1A0QL

29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
IELTQSPSSLSASLGGKVTITCKASQDIKKYIGWYQHKPGKQPRLLIHYTSTLLPGIPSRFRGSGSGRDYSFSISNLEPEDIATYYCLQYYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYSKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the crystallographic structures of two catalytic antibodies with esterase activity.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords 29G11 FAB (LIGHT CHAIN)
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qL01
3LH2H 4JAMA 4WI2A 2J8OA 4G5ZH 5IB4B 4FQHB 5IMLB 4FZEH 2GTZA 4DGYL 5SX5H 3L1OH 1B9ZA 5MHSE 4NKDA 3QUYC 5J8OA 4LSPH 1HEZB 3DECA 1CCZA 3DIFB 3FCTB 2C4XA 1ZKAA 2GFBA 3HG1D 1UH2A 3GSRB 1HINH 4EN3C 2IAMB 1CE6B 1NCTA 5FXCH 2OK0H 3EFFB 1O5DT 3QCUH 4MJIA 5T3XE 5IT2H 2ENYA 3OXRA 2DKSA 4JY6B 4P4KB 4LCUB 4GXVH 2DQHH 5DZOA 1R3KB 2IFFL 2ZJSL 4P23D 5E4IA 3L9RA 4OKDA 5C09D 3SDCC 2NY3D 4YHOL 3FT4A 5F1KC 5IIEA 1NUDA 2KH2B 5I30L 3MRJB 3CXDL 3P40A 5DC4B 2ICWJ 5FF6B 1OD9A 1MFNA 1OTSD 1GVIA 2RQ8A 1D5BB 2QQKL 5E1HB 3IKCA 3P0VL 3RIFF 4I18C 4LDOB 4YDJA 4X7TA 4PLKC 4NQDE 1I7RA 4WWKA 4QRQA 3C60D 4ZNEE 5IMKB 3MRKA 2IH1A 3P4MB 4LSDA 5IJVB 3DROA 5HGDB 4RBPH 4PY8J 3U7YL 1NAKL 1W0WA 5DWUL 3O8XC 1JN6B 4R97C 1IFHH 4V1DE 4LU5L 3LKRB 3DRQA 5DUBB 1K85A 2N4IA 4NQEA 4F3FA 4WTZA 3HMXA 2C1PA 4RZCB 4OLVL 5K9KB 5J4MA 2WBWB 3Q2CA 3OZ9L 2B2XH 1I7ZB 5FO8B 4QWWD 3BP4B 3QEUA 4HUKB 3BAEH 1DCLA 3EIFA 4I8DA 1N4XL 3K4AA 4NQUA 2FO4B 2HT2D 2E9WA 3X14A 4FTVD 4BH7A 4L29B 2VITB 4KRPB 3MV8D 5FYJH 4L4VE 4FG6D 1WJ3A 3KJ4B 4U1SA 5IK3A 4NKIL 4PRHD 1IC7H 4N5EC 2OJZL 4OD2A 1UACH 1HHHB 3C8HA 3B6SA 4OIIH 4HX1B 4R96B 5I75C 3VXUA 4G9FD 4K7PX 4HBCH 5F97E 3DUUA 2BRQA 2WWKT 4X9GA 1NBYA 3A6BL 4NNPL 1URLA 1TITA 1AXSB 1Q0XH 3RTQB 3WYRA 1EBAA 3NZ8A 4NSKA 4PJAE 3I50L 4LCIH 5IB5B 1J11A 3MYJA 1CXIA 3HNSH 3W11C 2F53E 3BDYL 3HE6D 4ZOEA 5HI4D 2HFTA 3IFPB 3MREB 3MA7B 3FOMA 3MOBL 1MCOL 4Q2ZA 1AC6A 2BMKA 3HC4L 1BX2B 1YEHH 5E94B 2BSSA 5KG9A 4X7SH 1UT9A 2BJMH 2DYPA 3JXAA 1JV5B 4KKCC 5F3BA 5SX5K 2ILLA 1L7TH 4U6HB 2HKHL 1MIEH 2Y5TA 3C8DA 2AEWA 1EIBA 1WBYB 1WFUA 1J1OL 3FQRB 3QPQD 4MLIA 4U6YB 3ULUD 4KV5F 5KVDH 4JZJB 3STZA 4H1LH 5DD6A 3ARXA 4WW2F 1XGRA 4OCWH 3STBA 2J6EA 2MJWA 4GO6B 1MQKH 4WW2B 4OLZH 3Q5TA 4HWNA 5F9OL 3O3EB 4E5XA 1KNOB 5T1MB 3SPVB 3QIUD 3GSOB 5MENA 3GIVB 3SCMB 1AGFB 1NC2D 3VXRB 1SYVB 1BFOA 2F54A 1M71A 3G5ZB 4JY5L 2F8XC 1WFTA 2K7QA 5A2JH 2Z91A 4Y88A 4WV1C 3I85A 4OFDA 4ELMF 5FGBC 3ARSA 3VWKD 3LDBB 5FYJD 4HJ0D 1ACZA 3BO8B 2JJWA 2C3GA 4LNRA 1XGPB 3WO3B 5DRZB 3IGAA 4JFEE 4NQSB 1CICA 3JVGA 1OLZA 4UNUA 4OCXL 1YEIL 4WNQA 3UTTD 1HXYB 1N5AB 4Z7QF 4D0BB 4QF1A 4E41A 2EDWA 1AXSA 3RTQA 3ARDC 1KXQE 1KB9J 1WCBB 5JXED 1LE9B 1I9RL 1RZ7L 3BZFA 4KQ4L 2QQNH 4I1NB 5DO2D 5IKCB 3W2DL 2DIBA 35C8H 1G7IA 5JHDD 3QT2A 3B6SB 1J05A 3B3IA 1F6LL 2BHZA 4LF3A 4OF6A 1O0VA 3D25B 2QSVA 1BIIB 3MQIA 5KS9A 1LO3H 1R0AH 2BVPB 1G0DA 2I27N 2EDXA 3QG7H 3QG6B 5IQ7L 1QLRA 1QACA 2CD0A 3LB6C 4O4YL 1MHCB 1FNLA 5GRXG 5F9WB 1PLGL 5LGHL 2FJHB 2NR6C 4JANB 1TZHB 3QFJE 3AM8A 5KSBB 4QTHB 2R9HC 3MLSH 4YK4C 5E8NA 2ZUSA 1MHEB 3DNKA 1GPOH 1IARB 1IAKB 2IBZY 2BC4B 4J6RH 4DVRL 4U7SA 4XH2B 3THMH 4CMMA 4BQ8A 4M5ZH 2ZP0T 3RWEA 1MWAL 3B2VL 4JFFB 5DT1H 4KTDL 1GGCL 3HPLA 3VXSE 3NFNB 1FL6A 2GUOB 1IGYA 3MJ9A 2X9YA 1L6ZA 3L3IB 3MRQB 2Y7QA 4OAWA 1T5WB 4ODSL 4WUKH 3EYSL 1ZWIA 2FGZA 1MCWM 1KENL 5TE6H 1FFQA 3LS4L 2HFEA 1BOGA 4KAQH 4YQXL 3VD7A 2WSKA 1UWGL 1ZLSL 4LCIL 3ES6B 4G8FA 3SDYH 2NX5E 1FV1A 4X6CE 5HI5C 3DUSA 4HF5H 1G7LA 2NY3B 3VGAB 5CJOH 3QPXL 1JGVH 12E8L 3GEWB 1FZKB 2H26B 1G7HB 3PL6B 1UYWH 5J13C 5I8KL 1V5JA 4I4WB 1U8PA 3MUZ1 2V2WA 3D87B 3KYMA 4PJAF 2ZNXA 2D7TL 5I1EH 2HKFH 3FMGH 2EH7H 3CFJB 3QDAA 3B8SA 3IDIA 1SMOA 1IAIL 1NH6A 1JNNH 4NM4L 3ZL4H 1BJ1J 2DI7A 3VXTB 1EAPA 3KPPB 1RUQH 3IETA 3IU3B 5IJKC 1IKNC 2A73B 5TPWH 4RQQA 5IM7B 2EXYC 5EIIA 1J1OH 5JW4Q 1FZMB 2F58L 3CFJA 1WAAF 2CXKA 1AIFB 1TZHA 3QIUC 3T2QA 4O2CA 5I9QC 4QHKJ 4R2GD 3UTSE 1T66D 3SE3A 2WWKO 2EDTA 5IMLA 4M1GH 3B9EA 4KK8C 1XCQA 4KWUA 2O5XL 5EC1A 3IDNB 4OM0H 3GI9L 1XZ0A 3HAEB 2HJKB 2OL3B 4HSQA 1KIPB 4Z76A 4WU5B 4PREA 4JM2F 4MNQE 2CMRH 2XYCA 4JQVC 3BI9X 2YC1B 1T5WA 2VDOH 2IGFL 1BIHA 5HGHA 2NCMA 2CK2A 4IDLA 3PNWB 2E7HA 4Y4KA 2Z93A 4S1DC 3TGXA 3VXRD 5J3HD 2Z92B 4P2OC 4K7PL 5DHXB 1V7NH 4GAJH 3RWJA 4BZ1H 5DO2C 3TIDA 1LNUA 3D69A 2H45A 3IJHA 1PBYA 1S7QB 1TVBB 5IBLD 3VWJD 2X4TA 3VXPB 3BD3A 3LN5B 3W82A 1J5OH 2BOCA 3WEXA 1QNZL 5BZWA 3QH3A 3UPRB 5F8RC 3QDGB 4UT7H 1DFBL 5GGRB 3CDGB 1KLUB 5IBTL 3PV6A 2XQBL 4B53A 3MMEB 1U0QA 1U8HA 1EO8H 1CDGA 2BERA 2MKWA 2P8LA 3MRLB 2F54D 4BUHA 3EDEA 4OT1L 3LN4A 2XA8L 5CSGA 4MA1C 3FQUB 3DO7B 4GG8B 5GJTH 4HV8B 1AXTL 2D2OA 5DS8A 2OZ4A 1ULVA 1UEYA 1MLBA 5BZDB 3T0ED 1V8HA 1CBVL 4JM2D 2YC1A 4M4PA 5FOBB 3U1SL 3H42L 1PX4A 4PS4H 2YMXH 5IB1A 4PREB 3P4LA 2VQ1A 2ADFH 4K9EH 2W60B 4W6WB 