4BE1A

Pfv intasome with inhibitor xz-116
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Activities, Crystal Structures and Molecular Dynamics of Dihydro-1H-Isoindole Derivatives, Inhibitors of HIV-1 Integrase.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4be1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4be1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4be1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4be1A03
4A4EA 3FDRA 4CEBA 1WJRA 1A5XA 3U3GA 2OA8A 4W5QA 4HHTA 2RJCA 3QNNA 1D9DA 1VSHA 4FJ7A 3P5JA 3VQBA 3L3UA 3MEWA 3VQDA 3KJVA 2ATQA 2M16A 1S1XA 4HUFA 2FBXA 2X78A 1G15A 2OPRA 4ID5A 3TAFA 3KLIA 5KCOA 2KW4A 4XIUA 4DTSA 2FBTA 2RHXA 1A5WA 3VQ7A 4NYFA 4IDKA 2B6AA 4CEEA 1VSFA 3CYMA 2LDMA 2X6SA 3L2QA 3OYAA 3QEIA 4HCBA 1OYXA 3ALYA 3EYZA 2HHVA 2QK9A 3OYNA 3M8SA 4CF0A 2I5JA 1O1WA 4M3XA 3SQ2A 2VG5A 1NKEA 2K3XA 1Y97A 3QBYA 2G8KA 1RT4A 3VA0A 4C5GA 3CM5A 1EKEA 2KTQA 4DTNA 1U47A 4CEQA 2B4JA 1OZ2A 1WSJA 4CRIA 4RW7A 3OYMA 1SV5A 1RT6A 1U48A 1BISA 1X9MA 4DMNA 3LP3A 4E7JA 4BD3A 2F8TA 2XY7A 4CEZA 2QQSA 3PNWC 4DTJA 2HHWA 4FL6A 3C4SA 3AVCA 3OYGA 2X4WA 4I2PA 1NKBA 3KK3A 1RTHA 1SKSA 4CGFA 4CFBA 3L3VA 3JYTA 4LH4A 4IUUA 3ZSVA 4CEOA 4O0IA 1NK7A 4H8KA 1Q9YA 3VQAA 4RW8A 1RBUA 4H4MA 5FRMA 3KKSA 4Z4EA 4FJ8A 3L2WA 4L8RB 4IURA 1MU2A 5HRPA 3MP1A 4PQUA 3NF8A 2YV0X 4FJIA 4QQDA 3SQ0A 4GVMA 1BI4A 3VN5A 3LWLA 3MECA 3SQ4A 3LDSA 3DRSA 3AVKA 3HL8A 5FROA 2EQJA 1CZBA 2YKMA 4J2EA 1SL2A 4E0DA 3KIOA 1WJQA 3CQ8A 4ID1A 4DTOA 1RTIA 2GFAA 5KGWA 2RHZA 1KHCA 3H08A 4ZHRA 1VSMA 3B6PA 3TWHA 2IAJA 3NH1A 3QERA 4H4OA 4FJ9A 3MEUA 1NJZA 3AO4A 4FLWA 4B8AB 2R5AA 3OS1A 1S1VA 2DFFA 2E4LA 4E89A 4CJPA 1KFSA 3LH0A 1IG9A 3C94A 1FK9A 4FVMA 2RHIA 4K8XA 1JLEA 3O4NA 3V1RA 5KCHA 2YNFA 4FLYA 4FK0A 4CFDA 4AHTA 5C42A 3KLHA 2P51A 2PYLA 4PL6A 4AHVA 4LH5A 1QSLA 4F4KA 5DMRA 4KFBA 3S3NA 4ZTJA 2E6MA 3OMCA 4CGGA 4AHCA 1XWLA 4A4GA 1WLJA 4BACA 1JXBA 3ASKA 1EETA 1HRHA 4KI6A 3SUNA 3MP6A 1WNSA 4IUQA 5KE2A 4C8NA 4CJTA 3HYFA 3NDKA 3RRHA 1RT7A 4MFBA 2M1HA 1JLQA 4DG1A 2QKBA 3PX4A 1OZ3A 3IAYA 4GW6A 1C1AA 3QIPA 3ASMA 4DTMA 3HPOA 2ZE2A 1L3UA 3TAGA 3FC3A 4Z02A 2GUIA 3V9SA 4FZYA 4DWIA 2RPIA 4OVAA 2A1SA 3MEDA 3M8QA 4BDZA 2HVIA 4F2SA 3DOLA 2XY5A 2YHBA 4PUOA 4E1NA 3VQEA 4FW2A 3O3HA 1TK8A 2R57A 1RDDA 3NFAA 1QE1A 1JXEA 4CIFA 2D5RA 3CM6A 3LP1A 4B9VA 2RI2A 3PMIA 2HHUA 3BDLA 3LWMA 4A4HA 3QESA 1RTDA 2HHSA 3KD5E 3K58A 5IAYA 4HCZA 5CYMA 2KFNA 3HXMA 3AVJA 3NGZA 4FJLA 3NHGA 3ZT4A 2YNHA 3E01A 3E9GA 4CF9A 1KFDA 4BDPA 2NUBA 4EP5A 3TI0A 1S1TA 4KI4A 5D6WA 5HP1A 2B8AA 1N5YA 4BE1A 4DU4A 1RCHA 5I42A 2HNZA 2O4IA 3ZSWA 3QETA 3GOXA 2BGGA 3SD4A 4M3TA 1L3TA 3KK2A 1ZBUA 3G0ZA 1RDBA 1WSGA 3MXIA 1SUQA 3LAMA 1RILA 5C25A 5JS2A 3DLMA 2PYJA 1S9GA 3OVNA 3OYLA 4DS4A 2L89A 1U4BA 4CJEA 4KRFA 4AHSA 1N27A 3QEVA 3P1GA 1JLAA 1WSIA 4M3RA 3NGYA 4GY5A 4DQPA 4PWDA 2XO7A 3O8VA 3SV4A 2BKDN 4HUGA 1JLFA 3O4QA 3VQ9A 4M3WA 1ZBFA 3QIIA 5C24A 3NF9A 4CJRA 3HM9A 1C1BA 3AO2A 2OZMA 3OS0A 4Q5WA 3EAEA 3SI6A 4FLUA 4FM0A 1C6VA 2M0OA 3KLGA 3C6TA 3K57A 2OPPA 4RW4A 2HQXA 1HJRA 5KI6A 3VQCA 4HVJA 5CZ2A 3K5OA 2YRVA 1CZ9A 1WGSA 3O3GA 3OYEA 3LZIA 1UA1A 4CGIA 1RBTA 3L42A 4E7IA 3AVLA 3NF7A 4TSXA 4DF4A 4LY7A 5CYQA 4DSFA 2ITGA 3TAEA 1J53A 3FFIA 4KHSA 3HJFA 4NCAA 2FHDA 4R5PA 4DTPA 1RBSA 1RT5A 3V81A 1SSFA 2L3RA 1T8EA 4M42A 4ELTA 4CHOA 1VRTA 1KTQA 3IG1A 3LPTA 1HPZA 4EZ6A 4OLBA 2QQRA 5KTQA 3H6ZA 3ZSZA 2P5GA 3QEXA 3LYIA 3DI6A 1JLGA 4KHUA 2EQUA 1SL1A 4CFCA 3C95A 1QSSA 1RTJA 4DFMA 5D6YA 3K59A 3VA3A 4FZZA 1CLQA 4YFUA 2Q3SA 5HBMA 1TAQA 4G1QA 4FM1A 4J2DA 1SL0A 3PFSA 1NOZA 4IBNA 3AVHA 1L3VA 3KUFA 3AA2A 4AHUA 3F73A 4CF8A 3Q1JA 3SCXA 4F3OA 1TL1A 3OYHA 3SZ2A 1HNIA 1NK4A 4DSIA 4B3OA 3F70A 2QKKA 2P5OA 3IRXA 4CJVA 1NK9A 1W9HA 3DRRA 2FC0A 4N47A 1VSIA 2VG7A 2DIGA 2BANA 4KKOA 3TABA 1I3AA 1HQUA 1X1PA 4E7KA 2G8IA 3RRGA 1QTMA 4FJJA 3PX6A 1I39A 5D3GA 3WNGA 3PUFA 3QO9A 1LAWA 3MO8A 3NTHA 2IC3A 5CZ1A 1VK0A 4QW2A 2OYQA 2RJEA 3IS9A 4KO0A 4ZTFA 4QQGA 4CGDA 4F3TA 2KFZA 3L8BA 2P0KA 3MEEA 3QJ6A 3SQ1A 2HHTA 3KLFA 3KKRA 2HW3A 2WONA 2KZMA 4BE0A 1TL3A 4NS5A 1TVRA 1C0TA 3KD1E 3VQQA 3BGRA 4Z4FA 3OYFA 2EHGA 2IDOA 3RMCA 4M3UA 3UT1A 2R58A 3D0PA 3ZSOA 4DTUA 2EFIA 3L2VA 1VSEA 2EQMA 1XHXA 3DLKA 2VWJA 3C6UA 1WAJA 3ZT3A 3VQ4A 3M8PA 4CEFA 3K5NA 5KRSA 4JLHA 3DLEA 2RJFA 1WN7A 1LWFA 2HNYA 4F8RA 3VQ5A 2GF7A 1J9AA 5D6XA 4DSLA 2VWKA 3LAKA 5J2NA 2ETJA 4DFKA 4I9QA 4C8KA 1RDAA 4OGEA 4N5SA 4CE9A 4NCGA 2JTFA 1U45A 4J2BA 4FJNA 3SUQA 1L3SA 4Z4HA 3ULDA 3V1QA 4DQQA 3WNEA 4M41A 2OPSA 1QHTA 3O3FA 4KHWA 1MHNA 4B9NA 1FKOA 3LPUA 3HK2A 1R0AA 3UIQA 4I2QA 3LGFA 2HHXA 4O55A 3NTKA 2NLUA 3CG7A 1VSKA 3WNHA 1F21A 5KRTA 4W5RA 4GMJB 4CJ3A 4M3YA 2O4XB 2BIVA 3QEWA 4DS5A 4DSKA 1YTAA 3DYAA 1WAFA 4CHZA 2D0AA 3CEYA 4OJRA 3LP2A 2G8WA 1FKPA 3ME9A 4N76A 3PMTA 4CIEA 3FEOA 2IOCA 2RKIA 4HTUA 4IKFA 4CHYA 3OQ5A 2BUDA 4CK1A 2EKOA 3RMAA 1RBRA 4CJWA 4CK2A 4E1MA 1JL2A 4Y1DA 3P8DA 1XC9A 4DFPA 5HRSA 2A1RA 3RR8A 2XRIA 3HT3A 4II1A 4N56A 2MWOA 4FK4A 4KHNA 4OKEA 2KQ2A 1T7PA 3AO5A 4C8OA 3NTIA 3SPYA 2RN2A 1LWCA 3MEAA 1RT3A 3S9HA 1BIUA 3JSMA 