1RTDA

Structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
554
structure length
554
Chain Sequence
KISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTDTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDESESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a covalently trapped catalytic complex of HIV-1 reverse transcriptase: implications for drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords DNA TEMPLATE FOR REVERSE TRANSCRIPTASE
total genus 136
structure length 554
sequence length 554
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtdA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtdA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtdA05
2HMIA 1C0UB 3I5BA 4O0IA 4B9SA 2GV9A 4ECXA 4DSFA 5KI6A 1SV5A 1REVB 1RA7A 5HROA 3I0RA 3GILA 4HCCA 4B3OB 1KHWA 2RKIB 4CJRA 3LALA 4QWBA 2ZKUA 3HM9A 2IJNA 3V9SA 4KI6A 4DS4A 4DTJA 3NF9A 4CESA 3AA2A 5CYMB 3KKSA 1T8EA 4NZ0A 4FLWA 4E7LA 1JX4A 4BDYA 5KRTA 3RR8A 4CGHA 1S6PA 1S1XA 4ID5A 5CY4A 4F4XA 3NE6A 1RTHB 4J9NA 5DG9A 2XY5A 2ZE2B 3UQSA 4FW1A 4J9RA 1B9DA 4PWDB 3EPGA 2W7PA 2IC3B 4ZPAA 2E6LA 1DTQB 3M8RA 1RT7A 4RW8A 3NAIA 4N5SA 4ZP6A 4O3PA 2V0NA 3IRXA 4CHQA 3SUPA 1TK5A 4CF0A 5HRPA 5I42B 3QEXA 3BQ0A 3LP2A 1RDAA 4F3TA 2C22A 4FK4A 4J9PA 1FXXA 3RMBA 1VSEA 3CFPA 5KG5A 1X9SA 1WSIA 1U49A 4FS1A 5DQHA 1MMLA 3ASMA 3VQPA 4NLSA 3MXJA 3S3OA 4KSEB 4DU4A 3OLBA 4YR3A 1WN7A 3LZIA 4DEZA 3VQBA 3OYFA 1WSHA 3MR6A 4DLGA 3QINA 1S48A 2G8HA 3Q8SB 2YNHB 4CGFA 5KT3A 4C8LA 4CEQA 4FJ5A 5L1JA 4DTRA 4DFMA 2OA8A 4F3OA 4KBIA 4ECQA 2XHBA 1HQEA 1JLEB 3SQ2A 3T5HA 2D7SA 3OYIA 1HYSB 3THVA 4ZTFA 1ITGA 4GC6A 3TABA 3AVFA 1ZBHA 2BQ3A 1DLOB 3BREA 2W9CA 3ZT4A 4DL4A 2BRLA 3SI6A 2OPPB 2DPIA 3SUNA 4X2BA 2YHAA 4C8OA 4DG1A 2WONB 3O4QA 3SV4A 2R8IA 1JKHA 3OL8A 3VQQA 1S6QA 3P1GA 1BI4A 1T7PA 1RTDB 3RR7A 4ZHRB 3TAFA 1S49A 5KFQA 2YKMB 3L2RA 1U09A 4KHMA 2EX3A 1YTUA 3C95A 4NYZA 2W9AA 4JLHA 1T3NA 3AVCA 2R7YA 4CFBA 1IKYA 3C6TB 3L3UA 5KGXA 4E19A 1BCOA 3HVTB 1LW2A 4TLRA 4IKAA 4PQUA 3BJYA 3HO1A 3SCXA 2XCPA 1KFDA 3PX4A 4U6PA 1UAXA 1C1BA 1QE1A 3TI0A 3AVHA 1DLOA 4DU3A 1ZBUA 5L9XA 1S9EA 4IOBA 2B6AA 1N48A 1D1UA 3NFAA 3LP0A 3F73A 5HBMB 3BSCA 4CIFA 1YT3A 1SL2A 4RW8B 4NLXA 4I9LA 3BGRA 2WHOA 3MTKA 2FVRA 2GUIA 1ASWA 4CHOA 2DPJA 2AJQA 4O3NA 3HHKA 2G8WA 5F8GA 4WXOA 3QIPA 5KFRA 1WSGA 1WSEA 4FLZA 4KV8B 3JSMB 1RT4B 3AO2A 3VQ4A 4PY5A 1S1UA 4GC7A 3QLHA 3C6UB 4ZP7A 4KTWA 1HNVA 3WNGA 2E9RX 4KAZA 5KFJA 3NHGA 3HK2A 3T5LA 4PUOB 3DLKB 1DTTB 4BDPA 4KB7A 1TV6A 3M8QA 3ZSXA 3RB6A 3AVMA 3KK1B 4HUEA 4I2QB 1RTJB 2HNDB 3G0ZA 4KO0A 4FLUA 1BIZA 1S9GA 3ZSQA 3QEPA 4PQUB 4EP5A 4NRUA 4ZTJA 3L2WA 2DFEA 3VQ9A 4CGJA 5J2NA 4ELVA 1JLGA 1S0OA 4OPKA 4CIGA 1TL1A 1UWBA 4ICLA 4U7CA 3RBDA 4CJPA 5FRNA 4FM2A 3V81B 1NK9A 4IBNA 4ECRA 4IFYB 4CJSA 1RTIA 1ZYQA 3IGNA 5C24B 4F4WA 5F8IA 3N6LA 2GIQA 4IG0A 4CJQA 3V9WA 2HHQA 4CJWA 3K58A 1NK8A 3MEGB 4ZP9A 2F8EX 2D0AA 1SKSA 3L2UA 1JXEA 1RBVA 3IN5A 4H4MB 1TKZB 1NKEA 3M8PA 2JC0A 3G10A 2PYJA 1C0TA 1TKTA 2ZD1A 4CEBA 3HJFA 3KK2A 3AO5A 4ZPBA 3DYAB 2HVHA 4KV8A 2FBXA 4F2SA 4PA1A 3LANA 5KFSA 1FKPA 1NKBA 3I0SB 3V9UA 5SWMA 4MK9A 3SQ1A 4KFBA 3AVJA 3O3HA 5KFGA 4BE2A 4ID1A 2X6NA 3PO5A 3AVIA 4DSEA 4F8RA 4Z4FA 5F9LA 1S1TA 4CEEA 3KK3A 5KFCA 2YHBA 4ELTA 1UOCA 3KMQA 5L1LA 2Z1JA 3DRPA 4NLQA 4YMEA 4TQSA 4KFBB 4DTSA 3UR0A 3PW4A 3TAGA 3IS9B 3SI8A 1VSJA 4EYIB 3DDKA 4RNMA 1BCMA 2YKMA 5KFIA 1N6QB 2KFZA 4AILC 1RT6A 3I8DA 2VG6A 3TR8A 2OPQB 5KFPA 1S1WA 1KLMA 4DL6A 2CJQA 1S9GB 3DOLA 1RT2A 5KG1A 4ECUA 1SKWA 3SYZA 1HARA 2R2SA 4CEZA 4KHQA 4CJ4A 3VN5A 1WNSA 4Q43A 3FDSA 3M8QB 1SKRA 3HPOA 4KB1A 4R8UB 1O1WA 2FLNA 3N6MA 1LV5A 4RW6B 4O3QA 4OJRA 3I0RB 4M3WA 2IGIA 1JXLA 2QKKA 3OYHA 4FM1A 2BE2A 4Y1CA 1VRUA 4M3ZA 2HMIB 4KHRA 4BWJA 4F4YA 4H4OB 1U4BA 1S1TB 3GYNA 4QWCA 3RRHA 1RT7B 1N4LA 4CF1A 3QIDA 4OLBA 3DRPB 4Y3CA 3PJWA 2G8IA 4IG3B 4NRTA 4AHSA 3LP1A 4R0EA 1KTQA 3QERA 1BL3A 2JEGA 4E7JA 3NL0A 1WAJA 4FM0A 4IFVB 3PR4A 1SUQA 4NLUA 3BR9A 3AV9A 4O4GB 4B9VA 4WXWA 1R0AB 2KZZA 1LW2B 4O3SA 3ULDA 1DTTA 4CHPA 4Z4HA 4HUGA 1T94A 1QSSA 5KT4A 4JV0A 3HSTB 3OY9A 4CEFA 1LWCB 4KHYA 4ZHRA 5J2MB 1IKVB 2R8JA 3TAMB 1HMVB 3GQCA 5KG2A 2UVWA 2XWYA 3PW7A 5KT5A 5HLFA 3AVBA 4DSLA 4KHUA 2VG5B 3EPIA 3CFOA 3LP1B 3CJ2A 3FFIB 4RUAA 2HHWA 4F4KA 2HNZB 3TAPA 4MK7A 3H08A 4YR2A 2HWHA 5DG7A 1RBSA 3PX6A 3VA3A 1J53A 1ZBLA 4URGA 3OYAA 4QOZB 4FK0A 1S9EB 3H4DA 3PY8A 4G1QB 4KAIA 3K2PA 4QWEA 1OS5A 3QNNA 4DQPA 4RW9B 2FVSA 4FJJA 1Z26A 2IBKA 4IG3A 3DLEB 3CDWA 4URSA 2ASJA 1JLFA 1T05B 4LSNB 2X74A 5EWFA 2EC0A 1NK5A 3GV7B 3K5OA 3SQ0A 3DLGB 3SZ2A 4GW6A 3CIZA 3QO9B 4FBTA 1BQMB 4MIBA 4NCBA 4CJKA 4ZVFA 1C1CA 3KMSA 1HNVB 3RTVA 2IM0A 3KLGB 5DLGA 2AGPA 3ISND 1I6JA 3CJ4A 4OLAA 4DG1B 3QYYA 2FVPA 2ZQBA 2OPPA 3UPFA 4O3RA 3OL6A 4OL8A 2G8FA 4B9UA 5JXSA 4TXSA 1RTJA 2I5JA 3NH0A 1S5JA 2AGOA 4JUZA 3CJ0A 3AVAA 4DU1A 1QHTA 4DQIA 3PO4A 1Q9YA 3HVAA 4LQ3A 4ZPCA 2IS3A 2E9ZA 1RT2B 4EBDA 3H59A 4FW2A 3BDPA 3DLEA 3D5MA 4QCLA 1RTIB 3QGIA 5J2QB 2XCAA 3JSMA 4Z0UA 3T3FA 3EYZA 1TK0A 1QE1B 1VSLA 3NAHA 4J2EA 4W5OA 4N47A 3LZJA 2ETJA 3H40A 3S9HA 5KFYA 2PZSA 1LW0B 4EO8A 