3V8KA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
molecule keywords Biotin ligase
molecule tags Ligase/ligase inhibitor
source organism Staphylococcus aureus
total genus 93
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8kA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8kA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8kA02
3ML6A 1L3LA 5L3FA 3IKLA 1B76A 5FFXA 4YROA 3ECHA 4CS4A 5ICFA 3WTWC 1R5GA 2FBKA 2XVCA 4H2YA 2CGHA 5E3IA 1LQ1A 1I6XA 1Y96B 4MEXF 2PLYA 4Z2YA 1ZH5A 4I2OA 1USYC 1F1ZA 2C8MA 1B7YA 2XKOA 4RCCA 1MKMA 4EMHA 1FP2A 1I81A 5E20A 1P4AA 3G3ZA 4OLFA 3WGIA 3WTUC 5LJ3e 3JB9H 2WWYA 4HWSA 3F8FA 5LEKA 4OOIA 2O6GE 1TH7A 1BI0A 3EYIA 2G7UA 3JCMW 1K78A 4P3OA 1I4K1 5E18F 4M7AB 3INZA 4YRRA 3VQWA 3I0TA 1B4AA 1ODDA 3TO6A 2QZ8A 5A2QZ 5DD8A 3IHUA 3QO7A 5F64A 4C92B 1NNHA 1LNWA 5DV5A 3SXYA 5JR3A 5GAMg 2Z5UA 4YCWA 3L2ZA 3RJPA 4ASNA 2Q8KA 4G94A 4JRKA 4G84A 3L1AA 5J6XA 2LNBA 4CZZA 1R22A 2M8EA 2M45A 1BI3A 4LB6B 3V8KA 4HX8A 3IKTA 5C52B 3AAFA 2XAHA 3WODF 2Y48A 3BWGA 4YFKF 1BIAA 2CO5A 4HQMA 2Y90A 1IL2A 5GANh 4YG2F 2E41A 2VBXA 2ZNJA 2RQPA 4EX5A 1G5IA 3F8MA 2WC2A 4YRMA 1LJ9A 4LJZF 4EQQA 3JCMb 3FMQA 3F72A 4RB0A 4C8QB 1B34B 3QSUA 4NOYA 1HSJA 3J81K 4F7UF 4ESBA 4FX0A 1D3BA 2EAYA 2GA1A 5ED4A 3HSFA 3I53A 2P0LA 2EJGA 4XTUA 2M5WA 2Z99A 4P75C 4YIFA 3J7AO 1H4SA 1NJ5A 1MJ9A 4KN4X 5F5WA 1O3RA 3HUGA 3NQOA 3K9TA 5D5VB 2KKOA 3CJNA 4EGZA 4N0AA 3VQXA 2RHSB 3A32A 4I0BA 2QQBA 2VE9A 2XV4S 1GGMA 5LHHA 1S7OA 3RPQA 3ZQ7A 2E1CA 1B59A 4M77F 3E9HA 3KZYA 4OINF 4M77C 4LD5A 3NENA 2C6YA 3CTAA 4YCVA 3Q5FA 4BH9A 4CO8A 2ARTA 4LGWA 3DFGA 2EFQA 1KQ0A 3EUHA 4PDKA 1LVAA 1ZHFA 4BXUA 4KN7X 1X56A 1EH6A 3K1MA 4L9VA 1IN6A 2VODA 3R60A 4KIGA 3M8FA 1HK9A 1ZAOA 4P71A 3W3SA 2EWNA 4YYEA 3I71A 3QU6A 3SWNB 4H0EA 2PBIA 3GFJA 2IRFG 1EQRA 3P9IA 3UFGA 3WGHA 2I4MA 4NHJA 2EV5A 3CUQC 3PFIA 1I8FA 3HXZA 3PQJA 1STZA 2RM4A 3BDUA 2XGTA 3TEHB 1MD0A 4XU0A 4FHTA 2ESNA 3V7SA 4M77D 2I4OA 4M78E 2QUFA 5LJ3d 5LJ3h 4M7DG 3VQYA 3JSPA 5LJ3j 1YW7A 1KU2A 2I2LA 1U5TB 2VXZA 1G3YA 4R8HA 3ZMVA 4DPGA 2VE8A 4RCBA 3JCMe 5JFRA 4IVNA 4WI1A 1EV7A 4H02A 2KJBA 1ON1A 3HXVA 2DDZA 5FLXK 3VFZA 2IP2A 5ICCA 1LDJA 2O3FA 1Z1DA 2E64A 3HXXA 3V8JA 3BY6A 2ADUA 1FZPB 2GIVA 3LWFA 3A5YA 2PMUA 1YIOA 4HQEA 2QTXA 3LA7A 3NETA 1HW2A 3QO3A 3K1PA 3MQ0A 1AWCA 4CH6A 3RACA 2QYOA 4XLPF 3QNEA 5E8IA 2RKHA 3G73A 2HGCA 3FB9A 3WG9A 3TEGA 4RDXA 4HDVA 2LSOA 1RUNA 3F8NA 4XTZA 1D8KA 2A6EF 1HKTA 1XGSA 1JRIA 4D0PA 2ZKZA 4EVIA 4CS3A 2V1XA 1XCVA 3GXOA 3J81Z 4HZFA 3CO7C 2YSRA 1DDNA 1LEBA 2JPCA 1FY7A 1ATIA 3IC7A 1OR7A 4HLXA 2WTEA 1WKMA 4LK1F 2STTA 2DU5A 3MF1A 1FBUA 2FNAA 2Q7EA 4UVAA 1O3SA 1DP7P 4CDGA 4XBFA 5LRRA 4ETSA 1C0WA 1K7AA 5GAOl 1SMTA 1OYYA 3L9FA 3JW4A 2Q2EA 3IL2A 3WTYC 2D2WA 5GAMe 1YB3A 3WTVC 2XKPA 3RL6A 1DPRA 2YPRA 1RZ4A 3MF2A 3HFNA 4M73A 4QVCA 1L0OC 4Q47A 3ZMTA 3FXRA 1RNLA 3RYPA 1HW5A 3F6OA 4M75E 4OMZA 3KEOA 1YW9A 2DI3A 4N9IA 2CJBA 1Y96A 5GMKe 5BQTA 2A07F 2M87A 2ZO4A 3TGNA 1YFSA 5FGMA 2A5YB 3IKMB 2ZMEB 4YFXF 1ULYA 4GO1A 3C1DA 4A54A 2UXNA 3FMRA 2RV8A 4P72C 2COMA 2EFOA 3HRKA 4HWRA 2PFBA 3QUIA 2DT5A 1IRGA 1Y0UA 4A53A 4H2UA 4M7DF 1MGQA 1R58A 2AXLA 2QVOA 1ADYA 1HW1A 1MGTA 4M7DC 1X55A 1ZRDA 4ENJA 2RA2A 5DYMA 5D5WB 4M7AA 4M7AE 4EGYA 5HS7A 3T0YA 4O5VA 4EM2A 1USSA 3FMSA 2YX7A 1GVJA 1R36A 1RIQA 1KGSA 1SETA 2MC3A 1HKQA 3MEXA 1FNNA 4MHGA 4YP0A 2P5KA 3LA2A 4LMYA 5DCMA 1TNTA 1SRYA 1O3QA 4C92A 4C92E 1FBSA 3HTUA 4HBLA 2PMHA 4LG0B 4ZYGA 2DU9A 1YS7A 11ASA 2TDXA 5TJJA 1IXSB 4UPAA 3FM5A 1ZG1A 4P3NA 2CFXA 2BV6A 4KIBA 2ARUA 2V1UA 2ZT8A 1QQIA 5ILUA 2YU3A 1TTYA 3EQLF 5L3EA 1DPUA 1YFRA 3REOA 1CGPA 3KEQA 3UGQA 1XCBA 2ODRC 1HBXG 1B70B 2HKXA 2JSCA 2NYXA 4HA8A 4EM1A 4YRGA 4M78B 4M7DD 3ERRA 4LB5A 3UGTA 3P9CA 2ZZEA 4OMYA 4C8QA 1B34A 4C8QE 1U78A 3N4MA 3NEUA 1G6NA 4YRTA 3BJOA 5JI6A 2E7XA 3FWEA 1T98A 1X54A 4P74C 2J5OA 4UUVA 2HNIA 2EFNA 4L0YB 3WTTC 3ZMSA 4BHBA 1E17A 1KU3A 2I4LA 4K2EA 4YPFA 5DUKA 4EMGA 2Q0OA 1W66A 2L4AA 3KP4A 3E5UA 4WXCA 3RKWA 5I21A 3QO5A 3HRSA 4GXOA 2RHSA 3MAJA 4G8XA 4O2DA 2LF7A 1JJCB 1BJAA 3R0JA 3R61A 3L00A 3ISPA 1XB4A 4RB1A 4CHUA 1WPYA 4IHSA 4A5NA 3KP7A 3U1DA 3U2RA 2DJZA 3EFSA 3HFOA 3RYRA 1K6OA 1H9TA 3V7CA 2QBYB 3NELA 2BBYA 4XEOA 2CYYA 1L0WA 2X4HA 5LHIA 2ZCEA 3QO8A 1NJ8A 2AMCB 4XEMA 4ESJA 2MBFA 1ZG5A 2HTSA 3TO9A 1BBWA 3FM3A 4KMFA 5GAN2 3BJ6A 4L9NA 5GAMd 5GAMh 3KETA 3V8LA 5GAMj 1QZYA 4ZTUB 2VBYA 3HOTA 5LBQA 1KQ2A 3TOAA 3AHUA 5LJ5d 2IA1A 5LJ5h 2FE3A 2FMYA 3SWNA 4Q5SF 1G3WA 4O6JA 1UB9A 3EDPA 2ZT5A 2G7HA 3BOQA 2P5VA 3PCOB 1XD7A 3TKYA 3WQZA 2Z3YA 5GMKj 4I0AA 3GYHX 2JT1A 4PJOA 1T0FA 4PJOE 3A74A 4U0YA 3HXUA 4P73A 1WQ2A 3FXUA 3TEHA 2NS0A 4ENKA 4ENNA 5GAN6 3A5ZA 4M75B 4M77G 4CH3A 1U3EM 4G6QA 4PZJA 3PZCA 4LLNA 1SESA 2QLZA 1Z7UA 1U5TA 4AD9A 2P5IA 2F5DA 1X01A 1KOGA 4IHTA 4UVBA 3EETA 1TNSA 3VBBA 1UCRA 5E17F 4TV7A 3EFRA 4L87A 3ZN1A 1FPQA 4L9TA 3MFKA 4JUVA 4P71C 3D0SA 1FLIA 4P3PA 1IF1A 5J8CA 1X3UA 1Z05A 1BBYA 3OV8A 4J5YA 3VEPA 1XDSA 4MQ9F 1WRJA 4A6EA 4CH5A 2E3CA 4OIOF 1J5YA 3L2CA 3CUQB 5ELNA 5GMKl 3C3WA 1JHHA 5DEQA 2PJPA 3DXJF 2J3MA 5HLIA 2DO7A 