5CIUA 5C0MA 2W42A 3SNNA 3I0SA 1NJXA 4FM2A 2Z1GA 3NH2A 2YKNA 4Z4GA 4B9UA 2X4YA 3AVIA 4DU3A 2AJQA 1QQCA 3NH0A 1N6QA 4DSJA 4AHRA 1C1CA 3RWUA 4FLVA 3V9ZA 4B9WA 4MQ3A 4KTQA 3SV3A 3OYCA 3QKJA 1QS4A 4AH9A 3HP6A 3OYKA 5K14A 2HNDA 1ZBIA 3RTVA 4AILC 1J5OA 1VSDA 3NF6A 1TAUA 2B5JA 4LD0A 3AVFA 3QIOA 2GV9A 1HMVA 4JS5A 4E3SA 4FJHA 2YHAA 4KTZA 4M45A 3HPHA 3QEPA 4DTXA 1UWBA 2D0BA 4CJKA 2WACA 1Z26A 2PZSA 3AV9A 4CCHA 3TAQA 1NK0A 1ITGA 3OYDA 4RW9A 5EU7A 1XHZA 3RR7A 4B8CA 1VSLA 3MAQA 1BQNA 1TV6A 3AVAA 5HRRA 3PO4A 3A2FA 2DAQA 3OYIA 4LD6A 5J1EA 3SUPA 4EZ9A 5FRNA 4UC4A 4HUEA 2X74A 3S3OA 4N41A 3OYJA 4BWMA 1HYSA 3V1OA 4DLGA 4X34A 4B9LA 4PY5A 1RBVA 5T7BA 3EY1A 3TR8A 3AVMA 1REVA 2G8VA 1JLCA 4QVZA 1WJSA 1B9DA 2RI5A 3LANA 3ZT0A 4FYDA 4NYNA 3OJSA 3SPZA 4J2AA 4FLXA 2HVHA 1TK0A 1KLNA 2Y1IA 3DOKA 2Y1JA 1NK8A 1D8YA 3V9UA 1KVCA 4B9TA 3G10A 3CFRA 3HVRA 4DLEA 1RT1A 2XDPA 4UQGA 4FJMA 2E6NA 1DLOA 3ZEHA 4IG0A 4DTRA 1KSPA 1LW0A 2XY8A 5DK5A 5IN1A 5KH6A 3MP8A 5E41A 1NKCA 3DM2A 3SYZA 4Z4CA 5M9OA 4CJLA 3H8ZA 3NE6A 4EP4A 4W5TA 2JGUA 2YNIA 1OI1A 1A5VA 3ZT1A 3T3FA 1C0MA 2Z1JA 4KAZA 4RW6A 3CFOA 3THVA 1LWEA 1YVUA 3P83D 2VG6A 2HB5A 3PY8A 2RHUA 4E7HA 4CJSA 3ZSRA 4KPYA 2MWPA 3M9QA 5HROA 1RI0A 2EQKA 1BGXT 1QSYA 1D5AA 1SKWA 3TARA 2BDPA 1KLMA 2HHQA 4N4GA 4CESA 5SWMA 3DB4A 1JL1A 2RI3A 4KB0A 2Z1IA 1UOCA 1GOBA 4CGJA 1LW2A 1UAXA 1K6YA 3QLHA 4DQIA 2DFHA 1KRPA 4Y1CA 3MXMA 4CJ4A 1IKYA 2FBVA 2G8UA 4OKJA 5SZTA 4FZXC 4CF2A 3S3MA 2GBZA 1T03A 1D9FA 1IKWA 4CGHA 3KTQA 5HLFA 4DU1A 4FJ5A 1TKXA 4IUVA 2QXFA 4B9MA 2CKKA 2PQWA 2ZD1A 1NK6A 4DFJA 3NNQA 1S6PA 4LSLA 2IGIA 4Q5VA 2G8FA 4NCBA 4ELVA 1EP4A 1LV5A 3QINA 1EXQA 2RHYA 3ZCMA 5J2PA 4KB1A 4CJFA 1NJWA 3K2PA 1ASUA 4CJUA 3TAPA 4FW1A 1H3ZA 3OS2A 4W5OA 3KLEA 1T05A 4O44A 1RT2A 1ASWA 3LGLA 1JLBA 2PY5A 3QNOA 2JZ2A 2XHBA 4DSEA 4BE2A 3DRPA 5C6SA 3AA3A 1S9EA 2IG0A 1XI1A 4JRPA 3M8RA 3AA5X 3U6FA 3AVNA 1ASVA 1BHLA 4FU6A 5J2MA 5J39A 4IUTA 3KK1A 3DB3A 1RDCA 3ZSYA 1UA0A 4FLZA 2JLEA 4IFVA 1Z25A 1IKXA 2RF2A 4CHPA 4CHNA 2L8DA 4C5EA 3LALA 3MXJA 3WNFA 4RG8A 4WE1A 1B9FA 4QAGA 4B08A 1YTUA 4CEDA 1BIZA 2WOMA 3VQ8A 1BI4B 3D45A 1G5VA 1W0HA 3K5LA 2HMIA 3AVBA 3OA6A 1JKHA 4PA1A 5KGXA 4IUPA 4CJ5A 2DIQA 3RMBA 4OPJA 2LCCA 3ZSQA 3UWNA 2G3RA 3DLGA 2F96A 3K5MA 3VQPA 4CF1A 1WSEA 4IG3A 2LTOA 3LP0A 1VRUA 1FXXA 2DY4A 1DTTA 4B9XA 2O4XA 3I0RA 2FBYA 3OMGA 4OPKA 2RO0A 3V4IA 3F9KA 3L2RA 1U04A 3PX0A 4CHQA 4FXDA 4JRQA 1HYZA 1Q8IA 1RNHA 1X9WA 3E9FA 2E6LA 5JS1A 4OKKA 4EDUA 3NBPA 2ZQBA 3NGIA 3HO1A 1ZBLA 4YNQA 4FJXA 4KHYA 2D9TA 4Z0UA 3T19A 3T1AA 3DMJA 2DTUA 3OYBA 5J2QA 3DLRA 4OGCA 4A4FA 4C8MA 1L5UA 1ZBHA 1NOYA 2OZSA 1NJYA 4KHQA 2XK0A 1TGOA 4JS4A 4ICLA 3OB9A 1HNVA 3L2UA 1HYVA 4O0JA 1U49A 4KREA 1KCFA 4O4GA 1VSJA 5KE3A 3CFPA 3AO1A 3U3YA 4FJKA 3SJJA 2LVMA 1KVBA 2Z1HA 2IS3A 3V9WA 2LRQA 4L59A 4QQ6A 4Q0BA 3BDPA 4F2RA 4KTWA 5HRNA 1Q9XA 4C5HA 4DF8A 2XY6A 2R7YA 1TKDA 2K3YA 1S1UA 1GOAA 3OY9A 4CK3A 1J54A 1S6QA 3PO5A 3DLHA 2VYTA 3HPGA 4DQRA 3S6WA 1DTQA 2YNGA 1WSHA 1ZYQA 4BWJA 4E19A 4E7LA 1BL3A 2E5QA 1B92A 4O5BA 2D0CA 4CEAA 4I9LA 2RJDA 1BQMA 4OLAA 3SUOA 4CFAA 3ITHA 3MEGA 3NCIA 1TK5A 4I7FA 1TKZA 4RG2A 4Z4IA 4QCLA 1IKVA 3MEVA 2GFUA 1X9SA 2O4GA 3AA4A 4QOZB 3HVTA 4W5NA 3TAMA 1NK5A 5CY4A 4KV8A 2X4XA 3LLRA 4N4HA 1S1WA 3PV8A 4K8ZA 3I8DA 3HSTB 1SKRA 2R5MA 3V6DA 3AO3A 3ZT2A 4OVLA 1C0UA 1KVAA 3V9XA 2EX3A 2X35A 4FK2A 3ZSXA 4CERA 4C5IA 2F8SA 3META 1BCOA 2F5KA 3P8HA 2X6NA 4B9SA 4IFYA 4DQSA 3DLBA 1XNIA 4BDYA 4LSNA 3EZ5A 2G8HA 4CECA 4FLTA 1S5JA 1HQEA 1GOCA 1WSFA 1LAVA 2DFEA 2LSNA 4NZGA 5FDLA 1TKTA 4CIGA 5J26A 1EX4A 4N4IA 4FJGA 3B6OA 3NAEA 5I3UA 3AVGA 3TANA 2HQEA 2KZZA 3RMDA 2BE2A 4C8LA 1YT3A 4PLLA 3LX7A 4FCYA 1IH7A 2OPQA 4CJQA 4M3ZA 1IO2A 1CXQA 3HP9A 1BCMA 4HCCA 1CXUA 4ELUA 2P1JA 3FLGA 3LZJA 3VQ6A 3OJUA 4PLIA 3ISNC
chains in the Genus database with same CATH superfamily
4Z94A 2VGMA 1J5EK 4FSVA 4W5QA 4YFKF 4XLEA 2KZGA 2RJCA 4BRNA 4RB1A 3VV0A 3TOBA 1QVUA 1D9DA 1VSHA 3P5JA 2DU9A 3L3UA 3CC2A 2RN7A 3JCMd 4R79A 5HS7A 1WPYA 2ZNYA 2CFOA 5AN4A 1WA7A 5AQJA 4BY9C 1UGVA 1Q7YO 3LWFA 2M2EA 2FZGB 3U1DA 1S1XA 2VODA 5FD5A 1YHQN 1G15A 1KD1R 3VKIA 4ID5A 5AIQA 4FWPA 5KCOA 2R4GA 2RH2A 2V75A 3O9TA 1NGNA 1Z3YA 2DA4A 3O9SA 2KW4A 1EBMA 5HLTA 1D0ZA 2FBTA 3KZBA 1HU0A 1A5WA 2PMUA 3VQ7A 4DR2K 1MUZA 2XMFA 1YCSB 1GLDG 4DNCA 1HKCA 1Z6TA 2XV4S 3VW4A 3F6OA 2LKXA 2VQGA 3QEIA 2NVYJ 5GMKh 4ME7A 3C7JA 2HHVA 2LT4A 5GMKm 2QI2A 1O1WA 1NGCA 6PAXA 2COWA 2EJGA 3EYIA 3D4VA 3SHFA 5CQYA 4HG2A 3AG4H 3QBYA 2G8KA 3VA0A 4C5GA 4DTNA 2Y9ZA 2HF3A 3CETA 4KUIA 4CRIA 5KYXB 4RW7A 3OYMA 1SV5A 3GNFB 1RT6A 2L2PA 5E18F 3AGKA 5I2MA 1XGNA 2P9PA 2E1MC 2L7FP 5GANj 1YITT 4X0GA 3LP3A 3WHCA 1D3BB 2F8TA 4EVVA 1IUYA 2LBFA 3T8TA 4NNJA 3DCFA 5ILUA 2JA8J 3CMEI 1TSFA 2O2OA 4OIPF 4FL6A 2NRWA 2DA7A 5AZIB 1Q86R 1R58A 2XC7A 5BPIA 4LB5A 1B9MA 2EQRA 4KH5A 3AVCA 3OYGA 2X4WA 2EZHA 4IXCA 2XD0A 2LQ8A 5KYUA 1RTHA 2KYBA 1OMIA 2FXUA 1MJBA 1OV3A 3TKYA 2ZZDA 3L3VA 3FXOA 3K4LA 5C4JJ 2ICWG 5ICCA 1FLIA 3WXKA 2X6WA 1XPXA 5HK0A 3WGIA 2XI9A 1DU0A 4CEOA 1ZUYA 1Y1WJ 3ZETA 2J5PA 1V4TA 2EBIA 5CKFA 4RW8A 