4E7KA 1JLCA 1IKWB 1TQLA 4YNQA 3RMAA 5KFBA 4TSXA 4KE5A 2F8TA 2YNGA 4E3SA 2LSNA 3CO9A 4IDKA 3KHLA 3KD1E 4JV2A 4G1QA 3RBEA 3NMAA 3V9ZA 3OS0A 4B3OA 4DL7A 3MEDA 1RT5B 4Y2AA 3LAKA 2Z1HA 1RBRA 4PUOA 2VG5A 2JEIA 4J9LA 2IM3A 1KSPA 3DRSA 4FLXA 1A5XA 3V1QA 1D8YA 4UQGA 2WOMA 2KZMA 1QQCA 4IFVA 4WZQA 3MEEB 4I2PB 4FBUA 3BQ1A 4ECWA 3CDEA 1L5UA 1TKTB 2ZD1B 1IO2A 1U48A 1X9WA 1GX5A 1K1QA 3V9XA 1K1SA 4M42A 4EO6A 4Q5VA 5DK5A 3VQCA 4ED7A 4J2AA 4KI4A 2HNYB 1G15A 5KT7A 4M95A 4O4GA 3CWJA 4CK1A 4DTXA 3LP0B 2W8KA 2FJVA 1UWBB 5KFOA 3T5JA 4CEOA 2FLLA 1YVFA 4JV1A 4KHNA 4Y34A 1NK6A 3OYNA 4DF8A 1NJXA 4Q44A 4DQQA 4RW4B 5J2NB 4IFYA 3D0PA 2AWZA 3AVNA 1W0HA 2OPRB 1T05A 2D0CA 4Z4CA 1FK9A 2IM2A 4CGIA 4J2BA 3SFUA 4DSJA 4ICLB 3BQ2A 4CK2A 4CIEA 4ECYA 2HAIA 2DFHA 1A5VA 1RDDA 4YFUA 2YNGB 1SL1A 5C25B 1TVRB 1RDCA 3BSNA 3S3NA 4DS5A 4XPCA 4I9QA 2RPIA 1HYVA 4M3RA 4LQ9A 2B5JA 3RB3A 3B6OA 1CZ9A 1HRHA 3OLAA 1GOAA 5KRSA 1QS4A 4CJFA 1L3TA 3OYLA 3NGZA 3OYGA 3H2LA 1X9MA 4ED2A 2W9BA 1JLAA 4W5RA 5F8NA 1BISA 3V4IB 2HNZA 3OYDA 1TKXB 4Z4GA 4WE1B 4RW7A 3KIOA 2YNFB 3VQSA 3CM5A 2IC3A 2VG6B 2BANB 1HNIB 3KHGA 4G3IA 1XR5A 3V6HA 4AHTA 4TY8B 4AH9A 1L3SA 3PW5A 4CJUA 3ZT1A 3GIMA 3SPZA 4LSLA 4NLOA 4R5PB 1N5YA 4M41A 3B6PA 2FC0A 1YVUA 4ED6A 1FKPB 4AHCA 1S1VB 1S0NA 1RT5A 1XWLA 4HTUA 1NOYA 4K8ZA 4M45A 5KG6A 1HMVA 3Q8QB 3KLFA 1TAUA 1EP4A 1L3UA 4EP4A 3QNOA 4Z4EA 4DTOA 1VSFA 4J9OA 3VQEA 2BE2B 4RZRA 1C0UA 2R8KA 1LAWA 1XI1A 2X6SA 4IQXA 1KLNA 5CZ2A 3T1AA 3U3YA 4K4TA 4F4ZA 1S1UB 1NK7A 2VA2A 3QGHA 2W8LA 3V4IA 3G6XA 3NF8A 3VQ5A 3RAQA 4ELUA 1J5OB 1JLAB 3PX0A 1NKCA 4KHWA 3H5YA 3TANA 3KLIA 1HYSA 3E01A 3ZSVA 4RNOA 3RWUA 1C0TB 5C24A 3K5LA 4Q8EA 2ZE2A 1QAIA 3LPUA 5HP1B 5SZTA 4J2DA 4FZXC 4ZVGA 1NNDA 3K57A 2V4QA 3KOAA 2V9WA 4AHVA 5CYMA 2B6AB 5F8LA 4FS2A 2HHUA 3AA3A 3SUOA 2XGPA 2OZSA 1BIUA 3IS9A 4FJGA 3NAEA 3IGVA 3FQKA 4Q45A 1D5AA 1HPZB 4ECTA 3LWLA 1D9DA 3BSOA 5FDLB 5KFUA 3HXMA 4CF2A 4CCHA 1BQMA 1C2PA 4FVMA 4B8AB 2XY6A 2PY5A 1IKYB 3C6TA 2XGQA 2R2TA 3DLGA 3OJUA 1MU2B 2OPSA 1S9FA 1EETA 3OYMA 4CJ5A 3AO1A 3QIOA 4IR1A 3PZPA 3GIJA 2GBZA 2BRKA 1ZTWA 1Z4UA 1RDBA 4FZYA 4H8KA 3KKRA 2W7OA 3UDLA 5I3UA 2HW3A 4J9KA 2B43A 2KTQA 4WFYA 4B9TA 5KFLA 1QSLA 4E1NA 2D3UA 4FJ8A 3N6NA 1RBUA 3NKYA 3DRSB 2OH2A 4O5BA 4RNHA 3OJSA 2AQ4A 3V6DB 4CECA 3UIQA 3GV5B 5I3UB 3SQ4A 3OVNA 2IAJA 3MEDB 1C0MA 4FJXA 2DFFA 2WONA 2OZMA 4M3XA 4QW9A 5DGBA 3AVLA 3SJJA 5HP1A 4CJEA 5JS2A 3QEWA 1WAFA 3NF6A 1NJYA 3O4NA 1RYRA 3ZSWA 3K59A 4KRFA 3HL8A 3FSIA 2OPSB 2Z1GA 1BHLA 1Z25A 1MU2A 3VQ8A 4YP3A 1LWFB 3WNEA 1JLFB 3GV8B 4IH5A 4IR9A 4DWIA 1FKOA 4ED8A 2ITGA 5DLFA 2CKWA 4EZ9A 3V81A 3AVKA 4E0DA 3SPYA 4MK8A 4ZVHA 2XC9A 1EKEA 3KLEA 3MR2A 3AA5X 4NLRA 1ZBIA 3ISNC 3RMDA 4ECVA 1UA1A 4YR0A 3KD5E 3NBPB 3PUFA 1JLQB 5T14A 4NLDA 5KFZA 3LP3A 4FCYA 1C1CB 4ZPDA 1WSFA 2RDJA 2D0BA 1F21A 3TVKA 4DL5A 5EUHA 3DI6A 1TKXA 1LWEA 2FJXA 4DQSA 2W42A 1YTAA 1SUQB 4FK2A 2D41A 5T7BA 2HHSA 2W9BB 1RT4A 1RT6B 5JUMA 3VQ7A 4DTPA 3OYCA 1RAJA 1TL3B 2KFNA 1IKXB 5KG4A 5D3GB 4IRDA 2QK9A 1QUVA 1NK4A 5EDWA 1TV6B 2XO7A 3M9MB 1U45A 4FJHA 1I3AA 4CF9A 3RRGA 4FJMA 4R5PA 3CQ8A 2Q3SA 4K4YA 3NF7A 4W5QA 2IMWP 3MECB 1EETB 1QTMA 2HHTA 1TGOA 4CHZA 3OSNA 1J9AA 2O4GA 4M3YA 3M8SA 1JLGB 3LP2B 5J2PB 5DGAA 2C28A 3QIPB 4O44B 3VQDA 1LAVA 2AX0A 2YNFA 4K4SA 1FK9B 3FRZA 5KFDA 2WOMB 5KT6A 3LWMA 1W9HA 3F9KA 1KHVA 3V1OA 5KFXA 4R8UA 4HHTA 4I7FA 4HCBA 5C5JA 4IRCA 4PWDA 3ZSRA 2QE5A 2FBVA 4DTNA 4TYBA 1JKHB 3HPGA 4FJIA 4LSLB 2WTFA 1C6VA 1S10A 3AO4A 4ECSA 2B4JA 1HQUA 2BQUA 3MF5A 4LH4A 3GIIA 2W9CB 3MFIA 4J9SA 4E7IA 1EX4A 4NLPA 3V6DA 3RB4A 3KJVB 1R0AA 3V6JA 2HB5A 3Q8PB 4JRPA 3H5UA 3BSAA 4O0JA 1JLCB 2F8SA 4AHRA 5EWGA 1ZETA 4IH6A 4JRQA 4URQU 2O4IA 5KFMA 3DRRA 2QV6A 1SV5B 1SL0A 3IG1A 1ZBFA 2C2EA 4M3UA 3HPHA 2FVCA 3G86A 1WNEA 4ECZA 1NJWA 4QWAA 2NUBA 4H4OA 4TN2A 5KFHA 3RMCA 2HNYA 2AU0A 4CFDA 3NDKA 4HUFA 4ZP8A 4OKJA 1Y97A 5JS1A 1KVCA 3HYFA 4ED3A 1IKWA 3NCIA 2G8VA 1IM4A 4HKQA 3MEEA 4MKBA 3HP6A 3OHAA 4CGDA 5J2MA 4DL3A 4CFAA 3VA0A 2IOCA 3L3VA 3VQ6A 4GMJB 2HHVA 3QESA 3BGRB 1XHXA 4B9LA 4OPJA 2ASLA 2YKNA 2FLPA 2R2RA 2RN2A 1KLMB 2D5RA 3CJ5A 4FJ7A 3KHRA 2A1SA 1NHUA 4K8XA 1Q8IA 2QXFA 3TAEA 3KNAA 2R8GA 4I2PA 3JYTA 3CM6A 3ZT3A 4WYLA 4K50A 4B9MA 3KLEB 1KFSA 2YKNB 3OYKA 3ZT2A 5KG7A 4QAGA 2JC1A 4IKFA 4LSNA 4KREA 2XI2A 2C2DA 2Z1IA 4OKKA 1VSMA 3OS2A 4XO0A 1B92A 4Y2CA 4AHUA 1CZBA 3ALYA 1KRPA 3LDSA 3A2FA 4RW4A 4N76A 2FJWA 1L3VA 5F8JA 3PR5B 1VRTA 3K5MA 1A5WA 1U47A 3CJ3A 3ZCMA 3CFRA 1N5YB 3H98A 4CERA 2YV0X 3KLHA 1VK0A 4J9QA 2ASDA 1VSIA 3O3GA 5HROB 1S1WB 3KHHA 3M8PB 3V1RA 2P51A 1TL3A 3EY1A 4C8MA 4Q0BA 4WYWA 3ZSYA 2WB4A 4K4WA 3QEVA 4C8KA 4FXDA 1Q9XA 2XRIA 4WE1A 1KVAA 1K6YA 2VG7B 5HBMA 3VQAA 1RILA 1RYSA 3OL7A 4MQ3A 1HYZA 2VA3A 4FZZA 4OGEA 3AO3A 3NGDA 3KLFB 3Q8RB 1QSYA 5K14B 2B5JB 3MXIA 2IDOA 2HNDA 4KO0B 3CVKA 3EZUA 4RU9A 3HP9A 2DY4A 3D28A 3P5JA 4IH7A 4EBEA 4W5NA 4K4XA 2DTUA 1QAJA 1S0MA 4E1MA 2XI3A 3DOLB 1ASUA 4CJLA 4NLTA 1IKVA 3QGGA 3KK2B 3M9OB 2BANA 2P1JA 2BQRA 3U3GA 4O44A 2FBYA 1JLBB 3TQ1A 4FJNA 4O55A 3E51A 4NCGA 5C42A 4KKOA 3L2VA 3DMJA 4CEDA 1S6PB 3HKWA 4NLVA 3QZ8A 4OKEA 4NCAA 