1BM9A 5E1ZB 1IXCA 1QNTA 4BWAA 5ELOA 5DCMB 4KDPA 2IY5B 2FBIA 4MMLA 2E7WA 1NYQA 3O2PE 1YO5C 4HF1A 2DU7A 5TRDA 2HTJA 2O03A 2ZNIA 1CF7B 3GZ6A 2P5LC 2L01A 3BJUA 2G9WA 5CAIA 3KE2A 3KP3A 3HY1A 3LAJA 1E22A 4HWOA 3KFUA 3L09A 5F6FA 2L3DA 2LF8A 5K1YA 3BP8A 4C92G 3SFZA 4WJ3M 4KIFA 3DP7A 4YRSA 2W84A 3QTCA 4JK1X 1R5HA 1D3YA 1XSVA 3MWMA 3IRRA 2DK5A 4LLGF 1RI7A 1PUEE 1PDNC 1QGPA 1ZREA 1BC7C 1R00A 2EFPA 4DQ2A 2XAQA 2GWRA 1H0MA 1M5Q1 2EB7A 2Z9OA 3LQRA 3KLNA 1X2HA 3P8TA 3FHZA 4HWPA 1TQMA 3QPTA 3RDIA 2GA2A 2P7VB 4AIKA 1GXQA 5CVRA 2HOEA 4C8QG 2ZIMA 5LHGA 2J5PA 2EJFA 2FF4A 2H6BA 4HW0A 5GANf 4Y91A 4H2TA 2CQKA 1XGNA 3IKVA 2ZMEA 4TQFA 4HDUA 2VXEA 1IAWA 2I4NA 2O0YA 2V9VA 1R1TA 1SMYF 5GAN5 5FFZA 2VXFA 3GLXA 2H09A 5ICEA 4OU0A 2ZT6A 4A6DA 2VT3A 2D1HA 1T6SA 3ZN0A 2RC4A 2OU2A 4EMSA 1BIBA 2ARSA 1LB2A 5ICGA 2RB6A 4RGSA 4HT9A 4Q4ZF 4Q48A 2MLKA 4BAYA 3RKXA 4ESFA 4JBAA 4EMKB 2DTIA 4RQEA 1QE0A 2PQ8A 3FIFA 4YRQA 2Q7HA 2ZNYA 4I7HA 4LG0A 1XSDA 4MEYF 3VU3C 3M9AA 2DZCA 4U0VA 1HQCA 2P8TA 3BROA 3KFWX 1J5WA 4KR3A 2CIMA 3TQNA 1NHAA 4MNUA 5BMZA 1JXSA 5GANg 1KQ1A 4PJOB 5BS6A 3HFZB 3GEZA 1HXDA 4GCVA 2ZXFA 1TLHB 1B70A 4OIPF 2BEOA 4IXAA 1NYRA 3F3XA 1YCYA 4M78A 5L3DA 3WTZA 4AH6A 3TDUC 2ACJA 4R79A 3BDDA 3K1NA 4WWCA 4C92F 3T5XA 2O8XA 2DQRA 1PYSB 2HQNA 4GYGA 3FX3A 4C92C 5C53B 2QHSA 5KVRA 1SFXA 4KR2A 5HS9A 2IW5A 3SB2A 2LKPA 3FJPA 1ASYA 1RUOA 5IT9K 2ISYA 4UP7A 1LDKB 2C7IA 1YQAA 2R7FA 3JTHA 4ZIBA 1I5ZA 2BE5F 2QHUA 5HLHA 1JJCA 1LJOA 1B6AA 4ON0A 5L3CA 4IRGA 3H3UA 2E65A 5E8GA 2HFHA 2K4JA 1YYVA 4KMUX 3SQNA 2ZGWA 5LJ3f 3MZYA 3WU1B 2QBYA 4C8QF 5H20A 1WWXA 4M7AD 4C8QC 2AMCA 2M30A 2UZKA 1S7AA 1FOKA 5ILSA 3RTRA 3I59B 4N9HA 2KIMA 2LDUA 4PCQA 5KK1A 12ASA 4C92D 5D4RA 4BW9A 3QP5A 4F7UE 1IN4A 3RUXA 3KP2A 4X9CA 4NQWA 5LRSA 1R1UA 4YRIA 4EJTA 4RAYA 2FSWA 4P55A 2OBPA 1W4MA 2P6SA 1U8RA 2BYVE 4IJAA 3I58A 4MTDA 3I5UA 1F4KA 2YR2A 3F23A 3LAPA 3E5XA 4QLCU 3M4PA 3PCOA 3JTGA 2A3SA 2DVEA 1BI2A 4V2SA 3I4PA 5GAOp 3IALA 4G7ZF 1H641 1AOYA 1O7FA 1HSTA 4M75A 3IG2A 4IRHA 4C8QD 4PHCA 5H6RA 1WYDA 2XROA 3HYIA 1IN7A 1J2XA 1B9MA 2ZZFA 2Q7GA 4P96A 2P4WA 4F7ZA 4QVDA 4S05A 1WNLA 2Y75A 3RKYA 3BY7A 1LEAA 2DQLA 1ZLKA 3P9KA 2VC1A 5IT3A 3SWNC 5HVQC 3QPHA 3HXYA 3M4GA 1TQIA 1UHMA 1YS6A 3O3KA 3B02A 3CUQA 2K02A 3IWZA 1M8VA 5ERIA 4P73C 4Q6GA 1UFMA 3H3ZA 2E1HA 1J59A 3JCMJ 4CICA 1QBJA 3R6SA 2QHVA 1Z6TA 2IY5A 2QHTA 3NRVA 4KNYA 1CF7A 1EVKA 2ZBKA 1Z7NA 1U6GA 1U5TC 3DF8A 3QOPA 2JPBA 4P5OA 2DXUA 2ALYB 3BJAA 1FSEA 2MH9A 1PP8F 1J9IA 2ISZA 2PI0A 1KMNA 2Z33A 1H9GA 5C51B 2DLLA 3VOEA 1YTYA 5FLXZ 1G51A 3GWZA 3JCMh 4CYDA 3JCMd 3GX4X 2OAZA 3TDZC 5CVVA 3HTSB 2GXGA 2R3SA 2CG4A 2HYGD 2JTVA 3BPVA 2EA2A 2FMLA 1JE8A 3JCMP 1FWZA 4J6XA 3I7FA 2L54A 4ZYDA 4TQDA 3DEUA 1OKRA 1MJBA 1XMAA 3W6KB 4PJOD 2Y0MA 3HRIA 2FQ3A 2XUBA 4FX4A 3H92A 1ASZA 4ZYEA 1MDMB 5GAOn 1NJ2A 4GGGA 1W5TA 4TVAB 2AKWA 2OA4A 4M78G 1GHCA 4HVCA 3J80K 3BW1A 1ZARA 3EYYA 2MLGA 4DNCA 1ZRCA 2NRAC 3Q9VA 4J15A 2XGXA 5GANe 3FXQA 4RQFA 5BPDA 1EH8A 3T8TA 2DTRA 1ZYRF 1R1VA 1IW7F 1V3FA 2OQGA 4G6DA 4NL3A 4MQVA 4RMFA 5K5OA 2E5AA 1Z9CA 4A0XA 1KYZA 4NCXA 2XIGA 2E1NA 2Q5IA 3QAHA 1W7PA 2VC0A 1O3TA 4RGUA 2ZR2A 2CJ9A 2IA2A 3TO7A 3BPXA 4FT8A 4ZZLA 2J3LA 5GAOm 5HS8A 4X9DA 2HQRA 4EJVA 5AIPA 2L4MA 2V1DA 4BYYA 1KU9A 2XASA 5HDGA 5D5XB 3JB9F 1H4QA 1ZGAA 4XTVA 4B8XA 5GMKi 4YRFA 4YFNF 2RHQB 2STWA 5GAOq 2P7CB 4EMKA 4WJ4A 3ZMZA 4F7UB 1YFTA 3CDHA 4M9SA 3DSQA 3K2ZA 3HSEA 2FEZA 4S04A 3RIRA 5L3GA 1HTTA 1ADJA 2H94A 3ABUA 4A12A 3LC0A 3HY0A 4N0AC 2XHKA 3WTXC 4MGRA 3L4GB 1OYIA 5DCFA 2A6HF 4A0ZA 1A04A 5GMKh 4AIJA 3HHGA 4TVYA 3ULQB 4P72A 1OPCA 3A7RA 3HFZA 3I64A 2HDCA 2FB7A 3WGGA 2RGVA 3KLOA 2RVCA 4WX9A 4M6XA 4MTEA 2DQ3A 4M77B 3HSRA 4KFCA 4M7DE 1D5VA 3MEYA 1REPC 2VOPA 2B0LA 2JRTA 2EV6A 1IN5A 5GAMf 3D5LA 5F1RA 3JB9D 4U88A 4I09A 3E6CC 1PYSA 3JCMc 3IRQA 1TQPA 4M75G 5LJ5f 2R7DA 4JLIA 2DTHA 3HXWA 2ZFWA 2NAZA 1QPMA 4HYEA 4RB3C 2H27A 1XMKA 2DAOA 1FT9A 4M9XA 4RB2C 5D8LB 4I01A 1W5SA 2FNPA 1ZN2A 3GFMA 5BPIA 3ROUA 4M78F 1WU7A 3V4GA 3G1ZA 1FYLA 3E6DA 2ELHA 4M78C 1G3SA 4LFUA 1J75A 1F5TA 4MMKA 4M71A 1FYFA 3JB9I 1OMIA 4M7AG 1EFWA 2DEQA 2OD5A 4I02A 1FSHA 5JHUA 1WI9A 3I59A 4UP8A 5L3BA 4HX7A 2K4BA 4P74A 1KYWA 2CJAA 4ZZDA 2RN7A 4BQAA 2KRFA 3F8BA 2KIUA 3E5QA 3J80Z 2FBHA 3CUOA 2A68F 4XSXF 5LJ5g 3BFMA 2GQQA 1N9SA 2D45A 3L7WA 1B1BA 4WCGA 1IN8A 5E1XA 4O3MA 4OIQF 1KQ8A 4EM0B 1EOVA 4H2WA 2YLBA 2F5CA 5K5QA 2ZT7A 1S29A 5GANd 4L18B 2MH2A 1G5HA 1GXPA 4KYWA 3P8YA 5GANj 4CXFA 1VQZA 4KICA 4XTXA 2HEOA 3IWFA 1YGBA 2DW4A 3E97A 4M78D 4XQ3A 4M74A 2AKWB 1I5LA 2PG4A 4K87A 2FA5A 4KT5C 1X2GA 3R0AA 1EIYB 2RDPA 4P9UA 1WQ7A 1NJ1A 3LSTA 3KCCA 5GAN4 4OP0A 4HOBA 1Z7MA 2ZXJA 4H2XB 2K57A 1I1SA 2PMFA 5LGTA 1LDDA 2E10A 3WE2A 3LQQA 1HC7A 1N9WA 1E1OA 4HWTA 3VODA 3A31A 4WF2A 1QF6A 2XAJA 1W7PB 5FD5A 3LFKA 2QM3A 3M7GA 4OIRF 2RNJA 5D5UB 2YX4A 2FU4A 4IRIA 5GAN3 4XSZF 3WE3A 1BN5A 4HF0A 3F21A 1HKSA 4YRCA 4UV9A 3M8EA 2BGCA 4E70A 4M75F 2K27A 3B73A 4HV5A 3T8RA 1N9RA 1ZRFA 4NB5A 1B9NA 3CMQA 5K1PA 3ECOA 4XU2A 1XDUA 4M75C 1R23A 2EFWA 5AIQA 3RF1A 4EV0A 4M9ZA 3N97A 1FC3A 5LGUA 1DUXC 