3PWNA 4HAGA 4J1UB 1G84A 4TQEH 5E2TH 1IJ9A 1Q94A 1KEML 3K3QA 2FWOA 4PG9B 5JW4R 4EDXA 2GI7A 4XP5L 2WBJD 4J4PD 4KVCH 3UJJL 2J12B 1U93B 4P49A 5FYLD 3V0VA 4WUUB 3UTSD 1BVLA 4PJFA 1KIQB 3CC5B 3H6JA 2XV6B 3VI4F 2AXGA 2ZG3A 3QXWA 4PJGF 1G7PA 1H15A 4JFYA 2WNGA 3HB3D 4F37K 3Q1SH 3D3VA 3QIWB 4DZBA 4H1LG 1MFBH 3QCVL 5I1JL 4UB0H 2IALA 1CDJA 4MQ7A 3S34H 4ELMA 2J5LC 5ID1B 2CK0L 5DJDA 2VLMD 2F74B 5C6TL 2COQA 3FB8A 4MVBD 4GKNA 2VRAA 3LKQB 4F9PA 4MHHG 4YDJB 4YDKH 2K9UA 3MCKA 3TO4B 2VZ3A 2X09A 4ZXBB 5T3XL 4X9BA 5K93A 2OMNA 1DP0A 2HTKD 1K3ZA 3RJQB 5ALBH 4JCMA 1RURH 5B8CB 1CGSH 2LV4A 1CQKA 2X9WA 2PYEB 1NEZA 1R5WA 1CIUA 3IU4L 4UBDC 4S1DD 3IXTB 3FONB 3OR7A 4CRPA 4I3SL 4I0PD 2GHWB 1LHZA 4LASL 3U7WH 3GMRA 4NZRL 2YRLA 5K9QG 4LRNH 2AGJL 4YHYC 2VDRL 4Y19D 3I3BA 4N0UB 4E42A 1A6TA 1OPGL 4P4KC 3PWJA 2H2SC 3ZE0F 1TCRA 2BOBB 2WBKA 4M6NH 3ULVF 1X4YA 2Q1EA 3GSNA 1YNLH 3P77A 5FECB 4AT6B 5JOEA 1FVDA 1CU4H 3TO4C 4RGNB 4DKEL 2LAGB 4YE4L 2GJ6D 3H9SA 1P4IH 5GISH 2DQEL 2NNAB 1MY5A 3OWEA 1QVOA 3QDMD 3HC3L 2HRLA 4MQ7B 4PRBB 1PZ5B 5ID1A 1WCBA 1LE9A 4XBGA 2DDQH 1C5DA 3AXLA 5E70A 3SO5A 2C3WA 1XGQA 3BJLA 1CFBA 1U6AL 3O2DL 1A3RH 4KKLC 3ZKSD 3DX6A 1PJ9A 5I18H 3HI6L 4L3CA 3L5WB 3QEGL 4YNYA 2EDRA 1AQDB 1I75A 2D9CA 4HK3J 4HWZA 1VKXA 4Z0BH 3STZB 1JGLH 2J6EH 3DV6B 1G6RB 3MLYL 3O8XB 3O3DA 3AAZA 2OTUA 4XMPL 2F8VA 1MFEH 1RUPL 4M8QB 5CMAA 5HHMD 2EO1A 2YA0A 5FGBA 2CGRH 4P99A 5FYKH 3F7YA 2PTVA 2Q20A 4P4RA 5C0AB 4PRPE 3DTXB 4U0RB 1RUAH 4A6YL 5FF6A 4J3OC 5KSUB 5IF0A 4L1DA 1H8SA 3V7MA 4PJXA 4LLYA 4GXUM 1QSEB 1A64A 2EICA 4PGDB 5T1LA 5F1IA 3WKNA 1RU9L 2FL5B 2DQJL 1SBSL 4LEOB 4M1DL 3C5SA 4TN9A 4R4BB 3U4BL 3AU1A 4LKXB 4N9GB 4IOIB 4GBXD 1IGJA 4PJ8A 5B21A 4OGZA 3KXFB 2YXFA 3QI9A 5D1QA 3HB3C 1G7JB 5HDLA 4KRLB 1DQDL 4JQIL 3VFUA 4BUGA 3LV3B 2PETA 3NACL 2B4CL 4BFIB 2BSTA 1BZ9B 2X1XR 5E94A 1U8IA 5IBLC 4N8VB 1B4JL 3DRTB 1QZ1A 5TE4L 4XMLL 1KFAL 1ETZA 5EOCL 1GGBL 4ONGL 4XNZC 4WHTA 4PB0H 4X8JA 1QFWI 5GZOD 1TPXB 1A4KA 1UEMA 5DD5L 4JKMA 1B6UA 1BOYA 5ALCL 1QFWH 3QHFL 5IEKA 4R0LB 3VXMD 5HHOA 4N5UA 5GGTH 3GSNL 4HXAH 4IM8A 2YBRA 2QKIA 2ZUQC 4QHLA 3V4PL 4PJBB 3MLXL 2H1PL 4F2MA 3H8NA 2AK4E 4O5LL 3ZKQD 4TSBL 5IUSA 2DD8L 1TQBC 3SQBA 3T0EC 1GC1H 4ZUSA 1VFBB 2X41A 3DX7B 3MNWB 4U31A 5CJQL 3P9LB 2NY5C 4OCYH 1HILA 4H25B 2HLAA 1ZT7A 1JWMA 1WF5A 5KSVA 1A3QA 4JRYD 4AENB 2ARJQ 7FABH 1A4JA 3U36B 3C5ZC 2I5YL 4KQ3L 3WMSA 4CW1A 4L3EE 4IIQA 4O02H 2DBLL 5E4EB 3S37H 3PXHA 3ZYIA 3PJSB 4LGSB 1ZMYA 3ZKNC 4FZ8H 3VD4A 2LU4A 4JCLA 4PJXF 1UENA 4HIIB 3UTTA 2QQLH 3R8QA 3ROOB 4MA7L 4PJIE 3GNML 3UDWA 1P6AB 4W81A 2V5YA 1MCNA 2QJDA 4MJIB 4PJDF 5B3JE 4XC1H 1NCBH 3EHBD 3RU8L 3CGTA 1ZE3C 2UYLA 3PUCA 5ECJE 3DVGB 4MD0B 1DQML 3SE3C 1D5ZB 3MODL 4S11A 3HUJF 3LQAC 4ODUB 3CPLA 1I85C 1C16B 4OZHB 5C07E 1OB1A 5ACZB 5DJ0A 1UWXH 1BECA 3C5JB 1EEUA 4HZAA 3F6IA 2HT4D 4L4TD 2RFXB 5C0DB 4O00A 1MJ8L 1D6VL 4HJJH 3UYRH 1KOAA 4AY0A 2FEDC 5IGXH 2HFEB 5IVOA 2ZNWA 1G7MA 2GJ6A 5I1DB 4TUKH 3VFGH 3C60A 3QHTC 4X98B 4QXTB 1W72A 2OP4L 5DI8A 4LDEB 3R8BB 1TZIA 4CMMB 5L88H 5D7IB 5GGQH 5J13B 3BPLB 1S7VA 1SBSH 2FBJL 4DOHB 5T1DH 4U1IA 5F71A 3L7FB 5LCVL 2FEEI 3VG9C 3VGFA 1R5IB 1RHHB 4ZFOL 5DTFA 4YHMH 1IQWL 5A1AA 5BS0A 5BRZE 5D70H 4U1NB 3VDCA 3WE6A 3WIFA 2D7MA 1DQJA 3T4AA 1A9EA 3X13A 3GSXB 4HUUA 1IC1A 4C56A 2KKQA 2C7UB 5SWSD 1J0KA 1CD8A 1S7XB 2EO9A 1C1EL 2FLRT 3EJJX 5T33L 5A3ID 2C3XA 5DJ6A 1ZT7B 5C7XH 1ZGLA 4JHWH 1ZWIB 5KVEH 4OZHA 3L5JA 2O5YL 3CZFA 3O8XA 1F4YH 4LSQH 1UQSB 1ZHNA 4QXUL 4PRHA 4U3XA 4YHZL 3CMOH 3D39A 3RWCA 5MEPA 1QHPA 2B1AH 4YDVB 4QEGA 4NUGL 5EA0H 5LGJA 3K74B 4O2FB 3WDJA 2YZ8A 5DMGD 3ULVL 1E4JA 1GAFH 4TSBH 4FHBD 4ENED 2FH6A 4H1LB 4PB9H 5DJ0B 1SY6A 1YNKH 2DJUA 3MBEA 3OV6A 4A2LA 3U2SB 3GJFA 2B2XL 3D0LA 1A47A 4YUEH 5EBLA 4F9LC 1RJLA 2JB6A 3AM8C 5I1IH 4NQXB 5DD1L 2LU3A 3ZKND 4F33A 3VXUD 4KZDH 4D9RD 3KWWB 2FX8L 1EJOL 2DQCL 2I5YH 1A1OB 4R8WH 2BNRB 1JPSH 3CVHL 4X7EC 1TETL 1ZHBA 1J0JA 2ED8A 2Z31B 4MDIA 1NSNH 5LVEA 5E2WL 1WICA 4HCRL 2IMNA 1GL4B 5J1SC 2W9EH 3HN3A 5JORA 4LCWE 1I1RA 3GM8A 4ALAH 4PJ9A 4EI5C 1NC4A 3GK8L 5BJTA 1DR9A 2FBOJ 5D1XB 2PXYD 2E7CA 3SE8H 5DF0A 4PUBH 4CNIB 2O61A 3A6BH 3WJJC 1QR1A 1H3UA 1O7SA 2QL1A 4P2QE 1CIDA 4APQA 4EUPG 5E5RB 2GSIB 3QIWD 4OZFH 5F7LB 4EVNB 2X4QB 3FRPA 3QAZC 4S2SA 2MQ3A 4NWUL 3QG7L 2IEPA 2XNAA 4GKSA 1Q9KB 1XT5A 1FLRL 2PCPA 3LOWA 1VHPA 1C5BH 5IFHL 1F4XL 5LBSL 1JVKA 4NDMA 4ZQKB 3SO3C 4ORGB 4IS6B 1TNNA 2JLLA 5C8JA 1G0XA 3H3KA 1RZGB 2Q86A 4WCYL 1U8JB 4LPYA 2NW3B 3E6HB 1BFSA 5KJRL 3E6FB 1AGDA 5FO7A 4R2GB 4H20H 4WRLA 4BQ9A 1YJDC 3HLAA 3PQYA 3CU7A 3VGHA 4HJJL 4NSKB 3H2WA 3RTQD 3V5HA 5D1XC 2FHBA 4OGYL 5JLZB 1L0QA 5L2KA 3V0VB 5GS0H 4TTDD 5DS8B 3ZTNH 2OR7A 5E8PB 4I9WE 1IAOA 5TDOA 3TH4T 2UWEB 4UU9B 3VWKA 4JFHE 5I16A 1Q94B 4K8RH 5J1TC 3BE1H 5F7KC 4MCYA 1AD0B 4MJ2A 2XKUA 2O61B 5DURB 5T3ZH 1U3YA 2QSCL 5DSCB 5GGSB 2I60L 