4CF8A 1XC9A 2P5GA 5CYQA 3DLRA 2ILYA 4O4RA 4Y1DA 4K4ZA 3NBPA 2Y1JA 2E4LA 5E41A 3ITHA 2UUTA 4M3TA 4OVLA 3PHEA 4FJ9A 4MIAA 3L2QA 4BE1A 2I1RA 4O3OA 1J5OA 2R8HA 4K4UA 2E9TA 4CFCA 4LD0A 1GOCA 1W25A 4I7FB 3V6KA 1VRTB 5KTQA 4DMNA 2O5DA 1C1BB 2J6TA 2P5OA 1VSHA 4RNNA 1VRUB 3CYMA 2JLEA 1IG9A 1JLBA 5KFEA 5F9NA 4LH5A 5FDLA 1CXQA 3PVXA 5FROA 4Q8FA 1RBTA 5DQIA 1SH2A 1LWFA 1JLQA 5J2PA 4RW9A 3SUQA 1RT1A 1J54A 5J1EB 4RG8A 5KG0A 1IH7A 3SFGA 2KQ2A 1HJRA 3OS1A 4E7HA 3IAYA 1RTDA 3I5AA 1SH3A 5F8MA 3RAXA 2RF2B 4DLEA 3O3FA 3U6FA 3OYJA 3H5XA 1RT1B 3PW2A 1UA0A 4DSKA 2GC8A 4DQRA 4ED0A 2J6UA 3DRRB 1XHZA 3KLHB 5KFTA 2X78A 2BGGA 3MFHA 4FJKA 5FRMA 5KFAA 4Q0BB 4RNFA 2RDIA 3SNNA 2YNIA 3I5CA 1T03B 2E6MA 3GIKA 3NGIA 4QWDA 4DSIA 3K5NA 3DLHA 4IG0B 3FQLA 4TQRA 2Y1IA 3ITHB 1REVA 4F2RA 1S1VA 2RF2A 2OPQA 5KGWA 1NK0A 3KTQA 1RNHA 1BQNB 1TAQA 3QO9A 4BWMA 1XR6A 3DM2A 1NJZA 3KLIB 4CK3A 5J1EA 3MXMA 4KPYA 4WZMA 2JEJA 1JIHA 1DTQA 2IA6A 4E89A 4JS5A 3OHBA 2WCXA 5DG8A 4MH8A 1HPZA 3LAMA 3NGYA 1TKZA 1IKXA 3CG7A 4CJVA 4W5TA 4DF4A 1RTHA 3TAQA 4ID5B 4FJLA 2OYQA 4RW6A 3PW0A 3WNFA 4ED1A 1KVBA 1T03A 4BDZA 3HVRA 1XR7A 5KT2A 4CJTA 4KKOB 5KFNA 1JXBA 3I0SA 1CSJA 1X1PA 4KHSA 2IM1A 4KB0A 4NLGA 2AX1A 3RB0A 3QLHB 4FLTA 2A1RA 3ZT0A 1RT3A 1WSJA 3QETA 3DOKA 4TY8A 2ILZA 3DOKB 2YNIB 2YNHA 1S97A 4NYNA 2XY7A 3S3MA 4EBCA 4MKAA 1TP7A 1LWCA 2UUWA 1TL1B 5KFKA 4B08A 3DI6B 2V4RA 1JL2A 1GOBA 4DTUA 2WK4A 4DFJA 3PJXA 4BE0A 4DL2A 1C1AA 2G8KA 3QEIA 1RCHA 5F8HA 5HRRA 3KK1A 2JGUA 4IDKB 4B9NA 1N56A 2JEFA 3IG1B 1BGXT 1JL1A 2J6SA 2R2UA 4M94A 1TVRA 5KG3A 1B9FA 4CJ3A 5EU7A 3OYEA 3EZ5A 4B8CA 2ATLA 2GIRA 4HVJA 1S6QB 1BI4B 3TAMA 4MFBB 4C8NA 4RUCA 3CDUA 5J2QA 1FKOB 3HT3A 1HQUB 2FVQA 1RT3B 1S1XB 1RA6A 2BR0A 1D0EA 4OGCA 4H4MA 3OSPA 2G8UA 4QW8A 1WLJA 4CHYA 3ZSOA 3KJVA 4WFZA 4LY7A 2UVUA 3DLKA 3L8BA 3TARA 1TKDA 2VWJA 2XY8A 2F96A 3DMJB 4NCGB 5C42B 5EWEA 5DMRA 4DFKA 3WNHA 3KLGA 2IAJB 3HVWA 2PYLA 1I39A 4TYAA 3HVTA 5I42A 1HQEB 5C25A 3E01B 4DFPA 4KTQA 1ZTTA 5CZ1A 3ZSZA 4KTZA 1TK8A 4HYKA 3H5SA 4RW7B 4DTMA 5DQGA 4L8RB 2C2RA 2ALZA 2QKBA 4QPXA 4ZVEA 3SV3A 5L1IA 4NLWA 2UVVA 4XIUA 3KLVA 2OPRA 4TY9A 1VSDA 3LPTA 3G6VA 4WFXA 4Z4IA 4CE9A 1EP4B 3AA4A 4J9MA 4CHNA 1ASVA 5CYQB 4JS4A 3T5KA 4I2QA 3JYTB 3OL9A 4F50A 1VSKA 1LWEB 3DM2B 4N41A 4NLYA 1NHVA 3IRXB 2IJFA 5HRSA 1BQNA 2VG7A 4CEAA 1JLEA 2RKIA 2D3ZA 3C6UA 5HLFB 3PV8A 3P83D 4CGGA 1EXQA 2HHXA 1S4FA 5K14A 5KFFA 4IRKA 4N56A 4YQWA 4FLVA 1RDRA 3DYAA 4MFBA 2ATQA 1HNIA 4GVMA 1U04A 3MR5A 1N6QA 3MR3A 2EHGA 2VWKA 3TWHA 4FYDA 4XPEA 1CLQA 3G6YA 2UVRA 3QZ7A 3MAQA 3NH2A 2FBTA 3NH1A 3MEGA 2AGQA 3OYBA 4EEYA 4BACA 1NOZA 2I5JB 3KK3B 3H4BA 2BDPA 1D9FA 5KFWA 2KW4A 5KFVA 3MECA 4K4VA 4H54A 3T19A 3M9NB 4EYHB 1CXUA 4FLYA 3C94A 3DLBA 5L1KA 2HVIA 1GX6A 3ICLA 4EZ6A 1LW0A 5HRNA 4ZMMA 3D45A 3FFIA 2HWIA 1KCFA 2WRMA 3AVGA 4NYFA 5D3GA 1SH0A
chains in the Genus database with same CATH superfamily
3DXSX 1P27B 2BJ8A 2O8CA 4ECXA 1SV5A 1P90A 4ZS6A 5ETKA 3GILA 4HCCA 2DGVA 1VFJA 2KT5A 4DI6A 1KHWA 1HR0F 4CJRA 2A18A 1VJWA 3HM9A 3TNVA 3V9SA 5DZ7A 4DS4A 4DR4K 2B9YA 4DTJA 1RZMA 4NZ0A 5BR8J 4BDYA 5KRTA 1HBNA 1REGX 5LMNJ 1HKGA 2JX2A 3NE6A 1RTHB 4J9NA 1IBKF 1VISA 2ZE2B 4FW1A 1B9DA 3EPGA 2MZTA 4CQ1A 3M8YA 1DTQB 2G0IA 2KI2A 4QS8A 3CDBA 3DKDA 5ADXH 3KG4A 2V5HG 5I42B 4B02A 3A8KA 1HKBA 3N5BA 1K47A 2C22A 4IJAA 1H2UX 4L74A 1FXXA 5CD4H 1IQZA 2DB1A 5CR4A 1MMLA 1U02A 3VQPA 5HL7L 4OLPA 3MXJA 4AE5A 1WN7A 3VQBA 3PNIA 3OYFA 5M1PA 1SZ2A 1XTZA 2YNHB 2PN6A 4C3LA 3MMVA 3H45C 4F3OA 5BPNA 1HQEA 5CCLA 3QAEA 4OPAA 5H1SV 2W6KA 4JB8B 4ZTFA 2DO0A 1KONA 3QT7A 3VHQA 1ZBHA 5BJRA 1DLOB 4YUDA 2QGFB 5H9EK 3JAMO 4CM0A 2DPIA 2V2VA 2PGCA 4NYPA 4C8OA 2YHAA 1YGYA 3QB0A 1FD2A 2R8IA 5M2PA 2A6MA 1S6QA 3P1GA 1S59A 3RR7A 4ZHRB 1OIAA 1J5EF 4B3RF 1S4EA 2EX3A 1YTUA 3BGOP 4CFBA 1IKYA 1UJ4A 5KGXA 5HSPA 3ZYYX 2XMUA 4E19A 3DLLL 1VLYA 1MN9A 4TLRA 3HO1A 2W41A 2XCPA 3W60A 1Z6RA 2JVRA 3PX4A 4U6PA 4H5RA 1SKUB 1C1BA 1QE1A 3GR1A 4IOBA 1N48A 5D15A 3F73A 2V4JB 1RBOB 3BSCA 4LF7F 2JNJA 1SL2A 4RW8B 1FW6A 4OFZA 3CETA 1ASWA 2AJQA 4CHOA 4GVBB 2WVDA 5KFRA 3QQCD 4ANCA 4M1KA 1U0HA 5AQGA 1Y4ZB 3PACA 4BREA 4K59A 4OZ0A 3AO2A 3VQ4A 2BE7D 3QLHA 4KTWA 3WNGA 3G4SN 3NHGA 1RHRB 4AD6A 3BKTA 4BDPA 4AL5A 3ZSXA 3RG6A 1LFWA 1XIQA 2HVEA 2YCHA 4HUEA 4I2QB 1B99A 4JI3J 2HNDB 3ILJA 3IDHA 1BIZA 3LGNA 5E3PA 3ZSQA 3QEPA 4ZTJA 4NRUA 3HBTA 4UY8O 1G4CA 4CGJA 3W7BA 3HHEA 2G0JA 3THPA 1VJQA 1WEYA 1UWBA 3MMBA 3ZTOA 3CCUS 5C15A 4O8UA 5ETPA 2ASYA 3JS6A 1H7XA 4FM2A 2WUSA 3G8QA 4DV2F 4B3SK 3O8MA 1ZYQA 5HO4A 2AYEA 3NCQA 2GIQA 4CJQA 3V9WA 3MMJA 1CEZA 2X51A 1D8ZA 3CJTA 3W0LA 3MDFA 1NH7A 4DU8A 3M2VA 1SAZA 3I33A 1GFWB 4H4MB 2KHOA 1TKZB 1FRIA 1M5SA 3G10A 2PSZA 3HJFA 3LDPA 2B7CB 5AZIA 4KV8A 1URRA 1WKLA 4F4AA 4F2SA 4P2FA 5KFSA 4C48A 2ZC3A 3MEKA 3V9UA 5SWMA 4MK9A 1DT9A 3SQ1A 2J9DE 4KFBA 1BMQB 4MDBA 4ID1A 3CW2C 3ET6B 2KM8B 3KJNB 3PO5A 2YKOA 2H48B 2E7XA 2E1PA 2FJEB 3LF0A 1S1TA 3J7AN 3LUYA 3OTOK 3B82A 4M8LA 3TOQA 1F5AA 1FXDA 2YHBA 4ELTA 3UE5A 3KMQA 4PR6A 2Z1JA 2YX1A 4DTSA 3W5ZA 3ZETB 4TVAB 3IS9B 5A0YB 4MMOA 2XHWA 3L9ZA 2KFZA 3WZ0A 3K9KA 3I8DA 3L3CA 1CJVB 