA 2WK1A 3TUIC 4GL2A 4EI8A 1T0JB 3HNRA 1ZJZA 5TT1A 1Z5WA 2W48A 4QVKA 3STUA 1BH6A 2ZJYA 4GZ5A 5B3JA 5DMXA 1GU7A 2P4SA 3EIUA 1X2BA 3Q1LA 2JFHA 3ELDA 4MV3A 3LBIA 3MJDA 4RXMA 2J6IA 4BHTA 3BQNB 3G8AA 7REQA 3K6SA 3N59A 3PF8A 1KJJA 5IEBA 2EHJA 1V4BA 2CDRA 3OPXA 4MRSA 3H7IA 3P9RA 3GLGB 4D02A 2NU9B 1WKVA 1GU0A 4EENA 1OYOA 3SS8A 1QQ6A 2YIMA 4XTRA 5EXPA 1GYPA 3JQGA 2A3RA 3AB3A 2A0WA 2W8BB 4QDUA 3ZX5A 4QPNA 2IFTA 4W4TA 5ALYA 1YIDA 3FDZA 2AJDA 4KXMA 2I33A 1Y37A 2DU8A 3IULA 4P7KA 4U1RA 3SX2A 1PT7A 3WGMA 5K8LA 4UJ5A 1H0SA 1OIWA 5E1MA 4ZOLB 2P2DA 4I4NA 5AIAA 1WB9A 3NEYA 3R5TA 2F62A 1E79D 3NCHA 3QKSB 3E23A 1UK7A 4QL3A 1X6VA 4MVWA 1J8YF 5AJWA 1GA1A 3WBBA 2VHXA 1Z35A 4DADA 1MV5A 2QN7A 1VKHA 4U6QA 5AIBA 5HZHA 2P9JA 1YZFA 1RKVA 3N3AC 1WSAA 4OQDA 1A9XB 1P9NA 2PO7A 4Z6KA 5KHOC 4FYIA 4XUCA 1IY1A 2IW1A 1DO8A 3HXMA 3X3HA 1B93A 4HI0E 5CPBA 3FCSB 2PIDA 3N6VA 3R77A 4G5YA 3YASA 3MTJA 1E1CB 1KK2A 5IW8A 1P5JA 3RUPA 3HM9A 1MDFA 1CQJB 1NN5A 4X8LA 1NM5A 3U49A 1UQUA 1NUPA 2XYPA 3OOJA 1E9BA 3GNSA 2DQKA 4K5QA 1M2OA 4DQ0A 5I8WA 1RC8A 1GHTA 2JFBA 1VCIA 3T99A 2YY7A 1DC6A 1VSVA 2EP5A 3E7WA 1XG5A 1GT91 1JT2A 1LPAB 3SHWA 1M34A 4MV4A 2AW3A 1T26A 3B82A 2NSYA 5AK6A 5TQVA 4F04A 2NU7B 2WYHA 1GQQA 3HBJA 3MJCA 1P1IA 5THQA 4PF1A 3W1WA 5JLJA 3GHYA 2H7VA 2EL7A 4REOA 1HDCA 5YASA 4JJ8A 2R79A 4I5IA 1PRYA 5D1NA 1SUPA 1YA8A 3ZG6A 2W2LA 4YS6A 4HYTA 5HFAA 5L3SB 4O2AB 2BBTA 3WGQA 4XX0A 1W1IA 1XDZA 4QOSA 5EWJB 1E9SA 5DLQC 1DJOA 3MINA 1B76A 1Q57A 5LPNA 2P3OA 4X5OA 2UZAA 2O8CB 1NMYA 5JTUA 3P9SA 4AW9A 2YWGA 4LYAA 2AEEA 2F1HA 3K1ZA 2GAJA 2UYYA 1GPKA 3KB6A 3O7MA 2X0FA 2C7PA 5GZ1A 1IVYA 4L51A 3HA2A 1Z5VA 1G59A 4BVGA 5GWXA 3PNYA 1GNRA 1HRKA 2I4NA 4QFCA 3LLUA 4AY3A 3A1SA 3A4IA 3ZZ1A 2QRZA 