4R4FH 2DQDL 2AK4B 2Z35A 3IXTA 5KW9L 1T04A 2P5WE 2VDKL 4N8CH 4XPHL 3OJVC 3EHBC 4JDZA 1IAIH 2RHEA 1XR8B 1QSEA 4TNWF 4QHUB 4XPAL 4TVSa 4LQFL 3EO9H 1FORH 2OR9H 4BZ2L 1YECH 1G1CA 5J12C 4Q9QH 2X70A 4JDTL 4LLVA 3GMNA 4I18B 2APVA 3WFBL 3F7YB 1KCLA 1NC2B 3D85D 3V4VL 2G75B 1XMWA 1XR9B 2EDFA 4FQ1H 3SDXB 5EO9B 1I7RB 2LTQB 2XTLA 2EDLA 3I75B 3O6FB 5K9OB 1TCMA 5A16A 2R29L 3L3HB 5F88A 1E28A 4A6YA 2CDGB 3TBSA 1FDLH 3LKSB 3BYYA 1WTGT 3FRUA 1IGIL 5FO8A 1HHGA 1NGQL 5HDOA 1NMAH 2FD6H 4HC1A 4ZUTB 1DQQB 4K3HA 4NQEB 2VXVH 5EBMB 1J7VR 4I0PA 4JFPA 3BWUC 2G60H 2MMXA 5E1AA 4GMSL 4HJGA 4F57L 3OAZH 4PP2B 4FQIH 1A7NH 5A2LH 3WXVH 1FZMA 4FP8H 5DD3L 2HJLA 4LPTA 2EIDA 3EZ8A 4EI5D 4YXLL 4LKCA 2AJYL 3WXWL 4MAUH 4QKXB 4ZUVB 3GBNL 2DN7A 3SY0B 2VJXA 4U1HA 1YPZA 1MWAH 2B4CC 4B7IA 1DN0B 2UWEF 2CDEB 1WLHA 3CVIL 1EFXD 2BVOB 3MV8B 1UJ3A 4F58H 4Z7WE 5DHVH 3VG0H 3MRJA 2KQNA 2ZUYA 3LKQA 1CFQB 1YN6A 4OQTA 5D71L 4G6JH 3DXAD 3I02A 2Y07L 1AQKL 2X40A 4YIQB 2P8MA 2BNRD 4XXDA 4U2ZA 5FM8A 2IANB 4LSUL 3S6CA 3WUZA 3I2CL 1NEZB 4HWEL 2GFBB 2G9HB 5FAAA 3DLQR 4PJ5D 5GGRY 3U82B 1RY7B 2R2EB 4PRNA 1T2QL 1R24B 1S7SA 3BEVB 4NQTA 2H6PB 5LBSH 4OF0A 3IS1X 5SWZB 1AGCB 1MEXL 1PY9A 4L8SC 1FNSL 2EH7L 4XGZB 4DOHE 1E4KA 1A2YA 1P5VA 5GXBB 4NM4H 4W4OA 3VFVA 4POUB 3WIHL 3LEXA 4PJCF 3BVNB 4KJYB 3CH1B 4PJ9D 2AS5M 3VWJA 2VE6A 3BZEA 3U4EB 4IIQB 4XCEA 4BELD 3RWDB 1F8TL 5BV7B 4OV5B 1GGUA 2QHRH 3WHE0 4JHZA 4NC0B 1JMXA 1J0HA 1MHCA 3TO2B 1T1ZB 4P5MA 4FXGA 5CSZB 4Z7UB 3QG6A 3M1BB 5JTWA 3MOBH 3QI9D 2EE3A 3PWUA 1ACYH 4RRPA 3TEUA 3QEHB 4F7MA 1VFBA 1D7FA 5SWSB 2R8SL 1S5IL 5CJBA 4N0CC 4XP4H 3IRPX 1K2DA 1MIEL 1UFUA 5DEGB 3PGDA 3QQ4B 5JMRA 4WEBH 1CL7I 4ZOAA 3L3DA 3MJ9H 5J56B 3JBG7 4YO0B 1ED3B 2A74A 1GH7A 4WV1B 43CAA 2LVCA 1T3FA 1BD2D 4MAYC 3IDMA 3BN9D 4PGCA 1N3NA 4KKNA 5DK2B 2CLRB 1FJ1A 4XNUL 3H3BC 1S7TA 5D4QA 3C9NA 4U1JA 5EC1B 5BV7C 5C0EA 1CD1B 3KYKH 4Q9QL 3JWDH 4KY1L 5C9KA 4JO3H 4Z5RA 1BD2E 1T3FB 2QSQA 1F97A 3L3GB 4G8GE 1HE7A 3C6SB 1AR1D 2DLFH 1YQVL 5BCAA 1MCKA 4RFOL 3RVUC 3BVNA 4KJYA 2EDBA 5BS0E 3BISA 1ES0A 3CX5J 5CZVL 1MI5E 1AKJD 4TYUA 4DN4H 3B5HA 1I3GL 2VQTA 3KPRE 4Z7UA 1NGQH 4IOIA 4XGZA 1ZGLB 4MXQC 5IMMA 2VTFA 2DIAA 4I3SH 3CK0L 3B2UC 3MJ7B 3RIAK 3ARFA 4K2UH 4AIXA 2XZCH 5TQ2L 3U4EA 3L5XH 1A6VL 1FYTB 1HIMH 4XT1C 1FPTL 4WGVB 2VLJE 4JFDA 2JJUA 1BFOB 4P9MH 4WEMB 2ID5A 3MV8E 3SCMD 4UINL 4EDWH 1AGFA 3LIZH 4OLEA 5IBUB 1JBJA 2XY1A 1FNFA 1QFWM 1ZVSA 1GHFH 2D7OA 5F9JA 3HCVA 5INCB 4KUZL 1BLNB 3CFBA 1JHKH 1T21A 4NCDA 2EDQA 5IW6B 1QD0A 4R4NC 1RZJC 4BSJA 4GW1B 5EB9A 1JUFB 2AJZB 3THML 5F3BB 1HQ4B 3QFJA 2FATL 2P44B 5DVOA 3PL6C 1I9EA 3CSPA 5ILTL 4NO0D 3RZCD 1FNSH 1KN2L 5ESQA 5EDXA 4WFGE 1CK0H 1JRHL 4NQCA 1K5NB 5FCUL 5D2NA 4P5TD 4PJ5B 3G5VA 2F5AL 4JZNA 3WIHH 1T1WA 3DXAE 4M61B 2VITA 4C54A 1L7IH 4TTGA 3TBVB 4HFWB 4NCC1 4QNPE 4KJQC 4JR9H 3PGFL 1JGUL 4LKCB 5GRUH 1IGYB 3D2UA 4WI5A 4RAHA 5GS1B 3BZFB 1LQSR 4HUXB 4W6YB 4JQVA 3RY5A 4FXKA 2GEEA 4OD3H 2AP2A 1J86A 1KTRL 4J3TA 4ZO7A 4HGMA 4ODTH 1U8PB 5DJAB 2D9QB 4HKJA 3EJYC 5BW7A 4F37F 2FYYA 5IT2L 1WEJH 1I7UB 2ARJA 3C5ZA 4TTDC 2X4PA 4XNQB 5ETUA 1MHHA 4X7FC 4XI5C 2ATPB 4O2EA 1C5CH 3S88L 4PTUB 1SJVA 3HC4H 3GMQA 3SDDC 4MCYB 1Z5LA 1BQHG 2DLTA 3RP1A 4PFEA 4K94C 1HYSC 3UAJD 2X4PB 3HG1E 1Q9LA 3G5VB 4JZNB 4AQ1B 3TA3B 5D2LE 5F21B 1EHAA 4P2OB 4XVJH 1J05B 3B3IB 1NMBL 1P4LB 3F58H 4HIXH 4BFEA 1EO5A 3ET9F 1VFOA 1EBPA 2H9GB 2EDKA 2H1PH 5I1LB 2X4SB 2CKNA 4WY7H 5DVLA 1RHFA 2DBJA 3C09B 5EU7E 1E6OL 3V5HB 1SQ2N 4Y4FC 3MRMB 5EIVA 1UKSA 2CIKB 5E95B 1TJHH 3HFMH 3PHOA 5EZIH 3O4LE 4YHKH 3L7EA 4QRTB 3KPRB 3L3JA 4HUNB 4ISVB 4FQXD 5INCA 2Z31C 4C59B 4RX4D 1DSFH 2BOBA 5F89B 4ZODA 4RMWA 3U9UB 1OAQH 4PY7A 3HZMA 5HJ3A 1EAJA 1FYHB 2H8PA 2YD9A 4NO5B 3QQ3A 3CDCA 5JHDE 2ITDB 2M26A 2NY0D 4NGHL 4PJGA 3FAWA 5DRNB 1A7OL 3EOYG 2WP3T 4GG6E 1D5XA 3ULVC 5CKAA 3ROLB 4X5WB 4KK6C 2DWDB 3NTCL 1CFSA 1PSKL 1NCCH 1X9QA 4EOWH 2VSCA 4Z78B 4M3KB 4MA7H 1EMTL 4MXVE 1YEDA 1ORQB 4LCWD 4LK4A 4ZQKA 4L8DA 2EE9A 2I07B 2J8UE 4K94H 4POYA 2NW3A 2CO7B 3GSWB 4NNPH 3K80A 5T5NG 3SO3B 5JZ7D 3NPZB 1CLYL 3C08H 1T7ZA 4WI8A 5E6IA 1C7SA 4FQHA 3CXHK 3MA9H 1IBGL 4U1LA 2YMXL 4NZDA 2D0FA 3OR6A 1L0YA 5HHOD 5DJDB 3V6ZA 2E9BA 3ILPB 2YUXA 3RL2B 1JYXA 4QXGH 1OW0A 4HQQL 1RIUH 3FO1A 3O6LH 4OLWH 1NCAL 4J1UA 5D1ZC 2VLKD 2J8UA 4PR5B 8FABA 1I9JL 4JRXE 4JFYB 3MV7E 4YR6B 3MRGA 4JRYB 1H3WM 2CKBB 3MRIB 3NCMA 3QJHA 3SKOB 1ZHBB 4KKLD 5AYUH 1L7IL 5FOBA 2EIEA 5GS0D 2ESVE 2B39A 2ESVB 1BBDH 4M48H 5B3NA 2V7HB 4TUJB 1UA6H 5IMKA 3QA3B 3FQUA 1T4KA 1WAAA 3RWCB 1TJGH 4CVWA 4V1DB 4OD3L 1U58A 1DLFL 4D3CL 2X1OA 1QRNE 4J23A 1KIRB 1Q9OA 4L8BB 5HHNA 4YGVA 1T1ZA 1AHWB 1U3HD 2RCSL 2HG5B 3BKMH 4TULL 2SEBA 3AFLA 1ZLWH 2HA1A 2NY2D 5B8CC 1UYWL 4X6DB 3AUVA 5AZEH 4HH9A 4DJMA 4Q6IA 2R23A 1I1AD 2R69H 1MAJA 4IHOA 4L3EB 1MPAL 1S5HB 3OKNA 4M9OA 5I1EL 4E0RA 4PJEF 2W59A 5LWYH 