4YHHJ 2A10A 5BYRA 4DL6A 2VJUA 2PMZD 5AE2A 9RUBA 1PAUB 3BGLA 4CO0A 3PFOA 4MYTA 4H0YB 4ECUA 4DDFA 2N4CA 3SYZA 2RDDA 1X4BA 3VN5A 4MYUA 1E4GT 4Q43A 2CQGA 3NS6A 3M2VB 1IWAA 3D6RA 1X8DA 2J8AA 5E7OB 3HSZA 1GLEG 4RTFD 1DQ9A 2C2OB 2X3DA 2FLNA 3N6MA 2WSCC 2E1RA 1LV5A 4RW6B 3CCEN 3PIPL 4LIRA 2IGIA 3A12A 5THWA 3OYHA 3CCQS 2XMVA 1HNWJ 2ZDPA 1P9QC 5AE1A 3RRHA 3IFEA 3DAWA 4JI6K 3CJ9A 4OLBA 3HTVA 4LBPA 2G8IA 4X4UA 1KTQA 4HT5A 4C3MA 4EWTA 4DOZA 3WUHA 4LR9A 3ZXWA 4FM0A 3CC4S 4KH6A 2RRBA 2RS2A 2JZ5A 4O3SA 2MDAA 1FX2A 4QR2A 4ES3A 1D9AA 3HSTB 2Z2ZA 4LR8A 3OY9A 1DURA 1HNXK 1LWCB 2QLWA 1R3NA 3IM9A 2IRUA 2GJFA 2BUNA 3IC1A 3CMAN 2R8JA 1NGAA 3TAMB 1HBOB 4OHWA 2VKZG 5KT5A 5HLFA 2MKSA 1CULB 4DSLA 1SC3B 3QPIA 4ITSA 1U1NA 2VG5B 3LW5C 2OCEA 4Z94A 4XK8C 2F9WA 1X3MA 2HNZB 3PX6A 3W8GA 5DG7A 1RBSA 1ZBLA 4URGA 4QOZB 1S9EB 5AXLA 1G3OA 3W2WB 4KAIA 4QWEA 1KVKA 1OS5A 1DQ8A 5I4MA 3TSQA 4IOCQ 5ETOA 1TELA 1UVLA 2CPFA 3D0HE 3TA2A 2CPEA 2L9NA 3G82A 2DYAA 5AFUH 1BY9A 2X74A 4M5MA 3K5OA 4FBTA 4MIBA 2QIFA 3RTVA 1HNVB 2QLFB 1I6JA 4OLAA 1OY8A 1WC4A 4LFAK 1X5PA 2CPDA 1B0PA 1K44A 4CTAB 3UPFA 4O3RA 4KHPJ 1R8BA 4OL8A 4B9UA 4WBFA 2I5JA 3NH0A 4BQZA 4JUZA 3CJ0A 3WHIA 2QWQA 4LQ3A 2FYXA 4DV5F 4ZPCA 4FW2A 1U25A 3D5MA 3QGIA 5J2QB 4Z0UA 3GDQA 1N8RO 3DU5A 4OLOA 4J2EA 3THWA 1NU4A 1IUJA 1EQ0A 5KFYA 1EWRA 1IKWB 2HKEA 3E2EA 1N34F 4YNQA 3P38A 2YNGA 2BM1A 2GQCA 4H0PA 4JI1J 4RUBA 4IDKA 3VWSA 4G1QA 4CM2A 5GADU 4H0VB 2I7NA 1XJWB 4KT0C 3OS0A 4B3OA 4DL7A 2KYZA 3S7RA 4NA3A 1CZAN 4E8UA 2RRAA 1XMOJ 1FRJA 1UZDA 2Z1HA 2PC6A 4J9LA 3IRWP 1FEEA 1RTZA 3V1QA 2VC1A 4EHTA 4GKKJ 4QOTA 3PSIA 2KZMA 1WB9A 3CXCR 4WZQA 1L5UA 4JI8J 1TKTB 1U48A 1GX5A 1K1QA 4J91A 4BR5A 2NZTA 1FCAA 1K1SA 3HOSA 4HL9A 5LJ5Y 4NXNF 4ED7A 1Z2LA 2VF3A 4K25A 4M95A 1ACMB 1FRLA 5CH7B 2KM8C 4O4GA 2V8GA 4OYPA 2HRYA 4DKWA 3CC2N 4CEOA 4W4MA 2XZDB 1X3NA 1H74A 4DQQA 4RW4B 2DNLA 2YWWA 2OHDA 1HJOA 3AVNA 1W0HA 2W6LA 3D0PA 3DGVA 2DH8A 5AR0A 4Z4CA 3DLLQ 1XBWA 3ZEUA 4Z37A 3BYRA 4DSJA 4WFBL 4ICLB 4P10A 3Q8UA 4CK2A 1O0PA 4ZN1A 1R43A 4M5DB 2DFHA 1RDDA 1T9WA 2VUGA 1SL1A 2YHYA 1RDCA 4CO2A 3S3NA 4DS5A 1OQ6A 1QAXA 4XPCA 3EXYA 4I9QA 2RPIA 1IBLK 4FYVB 4MO4A 2B5JA 3RB3A 1CULA 1GOAA 3BEXA 3THXA 1L3TA 4WKYA 3VMFB 3NGZA 3H2LA 1X9MA 2W2NP 1JLAA 1QVGM 1BISA 4WE1B 4G6VB 4OMFG 3CM5A 4M5LA 4ES2A 2KXHA 3ZZYA 2VG6B 2M8DB 2DK2A 3I9V9 2BANB 1Q79A 1HNIB 2FF6A 4OX7A 3K8VA 3V6HA 4TY8B 3OVBA 5AQRA 3RBXA 2VQFF 4AT1B 2PFDA 1NMNA 5IWAJ 4M41A 2BUPA 3B6PA 2FC0A 4C1NI 4QU6A 4IWVA 1U7LA 1S1VB 3ZLJA 4JI4F 2EK1A 4FVCA 3Q8QB 2BV3A 2FC9A 3QNOA 4OIXA 4Z4EA 4DTOA 4J9OA 1ICEB 2X6SA 3CCVN 5CZ2A 4K5RA 4AM6A 2M2BA 2CQPA 2VA2A 3QGHA 2W2OP 2GCFA 4DUZK 5AT1B 4F0KA 4AL6A 1VHXA 1RWKB 4CBWA 3E01A 3ZSVA 4F0MA 1S22A 4E2FB 2Z30B 4Q8EA 2ZE2A 2DIVA 5SZTA 4ZVGA 1WBBA 1EIYB 4DHVA 1RCOB 4LBIA 2V4QA 3HFVA 4M5GA 1AZSA 4O8KA 1E6VA 2BKPA 4MT1A 2XGPA 2A3JA 2UU9K 4CJ7A 4OX6A 3NAEA 3IGVA 3FQKA 1D5AA 1U2VB 1T11A 4P9SA 1IJJA 3D2EA 3DXKA 4L76A 5KFUA 1C2PA 1K9MT 2PY5A 3OJUA 3DLGA 3AY9A 3OYMA 2DH7A 4CJ5A 2LEAA 5HK4A 3R9PA 3H20A 1UEVA 4PPDA 4DV4F 5AQJA 3M2RB 1Z4UA 3RSEA 2CIMA 3D68A 2LXFA 4PCQA 3UDLA 1Q82T 4ES1A 2DR7A 3NNCA 3BUZB 1YJTA 2MKYA 4B9TA 4JN4A 3O1WA 1MWMA 1IV0A 1RBUA 1RAAB 1Z05A 3TUIC 2CJKA 2V4JA 4O5BA 4RNHA 2WVEA 3V6DB 2HFOA 1S6UA 3H3NO 1D09B 3SQ4A 4CLLA 1C0MA 2DFFA 4M3XA 4QW9A 2JVOA 4ZLPA 3AVLA 3HI9A 1DEJA 2P9LA 3LGMA 1NG9A 1VQNS 2HYIB 3QEWA 3VERA 3QRPA 2AA4A 3O4NA 3CMES 3I4PA 3HX9A 3ZSWA 2Q0RA 1WDTA 3FSIA 1YI2N 2OIHA 2AYGA 1BHLA 5A8RA 1PC4A 1VRQC 3IR5B 3GV8B 4BRPA 4FWKA 2FTRA 1Q86O 3FLCO 5DLFA 2CKWA 4EZ9A 3V81A 2CDQA 3K9JA 4MK8A 3HM8A 4ZVHA 2XC9A 2B0GA 1UCNA 3C15A 2HFUA 2J8SA 3CEDA 4RR5A 4NLRA 1ZBIA 3LQVA 5HOOA 1NGIA 1U8SA 4UOGA 3QJJA 4G9ZA 4YR0A 3P49B 3KD5E 4QS9A 5BREA 3OQ2A 3NBPB 1XNQF 1JLQB 2CPXA 3BP8A 5JVHQ 2Q97A 3SAFA 3LPYA 1ESVA 1WSFA 2D0BA 2MKIA 1DRZA 3SSRA 4P71A 5EUHA 1FTCA 3DI6A 1NAQA 1TKXA 4FK2A 2D41A 1IBKJ 3BYPA 3VQ7A 3QGPA 3CCJS 1QD1A 2VV5A 2BBEA 5KG4A 5ETRA 2ZITA 4IRDA 1RLDA 2IPOB 3UCGA 1HWKA 3CQ8A 1N5SA 4K4YA 3BGUA 1PSDA 4W5QA 1H2TZ 2EK6A 3MECB 3FFKB 1V4SA 1EETB 1S99A 3MPWA 1QTMA 1TGOA 6FD1A 3OSNA 1R6YA 3R6LB 3QIPB 1HNWK 3T1HF 1NBWA 1SS6A 2YNFA 1FK9B 2V8PA 2WSEC 5KFDA 3THTA 2P9KB 1NLVA 2NRWA 3OFFA 1FTRA 3C7NA 5LMNK 5D78A 2H51B 1VQ6S 3H2VE 1RACB 1BWFO 4I7FA 4DV6K 4HCBA 3ZSRA 2NPIA 2RH3A 3PRBA 4LF7J 4TYBA 1JKHB 4FJIA 2ZH5A 3E8OA 4K8RA 1FWKA 4ECSA 3OPKA 4LRCA 3UVJB 4LH4A 4Y0WA 2DXEA 2JOQA 2WBNA 2MQ8A 3MFIA 1S72N 4E7IA 4NLPA 3PCOB 4KBOA 1UEKA 3V6JA 1SXLA 1M90O 3Q8PB 4JRPA 5F1XA 3H5UA 4NX9A 1WF0A 3QT5A 1JLCB 5EWGA 1ZETA 5LT5A 4JRQA 3MURP 2HZCA 3PKMA 4UOFA 4URQU 2O4IA 5KFMA 3DRRA 5AJ3F 3CCLN 4NLBA 3EVMA 1OH8A 2IDLA 1ZBFA 2D1CA 2E2QA 3TPQA 4WU2A 2EFVA 4M3UA 1RAOA 2O8EA 1PBUA 3IAM9 2R7TA 3TVYA 1DBDA 1NUEA 1WELA 4ECZA 1T0TV 2JFDA 1NRKA 3J7YI 3R3LA 2HNYA 3O6WA 4HUFA 5D4PA 3PYGA 2GVDA 5JS1A 4AFFA 4YOYA 3EICA 3NCIA 2NRRA 1IM4A 2J0WA 4MKBA 2R7SA 1LOUA 2POKA 1HWUA 5J2MA 4QIGA 4KHPF 4OI4A 1FEHA 2DISA 2QM1A 2H54B 5A2QY 3E9LA 4WF9L 3VA0A 2IOCA 2YKQA 3FEXB 3GTYX 2HHVA 1XHXA 4B9LA 1C4AA 2OI2A 2GMHA 2F4VF 3N4WA 3KHRA 4JHDA 