2ALYA 5D4SA 4AIHA 4G7HF 1E2XA 2GZWA 1S6LA 1SD7A 2ZIOA 1TBXA 1XN7A 3SZTA 4K86A 1USYA 3A7AA 2XAFA 3RGLA 3ABTA 1QO0D 4ENMA 4KQEA 5K5RA 5D6EA 2DKGA 2YLCA 1IZ1A 4BHPA 4H2VA 2D1VA 4Y13A 3GFIA 1KMMA 2ZCWA 3F8CA 3V7RA 2DK8A 4M7AF 3OD1A 1MJAA 4CGZA 1BI1A 2RD1A 4AWXB 1V4RA 3ICAA 4YRJA 4ZYHA 3DV8A 3GUDA 2DPDA 4PNOA 3QP6A 2EJ9A 4M7DB 4M7AC 4LLLA 3DPTA 3PGGA 5GMKm 2UXXA 1I1GA 4PJOG 3LSQA 2YHTA 4J6YA 2IT0A 3HSBA 2HR3A 5GAN7 1MDMA 1JBMA 5D8KB 4M75D 4TVAA 4J6WA 4E51A 1BC8C 5HGQA 5CLSA 4A5MA 3I54A 3DKWA 4AVPA 3SZPA 2ZJ2A 2DTOA 3RI4A 1TW3A 2GXBA 2IJLA 1KQ9A 1KU7A 1B7YB 4G85A 4B09A 5FB2A 4EO4A 4RAZA 3E6BA 3KP5A 5CYVA 3HRTA 2Q5HA 1PP7U 1ZGJA 3KP6A 5HDNA 5HOOA 2FRHA 4IF4A 4L9JA 2G4CA 4UP9A 5CVJA 2W24A 4HF2A 2VONA 5LLQA 3REXA 2P6TA 1BBUA 1K78B 3GFLA 4N0BA 3QHSA 5D6FA 3C7JA 4HV6A 1VTNC 2DPUA 3GO5A 4L0ZB 2FOKA 3WTSC 5GAOr 1MZBA 1K79A 1U1TA 2EL9A 4UV8A 4CS2A 4LNSA 5FD6A 2OZ6A 3VQVA 1SD5A 2K86A 4HLYA 2ZTGA 2RHQA 3DQVC 1KA8A 2NNYA 4F7UA 1LOJA 2KIFA 4ZH4F 2EV0A 4P75A 3GVAA 1FYKA 4YREA 2IPQX 4XTYA 1Q1HA 3Q9SA 1U1SA 3JSOA 3LSSA 2VBZA 3P7NA 3PQKA 4L5JA 1R7JA 5J8FA 2V79A 4RGXA 3L4GA 3MZHA 2VOOA 5LGNA 3QU3A 2HKOA 3HTZA 4CH4A 4GYIA 4UHTA 3ZPLA 1SAXA 3R07A 2ETHA 3GF2A 3ZMDA 3MCZA 2ZZGA 2DZ9A 4YRKA 5DDGA 4KA4A 3E9IA 2PEXA 3TOBA 4EJOA 2EK5A 1ONVA 3C18A 3REUA 3ZMUA 5AONA 1BOAA 2V6CA 4Y15A 3OOPA 5JVTA 4P9FA 4M77A 4M77E 1RIOH 5LJ3g 4A0YA 3COAC 3SHFA 2VBWA 4U7DA 2CWEA 2VN2A 2UWMA 1E1TA 1IXRC 1YLFA 4I98B 1P6RA 1D3BB 4Q15A 2IA0A 1T2KA 2F5FA 4EMKC 4YCUA 2FYKA 5LJ5e 5EEHA 3JCMQ 3JB9G 3ELKA 2OQRA 2FXAA 4RS8A 1E24A 4UNOA 5CJ9A 1ZLJA 4NL2A 3BZ6A 3JAMK 5E1WA 4G9YA 2F2EA 1J7KA 3P8VA 1QZZA 4YIIA 4YRPA 3KZZA 3ERED 4PJOF 2ZNZA 3A7UA 4PJOC 4YDQA 5K1XA 3HFVA 1W7PD 3HRUA 4K88A 1T38A 1H4TA 5EEGA 3VB2A 1FP1D 2NNNA 2PN6A 1B8AA 4HX4A 1EH7A 2A61A 4XU3A 1FX7A 1LNXA 3FF5A 2MD5A 1I27A 1S3JA 3RERA 5BOXA 2VT2A 3FZVA 4RGRA 5DY9A 1YG2A 3CO6C 1XGMA 2A69F 2JZYA 1XGOA 4JQFA 4TWAA 2CW0F 3R4KA 4WK8F 6PAXA 1O7LA 2ZINA 3M4QA 1P92A 4UVCA 5HDKA 2M1BA 4PGHA 1WQWA 4YRLA 4HAMA 1EVLA 1ON2A 1SFEA 2WV0A 3ZP5A 1P4XA 3DPLC 3HRMA 2W85A 2CSOA 2W57A 3E6MA 3F22A 5LEJA 3T1BA 4A2UA 3CLOA 2XRNA 1SD4A 1Z6RA 4R1HA 5IT9Z 4HT8A 1H4VB 2DXTA 4H2SA 3WU0A 1NJ6A 2X0LA 5CVUA 4EJWA 2DBBA 5A2QK 1G4DA 4TTVA 2XTIA 3UH0A 5CVIA 1U2WA 3RPUA 4XU1A 4BNCA 3TUPA 5ILVA 1G3TA 1JGSA 3HIFA 3S2WA 2DFIA 1S8NA 2H6CA 4LK0F 1IRFA 1EIYA 5FO5A 3JCMX 4XTWA 3W6JB 2GAUA 1ZG3A 1XSXA 2HS5A 4U0WA 5DUIA 3O6BB 2ESHA 4XRFA 3JCMf 4TVWA 1TW2A 4H2XA 4YRNA 1C0AA 2CGPA 4Y17A 3GZ5A 3K0LA 3F6VA 1UHWA 1USTA 1OYWA 2O61A 3RESA 4UXNA 2ZR3A 2HYFA 3M1EA 2QENA 4JRIA 2XAGA 2EJRA 4KUMA 2W25A 4PG3A 4WXHA 2DQ0A 2QQ9A 3HOSA 4L5IA 4G7OF 3GW2A 2OZUA 5KNNA 2ODRD 5HLGA 1WSUA 1IUYA 4IPAA 4M6YA 1P4WA 5H6QA 2QQAA 3LA3A 2L02A 2PMEA 1Z91A 3GIBA 3QRFF 2EA4A 1WLEA 4BHCA 2HZTA 4XLNF 1T39A 1J0RA 2QWWA 2AS5F 1LYLA 4U7BA 2HWVA 3K69A 1F9NA 1YW8A 4PGGA 5DD4A 2JN0A 4F7UG 1FBQA 4X5OA 4EJUA 3JCMg 1YFHA 4WXDA 3U9GA 1SERA 1JHFA 3JB9J 3HHHA 4ZTZB 3E3VA 1FYMA 3JAMZ 2MA3A 5LJ5j 1O57A 1D8JA 3JCMV 4M72A 2K7LA 2F5EA 1SFUA 4M7DA 1P2FA 1SD6A 5GAN8 4QWQA 2IVMA 2KJCA 2VC8A 3NEMA
chains in the Genus database with same CATH superfamily
5L3FA 1NK2P 4IEJA 2CUEA 4XRSA 4KH1B 3ECHA 4CS4A 1WJCA 3OR1C 1Y96B 3EGDA 4MEXF 3GTJJ 2HD0A 1USYC 1R0CB 1B7YA 2KQWA 1FP2A 3CMMA 1JJ2A 5E20A 2GQIA 4OLFA 1FMKA 5LJ3e 2E5KA 2JJ9A 3F8FA 1VQ9A 2BY0A 3EYIA 1XQHA 2G7UA 4GLKA 2XD0A 3INZA 4XLAA 2WSEE 4DEXA 5F64A 4HKEA 1NNHA 3SXYA 1UMQA 5JR3A 2BKDN 2ROTA 5GAMg 2CW8A 1F43A 3BQYA 4XL9A 1RABB 2Y30A 1VZ0A 4CZZA 1R22A 2YSQA 3AAFA 3GTQJ 2VVKA 4YFKF 4RMOA 1GL5A 1BIAA 3MKDA 2JMWA 4PJLA 4YG2F 1Q7YC 1UGSB 2PUOB 1G2BA 1M4ZA 1ZR2A 1Q81R 2QQ8A 4DW6A 2DAQA 1LJ9A 3BTLA 4N4GA 4EDUA 3QSUA 5HK0A 2O01E 3OYBA 2ECZA 1WI7A 1T3SA 2EW3A 4ESBA 1TWAJ 2KP6A 3HSFA 1GUUA 3RCOA 3FKIJ 4P75C 2JNGA 1NJ5A 1MJ9A 1GDTA 4PSXA 2L89A 1EF4A 1DGRM 1WJSA 3NTHA 3K9TA 1JUMA 2D8HA 5D5VB 2KKOA 4EGZA 2CW7A 1KD1U 1SKUB 2ZPGB 4IKFA 1GGMA 2WSCE 2GXAA 5FU6B 4JPBW 2OI3A 1B59A 5IHNA 3KZYA 3M57A 4M77C 3NENA 1PRLC 3CTAA 8ATCB 1UE9A 4BH9A 2ARTA 1QVGP 1KONA 3LGFA 1YI2Q 3EUHA 4LVLA 1ZHFA 1RLQC 1R8OB 4KN7X 1ZA1B 4FSXA 1YBYA 5KCHA 4KIGA 2A37A 3LYIA 3BR6A 4LOCA 3GFJA 1EQRA 3WGHA 5IN1A 4BGDA 2RJCA 4LIUA 2L0KA 2WSFE 2WV1A 3PQJA 1STZA 3BDUA 2CP0A 1WJQA 3MJXA 3DEWA 2XGTA 1WGSA 4XU0A 4FHTA 2ESNA 4M77D 3BZCA 4LNPA 1I5OB 3ERMA 5LJ3d 5LJ3h 4M7DG 3VQYA 3ZQIA 5EEAA 1U5TB 1G3YA 3ZMVA 2DXCA 4WI1A 5EDNA 4P1WA 1VQPQ 5FLXK 1VQ7T 2DT7B 1QQJA 2QTVA 3NETA 3QO3A 3CDIA 3K1PA 3RACA 3QNEA 1YJWQ 1VQ8I 3FB9A 3TEGA 1RAAB 1IV8A 4MO7A 2VWFA 2LSOA 2PZ1A 4ELZC 1Z9ZA 3CZ6A 3VV0A 1KD1C 5HY6A 4B1RA 4D0PA 4C0DB 2V1XA 1XCVA 3J81Z 3CO7C 3EGXB 1FY7A 3IC7A 2WTEA 2O2OA 4I6ZA 5IP6A 2K2VA 2FNAA 2Q7EA 4UVAA 3HKZA 4XBFA 4ETSA 1C0WA 4PFZA 4C0GA 5GAOl 1FEXA 1SMTA 3WTYC 2QA4A 3NWTA 5GAMe 2XKPA 3X20B 3MF2A 4M73A 3ZMTA 4C3IJ 1HW5A 2BHZA 3TEDA 2IIMA 3KEOA 1YW9A 2IS6A 1PNJA 4B9WA 2A28A 1RPWA 2R5YA 3RNJA 2CDTA 3QDRB 1YI2A 4RKUE 3SFMA 4GO1A 2NS8A 4N4IA 2UXNA 2RV8A 2COMA 3HRKA 1TT0A 2BZYA 2DT5A 3SDBA 4B6MA 2AXLA 2QVOA 1NH3A 4M7DC 