4M7KL 5DK0B 1DBBH 1EPFA 1LO2L 2X1WL 2IH3A 1S7QA 1MQ8A 1TVBA 1S7UA 2X7LB 2AEQH 3NIDE 1RIVL 3LPWA 1F4YL 5INDA 3AY4A 3X3GH 3V5DA 5A40E 3R1GL 2JCCB 1NLDH 2F58H 3ZSSA 4P5KB 3W5MA 4R4ND 3LHPH 2QQNL 1MCLA 3HE7D 3QCUL 5DJYB 5E03A 1S3KH 2YK1L 1QEWB 1FLTX 4M7JH 1HXMA 1R3HA 1GAFL 2DQHL 3GSXA 4FNLL 1X5XA 3MV9D 5J12B 2F74A 4N90E 2WIIB 5F7NC 3AC0A 3LN5A 1XH3A 5B38A 4YHKL 5IQ9A 2CIIB 4HK0A 5J06A 1VFUA 4XCYB 3V0AC 1CT8B 4CMHC 5DUPH 1W72H 3OB8A 2XN9E 4LSRL 2VLLA 3JWOC 2QQKH 5CS7A 1DSFL 3LQZA 4F3FB 2LTQC 4ZD3L 4DUXA 4X5XA 5L2JA 4MD4A 2UV3A 4CVXA 1YEJH 2CH8A 4R9HA 1T5XA 2NY7H 4O9HH 3UTQB 1JE6A 1INEH 3RVUD 3V9FA 2XG5A 2CLVA 3CVHH 3MV11 3VXNB 3O8XD 1D5IL 5C70A 1NQBA 1OQXA 3SHSA 3EO0A 3CU1A 2G9HA 5J7CC 5E9DA 4LU5H 3B9KB 3RI5K 3BGFB 3QQ9D 4KH2A 1V3JA 5EC2B 3TBTA 1GOHA 2VAAA 4NKOA 4CN1A 4QWWC 5E1AB 3MFGB 3T2NL 1FFNA 2H32A 1D5MA 2J2ZA 2DQGL 1RV6X 2HVKA 1UJTA 1N4XH 4OUUA 4M43L 5ISZE 4CMHB 3G6DL 5HVHC 5JQHC 2WIIA 1FN4B 2YA1A 3QPXH 1IBGH 1DN0A 5EBGA 5A16B 1CT8A 1JGVL 3DPBA 4NQDB 4YAQB 4FFYH 4JKKA 3ZSTA 1A1NB 2ZCKL 3VDBA 1S7WB 1PGRB 5HYIA 3T77A 1FG9C 4XCNA 4FZEL 3NCCB 2BNQD 4HBCL 3ROOA 1RZFH 1Y6NR 5KVEL 5JR1H 4Y19E 2D0GA 3VFRB 1IZJA 2IPUG 1NPUA 1P7QA 3P0YH 5HDQL 2QTEA 5CEZE 1NGPL 2NY1C 4N8PA 4LFHG 5TPWL 3SGJC 1JTOA 3S9DB 5DK0A 5L7XL 1QYGH 2BNQB 1N0XL 2VLJA 1A0QH 3PWPD 5TDNA 3H7LA 4L9DA 4Y5XA 2BSED 4ZFOA 1B4JH 3QWRD 3QXUA 4MNQA 2ZJSH 1XGUA 3IFNL 3QBTB 1MCOH 1KB5A 4PTTA 3KG5A 4ZNCD 2IG2L 1A6ZA 1BIIA 4K3EL 5GSVA 3RGVC 2Y4SA 3UTPD 1DEDA 3RVVC 3U48A 4KK6D 5D72H 4S1SH 3RWHA 2ADJA 3VFWB 1DUZA 1KGCE 1X5IA 3ARWA 3DRTA 4PP1D 2NTFA 1EXUA 3MGAA 4EEEA 2VIRB 4R8WL 4JANA 5DR5L 2NY1B 4KK5C 4NO3A 4BSVA 5E08H 5IFJA 2OXHA 1F90H 3DX8B 1MI5B 5IG7B 4G8EB 3PP4L 2IQ9L 4JLRB 2DQUL 5ELIA 1KJVA 1A7RL 2B5IB 1XGYL 4XVSH 3N85H 1UXSA 4OSUL 4QRPB 1AGEB 4C83B 4GRLB 4PJEB 4IJ3C 4G6AC 2FLBT 2BRRL 4OV5A 4WI4A 3MGTA 2P5EA 4M93B 1BJMA 3QXDB 4NJAH 4XAWL 3C87A 1S78D 5E2JA 5T1KA 3T1FA 2AJUH 3CIQA 4FXLA 4BKLA 4GW5B 4LPXA 2QBWA 2UZXB 1JCKA 1NBZA 4Y16A 1DBJL 3H7BA 4NWUH 1EHLL 3GRWH 1JZ7A 4P2QA 5DGRA 1ZT4A 1U91B 1OGAA 3WLWD 4M8QA 1G7JA 1U41A 2IFFH 2EH8H 4Z77B 1A7BA 2FECL 4FQPA 5I8OH 3RDTB 1XGPA 2V2WB 1QLFA 1EJ6A 5I30H 5BMFL 1HZHH 2R2EA 4AYFA 4HX1A 4R96A 1AR2A 3OAYK 3OXSA 4PV9A 5IWLC 4HCRA 4L4VD 35C8L 4XNMA 5H94B 1NDGB 1S9YB 4PJGB 2KUTA 3GMMA 3EYUH 5FIEA 4M93C 1U8NA 3FFCA 4HIHB 1FSKC 2GAZA 4F58L 4ZAKD 2L4OA 5EZOL 2YEZB 5KAQG 2ZSVB 4MQXD 2AERT 3U9UA 3QRFM 2YUVA 2WK2A 5KS9E 4C83A 2AK1H 1U92B 2IADB 1J8HA 1MH5A 2ZG2A 3I2CH 2HJLB 3MRCA 4QRTA 5E8NB 3PABA 1AJ7H 1OAZL 5ESAA 1H9VA 4OCSH 2Z31A 2CIKA 1CG9B 2XXMB 3HI1A 2ICEB 4JZOB 2NQCA 4HWUA 2J88H 3C6LD 4WWKB 2N7AA 1GGIL 4N90D 4HIJB 1IILE 3G6JB 4RAUA 2JELH 4HXBH 1UQSA 4OCWL 1WQVT 4AEIH 4JFEA 3D25A 4Q6YA 5L8JB 4OIIL 2VLKB 5AWNH 4YHIB 3S96A 1AD9A 3JTTA 4M6OH 3ALPA 4O2EB 2LQRA 3S35X 4WTXA 4M62L 1PYWB 2AJVH 3QIBA 2ZWLT 4OI8A 2ARJB 3RBSA 2IJ0C 1NAML 1NGZA 4JFHD 1VFAB 3CFCH 4R6UA 4Z0XA 5DUMH 1INDH 1IKNA 1UM5L 1FZOA 4XNQA 1X5JA 3UJTH 5D2LB 3BUYA 1A6UL 1YNTA 3NCYP 1CDBA 2BVUA 4FABH 5BVJA 1S7VB 5FOJA 1NGYB 5GS1C 5C0CD 4OLXL 3CCHB 2EKSB 2IPTH 3IRZA 3TA3C 2FJGA 4UDTB 4ENEC 3QULA 4NFBA 2MCG1 5GS1A 3HMXH 4WEUD 5C0IA 5GRVL 4M61A 5D7SL 4AQOA 4Y2DB 4KHTL 1RQ5A 2F53B 1RUKL 5F7MC 1I7UA 3HE6A 3QHZH 1CICC 1H8NA 4Y4HC 5D93B 4HC1H 4PGJA 1G9ML 2VKWA 5GS2D 1DANU 3U7YH 3TVMC 4EI5B 3GHBH 2PO6A 4XAWH 2AXHA 4KRNA 5GJSL 2IGFH 4TVPH 1OSPH 3FQXA 2Q76B 1A3RL 4NHUB 1IL1B 2XTJB 2PXYB 3J8F7 5HXMA 2UZIH 4XBPA 1FIEA 2R0ZL 1KCUH 2AQ3A 2E6QA 2NY1D 4F15B 2CRIA 4Q97A 1KIQA 3CC5A 1KJMA 4X7CC 4LIQL 1BLNA 4AIZA 4HDIA 1LVEA 2WQRA 5FA4B 3UP1A 5IHBA 4PRIA 4PJHB 3SBWC 4XPBL 3P3YA 2ERJB 3WL9B 2Q3AA 2OQJB 2BFVL 1IEBB 3RUGE 3RUGB 3KPNA 4QHNA 3TFKD 5I73C 5TGBA 1T1XB 4YQXH 4DVBB 1UACL 4I3RH 3HR5B 4QO1A 4S10A 2XKNA 3DX8A 5I74B 4LOUC 5CP7A 4BZYA 4IRZH 4QCIB 4AK1A 4F7CB 2AJSH 4X7DC 4WI3A 3RY6C 4RAVA 5DMIL 3SGKA 2Y6SC 5DVNA 5IFHH 2ZSWA 4P2RA 4L3ED 3MJ7A 4N0CD 3T2OA 3FT2A 4O58H 1KPRB 3RDTD 4PGZA 4EQ3A 5D1ZB 1K9TA 5K9JL 2FECI 5EOQL 2ADFL 2R8SH 2VO5A 3JV6B 3LD8C 3TNNB 4FQCH 5JDJA 4U6XA 5TQ0H 5CUSH 2GSIA 1NBVH 1GZQB 4QTIL 3VGGA 2CUHA 5JHDA 4NQDA 4YAQA 1S9XA 3QH3B 1PG7L 3LKOA 3PWPE 1L7TL 4ESKA 4AEIL 4UTBL 3SEPA 4XNYH 3SJVA 2A6IB 5HHMB 5I19H 1OARL 3SDAC 3W9DB 4F9LA 3OX8A 5KVDL 3WN5C 1IM9B 4LVOB 3HNTL 3WDIA 5FKAA 1AHWC 5DFTA 4QRQB 1KCKA 3CFIC 5JNYB 1X6NA 4RISH 1EEZA 3EGSA 4OQ1A 5LCVH 3OQ3B 5F9OH 4ODTL 4LQ1A 3OX8B 1RJLB 5D8JH 4DEPC 3HR5A 4HEPG 1QO3A 3EFDH 2HWZH 3SKOA 1OOAA 3I6GB 4P59L 1T0MB 5D7JB 3WKMH 4W4OC 3RRQA 1FH5L 2AV1B 1MWAB 4YX2L 5CJ8A 4KQ3H 4HUUB 1WAAE 4BFBD 2XZAH 4M8VA 4I0KA 3FN0L 3ILPA 4APQC 3OXRB 2APBA 4F8TA 3C2AH 4HDIB 4JFXA 4UNTA 5GZND 1CFTA 2N7BA 4QXUH 2MCPH 5E2UH 3VRLF 2XQBH 3E0GA 3QHZL 2UY7A 4UINH 3CX2A 4ZDHA 1RURL 3MPCA 5HHQA 4JFFE 4DCQA 1X5ZA 1S9VA 4I5BB 4P5MB 1TTUA 