2OEPA

Msreca-adp-complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
325
structure length
324
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLEKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of RecA protein involving movement of the C-domain and different conformations of the DNA-binding loops: crystallographic and comparative analysis of 11 structures of Mycobacterium smegmatis RecA
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Recombination
molecule keywords Protein recA
total genus 76
structure length 324
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2006-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2oepA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2oepA01
2NQ2C 4ZDWA 3N2IA 4CEIA 2GBLA 1PZNA 4L16A 3SS8A 1JXMA 1KZGB 1OXXK 1E98A 4JVSB 3SBDA 1NN1A 3AVUA 4LX0A 2A30A 4PSVA 2JEOA 4QNMA 4URZR 4WXRA 1CU1A 3QIAA 4PANA 3THXB 3EA5A 2X2EA 4RFVA 2WPDA 1MO4A 3LBNA 1A7JA 3IBYA 3L8YA 3TH5A 4DLXA 3A1SA 4C7OB 4M2LA 3W9YA 3GCGA 5EJEA 1FNNA 2BBTA 2DBYA 3U5ZB 4QGGA 4PXAA 2O8BB 4KJZA 3F3YA 5DSZA 1NG1A 2BM0A 2NGRA 4EQ6B 3DM5A 4EFMA 1MOZA 4HSEA 2JLYA 2MSEB 4LYFA 1E9AA 4YQFA 4Q4AA 5JEEA 1DADA 1BIFA 3QXJA 2MSCB 3ADDA 2J0UB 2ZJ2A 1JECA 1K5GA 2A5FA 2QBYB 3WHKA 3DM9B 5CITA 1UEJA 3AF2A 3U7FB 4Y0VA 4OQMA 1CR4A 3FKQA 4E07A 1F2UB 1L2TA 1XJQA 2BBSA 2OFOA 1E2IA 1E9SA 2VP6A 3BRWD 4IEEA 3BFKA 1U94A 1JR3D 3SFVA 1CRPA 1SVMA 2IHBA 3OIYA 1YZNA 1E0AA 2JAQA 1G3RA 3QXSA 1G18A 2IYSA 2QBYA 1RRCA 1SKYE 2QRZA 2JJ1D 3QKSA 4LC1A 1E2MA 2JLUA 3RC3A 3OE7A 1E2DA 3KX2A 2G3YA 1F2UA 4HAYA 1AGPA 3IEUA 4M53A 2VSOA 2CK3A 2YKGA 2P5SA 3NXSA 2KWIA 4WIAA 3K0EA 3L43A 4FINA 4QBFA 3ZYCA 1XX6A 1W4CA 1ANKA 1XJCA 4LZZA 1OIVA 1FL9A 3RS5A 2DCUA 3A6PC 4PC1A 3AKYA 4D0GA 1P4SA 4UKDA 3BAFA 1RJ9B 4TLBA 3L82B 1LS6A 1VHLA 1Q1EA 2FSGA 5JMTA 3FMPB 3D3QA 1II0A 4GL2A 3UG7A 4UXIA 2A5YB 4N0EA 2LKDA 4GI7A 1OB2A 4MRPA 2J7KA 2JDIA 4HAUA 3F0TA 2YVUA 1KO5A 1V5WA 1TNDA 2GK7A 3N2EA 1QF9A 3TSWA 4X8OA 4X8MA 3O8DA 3AP1A 4JLAA 1X6VA 2O8DB 2NTYC 2XSZD 3R7WB 1TF7A 1NG9A 3K0CA 3DMNA 4Z8XA 3T15A 4BLSA 1Z0AA 3ZS9A 5JCZA 5SZHB 5BW8A 5FTLA 4JBXA 3U7EB 5D3MB 2AFHE 2EW1A 3TKLA 2GESA 3W3AA 4Q9JA 1IHUA 1P2VA 1KO4A 4PAMA 3RS4A 3CPHA 3EC2A 3MUFA 4IXMA 4HLCA 4ON9A 1OB5A 1H8ED 2FU5C 1YKSA 3EC1A 1ZNZA 2O8EA 2REBA 2BCJQ 2OCBA 1TEVA 3BB4A 3FKSA 1FP7A 1X3SA 2RMKA 3TK1A 3GLIB 4CEJA 1XD2A 2LKCA 5KNBA 1NBMA 3LRPA 1T0HB 4BEJA 1U9IA 4AK9A 2BIFA 1XBTA 5KNCA 1RJ9A 4OI0A 1CKEA 2OHFA 1RE0A 1OFIA 2HT1A 1QRAA 1FNMA 3RNLA 2WTUA 3BC1A 2V7QA 3ETLA 1S96A 2GEVA 4JLVA 5SZKB 3OIVA 2ORVA 1PV4A 3UANA 1TU3A 2IYZA 4F4IA 1FP6A 3KUDA 4HZUB 3GLHE 4C0BA 4D4MA 3U2QA 4JBWA 1M7BA 5FPTA 3PQCA 1HV8A 1COWD 2JJ8A 3EASA 2FEOA 4C2TA 3QPUA 1ZIPA 4UJ3A 5B30A 2XOKA 1YRAA 5E4FA 2ZRHA 2GVZC 3NH6A 3QI2A 2JLSA 2GRJA 2FX3A 1CIPA 5D3MA 4Q47A 4DSOA 2VQSA 3D7MA 4ZO4A 3L0SA 5CYPA 2EFHB 3CF0A 2Y8EA 3ZD6A 2ZI3A 3DEFA 5CK5A 4CW7A 3KFXA 2QE7D 4FWTA 1GILA 2RHDA 1N6OA 1OV4A 1VG0B 3A1TA 3NBXX 4V03A 2ZE7A 2OAQ1 2OZEA 3W5JA 4E03A 1S9HA 2ZE6A 2QM7A 4W5JA 3IPYA 4QHSA 4WBSA 1DBSA 4JKIA 1AS2A 3UATA 1OH8A 2Q3HA 3EIHA 4BASA 4C7OA 2ZREA 4TT3D 1G1MA 2ECKA 5BQ5A 4RZ2A 1F3OA 4XTRA 4D4JA 1ZAKA 4E22A 4M9SA 1GOTA 1SVIA 2WJIA 3G0HA 1AKYA 3T12A 4TTRA 2F9MA 2QN6A 2XSZA 3Q5EA 3BFVA 2B21A 4GPTA 4WAUA 5AR1A 2YWFA 2HT6A 4QBGB 1JJVA 3VKHA 2AXPA 1NF3A 2Z43A 2RGNC 3BH7A 1YRBA 3UWOA 3THWB 3SNHA 2ERYA 5KSYA 3FKSD 4JT4A 4TYNA 4F7WA 1UBFA 1HURA 2QMUA 1YJ5A 2NG1A 2WZQA 1D9ZA 3C15C 4UXHA 1I2MA 4DLZA 2VO1A 4HAWA 2Q9AA 3QXHA 1N6KA 3GLGA 1M2OB 2ZUBA 1U0JA 3GJ0A 4V0NA 4AD8A 1BO6A 4BLPA 2DWOA 2PZGA 3SYLA 4Q7JB 3U4QB 2IUSA 1SZPA 3ZDQA 3O8BA 3RS2A 2QQ0A 2ZI5A 2H7VA 3E2IA 1DO2A 1GL7A 1IY1A 3T1VA 2ORWA 4M8NE 1NBME 1SVKA 1WP9A 5CJ2A 2QTHA 2WJHA 2DY1A 1II9A 1PUIA 2F55A 4G5QA 1QZXA 1S3GA 4PSAA 4TYYA 3B9QA 3KJGA 2NMVA 4C0AC 2CXXA 3NTUA 4PFSA 4NYJQ 2FDCA 1W2HA 3U4QA 2CHGA 3BB1A 4A6PA 4YXWA 3ZLJA 1XNJA 3LV8A 3WMFA 3TW8B 3OAAD 1VHTA 1E0KA 5KSOA 4PQFA 4LV6A 5FOUA 4DSTA 4TYWA 2AR7A 5CLQA 1OIWA 3C16C 2D2FA 3LDAA 2ZTSA 3RSLA 4AKGA 3IPXA 1ZUHA 1K6MA 2D74A 1W36B 2CHQA 1DAIA 1RRGA 2IYQA 2R44A 3B2EA 1FZQA 2EYUA 3VU9A 3AUYA 2WKPA 3WYFA 5BN5A 1IXZA 1NI3A 3ASYA 1ZW6A 1XJ0A 1SHKA 3AGQA 2JLRA 4IJMA 4Q1AA 3ZIAD 1T5IA 4CRWB 3GLFA 2RAPA 1X8KA 2R6GA 3WYAA 3IO3A 5HE9A 1ZUIA 1E32A 1NIJA 1G9XA 1GSIA 1HYQA 4TL6A 4YONB 3QKTA 1AM4D 4EUNA 5GJBA 2A9KA 2CMKA 3C41J 4MITA 5C4MA 3VX3A 3J81k 4FCTA 5AUQA 2ANCA 3I8XA 5KU1A 2CLDX 2BVNA 1DE0A 4UQOA 5HZKA 3NHBA 1F5NA 2O8EB 4KVGA 3PUXA 3TR0A 4DKXA 1XEWX 2R6FA 5FBVB 2IX3A 4ESVA 1MT0A 4MUBA 5DI3A 3NIBA 1YZTA 1NKTA 5IRCD 1Q1ZA 1II8B 3EA0A 2JLWA 1U9IC 2QQEA 3GEHA 3X2SA 3DDCA 2HYIC 1G5RA 5BYKA 4HUQB 2LWIA 2GXAA 3W6OA 2WM9B 2AFIE 1NLYA 4XD7A 3ZS8A 2FGJA 2ZSBA 4FMCB 4M22A 2FZ4A 4WA7A 3KQUA 4V0OA 2G1JA 1LFDB 2PLFA 2WWFA 1DO0A 4DUGD 3QXXA 2IYXA 1II8A 4V02A 1TMKA 3CF6R 3T5GA 4AYWA 3FE2A 3OIWA 1IN4A 2ZYWX 4MUAA 1NVVR 4GOKA 4YC7A 2WJYA 3QEOA 1G3UA 1NLFA 3K0AA 4GFDA 1VG9B 4EAQA 1R7RA 2O8CB 2IS6A 1X8LA 3EAQA 1E2KA 2QT1A 4M9QA 4MH0R 5C18A 1JR6A 3U7HB 2E87A 3U3RA 2MSDB 4GMXA 3W5IA 2ODEA 4HAXA 4QG7A 3WP1B 