1ZRDA 3DBLB 2RA2A 3I5RA 5DYMA 4EGYA 5HS7A 1WJRA 4M3EA 3S3OA 1USSA 3HPWA 2YX7A 1R36A 1RIQA 3MEXA 1FNNA 4MHGA 2HYJA 2O9VA 3DWLE 4C92A 3CMYA 1FBSA 1FYNA 5TGTA 2PMHA 5CKBA 2GQVA 1IXSB 1ZG1A 3TREA 2ARUA 2J6OA 1VQPA 2JOYA 2CP7A 2R57A 3VPRA 1XCBA 1MW7A 1B70B 2HKXA 2JSCA 2NYXA 4YRGA 2JM8A 4M7DD 5KYUA 3UGTA 1JEGA 2KAFA 1B34A 4C8QE 3K4JA 4L5EA 1FMWA 1YJWA 1T98A 2ROLA 3D5RC 4DOWA 4II1A 5M5XJ 2DJQA 1KK7A 3RKWA 4G8XA 4MIMA 1BJAA 2FL7A 2GTOA 2QBYB 3SDZA 3CCVQ 1PYVA 5KYWB 1L0WA 2DMOA 3TO9A 1WJ5A 4KMFA 1TSFA 1VQMA 4BEHB 4ESRA 5GAMd 3H9JA 5GAMh 3DLLF 4RTUA 3CCQT 4ZTUB 3TOAA 1IXDA 3EG3A 4O6JA 2KEAA 2P5VA 3H9GA 2DT6A 3WQZA 2Z3YA 3CPWP 5GMKj 3GYHX 3A74A 3NHNA 4P73A 3FXUA 3TEHA 3A5ZA 3L42A 5C3EJ 2IG0A 1U3EM 2XPWA 4G6QA 3PZCA 2L0AA 2QLZA 1PUFB 4AD9A 2P5IA 1KOGA 4TV7A 1S5LC 1FPQA 5A0LA 4MZMA 1UAAA 1FLIA 4IHVA 4P3PA 1XDSA 3BR0A 2LY2A 4A6EA 4GBQA 5AYFA 1AA7A 3G6EQ 2X6YA 3L2CA 3L2UA 5ELNA 3C3WA 5DEQA 5HLIA 1BM9A 3QYFA 1MSFC 2KDZA 4KDPA 1YHQQ 1NYQA 1OQYA 1YO5C 1UUEA 2O03A 1CF7B 3GZ6A 2G9WA 5CAIA 2A36A 3EUAA 4OMNA 2QGUA 2L3DA 2LF8A 4JP0A 1AKHA 2FZCB 3SFZA 3CC2Q 4WJ3M 2F4IA 4KBMB 1UGRB 3QTCA 2JT4A 2KY9A 1D3YA 4X1VA 1K4SA 1FOYA 4LLGF 3GNFB 6AT1B 2J06A 1QGPA 4OB3B 2WY7Q 3QIIA 3NPFA 2XAQA 2GWRA 2E34A 2EB7A 2WAEA 1KHIA 3BQZA 1VOMA 2LLKA 4QT7A 2P7VB 3CCVA 2HOEA 4C8QG 1QA6A 2J5PA 2X48A 2K9MA 5GANf 4Y91A 2CQKA 4DBFA 1RADB 2V1NA 3CESA 1YITQ 4QQDA 2VXEA 1IAWA 1OR7C 2I4NA 3BG6A 4FYVB 3H35A 1K0XA 2XIDA 1ZUUA 3G71A 4RM2A 4OU0A 4A6DA 1SG5A 3ZQQA 1T6SA 2R58A 2VKHA 3S1RJ 1Y56A 5FU7B 3K4LA 2DD4A 4EMSA 2MC4A 1BIBA 5ICGA 2RB6A 2DFHA 2DTIA 4RQEA 1OPKA 4YRQA 3H0GJ 4XICA 2ZNYA 3VU3C 3M9AA 4E7HA 1JKPC 5JHFA 1K9MR 5H2FC 5BMZA 1KQ1A 3HFZB 1ZR4A 1TLHB 4IXAA 3M0SA 3WTZA 3PFSA 2IS2A 3PNTA 3G6EA 2ACJA 2PTKA 2MIOA 3DPUA 3T5XA 2DQRA 4JS4A 1PYSB 2HQNA 1YHQA 4KR2A 4FYXB 3SB2A 2LKPA 3FJPA 5F27A 2ZC2A 1K6YA 2ZB9A 2MI6A 4Y3OA 2E36A 1MIJA 2X4XA 4C2UA 5HLHA 3OYMA 1JJCA 1LJOA 1V29B 4D7MA 3CC2A 3OSVA 2E65A 1YYVA 4MZPA 1TWFJ 2KRMA 1W0UA 2NOJB 4C8QC 1Z0XA 2AMCA 1N25A 1VQLQ 1WVRA 2KIMA 2M1HA 4PCQA 5I11A 2MFZA 12ASA 5CKEA 2DN0A 3QP5A 2HCKA 1Z67A 1IN4A 3KP2A 2CV2A 4NQWA 1R1UA 1ABOA 1VQ6Q 5GPAA 4EJTA 3HOYJ 2F4MB 4P55A 1U8RA 4IJAA 4MTDA 1F4KA 3U1KA 3FJ5A 4QLCU 2QKLB 3GPLA 3M4PA 3JTGA 2AQEA 4PSWA 4V2SA 1IRZA 4DOVA 3CMET 2F5VA 1H641 1AOYA 1W1FA 4BI8B 2OX7A 4M75A 3IG2A 4C8QD 3K10A 3LWIA 1WYDA 2L7MP 2X51A 1B9MA 2Q7GA 3CC7Q 2HKQB 2EVRA 1K1ZA 2Y75A 1NPPA 3B6AA 3MEAA 4PUSA 3P9KA 2VC1A 5IT3A 2LRDA 5HVQC 3CCRT 3QPHA 3M4GA 2DBKA 1VQ5A 1TS9A 4FT4A 5C4XJ 3JR9A 3CDLA 2EILH 4BUPA 3I35A 5ERIA 1H8KA 4KT0E 1GBQA 1QBJA 3R6SA 2QHVA 1AT1B 1OU8A 2IY5A 4AFSC 4KNYA 2J7IA 1EVKA 2KMTA 2JPBA 2RQQA 1I07A 3M5AA 1J9IA 1W0TA 3MZ8A 2E70A 3CCMI 4QW2A 3VOEA 5E79C 5FLXZ 4AYBA 2OAZA 4NNJA 5CVVA 2BOLA 2CG4A 2Y0SN 5GP9A 4J6XA 2L54A 4ZGDB 2E71A 2NVTJ 2XUBA 3KYCB 1NJ2A 1W5TA 2GFUA 1QU3A 4M78G 1GHCA 1I50J 2LY9A 4HVCA 3BW1A 2CKKA 3EYYA 2MF2A 4J15A 2XGXA 4RQFA 5EG0A 1QZEA 1VQLA 3QQAA 4A3EJ 3RMQA 5C6SA 3BCBA 2OQGA 4RMFA 4A0XA 1KYZA 4NCXA 2XIGA 4FU6A 2Q5IA 1VQ6A 1MBKA 4LD6A 2V9PA 3PMIA 1JJ2P 4RGUA 2EGCA 2CJ9A 4BY6B 4ZZLA 2HZDA 4EJVA 5AIPA 5M3FJ 2L4MA 4BYYA 3R6NA 2XASA 4E7LA 3OBYA 5D5XB 1ZTRA 1H4QA 1WHMA 3ZMZA 3C2GA 3DSQA 2OV7A 3K2ZA 3HSEA 2FEZA 4FE4A 3RIRA 2ZFUA 5L3GA 3CCUA 1IC8A 2MGQA 1W2BP 4N0AC 2XHKA 2ZMEC 4RTZA 3CC7A 2KVQG 3C4SA 2OAWA 5GMKh 4QKUA 4AIJA 2W82A 3X25B 3AKZA 1IGQA 2JVHA 3KLOA 2RVCA 2LK2A 4MTEA 4IUVA 2P81A 3PIPA 1IN5A 4U88A 3E6CC 1DP3A 5GAHJ 2V8JA 3CBMA 1ACMB 3KYLA 4JLIA 2DTHA 3OS0A 5FROA 4HYEA 3H5RA 2H27A 3CPFA 1GCPA 4R55A 4DGWB 4RB2C 1OX9A 5D8LB 3OYEA 4I01A 4BL0B 2F2WA 2E2JJ 1CKAA 3V4GA 4LN2A 2VJIA 3G1ZA 1FYLA 5K7FA 2RNGA 4M78C 1G3SA 1UZCA 5KYYA 2NVXJ 4M7AG 2ZZDA 1EFWA 4I02A 1R0BG 3I59A 4HX7A 1AHDP 2K4BA 4ZZDA 3SFIA 2KRFA 1T3LA 2R7XA 3QWXX 5DM7F 1X1AA 4XSXF 5LJ5g 1OV3A 1AVZC 2AZVA 1B1BA 4WCGA 2RPNA 5E1XA 1EOVA 2YLBA 2F5CA 3UR3C 3K6GA 2ZT7A 1GXPA 4CXFA 1WJEA 3LH5A 4FT2A 3LW5E 2DW4A 2D1XA 4LG3A 4M78D 1JKRC 4K87A 5IP9J 3A01A 3BE3A 3LSTA 4PK4A 2DXBA 3KCCA 1IJWC 4HOBA 2H3JA 1Z7MA 2DFFA 2K57A 3LQQA 4HWTA 3JRHA 1K0SA 3SEMA 3WU2C 3DLLA 4PJJA 2F6CA 2YX4A 2FU4A 4IRIA 4XSZF 2KRHA 1MNMC 1VQ8Q 4N4OB 1HKSA 4UV9A 2LQKA 3M8EA 3IH2A 1B9NA 3CMQA 4CUGA 1QRYA 2JTFA 3Q1JA 1EIFA 5LGUA 2IAIA 4ZDLA 5D4SA 4KGXB 1ACIA 4AIHA 4ITVA 2B63J 2GZWA 2VKVA 1USYA 1QO0D 1LE8B 4ENMA 5K5RA 1XOVA 4BHPA 4H2VA 4Y13A 3OW2S 4JZ3A 3L1PA 3F8CA 3F9KA 1V4RA 4YRJA 4PLIA 2DPDA 2EJ9A 4M7AC 2I5UA 4PJOG 1W36C 3W2AA 4J6YA 2XC7A 3HSBA 4B48A 2R7SA 1MDMA 2EIJH 5D8KB 4E51A 2LKXA 3UA7A 5KAIC 4X0GA 3KEYA 3RI4A 1TW3A 2NUTA 2E6NA 3OIOA 2OCEA 2RHZA 3HP9A 4IIOA 1O4XA 5HK3A 2YXYA 2ENMA 5FB2A 4X34A 2PVOB 3EFOA 1YN8A 1ZGJA 5HDNA 2X4YA 2FPEA 2G4CA 5CVJA 3REXA 2OTJI 1K78B 1JJ6C 4L0ZB 1Y8RB 2FOKA 2DCEA 1U1TA 3X28B 3GP8A 2E5NA 4UV8A 1YIJT 4A3CJ 1PM3A 1W1WE 4J7IA 2EV0A 4P75A 5DLQE 1SFKA 1WXBA 2IPQX 2IGNA 3CQTA 4A4EA 1U1SA 5CQXA 2XDDA 3LMMA 3PQKA 3ZFJA 2V79A 4RGXA 2M51A 5LGNA 4JX4A 4M3FA 2F4OB 4GYIA 3BR5A 4UHTA 3ZPLA 2E4HA 2F5KA 3R07A 1M90U 3ZMDA 3QKJA 2KROA 4KA4A 3E9IA 3TOBA 