3VXMB 4GSDL 2OX5A 3DV6A 2XA8H 1KT2B 1ZLVK 2O5ZL 3PL6A 2FL5A 4NOBA 4NZRH 5DHYA 3KYMB 1I8MB 4YHOH 2IANA 5J89A 2P49B 4FQIL 2GY5A 1OT1A 4OJFH 4HHAB 4JFZH 4YHPA 5KZCB 2KBGA 1KC5L 1Z9OA 2UZIL 5EZLA 2OXGA 4GAYA 1T20B 2EZ0C 1PKQB 5BRZA 4JM4H 2C9AA 2M1KA 3QNYA 3F7PC 4DWHA 1I4FA 4QRUA 5D96B 2WBJC 5CJ5A 1N6VA 1X5KA 5BXFA 5J6HA 1AR1C 1BREA 4GKZB 4MD5B 2H6PA 4ODVH 3QDGD 3P4NA 3IFOA 3OKMB 1UWEL 4EXKA 3RWIB 3WLBB 3WLWC 5CD5C 1KCSH 4HLJA 4V1DA 4GMTH 4KI5E 3SY0A 4CL7A 4J8RA 5HVHB 2IF7A 1Z3GH 3QXAB 4TUKL 3T3PE 4HKXB 5EZJA 3HI6H 1BFVH 3EOAA 3T1WA 3MRPB 1I9IL 3G04A 4ZNEA 4MB5A 1VFMA 5TE6L 5GGQL 4GBXA 1MCPL 4JQXA 3QEQA 5HGAA 5JOFA 1ZLSH 3B9KC 4TUOA 5B8CA 1KJ2H 1TENA 5KSBF 5I1AB 1QA9A 2YUWA 4KROD 2R0LL 4ODHH 5FM4A 3GRWA 5C07A 5H8DA 4BSWA 1U58B 2BCKA 4HQQH 4QRRE 2EC8A 3U1SH 1YY8A 3GMMB 4GKNB 2OL3H 4ONOA 1N59A 1LO5B 1IGMH 5DJYA 3ZL4L 4ZTOH 4XP1H 4CU6A 5C0JB 3FONA 3OR7B 1G6RH 1SJHB 3IVKA 1X7QB 1E0OB 4QRSB 1SEBA 3CMOL 4XNYL 4UBDD 3UTTB 1ZHKA 1T04B 3GHEH 4S1QL 1ACYL 3HG1A 3T0EE 3ZTNL 15C8L 2Z8RA 3SE9H 2F54B 3E2HB 5IROC 1BBJA 4XP5H 4PJAB 4AH2A 2VL5A 1KFAH 4PJFE 3NIGF 1QP1A 4P23A 3GI9H 4D3CH 4MZ3A 5C09A 4OFKA 5DYOA 4V2BA 2BNRE 5F1SA 2W1NA 1BJ1H 4LLUA 1F5WA 3RA7L 4LDLB 5I1IL 2J8UF 4PLKD 1HHJB 4LVNB 1C12B 2X4UB 2DQCH 2MHAA 3DSNA 3FQRA 4NGHH 4QRPA 5DK3A 4AEEA 4BFIA 5M94B 4XRCA 3MJGX 1FC2D 1JHTA 1VGEH 4GJTB 1CGUA 3IJSA 3LS5L 4QHLB 3EO9L 1TNMA 4K7PY 1XIWB 4P2QB 4R90L 2W9EL 3E6HA 2MHAB 3T8XB 4WFFE 4ZPVA 1ZLVH 3HZKB 5F1IB 2NX5D 1I3GH 1JZ5A 4OCRH 3OJDB 1TTGA 3HCVB 4XI5D 3WUWB 3U0TA 4H8WC 1WC7A 1UCBL 4PJHE 1B0GB 1DFBH 2XT1B 3CFDB 3MR9A 3VRIA 5HJ3B 1MFEL 3K4ZA 1KTKE 3OJMB 2CLZB 1OWRM 4L4JA 4I77L 1CICD 2CGRL 5D5MF 2MQCA 1KTDB 4Y5YC 1YEIH 3OXSB 4PV9B 1IGJB 5JXEA 4JO2L 1J0YA 1IM3B 2CDFA 2NZIA 1RZJH 3BKYH 4KQ4H 1G9NL 2P5WB 2B20A 5LGKA 4X4YA 4D2NA 2YKLL 3MACL 2AJYH 4Z8FL 4K9EL 1B90A 4IRSC 5C0FB 5JIKA 1WT5C 2IFGA 3LEVH 1CFVH 5TFSH 4BH7B 4J3XA 2DLEA 3SKNA 4JKPL 3STLA 3EDFA 4OTXH 3K4DA 1EZVX 2CUMA 4WENB 5HTSA 1KBGL 1OTSC 4G8GD 1MCPH 4XBEL 4G6JL 5JHLH 5TF1L 2Y07H 4WU5A 4DK6A 1GGBH 1MJ7H 2EDDA 4X6CF 1WZ1H 1MCSA 1CGTA 1IRAY 1KULA 2ESVD 4HWEH 2CJUL 5SX4H 2XIDA 3U2SA 2EEAA 3C60C 3FQNA 4ZOCA 5B4MC 1MI5A 3MLYH 1CDHA 2YPKB 4EIZC 3B2VH 3CFEA 2WINB 1ORSA 1HQ4A 3QFJB 1E4WL 3GSUB 3PGCA 5I71B 3KR3H 5HGHB 5I6XB 5I1JH 1IGML 1NEZG 3RWHB 3SQOL 1YMHB 1OAXH 1FVDB 4GRMA 4V1DD 2DD8H 3ULUL 1TZGL 2ZSVA 4K23L 2JB5L 4JFQB 3DGCR 4ZO6A 2Z8VC 4Y1AD 4KK9D 1N2RA 3ARED 3CZFB 1MIML 1FG2B 2VZ1A 2AXFB 1A0QL 4RAUB 3QIUA 1P6FA 3NH7L 3KPSA 5FA3B 15C8H 3TN0B 4X6BA 5EU3B 1OLLA 4HUWB 2X1QA 1EVTC 1XIWD 2E8YA 3HA0A 3DVNA 2WIMA 5LGJB 2R56L 4NYLB 2OK0L 1AIFA 4PRPB 1R3IH 3VGAC 2VZOA 2AXJA 1HNGA 2I24N 2X89A 4Y2DD 1TDQA 2IAMA 4XC3H 3UTZB 5DJCA 2QV2A 4YFLI 3U46A 1NMBH 4U1MA 3OHXA 1L9NA 3TPUA 4AZ8A 5D93C 5KVFH 1RD6A 3LN9A 5DMGC 4FP8L 2VQUA 3HPLB 4NUGH 5EA0L 3VXSA 4I48A 2GAZB 1H3VA 4Z7QE 3BEVA 2E27L 2EE6A 2W9DL 2C7UA 4ZSOA 1YA5A 2AQ1A 4M6NL 1MJUH 1FZKA 5IBUG 3TNMA 5E6YA 5H37H 3UYPA 1WIPA 3W0WB 2ICES 2WUBH 1CU4L 4D0DA 4P9HC 5B38B 3WFDH 3LB6D 5ISZA 4YE4H 3OKOA 2CMRL 5K59F 2H3NA 1AHWA 2E7BA 3BH9A 1OAQL 1QLRB 3D9AH 2Y7QB 4LEXL 4EQ2A 2EDNA 1AY1H 4NZUL 5C0NC 4WI6A 5D9SA 1J87A 5DJ2A 3L5IA 4JFQA 2GJJA 2VISB 5KS9F 1INQA 1P7KA 3AB0B 4JFXB 4LSTL 7FABL 2EYTB 3FB6B 1NFDF 1MEXH 43C9B 4XVUC 5F7DB 4KI5D 3KAAA 3ZYJA 1YY9D 1I1YB 1HOCA 3OF6A 5C0BA 2X4RB 3MMEA 1F42A 4UT7L 3OAZK 1MWAA 3IGAB 3OKLB 3L3KA 2Y1VA 4EI6A 4RMQA 6CGTA 3SDYL 5ID0A 3GB7B 1RIHH 3GMPA 3UJIL 3RGVA 4V2CB 4GFTB 2ATKB 5L0QB 4D9QE 2PW1A 5CD3B 2CRYA 4NT6B 2A6JB 2JF1A 4UV7H 5I66B 3QUMA 5GJTL 1F4XH 4WHDA 4AENA 2I25N 2CQVA 1K4CA 2D7TH 4ONHA 2HVJA 1YC8A 3FJTA 3LN4B 3U79A 4PS4L 5HDBE 3VI4E 2XA3A 5E24E 4MWFB 5C9JB 3OSKA 4Q0XH 3HS0B 4J2XA 4PY8I 3SBWA 4JRYA 4OV6F 3S5LB 1JWUA 1BWMA 4OBRA 2F5BL 3FT3B 1E4WH 4RAVB 4KMTL 1I3UA 4PRNB 1A3LH 3EAKA 5BZWB 1BBDL 4M48L 1E4KC 4HGWA 5TH2A 1IGTB 3TNNA 1FHGA 4W68A 5EORH 1UVQA 1YEGL 3OR6B 1XF1A 4DVBA 4X9HA 5AEAA 1QQDB 3D2UD 2CSPA 2JE8A 3RY6A 3KPNB 4JHAH 5IVXF 2PO6C 3O2DA 1BVZA 3ARYA 5FGSA 2JIXA 1LO4L 2C1OA 3HZMB 4P2RB 1A2YB 1QBML 2APTA 2GK0B 4LARL 3QDJD 3VGDA 4L4TE 2GSGB 4JGUA 2XWJB 5AZEL 1KB5L 3WDHA 2Q8AH 2ESVA 5AZ2L 3O2VL 4POZD 1A6UH 1NFDB 3EO1B 4TOYL 1R3IL 2FRGP 1CLZL 4CJ0A 2X9XA 4BZ2H 4QRRD 1RUMH 4G5ZL 1OAKL 5TGBB 3MLTA 4D9RE 5FHBL 4LLMA 3HMXL 1K6QL 2UWEE 2ICCA 4OFYD 5FV2A 3DTXA 1P2CA 3BGMA 3BQUB 4HK3N 1KPVB 2YWYA 1L6XA 4K71B 4RCAA 5IF0B 5BS0D 5T3XH 4UIKH 5E9DB 4FNLH 4U1LB 5HYJB 4KXZH 3IFLH 3O6FD 2CRZA 1FFOA 4F7TB 3P9MA 3IETB 2D4DA 3AS0A 3WFDL 2AKRB 4LKXA 4N9GA 3QIBD 1AP2B 1P84K 4X6DF 5BVJB 4ZD3H 2M2DA 1ERNA 2OTUB 5HGBB 3MRRB 32C2B 1U8KA 2QEJA 1OSPL 4X5XB 4LRNL 3PIQA 4HAFA 5ICYB 3NZHL 5I1KH 3IDXL 2EDHA 4JM2A 5IW1B 5FYKU 4XCYA 5ENWB 4Z7OF 4HZLB 2P8MB 5D6CA 3RX8A 4LSTH 3V6FA 3AXLB 3VFOA 5JW3H 1K8IA 1UWXK 