1GZSA 5HTKA 4OYHA 2ZANA 3OAAA 1W5TA 1VCMA 5HE8A 3CNNA 5K8IA 2OESA 1FFHA 2A78A 721PA 1UKYA 1RIFA 1QHNA 2IEZA 4G1UC 4EPWA 3R9WA 4NZYA 4P33A 1FUKA 3VFDA 4B2IA 3THYA 2CL6X 3L8ZA 3D31A 5JECA 2JJ2D 4IHQA 4DCSA 4U5XA 2FPMA 2GCNA 4DSNA 3CX8A 1D5CA 2ZRKA 4LOAA 4O2LA 3ONWA 3GJXC 1Z47A 4D81A 2XITA 4DDVA 1MO5A 1XCGB 3U3JA 1WE2A 2GF9A 3U44B 3HU3A 2TMKA 421PA 4UNPA 4C4PA 221PA 3B1ZA 2OV2A 4OK3A 3G5UA 4RD0A 2V54A 4GNKA 1F60A 4OHYA 1GAJA 4JLPA 2ZYVX 3VHLB 1ESNA 1FX0A 4IFBA 1J8YF 2ZJYA 3BFXA 2HUPA 4EPXA 2IS1A 3JZAA 2P6NA 4M9ZA 1G21E 3MCAA 3AM1A 4RD2A 2QTFA 1CJMA 2ORIA 5FOVA 3HP1A 2Q9CA 1H65A 1VYUA 1UF9A 3EPKA 2BEJA 2XNDD 2XZPA 2IYLD 2IXGA 2VYFA 3AKCA 5HCNA 4KFRA 2FG5A 1ZNYA 2Z4SA 1N25A 4Q4AB 2FSHA 1MRNA 2WMNB 4KU4A 2IXFA 1ESMA 4TN1A 2J0UA 5EE1A 2C95A 1OFTA 1YR9A 2W0SA 3CRRA 2OSBA 2IYYA 4NCHA 1R0YA 1E96A 4K81B 3SBEA 1N6NA 2KI5A 4OHZA 3B1YA 4WZBE 5GVSA 3FVQA 3AUXA 1NSTA 4XWKA 2C98A 4ZKDA 3OEHA 2WBLC 1Z63A 3K0SA 4D25A 4FD2A 3FOZA 2NO0A 5AJWA 3B9PA 3ASZA 5E7JA 3SR0A 4FCWA 4D80A 4QM6A 2ZRNA 5JHGB 1HE8B 1TF2A 2GCOB 4BFWA 4PPFA 4NCNA 3KKPA 2WJJA 4RD3A 2REOA 1JAHA 5E7MA 1RZ3A 3ND8A 4BWYA 4L4UA 1IN7A 1CJTC 1OKKD 3IUYA 3PEYA 3K09C 4Q66C 4FCVA 3VR6A 3WHLA 4LV5B 1P61B 1JQJC 4GOXA 1XMJA 2VF7A 2ZR9A 3I61A 2OBNA 2JLXA 1KZ7B 5JFGA 1G6OA 2PT5A 4PO9A 1XU4A 3P20A 2ZAMA 4L9SA 2ZI4A 4PR0A 1E1RD 3RABA 2IA5A 4NL4H 1JI0A 4ASUD 5HKKD 1GNPA 2J1LA 1LVGA 4FMCF 1E2PA 3CIOA 4ZKEA 3R8FA 3IO5A 1P72A 3QKSB 2CCJA 4MA4A 5EUQB 4DEXA 3ICEA 1WXQA 3RRMA 1Z0KA 1Z07A 4LBYA 1OKKA 1OXVA 2V3CC 2FFQA 1RYHA 3DKPA 3PXGA 3QE0A 2Q3MA 1LB1B 1VYTA 1ZC4A 2A3RA 2CLSA 3KZ1E 5JEDA 2AXNA 2IYWA 4BZPA 2GJ8A 3HWSA 5F3WB 4B43A 4LJ5A 1W4BA 2ZJBA 1Q3TA 1CF4A 4ZCIA 3VNUA 521PA 1D2EA 4YDHB 2AWNA 4NYIQ 3PENA 2ZSEA 5KDLA 1E9FA 1KI4A 3LVQE 1LY1A 3QPVA 1G7TA 2FFAA 4Q1DA 1JNYA 1OW3B 4MGZR 1OFUX 5D3QA 1IONA 1G8GA 3X1ZA 2BOVA 2HXYA 3CRVA 3CX6A 2B6HA 1KSFX 1NVUQ 5DN6A 3CNLA 3PG5A 1F2TB 4XSHA 1S3SA 5LPNA 1OFHA 3KQHA 1KI6A 4ZI3A 1AN0A 2RGBA 4Q1EA 3H2YA 4PHGA 3MWLA 2PCLA 4AI6A 5TXGA 1E2JA 1LTQA 3ADBA 3THYB 3EARA 2J7PD 4EIWA 2BJWA 2BBOA 3AEZA 2QPAA 4A2WA 2VP5A 3VAAA 1NVXQ 4URVR 3GP8A 1NMYA 2FNAA 1EXMA 2BV3A 1KDRA 3KUCA 5JZVA 2WAYA 2O8FB 4NU0A 3RS0A 4NONA 2IWHA 2GAAA 1IN5A 3VR4A 1GM5A 2J0QA 1U2RA 3C5CA 3CRQA 2PEZA 2X8AA 4TTPA 4LJ9A 4ESHA 3A8TA 1Z28A 4B75A 2EWWA 2WKQA 4F4JA 1Q3HA 3FPAA 5DHAA 4JSTA 5G53C 4A0RA 1T6NA 1J70A 1NVVQ 1OLOA 4LJ6A 1IJEA 1GNQA 1E99A 4TMTA 4PC2A 4ACAA 1A2BA 4NYMR 2GJSA 5CM8B 3DZDA 1N6RA 4KSCA 3GPLA 2VP9A 2VBCA 2ZYUX 2JGNA 1W46A 4FN5A 4W9MC 4A4DA 3S1AA 3HPRA 1IXRC 2Q3FA 3BD9A 1KI6B 2QA5A 4KO8A 3ZVNA 4XIGS 4PO8A 5F2EA 2FFHA 4BFXA 2YZ2A 3DZ8A 1QVAA 1KKLA 2QP4A 2J45A 4Q4JB 5EP1A 2XNSA 1NLZA 5TDHA 2CCKA 4DUGA 4BECA 4MRRA 1OH6A 2ZITA 4RFSA 4U00A 1XCMA 4LHXA 4KFSA 4LUCA 3EZ6A 3SQXA 1XPRA 3X1YA 1XP8A 3S1AB 2VP4A 4PQYA 5ANRB 4B3FX 1S2MA 3B1VA 5JJKA 4H1UA 2D3WA 3DOEA 5CK4A 1XFAA 1VIAA 3RRNA 3K9HA 4K46A 1H8HD 3RDPA 4C0SA 1YZGA 1KNQA 5JS7A 1Y63A 2H18A 3B1XA 3GJ7A 3RANA 5B2ZA 2OUKA 4NBSA 3SYKA 5J4YA 3BWDD 1G3IA 3WNCA 3CBQA 5DE3A 2PZEA 3MGCA 3CO5A 2DWQA 3L0IB 4G5OA 4US0R 1B23P 4DZZA 1CS4C 2ZRBA 2RGXA 5FTJA 1GTVA 3LBHA 4QJ5A 1DTSA 4V0MA 3QSYA 3UIEA 3I8SA 1XEWY 2NO6A 3KJHA 1AK2A 4US2R 2FFBA 1XRJA 5DNYB 2DHRA 1JXOA 1KK3A 1WBBA 3UWKA 1VG1A 1YZQA 4NMMA 4YMVA 1ODFA 4EJSC 4GRAA 5H70A 4A8JC 4I1VA 3BH0A 4FIDA 1N5LA 3PVSA 3B85A 4B3DA 4O0MA 2W0MA 1B0UA 1Q0UA 4LWZA 2ZSDA 4QBHA 1AKEA 2C77A 3SJCA 3CRMA 2EYQA 3QY0A 2B92A 3P27A 1ZD9A 5K8UA 1BH2A 4M1OA 4M9XA 2GAOA 3RLFA 2QORA 2B7BA 3Q3JB 1P5ZB 5JI3E 3REFA 3FFAA 2XTNA 4IDOA 1IN8A 1WBDA 4DIDA 4D26A 1Z29A 3LX8A 4W5HA 5FFMA 4B3CA 5G3ZA 2J0SA 1C4OA 1FQKA 4Y0AA 3A58B 2I1QA 2XTMA 3SN6A 4XVUA 5DO9A 1P73A 1Z06A 4OQFA 3D6TB 4Q1CA 3FMFA 4YMSA 1WCV1 4RJLA 1XXHA 4Q7LA 4FWIB 5KNDA 2ERXA 1R2QA 4OBEA 2I4IA 1Q1QA 2FWRA 4KFTA 4Q9KA 3ADCA 2K5UA 1L4UA 3DVLA 2ZSAA 5CIWA 1E9DA 3MRSA 3VU9B 1U90A 3FYHA 3NC1C 3W6NA 5C1BA 1DVRA 4EKDA 4TYQA 3CPEA 1QHGA 4HYYA 4IW3B 5FTNA 4G5GA 1OE0A 3PITA 4ITRC 4TLCA 4Q21A 4MYCA 4URYR 2HF8A 4Q48A 1W0JD 1XPUA 3DKVA 5J4HA 4FXPA 5BWMA 1NN5A 4B6FA 4F93B 4D4KA 2OCYC 2QPTA 1ZYUA 2OFWA 4S35A 3TSOA 3AVVA 1Z2AA 2QSZA 1DOAA 4PHTA 4YXWD 2JLVA 4URXR 1CXZA 4KI0A 4Q5IA 4Q9IA 1R5OA 2WWWA 4TT3A 2QZ4A 3MWKA 1MKYA 2BMEA 2ZRDA 1E2NA 1N3BA 1KI7A 5FOTA 2IF2A 1SVOA 4TZ6A 4DWJA 5FR1A 4HB2A 2HYDA 4C0QC 4QGAA 4DCNA 1CTQA 1V43A 2W00A 2V8OA 3R8CA 1G3QA 3BBPA 1OH7A 3LBIA 1W1WA 1UEIA 2I3BA 3CRW1 5L3SB 2ZE8A 5C46F 5FBRB 3SE0A 1NY6A 2ATXA 3ZIAA 5ELXA 4PPNA 1L4YA 4MGIR 4IRUB 3M4YA 4R9UC 3TNFA 3GJ6A 3HDTA 2AWOA 1T4GA 2B8WA 3OZXA 1G4UR 2HLDA 3TUJC 4B35A 4A15A 1PLJA 5DYGA 2X2FA 3T61A 2NPFA 1G19A 4YDSA 3N5CA 1KO7A 4DDWA 1F48A 1NY5A 1G5PA 4JL5A 3U3KA 4B3GA 4KBGA 3GLGB 1IOZA 2ZM5A 3A4MA 2G9NA 5SZJA 2OLJA 5JBQA 3ZZUA 2Z4RA 4XD7D 2ONJA 2V55B 3TJZA 3MG9A 1SKQA 4BLRA 4ZIRB 1KIMA 3LFUA 3LW8A 1P9NA 3LQRA 1OH5A 1E2QA 2RGEA 1KDPA 2Q6TA 2WJVA 2HDNB 4MDEA 1VCNA 5IF9A 1G17A 2WWYA 3TBKA 2FOLA 3B5JA 1Q57A 4B73A 3QKUA 1X86B 1SXJA 2ZUCA 2PCJA 1HEIA 3AV0B 4HI0E 1DG3A 2GBLC 1YR6A 3E1SA 1Z8FA 1DAMA 1EG7A 1I4LD 3Q7PA 1CJKC 3DL0A 3IIJA 2GNOA 4RD4A 3EIEA 