1WZ2A 2HEQA 5AONA 1BA5A 3G4ST 3OOPA 4P9FA 4M77A 1QKWA 3HTRA 2L3QA 4A0YA 1M1FA 4DJAA 3QPSA 2RQWA 3JSCA 2KT0A 4XK8E 2HI3A 4L59A 1T2KA 3BZKA 3OYKA 2XG8D 5LJ5e 3EGUA 4ABZA 1BR1A 4RS8A 2GCXA 4UNOA 3VYUB 1RUWA 1APLC 1ZLJA 2LC2A 4QSHA 4NL2A 3HOXJ 3SD4A 1TUDA 4HXJA 3LSIA 2F2EA 3A8GB 3ERED 1MMNA 5J3LA 1V5FA 4RTYA 4V2GA 3A7UA 4PJOC 4AT1B 3X2QH 3OYGA 1WJBA 1W7PD 2E2HJ 2X1EA 4XONA 2CV1A 1T38A 1AEYA 4XM3A 5EEGA 2PN6A 2BY3A 1G8XA 1IHVA 2KSSA 3RERA 2VT2A 4RGRA 2JA6J 5DY9A 1XGOA 4TWAA 3CJRB 4WK8F 2IXSA 2LVSA 3VS1A 2ZINA 1P92A 1BU1A 1EZZB 4HPQA 4YRLA 1OCCH 3ZP5A 2W85A 2CSOA 4V19K 3CLOA 4C3JJ 1OQKA 2ME0A 2ELKA 2X0LA 5CVUA 3PNVA 2VASA 5A2QK 1PSFA 4J7FA 3UH0A 1C1AA 3TUPA 3HIFA 1VQ9T 2N8GA 1N6AA 2JXBA 1IRFA 1FXXA 4XKBA 3RZOJ 3VSLA 3L2RA 4J01A 1KC8R 4XNFA 3QYGB 4XRFA 4TVWA 4H2XA 1C0AA 4Y17A 4J9GA 3Q0WA 2CQ7A 1USTA 1X1BA 2JS2A 4D1QA 2SRCA 5LL6S 2ZR3A 2QENA 2KIQA 2DJIA 1I3AA 3C12A 1UFFA 4RG8A 3GW2A 3GLLA 1XX5A 3QXEB 1TWGJ 1NLPC 3LA3A 2MWOA 2P84A 3QODA 3BR3A 2EA4A 2JSPA 2PQWA 2KISA 3CD6I 2AS5F 2P4RA 4U7BA 2EQIA 2WY8Q 5IYDJ 4F7UG 4EJUA 2KYMA 3CMAT 3JCMg 3M53A 4WXDA 1QCOA 1KQSS 3U9GA 1SERA 2C0IA 4IHXA 2K5LA 2M9HA 1GLNA 2F5EA 4M7DA 1P2FA 2Q2EB 4QWQA 3G1JA 1L3LA 3X26B 1G59A 2FOWA 2ZJQF 1BJZA 2FBKA 4H2YA 1AZEA 2IGKA 1LQ1A 1U9NA 1I6XA 3PTAA 4I2OA 3FXOA 4RAGA 2C8MA 4DZPA 4RCCA 4EMHA 2V7FA 3LSKA 2WWYA 2M2EA 5LEKA 1JKOC 2O6GE 1TH7A 1BI0A 2KL4A 3M0TA 3JCMW 1JB0E 3LGLA 4M7AB 2K85A 2JMCA 2FPFA 3I0TA 1B4AA 2EPFA 2QZ8A 4XK4A 3CCYA 5DV5A 4YCWA 3RJPA 4D5FA 2Q8KA 4HSTA 1XS9A 4G94A 1IV6A 4G84A 2BY1A 5J6XA 3QBYA 1R9TJ 3M0PA 3O8VA 1MBFA 1BI3A 3M3YJ 4LB6B 3PNYA 2YRVA 3IKTA 2XAHA 3HXLA 2CO5A 2Y90A 1X19A 1IL2A 3I56I 4EX5A 2ZPEB 4OMQA 5F04A 1AOJA 2LJ0A 2PMZA 1G5IA 5CKFA 2WC2A 1UTIA 2FHDA 2JJ7A 3FMQA 2DM1A 1D09B 1D3BA 2GA1A 5ED4A 2P0LA 4N4HA 1H4SA 1LFPA 1MBEA 3QG1A 3HUGA 3NQOA 4R56A 2NOGA 4K11A 1HLVA 2L3SA 2RHSB 3A32A 4HVWA 5AT1B 2O9LA 1NG2A 2BHYA 3E9HA 3EHRA 4LD5A 1BYMA 3W3CA 2DL4A 2O88A 4CO8A 5GAEJ 5GJVB 3V42A 4C2MJ 2CV0A 1VQKI 4F55A 4PDKA 3LSGA 1LVAA 4BXUA 4CC7A 3J7AF 2LX7A 1X56A 1PWTA 1PCXA 4J9IA 3VJPA 3I71A 3SWNB 5CKHA 4HCBA 2PBIA 4H0EA 1DJ7B 4FM4B 3UFGA 1HSQA 4J19A 3EH2A 3A8LB 4NHJA 1E3HA 1YI2T 3CUQC 2DA3A 3PFIA 4XLFA 4IUQA 3ESWB 3UKGA 4OMLA 2CRGA 5HCKA 4Q5WA 1YW7A 3CP8A 4R8HA 2CZ1B 2X3WD 4DPGA 4RCBA 3JCMe 1EV7A 2KJBA 3J81E 2DDZA 2R92J 4LDUA 2R4GA 2HVQA 1LDJA 1RRJA 1Z1DA 2E64A 3V8JA 1FZPB 4MFEA 1QMCA 1YIOA 1KSWA 3C0CA 3LA7A 1OZ3A 1H89C 1F1BB 2F69A 2DDBA 3K70D 2AK5A 1VQPT 5E8IA 2RKHA 2ED0A 5J47A 4WTOB 4RDXA 1RUNA 3F8NA 3CCSI 2A6EF 1XGSA 1JRIA 2ZKZA 4EVIA 4CS3A 2GOXB 3S16J 3CCMQ 1UG0A 4HZFA 2JPCA 3QYBA 5IHKA 4XN3A 1OR7A 4LK1F 2STTA 3QWYA 3PT9A 4A3JJ 1DP7P 1SHFA 4CDGA 2FQ4A 3Q0UA 1K7AA 4B4CA 3L9FA 5IOYA 1KQSA 2D2WA 1YB3A 3LL7A 3RPUD 4E4HA 1KC8U 4F93B 1RZ4A 3I4NJ 2EYZA 4Q47A 3FXRA 1PSEA 1RNLA 2V6EA 4M75E 4RTXA 4OMZA 5J4VA 5FW9A 2KE9A 1OFCX 4KISA 5BQTA 2M87A 2OPTA 3FEOA 2CUDA 2XMFA 3HKZN 3C1DA 4IUPA 3H41A 3FK6A 2FO0A 1VF9A 3FMRA 4P72C 3A1PA 2PFBA 2O4XA 3QUIA 3ZGKA 4XR6A 4H2UA 1IDZA 1MGQA 1HCRA 3UPUA 1MGTA 1X55A 4ENJA 3FBNB 2EKOA 8AT1B 2QCOA 1POGA 2E1OA 4O5VA 3FLGA 2Z1DA 3FMSA 1GVJA 3TCJA 1SETA 1HKQA 2P5KA 1QVTA 4LMYA 1TNTA 1IB8A 2XSJC 3HTUA 4LG0B 3GF5A 1GXIE 1YS7A 2TDXA 4IQ4A 2JQ7A 2ZJRF 2CFXA 2BV6A 4KIBA 4C5IA 2PJRA 2ZT8A 2Z0WA 2LDMA 2YU3A 1DPUA 1YFRA 3O8HA 3REOA 2IEKA 3KEQA 4VUBA 3UGQA 2EH3A 2W10A 2ODRC 4YTLA 2PNIA 4EM1A 3UATA 3P5JA 4LB5A 3KX2A 2RQTA 2Y4XA 4F14A 4C8QA 1U78A 3LSHA 5JI6A 3L2QA 3FWEA 2CP2A 5FKLA 2J5OA 3LSPA 3TP3A 2HQEA 4M6VA 4W1UA 2ZPFB 3A02A 3WTTC 2R5MA 4BHBA 2I4LA 4BDYA 4YPFA 4EMGA 1OISA 5BNGA 3E5UA 4BBSJ 1KC8C 2H8RA 4GXOA 4O2DA 3HHTB 2UUZA 3QYEA 3R0JA 3R61A 1WPYA 4RB1A 1X1DA 3KP7A 1FTTA 2DJZA 3AL0B 3RYRA 3V7CA 3NELA 2VJJA 4FTHA 4BJTA 2JMAA 2X4HA 5LHIA 2CZ0B 3P8BB 1Y57A 2KI7A 1X6OA 1ZG5A 3H0HA 1BBWA 1TL8A 3FM3A 3OYCA 4CYCA 4OMMA 3A8HB 1PD1A 2M34A 4AG1C 3KETA 3V8LA 1OX8A 5L23A 2ICWG 5LBQA 3CCVT 2FE3A 3EDPA 3VSKA 2VXDA 3BOQA 1VA7A 1X1CA 3PCOB 1XD7A 2MPXC 4JS5A 1QP3A 2L9VA 2DVJA 4I0AA 2JT1A 2OTLI 4U0YA 1I6HJ 3OS2A 2NS0A 4CI0C 4ENKA 1X3WB 3WHCA 3C94A 3OIQA 1X01A 4OGEA 4UUSA 3HC7A 1RC9A 3H8ZA 3EFRA 3B6CA 2MWPA 3ABMH 3MFKA 1ZUKA 2VGNA 4P71C 3E9GA 5J8CA 1X3UA 2ZSIB 4MQ9F 4BKXA 2H1LA 2EQUA 4OIOF 3BCAA 5E3OA 2VGMA 3CUQB 1QWEA 2PJPA 4BWAA 3OIPA 3DTIA 5F1JA 2E7WA 4HF1A 2DU7A 2HTJA 2ZNIA 2P5LC 2L01A 2L3PA 3BJUA 3MKYB 2OC6A 2E35A 1Y39A 3KE2A 3G6ET 3KP3A 3LAJA 1MBGA 4PFOA 4AFZC 5F6FA 1B8IA 2OCCH 4DIQA 1UEBA 2NVYJ 1YHQT 2QG9B 1IUFA 1XSVA 1RI7A 1PUEE 5CKDA 3S17J 5DS9A 1ZREA 5J1YA 1BC7C 2EFPA 4RLQA 2G6FX 1H0MA 3F70A 2Z9OA 3UDCA 3LQRA 2HKNA 3KLNA 3CC2T 4A63B 2K79A 3FHZA 4BACA 4XN0A 3QPTA 1Y0NA 1GXQA 5CVRA 2KFDA 2ZIMA 5LHGA 4LE9A 2EJFA 2H6BA 4LITA 2ZMEA 4HDUA 4AFQC 2O0YA 1SMYF 2EIFA 5GAN5 4PJMA 3ME9A 5FFZA 2VXFA 1T08B 2OTJQ 4YRVA 1OCRH 3ZN0A 3RDVA 4Y4RA 2XAUA 2RC4A 4A4FA 2OU2A 2ARSA 1LB2A 2LP5A 2XDVA 1YITT 4BAYA 1JT0A 2M8GX 1WH5A 4EMKB 1QE0A 4C9YA 1MSEC 4XIDA 3D7SB 2CSQA 4U0VA 1HQCA 2DYRH 2M02A 3I9V2 1J5WA 4KR3A 1K4US 4MNUA 5BS6A 4XOPA 3MQZA 1MMGA 1H3ZA 