2OJEB 4G43A 3BXNA 5JQ6H 1QVOB 3BW9B 5CEZD 3CXHJ 1CS6A 1S8DB 3CJJA 3VMPA 5D6CB 4EJ1C 3O2WL 5AG8A 1K5NA 3UYRL 1SM3L 1ZS8B 3MV01 4GRWH 3ULVE 5INDB 2HN7A 1M1SA 1IAKA 5FHAL 2PW2A 3OAUH 3EYSH 1JWSA 3VU2A 1C5DB 1F13A 3L95A 5T1DL 4QF1B 5D5ME 4E41B 1LO5A 3Q1SL 2MNUA 1UM5H 2HN7B 4KDTA 5D70L 2ADIB 1MELA 1RMFL 2I9LB 4JG1H 3QCVH 1T2JA 5HYJA 4MMZC 3Q6FB 4PV8B 1P9MA 1HEZA 3S4SA 2XXCB 4JVPA 2OCFD 5IWLA 3TH3T 1CXFA 4MD5A 1YDPB 3BIBX 4N1HB 2APXA 2J1KA 4X4MA 3V6ZB 3L1OL 3G08A 5JUEH 2ITCB 4Y4HD 2PO6D 1PG7H 3RBGA 4H20L 1HHKB 2DQJH 5D7IF 2P42B 3E2HC 4PYGA 1A6PA 2BVEA 3O3BA 2HJFB 1W0VA 1WUNT 3D39E 1IEHA 1EHNA 4H8WH 4Y89A 1C8PA 4EBQH 2CKBA 1ZA3A 5J1AA 1NUGA 1CE6A 4OZFA 3VJ6A 4Y16C 5DEFB 3ZE1E 4F7EA 3UZQA 1WFOA 1EHXA 4JJHA 3LRGA 5T5FH 4HPYL 5GGSA 1CXLA 5EOCH 1U3HA 5HHQB 1NBZB 5I1HL 4HFWA 4LHJB 5I0ZA 4C56E 2OJEA 5TDPB 3U9PL 1GZPA 4OB5H 3RZCC 3T1FB 3K2MC 3SKNB 5GRVK 3CLEL 2YPVH 3ARFD 5D2NE 2DQUH 3O81A 3REWA 3VH8A 1T22B 1XIWC 4HXAL 1LP9E 4R4FL 4ZFZB 3U0TB 2ICWA 4XNZB 4KJQD 3UO1L 5DHVA 3MLRH 5KN5A 3DHJA 1HSBB 2V5TA 3NZ8B 4LVNC 3FOLB 1PSKH 1KJVB 1JP5A 3DV4B 1OWWA 4YO0A 3UDWC 3RJDA 1SJHA 2DQTL 2DYPB 4OCLC 5CJQH 4TNVF 3OB0K 5FKPB 1JGLL 3B2UD 2X1PA 5EU5A 1FNGA 1UADC 4Y4FA 2NXYD 1KPUA 4ZAKB 5CFHA 2HRPH 2VL4A 3PV6B 3L5XL 5CSZA 4CDGC 2DM7A 3TYFB 3H3PL 1JPGB 4PJCA 4DGVL 5ICZA 1Q1JL 1DBMH 3UAJC 4A6YH 1AXTH 3MRMA 1J12A 5D5MA 1RK0B 1ADQH 1SEQH 3U36A 3VWJB 3BHBB 3QI9C 4JGJA 5KJRH 4N68A 4Z95L 3PWPB 1G7QA 3HPJA 2DLHA 3JZ7A 4FXKB 3I50H 4KUZH 3QJFB 4X6EB 4POZC 3UTTE 4GG6F 4Y4KB 4HKZB 4CJ1A 1J9CT 2Y9RT 5JPNB 4S0TD 3BPNC 1MFDL 1HHIB 4G7VH 4TRPL 5HGGS 5F7UA 4N9OB 4P23C 2EEDA 1DN2A 3T0WA 5KVGL 3KYOB 4G8GA 4P0DA 3H9SE 3VE0A 3WO4B 1HI6B 4MSWA 1WZKA 1P1ZB 5IEHB 4M9PA 4K8RL 3DARA 4JG1L 2XFXA 4X7SL 3DX9B 4G9FA 4OUUB 1JZ3A 3L6FA 3D18A 4DZ8A 5FO9B 5H2BA 1Z0MA 4DVRH 2HJKA 2OL3A 1MRCL 5BRZD 2VNCA 3QHFH 1QFWL 4Z7WB 1MCJA 4JFOB 1JPFB 2CO6B 3A6CL 4EXPX 1A4KB 3UMTA 1FH5H 3GSNH 3WL9A 4KTEH 4OLYL 1FNEB 4U2YA 3IDGA 4RMRA 3D48R 2PYED 4M6OL 4QXTA 5BW7C 3MX0A 3VXQA 2DM2A 4D94A 2XRAL 4WFGD 1G6VK 1GSMA 4LHQB 4LQFH 4PPTA 5JA8B 2N56A 2JCCF 1MHPH 3DIFA 3FCTA 1UWGH 1X5LA 3MCLH 1AE6H 4W4NA 4HUMB 4Y1AA 1FFRA 3OKEA 3UX9B 5IHUL 5I71C 3GM0A 4DQOL 2HH0L 1LK2A 3ZKXC 3H0TA 4P9HH 4OCYL 1R5VA 4YBHA 1T7WA 4DKFH 5ITBL 3BESR 1I1YA 3C5JA 2AV1A 4XX1G 3QNZB 3QUKB 1LK2B 3HUJE 2MWCA 1G7HA 1A9EB 3N1FC 3X13B 4B50A 1FFNB 2H32B 1KC5H 2XICA 5GRYA 2VMFA 3O4OB 1NMAL 2FD6L 5FDYA 5C07D 2CIIA 3ES6A 4Y2DA 5HI3C 2XTJE 3SDAD 2X44D 4XBPB 4KJWC 2BSRB 3QUYA 4PJIF 1FNEA 1JYNA 1FO0H 1T5XB 3IDUA 4DAGL 1NCDL 4ODBD 3LPFA 2E8ZA 3UO1H 3W2DH 4N0FB 2JIXB 4IEFB 1EV2E 4KTYA 3CCHA 1T80A 3AY4C 3OPZH 5LG1A 4D9QD 1UVQB 4HIIA 2F15A 4PRPA 5KSBA 1Z3GL 4TVPD 2R0KL 1MHEA 1RFDH 3KYNA 4EZMA 1WIOA 2XFXB 4MJ5A 2VDMH 2DKMA 5I74C 4P5TC 6FABH 4PJBE 3ARFB 1KIUA 3V6OE 1JPSL 3ARDA 4JPIA 3NIGE 2NY0B 2BFVH 43CAB 2VLKE 4ODHL 4UIMB 3CPLB 5DJZB 4OZ4B 5FUOH 1FNAA 1OP9A 5DJXB 4FQLL 1UXWB 4JDZB 5SWSE 1RUPH 3IAPA 2R4RH 4LCCC 5JLZA 2PW1B 1A7PH 2EYRA 2G2RA 1HKLH 4G3YL 5FKAB 1IC4L 1KF9B 2V7HA 2D4FA 4PUBL 4NJ9H 1MCHA 2YSSB 3P0YL 5HDQH 3ZT6A 1T6WA 4HUWA 1XF4A 5CINL 5JW5A 4EDWL 2AABH 1CXHA 4S1QH 1CGYA 3EYFB 1F8TH 2O26U 2D7PA 1WEJL 1MFDH 3ARFC 4KROB 4TRPH 1FVCA 5E6IC 5JDSB 3IXAA 3WJLC 4RGNE 5MEOB 4UDUB 1F2XK 1VDGA 5KSUA 1Q0YH 3WNMA 2G75A 5CUSL 3VWKC 2RB8A 1KB9K 3SGKC 5KSBE 4FQJH 1AKJA 1TXKA 4OZIE 1NL0L 4HD9A 5FKPA 3TIEB 4LPVA 5EFIA 3BFOA 2DJ4A 5D1ZA 5DQ9A 1I1FB 3GSWA 1OAZH 3SGDH 3VFUB 4LCCB 1QSEE 4LSQL 3TM6A 1YJDL 3KXFA 5D1QB 3BPOC 3NBNA 4ONGH 4PJ9B 3FRPG 4PB0L 2PO6B 5IMOB 3G6AB 1KEMH 5D1XD 4CU7A 2JELL 1D5XB 2IPKB 3MLVH 4LCCA 1AD0A 3ULVH 3WV0A 4R2GC 2YD7A 5HI4C 5EO1B 3BKCL 1A6AA 1XF5B 5J11C 2P1YA 1YNKL 3KYKL 5E6IB 4S2SB 1WITA 5AAMA 3RVTC 4GRWF 3JWDL 4LIQE 4DQOH 4OLUL 1KNOA 1ZGLP 3PDOB 3PGFH 1ZLUK 4RA0C 3O11A 1YN7B 2AJXL 5I15L 2AW2A 3GIZH 1J88A 2EIZA 4M62H 1B88A 2BVOA 2HT4C 3KS0H 1VCAA 2V7NB 3MV9A 5IVXA 1JK8B 1YUHA 3D0LB 1IKFL 4L8DB 1DEEA 2JJTC 3EW3B 1K4DA 4YX2H 2C3VB 3DXAB 1AI1L 4F7EB 1EVUA 5C1MB 4TSCL 3BPOB 3SKJH 1QRKA 3DX6B 1RIVH 4K71C 4KUCD 3WS6C 4MNHB 4ZTPH 1RAMA 5C0JA 3DBXA 3ZMRA 1VACB 1JI1A 3GMRB 2PTTA 3NCYS 5GRJH 5JO5B 1U9KA 1CF8L 1ZHLA 3MJ6A 5ITFB 1G9NH 4PLNC 3B83A 1T0NA 3MCG1 4ZXBC 4OZGE 4G42B 4P5TA 1LO0L 5HHVH 1QRNB 4AEHH 2EZ0D 1LK3H 4AM0B 3CD4A 3P77B 3QCTL 3BT2L 4XTRC 3Q3GA 1OT2A 3TH2T 1J10A 2IWGA 3CUPB 4HS6B 3BQUC 2PYEE 3IU4H 4RA3A 3X14B 5ACLA 3BP4A 4G43B 3GHBL 1R3JB 4YHYB 1QTYT 3DYMA 4CNIA 3T3MF 1DVFA 5DMYA 4LEXH 1JPST 3QEUB 5EU4B 4ONFH 3WXVL 1JHKL 3MLZH 3O3AB 2X4UA 5F3HA 2W0LA 3ZO0A 4OGXH 3FRUB 4G6KH 3VFMB 1DBKL 4HWBL 1DVFB 3MRRA 3MRKB 3KPOB 1YY8B 3RY4A 1IE5A 4DK3A 5ILTH 3CVIH 1KN2H 2X2YA 1YMMD 5J9PA 3IF1A 2ZCHL 3TJHC 2DQFA 4FTVE 4WUUA 2G5BA 3ULUH 3QUML 5IW1A 2B1HL 4KU1A 5DLMH 1MFAL 3DHMA 5JPMB 3HG1B 2NY6B 5E99L 4HZLA 