2FZLA 4C2UA 4D6PA 4MKGA 1VDZA 4PPGA 2VHTA 3H86A 4F4CA 2GTPA 4BZQA 1A82A 1ONBA 4BLOA 2D2EA 4OHXA 4YMWA 3VKGA 4LHWA 3K09A 4NYMQ 1JR3E 4I1SA 5E95A 1S4QA 1IN6A 3I73A 5J4KA 2OEPA 2QPOA 3BGWA 3EWAA 2XAUA 4AG6A 2QE7A 5CYOA 2DFTA 3QF4B 3VR2A 3UPUA 2QENA 4A92A 1FMLA 3SHFA 5B64A 4R71A 2PMDA 2V9PA 3VQTA 3FB4A 1NMZA 3DO6A 4BZXA 1EESA 5CLLA 2ODBA 1FTNA 2ZR7A 3U3MA 4DEYA 2ZAOA 1QBKC 4D0LB 2W6IA 4DB2A 5KYKA 1NNEA 3BERA 5TARA 3Q85A 1W0KD 4DBLC 1CLUA 1R5BA 1IM2A 1Z6XA 1G7SA 2H57A 2Q21A 3AQ4A 3K0FA 4HUQA 1GFIA 1YHNA 1KK1A 4LJ4A 4FMDB 3FFBA 2WSSD 4GP6A 1US8A 2ZQ5A 3E70C 2C78A 2GDJA 1J7KA 2PX3A 2DWPA 3AVXA 5F9HA 4Z54A 2YOGA 3TMKA 2UVQA 3EPHA 1YZKA 2HLDD 3I62A 3BK7A 2QU8A 1XD9A 4Q7MB 4TLAA 5FPKA 4V0LA 1SVWA 3VNVA 1WA5A 2GJKA 1EFCA 1KMQA 1NN3A 4QHTA 2HF9A 2H5EA 4AC9A 2GWHA 4HDCA 5GJWC 5CM9C 2YC2C 5EP4A 2O0JA 3WY9A 3EIQA 4OL0A 3V9PA 1SXJD 2REXB 4DHEA 3TW4A 1I4DD 3WRXC 4PC7A 2YOFA 2PX0A 2V7QD 3SHWA 4KFUA 5HR5A 4LHVA 5JJLA 4P0TA 3W8NA 3ZD7A 2Q0HA 3GLFB 2W6JA 2GEDA 2XGJA 4HAVA 2IBMA 1SKYB 3GJ8A 4DJTA 2P6RA 3Q72A 2ZYTX 3LLMA 2OXCA 3K0FB 4TL8A 4A2QA 5J4LA 4A1FA 1UKEA 1PUJA 4TQUS 5DH9A 1YR8A 3HJNA 5EE0A 4TZ0A 1ZMXA 5FI1B 4HLQB 2J3EA 3T1TA 2RKOA 2WSMA 5AJXA 2ANBA 4X8LA 3CKLA 3EX7C 5FTKA 1X8JA 4IDQA 5L3SA 4KSBA 2P5TB 4JL6A 3SJAA 4JJKA 1ZIOA 4I4LA 4KYIB 3QXCA 5C2JB 2ZI6A 3QBTA 3GQBA 3FHOA 1BMFA 2J87A 3GMTA 5JRJA 1MABA 1T3SA 2WICA 1BOFA 4MYTA 3NG1A 2D7DA 2OE2A 2P65A 3AVPA 3RAPR 2DR3A 3QJYA 4M1KA 5IK2A 2RGGA 2ZRJA 2AD1A 1W48A 2GKSA 4AURA 4LCBA 4IOJA 4JLOA 2IS4A 4B3BA 3OEED 4Q00A 1C9KA 4LHZA 3MWJA 1FOEB 3TAHA 4Q1FA 5EE9A 4GBMA 2XJ4A 4OJKA 2FE4A 1QHSA 4J0QA 4WOPA 2B8TA 1R0XA 1ZCAA 5L3RA 3CWQA 5AK0A 2GA8A 1E2LA 2QT0A 1KY2A 2N1BA 1G20E 3CF2A 4JIMA 2F43A 4DSUA 3GJ5A 2IF0A 2QTVB 2IC5A 1W49A 2CE2X 2CVHA 1ZP6A 5C4GB 1AJEA 2N42A 3LVRE 2XJ9A 4TL9A 6Q21A 1R8SA 4NCKA 1SXJB 1TQ2A 4QBIA 2ZRIA 2J46A 2IYUA 1NJFA 1T8UA 1S8FA 4JLBA 1XF9A 3LQQA 1ZD1A 5A4JA 4OJQA 3KJEA 3QVUA 1ZC3A 3V00A 2HJGA 3AH8A 4M1WA 1NP6A 2V6JA 5LD2C 3W34A 3ZVLA 4DIEA 1Z83A 2KBFA 2VHUA 2O8BA 4L5BA 3FWYA 2ZJOA 4HZIA 3ADKA 2GCOA 2C8VA 2MMGA 5FI0B 3QKRA 3LH5A 3ND9A 3CR7A 4LHYA 1J90A 3SJBA 2NZ8A 2A5DA 1JEDA 2QMEA 1W4AA 2JDID 4HLUA 3C7KA 1U99A 3AKEA 4A0GA 2CL0X 4R7ZA 3IHWA 4TSFD 4B3XA 1TTTA 1G5TA 1GNRA 4EDHA 4MGYR 4DLUA 3C5HA 2J7PA 4Q7KA 4PX9A 4ACBA 4BLTA 1XMVA 1WQ1R 2F1IA 1XTJA 4BE7B 5FBWB 4IVQA 4JLKA 1UDWA 1G41A 3CM0A 3KKMA 4YMTA 1XEFA 2QRNA 3QG5A 1HT1E 2AHOA 4Q4JA 3R20A 4G5RA 4HDQB 4HAZA 2DPXA 4A8JB 2OILA 2PT7A 2FA9A 2GXQA 1BMFD 4UXJA 1EFUA 2YJTD 3K1JA 3PV0A 2O52A 1C1YA 1HE1C 1XTKA 3KTAB 2NPIA 1T3HA 3P4XA 3KXIA 5SZIA 2F1HA 4PPQA 1O87A 2G83A 3I1FA 2ATVA 1E9RA 1GVNB 1KY3A 5LDDC 3I32A 2ZRCA 5P21A 4Q01A 5JLJA 4A8JA 2OBLA 4AKEA 1M6NA 4HATA 4IEIA 4ARZA 3FHTA 3QKRB 4OHVA 1RYFA 1OT3A 2WWIA 4Z8YA 1CULC 5BXQC 1ZM9A 1G291 1ZINA 1XTIA 2RGNA 4TMZA 3GFOA 1ZM2A 4LV8B 1J2JA 2GZAA 3UXMA 4UNSA 3GD7A 5KPJA 4XH9B 2DFKB 3LXRA 2IYRA 2WPDD 3E5HA 4A0HA 4QFMA 4LGMA 1KMHB 3SOPA 4NYIR 2G0NA 4C0HA 2OFXA 1E9CA 4G01B 1DG1G 1P75A 4RCYA 2R6DA 3I5YA 2ZRLA 4G5SA 1YVDA 2EWVA 4JLNA 2VLIA 4I99A 1U98A 2GHIA 3LWNA 4LSGA 1XXHB 3U60B 3KKOA 2IUUA 4JS0A 1IXSB 1JB1A 4NP6A 2RHMA 2OO7A 4E5UA 3I5XA 1QVRA 2QP3A 3LAWA 4TMKA 1KDTA 1KI2A 1J99A 1M34E 3A4LA 2D06A 4JVMA 5TMPA 1DAFA 1DPFA 4IDHA 2GETA 1WB9A 2KBEA 4QGHA 5JS8A 2ZR0A 1VKJA 1OSNA 1TQDA 1XWIA 3TVTA 1E3MA 4ILEA 5EXSA 4TQAA 4QGFA 2FEMA 4C30A 2VEDA 1HQYE 1Q44A 1AIPA 1E1RA 3L0PA 2Z6VA 1MO6A 1E69A 1A2KC 3GLIA 4CEJB 2YNMA 5DLQC 4C3ZA 2VIIA 5DI9A 1U0HC 2OCPA 4JLMA 1JPJA 3KKNA 3OESA 3KFVA 5DIFA 1ZNXA 2W2TA 3DPUA 4FMBB 4NKRA 2IEYA 2Z83A 5FPSA 4M4SA 3ZZTA 3GLHA 4LBVA 3LW7A 2CJWB 3SDZA 4Q1BA 1JALA 5IT5A 3EZ7A 1BYIA 1Z5ZA 3LNCA 5M04A 1QHIA 3KQLA 4DVGA 5JCPA 3CZQA 2QAJA 1R10A 1RC8A 4OKSA 1QHYA 1U8YA 2BC9A 3Q9LA 3TIFA 1T8TA 3EZ9A 2ZJAA 4XVQA 1XTRA 4G0NA 1G8PA 4K8OA 3T5DA 3QF7A 4OI4A 2QSYA 2IHYA 4TTQA 3VMFA 1YQTA 1JJ7A 2ZPTX 2AK2A 4KV9A 1XTSA 2QUZA 3NHAA 5CJPA 3A36A 1Q21A 3BJIC 4A36A 4B44A 1ZBDA 1N6IA 5J47A 5FTMA 2GJAA 2PZFA 1W47A 1LNZA 2CDNA 5B57C 2ZRFA 4II7A 2WOJA 3RC8A 2W6JD 3B82A 3PCRB 5DGXA 1GWNA 3K8YA 2A7QA 4JYBA 2WIAA 4XJXA 5CDFE 1VCIA 2HJVA 4OQLA 1EFRA 1ZM7A 3THWA 1E79D 2BM1A 3ZVRA 1QHXA 1MRSA 2QAGC 2WVJA 1N5KA 2ZRMA 1CJVC 2FN4A 2W2VA 3TUIC 5F98A 4O3MA 1R0WA 4KLNA 3HU1A 2IK8A 1A4RA 1J8MF 5FUXA 2JA1A 5EUMA 1ZM4A 3T1OA 2RH5A 5KSPA 2VSXA 2XEXA 3KJIA 1P9RA 4IOMA 1X1SA 1FUUA 1D2NA 4P4UA 2ZXUA 1GUAA 3AF4A 1T91A 2IXEA 1CR0A 1SHZA 4GZMA 4KHZA 4OQNA 5AJYA 4TWZA 3CH5A 4DLYA 1RRPA 2EFCB 4IOKA 3FDIA 4GT1A 4BFZA 3KXKA 2J9RA 4UNQA 3A1VA 4FMDF 4NE2A 4UNNA 5BYJA 3K70C 2CCGA 4POAA 1E0SA 2XZLA 3EXAA 4ASUA 4D2IA 3O8RA 5G41A 1OIXA 1G8HA 3UMSA 1P62B 1UKZA 4JVNA 4L9WA 4UNRA 1U81A 4OK6A 1XCPA 4B6EA 2RCNA 3KKQA 4LJAA 5KTYA 4NHOA 1YZLA 2QNRA 4MYUA 3FMOB 1KHTA 4P4SA 2OCAA 5AUOB 5TVKA 3JVVA 2EFDB 2EFGA 1ZJ6A 2FPLA 2ZI9A 4LC0A 4GP7A 5FOWA 2QGNA 3LLUA 2R8RA 2ZIAA 1NBMD 2CVFA 4Q02A 2PLRA 1M7HA 5EZ6B 5BN4A 4N0DA 3V4RA 5J4VA 1JR3A 3IKJA 4MKHA 1UPTA 1XB2A 4B47A 4QKQA 3AB3A 3OE7D 2FPKA 3THOA 5FUWA 1GL6A 4YMUA 3B78A 2V4ZA 1VG8A 1E1QD 1TX4B 3R9IA 3IILA 5A5GA 3ICQB 