1HKHA 3SKYA 3V8PA 4FIZA 4LJRA 3U1VA 3EH2A 1XVTA 3UA3A 4D4HA 1JR6A 1R0LA 3IHWA 5DTRA 2VH5R 5IASA 1E20A 1M5UA 4U7FA 3MAJA 1FDWA 1AQ6A 3OH8A 4CN9A 1ODJA 1G2IA 1QS0B 3DOJA 5B6PA 5B7PA 5JALA 2V7PA 1SUFA 3EPLA 2C0QA 2VIIA 3NTQA 3QW4B 4YRSA 4CKZA 2O59A 2CKMA 4QQKA 1UFKA 4ZRMA 4CIYA 2IHZA 3OI7A 5IMSA 1GGNA 3CX7A 3LUPA 2XGGA 2OCAA 3QF4A 4LF5B 3PDUA 3Q1KA 1G5HA 4UATA 5GONB 3M6VA 4KGXA 2YKPA 2YWEA 3QLTA 2E4XA 4YVFA 4BVAA 1QBGA 1DEKA 3Q6MA 2WWTA 3B78A 3A1UA 1JA1A 1C0PA 1Q2UA 1UL1X 2F4VB 3E82A 1V8DA 5TVKA 5TS2A 1X1RA 2JI7A 3CPEA 4ALMA 5EE0A 1VJTA 4PS1A 1ACJA 2Q6VA 3FE2A 3EWIA 3B5EA 5EJAA 4C1BA 3NIBA 3EZ9A 3O4IA 2PX0A 3TLBA 3EVCA 5ESRA 5ADVA 3SFTA 1L5ZA 1W4RA 4HEA1 4RU1A 1YE8A 1IMJA 1GN9A 1SNYA 4UTXA 3ZD8A 4ZDIA 1Q83A 2AQKA 1RU3A 2XCIA 3AEQA 4Q1AA 4OYHA 2F67A 3H5WA 1HMYA 5I9MA 1H4SA 2OO3A 4P7BA 4G1CA 5AI5A 2OFFA 1KDYA 2EZ4A 4JV5B 2FSPA 1RJGA 4YX9A 5IK2D 2PJZA 3EZGA 3FWYA 3OKAA 3DAOA 3TW4A 1FB5A 1X77A 4AZ3B 2QVCA 4WCFA 3GXBA 1W0KA 1KZYC 2NSHA 3R3WA 5DIFA 2KJQA 5SZKB 2MSEB 3HU2A 4PPQA 4LYFA 1AXRA 1YB6A 2ZUUA 1F60A 1PW5A 2PT6A 4KYIB 5G0WA 4CEJB 2IZ0A 3IVGA 1COZA 2Y27A 4WZBA 5J2UA 2HA3A 1IM2A 1X1BA 2H5JA 2EF0A 4DSTA 2ZJ8A 5K3AA 4ZEXA 2VWQA 2RH5A 4RFVA 5DRTA 3QZUA 1QTNA 3BGOS 1ISRA 1X1EA 2DFKB 2V5AA 3PJEA 4FMPA 3ZK7A 4RPLA 1T2NA 3L8FA 1IB0A 3OVMA 2C9DA 3PVSA 1TW3A 3ZJUA 1RAFA 4D9EA 1UT5A 4NWIA 4MB2A 1H8HA 2IYWA 3QITA 5TGTA 1C1DB 3LVBA 4KBYA 1C1XA 3AR8A 3WGKA 3ZWXA 4RLFA 4C0WA 2J30A 1M0TA 1MF7A 4MUKA 5CLQA 4PQRA 3A2KA 4ER3A 2WYWA 2GK7A 2YWXA 4ZOLF 1RXWA 5AYVA 1P0CA 1TO6A 2Q8QA 5EJFA 3SQOA 3STHA 2YY6A 2G5CA 2GNPA 2ZBGA 1G5PA 1NKVA 1NTOA 1OH5A 3EIHA 5F4ZA 2H1IA 4KYUA 5SZIA 3KT8A 4E4RA 3W05A 1NE7A 4EB8A 2XD9A 5KJ1A 1FRVA 3OTGA 1KO7A 3SYTA 3ZZNA 