2QADD 3PWJB 9CGTA 1A9BA 3MRFA 4HH8A 1M05B 3GI8L 3X11A 5HGBA 2K3TA 5HI3D 1U8MB 2IAMC 2QHLA 5ICYA 3EYOA 1XCTB 4DN3H 4JY6A 5HGDA 3DBXB 4MA3A 1R3KA 5DURD 2YWZA 4HKXA 1HK6A 1R3JA 5KW9H 5FGRA 2V5MA 3E6FA 1DVFC 2DMKA 4HS6A 4HW6A 4FABL 3S34L 4BH8A 4WW1B 4DKAA 1T1WB 1ZVYA 2X6MA 3Q5OA 3Q3GB 4XPAH 1IC5H 1KPVA 5EWIH 3VXTA 3OKYA 4OZHE 5C07B 1R6VA 3VXME 4IRSA 2DM3A 2X4NB 1V3MA 4J4PA 4JDTH 1P69B 3FB7B 3ZLQC 1LP9A 1Z9MA 3UTSA 4JFOA 3MOAH 5E8DL 3ABZA 4D9LH 2E27H 3D5OF 3ARGC 5MI0B 3SE9L 5AYQA 3D85B 3HZYB 1R3LA 2JJTA 4HBQA 4IRJD 3RUGF 2P4AB 1KG0A 2MFNA 2B1AL 3VMOA 5I75B 4IIQC 4OLUH 4MXWH 1WCQA 3RVVD 4R97B 1IQDA 1JHLL 1LEKB 3QB7C 1H3XA 1WSST 3S36X 3TWCH 2LVEA 4XP4L 1HDMA 3KPTA 4M7LH 2HLAB 2N1KA 1GXEA 4S1RL 4JM2C 1CN4A 4XWGL 1TJHL 2Q8AL 1A7NL 2GJ6E 4HEME 4ZDHB 2GJ6B 1EO7A 3UYOD 1X4XA 1DDHA 5DR5H 4PJBF 3IB4A 5MP6L 1FGNL 2AQ2A 3WS3A 4KI5C 4PJ5E 5DC0A 3P0VH 4XZUB 1QHOA 5MEQA 4P4KD 1CTNA 1U8LA 1RUML 4Y5YB 3DSFL 3FHQA 1D6EA 4NQXA 3W5NA 4X6FB 4LPWA 5IW3A 3KJ4C 3QWOB 2HFFA 1DBBL 1TQBB 2FJHA 4DKEH 3B8YA 3UPRA 3RZCB 1EFXA 1E6JL 3T2NH 2QR0A 4ZFGH 1T7XA 5EN2B 3JV4B 1FIGH 4NFDA 2J4WH 3VH8G 1DE4A 1FJ1B 4RMUA 1X4ZA 3GMOA 4OGAD 4NKMA 5CEXA 4H26B 3I9GL 4NUJA 3RAJL 4OF8A 3QDJA 1VA9A 2YOCA 3NAAH 4ZS6D 3SDXF 4PBVC 3QQ4A 1UM4L 2RIKA 2VDPL 4QCIA 4WFED 2EYTA 3CDFA 1MF2H 1BHGA 2XACC 2VUYA 5T1KB 1G9EA 4JN2B 3VWJC 4JB9L 4OIBA 1RZFL 3C6LB 5K9JH 3TO2A 2W65A 2X4RA 4K55A 1JRHI 3RWGB 3VFPB 3IDMB 4L3AA 5C0EB 1YEFH 4LNRB 2NY7L 4JDVB 3EYUL 5TFSL 4KZEH 2AV7B 5KOMC 3G5YB 4X6FA 5JQ6L 3N1GC 3PWLB 3MBXL 3OAYH 3REWB 3VH8B 3LY6A 2LU7A 2VLJB 1RU9H 3QZWA 4XCCH 5JIIA 1BZQK 3WO4C 1KEGH 3U0WL 4U1IB 5JHLL 3DI2B 5H35B 3IFOB 2ZZUT 3QI9B 3EKCA 2V5SA 5BV7H 3A0OA 2ORBL 1NKOA 3AU1B 3V0WL 5D72L 2D31A 2QR0B 4BJLA 5ADOH 4MAYA 5TE4H 3CMGA 3UBXB 4L8CA 2ZPKL 3RZCA 4G9DB 3TN0D 4DKDC 1GGIH 3G5XB 1NCUA 3I3DA 1XF2A 4U6HA 2FB4L 2P7TB 4HXBL 1G1YA 4P4RB 1OAXL 5EU6B 3S36H 3IDNA 4L9LC 5H37G 5T3ZL 4XTRD 3P11L 2R69L 2YUZA 2JJSA 2BY3A 4IRJC 5CBAB 2CKBL 3MLXH 4N8CL 4NO5A 3KDMA 3MREA 2VOTA 3H0TB 1UZ6F 2AXFA 5E8DH 4D9LL 4QT5A 4I13B 3O0RH 4WU7B 1VPOL 4RFOH 4ZPTA 2Z4QB 3MGOB 3IJYB 1QYGL 4LCYA 3W39B 1YEKL 4NWTL 5FGCB 4DN4L 1FZOB 3GBMH 4A2MA 1CFSB 3PP3H 4UV4L 2EECA 1VFAA 1MCCA 1RJCA 2BDNL 3U6RA 5EU3A 4X4ME 2WINA 4M7LL 2OZ4H 2XPGB 3W9EA 1FG2A 1NLBL 3FAXA 2BY1A 1OAYL 2H26A 4O02L 3VCLB 1HZHL 1E28B 3L6FB 3FO2B 4X6BB 1R5VB 1FO0A 4H0HB 4DZ8B 1E27A 2P5WD 1FPTH 3V4UH 1EEYA 4JFEB 4DW2L 4IRJB 3PDGA 5KS9B 2CDGA 4G9FE 4K3JL 3KPRD 3P4OB 4HIXL 5F1NA 1OTUD 3L5HA 1QFOA 4PTUA 3PQYD 2FO4A 4HT1L 4MGXA 4HJGB 1HQRA 3O4OC 4HUVA 3STLB 1MLCA 4NRZA 3DURB 5EBMA 1JF5A 4WDIA 3U0PA 3CSYB 4N0YH 2HMIC 4EN3D 4PD4J 4PP2A 5GGTA 1KXVC 4ZS6C 3Q5YA 1S7RA 2DWEA 1M7IB 1HXYA 3OKKB 3WIIH 2P24B 2H41A 1SJEB 3ETBF 2VLJD 3PWPA 1LP9F 3BP6A 1JZ4A 4U0QB 4O4YH 3NAAL 4P2RD 1GOFA 5D71H 2V9QA 2VDNH 3TJEL 4AMKL 2R0WL 4KZDL 1PY4A 1AQKH 4OD1H 4H0IA 4LLVB 4WTZG 1DBJH 5CBEA 1TETH 1E4XI 2GY7B 4NO0A 3K2UH 1ND0A 4L4VB 1GPOL 3TF7C 2EKSA 1EX0A 1WVZA 3MO1A 1EEYB 5IR1A 2XKSA 4DGVH 4P5TB 4DTGH 1A6TB 4KGLA 2QLVB 4D8PA 1GGCH 4XHJD 2FZ3B 4MXVF 4Y0GA 2Y36L 3BUYB 2VDLL 1NBQA 3W9EB 3FO9A 5JO5A 3GK8H 2JKXA 5IKCA 1TIUA 3AGVA 3MACH 4EKXA 4Z8FH 1JUFA 2AJZA 5GS3A 2AVGA 1JJUA 5E8OB 1NGPH 4Z78A 4LGRB 1AP2A 2PTTB 3JVGC 1JNLL 4NZTH 4R4BA 3ULUF 4O58L 3CFBB 1OGAD 1U8JA 3BMWA 4XRCB 1OF2A 3M8OL 4YEFA 5IESL 1M4KA 4LLDA 4L9LA 4YXHH 3A67H 2R1YB 3I84A 5I8KH 3HUJA 5EOTA 5ADOL 3C5ZD 3LPGA 4X4ZA 2P8LB 2C1OB 3MRLA 3WFZA 3N0PB 3S88H 3HZKA 1NCAH 2AK1L 1OSZB 4GQ9H 3W0WE 5C7XL 4OB5L 1NJ9B 3IDYC 5E8PA 4K3EH 3LVEA 4U7KA 4NHUA 4OCSL 1QSVA 1WIUA 2BVTA 3PHOB 4UTBH 1IGTA 3KXFD 4YHZH 3A6CH 4X80L 2YD3A 5F6HI 3GFUA 5J11B 3QJHB 4WFHE 4L4TA 4CN6A 1NKRA 5ADPH 1H8OA 1VERA 1DEEB 1G9MH 2J8UB 4PR5A 2OM5A 4PJXB 4Y4FD 3MLRL 3TIDB 3GSQA 2JTDA 3MUGA 5D1QC 2GK0A 4EUPB 3KPSD 4OSUH 2DQIL 1AKJB 4NN5C 4ONHB 2E9JA 5ABDE 2PUQT 2X4QA 5EFIB 3D0VA 4P3DA 4P59H 4UV4H 4HPOH 2RCSH 3BKML 1RZ8A 1CGVA 1N8ZB 4Z7OE 5I76A 2DLFL 4NN7C 4ERSH 3KPSE 4PG9A 1T03L 5CGYC 3JTSA 1INDL 4JKLA 2NR6D 1K8DB 3IDJA 5ERWB 4E42B 1XCQB 4Y5VB 3H3PH 4X6DE 4LOUD 4G8EA 5F8QC 1V3KA 4PJ7F 3VXSD 1BD2B 3KPQA 2YXMA 3DRQB 1DBML 3L9RB 2HMID 5F44A 2V2XB 3M07A 4I3RL 4YDVA 5GSRA 3KPMA 3LHPL 5F7YC 4KVNL 2X4SA 1J5OL 3GJEA 3UZEA 2WWMD 1HIML 3HE7C 1YQ2A 3ARTA 3VA6A 3V79C 5C92A 2GTWB 1LEGA 3GSRA 5F9AC 3ARGA 3QQ3B 5D6DA 1KN4L 4UQ3A 2BCKB 3ZT5A 2DKUA 2K7PA 3MCKB 3TO4A 1VENA 4OJFL 2NY4D 2IPUK 5C0BE 3Q6FA 1CFNB 4JHBA 3S97C 5MERA 5CZXC 1N3NB 1HYSD 3NMEA 2G60L 3H9HA 3QDME 3S8WA 4QXGL 4M6AA 3EOAB 3HC0B 5E00A 3OKDB 4XP6L 4PGEB 4F7PA 1J8HE 3CAFA 3B4NA 4IDJH 1LNUB 2C1PB 3WXWH 1P7QB 2PF6A 2VXTH 5E9DD 32C2A 1Z0NA 4KI1A 4NBYB 4U6TA 2OJZH 4GKZA 2EXYD 4OKVA 4WIQA 2VWEE 4UILL 4I5BA 1S9VB 2JJVA 3NCFB 3EDKA 2WV3A 3FQTB 4YWGL 3DYPA 2D0HA 2X10A 1JZ2A 3VFOB 3ESVF 3FB8B 1JNLH 