1TWGJ 1LNWA 2HDDA 4DZPA 3GZ5A 5FRMA 1QVGA 1JTYA 4XRSG 4BVOA 3LSGA 2GUPA 2MK5A 3G71A 5LHIA 4IURA 2LD5A 4JX5A 1MU2A 1ZKGA 1Q81C 4RTVA 3ABKH 1RAIB 3D7SB 4DV6K 2STTA 4B3RK 1MJ9A 2IS6A 1KONA 4PQUA 4BR4A 1VQ6I 1SVMA 1BUPA 2KROA 1M3BA 4X66K 2E65A 2EKHA 2Z99A 3HKSA 2V8KA 4AM3A 3DRSA 2HBJA 3AVKA 4J83A 1YRNB 2P84A 9ATCB 3D2EA 2EQJA 4HLYA 4J2EA 2H3JA 1VTNC 1RTIA 2PG4A 4BR2A 3GTKJ 2KQWA 3BTLA 2RHZA 3S32A 1YO5C 1ORNA 3SFZA 4B1WB 2K9QA 2VKDA 3B6PA 2IAJA 4RTXA 1IREB 3LWHA 4H4OA 3FM3A 3PGGA 4FJ9A 1Z1DA 1Q81U 1NJZA 3AL0C 3OA9A 4QS8A 1N39A 2MPXC 4C0GA 1GVJA 1VOMA 4MFDA 3P31A 3L7WA 2EV5A 1IG9A 3GF2A 3C94A 1FK9A 1M2VB 1XQSC 1DIZA 1SVLA 2B7EA 4K8XA 4ESFA 5CVUA 3O4NA 2DA6A 3ZMUA 3V1RA 1OH7A 2L7MP 2VLAA 5C0YA 4XMYA 4FK0A 1QZ5A 4CFDA 1IXCA 5C42A 4I2OA 2EYZA 4CCLA 2MBFA 3SWNA 3ULEA 1Q81O 1VAZA 3GBTA 4LH5A 4OPHA 4AI5A 4ZC3A 2YHXA 4OFEA 4A5MA 2LMJA 1DJ7B 2ZGWA 4EV0A 3PVQA 3GE1A 4DOZA 2DK5A 2QWWA 3KZZA 1NK3P 1UJ0A 1QVFA 5HNFA 4AHCA 3ZN1A 2R3SA 4A3CJ 1M90C 2DXIA 1OKJA 1GL5A 1R4NB 3CCEN 5KVRA 4IUQA 4C8NA 1VQLN 2M9HA 2E5NA 1WHHA 4AFSC 1Z0XA 4HWIA 4X65K 4B6MA 2WB1A 3ZOBA 3CW7A 2QVOA 4B23A 3RRHA 4M6XA 4IFEA 2DVEA 4DG1A 3A4CA 1WGXA 2K4BA 4G8XA 4GW6A 4CC3A 2KXCA 1M4ZA 3QDRB 1L3UA 4HBLA 3R6OA 3I0TA 3F23A 5HL7L 2BY0A 1VQ7I 4P5NA 1NGGA 2OI3A 3V9SA 2CUZA 4DWIA 4XQ3A 4OVAA 4MGRA 2VL8A 4M7AB 2HVIA 1NNEA 1R7JA 1LWVA 4RDUA 2V7FA 2JOYA 3REOA 4JJCA 4JK9A 3I35A 4ZNXA 1M90U 3P39A 2DMTA 2RK1A 3P9CA 2CRGA 3JRBA 2I10A 3KE2A 3QDFA 1JXEA 1TZLA 1QE1A 4CIFA 1BI2A 1YLFA 2ZO4A 2FSNA 2D5RA 1RC9A 3LSRA 3LP1A 2QGGA 3CZ6A 1S7AA 2HHUA 1Q1HA 2W04A 1I1GA 4BRFA 1BI1A 3QESA 1OVQA 1RTDA 3JRGA 3KD5E 2P8TA 3CJQB 3TCJA 5IAYA 4BG9A 5CO7A 1IV0A 3J81Z 1M90O 2O9VA 1I5LA 4HCZA 4M3GA 1JXOA 2K9GA 3CC4T 3LM9A 2A6EF 3HG9A 2NYSA 5I11A 1ZAOA 4LLNA 4FJLA 4UNFA 1X6GA 3NHGA 3ZT4A 4GKKK 2HI3A 1HKSA 2BZXA 2VC0A 3PLAA 2ZPIB 3REAB 2BW3A 1PRMC 1BK2A 1LB2A 1AWWA 2ED0A 2HVRA 4EP5A 2XGEA 2QSFX 5LEJA 4F14A 3BTIA 3INZA 4OU0A 2HNZA 2LKSA 3ZSWA 3R61A 4YPHA 3QFUA 3BEXA 1R1TA 1L3TA 2GXGA 1W2BA 3G0ZA 3H36A 5FU7C 5D8KB 3ZEUB 1FSEA 1ERDA 3LAMA 1RILA 1JHHA 1Y56A 2Z0WA 1WYXA 5DDGA 2DLPA 2HVSA 4DS4A 1U4BA 3QEVA 3A01B 3I71A 4D6WA 1KC8R 3REBB 4DQPA 2LNBA 2XO7A 4F7UA 3O8HA 2FVUA 1W4SA 1E4GT 4HUGA 1YITA 4XKCA 2K5CA 5BN9A 4LDYA 2KJCA 1OQYA 4M3WA 3CF2A 4BY6C 1RL2A 3FXJA 2XAFA 4CJRA 2R92J 1C1BA 3AO2A 3OS0A 1IHWA 2XVCA 2D6FA 3G1JA 1NZ9A 1BWFO 3RKXA 5GAMh 3HOYJ 2CH4A 5GTHC 3VTIA 1SRMA 5LJWA 3VERA 4RW4A 2HQXA 5KI6A 5AQPA 1UMQA 2UXXA 3TO9A 4RCHA 4A6EA 2YRVA 3P7NA 2VKNA 1WGSA 3WGGA 2HAXA 2QSGX 1W5SA 1UA1A 4U0WA 1WQWA 5BMZA 3WU1B 4CGIA 2YX4A 4E7IA 3AVLA 2QK0A 1XSDA 1X4PA 4LY7A 1VIEA 1G2HA 3WE2A 4OMZA 3CC2N 1IJJA 2GXBA 2BXZA 2FHDA 4Z8AA 3HHHA 3WU2C 3V81A 1RESA 1SSFA 2IJLA 3E5XA 2L3RA 2OTLN 3QG1A 2ED1A 1VQNI 2CGLA 3KTUA 2YT6A 2Y69H 2KNBB 2EIMH 1RAEB 4OAYA 1HKTA 4IXAA 5IT9Z 3ZSZA 4RA2A 2LQKA 5F0CA 2J05A 2H94A 3CD6N 4Q47A 5D6YA 1OJLA 3VA3A 2NS0A 1C0WA 4FZZA 1TBXA 2OTLI 2YSQA 4BC5A 2P4TA 4DR4K 1TAQA 4G1QA 2IT0A 4EJTA 4B21A 1VQPA 5FPMA 1Y39A 3SWNC 2NOHA 4ETSA 3G6EA 2BXYA 5EC7A 1TW3A 4E9EA 3OV8A 3CD6I 3AA2A 2QWMA 4AHUA 4KULA 3TBIA 3F73A 2RA2A 3Q1JA 1WNLA 1TL1A 4A3LJ 4XLCA 2V79A 3WTYC 3P4IA 3T1BA 2VPLA 3F70A 2QKKA 4ZYEA 3BT9A 3QWYA 5KYXA 2P5OA 5CQXA 1W9HA 3RMSA 4BC2A 3NFCA 3AHUA 1P92A 4GV3A 1D3BA 1NYGA 4IHWA 3CBOA 3QMLA 3TABA 4LMYA 3RBBB 4C8QF 1X3NA 4O3MA 1OR7A 5AZIA 1LUJB 4TV7A 1R71A 4B3XA 1EIFA 2V1XA 1IRGA 4ENNA 3HUGB 4P96A 3T5XA 4C8QD 4EGYA 1YJNA 3NTHA 4OMLA 5CZ1A 4UUTA 3TOAA 4U67L 1TWBA 4QQGA 2LMDA 3COAC 1X6OA 5GANg 5E1XA 4B47A 2UU9K 2MD5A 2HHTA 3HTVA 3WEEB 3DFGA 1BB9A 1TVRA 1C0TA 3UB5A 3B8AX 3KD1E 2DO3A 3J7AP 4JK7A 3VQQA 3G71N 5AYFA 4CHUA 4Z4FA 3OYFA 3EG0A 1QZEA 3VF4A 2IDOA 3WE3A 1S6LA 1XG7A 4S04A 3I56I 1R36A 3UT1A 1HLVA 1UUEA 2GCXA 3L2VA 1MGQA 3HOZJ 2P6TA 3WTUC 5FPEA 1VQPQ 4EHUA 3CPFA 2OAWA 3FX3A 3OIPA 5LBQA 2W6KA 3G6EQ 3ML6A 4MFEA 1XMQK 1YRNA 2EYXA 1LWFA 4M6VA 2FD5A 2JVGA 2HSPA 5EDNA 2O8KA 5D6XA 2CH5A 1KU9A 1QA6A 3LAKA 1S8NA 3M55A 2DMQA 2KPMA 4XTUA 5BPMA 1OYWA 2V1UA 4M73A 5CPRB 1IUFA 4FWQA 4N5SA 5KK1A 4ANJA 1U45A 3A1YA 1IZ1A 3CMEQ 3VS6A 3ULDA 4HSRA 1K4US 5AQXA 2H1KA 3PJRA 4XKWA 1L0OC 2KP6A 4LXCA 2FF3B 2NOFA 1VQ8T 1JXMA 4P5OA 1EO1A 1MHNA 2VQEK 2PBIA 4KN4X 3LPUA 1M2VA 2P0WA 1OH6A 4EVIA 4I2QA 5K1YA 2CQXA 1YJNQ 4HPQA 2Y9YA 5TGTA 4GDFA 2NLUA 1VSKA 3LSKA 2E3IA 3VJPA 4OMMA 2CP2A 4W5RA 3OW2P 2O4XB 3O4WA 5KPTA 1IHVA 1T6CA 4LK0F 5FWCA 3AG2H 2V1NA 1JCFA 4CHZA 1NGBA 1HX1A 5J4VA 3QICA 2HDCA 3L09A 4N76A 3THXB 1WJBA 5HS9A 3RPQA 2IGOA 1VQ6Q 2RKIA 3E2UA 2L9VA 1P4XA 3FZVA 4JK1X 4J6YA 3LL7A 1OEBA 2GGRA 1JL2A 1XC9A 1TXQA 4C3JJ 2A1RA 1NE8A 2DPDA 3BR3A 3SEQA 2WB1N 3ZQFA 2CREA 1KIKA 4MZTA 4HF0A 4UVBA 2KQ2A 2F4VK 4BKXA 1GFCA 2Z5UA 2RN2A 5FKKA 3OL4A 3K0LA 4IOAF 3E6MA 1UCRA 2DXUA 1BIUA 4FWNA 3JSMA 1R4MB 2X3XD 4FM2A 1K83J 2YKNA 1VQ5T 3N4QA 4Z4GA 4XL9A 2X4YA 1T38A 4DU3A 1K79A 3RNJA 3QYHB 2AJQA 4A63B 1UEBA 1WHUA 4A3KJ 3JB9G 2RREA 4EJYA 4AHRA 1C1CA 4ZYHA 1KQ0A 4YOTA 3V9ZA 4MQ3A 1F5TA 1NM1A 2DM1A 3SV3A 1TP4A 1NJIR 1HDDC 1ABQA 5K14A 1ZBIA 4IEEA 4RB0A 