4TLDA 2V1UA 4U02A 2EQBA 1SULA 4D4LA 1TPZA 2JJ2A 1COWA 5FL7D 4TSFA 1N0WA 3QENA 4OI2A 1WRBA 3HYTA 5DN6D 3MJHA 1SVSA 4BFSA 1E2GA 5DISB 4FI3C 4Q4HB 3I3SR 4IXNA 2BKEA 3B6EA 3GJ3A 4P31A 3DOFA 1E2EA 4B48A 1P2UA 1VPLA 2WAXA 3D8BA 1XMSA 1QG2A 1FW6A 4CGZA 1AGRA 1KSHA 3RRYA 2P2LA 1EWRA 2LCFA 2EFEB 2JASA 4V0ME 3K70D 4EPYA 1FMJA 4GOJA 3A1UA 5AUPB 3L0OA 3K9GA 2VRWA 3F8TA 3M1IA 1JBKA 1VTKA 3EZFA 3K0AB 4JMPA 1P7CA 4QC2A 4QNRA 5A0FA 2O8CA 2CJWA 4UJ5A 2H92A 2C9CA 3DHWC 4Z1MD 4O25A 4LBZA 5JSZA 1EFTA 2FH5B 1UFQA 1Q1BA 1EX6A 3TRFA 1D8TA 2QMHA 4PZZA 4ZIRA 1KJYA 3TSZA 1XEXB 4AKHA 2XXAB 1EFHA 3G82C 3MMPA 4KVAA 2D4HA 2CNWD 4CEIB 2NO7A 5AUNB 2QROA 1N2CE 4A2PA 2G0TA 2NO9A 1U8ZA 4I81A 3P26A 1DAHA 4Z1MA 1S0UA 4QXAA 4BFTA 1YR7A 4AYTA 4Q4LA 1A1VA 1XD8A 1IY2A 2AD5A 2G88A 3NVAA 3Q5DA 4XWOA 2A5GA 2YINC 4R98A 2FV8A 1T5LA 3CH4B 3C4JA 3EW9A 1PVOA 4TMVA 3QOFA 2JATA 3I92A 5LBIA 2BKUA 2XOKD 1XZQA 4TLEA 5G40A 3PEVA 3T34A 4ERNA 2DFNA 2BMFA 3T35A 3LD9A 1KI3A 3VKWA 3NC0C 4EJSB 1QG4A 2L0XA 4N3NA 3T06B 1R5NA 4LI0A 2ZJ5A 3JZMA 4JKYA 5AJZA 1CBUA 2WOOA 5JSZB 3TLXA 1G3MA 4RKEA 4B71A 2CL7X 2NIPA 3IQXA 2GXSA 3I4LA 1NMXA 4LY6A 4W5WA 4IOLA 3H1TA 3HR7A 3NKVA 4LJ8A 4MDFA 3HR8A 4RZUA 3OHMA 3X1DA 1XEXA 3A4NA 3LO5A 3B60A 2IS2A 1XPOA 2QP9X 2H1LA 1S1CA 5GJCA 2EVWX 2VSFA 2KB0A 1Q12A 3HPQA 4X8HA 3RWMB 1QHHA 3V4FA 5KUTA 1P6XA 1M74A 3K0CC 4M1YA 4PC3A 2G77B 1BKDR 3SJZA 1VMAA 3MLEA 5L3QB 4KYUA 1Z0IA 4LYHA 1VIYA 4B2PA 3X1XA 1E9EA 2PBRA 2AKAB 2HCJB 4NTZA 1W36D 1CR2A 1G4AE 1P3JA 1TAGA 1IJFA 1OHHA 2HEIA 1I2DA 2GILA 3WMEA 1NRJB 4DCTA 4JVLA 2WHXA 4WZ6A 1RVDA 1RPZA 3THXA 2SHKA 2IUTA 3PUYA 3Q8XB 1E6CA 3ZH9B 3TUZC 1KO1A 1EX7A 2AN9A 4CVNA 1OYYA 5EXXA 1UJ2A 1D9XA 4PQRA 3KDSE 3KXLA 4QL3A 2HV8A 2C2HA 4DC9A 3WMGA 3EG5A 2WWHA 3NH9A 2CNWA 4PAOA 4ZDKA 3IIMA 2QY9A 5GJVC 2ZRPA 1HA3A 1Q22A 1WMSA 1Z3IX 4ZDIA 5CB6A 2CE7A 2CLCX 3B7GA 3CWZA 3SU8A 1CR1A 1BS1A 2GK6A 4M1SA 5EZ5A 3ZJYA 3QEJA 1PLLA 3IQWA 4DLWA 5AWFC 2UZ3A 4HDOB 5AJVB 1Q20A 4R2HA 3KQKA 1SXJC 1A5TA 1VYVA 3UKDA 4P32A 3RYTC 4NH0A 3CR8A 4XVRA 2QMOA 4Q4HA 1KK0A 1ZD8A 5J5CA 2FMXA 4IFEA 4KITB 2VL7A 1S9DA 3MJRA 2WWXA 1W2GA 4JLJA 4MRVA 2VHCA 3AKDA 5EXPA 1JPNA 2CHVA 4F92B 2GF0A 4LK2A 4MKIA 5B58C 2Z0MA 3MFYA 3EZ2A 3AVTA 2CBZA 1E4VA 5G3YA 4B74A 2FGKA 3WRYC 4KXFB 5JI2E 2WKRA 2ZE5A 5JWRA 2ZRGA 1GIAA 1E4YA 2GEUA 1GG2A 1NIPA 3HU2A 4EPRA 5CDFA 3AVWA 3UG6A 4P3YA 5KHOC 1P2TA 3PUZA 4BFUA 2JLQA 1KMHA 121PA 2DFLA 1M7GA 2O0KA 3SC3A 2ZS9A 2C03A 2C96A 2YHSA 4QOSA 2XZOA 1E0JA 2UZIR 4IDPA 4F91B 1E2FA 4H1VA 4AIIA 3DMDA 1Z6YA 1O3YA 4DT1B 2YC4C 5FOSA 4EFLA 3A37A 3VR5A 1KI8A 3PEWA 2XXAA 3KQNA 4G3XA 1KO8A 4H9GA 4URWR 4NPHA 2NZJA 5L8VA 1W44A 4CF7A 1MV5A 3VX4A 4BRWA 2VHQA 4PAQA 4KBFA 1F2TA 1KI9A 5F9FA 1FQJA 4JT2A 5KDDA 1XMIA 3WNBA 1PLKA 1RKBA 1X1RA 4TQ9A 4RVCA 1GDDA 5FPYA 5K8TA 2MMCA 2O8FA 1UBCA 2PJZA 2X77A 4LYAA 2XNDA 1NVWQ 3CW2A 3IGFA 4R2IA 3WP0A 2BMDA 4W7SA 1E94E 1KAOA 1N5JA 3HYRA 5FUYA 3MD0A 1G8YA 4BUJA 2F6RA 1E1QA 1RW4A 1N6LA 4CIDA 4PZYA 4ZDJA 2V1XA 1LW7A 4OK5A 1DARA 2W2XA 1AQYA 2F1JA 2RGDA 1G6HA 1M8PA 1P60A 3CB4A 3H84A 4RD1A 1NJGA 1TQ4A 2KE5A 4DDTA 1N6PA 3K53A 3LA6A 2GXUA 2IW3A 4EQ6A 4DT1A 2ONKA 1I4TD 4AY2A 2JCSA 3REGA 2QAGB 2VTKA 2C99A 1MR3F 4XWAA 5CB8A 1SVLA 4HZUA 2P6UA 4A82A 1K8RA 1Z2CA 4RFSB 3ZQJA 2BDTA 3X1WA 1QHHB 4KODA 1OXUA 4L8GA 1ZU5A 2VP2A 5FL3A 2ZU0C 3H4MA 3VHXA 1AZTA 1KJWA 1XTQA 1Z6AA 2GJ9A 2QAGA 2YYZA 2YWGA 4WZAE 4GDFA 3IEVA 4CDGA 3P1JA 4FW9A 4PHHA 4ZPXA 2W83A 5L3VA 2IL1A 5KO2A 1KJZA 4JBYA 5TY0A 3I72A 3EPJA 1Y3AA 4N1AA 4LRWA 5HKKA 3JVUA 2G1KA 1G7CA 1WF3A 3U3OA 4V0KA 5HZHA 3WBJA 4DCUA 1KDOA 1R8QA 4US1R 3U6KA 1IAQA 4MKFA 2OXRA 2RGAA 1HUQA 4D0NA 2BBWA 2WIBA 4HUTA 1R6BX 2OAP1 1SGWA 2R6AA 1ZCBA 5JWOA 3TQFA 2FSFA 5H1YA 5IDVA 1AS3A 1KKMA 4AKIA 1TU4A 4RD6A 3IIKA 3CUEF 4MRSA 2ZI7A 3SEAA 1TUIA 4M0LA 2J59A 1H8EA 4WVFA 4A9AA 2WSSA 621PA 4JLDA 4KAXA 4CYMA 1KK2A 5KDOA 1ZRHA 2JJ1A 1GP2A 3L2OB 2QEQA 1RRFA 1KAGA 2V6IA 2WMOB 4CT5A 5TB5A 2E9SA 2ZETA 3QG1A 3W3ZB 2I1VB 1LV7A 1AQUA 4B76A 3FMIA 1YU9A 2PL3A 3WXMA 1NSFA 2HCBA 4HB4A 5EE5B 4IVPA 1G8FA 2C04A 4Q18A 4JSYA 4URUR 1EK0A 3RVBA 3R7WA 4PC6A 1HTWA 5FBLB 5EP3A 4M1TA 4CZ2A 4AWXA 2F9LA 2VPPA 1EFRD 3PUWA 2JIZA 3SI7A 1HQCA 1U8AA 5EP2A 5E3HA 4XTCS 2BHRA 1U0LA 2R6CA 3KL4A 3AF0A 3ZQ6A 4CEHA 4LYJA 4LPSA 3H0KA 3KTAA 4ZCLA 3LY5A 1IY0A 5KOYA 3RS3A 4B2LA 3T1QA 3O8CA 4P4SB 4B33A 1UM8A 3QBVA 4MGKR 4HLUC 3TE6A 4IVRA 5BN3A 1H8HA 1KSJA 3B8HA 1JQLB 4MRNA 3M0EA 4ARZB 4AYXA 1WDTA 2XX3A 2JIZD 3EPLA 1TL7C 2YWEA 3GLHB 1OYWA 1CJUC 1EWQA 3ECCA 3NEYA 2ZSFA 5LB2A 2HXSA 3RRZA 2VH5R 3N70A 4ABYA 4DXAA 2ZS8A 4OHWA 1UKVY 4B32A 4TMWA 4KLZA 4ZCMA 5LB4A 3VR1A 4NCJA 5CIQA 3BORA 2FF7A 1W4RA 1LS1A 1VECA 2QL6A 1CRQA 2ZUDA 4NYJR 2ODNA 4PSKA 4RSGA 1IBRA 4IKEA 4LJYA 2H16A 2DYKA 5GADl 3AP2A 1GRRA 2AX4A 4WXPA 2QGZA 1W36C 3SFZA 1XD2B 4DLSA 1TEXA 2FJUA 1QDEA 4M21A 1KNXA 1OPXA 1P9WA 5FBQB 5FPHA 3NDPA 1GITA 1LF5A 2IT1A 4P4TA 3OEEA 4CEHB 2P3SA 4A6XA 3FTQA 1DAKA 4Q9LA 3WNDA 3OFNA 2PEYA 1Z0JA 4JZKA 2PMKA 4RCZA 4HLDA 4DLRA 1ZM3A 5E7IA 4OI1A 4LPKA 3KB1A 1KOFA 2R2AA 2ZEJA 2VHJA 1F6BA 4PZLA 2F3RA 1N5IA 1ZU4A 2OBMA 