2I29A 2W0SA 1KE1A 4D6XA 3SR3A 3GNQA 1HQKA 4KO3S 4B76A 3TIFA 3FVRA 4XQCA 3J7AC 2YX1A 2VEDA 4FMDB 4DPLA 4MRMA 1FDRA 4CIDA 5HFJA 1KZ9A 3KJEA 4X1IB 1WV1A 1ZPDA 1LPBB 3SC6A 3FFAA 1VG1A 1LTHR 5L3QA 3AHCA 4TXJA 1DC7A 1P6QA 1UOEA 3LP6A 3MGAA 4HNAB 1ULHA 2JFOA 5EWMA 1UWVA 3D43A 1XKXA 2GUWA 3KCNA 3NHZA 3ZY5A 1QQ5A 3NP9A 4NLLA 3T1HB 2NG1A 4LRSB 5IAJA 3Q5GA 1TIPA 4MA0A 1Z63A 4LXQA 4RVNA 1P75A 3DOFA 5T41A 1L7OA 3QWBA 2VZ0A 3TNDA 5LSAA 3PKIA 1O0SA 1PTJC 4KXXA 2OP0A 4YA6A 1G20E 1ZD3A 1OA0A 4KQXA 2QA5A 2ZUFA 1E9VA 3NPAA 1Z7WA 3ZU2A 3CE6A 1OGJA 1U8FO 1DMRA 4YP7A 4G0VA 1QLHA 3C3WA 1CRLA 3I05A 4TV8F 2BW0A 4NYJQ 3FOEC 3S2YA 5CT8A 2KW5A 2COEA 2YBEA 3R74A 4PIPA 1V43A 2W58A 2EBHX 4UBOA 3EW7A 4F2WA 1R4ZA 5JFOA 4CN8A 1AQLA 1M6VA 1S2OA 1X13A 4Q12A 5IRCD 3A37A 4KFRA 2F3RA 2JG3A 2RJ3A 4BU1A 3WGYA 1SG9A 3LCVB 1MJGM 3DEJA 1BFKA 2DCUA 1WV0A 2NUPA 2Z8XA 4L76A 4PR3A 2PD6A 8OHMA 1AKMA 5GVSA 3KTDA 4RFLA 2W2XA 3K0KA 4ML3A 3HR7A 4KV9A 2Y1WA 1XMPA 1S8FA 3QNMA 1NXTA 3DC2A 3NOOA 1AK2A 1Z82A 3R5SA 4ZALA 1D6JA 1E9CA 2OFPA 3LMKA 1ZN9A 4KTTE 2BR3A 3P0JA 2CFIA 4H7JA 1G3QA 3Q40A 5FBVB 1ZLYA 2ERXA 3W4JA 3G0DA 3EDOA 4UFPA 1KQFA 3SLKA 1DC5A 3GOQA 1QPZA 3FPBA 5KYVA 5HGXA 4DLKA 4A0GA 1IQPA 2C57A 4LMAA 2Z57A 4HH0A 5KAMA 4YV1A 5JZBA 3OQ6A 3R9XA 1NZDA 1KI6A 5L6LB 1K6EA 2AMJA 3AJAA 3OE1A 5DYTA 3ECCA 5C8DA 5F9HA 4UHCA 4EI7A 5TPZD 1XTUA 2ST1A 4LISA 2FKNA 3RRNA 2FXVA 4Q9DA 1A9PA 5DGHA 4NMXB 5DP2A 4DRYA 3OCZA 1VL6A 1UWCA 4LJYA 4JJEA 5AK0A 3VPGA 1QP0A 2HF7A 1L5NA 4TXHA 3A3KA 3BQ9A 5DEIA 1ZMRA 2BMDA 4N7RA 2R6ZA 5DM4A 2IY8A 4MGYR 1QZXA 4OV6B 4PYRA 4X3PA 1BS1A 4JT4A 2I55A 3RD5A 4AJKA 4I9FA 1R0WA 2IYSA 3Q3GE 3L9WA 4ZCQA 2AG8A 4HN4B 4S3MA 5HWSA 4EHNA 1GQ2A 1VI5A 4HQKA 1PEAA 3PFBA 4PW0A 