1VQ9A 3D7EO 3C2BA 1R5ID 4W1UA 2BV6A 4DB3A 3HBTA 2YPRA 1U6GA 2OTJT 4LF9K 2B5JA 1LOJA 2M4KA 1ETYA 3T8RA 4DV2K 3EDPA 2CUBA 3AVFA 2D1HA 1WQ2A 5K5QA 1WOQA 4KGVB 2E19A 3CJRB 1QU3A 1Y71A 4ESJA 1ZBJA 1QVGM 4M45A 2HL5C 1UWBA 2D0BA 3QYBA 2KT1A 1H641 1SZ2A 3KZIC 2M9UA 4TVRA 1UZCA 3AV9A 4CCHA 1HUXA 1ITGA 3HM5A 3C6HA 4YHHK 4EM0B 1KAXA 1K9MC 4FWRA 2YX7A 2LRDA 1YI2A 2LX7A 1JB0E 1ZSZA 3L2CA 5FLXK 2HL3A 3MAQA 4BHPA 5GAOr 4ZGDB 2M51A 1OR7C 1NG9A 1SQKA 1JGGA 3PO4A 3ZEUA 1BIBA 3A2FA 3MWMA 1LQ1A 3B6CA 4LD6A 4FT4A 3SUPA 5AQZA 1VQ7Q 4HUEA 3S3OA 3R60A 5AQKA 1FTZA 1E4FT 1XTDA 2JTEA 2DVJA 3CMMA 3OOUA 4PY5A 3EY1A 3K10A 1Z6RA 3QPLA 1JLCA 1WJSA 1HF0A 4E9FA 1YITN 2RI5A 4FYDA 4NYNA 3OJSA 2QG9B 3RTRA 5GP9A 2DEQA 4Q4ZF 4FYYB 2Y1IA 2CT4A 3RQIA 2CP0A 4AFZC 4ZYAA 1K9MU 1PRLC 4O5FA 3WGHA 2NRAC 1R1UA 3CCMA 4UNOA 3VS7A 2FPDA 3JAMK 3JCMh 3SEMA 2GM4A 5CKBA 2IVMA 2XDPA 2LJ0A 1Y7XA 4BH9A 5FW9A 5A2QO 1KSPA 2PJPA 4A57A 4C30A 4RTYA 2YXYA 3JCMX 5IN1A 3MP8A 1GCQA 2YUNA 3V7RA 3SYZA 4LFUA 1BYMA 1R77A 3H8ZA 2E34A 1BO5O 2YNIA 1OI1A 1QVFM 1NLOC 4B9QA 1QZ6A 4KAZA 2IA1A 1EJ9A 4RW6A 2FF6A 1PVEA 5HCKA 3WT0A 2NAZA 1YVUA 2VG6A 2HB5A 2RHUA 4CJSA 4JJBA 4C92B 1RI0A 5E79C 3A0BC 5M1QA 3GFJA 2M3AA 4DR7K 1KU2A 5LGTA 2O8XA 3WXJA 1MV3A 4H5RA 4YFNF 3U9GA 4LC9B 5AQSA 4N4GA 1MMDA 3L4IA 2JTMA 4RAZA 2HZYA 4AI4A 3DB4A 4AFUC 1Z9QA 1D4XA 3VUBA 3MVPA 1JL1A 2RI3A 1VQPN 4JI2K 2R7DA 1UOCA 1GOBA 4MTDA 4CGJA 3WVEB 2EFNA 2H6CA 1K6YA 3EG9B 2OX7A 3LSMA 4H03B 3G1OA 5GMKj 1K8AO 3CXCP 4Y1CA 3TSPA 2LSOA 2Q1ZB 2LR8A 3ZP5A 2LY1A 1MBEA 2G9WA 4OKJA 5SZTA 1HSQA 3CCUT 4CF2A 2GBZA 2OAUA 1VQ8A 1T03A 1D9FA 4CGHA 1KQ1A 3K9KA 4DU1A 1PP8F 5B5EC 3H1CA 1TKXA 2E1CA 2FUG2 2CSOA 1N77A 1U9OA 2G7UA 1ZXOA 3DXMB 3NMZC 3FZKA 2ZSHB 3M5RA 4IHSA 2EZLA 2NLXA 2Y30A 2DYBA 3TTCA 2RK2A 3MAJA 1SFXA 3NNQA 2WUSA 2K9MA 4R56A 2IGIA 5EYRA 4OOIA 2XF6A 3JCMJ 4XKBA 5FJ8J 4G7HF 3ZMDA 1YFNA 3QODA 3HIFA 1X2QA 3ZN0A 3HUGA 3ZCMA 4CZIA 1NJWA 2DKGA 1ASUA 2K5LA 1K1ZA 3TAPA 1CZAN 3KFVA 2JM9A 1VQNQ 5FPDA 2EWNA 1DU6A 4WF2A 1D09B 3LGLA 2PY5A 3HOSA 2JZ2A 2DE0X 4D9JA 1JCGA 2XHBA 2CV0A 2G6FX 3TW6A 1S7EA 4BE2A 4KT6A 3ZQGA 3D5LA 4Y0WA 3RZDJ 1S9EA 4OFAA 1C0FA 1XI1A 1KQSM 4JRPA 3M8RA 4XLPF 2YDLA 2A3SA 3CCQI 2VB6A 2I7PA 4IIOA 4AM6A 3FB9A 5JLHA 3CCYA 3CCRT 5C4XJ 5KYNA 4N0AA 3ABTA 3H3OB 4FWLA 1OPCA 5D4SA 1OX8A 3K0SA 1X3MA 2JT4A 3DWLA 2JRTA 3QYEA 2D5VA 3E1SA 5E3NA 1OCTC 2V4JC 3CJCA 3A0HC 4KMUX 1RDCA 3PQJA 3ZSYA 1ON1A 1UA0A 2JLEA 2XKPA 3F8BA 3MZYA 1Z25A 1IKXA 2HKXA 2JXBA 4QS9A 3BY7A 3PFYA 1B8IB 3R9PA 1K73C 1FT9A 3E9PA 2E20A 4V2FA 4NLBA 2IIRA 3FZHA 3VGLA 4GV6A 3GTGJ 3HRGA 5IXBA 2JA6J 4M7DE 2IVOA 5C2DA 1N3AA 2DI3A 1ZSZC 1VQKT 2QWQA 1B07A 3C6AA 4M77B 2HMIA 3IFRA 4M75E 2EGCA 4DV1K 3OA6A 1JKHA 5GINA 1WJDA 2BHYA 5KGXA 4KBMB 3RERA 1HJOA 1APLC 3RYPA 5KYWA 3MCZA 2DQLA 1N25A 4CZMA 2BTTA 5K7HA 1POGA 3ZSQA 2CGKA 2F96A 4GCVA 4CF1A 2VC8A 1HNXK 3NARA 4C2UA 1M3AA 1FXXA 3O9RA 3W3DA 2IA0A 4IVNA 3CJTB 2DPNA 2O4XA 4IHTA 1K73U 3ZGKA 2YUOA 2FBYA 3CC4I 1D1BA 3R0AA 1S72T 3L2RA 1IB8A 5DLOA 3I56Q 1H92A 3VEPA 3THXA 3IC7A 3NEUA 1S22A 1HYZA 1X9WA 2VUMJ 2MD0A 4EDUA 2M45A 1K73O 3NGIA 1XMAA 2UWMA 1EZZB 1UFMA 1GCQC 1E3MA 3DMJA 4OMPA 3TQNA 2KRFA 3OYBA 2IS4A 2Y90A 5AQQA 3RCOA 2VIXA 1XQOA 5JLFA 1TTHB 1L5UA 5GAMf 1ZBHA 3TEDA 1NOYA 2VJIA 4EMSA 1NJYA 1MSEC 2L54A 1K78B 1FP1D 4DYRA 1NG6A 3FHGA 2JA7J 4O0JA 2RV8A 4KREA 1KCFA 4CZJA 3CFPA 2K57A 2L3SA 4ILJA 2YI1A 2IPOB 3U3YA 4FJKA 1X4OA 4IOCL 2HDWA 1KVBA 1YAGA 5DCFA 1WHJA 3V9WA 1MNDA 1J9IA 4AM7A 2FBHA 5GPAA 3CF5F 4F2RA 1BN5A 1UECA 1VQ9N 2HXIA 4DF8A 4GXOA 4KFCA 3DV8A 1S9HA 2K5IA 2A6AA 2NNNA 2K3YA 4MDXA 4N4OB 2E41A 2PNIA 2ID6A 4E2FB 3H6EA 1S6QA 2FZKB 4CZKA 4RLFA 5KPRA 1UJYA 3S6WA 4N4NB 3Q0WA 1WSHA 1RI7A 3KP3A 2HS5A 3QWLA 3SFMA 1LDKB 3O3KA 1IBLK 3GWZA 3I53A 1X2NA 4ON0A 1MSFC 2WADA 2GWKA 1PU8A 4AIDA 2A6TA 3NCIA 1TK5A 5ADXH 2XIDA 3BZCA 4PJLA 3M5AA 5CVJA 1HCRA 2HEOA 1AVZC 1XS9A 1H8KA 1KA8A 2L7ZA 4CCJA 2OQRA 2BZ8A 3C18A 4RAGA 1YI2N 3KK7A 1R1VA 3HVTA 2EFPA 3HFOA 1GLFO 3CQXA 2KAFA 4N4HA 1J75A 3PV8A 5GANe 3I8DA 3JSCA 2IEKA 1QVFS 2YWWA 3BF1A 1Q82C 5LJ3d 2VBYA 3V6DA 3QP5A 2DMPA 2L3QA 4QSHA 3CMAA 2KJBA 5EGOB 4RTTA 3J80K 2XSDC 3WHBA 4BQNA 4F91B 2W85A 1X2MA 4AIHA 2EX3A 2PMZA 4YIRX 3RVCA 3A8GB 3M8EA 2JPSA 2DZCA 4C5IA 4JEPA 2F8SA 3SDBA 1GLEG 1WXTA 1QP2A 3LA7A 3CPWS 4PIIA 4FWOA 4DQSA 3C12A 3U23A 3DLBA 4BQQA 1N3CA 1VRLA 2R7OA 1WWXA 2DK8A 3BZKA 2A69F 3M3ZA 3M4YA 2DBKA 4II3A 1AHJB 3CCMN 4FLTA 2QKMB 4A93J 4N0AC 1S5JA 2JSCA 1GOCA 2ABLA 3BQYA 1Q82U 2ZB9A 3HL2A 5GAMj 4CIGA 2BTFA 3F6VA 1YW8A 2AZVA 3EETA 5D4RA 2WY7Q 4XU1A 3CLOA 2EILH 1KG6A 1SKUB 3RMDA 1YT3A 2EJRA 3U1KA 1ZK8A 3NHNA 1IXRC 1YQRA 4X1EA 4F9OA 4ZH4F 4FCYA 1TQIA 3LSIA 1WRJA 4HSTA 4HQEA 4MDWA 3H0FA 1CXQA 4YDUA 4IO9F 1BJAA 2QDLA 3CCRA 4ELUA 3LA2A 3K69A 4PLIA 4XN3A 3KVGA 2CQKA 2XIGA 3FDRA 4C92A 1WJRA 5IY5H 1A5XA 2W00A 4MQVA 5HK3A 4AWXB 3J7AY 1PYVA 2JUGA 4RLQA 1JUMA 4FJ7A 3EH1A 4IIMA 2KHOA 2D0PA 3RUXA 1OCPA 3WTXC 3VQDA 4G7ZF 3H0DA 2JUCA 3I59B 2G7HA 2VBWA 5D5VB 3GTJJ 5FKOA 3VEYA 3CMAQ 3KJVA 3E97A 3OS5A 3BR6A 3ECHA 4F7UE 