2QMWA 3HKZD 1NHUA 2C42A 4QS7A 2QXFA 5A76A 2PA8D 3TAEA 4WFNL 1FRHA 3JYTA 3ZT3A 1LXJA 1KFSA 5BYSA 2H5EA 4ZCIA 3OYKA 4QAGA 3AOAA 3I55N 3MM8A 2JC1A 3J81O 4N77A 3O5TB 2MXYA 4LSNA 2LEPA 1RISA 2BM0A 2C2DA 2Q0UA 4ZOSA 2ZBQA 4UOCA 3BO2A 1B92A 2I9SA 4AHUA 1CZBA 2FJWA 3PR5B 1VRTA 4BC2A 2F1FA 1J5EK 4B3RK 3JXUA 4WP8A 1VQNN 4YHHF 3WEEB 3IXQA 4J9QA 4JV5K 1S1WB 2CDRB 2EBGA 3AJDA 1HD0A 4CRJA 4K4WA 1PJ6A 2RE1A 4FXDA 1Q9XA 4FWSA 1SC1B 2EFPA 3OTCA 4BQLA 1K6YA 2VG7B 4DR6J 1GXLA 3R1XA 1RILA 1Y5NB 3CJSA 1EAYC 3R7BB 1OMSA 1URNA 4WCEQ 2VA3A 2OEJA 3M6XA 3V4MA 2B5JB 1YJWS 4Y0FA 2PI5A 2F3JA 1NGFA 3E9PA 4F36A 4K43A 3EZUA 5CCMA 2BW7A 2DY4A 3WX8A 1V9OA 2LU1A 4IH7A 8ATCB 1XUPO 4W5NA 1PAEX 2A2DA 3MM8B 1S0MA 5CA5A 3DOLB 2U2FA 2KVIA 1FNOA 4C6AA 2GWKA 3QGGA 3KK2B 2RQKA 2BANA 3EDRB 1YAGA 2V9KA 3E51A 1A6LA 4OX9F 3L2VA 3DMJA 3BBFA 3X3UA 4DL0C 4OKEA 5A8WA 5CYQA 3NMUA 1BUXA 3G8SA 4Y1DA 4K4ZA 2VBXA 1S77D 2Y1JA 5E41A 4LF8J 3MDQA 5IWAF 4OVLA 4LFAF 4BE1A 3L0QA 4U67L 4B1YB 1FRXA 1J5OA 1T3OA 1RGIA 3GP9A 2E9TA 5E0OA 4DHYA 1GOCA 1EARA 4I7FB 1GMWA 3V6KA 3R3TA 1N34K 2ZHBA 1WC3A 2VKRA 2EG1A 4GMKA 1VRUB 4RL1A 2A42A 3CYMA 4PQAA 1JLBA 5KFEA 5F9NA 4LH5A 5FROA 1BA0A 3TJ9A 5DQIA 5J2PA 3SUQA 5DDRC 1J54A 2J9EA 1HJRA 4K0KF 3W3SA 1IR0A 1SH3A 5C10A 4DR1K 3O3FA 4CZIA 1P8ZA 1RGVA 1ZZFA 2MJNA 3H5XA 1FWPA 1HWLA 1UAWA 1VGYA 1YIJS 2GUPA 1TYQA 4WP3A 2NNWA 5BYQA 4RO0A 5IZHA 2HFVA 4C0BA 5CZXA 2QA4G 5KFTA 1VIOA 4DUZJ 4FJKA 4ILRA 3GG0A 1JCGA 1RWNB 5KFAA 1LK7A 3UKUA 4RNFA 2YNIA 4DPXA 3I5CA 3GIKA 4JI5F 4CTAA 3LM9A 2E44A 3DLHA 2GA7A 4F04B 2Y1IA 1REVA 4F2RA 1S1VA 1XQSC 2A5XA 3KTQA 1RNHA 1LOTB 1BQNB 1UFLA 4B3MK 3HD2A 4NXNK 2E5LF 4DR1F 2CJ9A 1XR6A 2NUUG 5FLXY 3KLIB 4KC5A 4AXJA 2BEFA 4KPYA 3MXMA 5CYJA 4F7VA 2JEJA 4IDHA 4NPOA 3BZQA 2V6AA 2J0QD 2EEYA 2WCXA 1HPZA 1XNQK 1HFEL 3LAMA 2Z57B 1FF2A 3NGYA 4CJVA 4DF4A 3TAQA 2FGCA 3PW0A 5D0RA 3WNFA 1T03A 1YVNA 4BDZA 2HSTA 1X9JA 1XR7A 2QW9A 3M7VA 5KT2A 2DHSA 1K73T 5KFNA 2GVZA 2A3ZA 5FLXO 4AQYJ 3UW1A 3RB0A 3ETOA 1WKKA 3VF2A 5GADI 4TY8A 3P4UB 2ILZA 3GFXA 2ZH6A 1S97A 4MKAA 1Q18A 1LWCA 2UUWA 5E3QA 4H5NA 2LDIA 4JYAF 4V19X 1PBAA 3K0SA 1CLFA 1VDHA 2DNMA 2XS2A 4BE0A 3WC0A 2BW2A 4DL2A 1C1AA 1GMWD 2G8KA 3QEIA 2IMOA 2M9KA 1RCHA 3NCRA 1HLWA 4YY3J 5F8HA 3O5BA 4IDKB 2DNOA 4B9NA 4CIOA 2JEFA 2M7SA 1BGXT 4WYBA 2FGOA 5M1OA 3D4JA 4KPCA 3U1NA 2L9DA 3QICA 2QSFA 1RUSA 5BR9A 4B8CA 1WD6A 2ATLA 3Q86A 1BI4B 3W63A 1KVJA 3N0VA 3FBBA 1NGEA 5ETQA 2LDYA 2VGNA 1KTVA 4OGCA 2G8UA 1PYSB 3NXZA 4LY7A 2MZ1A 4KGMA 3DLKA 3MD3A 3L8BA 4BS2A 3TARA 1NSPA 2VWJA 3DMJB 3R5CA 2F96A 2HIQA 2IAJB 2LMIA 4TU8A 3HVTA 3J80O 1ZTTA 1OKJA 3BBBA 3SQGA 2P9UA 3IKMA 1E6YA 1TK8A 2EFQA 2ZWOA 4DJBA 4K0KJ 3DOMA 4XEIA 1T95A 4L8RB 4DPTA 3IAS9 5AQPA 3OXLA 3CJKB 4FVUA 5EX3A 1F2HA 5ETMA 5L1IA 4KYZA 3WIUA 3OR1A 4XIUA 1ZZNA 2ZKTA 1MROA 3LPTA 1WHWA 1M0SA 3AODA 1KN6A 4Z4IA 4J9MA 4LF9J 4WQ5C 4KHPK 3T1HJ 5A8KB 2OANA 3T5KA 1A7GE 1BA1A 4HH1A 3A3PB 3CCSN 2BABA 3VGVA 2M5YA 1LWEB 4NLYA 4C8YA 1NHVA 1RAEB 3IRXB 3U1MA 2IJFA 5LL6d 4DPUA 1BQNA 3BH7B 4J37A 2NSBA 2RKIA 2A40A 4QIWD 2HHXA 5K14A 4JI2J 4PKHA 3FVYA 2ATQA 1NGGA 1U04A 3MR5A 2EHGA 2VWKA 1H0HB 3O9UA 2XMJA 4CZFA 3ZETA 1W26A 1Q8KA 2A6AA 5DJBA 3A1YG 1AA1B 3D3CJ 4RBVA 4BACA 2KRBA 1NOZA 1NWKA 1TFWA 5KFWA 1HI1A 3O9RA 4C11A 4K4VA 3T19A 3M9NB 4YY3F 4FLYA 2EKYA 2X3GA 2P8IA 3HF5A 2HVIA 3JTNA 4ZMMA 1XN9A 4LR7A 3EL2A 1KCFA 4YS2A 3TUZC 4NYFA 5D3GA 5GIPA 1JJCB 4O0IA 1S5ZA 3MR7A 4B9SA 5ITHA 3W9HA 4CH1A 4LUBA 5HROA 3ZZPA 2HS3A 4B3OB 3BF3A 2RKIB 3LALA 2NRHA 4QWBA 3VEXA 2QL5B 2IJNA 4JHDB 4KI6A 3NF9A 3AA2A 3JTPA 1VMBA 1NEEA 4A57A 4FLWA 3CE8A 4E7LA 4HLBA 2GHWA 1JX4A 4OZJA 2GIFA 3EVOA 3G87A 3C6AA 1YHQN 3QATA 1G6BA 1WBDA 4WFBQ 3UQSA 4OZLA 4J9RA 3CD7A 4DR5J 4NASA 4CWBA 2W7PA 3J7A1 5IT9U 3M8RA 2MB0B 5E3CA 5GMDA 1RT7A 1YF5L 4BGAA 3NAIA 3PJ9A 3CDAA 2QWMA 3N4QA 1TK5A 4DCOB 3BQ0A 1WG5A 4L3NA 4FK4A 3C46A 3M8ZA 2FHOB 4WIQA 3DWLA 4GVLA 4DPYA 1VSEA 2P9SB 3CFPA 5KG5A 1X9SA 1WSIA 2FY1A 4FS1A 2D74B 4YB1P 2V34A 4CZCA 2P9IA 3EKUA 2JH3A 3OLBA 4YR3A 3LZIA 2O8BA 2ACYA 4DEZA 3HHNB 4I6YA 5AQOA 3D2FA 2VD3A 1CQMA 5AQTA 4CGFA 3NS7B 1VBKA 2NXJA 3KUGA 2ADBA 4DFMA 4GVEA 4YOTA 2OA8A 2YBVA 2XHBA 3UVJA 3TZZA 3C0BA 3NNAA 2IYIA 3IR6B 1HYSB 2DNRA 3QBWA 2VASA 2MTLA 3R27A 3THVA 2W01A 3TABA 4LVOP 5IQQA 2W9CA 2DR9A 2BRLA 2P9NA 4IOXA 1FE4A 4WKRA 3C16A 3O44A 4X2BA 2F8MA 1VQ4N 3AA9A 2WONB 3SV4A 3OL8A 3VQQA 3D2FB 5AQUA 3CIMA 3J7YP 2YKMB 1U09A 4R79A 3C95A 4NYZA 3AVCA 3FMWA 3L3UA 3LM2A 1WTFA 1KD1T 2B8QA 3HVTB 1LW2A 2CNLB 3VEOA 1FVSA 2UU9F 2D0PA 5KPTA 3BJYA 4WTOB 2QWNA 4O5FA 2H65B 3A3OB 4FXVA 3AVHA 4LF5J 1DLOA 3D9BA 1S9EA 3TSPA 1D1UA 3LP0A 2L08A 3G4SS 3FEYB 4OI1A 5KPRA 2RMLA 1QJHA 2ASOA 5A2QO 2GMLA 5CXTA 1RKJA 2DPJA 4O3NA 2K7KA 3R5GA 2G8WA 1NMEB 3VTIA 1WSEA 4BY9C 3THXB 1RT4B 2F5GA 5AQYA 4GC7A 2N7CA 3FBEA 4RWTA 2PBDA 1JQGA 4USUA 1HNVA 3HK2A 2LQJA 4PUOB 3DLKB 1TV6A 2CQHA 3SCIE 4H0OA 1T9XA 1RTJB 1H3DA 1O13A 3GCXP 1WKJA 2CZ9A 2CYYA 2J7KA 4X4TA 4EP5A 3L2WA 4NYOA 2ZHOA 2HK3A 1ILYA 3M2UB 2MLYA 3ADAC 4ELVA 4OPKA 2WZ1A 5JVHL 3OD2A 3EE3A 1I51B 5FRNA 3B78A 2ZH4A 1Y0HA 2E5IA 