4RBOA 3OQ5A 4M78A 4AH6A 2CS3A 3TDUC 1TT5B 1YP5A 3CF2A 5EGOB 4R79A 3BDDA 4C92F 1K73R 4A69C 3ZRGA 4XRSG 3S3NA 5KVRA 2X6OA 1U0JA 3N5BB 1R49A 3EG9B 1KIKA 2EZHA 3VS2A 1ASYA 1BK2A 1AWJA 2ISYA 1TWBA 1YQAA 3JTHA 5M9OA 4JRPA 2BE5F 1RR8C 4AFUC 4ON0A 2OF7A 5JVGF 4KGVB 3FXLA 5E8GA 2HFHA 3CCLQ 2ZGWA 4KMUX 3SQNA 3CC4T 2RI3A 3ABLH 4OAZA 4MZTA 2M9UA 5B5EC 3QDFA 2XPUA 2M30A 2UZKA 4RTTA 1YOVB 1FOKA 2QASA 5D4RA 4BW9A 1VQOI 5EZHA 5LRSA 2W7NA 3OB9A 4B47A 3TEEA 2FSWA 2L7FP 2HDAA 1W4MA 2BYVE 2YWWA 4FYWB 4IIMA 3LFUA 2MCNA 4OVAA 3LAPA 3E5XA 2XHCA 3GCMA 1ZBXA 3VUBA 1VQLT 1W4SA 4ZTJA 2A3SA 2DVEA 4FISA 3TBIA 5J39A 5FU6C 1BI2A 2NUPB 1VQ6T 2OTJA 1JXOA 1WI3A 1E6GA 4IO9F 3EG0A 1GCQC 2XROA 1IN7A 1J2XA 4P96A 2M0YA 1UG2A 2LT1A 1WNLA 3RKYA 2AT1B 5FLXE 3FC3A 2A0FB 4BE1A 5KNLA 5B1AH 3CC7T 2K02A 1T0FC 4P5NA 5KE3A 3GTKJ 4Q6GA 3H3ZA 3OSGA 2ZAEA 4J9CA 2QHTA 3NRVA 3CD6Q 3VYRB 1U5TC 3QOPA 2DXUA 2PI0A 1KMNA 1EJ9A 1H9GA 5C51B 1YTYA 4U87A 4CYDA 1SEUA 2GXGA 3RKQA 1OZ2A 1JE8A 4E7KA 1AWXA 1XTDA 1Q95G 1OKRA 1OU9A 1WHJA 3H1CA 1RETA 5B66C 4GGGA 4TVAB 2OA4A 3J80K 1M2VB 3OW2P 1R4MB 2JS0A 3FKJA 4DNCA 4OMFB 2NRAC 3CCUI 2X9HA 4C0DC 2C0TA 2VQGA 2Y31A 3LX7A 2DTRA 4G6DA 5K5OA 2DODA 2E5AA 3VS3A 4JZ4A 2E1NA 1BCMA 3GOXA 1W7PA 1GV5A 2IA2A 3BPXA 5GAOm 4NUBA 4J9HA 1V55H 4X9DA 2IS4A 2V1DA 1PHTA 1W6XA 1WXTA 4YRFA 2STWA 2P7CB 3W2WA 2XSDC 3CDHA 3JRFA 1HTTA 2VKDA 4XLHA 2DMQA 3ABUA 1OLTA 3L4GB 5KAFC 3JRZA 2A6HF 4A0ZA 3I56Q 2JUCA 3HHGA 4TVYA 3ULQB 5J26A 1OPCA 3A7RA 3WGGA 4CH7A 2HXOA 2DQ3A 3HSRA 1VQ4I 4KFCA 2QKMB 4M7DE 2XB5A 2VOPA 5EZGA 4XRMA 3REAB 2FD5A 3D5LA 4HNTA 5F1RA 3ZL7C 3JB9D 1MBJA 2WB1A 4I09A 3S1QJ 5CKTA 5LJ5f 2RHYA 2R7DA 1OULA 4XKVA 1HC8A 3CD6A 2MSYA 9ANTA 2HOSA 4E7SA 1XMKA 2FRYA 2ID6A 4C5GA 1ZK8A 4A3FJ 3ZBDA 3O5ZA 4A4KA 3VS0A 1W5SA 3FBIB 3GFMA 3DKYA 1WU7A 3GNGA 3KIOA 3K4BA 2ELHA 4CC2A 1YE9A 1LKXA 3CMAI 1T0JA 2AQFA 5IXBA 4MMKA 1FYFA 2RJFA 5KYXA 3JB9I 1S72T 1ZSZB 2ZPIB 1KG1A 5GTHC 4AVZA 1VQKQ 1IREB 3OYFA 1WI9A 2TRTA 4Y28E 4P74A 3ZXSA 2FBHA 2A68F 1SHGA 3BFMA 2GQQA 1N9SA 1NZ9A 4EM0B 1Y71A 2KQRA 4ZN3A 4BXXJ 4QQGA 4ZDOA 5GANj 1R6RA 1ABQA 1K73U 4XTXA 3VYSB 1YGBA 3E97A 1VIEA 4M74A 3HJEA 2DBMA 1I5LA 4KT5C 1X2GA 3R0AA 1ZHIA 1WQ7A 1FTZA 4BD3A 4OP0A 3MP1A 1I1SA 4II3A 1LDDA 2E10A 3WE2A 1HC7A 1N9WA 4FW1A 4MDXA 4WF2A 1W7PB 5D6WA 2QM3A 4TVRA 2KPMA 5D5UB 4XKWA 1Y8QB 4A3IJ 3WE3A 2QA4Q 4CZCA 3I56A 5FKOA 2Q1ZB 2BGCA 4M75F 1N9RA 1ZRFA 2ZPBB 4NB5A 3ECOA 4UY8I 1R23A 5A0GA 1K9AA 3CCSQ 2CUFA 3RF1A 1ARKA 3FK7A 3N97A 3EG2A 3OL4A 2ALYA 3DTEA 2DRMA 5EF6A 2ZIOA 2VUMJ 1VQ8T 3SZTA 4XKCA 2XAFA 1UHFA 1B72B 4KQEA 1D0XA 3TW7A 3OY9A 2ZCWA 1MJAA 4CGZA 3DV8A 5C44J 3GUDA 1IG7A 2CZ7B 3RQIA 2D5VA 2UXXA 4CSWA 1WFXA 4CCMA 1UG1A 3LSQA 2YHTA 3QJYA 2RQRA 4M3DA 2RI2A 1KQSP 2ECCA 5HGQA 2RK1A 3I54A 3HGGA 2VJ5A 1Z3YA 4AVPA 1J3TA 3EGDB 1VQKA 1BCOA 2X3XD 3NMZC 2V8KA 4C0ZA 2L7ZA 1K73C 1B7TA 3UNGC 1B7YB 4G85A 4B09A 5CYVA 1LCKA 2DF6A 2Q5HA 1PP7U 4DEYA 2MK5A 2FRHA 4L9JA 1SVMA 1QVGA 2W24A 3FXKA 2P6TA 4N0BA 2QGFB 4AC0A 3C7JA 1VTNC 2LVMA 3GO5A 2DLPA 1N77A 2K9GA 3NTKA 1MZBA 1K79A 3UA6A 4BI3A 2K86A 2ZTGA 3SJMA 2RHQA 3DQVC 3OYDA 1KA8A 3E7LA 2X6XA 4F7UA 2RO0A 2KIFA 2D9TA 4YREA 1FYKA 2YU9J 1VIFA 3Q9SA 3ZQLA 2VBZA 3P7NA 1QVFA 4L5JA 4XLEA 2JUGA 4KUDK 2OJ2A 3I55I 4IX7A 2HKOA 2DX1A 1SAXA 3MCZA 1XG1A 2DZ9A 2MG4A 1ONVA 3OYLA 3REUA 3ZMUA 1BOAA 2V6CA 1YWOA 1S9HA 3GTGJ 5FU7C 3COAC 2VN2A 2UWMA 4I98B 1P6RA 1VQMQ 1JJ8C 1MUZA 2FYKA 2DNUA 5EEHA 4KH0B 3CCEI 1ZGWA 2RQVA 2NS6A 3CCSA 4E7IA 1QLYA 4DYRA 4G9YA 1MMDA 1QZZA 4YIIA 3KZZA 3PE0A 3OYHA 5K1XA 1ETKA 2COBA 2FZKB 4ORZA 4K88A 1H4TA 4FASD 3VB2A 2HVSA 4HX4A 1EH7A 4XU3A 1FX7A 3GZNB 3AG1H 3UT1A 2W4SA 1HDPA 3PIPF 1XGMA 2JZYA 1WDXA 5TISC 2JTMA 1IO6A 1LFUP 1AZGB 2M1BA 5DLOA 1Z77A 2X6WA 1ON2A 1SFEA 1P4XA 1RAGB 4FIBA 3F22A 1GT0C 1GFDA 4A2UA 2Y9YA 2BZTA 2R0QC 2NUZA 5E3LA 4H2SA 2OTLQ 1YX5A 2HAXA 1U2WA 4FE7A 3RPUA 1G3TA 2DFIA 1S8NA 3UWNA 4LK0F 1CSKA 1EIYA 4RUGA 4XTWA 3W6JB 1ZG3A 2NXNB 3DU5A 2R7QA 2BW3A 1RI9A 2ESHA 3JCMf 3S8PA 2CGPA 3K4CA 3GZ5A 2KLOA 1OYWA 4AUXA 3WVEB 3ER0A 2O61A 1X43A 4UXNA 3OWTA 3M1EA 3FDYA 1CQTA 2KGTA 1E3OC 3HOSA 4L5IA 2OZUA 2LYCA 5KNNA 5HLGA 4HCZA 1IUYA 4IPAA 4M6YA 1P4WA 5H6QA 2QQAA 2PMEA 1R77A 2GM4A 2O8KA 4LIVA 4XLNF 1T39A 1T56A 1J0RA 3MN2A 2E1MB 2HU9A 5CR2A 2HWVA 1F9NA 3CCJI 2QSHX 2GNCA 1YFHA 1D1AA 3QZ5B 4PKCC 3ULRB 3G71Q 3JB9J 2XI9A 3JAMZ 2MA3A 2FX0A 3JCMV 3KUFA 4LXCA 3MHXA 2EZKA 2VC8A 3NEMA 3ML6A 3IKLA 2XGCA 1XC5A 1B76A 4IHYA 3OA6A 3MVPA 2CFOA 1R5GA 2XVCA 1AU7A 5E3IA 4GDFA 7AT1B 2R5YB 1M1KR 4Z2YA 1TUGB 1I81A 1P4AA 3G3ZA 3WGIA 2EGEA 1Q86U 2XK0A 3CQZJ 4D8DA 1TZLA 5FRNA 1YRNA 4P3OA 1WGXA 4RAFA 5E18F 1U06A 3MEUA 2OTLA 2DFEA 3IHUA 4C92B 1LNWA 2Z5UA 3RQ4A 3L2ZA 4ASNA 3AG2H 2OJED 1C6VX 2LNBA 3MO8A 3CJTB 3I9QA 3CPWA 4HX8A 5C52B 3WODF 2Y48A 3DLMA 3BWGA 1AWWA 3IP4B 5GANh 2L2PA 2VBXA 2ZNJA 2RQPA 1V54H 1H88C 4BY6C 5M5WJ 4YRMA 4EQQA 5KYUB 3H3VK 1NG6A 3F72A 4RB0A 1B34B 1TUCA 1Q82U 3IH3A 4NOYA 1HSJA 3H0FA 3J81K 2OUMA 4FX0A 2EAYA 2L3RA 4XTUA 2M5WA 1UJYA 4YIFA 3J7AO 1QHHD 4HNUA 3HB9A 3OYNA 5D6XA 4OMPA 