4ELZC 2O61A 1OYIA 4QWQA 1W4MA 4HUFA 4MZMA 4CD1A 3I55A 3W6KB 4GKJK 4LB6B 1BC7C 3EG9A 1CSKA 3TAFA 3KLIA 4BR0A 1KQSS 1LEAA 3DKXA 4GRIA 2DT5A 1QWFA 2DL7A 1VQKA 4BC3A 1I5OB 4RGRA 3LFKA 3Q3SA 3G7ZA 1D1CA 3EFRA 1FY7A 1FSHA 3SMSA 2NOJB 2V1RA 1VSFA 1VQ8N 3CYMA 2LDMA 3KNTA 2X6SA 4IHXA 4G6DA 3KWIA 3OYAA 4HCBA 2XHIA 1BBYA 1BG3A 1OYXA 4NBQA 2L2OA 3DXMA 3EYZA 4JKEA 2QK9A 3OYNA 3M8SA 4CF0A 5KQDA 3JB9I 4M3XA 1ZTRA 3KFWX 2VG5A 1TNSA 3SK3A 4JKAA 1VQ8I 2LCLA 2WY8Q 1HW1A 4S0HB 1UGRB 5BRFA 2KTQA 1M8VA 3X28B 4M78B 4CEQA 2DD4A 2B4JA 1OZ2A 4KDPA 1WSJA 3V8JA 2SRCA 2ZM6K 2M1BA 1UHCA 3HSRA 4AG2C 2GTOA 3I0XA 2O88A 3JR9A 4JRKA 4DK9A 2FSWA 4OAZA 1X9MA 2JN6A 4JLGA 2C0OA 1USTA 3EFSA 3WVDB 3I3LA 2O0YA 2KRSA 1QP3A 1XGOA 4B4CA 4NO7A 3BCAA 1IN6A 4BQAA 1FW6A 3C4SA 1IG7A 1V5FA 4JJDA 1BW6A 2J7IA 4KIGA 2FMLA 2FMYA 4I2PA 1NKBA 2CUDA 1BI0A 1FP2A 3MDQA 5GJWB 3JYTA 2F5CA 3EKUA 1NG2A 4LH4A 5CQGA 3ZSVA 2YR2A 4O0IA 3CCVI 2F5VA 1RBUA 1HKQA 2UXCK 1J09A 3FIWA 1OH8A 1I07A 2B9SA 1YN8A 1EFNA 2KBTA 2CW8A 5A2QE 1R6RA 2ZCWA 1B8IA 3UDCA 4EGZA 2MG4A 1UG1A 3MP1A 4MIMA 1Z9ZA 1VQ5I 2YV0X 1T2KA 4E9GA 4YOYA 4QQDA 5KN9A 2K85A 3CJNA 3VN5A 2JS0A 2ATCB 4M77A 3NMUA 1NLPC 4WCGA 2KGTA 2J5OA 2JG6A 2XB5A 1NGEA 2YKMA 3E1YA 1SL2A 1WJQA 2Y48A 2VASA 3CQ8A 4DTOA 3HGGA 2LQNA 4ZZDA 3A5LC 2CQQA 1GLLO 4WQ5A 4C3HJ 1U06A 5LJ5j 2OTJI 3JCUC 3H08A 2A05A 1N8RC 2E2NA 1ZARA 2HZTA 1PUFA 3J7ZI 3P38A 2XAHA 1G3TA 2X6OA 3MEUA 1EH7A 2XF5A 1MNMC 2MOXA 5L3BA 4MLHA 1LVAA 1S1VA 3VYRB 4X1VA 5GAN2 3CCQQ 4CJPA 4AIKA 4C0ZA 3L2ZA 1HLUA 1Q7YR 3OOPA 1Y0UA 2KIMA 2VBXA 1W0TA 1B6AA 1W6XA 1JKOC 1MBFA 2YNFA 3BY6A 3UKRB 3CJ1A 1ATRA 5FD6A 1IN4A 3FXQA 3K4CA 3GF5A 4XBFA 5JVGL 4F4KA 3UKGA 1VA7A 5E26A 1KHIA 3I33A 3S2WA 3CCLA 3S3NA 1N8RU 1UE9A 2HXOA 3IAS2 3OMCA 4CGGA 1XWLA 2E1OA 1WI3A 3JCMP 3D5RC 2A42A 1K78A 1JXBA 3ASKA 4ZDPA 3H45C 3JCMf 5DS9A 2AXLA 4KI6A 4YDUC 4NHJA 3TMOA 1BKBA 5KE2A 1YCYA 3PNVA 3HC7A 2R7FA 3ECOA 3JV3A 4C92C 3HYFA 4M9XA 5AFUH 2DPUA 1N8RO 2R5YB 3MZHA 1JLQA 3PUBA 3QPSA 3IAYA 1D0XA 1KD1O 3ASMA 3HFNA 4FO0A 5AQMA 4I76A 4EJOA 3H3VK 2QM1A 4AUXA 2Z3YA 3MEDA 3GX4X 4FETA 4OINF 2DO7A 3BR2A 3J81K 4S05A 3CC4Q 4LE9A 4YOXA 2QQ9A 4NUBA 3VU3C 3WXMB 2XY5A 4EMKB 5BPDA 3U9DA 4PUOA 3VOVA 4QT7A 2NRTA 1WSUA 4E1NA 3VQEA 1U6ZA 5FGMA 1T6DA 3G4SA 3VYSB 3O3HA 2R57A 4LF8K 4J6XA 4HCKA 2RQRA 2D2WA 4JN4A 1D1AA 5DTDA 2OPTA 2X9HA 4KN7X 4A4HA 3MJXA 4RS8A 4HVVA 2IVNA 1VQ4I 4YOWA 2E88A 5CYMA 4Z89A 1BM9A 2WV0A 2MABA 1ZYRF 3HXMA 2K6DA 2H3EB 1LDDA 3AVJA 3NGZA 3FBNB 2OZ6A 3SDGA 2ISYA 4ZGJB 1V3FA 2QUFA 5FU6B 3HOUJ 4WXDA 2YNHA 3EO3A 1RNLA 3X2QH 3E01A 4CF9A 5JMVA 3CMAN 1KFDA 5EGOA 4JD2B 3CCLQ 4P1WA 1RIOH 4LDWA 2Q2RA 3TI0A 2D1VA 3DBRB 1RAHB 1Q86O 2PMZN 5F0HA 3FZFA 5AQOA 4M7AE 2MLGA 4QPQA 4RB3C 1QPMA 1ZRFA 5D6WA 3DLAA 2BBYA 4DU4A 1RCHA 1XMXA 4QVDA 3A2KA 2YU3A 1T95A 3QETA 1G3SA 1LFBA 1FYLA 3SD4A 4M3TA 2O3FA 3DF8A 1JXSA 1WSGA 3EYYA 5C25A 5JS2A 3SB2A 1IF1A 3SLCA 3CCUI 1TUYA 5IHIA 1NMNA 4JKCA 3FKJA 1AWJA 3VYGA 4KRFA 4AHSA 1N27A 2YRDA 2E2OA 2KLOA 3CBPA 5C2FA 4M3RA 1KG4A 4OMNA 5L3EA 4GY5A 5JVTA 2V7ZA 1SD7A 1QGPA 4HYEA 3VS1A 4PJOB 2BKDN 4KIFA 1JLFA 4RB2C 2DFIA 1AA7A 3VQ9A 1OCOH 2RNAA 1XCVA 2DOFA 3NF9A 5GAEP 3HM9A 4OF1A 1RKWA 3HRSA 3CCET 3DTIA 5TJJA 3F10A 2GA1A 4FM0A 1C6VA 2N8GA 1Q81R 1YIJI 1XX5A 2OPPA 2ZXHA 3W0LA 1ZSGA 3CCRN 3IDHA 2Q31A 1KQ8A 2GEMA 5GAMg 3O3GA 2CZ6B 2R7WA 4M77C 1F1BB 2HNHA 1GLBG 5IT9K 3ID6A 3RESA 5I21A 1RBTA 4FT2A 4TSXA 4DF4A 3CCJA 3HRUA 2F4MB 2KKOA 1Z77A 3TAEA 1NLVA 1BC8C 1J53A 4KHSA 1ACIA 3I59A 4WQ5C 1RT5A 3BTJA 3TTDA 1E6GA 3LFUA 1YW7A 3AGRA 2E2PA 4CHOA 5F64A 1VYVA 3I55N 1VRTA 4Z88A 4BEHB 1LCKA 1HPZA 4IOXA 2P4WA 4R55A 3TQ7P 4U7DA 3H6ZA 5DYMA 1VQKN 2P5GA 3VDXA 3W3CA 4K11A 1OFCX 3KEOA 1JLGA 2QGUA 2JHJA 2EQUA 1Z91A 1XGSA 1YG2A 2QCOA 3C95A 4DFMA 4J9IA 2DK3A 4YFUA 2BE7D 3DPTA 4QVCA 3LWIA 3PIPA 3TL4X 3BLYA 4ENKA 2L0KA 2XAGA 3BROA 2UUZA 3DTKA 3KYDB 4PJNA 2QQ8A 2YLCA 4KRTA 3AVHA 1L3VA 2OA4A 5B1BH 3ER0A 5ILVA 1O9SA 4RTWA 3H9GA 2W25A 4CF8A 4K41A 4F3OA 1R22A 2F6CA 1ZLKA 1HNIA 5KHDA 1XQPA 4RMOA 4M78A 2VI6A 4B3OA 2H56A 1MD0A 1S72N 1QRYA 4OPAA 1QBJA 3G2BA 2E10A 4CJVA 1VQOA 1H3HA 2HQNA 2Y31A 3DRRA 3UA7A 1M90R 4DV3K 4WX9A 1DGKN 3OR2C 2CJJA 2DIGA 5F0XA 2MH9A 1I3AA 6AT1B 1X1PA 5GAOq 4OB0B 1FOYA 4E7KA 4O6JA 2M0MA 3MKLA 1S72I 4FJJA 5EG2A 4UHTA 2HKNA 4WCIA 4L0ZB 5D3GA 3PUFA 2ABKA 4HLXA 3FXUA 2LLKA 2LK2A 1LAWA 4F52A 5CVIA 2IC3A 5F04A 4DUZK 2OF7A 3KXTA 1VK0A 4QW2A 3ZXSA 3CCJQ 2Z1DA 2OYQA 2RJEA 4E6RA 4HF2A 2YG9A 4CI6A 3EUHA 4CICA 2KFZA 4H5TA 3IKVA 4M7DB 2GOXB 3SQ1A 4JZ3A 3C7NB 2YSRA 2Q0UA 3MKYB 2KRNA 1YWPA 4BRKA 3HGYA 2DA3A 4HXJA 2KZMA 5HDKA 2DT6A 4BJ6C 3VS2A 4CCKA 3ZMZA 4ZGEB 2NUTB 1F36A 3BGRA 1NEGA 2RD1A 2QASA 1VQMA 2K9LA 1PSEA 2EQIA 5J3BA 3HBLA 4M3UA 1V4RA 4BXXJ 4I6MB 5J4YA 2JA2A 1QQNA 1T33A 3D0PA 3ZSOA 2VE9A 3DP7A 1VSEA 5AQYA 2EQMA 2RF0A 1XHXA 2O8CB 2QA4I 3PQKA 1ZRDA 4XEIA 1MMGA 5KRSA 2ESHA 2RQVA 4HZFA 3VS0A 4J8FA 4DV0K 1FOXA 4JLHA 2FF4A 2EPDA 2PFBA 1Z7LA 1NGFA 2HNYA 5ECAA 4F8RA 2QTXA 2GF7A 3K1MA 4JI1K 1QW1A 1T8IA 5BRDA 4DSLA 4MLEA 2XU8A 1P4AA 5J2NA 3QYGB 