4M7PA 2X7HA 1E6MA 4OOEA 3ZV7A 2RB5A 2PRSA 1P77A 1QIMA 3OX2A 1M2VB 5DGTA 2XXAB 4C2AA 3RO7A 1KPIA 1K08A 2ZR7A 1L4KA 3GZNA 3KZCA 4PC1A 4EMSA 3GLIE 3IX7A 4QHYA 2AZTA 1MDBA 3SP1A 1QRUA 3M83A 3JRNA 4ZCSA 3P27A 3L1VA 1PGJA 4KR3A 3MMPA 4Q3NA 4DDWA 5L51A 2AFIB 4JSYA 4EARA 1Q91A 5KYGA 1N2ZA 1JNXX 3Q3EA 1G3UA 2YYAA 3I6IA 4J7XA 4JMLA 4QDKA 7MDHA 2I71A 4UKDA 4L5IA 5B7GA 4BPBA 2JIMA 2JFVA 2AC2A 4BQRA 1HLDA 3S28A 4GLJA 4XWTA 1ORVA 2QTTA 2GJSA 5AW0A 2PU5A 1PG5A 2PSHA 4CHGA 3HL4A 1H4QA 4MUAA 4URYR 4N41A 5DYWA 1NNSA 1UJ2A 3PHIA 2VH2A 1E7RA 1SOMA 3R23A 3R40A 4P81A 3VQTA 4QKQA 5JVDA 2BFFA 4PAQA 3MMNA 4KSBA 4L02A 3BD8A 1ECCA 5JV5A 5TPWB 4AJNA 4BRWA 4CMJA 1IPEA 2Q1UA 1W73A 3Q85A 3THSA 3FYCA 3N58A 3ZZ0A 1Q0RA 4TVOA 3HCPA 2VYVA 4UQOA 3JAKB 3M70A 4CBVA 4B71A 2Q4OA 1UFRA 3R7SA 1N5OX 1XRJA 1W49A 4DIKA 3GN2A 1ZJWA 2Q5OA 5JVDB 1U1FA 1ZP6A 4R69A 4B4OA 2L17A 1Y1LA 2FLWA 2ZQZA 4YWJA 5COBA 2OXIA 2NNWB 1VG9B 1E3QA 5CVUA 2UV8A 1SVMA 1SKAA 3LY8A 1RZUA 1QGUA 3NBQA 3ANLA 4IGKA 4ZT2A 3VU9B 1QGDA 5AHKA 4QDZA 5LQRA 2O23A 1UCFA 1B16A 3JYLA 4B9EA 2GAFA 4ARSA 1WXFA 4Z0PA 3VC1A 5HJ2A 3OESA 3D3KA 3PGJA 4KIJA 2IUUA 3AL0C 2BFPA 2D1RA 4HXFB 1INLA 5JH7A 2Y1LA 4L75A 5LBUA 4FI3C 4JROA 3I37X 4ZV9A 3SOZA 1FYEA 2VAMA 3KYCA 2RGGA 3K1YA 2BWJA 3T5MA 3TSWA 3KQTA 3T5TA 3VYRB 3VZDA 3W6PA 4B3JA 4HQ0A 1ACLA 1HWYA 1JEDA 1U0LA 3RSGA 4AICA 4MWCA 4X1IA 3UPDA 1ZX1A 4E5KA 2GYWA 4PTLA 4NAVA 1AGPA 1MX5A 3ZKWB 2B8JA 4QYIA 1A7JA 1OWOA 3NRBA 1JIXA 1IE3A 4FPXA 1XU9A 3ZS8A 3U7FB 2LR0A 2QLLA 3FJOA 3QG1A 3OU2A 4B7ZA 2VUTA 3NDIA 3IPAA 3H1TA 2HO5A 5CFZA 5I7UA 5AVOA 5U1PA 3W04A 2VSQA 4NV1A 3OEYA 3TZLA 5C5EA 3IVAA 1TCVA 3I8XA 4B5KA 3RS4A 2FZVA 1JWAB 1Z25A 3KJQA 1FRZA 1NJ2A 2IKQA 4GKBA 1KI7A 1I8TA 3UHJA 