2YWHA 3KB2A 3F5FA 2WJGA 1GKUB 4JYCA 2VP0A 4C0JA 4I1OA 2IYVA 3QUSA 1HY3A 4BLQA 2PJRA 2F7SA 5TV2A 1NN0A 3PUVA 4IDNA 2XTZA 2OM2A 3GEEA 2WWGA 4E09A 2A5JA 2XB4A 4OQXA 4EPTA 4GSYA 4MQBA 3W90A 2H17A 2O0HA 2QM8A 1W7AA 1DEKA 2DB3A 2J5XA 2PH1A 3NDBB 5FL7A 5JJIA 1AA3A 1TUEA 3K9LA 1KI1A 4XOIA 4EJSA 3P4YA 2QI9C 5EQTA 2AK3A 1MH1A 1W0KA 4HB0A 3ZZ0A 3PJRA 3MWYW 4ZV4A 1YZUA 3R9XA 3AF1A 2D62A 2KSQA 3GEIA 2JLZA 4QHYA 1CEEA 3UK6A 4XSGA 4PTLA 3QVVA 3U6BA 5KPDA 1NKSA 1MO3A 2P0EA 1Z08A 1Z0FA 3PR1A 2P67A 4Q19A 2IWRA 2ZJZA 2OLKA 4DCVA 1G7RA 3PIRA 5IK2D 3GFPA 4LBWA 3QNUA 1ZNWA 3AP3A 2ZS7A 5HPYB 2E1RA 3NEJA 3O47A 4BFYA 2R62A 4RKFA 3BIFA 3TQCA 4NCIA 1ZVQA 3SZRA 1KGDA 4DB4A 3RWOA 2NOAA 2GZHA 4PHFA 5L3QA 3OF5A 1IQPA 1JEEA 1ZUNB 5JWHA 2C9YA 1JAIA 1BYUA 2F3TA 2KJQA 1D6JA 3GFTA 5UKDA 1DAGA 3FGNA 5J40A 1UAAA 4Z51A 4NDZA 4U7DA 2OG2A 4EPVA 5DHFA 1T3LA 1EGAA 2J41A 3B1WA 2AL7A 3RHFA 2OT3B 3QF4A 3LX5A 3QQ5A 2VF8A 2W58A 3UMRA 3ZVMA 8OHMA 2BEKA 4C9BA 3BXZA 1AA9A 2H8KA 3UMFA 1PJRA 3K70B 2BCGY 2RB4A 1L8QA 5JRZA 4DDUA 3AVQA 4BGDA 2GVDC 4JL8A 3W8RA 1N6HA 3NBFA 3P32A 4RZXA 5HCIA 3ZGXA 3GLFE 1US8B 3NBZC 2Q9BA 4BEBA 1W0JA 1Z6GA 3CZPA 1Z22A 3GJ4A 4WW0A 3TR5A 5EXTA 5K8LA 2ZRAA 5DYIA 1S1MA 2BMJA 1HT2E 2D7CA 3BB3A 2C9OA 3GLIE 1OF1A 2XB2A 5DI3B 2BJVA 3RSOA 3LXXA 1VCOA 2ZU6A 2AKYA 3IDQA 4GZLA 1GKIA 4YLGA 1N0VC 3SYNA 4M1MA 2R65A 2ZJ8A 1TADA 2FSIA 1RFLA 1D2MA 4JJZA 1T9HA 1KSGA 5FH9A 2CK3D 5H68A 1DELA 5GVRA 2UKDA 4Q03A 1W5SA 3BOSA 2X19A 3K9NA 2J0VA 4TL7A 4DRZA 4AG5A 821PA 3NBYC 3MSXA 4QM7A 3TVDA 1Z0DA 2YV5A 3WBKA 1NL3A 1XDBA 1E9BA 1GKYA 1OXSC 2IYTA 2NO1A 2RGCA 4BQSA 5KSZA 1OJLA 2GCPA 4A0FA 1M1YE 3CPJB 4TMXA 2X1VA 3CLVA 5FUVA 1GRQA 3AVYA 4LDJA 3TAUA 1R0ZA 4TYPA 3NWJA 4GMDA 3GLGE 1KYIA 1DS6A 3SQWA 2O8DA 2YOHA 5JHHB 2ZVQX 1OHHD 4C0KA 1LF0A 1DAEA 3BH6A 3TGPA 3OIUA 3PFIA 1HH4A 4I1UA 5LD2B 4QRHA 1L7VC 2VA8A 2BWJA 1AZSC 2Z5FA 2WV9A 1UDXA 4HEJA 5FR2A 2ODWA 1CP2A 2A2ZA 2W6ID 3M6AA 3PEUA 4RY2A 1SXJE 2N46A 2ZVPX 3AF3A 4PO1A 1UBGA 2G6BA 3BS4A 2EU8A 1MABB 3C8UA 3RS7A 1FTSA 1XZPA 3WYGA 1GRNA 4QJ4A 2ZROA 2CEAA 3OFND 4CT4B 3QPWA 3CNOA 4BRUA 4B34A 1K5DA 2F1RA 3B13B 4L15A 1ELOA 3MAAC 1GL9B 3W6PA 3U44A 4HB3A 1AS0A 1P2SA 4BPBA 4C0LA 4ZI2A 4DLTA 4Q9HA 3OEHD 3Q7QA 1Z6TA 3C14C 4D82A 5H8WA 1XXHE 1YE8A 1OXTA 4F38A 1R4AA 1FX0B 3VTKA 5EE3A 3FHCB 1SQ5A 3BE4A 4DLVA 3A1WA 5IHPA 2C5LA 4MYHA 1G64A 2QG6A 3CX7A 1TF5A 1UBEA 3AVOA 1E2HA 3IBGA 3U61B 4LJ7A 4EFNA 3CONA 4RZ3A 3VR3A 1ETUA 1TQ6A 3AGPA 3EWSA 4QJ3A 3IHLA 4S2EA 3U7GA 1N0UA 4KCGA 2GZDA 1E79A 1FPMA 1G16A 2F43B 2B7CA 1KTVA 2R9VA 2ASEA 2O5VA 4O2RA 5FOXA 4BFVA 1T0JB 1UADA
chains in the Genus database with same CATH superfamily
2X8WA 3HLTA 3P71T 3PXCX 2HO4A 5IMSA 4CEIA 1HKHA 2FRVA 2FPRA 4WE3A 4MVJF 1E98A 2R7MA 1PNOA 3O4IA 4FNMA 1U0GA 4L9RA 3AVUA 1HE4A 2G08A 3QOXA 1GVHA 4QNMA 4URZR 4C04A 4MVXA 1CU1A 3QIAA 2XYQA 1EGHA 2MSNA 1EFKA 1TT5B 3H04A 2E4VA 4CM8A 1RPAA 4I36A 4IUYA 2YXDA 5CT6A 3TLKA 3A1SA 4HYEA 2O7SA 3N8HA 3TBHA 4IILA 1FNNA 1GN9A 2BBTA 2CMHA 2PTGA 4QGGA 3S44A 3VR5D 1SG0A 3U5ZB 3FCYA 2O8BB 1RHJA 5AIAA 3OJCA 3G1TA 4ZJYA 2QZSA 3F3YA 5E38A 1ZVJA 3D9QX 3DM5A 4E94A 2WILA 2H0QA 1WVMA 2YH2A 3PXBA 3TL2A 3A9TA 4KMOA 1A77A 3BF7A 3QSGA 1PDVA 1E9AA 4B6QA 4YQFA 1OTHA 1BIFA 4IHJB 2MSCB 3FJYA 3FLMA 5ALKA 3W2TA 1N0HA 2A5FA 3G88A 4DLPA 3DM9B 4I6JA 3MS7A 2PH5A 4EF4A 4CQNA 5CITA 1UEJA 4MJLA 2X4GA 3M1LA 3U7FB 3EODA 4OQPA 1CR4A 1YRYE 4Q12A 5CFLA 2ONZA 3VV3A 3K6RA 2XXBA 5L3ZA 1E2IA 1FX1A 2EV9A 2J0EA 3KVNA 4LX8A 4AS2A 3HEMA 4H6WA 4RGQA 1CRPA 2ZTLA 4QO7A 3L7AA 1E0AA 2JAQA 3QXSA 1RAFA 2R751 1GJRA 3D6UA 5EKTA 4AJNA 1T2AA 4BKRA 3NS7A 5KCMA 2QBYA 1SQ0A 1U1DA 1NI5A 2C3PA 1JQAA 1E2MA 3AR5A 3IB3A 4OA5A 4CUKA 2IOFK 3L79A 3ZHOA 1KEEA 1F2UA 3PFFA 4AUNA 4LSWA 4N03A 3DLBA 4W6QA 4RMIA 2P5SA 1YZHA 3A27A 4KO1S 4R7TA 2Q1UA 3H4IA 4RJJA 4R1OA 4FINA 3ITEA 3OF2A 4TOIA 1XX6A 1W4CA 3ZPXA 1ANKA 5EY5B 5TMDA 5AHKA 1FL9A 3RRXA 1X74A 3UN1A 3VISA 2FQQA 4GOMD 2POCA 1JHUA 3EVZA 1T2EA 3ZCUA 3BAFA 3MGGA 4PLGA 4EABA 3L5KA 4TLBA 4IGIA 4ZC8A 1AK1A 1VHLA 1NQUA 1IUKA 3NOVA 4P92A 1F2DA 2PS9A 2O5CA 1TPYA 5IHXA 3OFKA 2X1HA 5C8YF 1II0A 1JDJA 3FBGA 1STOA 3R5SA 1QQTA 4KN6A 4MUKA 4MPDA 1K66A 1XMPA 1H3NA 3GLRA 3TTVA 1UMBA 1OB2A 4MRPA 3P0JA 4CMCA 1V5WA 2OBBA 5MGNA 4DTCA 2JK1A 2GK7A 2ZCVA 1N32B 1QF9A 4JGIA 1UK6A 3O8DA 3UTCA 7YASA 1RP1A 5L40A 1PFKA 4JLAA 1X6VA 4P93A 3CKKA 1YMQA 2E1PA 2YJ6A 4LFBB 3QKWA 4F1KA 3GG2A 1KS2A 3WL3A 1LLDA 1Z0AA 3JQEA 3WGLA 1MX1A 3OZVA 5SZHB 1A4XA 3ZS9A 5BW8A 5FTLA 5JCZA 4A5SA 4JBXA 3U7EB 2V7VA 1RM0A 2EW1A 1UZUA 3TKLA 3F96A 1ECCA 1M2FA 1OZHA 4KI7A 4TXLA 3WFIA 4AZ3B 2EDCA 1IHUA 1P2VA 2OA0A 2ODPA 3ONVA 4Q39A 4PLWA 3NBAA 4GMHA 3RS4A 3TD2A 1NW3A 3SDSA 4HLCA 1SK9A 3K8QA 3NW9A 4MNTA 4CCYB 1YKSA 3EC1A 1SOUA 1ZNZA 4J6FA 4ZQGA 2BCJQ 4M7PA 2VXBA 4C4AA 1X3SA 5HOEA 1GA1A 2HLPA 5C81A 1MZVA 4ZT3A 3TK1A 3GLIB 3T5AA 4CEJA 2LKCA 5KNBA 1E4EA 2Z8XA 3QEBZ 3R5XA 1T0HB 2LV8A 2JGMA 3A25A 1U9IA 4WBXC 2FPSA 4WNAA 3LGAA 4ROTA 1J0DA 3KWJA 1SVUA 5DKFA 3ZBUA 1P19A 4M7OA 4TKVA 5EJ7A 1PGOA 1FNMA 5M5BA 3L7OA 3EGOA 4A8PA 1UQUA 1VLJA 1JFFA 2A5LA 2XV1A 3OIVA 2RC5A 