1HKBA 2NRRA 4ESBA 2NZTA 3M53A 4I9QA 1BI3A 4C8KA 1RDAA 1ZN2A 4NCGA 3S1NJ 1VQOQ 2HSTA 3SUQA 5LMNK 5GPCA 1WUAA 3V1QA 4DQQA 1WHGA 4XLNF 3BOQA 2GQVA 3M0TA 1TTYA 4M41A 2OPSA 1YNZA 3SQNA 2P9UB 2X48A 3ZQCA 3O3FA 1RLQC 1HSJA 2LTPA 2DJNA 3KP7A 1R0AA 3E19A 1IJWC 3FKIJ 3D0SA 3UKRA 3WNHA 4A0YA 5LJ5g 2DTIA 4EAHD 3CCVQ 2E71A 2BIVA 1MWMA 2KFDA 4I98B 4O5VA 4Q5SF 3FMSA 1X6BA 1KEAA 3LDNA 2CG4A 2QAZA 2O01E 1ZX6A 3CEYA 2CZ7B 3PMTA 4JAXA 1VQ5Q 5LHHA 4HTUA 4IKFA 2FBIA 1VQMQ 2BUDA 4CK1A 5E1ZB 4A0XA 2EKOA 3BCBA 3BG7A 4CJWA 2F5DA 4MMLA 5DEQA 5AT1B 3FSPA 1K0XA 4DFPA 4BS9A 1H0MA 1MJAA 3HT3A 4C0DB 2MWOA 4D7MA 3TSQA 4PKIA 1T7PA 2BVMA 2R5YA 3AO5A 2VBZA 2X4HA 2ZPBB 3NTIA 4C8OA 1LWCA 1YJ9I 1VUBA 4ESRA 1RT3A 3OR1C 3S9HA 5TISC 2HEQA 2MSYA 3H46O 2XPUA 5C0MA 3GL1A 2W42A 2OTJQ 1JUSA 2Z1GA 3M0QA 1LE8B 3SZPA 4F92B 3ABUA 3J7AO 4R8HA 1UHWA 2E1HA 2CH0A 5ICFA 4FTHA 3AVIA 3DJCA 3TU4K 4BGBA 2VQCA 1V5EA 3NH0A 1NM7A 4J9BA 1N6QA 1H9GA 3T9NA 2R7VA 4CZLA 1I81A 5IHKA 4BY1J 4FL9A 4FLVA 4B9WA 2KXDA 1BOTO 5FPNA 4EMKA 2LY9A 3QKJA 2CH4W 3OYKA 2HWVA 1MW7A 3G4SN 3E5UA 2HNDA 4Y52J 3RTVA 2COBA 3GO5A 2K7AA 5HOOA 2F2VA 1J5OA 1REPC 5GMKe 1VSDA 2J6FA 5IP6A 1WDXA 1TH7A 3CCSI 1IXDA 1E3OC 3E9LA 2ELHA 4E9HA 5ILSA 2PJRB 2ZXWH 4FWSA 4HF1A 3PO2J 3QIOA 2QEXQ 1GV5A 2GLOA 3MKDA 5DY9A 3QAHA 1N75A 5JLXA 2RHKA 3SAGA 2YHAA 4JKBA 2HOTA 3M54A 4IOAL 1QVGP 2OZUA 2F2WA 2M02A 4M78C 5EEAA 4A6DA 2AHJB 1SD6A 3I5UA 5AR0A 4JD2A 2O8BB 5J40A 2DTRA 2KVQG 3LDOA 3RIRA 1NK0A 2JMAA 3OYDA 5KNLA 4M75G 2P9KB 4LIUA 2HDAA 1V4SA 2YJFA 1NEBA 3THYA 3RR7A 4QTRA 3MKZA 1YJWI 4LFCK 4H0TB 1EQYA 1N34K 4B8CA 1YF5L 5HKCA 1IGNA 2OQGA 1Y8RB 1TV6A 1UB4A 3MWPA 5HRRA 2DAQA 3OYIA 1TUCA 4PSXA 4U7BA 1MMNA 2HQAA 2AKLA 4KITB 3H1QA 2YUPA 4JJNK 5CKTA 3HOTA 2HYGD 1MH3A 1DGRM 2TDXA 3VENA 5MLCQ 1HYSA 3EUHC 1K6OA 3MCAB 4DLGA 2O8FB 2XASA 3O8MA 2GBQA 4B9LA 2MGQA 3TR8A 3BW1A 3AVMA 1REVA 1UFFA 2G8VA 1J5YA 4JX6A 1B9DA 1GLCG 4JUVA 3LANA 3BPVA 3S14J 3K1NA 3SPZA 2QWLA 4J2AA 4FLXA 5E20A 2KMUA 5AJ3K 5CCAA 3K9JA 4M63C 5I22A 4BJTA 2KDZA 3CPEA 2IRFG 1RGIA 1KVCA 2P4RA 3G10A 3CC7I 5BPLA 4DLEA 2KYMA 1O3RA 1NGJA 1EV7A 1RT1A 2DA2A 4UQGA 1XMKA 2E6NA 4LJZF 1M9SA 2PUOB 1VQ4Q 4H5VA 1LW0A 5CE3A 2XY8A 3HSCA 1UG0A 1E0EA 5E41A 3F8FA 4FX0A 2HFHA 3JCMg 4H0OA 4Z4CA 2W1OA 3CCJN 4CJLA 2JWKA 4ZYDA 1A0NB 5GMKi 3NE6A 1WPKA 1QVFP 2NOEA 3SZTA 2Z1JA 4NC6A 2B86A 5LGNA 1AWCA 2IVPA 3FE1A 4EMHA 4PZJA 1LWEA 3ASNH 3HZJA 5BREA 5E3MA 3PY8A 2V52B 1ITYA 2EK5A 4BEHA 4OMQA 3AFHA 1X1CA 1G8XA 3M9QA 2DYSH 3FXMA 4EJVA 1Y57A 2IAIA 2Y0SA 2OC6A 1BGXT 1QSYA 1D5AA 4BI8B 3HTRA 3I4NJ 2RPNA 1TQMA 2GX9A 2XHKA 4PKHA 1SKWA 1TWCJ 2HHQA 2ELJA 3ZQ7A 3DAWA 5FLXO 3TREA 2JTVA 2M5WA 1BIAA 3IWZA 5C44J 1WKMA 4C1NI 3ASOH 2A28A 3VEWA 4Y7NJ 2K2MA 1ZHIA 1UAXA 3SBGA 3QLHA 3I4PA 3EG2A 2FEZA 3UKUB 1B4AA 4DQIA 3JW4A 1KRPA 2HKQB 5J3LA 3IH7A 3FZLA 1JJ2P 4P9UA 2K3BA 3GYHX 1X3WB 1IKYA 2L9RA 1NU0A 4FZXC 5C15A 1KQ2A 4KICA 3S3MA 2DDBA 1YIJQ 1YHQI 5DM7L 1U1SA 4FM4B 1HC8A 1X9JA 5HLFA 5IXFA 1VQON 4B1ZA 3ID8A 4FJ5A 1XTAA 1WFWA 4CZGA 4FASD 3J7ZO 1O3QA 2PQWA 3JB9J 2ZD1A 3JRHA 1UJ8A 4C92E 3CUOA 1YX5A 3HSBA 2ROTA 4DGWB 2G8FA 4NCBA 3QYFA 2MC4A 2YS9A 1SHGA 3JAMO 2W7NA 1XCBA 4M77F 4EM2A 1EXQA 2RHYA 5IWAK 3W6VA 4KB1A 4CJFA 2OFIA 5L3GA 3JREA 4CJUA 3N4PA 1YW9A 2VVKA 3CVTA 3OS2A 3O2PE 4L9NA 3ROUA 5J1YA 3KLEA 1NJIO 1T05A 4O44A 1ASWA 4M7DA 3KYLA 4HNVA 3GG4A 1PWTA 4ELYC 1X69A 4DSEA 3ZQHA 4M75A 3NRVA 4XSZF 3DRPA 4EMKC 1U5TB 4M4ZA 1W2BP 5J8CA 1JTXA 1OPLA 2NUTA 3U6FA 1WJEA 4UV9A 1E17A 2RB6A 5GAGP 3VEVA 2KE9A 4GO1A 3O6BB 5FO5A 4I6MA 3HJEA 1VNDA 4RGSA 1T0FA 2XUBA 2O8CA 2HOEA 2CYZB 2ZJPF 2HD0A 5EZHA 4XLAA 4XSXF 5J1RA 4IUTA 3RR6A 1SAZA 5AQLA 3Q0VA 2NOZA 2F1LA 2DAOA 5FU6C 2ZJ2A 4BRLA 2WBNA 4G6TB 4FQGA 3CJAA 4CHPA 4CHNA 4LF7K 2L8DA 3OMYA 4C5EA 4RMNA 1N5ZA 3R6MA 3H5AA 3WNFA 2V6CA 4YOVA 5I9EB 4RG8A 3HHTB 5F0FA 4JYAK 4WE1A 4B3MK 1GHCA 3VB2A 2PZ1A 1B9FA 4WF9L 1FBQA 1YUWA 4Y33A 3M9AA 2L02A 2HKOA 1W7PB 1JCEA 1K9MR 2FQ3A 4C8QB 1GFDA 1OLTA 1SAXA 1UG2A 3I4MJ 4G12A 2ZF5O 1GLNA 3CTAA 1ZUKA 2LFBA 4PA1A 1VQPT 5TKYA 4J01A 4CJ5A 2OUMA 1AZGB 1ZRCA 2W24A 3G6ET 4DBHA 2FJ1A 3QO3A 4F7UG 2M34A 3UWNA 3G73A 2LREA 4PJ0C 4CCOA 3H1VX 1ORPA 1ACMB 1M3HA 4XH4A 2E2JJ 1H89C 1VRUA 2C0TA 4PJOC 3I0RA 3OW2M 3K70C 4GY2B 4HVUA 3H0IA 4WTOB 4ABZA 4DQ8A 3F9KA 4CH7A 1U04A 1HXDA 3PX0A 3H3NO 4CHQA 5LY3A 5GAMe 3K2AA 1ARKA 2LOOA 5DCMB 4AVZA 4FXDA 2P9NB 1Q8IA 4NB4A 2JVVA 3E9FA 1RR8C 3CQYA 4JKDA 4IZZA 5JS1A 2QA4Q 5AQRA 5ERIA 1OU9A 2LT1A 2DYRH 3WODF 4OB1B 1R49A 2ZQBA 4L18B 4M77E 2CGJA 4M3BA 3HO1A 1ZBLA 1YJNT 3ZQQA 3H9QA 2DF6A 2FNPA 4DQ2A 3E6BA 2D9TA 4OB3B 4YOQA 4Z0UA 3T19A 4HV6A 3P8BB 5CVVA 5J2QA 4RAFA 1X58A 2F48A 1PD0A 4LLLA 3CWUA 2NOGA 4B1RA 1RFQA 1ZA1B 4LOCA 4J9DA 1TNTA 1WHLA 2OU2A 3KZYA 2DL8A 1M1GA 4ICLA 3OB9A 1LE8A 4F04B 2RM4A 3HEFA 1MZBA 4M3EA 1VQ6T 2EGAA 1NBWA 4F55A 2AP1A 4XICA 1MKMA 3CO7C 4CC4B 3SJJA 1ZGJA 2WAEA 5C12A 3CPWA 5HNHA 2UUCK 1PG5B 1XSVA 4L59A 1BOBA 3BDPA 4KTWA 3JSOA 2NXNB 3CCEI 2VOPA 2CYYA 4EJZA 3VS5A 2D1KA 1VQLI 4OMOA 4AT1B 4PFPA 3O80A 4PFOA 3R2XC 4NXMK 5JLWA 2NRXA 