1NUQA 3R5XA 2QMYA 5JMWA 5BSGA 1Q12A 3Q9UA 1Z0FA 1E79A 2WEKA 5D1HA 1U8CB 5F1OA 4EVQA 1N5JA 1V26A 3LFUA 1GDTA 3UB2A 3ZIDA 1O9GA 3S1AA 1DAFA 2BISA 2QMZA 4E2YA 1NXSA 1E63A 3HZHA 5IC6A 2M32A 3SY8A 1AO3A 3G2OA 1BDMA 4IH1A 2ZIAA 4NDZA 3KDSE 3GFQA 5CX4A 4DZZA 3ZW8A 2VUUA 1C14A 2XOEA 4ENUA 4UMDA 2NUPB 3SLRA 5J58A 1QV6A 3EQ6A 1N7GA 3IMFA 2EVWX 4GZLA 4YP1A 5BR1A 1JDPA 4M37A 1VPWA 3FSRA 2P35A 3ND9A 1FUIA 1OFGA 2G4CA 5NULA 3U0VA 3VJRA 4TMZA 3EJ6A 2XUOA 1FYFA 4YAEA 1KZ1A 3C70A 3OZVA 3DBLA 1URPA 4Q9JA 4XYLA 2HA0A 3HDHA 4G81A 2VHUA 4KITB 4C30A 3FLAA 4KO2S 4AP5A 3AKZA 5AW3A 2QTWB 1VZ3A 3EEBA 2G09A 1OXXK 2HCRA 1SXJC 1EG2A 4UFOA 3TOCA 2OORC 4BVHA 4I81A 1B8VA 2ZI9A 4FGLA 3UJ9A 3WQBA 2Y2UA 3KQQA 2Y0DA 2EZTA 1ZY2A 4PLHA 3IHLA 2NO6A 1MOPA 1IB6A 4G2NA 3DT9A 5FEUA 5C4IA 3OCXA 4D8UA 2P65A 1JHRA 3BE5A 3OFVA 3LWZA 1VG0B 1EVEA 1XKQA 4Q7JB 5EWMB 4B3MB 3QLUA 2ZI3A 4BGUA 2ZAYA 4BVLA 3T7JA 1EFAA 3OFNA 3X1JA 2OHJA 1EM8A 2H7YA 3NI2A 2H4JA 2OCIA 4OJNA 2TS1A 4AFNA 1PSZA 4MA4A 2W6ID 3EXFA 4KRFA 1KY2A 1Z33A 4OD0A 3K6JA 3IH5A 2YXLA 3DNMA 5BOSA 1FPMA 4X6LA 1Q1ZA 1Z74A 4JI4B 4AJ2A 4QFBA 1VRVA 2IEDA 2E5FA 4LDPA 1PS8A 2CHEA 3NYRA 4G1EB 1SUIA 1GNTA 4YBZA 1A50B 5FWAA 3Q2KA 4BEBA 1UZUA 1FNSA 4CV3A 4YJDA 1NVMB 1U4NA 1ECPA 5CCDA 5ED0A 4R40A 3BMOB 1OLXA 1QS0A 3UMBA 5C80A 1J8MF 2K2QB 3NASA 1TT5A 1Z73A 4IOMA 2XCSB 4HWGA 1CDZA 5D8DA 3LZ6A 4ZIRA 4HFJA 4NDAA 3A6EA 1PUIA 3CE9A 3VC2A 3LPCA 4Q7MB 3DZCA 5CG1A 3K5PA 2ZYGA 1SG6A 4U2FA 1NJ6A 4K9SA 4EW3A 1VJRA 1CRWG 3N53A 5JPIA 5WRFA 2JCBA 3DEIA 3LX8A 5CU7A 3OCJA 4BZQA 3HK2A 1RKQA 1GUBA 2XNKA 2V45A 5I7AA 3AR7A 2H07A 1ULAA 2XIQA 4JI3B 1A1SA 2ENWA 2P9ZA 4RPCA 1S3IA 1MPXA 3DO6A 2VEOA 3L84A 3G2LA 4MW1A 1VIDA 1KJYA 2DBYA 3LCMA 1EGAA 1NULA 