1NK9A 3TSUA 4X62K 4QJVA 4IFYB 4AQYF 1LNQA 1RTIA 5C24B 5F8IA 2YPZA 3ZX3A 1F6TA 4IG0A 2DCUB 2KHDA 4DUYK 3K58A 4ZP9A 2ZJQL 2YPYA 2F8EX 1CS4B 1Q5VA 3QSYB 2VL1A 4GKKF 1RBVA 2F4VK 2JC0A 2ZD1A 4CEBA 3KK2A 3AO5A 5D77A 4U7UK 2VPZB 1HKCA 2DNZA 1M5HA 1WC1A 2FBXA 7AT1B 1TTHB 3CCRN 4FPAA 4PA1A 1U2CA 2QX0A 1VQYA 3E9OA 5B0AA 3O3HA 3W1YC 1U0SA 2MHEA 2X6NA 2QFJA 3TW0A 4USJC 4Z4FA 1E3MA 2MYFA 2XSJA 4A8YA 1OVQA 3G71S 4DV6J 1UOCA 3UKRA 5L1LA 1BWEA 1KDNA 3BN7A 3GE1A 4TQSA 4KFBB 1T6DA 4OHVA 3TAGA 1MLAA 5IQ6A 3MI7X 3DDKA 2FD2A 4RNMA 4B9QA 3MOZA 1BCMA 2YKMA 4DX5A 5KFIA 2LXUA 3KHYA 3CCES 4C3KA 3PYFA 3MPYA 1IBMJ 3TR8A 2OPQB 2DY9A 5KFPA 1IBKK 3L09A 2HF4A 1WEZA 2E5HA 4DCHA 2P9EA 3KXDA 1SKWA 4B1ZA 3FDSA 4KB1A 2FXUA 3UNYA 1LK5A 1O1WA 4P73A 1F3FA 3Q7CA 1VHFA 2FLOA 4M5NA 1CBKA 4O3QA 2NXCA 3I0RB 2OTLN 4WK3A 4M3WA 3UKRB 4RX6A 3TR5A 1BOTO 3CERA 1VRUA 5JVGL 2HMIB 3OW2R 1U4BA 3GYNA 4QWCA 4YDUC 1HBMB 1Q5YA 2X1FA 4D3HA 1HX1A 5GMKa 2A41A 4Y3CA 3PJWA 4DV1F 4CD3A 4IG3B 3SBGA 4AHSA 2WAQD 3QERA 2QJ3A 2KL8A 2ZH2A 1BO5O 4E7JA 1WAJA 3PR4A 1SUQA 4NLUA 4B9VA 2EWSA 3AV9A 1R0AB 3U27A 3ULDA 2R7RA 1DTTA 4CHPA 4Z4HA 5HVHA 3O80A 5EVZA 2DITA 1NGBA 2XLKA 4KHYA 4ZHRA 5J2MB 3I82A 1MWQA 1QVFR 5LMUF 1X0FA 3WQTA 1HMVB 1LEOA 3KWGA 3AVBA 2XTJP 4KHUA 4GO7X 5BPMA 3NG8A 3MX5A 3FFIB 3T41A 4P2XA 1Q86T 2HHWA 4F4KA 1R7IA 5B7WA 1JNRB 3G25A 3TAPA 2HWHA 3VA3A 1J53A 3MM5A 2CQ1A 3G71N 4XDDA 4G1QB 2QWLA 1QVFM 3QNNA 4UF4A 2L9WA 4IG3A 2ZZTA 1N0UA 3DLEB 4URSA 2AP1A 3UD5A 4QZVB 4MLEA 4NXMJ 5EWFA 3FGUA 3DLGB 1VQ9S 2GFFA 3JSYA 3QO9B 4HTIA 1AYEA 4CZJA 3CPWR 2IM0A 5DLGA 2AGPA 3ISND 2FVPA 3Q2TC 3GCWP 5AZJA 1S5JA 2X7IA 3WDOA 1Q9YA 3HVAA 2GEMA 2BOAA 2HBJA 4H0TB 2E9ZA 1RT2B 2KRRA 1FFGB 3H59A 4Y2MA 3EZOA 5GAHP 3JSMA 3T3FA 3EYZA 4WIIA 1TK0A 2GMJA 1RFQA 1VSLA 2WW4A 4W5OA 2HVDA 3LZJA 1H6KX 4KJIA 1YXQA 3H40A 3S9HA 3ETMA 1LW0B 1JLCA 1RABB 1X60A 1TQLA 1M1HA 5KFBA 4TSXA 2JSXA 4KE5A 3TYTA 2F8TA 2DR8A 1O6XA 2DNGA 2DNKA 3WIVA 3KD1E 1RAGB 2A2CA 3RBEA 3NMAA 3M8WA 1SQEA 3V9ZA 1EX8A 1CQNA 2P9GA 3MEDA 4Y2AA 5AQLA 2VBYA 2M8HA 4LFCK 1RBRA 2JEIA 2IM3A 4CZLA 1KSPA 3DRSA 3HJVA 2MMYA 4FLXA 3CJKA 5MLCV 1SIZA 4IFVA 2G9OA 4DX6A 1P1TA 2ZNYA 1IO2A 3D0GE 3V9XA 3HDSA 1NSAA 4JI5J 3VAMA 4M42A 4EMDA 2M4MA 4AYBD 4IEEA 1U6FA 2VJVA 4J2AA 4KI4A 2HNYB 4BC3A 5KT7A 2UUBF 4CK1A 2DRAA 2O8FB 2FJVA 1UWBB 2DHGA 4JV1A 1WDDA 1NK6A 5LOQA 3OYNA 3ZX0A 1NJXA 4IFYA 4MO5A 4CYUA 3ILIA 2AJFE 4NZ6A 1G2EA 4YDUA 2O8DA 1S3XA 3SFUA 3BQ2A 4E1JA 2R7UA 4Y28C 3QBCA 1IR2A 3DXBA 3GZ7A 1TR0A 2ZFHA 4JI0K 5C25B 4C1NK 2BJ9A 2G1DA 3D67A 3BSNA 2AZ3A 4LQ9A 1TUWA 1I94J 1YQHA 4B3SF 3B6OA 2Z4PA 1CZ9A 4FF4A 5KRSA 4LF8K 1QS4A 1ZM2A 3KDNA 1ZAXA 1ITPA 3OYGA 2HGLA 2DNQA 4ED2A 5F8NA 1V6HA 2QRRA 3OVSA 1JXVA 3UDEA 3KWMA 4JI8F 2YNFB 1UEUA 2OTJN 1YJNS 5M2UA 2IC3A 4NA1A 5GAGP 4G3IA 4AHTA 4AH9A 2XEXA 3AY0A 3D1OA 2J0SD 4CJUA 1NZ8A 5A8RB 3GIMA 2JWNA 2AEJA 4BR9A 5D0EA 1LCUA 3QNWB 1IJEB 4ED6A 2BJ7A 4AHCA 1S0NA 3CPWM 1XWLA 3WXJA 1NOYA 4M45A 5KG6A 4X4QA 4ER8A 1HMVA 1TL5A 3TUJC 4M63A 1TAUA 2MGZB 3QRRA 2ASPA 1L3UA 4FKXA 5GINA 1BG3A 4EP4A 1VSFA 3GG1A 2CGKA 4RZRA 4GV9A 3CCLS 1LAWA 2MQNA 4IQXA 2YWGA 1RDUA 3HRGA 2FZGB 5I3QA 2VQEF 3U3YA 1CJUB 1M5OC 2HGMA 2QN6B 3G6XA 2DRBA 1T02A 3NF8A 3RAQA 4ISGA 3E66A 1NKCA 3H5YA 3TANA 3KLIA 2CJYB 3MM7A 2AJ2A 4RNOA 4CO4A 2YXLA 4USTA 4PL7A 5JMNA 3LPUA 4J2DA 1AUDA 4FZXC 4USKA 1RAFB 1B3TA 3KOAA 2V9WA 4AHVA 2K3IA 4B3MJ 1N36K 5E3RA 1KP6A 5F8LA 2HHUA 2OZSA 1PG5B 1SI9A 2BX6A 3FKBA 4LF7K 4OJGA 4LJMA 3IS9A 1T44A 3IBCB 3FZFA 4FJGA 3ZNJ1 2NXUA 4FPRA 3ENAA 4ECTA 3IP0A 4CF2A 4CCHA 1YX2A 4FVMA 5HN0A 1J6ZA 3C6TA 2HLUA 3GFZA 1F2GA 3E1YA 2OPSA 1S9FA 1EETA 1ZA2B 5L46A 5DO2A 2GBZA 1F60B 2GWJA 1VQ7N 3ZEUB 5E84A 1WOQA 1HWIA 1RDBA 3DRYA 1HI0P 1FDBA 2OSRA 2PIIA 2W7OA 5IM0A 5C2GA 4NZ7A 2ZWPA 3W2WA 1FESA 5AXMA 1CJKB 2M70A 2HW3A 1GTHA 2DT9A 2KTQA 3OXFA 2C2MB 3L7OA 3CF5L 1QSLA 4FJ8A 3B4DA 3QDKA 4Y6IA 3RBZA 3DRSB 4C98A 2COLA 2OH2A 1S7IA 1G99A 2DCLA 3CF5Q 2C2KB 3NGUA 2PD1A 2AQ4A 1WSRA 3H1VX 3TJ8A 2OGUA 3GV5B 4A48A 4LF4K 2KB2A 3OVNA 3D6TB 3DU6A 3MEDB 4WF9Q 5DGBA 1IXKA 1N32J 4DV2K 2P9CA 2ASMA 2HMPA 5JS2A 3JB9k 2MLXA 4JI7J 3A8EA 3NF6A 1NJYA 3EUNA 3R2DJ 4BR4A 4CD1A 4DR4F 3T69A 3VQ8A 1LWFB 2C2ZB 4LF9K 4ZPTR 4PKIA 3C2PA 2HVZA 3T1HK 3MCAB 4IH5A 1FKOA 3TVZA 3W8PA 4ED8A 3QBXA 5HQ8A 2F9TA 3GFYA 4DR2F 3MPUB 4E0DA 1QQOA 4CZKA 3TEHB 4X4SA 3UCZP 2LU2A 2C3YA 4H5WA 4LF2A 1W7AA 1UA1A 4I6MB 1C4CA 1Y7PA 5IFMA 2C3MA 3MWTA 5F41A 5T14A 4NLDA 5KFZA 3LP3A 2N7YA 4Z2XA 3MCNA 2F63A 2RVJA 3N4PA 2WB1D 3Q7BA 2RDJA 3TVKA 4ZA1A 1ZAWA 3NOCA 3QFHA 1SQGA 1VQKN 2QA4S 1VQKS 5M1NA 4JV5J 4ZVRB 2PFFB 2NZCA 3TU5A 5JLFA 1RT4A 2XB2D 3SK3A 4DTPA 1YRUA 1CJKA 4K2JA 3I55S 1RAJA 1TL3B 2DNPA 3NGRA 4A8QA 1CVJA 4P52A 3GSIA 1JJ2R 1I3AA 3R9LA 4FJMA 4R5PA 2Q3SA 1WTBA 3FZHA 1NJIO 2BOPA 1V4TA 2Q79A 2V63A 2E7VA 3SDEA 4C11B 4CHZA 4ZCLA 4M3YA 3M8SA 3DHWC 2P2CB 1MROB 4A8OA 4O44B 1QZ5A 3VQDA 2QWPA 2AX0A 2KU7A 1BDGA 3DLJA 1W9HA 4OI3A 3O3LA 2BJ3A 1FERA 4R8UA 1UVJA 3EMTA 1TU0B 2VBZA 4IRCA 1SPBP 3CCQN 2FBVA 4DTNA 3BPSP 3HPGA 3AJ1A 2WTFA 4GKJK 1C6VA 4ILJA 4FOEA 2B4JA 2HZVA 