1GOAA 1SPKA 4FSSA 3CVSA 4CK3A 2PJRA 4HV5A 1DTQA 1PSFA 5GIPA 1NBEB 4BWJA 2KMTA 4E7LA 1BL3A 2E5QA 3JS6A 2V26A 4K25A 2WSFE 3NPFA 1TT5B 4A53A 4OWRB 2OJ2A 2JRMA 4CEAA 5LJVA 2RJDA 1BQMA 2KRMA 2A0FB 5D5WB 3SUOA 4CFAA 3O6WA 3MEGA 2O8BA 3O8GA 2HBLA 2IS1A 3X26B 1E7OA 1WVRA 2ASPA 2D4WA 1TUUA 4EW4A 1W36D 4Z4IA 2Z16A 1RADB 4QCLA 1IRZA 1IKVA 2P9KA 4MO5A 2QYZA 3L1AA 3VRYA 4FWKA 2GFUA 3N97A 4QOZB 2JNGA 1KSWA 1R0CB 2RQTA 4M3FA 4D5FA 2A5YB 4KV8A 3HYIA 2X4XA 3LLRA 2R5ZB 1YJ9Q 4EA5A 3FZMA 1JO8A 3ENBA 2P7VB 1SKRA 2O9LA 3UR3C 3QB0A 4XAXB 2KT8A 2ECBA 4FIBA 2L9SA 3LSHA 1Y0NA 4H4KC 3V9XA 4Y28E 2BVLA 2WSCE 4A69C 3AKZA 4KYWA 2O8FA 4UUVA 1ZC6A 4M7DC 4CERA 2DLLA 4ZDLA 2KRHA 5KYYB 3JB9H 3META 3SMPA 4A5AA 2F5KA 2M7AA 4M75C 4NQWB 1QHHD 2NRHA 1KQSA 2X6NA 3SJHA 1A31A 2GIVA 3SYTA 2X1EA 3MEXA 3IH2A 2H1LA 2UXBK 5BPNA 1KXPA 3WTWC 3FK7A 2MA3A 2CUJA 3ELKA 2Y2ZA 3EZ5A 3CCSQ 4DR3K 3ABMH 1WSFA 1UHSA 1QMCA 2AO9A 1T0FC 5LGUA 5FDLA 4ISEA 3AG1H 1WH5A 3PIPF 5J26A 1DPRA 1RAAB 3M59A 1EX4A 3BG6A 2FPEA 3PO3J 2BUPA 2X6YA 3B6OA 3ZR8X 3I58A 1JGSA 4IQJA 2KIFA 3TANA 2IW5A 1CKBA 1NMDA 2YU9J 4M78F 1K73R 2OPQA 1FPQA 5GADJ 1KZHA 4CJQA 1A36A 1GV2A 1IO2A 2TRTA 1YJWQ 4JX4A 3V42A 2ZMEB 3LZJA 3FLGA 1KFZA 4M78D 2V51B 3I9QA 1PU6A 2F7TA 4M71A 1VQ9T 2CV1A 5E84A 5ADXA 1YOVB 2RDPA 4CEBA 1RRJA 2OA8A 2Y0SN 1LPLA 5LJ5e 4HHTA 4BBRJ 1I5ZA 4XTWA 1MMAA 4PK4A 3H92A 3VQBA 3MCPA 3MEWA 4PCQA 2LC4A 4RWTA 3R3LA 3JCMb 3CP8A 4HAMA 2ATQA 4L9JA 1S3XA 2M16A 2FBXA 1X01A 4V2GA 2VWFA 5J6XA 3VOEA 3CC2I 2ZPEB 3UKUA 3J80O 4DHYA 4J9GA 4FOEA 1H9TA 1OKRA 4IRGA 2GQIA 4DTSA 4XIUA 5FKMA 1TC3C 2RHXA 4LGWA 3LMMA 1ZELA 2VKEA 4NC8A 1LNXA 4NYFA 4IDKA 3CC7Q 4CEEA 3PSIA 1Y07A 2WV1A 1YI2T 4BBSJ 4GLKA 2K02A 3VS3A 3GBQA 2WSEE 2LDUA 3ZCOA 3EKSA 2I5JA 4DOWA 4NDLA 1L3LA 3SQ2A 4B3SK 2LNVA 4C0DC 4AIJA 5AQTA 1MDMB 1EKEA 5K5OA 3CM5A 3ENOA 1U47A 1FJGK 3MN6A 3CMEA 4XH1A 4U0VA 2GELA 3W2AA 2P9PB 1F4KA 4DMNA 1MNEA 5F1JA 4BD3A 1IGUA 4C2MJ 2E5KA 2XY7A 3S17J 2QQSA 1Y8QB 4DTJA 3CDIA 2RKHA 3CCMT 1U5TA 4U0YA 3UE5A 1IDZA 2VXEA 3IUCA 1MUNA 2L3PA 4CYDA 2E1NA 4XM3A 3KK3A 1IXSB 2K5FA 1SKSA 4YY3K 3QSUA 2O8DB 4JKHA 2TCTA 4WXHA 1ZBXA 2GOMA 4DEYA 3OW2S 1P8ZA 4DUYK 2KISA 1N6AA 1IZ6A 3IP4B 3BDDA 3ZETB 1VQ6A 4BI4A 1WIEA 3KKSA 4M78E 4Z4EA 3F21A 5LMUK 3SFIA 1YHQQ 1MMSA 2AQEA 2UZKA 5AQIA 4L8RB 1TLHB 5HLIA 5ICGA 5HRPA 3PNYA 4A0ZA 3Q9VA 1X27A 1WXUA 3NF8A 4A12A 1V76A 4FJIA 2XHCA 2F5TX 3QOEA 5GTIC 3G71I 1W7PA 4GVMA 3SQ4A 3OSVA 3JCMQ 1BA1A 5FKNA 5B1AH 3C2GA 3QZ5B 2CH6A 2DOEA 1ULYA 4CI0C 2UUAK 3I0WA 3HL8A 4UUSB 5FROA 1K4TA 2R7TA 1WI9A 1RUNA 4K0KK 3D2EB 4E0DA 3KIOA 1Q82R 4CW7B 1N33K 3E3VA 4AIAA 4DJAA 4RCBA 2DXTA 4F7ZA 4L0YB 2F2XA 4XLHA 2ZBKA 2HZDA 2COZA 5M5XJ 2JUFA 1AKHB 4E1JA 2UXNA 4ZHRA 2JQ7A 5EOYA 2FEIA 1VSMA 2A61A 3TWHA 3QERA 1XD7A 1CGPA 3AO4A 2W48A 5FLXE 2MMPA 2VXDA 5LJ5h 3V7SA 2R5AA 1M1KC 3G3ZA 2ZSIB 2DFFA 2P5LC 3I54A 3KPHA 3F8MA 2RN8A 5F27A 4IOCF 1MPGA 3LH0A 1KFSA 3RSEB 5DCMA 2K3FA 4FVMA 3ZMVA 2E12A 2P9NA 1JLEA 3T7ZA 3JCMe 2A5XA 1ZR4A 5KCHA 5M1FA 5E17F 1D8KA 3VYTB 4AHTA 4HNTA 3KLHA 2P51A 4A2UA 1U5SA 1VF9A 2PYLA 2L5QA 2Y0MA 2NOIA 2O8EB 1KG5A 3SWNB 1LOTB 3ULEB 2KRCA 3R0JA 2W0ZA 3AG3H 4Y4RA 4H0XB 1HQCA 4IPAA 4KFBA 4X9CA 2OJED 1XG1A 4DBFA 1KJWA 3M0SA 4DR5K 1F1ZA 4A4GA 2NS7A 4CGZA 2H8WA 2W6LA 2I2LA 5FFZA 1M1KU 3JAME 2E7XA 3I56T 4J9CA 4IX7A 3QZ9B 3SUNA 1WCMJ 1DT9A 4CC7A 5CAIA 4CJTA 5BOXA 4E6KG 1VQ7A 1KG2A 3WU0A 3UNGC 5DM6L 3L9FA 3ZQLA 5F1RA 3OBWA 4PGGA 1ETKA 1RT7A 2M1HA 4D0PA 1K7AA 1ZBSA 2HBMA 4XH5A 3PX4A 4G6QA 1RI9A 2XICA 1C1AA 2GTJA 3QIPA 2XAJA 2HGCA 2ADUA 2ZE2A 1M1KO 3TAGA 4LD9K 1X75C 4QKUA 4IHYA 2GUIA 1SFEA 2LF8A 4M7AA 2P7CB 2RPIA 1FWZA 3M8QA 4K43A 4BDZA 5LJ3j 2JMWA 3TPQA 1QQIA 1AWXA 1STZA 3G25A 3DOLA 1TUDA 3K4MA 2GZWA 1RDDA 4RBOA 1FIAA 2WFBA 3EGXB 2PTKA 3R1XA 3M0PA 4CSWA 5EJCA 2AQFA 2XGDA 4I01A 3EE8A 2W82A 2J6OA 2M8GX 4XK4A 1EF4A 2QF7A 2RI2A 2YCHA 1D8JA 3LWMA 3VEZA 2K27A 1E3HA 4PSWA 2HHSA 3ZYYX 4UOBA 4U88A 1I94K 1YTYA 1K8KB 5GAHP 3S1RJ 1XGMA 1YX3A 2KFNA 1ZA2B 4DEXA 2BEOA 1QZZA 4XOTA 2ME0A 1W0UA 3EFOB 1G4DA 3E9GA 3KLNA 4HQMA 1PU7A 4LIVA 4DYQA 2BW3B 2CQNA 3DEEA 1Y96B 3DU6A 1B34B 5HP1A 4KI4A 1N5YA 4A4KA 2V8IA 2IPQX 5I42A 5KYYA 3FXKA 2O4IA 2EZIA 3BR1A 5F2RA 3TP3A 2A7YA 3GOXA 1TUGB 2EYYA 3NVKA 3KK2A 1ZBUA 1RPWA 1U5TC 3RPUA 3JRDA 5H1SQ 4PJJA 3MX5A 4OFHA 3JRIA 4DOVA 1VQLQ 1SUQA 4YOUA 5DV5A 4WFBL 3HI0A 4KH4A 2PYJA 3K4JA 1S9GA 2PVOB 2X4JA 3GFLA 2WA0A 1K0SA 3MN9A 4LD5A 4MMKA 5AFUA 2L89A 4GFBA 4CA0A 3A01A 2F9WA 1V1CA 1WSIA 2HOAA 2HYFA 5H20A 4KJZA 3NGYA 3GTMJ 4JKGB 8ATCB 3HPWA 3BF3A 3FHFA 3O8VA 4GNIA 4IF4A 1KAYA 2QWOA 2D1XA 3CXCS 5HLGA 3V7CA 2QWPA 5CR2A 1ZBFA 3L0QA 2ASOA 5C24A 3O1BA 5M5WJ 2GWJA 2OZMA 4Q5WA 5K7FA 3EAEA 3L1PA 2W40A 1B3QA 3ISPA 2M0OA 2QGFB 4KH1B 4GLMA 3VYUB 2PBDA 3J81O 1K8AC 3KLGA 3C6TA 1YITI 2CGPA 2BH1A 1FYNA 1HJRA 5AIPA 4EQQA 1VYTA 4EEFG 3VQCA 1KG7A 2ZMEA 5GAN5 3K5OA 1CZ9A 4C8QC 3OYEA 1HW2A 2LJ3A 4B3TK 4KHPK 2QWRA 2EYWA 1P2FA 3L42A 1VHXA 5KCMA 2XGCA 2DDAA 4A2AA 1VQNA 1O4XA 5CYQA 4DSFA 2ME6A 3BP8A 3CDLA 3HJFA 3RQ4A 4EIKA 5B3SH 4NCAA 2FG0A 1RBSA 