2AQIA 3LWNA 3STTA 2O8FA 3BKXA 4CL3A 1RRFA 3HB9A 4FSXA 4MQMA 4S2EA 4K9QA 3RVKA 3ZU3A 3TVTA 4QA9A 3A2LA 4B6FA 3WK6A 2D2IA 5KOYA 4DWOA 5F2KA 2CNBA 2FDRA 1O9HA 2XE8A 5EERA 5P8WA 3HO8A 4MUYA 4XEHA 1VI6A 4Q37A 4DWWA 1CPYA 1GFZA 3NS7A 5HNKA 3AUUA 4ZQEA 3MLEA 2C00A 1E3LA 4NC9A 1P7PA 2HV9A 4TQGA 2K5UA 2WAOA 2QM8A 3PG5A 4EATA 2IDZA 3L1UA 4N5HX 2M6RA 2WU4A 2EWMA 2W90A 3HPQA 4LE2A 2JZNA 3TEMA 2BTQA 3O21A 4XRGA 2A0XA 3TECE 3ZS9A 4MR7A 3LNCA 4UVIA 2MOKA 1V5GA 2VTKA 1DWQA 4R1MA 5JNTA 2VRBA 2VOJA 1M83A 4HBZA 3WYDA 3VKHA 4PWZA 4LZLA 4RK7A 2ATXA 2UZ0A 2AI1A 4DSZA 3T52A 4YRKA 3OMLA 2R44A 5FULA 1X14A 2CFTA 4EA7A 1OX6A 4IOKA 1GZ5A 2V6IA 1W46A 2YFHA 1MC8A 1ZOOA 2D5AA 2X5JO 2XDQB 3KV3O 4JYCA 2FPPB 4RELA 5ALPA 1H5QA 1RC1A 2IYAA 2JFUA 1HYHA 1BVUA 3FUVA 3ZK8A 1BN6A 3OO1A 4KVGA 5TY0A 3E5RA 4AULA 1XMVA 1PNOA 1GOTA 3FYHA 4KI0A 5IJXA 1GPDG 1X2EA 5IHXA 4M0LA 2CUTA 5HIIA 4OK6A 1LNQA 2NMVA 4WCFC 5EJMA 4YALA 5C52B 1NQXA 4AWBA 4F2DA 2FUCA 4E1AA 3V1TC 2QW0X 4GICA 1T5IA 1R4MB 2P11A 1NW8A 3ZNPA 3O31A 2H2GA 3JASA 4YHBA 4TS4A 4N3BA 5FTLA 3TCXB 5ELXA 1NVGA 1EHYA 4GT1A 1G5TA 3M1IA 4BV8A 4FHCA 3NVDA 3PUJA 4XJTA 3GRAA 3Q9SA 1RXYA 3DTNA 1YUMA 3E03A 4TUYA 2IOYA 1JHYA 3IE2A 5FT9A 4PGFA 1D2CA 5ERXA 1SUCA 3NGMA 4DV7B 2P79A 3GA0A 1E2DA 1NGSA 4ABYA 1K27A 3G0GA 4R31A 2CE7A 3BB3A 1FX1A 3QKRA 3UWOA 4ER7A 2WAMA 2R1VA 2B8EA 2XQVA 3KU4A 4MLDA 5CBKA 4B3GA 4BX2A 2CC2A 3O8CA 5KPJA 2HK6A 3B12A 2AT1A 2FI1A 1Z7YA 3E2IA 1P7WA 5KDOA 2IT1A 4OQQA 1GUDA 1ZCFA 3L7BA 1XDSA 2JLAA 3RG8A 4J1NA 1YQUA 1LXCA 3C5WP 2I4TA 3MRXA 3NKFA 3OOHA 4YRDA 2J3LA 1QO0A 1FEZA 2JLCA 3R3JA 1OXUA 4LBWA 1M34B 2VL7A 2VG8A 4MW9A 1EWYA 4BVKA 1GZ7A 4MDHA 2B3DA 5KTMA 2AKYA 1TO1E 3ZEAA 2JEOA 1OLSA 2VVTA 3OIVA 1FFYA 3HUFA 