3VQXA 4F92B 4I0BA 2QQBA 2PMZN 3DTKA 2L5QA 4FQGA 5LHHA 1RAFB 1S7OA 1T95A 2PVGB 3A1YA 3ZQ7A 2E1CA 3ZOBA 4FL6A 4M77F 3JRIA 4RMNA 5HLTA 2C6YA 4HT4A 1HF0A 3Q5FA 1WXUA 5FKNA 2EBIA 2EINH 1KQ0A 1VQOQ 1Q86C 4Z89A 5K7HA 1TP4A 2LCSA 2E6ZA 1RR7A 1EFNA 3ASKA 1EH6A 1IN6A 2VODA 3R60A 4Y92A 2R7OA 4P71A 3W3SA 2YRDA 4YYEA 3QU6A 1VQ5Q 4XOTA 1MNEA 1X58A 2IRFG 4B3XA 5CCAA 2KK4A 2QEXI 1IHWA 3HXZA 2CREA 2YS9A 3TEHB 2W48A 2R5ZA 1FJLA 2F48A 3A5ZB 2I4OA 2DO3A 4FSSA 4M78E 1UGVA 3JSPA 3PJRA 5LJ3j 1KU2A 1OI1A 3HPGA 1VI0A 2VE8A 5JFRA 1YNZA 2GBYA 1RAIB 1ON1A 1JXMA 1BKBA 3HXVA 2NWMA 3FHNA 5I2MA 3AT1B 4BQOA 3IV5A 3DBRB 1SPKA 5ICCA 4EIKA 1YITI 2O3FA 1RESA 2ADUA 2X1CA 1ZELA 2PMUA 2QTXA 4JX6A 1D0YA 4LVMA 1N27A 4CCKA 2HGCA 2LBFA 3GBGA 3WG9A 4QIWN 2QSGX 4XTZA 1D8KA 1ENHA 1V1CA 4BE0A 2YSRA 1DDNA 1AKHB 4HLXA 2P0PA 3RSNA 1X4OA 3MF1A 1O3SA 2AO9A 5LRRA 2C06A 3CCMT 3JW4A 3IL2A 2VPLA 3WTVC 1YJ9I 3RYPA 3F6OA 2Y2ZA 3CCUQ 4GLMA 1R4NB 2A5WA 2CJBA 3CC4I 1Y96A 5GMKe 1VFCA 3TGNA 1OCPA 4J83A 3E1SA 1CKBA 2ED1A 5FGMA 4RA2A 1VQOA 4YFXF 3EAEA 1ETYA 2DMUA 2FG0A 1E3PA 4HWRA 5IXFA 2D8JA 1Y0UA 5CIUA 4M7DF 1N78A 2VKEA 3K4NA 2R7WA 1ZBJA 4M7AE 4EM2A 2CP5A 1M8MA 2MC3A 1MNDA 1T33A 3LA2A 1SRYA 2HBWA 3GTPJ 2DD5A 1WHLA 1WX6A 4HBLA 2RNAA 4LVKA 2RREA 3KBGA 5TJJA 1SSFA 2CP3A 4UPAA 3H9NA 3FM5A 2COYA 4P3NA 2XKOC 4YELA 1QQIA 1TTYA 3X24B 3EQLF 3S1NJ 1YIJA 3M07A 1NEGA 2RHUA 3CEYA 1H8AC 1VQ4Q 1BBZA 4HA8A 5J3BA 2JA2A 3ERRA 5HNHA 3P9CA 2ZZEA 4OMYA 2A3LA 1M1KU 3N4MA 2KYBA 1M90R 3BJOA 2E7XA 4UUVA 2D0NA 1ZUYA 2HNIA 1FOXA 4L0YB 1E17A 4UUTA 3MCAB 5DUKA 2L4AA 3KP4A 4WXCA 5I21A 3MAJA 1JJCB 1EA3A 2LTPA 2FUG2 4IHSA 1AWOA 3U2RA 5IHIA 3SZGA 3EFSA 1H9TA 1HJDA 2WADA 1Q7YU 2BBYA 2BUDA 2CYYA 1SC7A 1NJ8A 2AMCB 1YJNI 4XEMA 2XF7A 4ESJA 1GCQA 3JRDA 2MBFA 2HTSA 2JVGA 3BJ6A 5FJ8J 4L9NA 1M9SA 4FW2A 4NQWB 3K7AJ 5GAMj 1QZYA 1KQ2A 4LUEA 2IA1A 1D1CA 4Q5SF 1G3WA 4MFDA 3DB3A 2HVRA 2ZT5A 2G7HA 2EQRA 2TCTA 1TTHB 3VYHB 2LY1A 1X4PA 1BB9A 1T0FA 1RAHB 1U3OA 4PJOE 3HXUA 3E19A 2CH0A 1TWCJ 2YUOA 5A2QE 4M75B 4M77G 4D7NA 4KITB 3LSJA 2X9DA 4ME7A 3JRCA 2BIVA 1U5TA 2F5DA 4IHTA 2RAEA 4UVBA 1TNSA 5CPRB 1UCRA 3HG9A 5E17F 3VYGA 3IH4A 3ZN1A 4L9TA 2HZYA 3D0SA 1GVDA 2LJ1A 2BTTA 1BBYA 1Z05A 3OV8A 1NBEB 1M1KC 4CH5A 5IOZA 2E3CA 5GMKl 2L7KA 2J3MA 1IDYA 1IXCA 1QNTA 2O31A 1IO2A 1Z21A 1VQNI 1X2NA 5ELOA 3DB4A 2KBTA 2IY5B 4ZN1A 1VQ4A 4MMLA 1W2BA 3O2PE 5TRDA 1WHGA 3NWSA 3ONQA 5J40A 5DM7R 3HY1A 2JUFA 2L9NA 3L09A 3EGXA 3WVDB 5K1YA 2X4JA 5DTDA 1ETXA 1WHUA 4KIFA 2RHIA 4JK1X 1R5HA 3MWMA 3IRRA 2DK5A 1PDNC 5ECAA 1E6HA 3E9FA 4DQ2A 2H8HA 1PD0A 4V2FA 2LMJA 1GBRA 2KXDA 3P8TA 3CMAA 2GLOA 4OMOA 3A98A 2LNHB 5D6YA 2EQJA 3S1MJ 2CP6A 4PJ0C 5EG0B 2FF4A 4JOMA 1S72I 1XGNA 3IKVA 4TQFA 1TXQA 2LP0A 2E3HA 2V9VA 1R1TA 1Y07A 4IOCF 3RZDJ 3GLXA 2W00A 2H09A 2VT3A 2D1HA 3BTIA 3QWLA 1X69A 3EH1A 1WYXA 4CCNA 3RKXA 5I22A 4ESFA 3DLAA 1SVLA 2PQ8A 5IYCJ 2OTJT 2Q7HA 1QWFA 4MEYF 1HOMA 2DZCA 3I55Q 5F0FA 1I39A 3BROA 4LDYA 2MYSA 2BXZA 1T8IA 1QVFP 1NHAA 3M59A 1AD5A 3GEZA 1HXDA 4OB0B 2ZXFA 2XDPA 1B70A 4OIPF 2BEOA 3Q3SA 1YCYA 2WACA 5L3DA 1U5SA 4DBRA 4OB2B 1JO8A 2K9SA 2O8XA 3CCEQ 3FX3A 5C53B 2QHSA 1SFXA 5HS9A 2IW5A 4DZJA 1GV2A 3I3LA 2DYBA 2COZA 1RUOA 4AG2C 3LOCA 5IT9K 4ZIBA 3ZEHA 3TP0A 4OB1B 2CUJA 3H3UA 2K4JA 5LJ3f 3MZYA 2QBYA 4C8QF 5H20A 1WWXA 4M7AD 5KYYB 5KYWA 4ZGEB 1S7AA 1MMSA 1W36D 5ILSA 3RTRA 3I59B 1QVPA 2LDUA 2EYXA 3K2AA 2EGAA 4F7UE 4BEHA 4IZZA 3CCLT 5KHDA 2QF7A 2OBPA 2RQUA 4C5EA 3CF5F 2XB0X 2EZIA 1NK3P 1ETQA 4BY1J 2HL3A 1X1PA 3M56A 2Y4YA 2WAQA 3I4PA 5GAOp 4G7ZF 5CO7A 1VQ7I 4L5GA 1O7FA 1HSTA 2O9SA 3UF4A 3A01B 4IRHA 1MH4A 5H6RA 2KMUA 2GFAA 2GBQA 1PUFA 2ZZFA 3PVLA 2P4WA 4QVDA 4S05A 2NS7A 1LEAA 2DQLA 3K4KA 2CQNA 1ERDA 1ZLKA 3G1MA 4KJZA 2F2XA 3SWNC 1C0MA 1TQIA 1YS6A 3O3KA 3B02A 1KHCA 3I55A 4XAXB 1TC3C 2M0MA 3IWZA 4AIDA 3S93A 1M8VA 3ZQCA 2E1HA 3H5AA 2EIMH 3JCMJ 3NTIA 4JYKA 1Z6TA 3SEQA 1SFOJ 1CF7A 2ZBKA 3CBOA 2LQWA 4P5OA 2E12A 4M4ZA 2MH9A 1PP8F 3BT9A 3CCJQ 4KGZB 3U21A 4B44A 3HGYA 3JRGA 3H5NA 2HQ5A 3CCEA 1BR4A 3GWZA 2KR3A 3PNWC 3TDZC 2K3BA 2DOEA 1BL0A 2JTVA 3CD6T 1EKEA 4IL6C 3I7FA 4CA0A 4ZYDA 4PJOD 3HRIA 3MKLA 1Y0MA 2FQ3A 4J8OA 3CBPA 2WBMA 4FX4A 1ASZA 4F91B 4ZYEA 1MDMB 2DIQA 1A6IA 2AKWA 2BXYA 1WJDA 2YUSA 4ZC3A 3Q9VA 3FXJA 2NUTB 2YUQA 4JLGA 1M90C 4AU7A 5BPDA 2B9SA 2W1OA 1EH8A 3T8TA 1R1VA 1IW7F 4CC4B 3EFOB 4NL3A 4MQVA 4XQFA 2ABLA 4LUDA 1G5VA 1DGWY 3QAHA 2E19A 2ZR2A 2J3LA 1WIEA 1K8AR 5HS8A 2EYWA 1IRXA 2K40A 3CLQA 1ZGAA 5GMKi 4B8XA 4YFNF 3S14J 3BG3A 1UJ0A 1ZQ1A 4WJ4A 2M4KA 1YFTA 4M9SA 2HBPA 3M8JA 3H36A 3NARA 4QPOA 1Q81U 1Z7LA 2H94A 4A12A 3LC0A 2RJDA 3HY0A 4F52A 4MGRA 1OYIA 5CQGA 5DCFA 2M16A 1G83A 3NAUA 3HFZA 2HDCA 1KJWA 2RGVA 4WX9A 4M6XA 4BQQA 4M77B 4DA4A 2Y69H 3BLYA 3HL8A 1LVKA 3MEYA 2B0LA 2DA5A 3I56T 2JRTA 2J6FA 5GAMf 1PYSA 1BW5A 3JCMc 1TQPA 1RI0A 3PUBA 4YEJA 3DKXA 4JJDA 2KXCA 2ZFWA 2NAZA 4E47A 3OYAA 4RB3C 3CCJA 3VS4A 4B43A 3M55A 4NDLA 4BJ5C 1JI8A 1FT9A 4M9XA 3T9NA 5BPIA 3PUFA 4M78F 5J4YA 4A3GJ 4D8KA 3A03A 3E6DA 2GOMA 4LFUA 4N4NB 1J75A 4M71A 3CCQI 3ABKH 4QTRA 9ATCB 4DYQA 2WB1N 5CQEA 3W2VA 