1RDUA 4MO4A 2WC2A 2DMUA 4HW0A 2DETA 1N8RR 4PJOE 1KO9A 1FTTA 2OTLA 3IG1A 3LPTA 2BYVE 4EZ6A 1U1TA 4OLBA 2CS7A 4M7DF 3BTCA 1K8AU 2LNHB 3CPWM 5KTQA 2O9SA 3SDZA 4XTVA 3NWSA 1NKUA 1GLAG 4BRHA 3LYIA 1TW2A 1WX6A 4M75F 3VEOA 3WQTA 4M7DD 1BW5A 3CD6A 3GP8A 2PVDB 2Q3SA 1RKTA 2RGVA 4BROA 5IYCJ 1W7AA 4M75D 3G6EN 5J8FA 3CIPA 4I99C 4J2DA 3FIFA 4J9EA 3PFSA 2FA5A 5A0DA 4IBNA 2AZSA 4XU3A 3CMAT 1XNQK 2PX9A 3KUFA 4H5NA 2JVHA 2VCPA 3MK6A 1VQPI 2C6YA 2KY9A 1N9SA 4RKUE 1AOJA 3N5BB 1MDMA 1Z67A 1NK4A 3MZ8A 3EH2A 2QKLB 4I7HA 3Q7BA 5EEGA 3G6EI 1B59A 3CMEN 2JT1A 1KK7A 3IRXA 2GBYA 3FGUA 2ESWA 4XKVA 3HTUA 2BZYA 1QKXA 3H0HA 1FOKA 1BOAA 4N47A 5FLMJ 5BNGA 2E70A 5CLSA 1W5TA 3FR0A 2VG7A 3KCCA 4IQ4A 2BANA 4KKOA 3EG1A 1ETWA 4M7YA 1HQUA 3GTQJ 2ZC2A 1QTMA 1KU7A 2MF2A 1NWKA 1YJNN 3PX6A 2MC3A 4DR6K 1I39A 2L4AA 2DW4A 1M27C 4V19K 3PNTA 3QO9A 4HT9A 4QS7A 5CKDA 3IS9A 5IT9O 2EYQA 4ZTFA 4M7AC 5GAOn 4BUGA 2DFUA 2O8DA 4F3TA 3GW2A 3MEEA 3CC2Q 5ED4A 4DCHA 4BXUA 3WEEA 5CK9A 3I56A 1YJNI 4JHDB 4LDVA 4OIOF 3KKRA 4UY8I 1FX7A 1VQ6N 1ZH5A 4BE0A 1TL3A 4NS5A 2OTLQ 1QVPA 4MTEA 1JHFA 2EA4A 2M30A 3JTHA 2EIJH 4OO1J 2A3ZA 2EHGA 4X6AJ 3J7YJ 4CJ7A 4AC0A 1M8MA 4IEJA 1Z7UA 4D8KA 3RMCA 4M3DA 4G94A 4CZCA 2EFIA 4XRFA 3CD6Q 5DPKA 4ORZA 2EPFA 3DLKA 5JR3A 3OH6A 3MPUB 3C6UA 4ITVA 3JCMV 5LL6Z 1WAJA 3ZT3A 4GVEA 3PL8A 3VQ4A 4CEFA 2ZJQL 1T3VA 5GADP 3DLEA 3UA6A 4UUSA 2AK5A 1WN7A 1CF7B 1G59A 2QXLA 5JVGF 3PTAA 3QBWA 3S15J 1U3OA 3VQ5A 2HU9A 2HQHA 2CU7A 2J6KA 4XNFA 2ECCA 3I55T 2R7SA 2VWKA 1PHTA 2ETJA 3HOVJ 3T1YK 3MKWB 4LUEA 4OGEA 4CE9A 3GXOA 1AKHA 3VGMA 3VTHA 2CUFA 2I5WA 4J2BA 4FOIA 2HVQA 1LFUP 4Z4HA 2BY1A 2A68F 3EGUA 3WNEA 3A8YA 2K4JA 3A5MC 1QHTA 3ULRB 5FWBA 4QPOA 5CHIA 4XN0A 2P81A 3M3YJ 2ZAEA 4A62A 3HTSB 4E70A 2DL5A 3NVMA 4XTXA 1R5HA 1FYKA 1IG8A 3HK2A 3RSEA 4W97A 1GXIE 4A5BA 3UIQA 4BRCA 1LFPA 3EN9A 2A36A 3J80E 3C0BA 3C1DA 4O55A 2IGNA 4MEYF 3NTKA 4LF6K 4ASNA 2PFUA 3NAUA 1LWYA 4UVAA 2FRHA 2O6GE 2VPRA 4GMJB 5H2FC 4CJ3A 4A2BA 2O8EA 2F69A 2HBWA 2NOBA 3QEWA 2MW8A 4DS5A 3W2WA 5D7UA 2X6XA 4MNUA 3DYAA 1WAFA 1IAWA 3KBGA 4MZPA 3Q7CA 2KK4A 1FKPA 3ME9A 3VGKA 4CIEA 2YX6A 4BRIA 3FEOA 3VF6A 2FB7A 2CZ0B 5IH2A 5ELZA 3CCQT 1QKWA 3G1MA 1DUXC 1U84A 4C92G 3IH4A 5GAEJ 2MCNA 3RMAA 3G71Q 3X25B 2ZMEC 3MQ0A 3PSFA 3RR8A 1NGDA 1QZYA 1VQ7N 3A0IX 4BREA 3ABLH 3M6GA 2WC9A 4N56A 4FK4A 4M7XA 4OKEA 5DUKA 1U2VB 3DKWA 3SJMA 1KG1A 3SPYA 3MEAA 1TG0A 2A5WA 2DTZA 3PM1A 1YS6A 5CIUA 1QCNA 1O3SA 3I0SA 4PL7A 1Y1VJ 2GAUA 2R93J 3QJYA 1SFOJ 4B9UA 3M1FA 1XN7A 2XKOA 1W5CC 5H6QA 1OVYA 3L6QA 2KLAA 3PIOL 3RWUA 4ILGB 2DA1A 3URGA 1NH3A 1JJ2A 5HLHA 4AH9A 3HP6A 4HNUA 1T0JA 2HTSA 1JRIA 1K61A 2DL4A 1BA5A 4AILC 2JHNA 4RUGA 3EGXA 1AOYA 2R7ZJ 3L4QA 3NF6A 2HTJA 3T69A 4LD0A 4K2EA 1PJRA 1IRXA 3UATA 1IN8A 1ON2A 5EEHA 4ZZLA 4YPRA 1PKTA 4FVUA 4F7UF 3OYYA 4ZYGA 5LJ3g 3M7GA 1VQ9I 2W4SA 1K8KA 1HMVA 2P9IB 4DZJA 4E3SA 4KUMA 4CBXA 4FJHA 1UTIA 2X9DA 4KA4A 3LDPA 3WTVC 3HPHA 5IYBJ 4DTXA 3EFOA 5A2QZ 3F2KA 4J8OA 3WG9A 3K4NA 8AT1B 2XAUA 3IRQA 2QBYB 4P55A 4XRSA 2R7XA 3TAQA 3VSLA 3RKYA 3O1WA 4RW9A 2D8JA 1Y96A 1B34A 5EU7A 2XDBA 4JP0A 1XHZA 2GA2A 3DLLL 3A8MB 4FSXA 4DIQA 2JS2A 1ZSZB 2EV6A 1F9NA 1XC5A 2JK3A 2LQWA 5J1EA 4LITA 2VQFK 5JI6A 1YI2I 2VWBA 4N41A 3OYJA 4BWMA 2VV5A 5FKLA 3ZX0A 2Q2EB 4WFAL 4X34A 2E5LK 4FT8A 2K4YA 1Y64A 1RBVA 4JKGA 3CCLT 3LOCA 2M0YA 4A3GJ 3A5NC 4QVZA 1R59O 5EXWA 4DKWA 3E7LA 2R7RA 2HVHA 1D3YA 1KLNA 5IYDJ 1TYQB 2Y1JA 2AT1B 3RSNA 1NK8A 4JYKA 3CFRA 2L7KA 2PLYA 3HVRA 2V9PA 2WWYA 4M77G 4B1YB 4EPCA 5M1NA 1DLOA 3ZEHA 2OBPA 4DTRA 4PFZA 1JT6A 5DK5A 1NKCA 3ULQB 1IBMK 1I0CA 4GBQA 3CCMI 3TW7A 3K9TA 2EGEA 2PEXA 1M3CA 2WTUA 1N32K 1QLYA 2NRZA 3R6SA 1VQNN 2XSJC 2W03A 4W5TA 2JGUA 4PGHA 3U2RA 3HSEA 3BJOA 3BE3A 3ATVA 1C0MA 1M1EB 1LDJA 5LL6S 2RMOA 3RZOJ 1LCUA 2YHWA 5E8IA 2H09A 3THVA 1J0RA 2COYA 4HOBA 3G4ST 4E7SA 3QP6A 5E3LA 3VPZA 2CDTA 4KPYA 3K2ZA 3GTPJ 1J7KA 5GAN6 2A08A 5HROA 4PKCC 1ZQ3P 3F8CA 3M8JA 1J6ZA 4IDHA 3QDKA 2DD5A 4X9DA 4N9IA 3R4KA 4JI5K 3TARA 1R0BG 4D1QA 4HT8A 1VYUA 1JI8A 4KGZB 3O5ZA 2KEAA 4OX9K 4KB0A 3KP4A 4JBAA 3OSFA 1FNNA 1OCCH 1GUUA 3KYCB 2R7QA 2OV7A 3EZWA 4AD9A 2WBMA 5IT3A 5LJ5f 3ERMA 3MXMA 4CJ4A 3ZRGA 2FBVA 1T3SA 5BRHA 3EE9A 1WXBA 3WXLA 2G8UA 4O8KA 3P9KA 4C2TA 1OQKA 4ENJA 3RI4A 3M57A 1YITQ 1IKWA 1UAAA 5EG0B 2ZPHB 1I50J 4XU2A 4FISA 2KDOA 4IUVA 2QXFA 4J19A 4B9MA 4C3IJ 1Z05A 3E6CC 2CKKA 4MQ9F 1XDUA 4XK8E 3ZX2A 1ZG1A 4VUBA 3TGNA 1RAGB 1S6PA 1BR1A 4Q5VA 2E2IJ 4LF5K 2LJ1A 4ELVA 2K79A 1M30A 3RYRA 1T44A 1LV5A 4BHBA 2KIUA 3TEEA 3M4OJ 4EIAA 2HBPA 1ATSA 3A98A 4AFQC 2ZFUA 1W7PD 1KYZA 2CO5A 4JOMA 1F43A 3K2PA 1SANA 4CCNA 1X1DA 1HNZK 1YFHA 1H3ZA 1V29B 2HQ5A 2H3GX 3OIOA 2XKOC 3CCQA 3QNOA 1HJDA 1I4K1 3I56N 4WQ4A 4JHDA 2EV0A 3F0CA 1KU3A 1Z21A 2JMCA 4B3AA 3GUDA 3AA3A 2IG0A 2M0CA 3F0ZA 2DTHA 4N0BA 2QWNA 3AA5X 1I6XA 5JHFA 1MBKA 3AVNA 1KQ9A 2WAQA 3DXKB 4EATA 3CMYA 2QYOA 5M3FJ 5KAFC 3FISA 1MH4A 4FU6A 4JRIA 1MIJA 2F2EA 3CCJT 5J2MA 4AMCA 4L5JA 1B9NA 1NTCA 5JFRA 3J81E 5J39A 5GANd 3AY9A 2IP2A 3LQQA 3KK1A 3C3WA 1CF7A 4FLZA 3LDLA 2LKPA 1DP3A 2RF2A 3CJBA 3NQOA 2ROLA 3H3ZA 1OYYA 3LALA