4BEVA 4RWZA 4WLNA 3IELA 2HAEA 1A8SA 1BXKA 1NKTA 2B4TO 4QOJA 1RI3A 5IDWA 1HR0B 1G2QA 2EW1A 5KWVA 1NXWA 3PHGA 4I8DA 3S5JA 1ZM9A 3DF7A 4HWTA 4JMPA 3UWSA 4NV3A 5EP1A 5IAAA 2IYPA 3A6JA 3IIKA 3OIYA 1S8AA 3ZE1B 1IZ9A 2GJAA 3NORA 4TN1A 1TA0A 2BEUA 1MJFA 2C61A 3KAPA 5H83A 3WZ2A 1IATA 2G36A 2O0MA 1N5IA 2RHRA 3M4NA 3N86A 4HEJA 1PEYA 4AZ3A 3WQQA 2VNAA 4EY5A 3DBRA 3WKEA 5FV7A 2B4RO 3VMFA 2J9RA 4ZN6A 4URUR 5FTNA 5JCPA 1ZD4A 4QRDA 3QEAZ 3C5HA 3DWFA 1AXEA 4N5MA 4BLOA 4UBLA 2AGVA 3EVNA 4HRVA 3T3GA 4B3FX 2P9YA 1T2AA 3IB3A 2ODAA 4LXIA 5FPHA 1QE3A 4WLFA 4PYJA 1SU4A 1EK2A 1NDHA 3K9BA 4HTAA 1RSZA 1S5PA 1SKYB 1UR5A 3O0TA 2H65A 3PT5A 5CNJA 1G3IA 1DPGA 2FPLA 2GARA 3LBYA 3GDGA 5K4HA 3A2MA 3LT5A 3VV2A 1DMSA 5D3MB 3Q8LA 3RKUA 3D4NA 4MYTA 1DLIA 1EE2A 2PMKA 1QP8A 2ESRA 4FHFA 1RVDA 1ZM3A 4MW5A 5TGZA 5KNCD 1ZGGA 2KLHA 4E6PA 2HF2A 2FMXA 1PHPA 3UIEA 2QD5A 2WUGA 2YH2A 3MJVA 1AY0A 3E22B 4LHSA 4LSMA 3GLGA 1ZH4A 1LVHA 2Q21A 2PDAA 1IZZA 2XADA 4C7VA 4PQEA 2PFKA 3VU3A 1H1TA 4S1WA 4ZYUA 3SQNA 4DFDA 4QYXA 3NTOA 1Q3KA 3S1SA 3QBJA 4JLOA 1DKMA 2QUBA 5A06A 2WFLA 3I0NA 3MT0A 4AG5A 5CNKA 8ABPA 3PQ2A 3L1IA 4LMRA 3T3MB 3VVBA 2J9FA 3DPSA 2AUTA 4U3JA 2DERA 4RQBA 3NV7A 2HWYA 1IZYA 1E89A 2AYZA 2J4CA 1T8RA 2B69A 4DW8A 1I3MA 1ORIA 3CX6A 3SLGA 3ILSA 2OR3A 3KVOA 5K6RA 5KYYA 5KJFA 1QK4A 2IHVA 4TROA 3W2HA 1KPHA 2R4QA 1M6EX 1IXKA 1X9GA 3CM0A 3EDYA 4FZ3A 4PLWA 3B70A 3SHTA 3L1HA 2HCJB 3UXMA 4II3A 2FSVA 3Q7IA 3QXCA 4INJA 2C4WA 4YP0A 5J63A 1W6RA 3UMYA 1IOVA 4IJWA 4J8PA 4NS4A 3VR6H 3G7SA 5CMLA 3LP8A 4DNXA 4GBMA 3LG2A 1R6BX 1F2UA 4AQDA 1DIGA 2PX8A 4KTVE 4C3ZA 1IC6A 5EJ8A 2FSHA 1M2EA 3BGWA 5EMJA 2BMFA 1JKFA 1MH1A 1P5HA 3LOPA 2ZDQA 4GP6A 4EPVA 4XM2A 3L05A 1DTWB 2C2BA 4LHZA 4BNUA 1T1SA 