4PL6A 3WHBA 1KYWA 2CJAA 4GY5A 2KIUA 1WFWA 2R93J 3E5QA 4J9EA 2IGMA 3OMGA 1NJIR 2QEXQ 2D45A 1VQKT 1IN8A 4OIQF 3M0QA 5K5QA 2K9LA 2MH2A 1G5HA 4KYWA 2RHXA 3P8YA 1JUSA 3AL0C 4KICA 1Q81C 2YT6A 2AKWB 2DETA 4P9UA 1NJ1A 3BG5A 2IGOA 1SANA 5GAN4 5IAYA 4OAYA 2HPMA 2ZXJA 4H2XB 3TSWA 3OL3A 2MD0A 3HOWJ 3A31A 1QF6A 2XAJA 4OIRF 3PO3J 1ZKGA 2RNJA 5GAN3 4B9XA 4RM3A 2JZ2A 1BN5A 2A6TA 3MPUB 4HF0A 3F21A 2O5RA 4E70A 3B73A 5K1PA 4XU2A 1XDUA 4DBHA 4M9ZA 1DUXC 1E2XA 2QA4T 1S6LA 2VQLA 2FVUA 3RGLA 5J1UA 2H8WA 2YLCA 1IZ1A 3Q0VA 3A0HC 4BS9A 3CCST 4I99C 3V7RA 1LPLA 4M7AF 3OD1A 2HDDA 1BI1A 2RD1A 4AWXB 3ICAA 3KYDB 4PNOA 3QP6A 4M7DB 4LLLA 3DPTA 1YJ9Q 4JDSA 2E60A 4AM3A 2G0EA 2YDLA 3HBLA 1Y1WJ 2E5QA 2HR3A 3DCFA 4J9BA 1JBMA 4A5MA 3PMTA 2RH2A 3CC4Q 2B8AA 3SZPA 2ZJ2A 2DTOA 2GXBA 3M4OJ 2IJLA 2W0ZA 1KU7A 3N05A 4EO4A 2HQXA 3E6BA 3KP5A 3HRTA 3VRZA 4LVJA 5CK9A 2EYQA 3KP6A 3S32A 5HOOA 4IF4A 1N5ZA 2M0OA 4UP9A 3ZQGA 2QEXA 3GFLA 5D6FA 2DPUA 2HDWA 2M7BA 2K3FA 2JM9A 1K4TA 1H3HA 2CUZA 1QCFA 2DXIA 4LNSA 5FD6A 2OZ6A 4ATOA 4HLYA 5EYRA 4S0HB 4NBQA 1LFBA 1HDDC 1PKTA 1JT6A 4BQNA 3LSSA 2P4TA 3GBQA 5J8FA 1T0HA 2V26A 3MZHA 1YJWT 3HTZA 4CH4A 3O8GA 1LPQA 1YITA 4HVVA 3M0UA 1GRIA 5FWBA 4YRKA 5DDGA 2XDBA 1M30A 2PEXA 4EJOA 2EK5A 1PJRA 3FDRA 1I1JA 1RIOH 2RF0A 3SHFA 2CWEA 3IAS2 1YLFA 1BOBA 1D3BB 4Q15A 2F5FA 4EMKC 3S2HJ 3JCMQ 3ELKA 2FXAA 2K5FA 5CJ9A 3HUGB 2CYZB 3CP2A 5E1WA 3W6VA 3P8VA 2CQXA 1XNIA 1K8AU 4PJOF 4ZTFA 1VQMT 2ZNZA 3MP8A 1JTYA 2NNNA 3OOUA 3PIOF 4KUIA 1H92A 3A0BC 1YJNQ 1U9OA 3FF5A 4C30A 1S3JA 3FZVA 1SF9A 3CO6C 2A69F 1YJ9A 4JQFA 4DYCA 1TWHJ 2CW0F 6PAXA 4ZNXA 4UVCA 2L2OA 1WQWA 1JTXA 4HAMA 2JA8J 3CC4A 3DPLC 3CMEI 5FWCA 2W57A 3FISA 2M3AA 5LEJA 2K9NA 2XRNA 1SD4A 4R1HA 2LKSA 5IT9Z 4HT8A 4HNVA 4M3BA 1H4VB 1NJ6A 4ANJA 3L2VA 4EJWA 3BG7A 1WJFA 2DBBA 1G4DA 4TTVA 2VV5A 4WCIA 3J7ZI 2QGGA 4BNCA 5ILVA 1QP2A 3OSFA 2H6CA 3R6OA 4PLLA 3CCRI 1JKQC 3JCMX 4E6RA 2GAUA 2HS5A 2OTLT 4U0WA 5DUIA 3O6BB 3HZJA 5JLWA 2K5CA 5FKKA 4YRNA 1P7JA 2JA7J 3F6VA 1UHWA 3HL2A 3JAME 4L6V5 3PL8A 1E0EA 4JRIA 2CZ6B 2XAGA 2EJRA 2LNVA 2QQSA 4WXHA 2DQ0A 2QQ9A 1VQNQ 4IOAF 4G7OF 5D7UA 1RLPC 2ODRD 2LX9A 1WSUA 5GADJ 3GIBA 2L9SA 3IUOA 3QRFF 2XGEA 4BHCA 2HZTA 1A6QA 1K8AC 2BY2A 4JJBA 2DA7A 2IBDA 4ZDPA 1LYLA 1NJIU 3K69A 4PGGA 1X2QA 2JN0A 1SSHA 2DA6A 3DU6A 1WZOA 1FBQA 1SRLA 1LE8A 1JHFA 5FRMA 4CCLA 3S15J 4ZTZB 4NC8A 3BG9A 5LJ5j 1D8JA 2WAFA 3J7AY 2K7LA 1NTCA 2DFUA 4C0FA 1SD6A 2FJ1A 3QJ6A 3VQVA 2KJCA 3KZIC 1TG0A 3EUKL 2PVDB 2DMTA 5FFXA 4UB8C 4YROA 4ZJZA 4A3MJ 2DERA 5ICFA 3WTWC 3G71T 2FEIA 2CGHA 4QPQA 1YJNA 3H0IA 1QVUA 3OS5A 1ORKA 3J80E 2PLYA 2CS7A 1S72Q 4J00A 2L9RA 1WJAA 1W70A 3A8OB 3M0RA 1ZH5A 3P8HA 2K9QA 1F1ZA 2XKOA 1MKMA 1YX3A 4FYYB 1N75A 5GPCA 3WTUC 4F16A 1N8RR 2DE0X 3JB9H 2O4XB 3S3MA 4HWSA 4OOIA 4NS5A 2LZ6B 3IQLA 1K78A 1I4K1 4YRRA 3VQWA 3A4CA 1ODDA 3TO6A 1K9MU 5A2QZ 2AHQA 5DD8A 4E7ZA 3QO7A 3VS5A 3EPZA 5F08A 2CSIA 2A05A 4JRKA 3L1AA 3LWHA 2BVMA 1X75C 4G6TB 1MV3A 2M8EA 2M45A 2PJRB 1YWPA 3V8KA 4HQMA 3MKWB 2DRKA 4HVUA 4XORA 2E41A 2GTJA 3DKMA 2VL8A 3HDDA 3F8MA 5FLMJ 1NJIC 4LJZF 2VYTA 2JVVA 3CXCS 3JCMb 4C8QB 2ZJPF 4F7UF 1VQNA 2KT1A 1I3QJ 2LOOA 2DJNA 4XLCA 3I53A 2EJGA 2Z99A 3LLRA 2M4GA 4KN4X 1PRMC 5F5WA 1O3RA 1VYTA 2DL3A 4BU2A 1HA8A 1K83J 3CJNA 4N0AA 5L8RE 2VE9A 3WXMB 3DBHB 2XV4S 2EIKH 1MHNA 3RPQA 1HD3A 4LD9K 4OINF 5GTIC 4GFBA 4YCVA 1OEBA 3OR2C 1UHCA 2DA9A 4LGWA 3DFGA 4A3KJ 2EFQA 2HL5C 4CYCB 2X1DA 1JQQA 3VRYA 3I4MJ 3K1MA 4L9VA 2SEMA 3M8FA 1HK9A 1ZAOA 2EWNA 1Z9QA 2MW8A 4LVIA 1FMVA 4JX5A 5M3MJ 1S72A 4A3LJ 3P9IA 1VUBA 2I4MA 1K9MC 3H0DA 2EV5A 2BZ8A 1VQOT 3RMSA 1I8FA 3IAM2 2R7ZJ 2RM4A 3HEFA 2CH4W 1K76A 2R7RA 1VQ7Q 2QAZA 5E3MA 4BY7J 1MD0A 2P0WA 3V7SA 2E2IJ 3ZCOA 2QUFA 1ZSZC 4BXFA 3E0JB 1VQ5T 2I2LA 4BE2A 2VXZA 2KNBB 2LJ3A 4UUSB 2COWA 2KDOA 4IVNA 4AMCA 4H02A 1FOWA 2JWTA 1LUJB 2IP2A 3VFZA 3PSIA 3HXXA 3BY6A 2GIVA 3LWFA 2FPDA 3A5YA 1VYVA 4HQEA 4CRIA 1HW2A 3MQ0A 1AWCA 1UGPB 4CH6A 4GRIA 4A93J 1F36A 2QYOA 4XLPF 3SDGA 4C2TA 3VKIA 2HOTA 3G73A 4LDXA 5IP7J 3VS7A 3U23A 4HDVA 4KRTA 1QKXA 4BDZA 2HSEB 1HKTA 1OYXA 3EHQA 4RTVA 3GXOA 4ZYAA 2IS1A 1LEBA 1B8IB 3QOEA 1ATIA 3I5SA 1WKMA 3GMEA 2DU5A 4IHWA 1ETVA 1DU6A 1FBUA 3TL4X 1RL2A 1A35A 1ZA2B 2PUKB 2LQ8A 1WHKA 2LREA 1VNDA 1OYYA 2XRLA 2Q2EA 1R5ID 5K7ZA 1B3QA 1A36A 3HKSA 1VQ8A 4C3HJ 3EG1A 2LTOA 2K4YA 3RL6A 1DPRA 2YPRA 1BR2A 3HFNA 4QVCA 1L0OC 3VS6A 2CU7A 2MAMA 3ASNH 1IGNA 4OWRB 2DI3A 3META 4N9IA 2B86A 2A07F 2ZO4A 1YFSA 2A5YB 4YIRX 3IKMB 2ZMEB 1ULYA 4A54A 3JCUC 1ITYA 2QK0A 2EFOA 1YIJI 2VKNA 1IRGA 1NE8A 4A53A 3CCUT 1R58A 1ADYA 1HW1A 3RBBB 3CCLI 2ATCB 5D5WB 4M7AA 3T0YA 3MEWA 2VLAA 4MDWA 1KGSA 1VQ7A 2EYYA 1SEMA 4YP0A 4BB7A 2DDAA 5DCMA 3LSMA 1O3QA 2BVLA 2RN8A 4C92E 2V1RA 4NC7A 4HEA2 3TQ7P 4ZYGA 2DU9A 1SAUA 1IGUA 11ASA 3G4SI 1NLOC 2BE9B 2V1UA 5GAGJ 5ILUA 1OJLA 5L3EA 3HOZJ 1CGPA 1B07A 1HBXG 4RDUA 1M1EB 1XJWB 4M78B 2HSPA 4Y52J 1MV0B 1A5JA 2LG4A 3NEUA 1G6NA 4YRTA 1X54A 4P74C 2XPVA 1M3AA 3M9QA 3OYJA 2EFNA 4E2FB 3CXCA 3ZMSA 4C5HA 1VQ4T 1N8RU 2EFIA 5F0CA 1KU3A 1FIPA 4Z8AA 2VPRA 4K2EA 2Q0OA 1W66A 3QO5A 4AYBN 1QVGS 3HRSA