4MWSA 1TU3A 1JSLA 1CVRA 1NU6A 3CG0A 4RIGA 2I6GA 5IJ9B 2BGGA 1ECBA 3R5KA 3U2QA 4RWEA 2JW5A 1M7BA 2C9BA 1ZH6A 3OZWA 3WB2A 5KYUA 1K4MA 4NAHA 1ZA1A 2Y2VA 3QPUA 4UJ3A 2B4YA 4DJJA 2OC9A 1EGMB 3LK6A 5DBEX 4B8WA 2R00A 1H9CA 3QI2A 5CU7A 2JBWA 3NZEA 2PRKA 1QTNA 1CUUA 3I6QA 5D3MA 2AC7A 1ZUD1 1TFUA 2P9QA 2Q0XA 3JASA 3O2NA 4YAUA 4Q47A 4WBNB 2Y0DA 1T4MA 2OHGA 5K4GA 1U4NA 2AN3A 5AKGA 3S27A 1Y7LA 2HRZA 3JVIA 2EFHB 3CF0A 3NHFA 1KQPA 3QLUC 5CYPA 1LFAA 3EEQA 4BCCA 2ZI3A 4FC6A 5JPCA 1OZ0A 3KFXA 4MRMB 5B1SA 2QE7D 4H6VA 3T7RA 1C2TA 1OV4A 4MV0A 1DIBA 4QA9A 4PYIA 4QDUA 4K9SA 1HG1A 2ZAYA 5IVPA 1S9HA 4W5JA 1NQWA 4R5HA 1OH8A 1ZK1A 2Q3HA 3F5DA 2ZREA 3WGIA 4CCSA 3UCEA 2ZAIA 4L1KA 5FLEX 1EXNA 3E5NA 2UZ1B 4XTRA 4E22A 3RKRA 1XWWA 1BHJA 2QTBA 3WISA 5JNSA 1AKYA 1BROA 2ECFA 2VCEA 1XR3A 1UDCA 2F9MA 2HU7A 3CF4G 1VA4A 5FKJA 3CUTA 2W8BB 4GPTA 1G0OA 2O9JA 3UZUA 2WT8A 3N7TA 4Y9RA 4HDKA 3N2KB 4QBGB 4X6UA 1ZWLA 2WJAA 1JWAB 3MTDA 2AXPA 1CRZA 1NF3A 3BH7A 1YRBA 3THWB 2A3NA 3SNHA 3BDIA 4GYWA 3DNMA 4YJHB 1SOWA 3FKSD 1LCIA 4HFJA 3IE0A 2WZQA 1YJ5A 2Y3IA 3LCCA 4MQFB 4EG7A 1PO7A 3C3KA 2Q99A 4EELA 5EZYB 4HDMB 4DMFA 3AHHA 3PGVA 1XZMA 4JYPA 3PYXA 4NABA 2E0IA 3R0VA 4J91A 4BLPA 3DH0A 4O6VA 2YV2A 4JBNA 3UO8B 1GTJ1 3MT8A 5KNBD 1SZPA 4I8IA 4D41A 2Q3EA 4A91A 3N9IA 4MOWA 5BVHB 3KLMX 1QXSA 2GDZA 2ORWA 3BX1A 4QVKA 3RHZA 4E5KA 5IWAB 1H3FA 2VH2A 3KKZA 1GPH1 2DY1A 3HFSA 4N5NA 4HQ0A 4G5QA 1N8KA 1QZXA 4B45A 1J0AA 4TYYA 3WLNA 4FBGA 4B6GA 4G0MA 1B0PA 2XT9A 3UW3A 4FM9A 1QIDA 3OIFA 3AERB 2CUTA 1NZJA 2HWUA 3OX3A 3OZFA 4NYJQ 4UUBA 3BB1A 4A6PA 4TS4A 4N49A 4YXWA 2L19A 4ZT6A 5B7GA 1SBZA 3DHEA 1P2DA 1PX2A 1VB3A 3OAAD 5AKHA 3TW8B 4K03A 4LOKA 1HSZA 4HTFB 5KSOA 1JQEA 4LV6A 5G4LA 3TRKA 2AR7A 3MUEA 1SUDA 2YIMA 5CEEA 4W1QA 1M2JA 1UZNA 1W96A 3RSLA 4NK5A 3NBMA 5AO9A 2DBRA 4F5EA 1Z56C 4C6SA 3DKIA 1QH8B 2LBPA 3EAFA 3EDMA 3OQVA 3UFBA 4YMLA 3H42B 1R18A 4RIHA 2CHQA 4C07A 1RRGA 2R44A 3CEPB 2JVKA 4PGFA 4EA9A 2YVLA 3HE3A 5EKXA 4X63A 3GAFA 2H06A 5IAEA 1KFCB 3FCEA 4FYPA 1V5GA 4HUJA 3ULKA 2GFIA 4G5YA 3REQB 4D9MA 4IJMA 3TQHA 2QXYA 1T5IA 1BX0A 1P3Y1 3VZDA 2J6BA 5DM60 4KK3A 1UK8A 3WYAA 5IC4A 3ISVA 1CVLA 4CKCB 2GK4A 3C70A 1G9XA 4EGFA 1L3BA 1DU4A 1NULA 2W4MA 1TTQB 1AM4D 4PIPA 4W8GA 1JA9A 4LSMA 1KJQA 2W43A 3C41J 4KNWA 1V25A 4MITA 5A05A 3WLKX 5C4MA 1V41E 2N1MA 2OR3A 4OKIA 2ONYA 3TTTA 3OD5A 2IDZA 4BWYA 1AF4A 2IGBA 1L4BA 1VXOA 2C3OA 3KELA 4DKXA 2IP4A 3ZHCA 5FBVB 4ESVA 1EVEA 1I5OA 1MT0A 4HPJB 4IZHA 5JNVA 1QOPB 2P4QA 2QXTA 3NIBA 2UVDA 1NKTA 3HCNA 4CCAA 5JH7A 1II8B 2NX2A 1CY0A 4RLHA 3SXUB 2G4CA 3AFHA 1QU2A 3RTDA 2YBDA 4HADA 5SV2A 1CHNA 4OUKX 1IUOA 1ZMOA 4WNAB 1UZMA 2GXAA 3RCBA 1F2VA 1Y6FA 2GNAA 2W2QA 1SUWA 1NLYA 4LXHA 3KR1A 1Q19A 3AOEA 2FGJA 2Z5LA 3OI7A 2BEUA 2GYWA 3HN7A 4M22A 3FTFA 4LC9A 3CN7A 3QMWA 4LDZA 1LFDB 1CUYA 3C3CA 1UC9A 2ZUEA 2HDHA 2WWFA 2WTBA 1ENZA 1KAMA 2HIGA 1H85A 4V02A 2AIRA 1JT9A 1HETA 1TMKA 1UBSB 3CF6R 1FFXB 4AYWA 4YX9A 1N9GA 2PM8A 2C2MA 2R87A 3TWOA 2VJMB 1E89A 2ZYWX 4MUAA 1NVVR 2WJYA 2JZCA 3RRJA 1DCMA 2XUJA 4GFDA 3LPDA 4AKTA 3EAQA 3EEYA 4MZDA 4RULA 3T3GA 5J2TA 3W5IA 2ODEA 1U04A 5EQDA 1HYGA 2WDPA 3R9XB 2TS1A 3K94A 1GNVA 4QG7A 4DR3B 3WP1B 3O2SB 2IPAB 3THYA 3OTOB 1G5QA 1G20A 2QRPA 2ZANA 3BHJA 5DTQA 3VR2D 4O29A 1FSSA 3M70A 3O8QA 721PA 4JT9A 2IEZA 4U3JA 2NW6A 5L51A 1QMGA 3R9WA 1I01A 3ZZNA 5LYJF 1E5VA 1FFYA 4D42A 1F1JA 5L4SA 1JWLA 1BMTA 3D31A 4ZZ2A 1ULUA 1KJNA 5JECA 4DCSA 1TLLA 4ZHQA 2FPMA 2GCNA 3A05A 4OLFA 3WGQA 3R40A 2GSDA 3G9QA 4O2LA 4X6YA 5JD5A 5H0IA 4D81A 4DDVA 3PQDA 1WE2A 2GF9A 1ETHA 3HU3A 3LPCA 3HO6A 4QULA 2GS9A 4WFIA 5C5EA 1J7JA 3JWIA 4KJXA 4W5RA 5K20A 3ZJVA 2WUWE 3PEFA 2EHDA 2OV2A 3TCNA 4OK3A 5CDYA 1W52X 2V54A 4GNKA 4HRYA 1XO1A 4MMZB 2ZYVX 3I9V1 3FGZA 1CLEA 1ZD5A 2RGYA 2YQZA 4YJHA 3VHLB 2DQKA 4GLFA 4GI3A 1WETA 1CFJA 1RABA 1V16A 4MB6A 2HUPA 4EPXA 2IS1A 3OZTA 5HTOA 1MC4A 3MCAA 4RD2A 2DVMA 1CJMA 5LIRA 3AEYA 1DWUA 1JH9A 1VPEA 4YR9A 4C4TA 3FHJA 3RWBA 4HAOA 5DM4A 4R01A 5HF9A 4OHPA 2PR7A 3SK0A 4DLLA 1JKFA 2O4UX 3F6YA 3IKMB 2BEJA 3KTDA 2XZPA 2YY6A 3TD9A 2R1VA 2VYFA 4DMKA 1LLFA 3ZY6A 1QE3A 4WOJA 4P5DA 4ROSA 3FW1A 2EX0A 2FSHA 2UUBB 3ZX5A 4CM5A 2IXFA 1ESMA 1XN1A 1J2EA 4JJAA 4JEUA 2P11A 4PZCA 4REMA 3V1TC 1OFTA 4ARAA 5AIBA 3II6X 1R4MA 3LSYA 5CURA 2IYYA 4PX2A 1E96A 1DCKA 4CM7A 2LGJA 1SEPA 2Q1YA 2DEUA 3T94A 4GEGA 4AUKA 4BX8A 3WFZA 5KHLB 3B1YA 4WZBE 1KR5A 4U2DA 1T5SA 1NSTA 3I04A 3NO4A 4BNKA 4CV3A 2WBLC 1TQHA 2BM9A 2WNHA 4Q7EA 3G2LA 1I2AA 1M83A 4FD2A 3S2FA 1QGED 1R66A 4U4AA 1F7VA 2IYEA 2PL5A 1XL0A 4L76A 2FZGA 5LA6F 2BFFB 1SZCA 3UVEA 4HKTA 3D2LA 2IU3A 5E7JA 2EWMA 1H69A 4QQRA 5IN5A 1ULBA 2GCOB 4GMFA 5ELLA 2AUNA 2I1LA 4PU0A 3SHOA 4PPFA 1IZ0A 5BPFA 5JUWA 2FZKA 5CT5A 2REOA 1U80A 2JGIA 2BP7A 4WCDA 3ND8A 3TLGB 1O6GA 2JGFA 1OKKD 4MS4A 1XVAA 4JD5A 5DXFA 3GPBA 3FETA 2PWYA 2B1GA 2FKAA 2CFOA 1J56A 2ZR9A 1S3FA 5FF9A 4AJOA 1EK2A 1NLMA 4AECA 1NM5A 2PT5A 2BMVA 2R1VB 4KXUA 3OUTA 4PR0A 1ADBA 4TVSA 1FSFA 4TWIA 3EMDA 3E35A 2IHTA 5CXXA 2BN4A 3RTBA 1GYQA 2AI1A 1FFGA 3EYWA 3IAS6 4OY3A 5SY9A 2R1UA 1A7KA 3V97A 5BVGB 2AW3A 4RY8A 1L8XA 1YRLA 1GZ3A 5EUQB 1N8TA 4MA4A 3WKBA 2QLLA 