4MQEB 4Y7CA 5KHLB 5J43A 3KHUA 3OMXA 2BGMA 4GEKA 3WA6A 3ETHA 3BAZA 2DQYA 1QF7A 2YINC 3JALB 4DBLE 4MUHA 5EGSA 4C08A 3SNKA 3R3VA 1JQJC 2EZ9A 4O4HB 4FJ0A 4LZWA 3AF5A 5CM8B 4QOIA 5JXIA 4PNEA 2WB2A 2XUZA 3T3DA 2FNAA 1W6UA 1XZPA 3F2VA 4RA9A 2BGLA 4HDKB 3D4LA 1D07A 5CT9A 3CIFA 3JQ6A 4JEUA 1P0PA 4RPIA 4F1JA 3I4CA 4Q4HB 2H5IA 2J6HA 2Q3FA 3OIFA 1MB9A 4X1OA 2VSYA 1DJQA 1GYRA 4RKYA 4UUPA 3ICQB 5INTA 4KH1A 9ATCA 2A2ZA 1ILEA 5CR9A 9ABPA 1FIUA 2Z9CA 2ZOSA 1F48A 1KO1A 6Q21A 3CO5A 3RS3A 3RYIA 1JHVA 5ITSA 2P1ZA 1K3FA 3UG7A 1KEUA 1FTYA 3IV9A 1SBZA 1XLVA 4HXGA 3T34A 2Z5VA 2L19A 5BNZA 1R3DA 2BY4A 2P6MA 3MMZA 3D7KA 4LXXA 4YCMA 3KNZA 1MGOA 5TNXA 3A9WA 3DTVD 1T15A 3D2BA 4MOWA 4URHA 5C5IA 3H83A 1PVDA 1M76A 3NYQA 2VWGA 4BFUA 2PA3A 1E6CA 1QGAA 4R6WA 3QW2A 3GAAA 1F1JA 2PT7A 1HXHA 4IGEA 2OZEA 2X0DA 2G4LA 3HWWA 3V8NA 5K5EA 4CLOA 1C3OB 1XQXA 2PYZA 5GOZA 3G85A 4NTZA 2WMNB 1L4NA 3FTCA 2J9ZB 2E4VA 1P9LA 1CZLA 1JEEA 4PXYA 3ZUPA 3KRTA 2A33A 4C87A 4PSKA 3W3ZB 4A26A 2OZPA 3ZHTA 4EY4A 1GKKA 2X76A 3KB8A 3WLHA 2XBLA 1UC9A 4LW8A 4G4GA 4NPAA 2BSXA 1J0AA 1VZ2A 3BHIA 2V7GA 1HE2A 1QSGA 1GDDA 1XXHA 2GZHA 4DQDA 1WHSB 2OAEA 1Q22A 2VBFA 2XQJA 3I58A 4OQNA 3CH7A 5C8YB 2ODBA 1BAPA 1MQ9A 1Q15A 1XXHB 1ND5A 3ZHCA 4F5YA 1J1UA 1PJCA 5D86A 1ODCA 5G0TA 2YXNA 2FZEA 4LBVA 4EO9A 5EFZA 1NATA 3U7GA 4PC7A 4KAAA 2FP3A 2RCYA 1SOAA 2F3UA 2PBFA 4QASA 4JS0A 4ZVTA 3UHOA 3TRHA 3WGIA 5ECGC 1AQIA 5FR1A 3WVNA 3OJ0A 4RY9A 4AJIA 6ADHA 2QE7D 1KQ3A 1GKLA 4EL0A 5LJLA 3T7RA 1ZHHA 1QAMA 1KGSA 1OW3B 2NU8A 1NSFA 1S02A 1W5EA 1HFEL 2P2LA 2YXPX 3O8QA 5D5HA 3TPFA 2C31A 3V55A 3NM6B 3M4XA 1IJBA 3ETCA 2G71A 1P1BA 2I62A 2HYDA 3CURA 1DIHA 2PSFA 3EXG1 1T3SA 2YV3A 4O2BA 2HDOA 2P4HX 4B83A 1QM5A 1GPUA 3QU5A 4D43A 5BQ3A </