1HQUA 4BRHA 3MF5A 4ENOA 1KAZA 1F9HA 3JAMY 1PYOB 1EX4A 3V6DA 4X64F 1LKZA 4O0JA 1ZXOA 3PYEA 2F8SA 4JNEA 4AHRA 3SCLE 5AQVA 2UUAK 2RD5C 2NRXA 2UUCJ 2HQCA 2OEKA 3J7AP 4I67A 5AQFA 3ENHA 3GFHA 1SV5B 3IG1A 4J9UE 3RVCA 2C2EA 3M32B 3HPHA 3MK6A 5L39A 5LXYA 2MY8A 1H72C 2NZ4A 2K8GA 3MCPA 4QWAA 2NUBA 4H4OA 4TN2A 3RMCA 2AU0A 3TEGA 3H2UB 4OYIA 1NB2A 2OTLS 2QZ8A 1Y97A 4JD2A 3VCDA 5M1KA 4HKQA 3M30B 1VQ5N 3OHAA 4CGDA 3SCKE 4YOWA 2YWKA 1RHKB 2CQ2A 3P8BB 3OV7A 3L3VA 3VQ6A 4GMJB 3QESA 4DBQA 3BGRB 2ZH8A 2ASLA 2FLPA 2R2RA 4NMLA 3HFKA 1M1KT 4HACA 3CC7S 2YQ1A 3QT6A 4UW2A 1SJRA 1TMMA 2A1SA 3F41A 2IVFB 1H73A 4BRLA 2Y9HA 3T7ZA 2MZJA 3RSEB 2E8AA 1X4EA 2V67A 4K50A 4B9MA 1EKRA 1T3VA 2YKNB 3U7JA 3D6FB 4BRIA 4IKFA 3KFWX 4I56A 4OZNA 1UZHA 2Y1RI 1HKAA 4OKKA 1PJ7A 3D2EB 3OS2A 4XO0A 1HHQA 3MD1A 1KRPA 2H3EB 3ONQA 5H9FK 5D0GA 1L3VA 1ZPVA 1S79A 3CUNA 4FKYA 1W2IA 4DV7K 1I5OB 3K5MA 1A5WA 3SIPB 3L4BC 5DETA 2YWEA 5CZVA 2KFYA 4DB3A 2J0XA 1GLLO 3KLHA 2B9WA 1VK0A 1UTAA 1NCLA 5HJXA 4V19J 2Z2YB 3THYA 4D3GA 1VSIA 5HROB 3O3GA 3KHHA 1VQ9N 4NI2A 4WYWA 3ZSYA 2AJ1A 1EO1A 2XRIA 4CLSA 4WE1A 3CD5A 1C0GA 3DXMB 1KVAA 2CFXA 3VZIA 4YORA 4ILHA 3IMQJ 1VBYA 2MKHA 2OSQA 2CQ4A 4FN5A 1RYSA 4R0JA 3CJAA 1GLDG 1HYZA 3AO3A 3NGDA 3M05A 3Q8RB 2Z58B 1QSYA 3MMBB 3ET6A 3HHLB 1EWQA 5IT4A 2ZGZA 4B1VA 1QUPA 2ZH9A 2QLJB 1VK8A 4EBEA 3A13A 4E1MA 3CMQA 2XI3A 1YBUA 3OHRA 1ASUA 4ZIVA 2QEXS 4YOEA 1WHXA 4WQ5A 3AA8A 2QC3A 5BRFA 3M9OB 1Y64A 3QMQA 2FBYA 1JLBB 3HHLD 2ZHAA 4L6V3 4FJNA 4NCGA 5C42A 4KKOA 3MCSA 3HKWA 2E2NA 4NLVA 2F4VJ 1EQYA 4PXEA 1DAXA 4DQ8A 2BACA 1E6YB 1ZAVA 1RWPB 1HI8A 4O4RA 3WX4A 4DR7K 3DN9A 4CLFA 4K41A 3D66A 3C14A 1NGDA 3M3ZA 3ITHA 4M3TA 3PHEA 3PIOL 1RQ0A 1SC6A 4FJ9A 2E5LK 4JKDA 4BG9A 1R0BG 2R9LA 1RKIA 3FBCA 4O3OA 3G6ES 1F5BA 1YJ7A 3MM6B 4LD0A 5A8WB 2PMWA 3CD0A 2CPHA 5KTQA 1NSQA 1JNZB 1H2VZ 2H1YA 4DMNA 1C1BB 2J6TA 1VSHA 1HL6A 3F0NA 4RNNA 1IG9A 3W9JA 2L41A 2BXJA 4YEAA 2E66A 5FDLA 3EGWB 2PMHA 3PVXA 4UY85 2QA1A 2ZH3A 1SH2A 2R42A 1LWFA 3C16B 2E5GA 2QG9B 2VQEJ 4P2MA 1RT1A 3J81U 4OO1J 3O1LA 1RADB 2D9OA 4RG8A 2KQ2A 3SFGA 1IH7A 3ZTRA 3NNHA 3IAYA 5FPDA 4PZVA 3IMXA 3RAXA 3GE9A 1GAOA 1S76D 2AP6A 1KOOA 3GU0A 1J2VA 1BHNA 4CZEA 3WC2A 3HZ6A 4Q2LA 2BE9B 1UA0A 2GC8A 3F2KA 4DQRA 3CT9A 1DARA 2J6UA 3R1HA 3DC2A 2B4VA 4CLTA 1WC5A 3QMLA 2PA3A 2NRTA 2EBEA 3DDNA 2HHHK 1ROFA 3CD6S 5K8PA 2DR5A 1JJHA 2B8PA 3SNNA 3MCOA 5T7LB 2W2MP 2G13A 4DSIA 1QVGR 3LPEA 5T41A 3FQLA 3ITHB 2OPQA 1SIWB 2MEWA 1TAQA 2UUBJ 2RE2A 5KQDA 3DM2A 1VBXA 4CLKA 4MLHA 5ETLA 5AQQA 5J1EA 4FYXB 1UVMA 2ZUGA 4B1WB 1AFIA 1JIHA 4JI4K 3FNNA 1YUWA 4MH8A 3R7NB 5M2RA 2NLXA 4WFAL 3L4QA 1TKZA 3NRBA 1OQ3A 7FDRA 1PIEA 4ID5B 4FJLA 2XYPB 2OYQA 4LFCF 4ED1A 1KVBA 3VAGA 1N52B 1N54B 4H0XB 3KG0A 1ELOA 4NEZA 4DUZF 3VOVA 1CSJA 2CQBA 2IM1A 2CJXB 2YKPA 4B1XB 2Y0BB 1S7HA 2AX1A 2OD4A 3MM7B 3QETA 5T7LA 5SUHA 3DOKB 4NYNA 2XY7A 4DR6F 4EBCA 1VAZA 4DR4J 2OO4A 2Z56B 3O6QA 1TL1B 3F9MA 4DCJB 5KFKA 3UWTA 1F3VA 2W4PA 4DR3F 3N28A 3BF4A 1NGJA 4RLEA 4NO7A 2DBBA 1KC8T 1CS4A 1OPZA 4LF4J 1R8AA 5AE3A 1GOBA 2WK4A 2ZOMA 3PJXA 1RJJA 4BRFA 3AH6A 4IOAQ 4OX8A 3FMBA 2NXEA 1RAIB 1N56A 2NQPA 1JL1A 2J6SA 4OZ5A 4JI0F 1TVRA 5KG3A 4P75A 1B9FA 5EU7A 3OXGA 1VQ8N 1AW0A 1X5SA 1ZBSA 3QFPA 5D8HB 2WVFA 3TAMA 4MFBB 4IJNA 2UXDJ 3EE8A 4CI6A 1FKOB 5KQ8A 1X5TA 4DR3K 2FVQA 4LMZA 1U26A 2LXIA 2BR0A 4KIAA 1M5KC 3TP2A 4H4MA 1WLJA 4CHYA 4WFZA 4DZDA 3V2UC 4HTJA 1RHMB 4HHJA 5GAEP 3HHLC 2XY8A 1TL4A 5BR8K 3MPVA 1N33K 5GMEA 1PCAA 3HVWA 3S1TA 2D3OR 2RU3A 5C25A 1YJ9S 4DN0A 1XNRJ 4KTZA 4PAAA 4HVZA 3M6VA 4NXMK 1JB0C 5GAGU 2ALZA 2QKBA 4ZVEA 2W2PP 5H9EJ 1CPZA 2FHKA 3KLVA 2OPRA 3PXGa 3G6VA 2FIUA 5BN9A 1EP4B 3OR2B 3AA4A 4R25A 1ASVA 5CYQB 2VICA 4GKKK 1DGKN 3JYTB 1Q82O 5AQNA 2HBMA 3M6UA 3Q2SC 4OHXA 2EFGA 5HRSA 1YI2S 1VQMN 1JLEA 3OTBA 1X4FA 1FD8A 3EGNA 1YTYA 3DDIA 4FDFA 4FLVA 1RDRA 4MFBA 2X1GA 1YJUA 3W62A 3UCUP 3TWHA 2YY3A 3G6YA 2VH7A 1WF2A 2XLIA 1I3OB 4TU7A 3P6YC 2K1RA 4UZBA 3NH2A 1M90T 3NH1A 3MEGA 2VFVA 4MAKA 2GTDA 4QIEA 1IQTA 2I5JB 2FUG9 2BDPA 2HBLA 3LDQA 1D9FA 4G1PA 2KH9A 3AOBA 3VAIA 4H54A 4EYHB 1CXUA 4BC5A 3DHXA 2B9XA 4OYAA 3GOIA 2P6TA 1LW0A 3WBZA 2ZJQQ 3J81j 1I94K 4CZHA 4QQBA 1C0UB 3I5BA 2ZH7A 2GV9A 1FJGF 5KI6A 1JWWA 4S0MA 4L72B 1Q16B 2IFXA 3M5RA 3N5FA 2ZKUA 3VGLA 1XMQF 3UKUB 2UZAA 4BRAA 5CYMB 3KKSA 4TNOA 1T8EA 3MGJA 1S6PA 3VAHA 4ID5A 2LLZA 4F4XA 4OYMA 1WUUA 1HLUA 5CY4A 5MLCQ 4MKYA 2XY5A 1EQMA 1RBAA 4Q2MA 4PWDB 1VQON 2IC3B 4ZVUB 5D6GA 4ZPAA 2Y8WA 2E6LA 5B0DA 3P31A 4B3MF 4IOCL 1NDKA 3DFEA 2M3DA 2J76E 3OA9A 4RW8A 3HT0A 4N5SA 1MMNA 3W5XA 4ZP6A 4BRCA 2O8BB 1VIXA 2GV1A 4CHQA 1Z1ZA 1UMJA 5HRPA 3QEXA 3HMJG 2OELA 3LP2A 1RDAA 4F3TA 4PG7A 4LBHA 4J9PA 2Q66A 2V7YA 3RMBA 4DV3K 1O8BA 2HGNA 5DQHA 5G4DA 4NLSA 4CVNE 1YSJA 3S3OA 3UN3A 4J8FA 4KSEB 3OR1B 2HFZA 2D3O1 1WSHA 4DLGA 2E1CA 2QA2A 3IBWA 2QSWA 2JDJA 3HZGA 3T9ZA 4U7UD 5L9NA 1W2BM 1O51A 3CCRS 4CEQA 4FJ5A 2XYHB 5HQLA 2MQPA 1OYEA 4KBIA 4ECQA 2BJEA 2OFGX 3T5HA 2YH1A 4JD2B 5JLHA 2DJWA 2GHPA 1U1OA 3OYIA 3TQEA 4TU9A 2QMXA 3IA0A 4G1IA 4X64K 3AVFA 2HBRB 2BQ3A 3BREA 2HG4A 3UD4P 4YHHK 2PEHA 3AD7C 3PLAA 3SI6A 1YJVA 2OPPB 1MG7A 