5JO9A 3RRMA 1F0YA 1Z0KA 1E18A 3LCRA 3UBMA 4EVIA 3GCZA 2XNJA 1Y6QA 1NLUA 3NKLA 3T54A 2C1XA 4WD3A 3PFNA 1YF3A 3PXGA 2WWRA 3PNBA 3OCYA 4ML3A 1VYTA 4IMIB 2A3RA 4EKDA 4EKNB 1BVRA 2IYWA 1DKNA 2GJ8A 5F3WB 2Z2IA 3EQ9A 1F17A 2CNNA 1CEYA 1NUQA 4LTDA 4ZCIA 2JAPA 3VYRB 1D2EA 4YDHB 4J4TA 5ALPA 2WYUA 5HUQA 1PQ4A 5A03A 4COOA 3SP1A 1LPAB 1UKBA 2X8JA 2C2BA 1YRQA 3JYHA 4Q1DA 1JNYA 5KYWB 2VDQB 3VC3A 4E2YA 3NOQA 1L4MA 3OOWA 5D3QA 2RE8A 2RI6A 5SYMA 4KGZA 5LQCA 1NPDA 1U5CA 3LRTA 1HZJA 1UR5A 2BOVA 2HXYA 4DMCA 1KP3A 2B6HA 2WUVA 3LQ2A 5ER9A 4X1OA 2PRIA 3N6VA 1H5QA 4ZZIA 5HQTA 5K0EA 2PGDA 5DM1A 4ARUA 2Y1DA 1X15A 4YIHA 5LPNA 1CR6A 4O4HF 3IQIX 1PFUA 5CVTA 4QD3A 1OFHA 3DAOA 1BDHA 2WU3A 1KBQA 2XKAA 3AQIA 5G1PA 2PGIA 3U80A 2RARA 4ZODA 3HBMA 3B6ZA 1ZZEA 5TXGA 1KZ1A 3PJGA 3ADBA 1TVCA 4ZAVA 4FGSA 1DHRA 3DZCA 5HGXA 5INTA 4ZYVA 4KNVA 2J7PD 3AEZA 3LKZA 4OTZA 4PAWA 1FNDA 2VP5A 1NVXQ 2OPHA 4N8SA 1VLQA 4RLFA 3VAAA 1EXMA 4IDEA 1DXOA 4TQGA 4NULA 3UJAA 3WIBA 5JZVA 5CD9A 2I91A 3KKEA 4GL4A 1I1NA 4CTNA 1EFLA 2EIHA 2QZPA 3RG8A 3WRVA 4DG9A 4KXLA 5CD1A 3C5CA 3TPFA 4REOA 5HZGA 2SNIE 2X8AA 4TTPA 4ESHA 2HLHA 2BLNA 3ZY5A 4JQOA 1WVGA 4TZTA 3U0BA 1UFVA 1BN6A 1D0IA 1VI5A 1VLLA 3E0QA 1V7PC 1P5HA 4XVHA 1FP4B 3DOCA 3PPIA 1L7QA 1V16B 3WB9A 1GNQA 4GHWA 4ALLA 4AY2A 1SD2A 4TMTA 2A9VA 4X91A 5KX5B 2WNIA 1DJOA 4NYMR 2H2AA 4IZOA 4C2UA 1XRRA 2O7QA 4KXYA 3MBIA 3DBIA 4DCGA 2JGNA 4BNJA 1W46A 1YDFA 3BGVA 3S1AA 4GYJA 2EW2A 4RA9A 3V1LA 2G28A 1XU7A 3BD9A 4RSMA 2QA5A 3NTLA 1AF7A 3RVRA 4FKBA 4KO8A 5JH7F 1JV2B 3AV3A 4BFXA 1TW3A 4N54A 2FFHA 4HAIA 5F2EA 4EI7A 3DZ8A 5CXQA 4Q4JB 2VS1A 2PSJA 2ZT8A 4K86A 4OHRA 2XNSA 5C3UA 2FDRA 2X6QA 3V34A 1I2CA 1FY2A 4MRRA 5HZMA 2ZITA 5FORA 1TUBB 3AI2A 4PGMA 4ZVQA 5H83A 3HWX1 4LHXA 1GT91 4GVXA 1GUYA 3UB3A 1QP0A 3NM5A 2XDWA 3OTGA 8ABPA 3O1LA 2IOYA 4BB5A 4BVEA 1YI8A 1XUOA 2D3WA 5CK4A 3RRNA 3TRIA 1E3JA 4TV9A 5JJIA 1H8HD 1UFRA 1XCBA 3WIOA 1RQGA 3GJ7A 1QZZA 1VBFA 3RANA 5B2ZA 1U0OC 2RHTA 1Z7GA 4NBSA 2YJ3A 4UPDA 1XDSA 4WK0B 4WXHA 3D6FA 2PMEA 3Q1KA 3CO5A 1CUDA 1XJ5A 1ZXBA 2BGIA 3P2KA 4DZZA 1RKVA 1CS4C 2ZRBA 4JENA 3RT9A 4QJ5A 4HQRA 5HK9A 2HHLA 2VTBA 1WG8A 1RC1A 1WR8A 5THXA 3SXJA 1XEWY 4GPIB 1YQWA 2O57A 2H9IA 2FFBA 2DHRA 3GMIA 3DMRA 3G59A 1GYPA 2R1ZA 1YB7A 1C7IA 3O3CA 4QUIA 3UWKA 1PR3A 3D6AA 3EQ2A 4NMMA 2NVWA 2VAPA 3L8GA 4ILKA 4G0WA 3G8CA 1RJFA 3GY0A 1R9MA 3OE1A 5CH8A 1NAHA 4X44A 3LM8A 4A16A 4A8JC 3GN2A 4I1VA 3BH0A 2PYDA 1N5LA 4LY0A 1QWSA 4LGYA 1WKVA 5T3YA 4K6HA 4W5NA 4QBHA 1E66A 2J3DA 3K5IA 5IW8A 3L02A 3RRBA 2PKRA 1MMFB 1M10A 3O9ZA 2XRFA 3CRMA 4OXRA 1UP6A 1ZD9A 1C4WA 1ZCZA 1N1DA 2FN7A 3PHCA 4DA0A 1NP3A 2GAOA 3E3LA 2X5NA 3SX4A 1EJ0A 1E61A 1XLUA 3OOSA 2H31A 5JI3E 1Q91A 1P18A 4X7MA 3REFA 4W63A 3AIMA 1HLDA 1X8XA 3FOEC 4WADA 1WBDA 4GC9A 3I1JA 4XJTA 3F5QA 3A3KA 4MP6A 3V8VA 4HV4A 2J0SA 1PRYA 3VOSA 1FQKA 3SN6A 4XDGA 5DO9A 2H48A 3EWNA 4RJTA 2NSHA 1X38A 3D6TB 1SOMA 3G8DA 2SCUA 4XR4A 3AX6A 3IRUA 4Q7LA 5KNDA 1XV5A 5DNVA 4OBEA 1NVTA 2OXIA 1F38A 3MQ4A 4Q9KA 1U3TA 1T8RA 1Y5MA 2K5UA 2N3ZA 3A1EA 3CWCA 1Y5NA 2ZSAA 4KN9S 5F73A 1A8PA 3T38A 5CIWA 5CDSA 3O83A 3FYHA 3W6NA 3NC1C 4B1FA 3O4JA 3V80A 2HYIC 1DVRA 2WM8A 3GLTA 2H4XA 1J00A 3Q7EA 2AE2A 3P5BA 1AD2A 3SZ3A 5FTNA 1RS0A 1ZRNA 2EP5A 2Z9DA 4YRJA 1OE0A 3H6KA 3H6GA 1USKA 3RI3A 1VXRA 3GRVA 2HF8A 1XPUA 4OYLA 3UUGA 3KZVA 2CJYA 3WMWA 2SKEA 1IYZA 3O38A 5TF4A 2QVXX 3FI9A 1FEZA 3GFRA 3L8DA 4L73A 1ZYUA 3WLAA 3DPIA 3PNYA 1VLZA 2O1EA 2PX4A 3AWIA 4QICA 5AT1A 1XKTA 3W8FA 1PYOA 3IA2A 4UUMA 2A9FA 4TT8A 3NGLA 4GQBA 4QPCA 1ZJJA 2BMWA 3ZG6A 4DQVA 4EKGA 3UAYA 2JLVA 4Q9IA 5JNTA 3IVAA 4TT3A 4GM0A 2ZRDA 1E2NA 2VQDA 3THSA 2BISA 5FOTA 4LZOA 1JG1A 4GECA 4TZ6A 4TLLB 3IYLW 3OPNA 2JARA 5DT9A 2G76A 4RU1A 2Z2KA 1CTQA 4LMBA 2YKOA 3F2VA 3IC5A 4RVOA 1U28C 1NW8A 1W1WA 5AOCA 2VSYA 2UXCB 2I3BA 2PBZA 4DVJA 1J1IA 2YWJA 3HZHA 3CJRA 1B26A 1K8YB 1P1RA 4IDBA 4PVDA 3SE0A 2O2DA 1NY6A 2ATXA 1X0XA 4DR6B 3HDQA 5FJIA 4F4FA 4IRUB 3M6MD 4M76B 3GJ6A 4DIOA 1UMKA 1A95A 3S8MA 3PIDA 3OZXA 3A9SA 1RLIA 2CFTA 4B35A 1VSUA 1PLJA 5L9AA 3GAAA 5DYGA 2X2FA 1P2FA 1SB8A 3KYBA 4KPYA 1U7DA 1IZ9A 4YDSA 2P9HA 1ZLXA 2IPMA 3N5CA 2AV6A 1Q14A 4DDWA 2P3QA 2A1TR 5AVYA 5C5IA 5IJ9A 3F73A 1PJ8A 5DLPA 3OQMA 2ZM5A 1SOVA 5SZJA 2G9NA 3QUCA 2XD9A 3CPSA 5TPWB 3H5OA 3ZZUA 1RQXA 2ONJA 4K87A 3FJ1A 1E6LA 1LPBB 3BM5A 1HK7A 3MG9A 4BV2A 3LFUA 1CFZA 3LW8A 1WCXA 2IEIA 1L7OA 3B12A 5EL0A 2P9GA 4ERXA 1EA5A 2RGEA 2WJVA 3IMCA 1CJCA 5LA6B 2WSBA 3JWJA 1KDZA 4LWOA 2WWYA 4YALA 1LEHA 1ZK0A 2NU6A 3B5JA 1FMFA 1NI4B 4RUKA 3ZUPA 3QKUA 2HV9A 1F8GA 2OB2A 5AKIA 3K0HA 2ZUCA 4B73A 1ZK3A 2PCJA 3VU1A 2VZEA 1S8OA 4U6NA 1JR4A 1DG3A 4YBRA 2GBLC 3TNDA 1VL8A 1ZKMA 4O4LA 3DL0A 3IIJA 3AK4A 1F20A 5LCXA 1OVGA 2VHTA 3GZNA 4D9JA 2QD2A 3UUEA 1CERA 2G25A 1A82A 3GFQA 1PNTA 1BA3A 3W9SA 4AMYA 1YAHA 1U7UA 3ANMA 4NYMQ 2IH5A 1GPWB 3R0IA 5HVNA 5I7FA 3EXHA 5JS1A 1S4QA 1Z2NX 3FZQA 3KJNA 1YKFA 3EWAA 3SD7A 3V2IA 2WSIA 2WA1A 1ESCA 2VQFB 2P30A 3MRVA 3L46A 4ZK6A 4DQLA 1G2PA 1XMQB 3CCBA 1JTFA 2IV3A 1U3WA 3SHFA 5L7YA 3GRPA 3NP9A 2WY2D 2PMDA 3IL2A 5KYXA 5BMVA 1JW9B 1ORIA 4Y2JA 4UEOA 3M33A 1THTA 5FWDA 2I66A 2P4HX 2R66A 4ZRNA 1A5AB 2JFQA 5C8ZA 1BHQ1 1PZFA 2YV3A 5CLLA 2ODBA 5JZBA 1K7SN 1V7ZA 5TGDA 4LQCA 1JEJA 2PVPA 4DEYA 3KUKA 2ZAOA 4Y2HA 1BJTA 4YRBA 3HKEB 2H1VA 3C2QA 3O8OA 4HDMA 2P6MA 2ZYGA 5MDHA 3Q85A 2XRZA 4WLFA 3DLPX 4ZTZB 4OAOA 1MOSA 1BD3A 1SFRA 1AKRA 4J94A 4DBLC 3CNBA 1Z6XA 3G9UA 1IOWA 1MORA 4RZQA 4CFSA 1KK1A 5AK5A 4FMDB 4FNGA 2WSSD 4RC9A 5JD3A 2P4EA 2ZQ5A 4UUQA 1SCBA 1J7KA 2C07A 2J48A 4KQ1A 4BBJA 3DT9A 3T5MA 2JKZA 1K3FA 3NUQA 2VDUE 5JVDA 5F9HA 2YOGA 3QHQA 4NENA 2ZSHA 2UVQA 3UH0A 1YZKA 1ML3A 3CUUA 3I62A 2DWCA 4MW4A 3OFJA 2PYZA 1E3LA 1XD9A 4Q7MB 3VGPA 3TTYA 1XL1A 1Y89A 3ELYA 3QELA 1E64A 4V0LA 1VMIA 3AW9A 3VVMA 5IZCC 3VNVA 4Q05A 1KQFA 4PNZA 1EFCA 1WPXA 2QRJA 2NN3C 2XT0A 3E9DA 3PUJA 4OHUA 4RPKA 4BTEA 4D9HA 3EFOA 3R3JA 1PR2A 2JIRA 3X0DA 4P98A 1A98A 1UKCA 2CBGA 1XHLA 2O0JA 4O5AA 1K0FA 2XKJE 4D9IA 2GUWA 3V9PA 3EHDA 4ATNA 1SK8A 4IXWA 4DHEA 3TW4A 1PWZA 2Q5CA 1ZDMA 3H5NA 1T6ZA 2PX0A 2V7QD 3SHWA 3SZGA 4IGAA 4LHVA 4LMAA 3GF4A 1BFUA 3L8HA 1CF9A 1ULTA 5JJLA 4PCVA 1SM4A 5FBHA 4N6GA 5ADUS 2OL4A 4C5AA 2GD0A 3M6XA 2XGJA 2WYWA 4IP0A 4FCCA 4HAVA 3GJ8A 3JQDA 4ND5A 3QEAZ 1NF2A 3Q72A 4A03A 2OXCA 1UWVA 2ZSJA 3K0FB 3BGOS 4E2WA 4A2QA 5J4LA 3N74A 4R2WA 3ACDA 3MD9A 1YR8A 2O3SA 1T6XA 1CT9A 1RHRA 4G8JA 3I04M 1O6FA 2B34A 5EE0A 2XOEA 1ZMXA 1KQOA 4TZ0A 2I8AA 3VAZA 3DT8A 4J03A 3NWEA 2WSMA 5DHUA 2ANBA 4JQYA 4XDYA 3HSYA 4FN4A 4KZPA 5AM0A 4ZT4A 5CFNA 5JYCA 2IKQA 2J5RA 5FTKA 4RS3A 4C06A 1CJBA 2NUPB 4L8FA 4I4LA 4KYIB 4YWJA 3P8ZA 2ZI6A 3L6UA 1FLVA 3FHOA 2J87A 4B9EA 4JI8B 4I1IA 1KBZA 5JRJA 1WZCA 1T3SA 4MYTA 4WKGA 2ZIWB 2HRBA 1R0BA 2P65A 3AVPA 2DR3A 2W4IA 4B3SB 1P7YA 1QPGA 4KAAA 4C1NA 1NM5C 2AD1A 5BSRA 1JIIA 4IOJA 4M1ZA 4ZGWA 2IS4A 3W8DA 4B3BA 3BSYA 4JOCA 3LYUA 4DG5A 3FAZA 3FOCA 1FOEB 3U4CA 3BXFA 3A04A 2AOWA 2XJ4A 1O9BA 2C2XA 1V37A 2G9QA 3G7UA 1N3LA 4V3CA 4E3WA 2NT3A 1R0XA 4D0SA 2AYYA 1KMIY 1RVV1 1J6UA 1NVMB 2QT0A 2GA9A 2IDMA 2IYNA 3VHXB 1G20E 4MQUA 3TNYA 3D5QA 4UFNA 4EW2A 1N33B 2F43A 4J0EA 4DSUA 2IF0A 2QTVB 5BQ3A 4I0WB 5E9AA 1EFDN 3VTFA 5JV5A 4NCAA 1AJEA 4KQWA 1EDZA 2XJ9A 2IW1A 2PKEA 3LX6A 3BSFA 3OEYA 5JVDF 4NCBA 4UE2A 5LM3A 3HHEA 5E9QA 2FN3A 1R8SA 1TQ2A 3NHJA 2VR1A 3WK6A 2ZRIA 2BRUA 2NNWB 3FY4A 1NJFA 2Y0CA 4EHKA 3DYBA 1T8UA 1EDDA 3NWBA 4F4UA 3IP1A 5IJZA 5ED4A 2ZXEA 1Q0QA 3HCWA 1I10A 3B48A 3I28A 3SAJA 1MW8X 1QQBA 3NYIA 4ZRMA 3MS2A 3PTAA 4CKXA 3DQPA 1SPBS 3GLQA 5LD2C 2YHAA 4FLEA 2NUPA 3HBNA 3N07A 4MUHA 5EN4A 3A10A 5FWYA 3KOZA 1RCFA 1ISHA 2O8BA 3QUTA 3RIYA 3FNBA 4HZIA 2CMFA 2I4TA 3PGLA 4RM2A 4LHYA 1U5BA 3ND9A 2NZ8A 2FUEA 1JEDA 3QK7A 4WY8A 1W4AA 3UJPA 4HLUA 4OCZA 5A3VA 4ZZ3A 2HRCA 3P2JA 4QXQA 3C7KA 4A0GA 1P77A 3S8EA 4RY0A 1P4AA 2HSZA 4W82A 1TTTA 4EDHA 3MB5A 1X7WB 2J7PA 4DLUA 2FDXA 1XMVA 1WBJB 2HBRA 4M0EA 5BT8A 3P2MA 1LX6A 1V96A 3R3VA 4PLFA 2O1XA 4CF6A 2VHVA 3LDFA 3IE1A 1VJRA 3KKMA 2IZZA 3V46A 2NVBA 1GAQA 3A32A 3BMQB 3QG5A 2W98A 3S3TA 4AJHA 2QVZX 2DT8A 1ZBQA 2QRHA 2YKQA 3U4GA 1GZ4A 2QLTA 2WIKA 2I6QA 2FWBA 2OILA 3CLUC 4EHFA 1CNFA 2GXQA 1BDMA 3DQZA 4DQKA 1BMFD 2R6R1 2HA6A 3Q7SA 3UWPA 5JW6A 4BMDA 1ULAA 4G5HA 5BNWA 3KTAB 2G0AA 1T3HA 3JYNA 4B9AA 3GRCA 4BEBA 2XCUA 5CCEA 5LQJA 3L6OO 3ZXXA 2VJCA 4JXZA 3KCNA 1PJCA 3QFHA 1O4VA 1NE2A 5A9RA 10MHA 1FSGA 5C37A 5L4NA 3K6JA 3F7TA 3OH8A 4OQDA 4Q01A 2VYCA 2FUG6 5JLJA 4EX7A 3DT6A 2OBLA 3R41A 4D9GA 1M6NA 5CVDA 4YT5A 5GP1A 2AS0A 1CB0A 2G5TA 3ZDFA 4F2HA 4ARZA 3KLNA 3FHTA 4MIYA 1OT3A 4M38A 2WWIA 3CS3A 5AM4A 4FFLA 1YAJA 3QVWA 2AC2A 1Z74A 3ZEIA 5AHOA 5BXQC 1ZM9A 2ACEA 1G291 1GDHA 5IYZF 4TMZA 1QRDA 3BCSA 4FUQA 4LV8B 4NOMA 1J2JA 4DMUB 4RHXA 2RC6A 1HTBA 1Q1GA 2BRUC 2E4WA 3NHZA 4IIUA 4XH9B 4A0HA 1SIUA 3PKZA 3CNQS 3ECAA 4LGMA 3U4MA 1NE7A 3SOPA 1K8XB 4F1JA 4JELA 3UT6A 4KREA 2FR8C 2DLCX 4TXNA 3F9RA 1DMRA 2R6DA 2ZIXA 2HFKA 1TZJA 3FYUA 3K16A 3TFOA 3H8WA 2I7DA 1U98A 4KQKA 3G9ZA 2Y1CA 3HCFA 3P4UA 5K0BA 1JG6A 3PC8A 5CA1A 5KREA 1OCEA 2IUUA 1D0SA 1H0RA 7MDHA 3GT0A 4JS0A 1JB1A 2DH6A 5DGIA 1CS0B 1EWVA 1U1IA 2QJOA 1DXHA 2RHMA 3BE8A 3RVMA 1VE3A 4DV6B 2HJ9A 2PX5A 1RNLA 1SKMA 1CUBA 1YO6A 3R3XA 3LAWA 4WESA 5K3OA 3E5RA 4TMKA 3CLKA 2ZAGA 3DZBA 2B2XA 1J99A 3MQFA 5KQMA 1EFPA 4JVMA 5TMPA 1X7XA 1CZKA 2D59A 4LJKA 1WNTA 5K3DA 3DE3X 4IDHA 2WABA 1GPYA 4FHZA 1FVOA 1VLHA 3HNOA 4I55F 4MIOA 2X0NA 3ZWBA 7MHTA 5JYDA 1OSNA 4Q0MA 5B3JA 3TVTA 1E3MA 4ILEA 4MKZA 2YMQA 1X80B 4TQAA 2P90A 1T8WA 4QGFA 3R9XA 2FEMA 4ZO7A 3ZE7A 2J07A 1PW5A 1QF7A 5ALQA 1FNBA 4O2BF 4PX3A 3WHPA 6ADHA 1MO6A 2X4IA 1PDOA 3AM3A 4CG3A 5IXJA 2E4YA 4KGXA 2R7LA 3L40A 4JEHA 5DLQC 5JCOC 3OQHA 5FA6A 4S1TA 1I7DA 1S7GA 1JHVA 2GO1A 1MC5A 3OQOA 3WI7A 1U0HC 4JVOA 2OCPA 4JLMA 2ZYAA 3K2IA 3KKNA 1U2TA 2Z2ZA 5BRNA 3HM9A 1OC2A 5DIFA 1Z18A 4IQ0A 3IP6A 4NKRA 5F4ZA 2W6CX 2Z83A 3NIGB 3F9CA 1JKJB 3EVEA 4YB8A 1DGQA 2NV6A 1Y8RB 4FOLA 4Q1BA 1DO8A 1ENPA 1WVIA 3EZ7A 1O5TA 3BRQA 1WMFA 1R37A 1AXEA 1Z6PA 2OO5A 2CV2A 3ZHZA 4DVGA 2AOUB 2PQ0A 3CZQA 4WK2B 2KW5A 1P5JA 2B36A 4K9KA 1ZW1A 4YJ3A 3MW8A 2Q45A 1V11A 4CFZA 1QHYA 5ITZB 2BC9A 4C4XA 2ZPUA 3Q9LA 2DH5A 4HRAA 1OLSA 1CY6A 1QORA 2M2IA 2ZT6A 3KEGA 4ZT7A 1T0UA 3QH4A 3RS9A 3KQQA 1EZ1A 3WK4A 3PC3A 4HVAA 4BVLA 2Q5QA 1Z5UA 3ZW8A 4AQYB </