4XAKA 4DG1A 2WW8A 3B54A 4LF6F 4QYRA 1JKHA 1NM1A 4A8WA 1BI4A 3H90A 4ISEA 1T7PA 1RTDB 1IR1A 3TAFA 3AQOA 5KFQA 1T9VA 3L2RA 4KHMA 2W9AA 3C7NB 2R7YA 3C6TB 4EGLA 4IXCA 4USMA 3I4HX 4IKAA 4HT7A 4PQUA 2CG8A 3SCXA 5L8RC 4F3QA 2WVBA 2LKZA 3TI0A 4GV6A 3NFAA 5AQKA 4OV6A 1YT3A 1BWVA 2A0FB 4NLXA 3BGRA 2WHOA 3A4TA 3MTKA 2GUIA 3HLUA 4BBYA 1N32K 1RWVB 5F8GA 4JBCA 2CPIA 4WXOA 2AJ0A 1WSGA 5D4OA 4A61A 4NL5A 4KV8B 3J7YU 2WTUA 4PY5A 2F40A 3SDEB 4ZP7A 2BMBA 3RGIA 1GLBG 2E9RX 5KFJA 1RI7A 3T5LA 3OUYA 2GAGC 4KB7A 3MUMP 4DR7J 1NGCA 4FF2A 3RB6A 4DX8H 2N3LA 4USVA 3KK1B 4ATNA 1MWKA 4PKGA 3G0ZA 5IT0A 2DGUA 2LQBA 3O9TA 2E5LJ 1S9GA 2NRZA 3NGTA 4PQUB 3JTOA 2DFEA 4QIFA 2UXBK 3VQ9A 2PFUA 5J2NA 4XH4A 1JLGA 1TFYA 3FBFA 4CIGA 1GXUA 4ZVTB 3X1LB 4ANDA 2XQCA 4ICLA 4CJPA 3MXHP 1K8KB 1K8AO 4UQTA 4B3TJ 3S41A 4CJSA 3IGNA 3FZKA 4F4WA 3DCAA 2ZM6F 3N6LA 1GMVA 4CJWA 4JI7K 3KK7A 4K5SA 2FQQB 1CJUA 1SKSA 3B8HA 3R5DA 2B56A 3IN5A 1ZA1B 1NGHA 5AFUA 4DV0K 1C0TA 4BR7A 3CQYA 1HNXJ 2HVHA 4A47A 2L48A 2KDOA 1U2RA 3CJBA 2V2QA 1FKPA 5F2RA 2ZDOA 3VEWA 3BEGB 2P9PB 3AVJA 5IOLA 5AQIA 4C0HA 1R8CA 3VVUA 3AVIA 3IWNC 5AQXA 4DSEA 4F8RA 5F9LA 3KK3A 2CZ4A 2OP5A 2XLJA 4USHA 3KG1A 4KH5A 3AXMA 2IA0A 2I7PA 3UD3P 2HRUA 1W7WA 3RU0A 4IO9L 3G96A 3DRPA 4NLQA 2PT0A 4YMEA 3UR0A 3PW4A 3ZZUA 4GKJJ 2OLWA 5E33A 3M1VA 1VSJA 3TRGA 5AQSA 2DTJA 4AILC 2VG6A 4FNIA 1S1WA 4LT6A 1S9GB 3DOLA 1RT2A 4OI2A 5B0BA 4CLUA 3CSKA 3MWBA 4CEZA 1WNSA 3M8QB 5DM6L 2VFUA 2F4FA 2UXCF 4FWLA 4R8UB 4Y00A 1S12A 3AHPA 3HSCA 2VDHA 1WG4A 4DR7F 4OJRA 2QKKA 2ZUAA 4JI5K 2LFVA 4PXCA 4FM1A 2BE2A 4I64A 1GLCG 3IWXA 1ATNA 1S1TB 3CCWA 2HRTA 1S6OA 1JCEA 4U7BA 1N4LA 3QIDA 4YOVA 1VQPS 3DRPB 2AYBA 3FZMA 2YWFA 4QU7A 4NRTA 3K89A 3LP1A 4R0EA 3PIPQ 2MY7A 1V3RA 2CVIA 3JQKA 1MWYA 4X66F 5K8MA 3FCWA 1ZM9A 3BN4A 4JI1K 2RAQA 1Q81O 2Z2MA 4MDAA 3WEEA 4IFVB 4O4GB 3W66A 5GAHI 1RWOB 3NOGA 2EFOA 4HUGA 4ILLA 4X4VA 1T94A 1QSSA 5KT4A 4JV0A 3R2CJ 3UR3C 2XHCA 1HPMA 4F67A 1EB0A 1IKVB 3TTDA 4IOAL 3NGKA 5CQGA 3AGKA 3GQCA 2UVWA 2XWYA 3PW7A 3H3OB 4FXWA 5KOWA 3CFOA 3CJ2A 4RUAA 1AXQA 3VPZA 1MMDA 4JOUA 3H08A 4YR2A 3VF6A 4X66K 1RSCA 4FK0A 1NMDA 2DNNA 3H4DA 1F9FA 2VWBA 4DQPA 2FVSA 1Z26A 4IFEA 1KEKA 3T6BA 1J5EJ 4B3RJ 7FD1A 3A5NC 2MQLA 1T05B 2C3UA 4LSNB 4DV6F 4FWQA 2EC0A 1NK5A 3VGTA 5HQMA 1X4CA 3SZ2A 3CIZA 1TMJA 1BQMB 4ZVFA 3KLGB 3CJ4A 4DG1B 1U2VA 2YX7A 4YDXA 3VALA 3OL6A 5JXSA 1IBLJ 1RTJA 4DR6K 3JS9A 1V3ZA 1HR0K 1QHTA 4DQIA 4HI2A 1U1KA 3MX2A 3BO3A 2BKNA 2NR0A 4ZVOB 4H03B 4YN3B 2IS3A 2MKCA 4EBDA 4M7YA 2KJVA 3C19A 1NH8A 2KJWA 4H4KA 3CULA 4QCLA 4O23A 3FCVA 1AB8A 2XCAA 4QPTA 1QE1B 2QEXN 1SJ3P 2A1BA 4XDCA 4WFAQ 8RUCA 2ETJA 5H9FJ 2CQ3A 2PZSA 3JXOA 4XH5A 1FO1A 2CUYA 3CC4N 2RSQA 2V2ZA 4YB6A 3ZFVA 2GJ2A 2DXFA 3CO9A 1RCXB 3KHLA 4JV2A 3FZ2A 2DIUA 2EXUA 1YDLA 1RT5B 1QAYA 1Y3JA 2BTFA 3LAKA 3CJRA 3KKFA 3OUYB 2VG5A 1YZ6A 2EVZA 3C8YA 5HVFA 1D8YA 3AB2B 3DRXA 4IEIA 2AKWB 1QQCA 4C7QA 4CT8A 3TZYA 3N01A 2ZD1B 1X9WA 4LIWA 4PHTX 3OTEA 4EO6A 4Q5VA 5DK5A 5A0YA 3U02A 5LXRA 3VQCA 3SXLA 4OYXA 3CI5A 5LSLA 2V51B 4DTXA 3LP0B 2E20A 2W8KA 5KFOA 3T5JA 4NMXA 3EE9A 1XMBA 2FLLA 1NM2A 1YVFA 4KHNA 4Y34A 3PG9A 2XYGB 4DF8A 4Q44A 5J2NB 2OEMA 2OPRB 1YZ7A 4LFBK 3M1FA 2C3OA 1DFDA 2IM2A 4YOXA 4CGIA 4J2BA 4BLGA 2MHNA 2IJRA 1YLXA 2ZBRA 4QBUA 4ECYA 3SMSA 3PFEA 1PGZA 5C7PA 1OVYA 4RUHA 3ENVA 1A5VA 2YKAA 4WQ4C 3ENBA 1U24A 4YFUA 2D9PA 5LY3A 5DDOC 3DJCA 1T9YA 1RHQB 1UKUA 1P8GA 2ZVIA 3OLAA 2XSJB 3AB4B 3OYLA 1VQ6N 4YB7A 4Y2KA 2R3VA 2F9DA 1TUGB 4W5RA 2V8VA 1R8HA 1U1PA 2HNZA 1TKXB 4XH1A 4RW7A 3KIOA 4M5JA 2FHMA 3VQSA 1HNXF 1RK8A 1VQSA 4PYDA 3AD9C 1NJIT 3R8YA 4RJVA 5F0XA 1HD1A 5F0UA 4CDIA 3CNQP 3L6QA 3VF0B 3SPZA 4LSLA 2QO3A 2VBWA 2QL9B 4NXMF 1WUAA 1YVUA 2W2QP 2QLBB 4IUFA 1FKPB 5A6WA 4ILMA 1DJ0A 2DGTA 1TL7A 3VGSA 3KWIA 3KLFA 1EP4A 1DQAA 1Y9OA 8AT1B 4EFAC 1YK9A 3CCUN 1VQPN 1C0UA 2J7WA 1U2FA 1HHSA 2NCKL 4ZLLA 1WEXA 3T1AA 4K4TA 4F4ZA 3FCHA 2J9DA 1NK7A 2W8LA 3VQ5A 3THWB 1Q8LA 4ELUA 3MM6A 1JLAB 2EC2A 3CCMS 3PX0A 1SJ1A 1ZM4A 2LECA 5CD4A 5DZ6A 5DS7A 5C24A 3K5LA 1QAIA 1LXNA 2P9LB 3BZKA 2HQIA 3I6PA 3AQPA 2Y8YA 2BA9A 3K57A 2FJDB 5E5NA 3HCXA 1GTEA 4BRMA 5CYMA 2RUGA 3EGVA 5C12A 3AA3A 3SUOA 1GEHA 2ZOFA 4OQJA 4ZJOA 3L95X 4Q45A 1PILA 1SQFA 3FZLA 1HPZB 4JI4J 2WC9A 2EG2A 5FDLB 3I96A 2Q6BA 3FGVA 4B8AB 2XY6A 4MKVA 2R2TA 2CZVC 1F9EB 1MU2B 2B51A 2ZBIA 1UW4A 4FSVA 2UUAJ 1UL3A 2D1KA 2HBQB 2HWTA 3GIJA 4O0NA 3PTWA 3VV2B 2MLZA 1Q0NA 3KKRA 4L73A 9ATCB 1CC7A 3WT0A 3OFGA 3C6HA 4DV3F 4CBXA 1SBRA 4DMZA 5IT9Y 3BO4A 2B43A 3QSIA 4WFYA 3OBIA 2OKQA 3TX8A 1R89A 5KFLA 4ETXA 4CH0S 1HBUA 2D3UA 1RLCL 2MZSA 3K17A 4H5VA 4P2SA 3A3NB 3NKYA 3MUVP 2M88A 3RZAA 2YHXA 3OJSA 1NBEB 4CECA 3O9QA 4B3TK 3UIQA 1RE1B 5I3UB 2IAJA 1XNRK 2OD6A 4FJXA 3J80U 2OZMA 2I6WA 1NNEA 3SJJA 4K0KK 3W2VA 4CJEA 5FD1A 4ERDA 1RYRA 4KRFA 1VHIA 2Z1GA 2QMUB 1MU2A 3D3BJ 4MIWA 2YJFA 5HMWA 4DV1J 4DWIA 4IR9A 2QI2A 2ITGA 3LA0A 2QYGA 5D4NA 1S0VA 2O8CB 3I32A 3J8AA 3ENWA 1EKEA 2GO9A 5FLXU 3KLEA 3AA5X 3CJ7A 4GKJF 4NEYA 3RMDA 3ZNUA 4A5BA 4AF1A 4FPBA 1P1LA 2YVSA 1RHUB 1QLNA 3I87A 1HBNB 2GHVC 1SVDA 1DHMA 4OYWA 1NXIA 3AJ2A 4JYAK 1VBZA 4DL5A 2DY1A