4Q9RH 4P3WA 4HHAA 3ZDZF 1D5BA 4KMLB 3ZE0E 1U2HA 2Q87A 1MCWW 2VDQL 5D2NB 2AI0H 3M8OH 3BE1L 5EZLB 3EFDL 3NH7H 3ARRA 3MLWH 3TNMB 1J1PL 2DI8A 4L8SB 4R3SB 1I1AC 1A5FH 3GKWL 3QIWA 3VGBA 4YBQD 3FO0H 4Q74A 5ACZA 1I8MA 1CFNA 5HDBF 3KLAA 2R2CA 1UB6B 1I1AA 1OGAB 1WBZB 1WZMA 2OL3L 4MJ6B 3ZT7A 3UZVB 3BOVA 5DQDH 1KV3A 1S7WA 4HLZH 2DI9A 2WLZA 3QUXD 2IPTL 3F62A 1UH3A 1WZLA 3QUZD 1S7UB 4JREB 5F96H 4PGEA 4IRSD 5FYJU 5HVFB 5HYQB 3BYTA 3OKDA 2BHUA 1HWGB 4I9WD 7CGTA 3FKUS 3MGTB 2GYSA 5L2JB 3DWTA 2QHRL 1RZIA 4MNQD 1XCTA 5DC9B 1VSCA 2VR4A 2NMSA 3S3PA 3PJSA 2VH5L 5F7HA 1BFTA 2DF3A 2XZZA 3C9NB 4U1JB 3TESA 1MRDH 3F58L 1ZVHA 2WUBL 4X9IA 1HCFX 5IG7A 1B3JA 5C08E 1A4JB 2R0KH 4OFPA 4UTAL 5K9OA 3ARGB 1MREH 5BO1H 3T0DA 2R2BA 5I1CH 3CLEH 4NQDD 3VD5A 2BNUA 5BVPH 3T0EA 4XP9H 4XXCC 4TVPL 2F9BT 4MAYB 5MEQB 2ADJB 2UYLB 4OBSA 3QZWG 1V7MH 3RIAF 1JPFA 1F90L 3K81A 2IBZX 4NKMB 5CEXB 1ES0B 2BC4A 3RTQC 2WP3O 2QSTA 1UWEH 3HKFA 2VLLB 3QJFA 4XVSL 1DZBA 1BAFL 3N85L 1IZKA 3SJVB 3SJVE 2GT9B 3JV4A 3QXVA 1CF8H 4ETQA 4XPBH 3B9KD 2BRRH 1IQDB 4F2MB 5HHOB 3I6LD 3VG0L 2KQMA 4PJCE 4G8GB 1M71B 3G5ZA 1CD1A 1RK0A 1SVCP 2O93L 4PRAB 2P45B 4Y5YA 1WGOA 3SJVD 5KG9B 1VADB 2CLRA 4AL8L 5CZVH 4MZ2A 2A6KB 4P2QD 3UJIH 3HTLX 1M7DA 3GRWL 2JCCA 3CFDA 3MUGB 1BEYH 1K2DB 4RFEB 4JO2H 3T0EB 4NO2A 5JOPD 3ZE2F 2APWA 2R2BB 2AK4D 3MA9L 3IDXH 2PN5A 5DSCA 4LLAA 4XXCA 4OGXL 4WNQB 4XP1L 4IDJL 1I3RB 3GMOB 1EDQA 5EG6C 1DQLH 4M6ML 1DE4B 1IEBA 4Z7WF 1ODAA 5ANMB 4R0LA 3LCYA 4QNPF 1UGNA 2FX7H 3LZFL 4UAOB 1EFXB 4Z18A 1BM3L 1HHJA 1NCWL 2DTSA 5D7LA 1EUUA 3ILQD 2UWEA 2ICWB 3BDXA 1NFKA 1PFCA 4OQTL 5F89A 2VE6B 2VWEC 4WHTB 3KLHD 3BZEB 2X4NA 1N26A 3QUMH 3V7AG 3FB6A 5C0AD 2AAVA 3SPVA 3X12A 2IANE 1L4IA 5I1GL 4MJ4A 4ODXA 1XIWA 2EDJA 1DDHB 4NRYB 3FN3A 4LRIA 1ZLUH 3NFNA 1BF8A 3M17B 4HMCA 3PWUB 3BKJH 2ZUTA 4JFFA 1DL7L 3EYQD 2EYSB 3EYVA 4PGDA 4JEGB 3BH9B 1SJEA 1ZA3B 3IT8D 5J1AB 2DMBA 1DQQA 4FQQA 1LEKA 1CTOA 1C12A 4RNRA 4IS6A 2ADGB 1T22A 5F9DC 5IB2B 2ZCLH 5ISZB 3BP7A 3MROB 4PRBA 4HS8H 1JV5A 1RUQL 2H32H 3ISWA 3DMMC 2BSSB 4OZIA 4GW4B 2PYFB 3MUHL 1DUYA 3VFNB 1MIMH 3G6JE 4JO3L 2H8PB 1XR9A 4WWKC 3FB5B 5GRUL 1XF3B 3IFPA 2FJGB 4G6MH 5E6ZA 3JTTB 1G6RA 1IAIM 3E8UH 3BPCA 1FP5A 3QULB 1U3ZA 4L9LB 1GC1L 4DUWA 1CR9H 4LF3B 2RAMA 1LK3L 3T4YA 4JVWA 4MNGA 4P2CG 3FHAA 3GHEL 2NTSP 4RIRB 5A43C 1EHLH 5JORB 4LL9A 1KCRH 1S7RB 2DWEB 1N7MH 3MUJA 2XWBA 4PG2A 2R1XB 4PIRF 5BO1L 1B4RA 5ACMA 1ZLWK 3D2UB 3BPLC 4HPYH 3BH8B 4HUVB 1EGJH 4I0PB 4JFPB 1NGZB 4K2UL 4XBGB 5ESVB 3MBEC 1FFPA 3OBAA 1VGKB 5T3ZE 1CQYA 3KWWA 3WFEL 4AIOA 5CKGA 1CD0A 2IQAA 1FGNH 1QUNA 4FZ8L 3MNVA 3RA7H 1Q72H 1I7TB 4MVBC 4Z7VE 2QQLL 4JE4B 3KDMB 5GIRB 3QEQE 5JW3L 2I9LA 1B0RB 1ZGLM 3O9WD 1VGKA 5CGYD 2PYFA 1IAOB 3BD4A 4JKPH 1MHHB 1BZ7B 4H1LA 4OTXL 3PDOA 5SWQA 5DFWH 1DUYB 1CLCA 2IALB 4XBEH 2HTKC 2HT3D 1IEAA 2V17L 3CNKA 1ORSB 4R90H 2H9GA 3TP4A 5FB8B 5E99H 5GGUB 1CICB 3I9GH 1R5IA 1RHHA 5FO7B 4P2RE 1BFVL 3QUXC 3T4YB 4I0PC 3QUZC 4MX7A 3TYGL 2DQGH 2C3VA 1Y18B 4QRPD 2FATH 3CVHB 1HQRB 3K8KA 5DMJB 3RL2A 4NDMB 3FB5A 3NCJH 3BRFA 3WFCL 1G7MB 3OJ2C 4PJFF 3NCBB 4PJDA 4XWOC 4EIGB 4IRJA 1S9YA 4ELMB 1MJ8H 1U93A 3B9DA 1FO0B 1YEFL 3WE6B 4EOWL 1T1YA 2R1YA 5E2TL 1RIHL 3MLTB 4LRIC 3MROA 3PWNB 2AEIT 2VXQH 4XCFL 5JR1L 4YGAB 2IBBA 5L88L 4GH7B 1G6RL 3U4AA 2V5RA 2VN7A 1RULL 4L4TB 3QRGL 5F6HJ 3HE7A 5IB1B 3ECBB 3RDTA 1CL7L 4LHUA 1ROWA 1CLYH 4K07A 5CP3H 5JMOC 4Y1AE 5IB3B 4PRDB 5C71A 3IDYB 2IBGA 5FYJE 4HG4J 3E3QC 5L9DH 2VZTA 2F19L 4I0CC 1TMCB 2CLZA 4FA8A 4G8IA 4HIEB 4R7DA 5T5FL 3MA7A 3FQWA 4XC3L 3SKMA 4XMKL 1DL7H 1RJZB 3GO1L 5ESQB 4KC3B 5IB4A 3RVTD 5KANI 3CDGA 3O3UN 3HRZA 2BNQE 4OIAA 5MP6H 1QSFE 1A6ZB 1MNUH 1HSAA 5DK2A 5EH1A 4KHTH 1PAMA 3TBYA 4M7ZC 3KNBB 3B43A 1TLKA 3LD8B 1TQCC 4JG0H 3DX9A 4G9FB 4KJPC 3TV3L 4WO4D 3VXPA 4N8VG 4WWID 2Y72A 3NA4A 3GMLB 2MQ0A 3BP6B 4GG8A 1HNFA 2VXUL 1QSED 2OR8A 1VGEL 4GLRH 3LKRA 2JB5H 1FGVH 3Q6GL 3GSVB 2J4WL 4HFUL 1JN6A 1A14L 1MSPA 2HVJB 3PDDA 2W0FA 1AY1L 3PHQB 3MNZB 4MDIB 2DQTH 3DURA 3TBWA 4MWFA 1B2WH 4TOYH 4TSCH 4TULH 2EDOA 4Y5VC 1CLZH 3ZZ1A 4FQXC 3CLFH 4MAYD 1YY9C 4RGOL 1I8KB 5GGVL 2AJUL 1DANT 1KLUA 3EOBB 3QYCA 5GZOC 5GRJL 3IKCB 4LGPB 3GB7A 3GMPB 4K8RC 4J3VA 4BSWB 5LXGH 4YPJA 3BEWA 2NZ9D 4M03A 3SDAA 3O9WC 2V2TB 1KIPA 3F7VB 1NSNL 4Z7VB 1WK0A 1YZZA 1C7TA 4YFDB 3UCRA 3WFHB 1RZIB 3NFSL 4NN7B 3N1PC 3BQUD 5DUBA 3UROR 4KKAC 3IFLL 1LE5B 1A6WL 3GGWA 3WJLA 1F3RB 4O2FA 4CVZA 5SWZA 1CZ8H 3SKMB 5C0CB 3V52H 4XCCL 5EC2A 2AJSL 2X05A 3SDCA 3K8MA 1LD9B 4IMLB 2Y25A 5E5UB 2VC2L 2ARWA 4YFEA 1OY3B 3MXVH 5EUKB 1T89A 5AUMA 3V2AR 5CCKL 1KELL 3P30H 4Q7DA 4G7VL 1Y6KR 2NY6C 3FO2A 4TSAL 3HE7B 1RJYB 4Z76B 1BQUA 1HH6A 3ZDYE 5KSAA 3C8KB 1HSAB 3RVXD 4JQXC 3SGJA 3NA9L 1MCQA 3D9AL 3ARBB 3O9WB 1M05A 5HI5D 1D9KA 4QTIH 5AD0A 3FN9A 3FB7A 5F7DA 1T20A 4JRWA 4LLQA 4OF5A 4FQ2L 4RX4A 4YHPB 1PKQE 1X5AA 1UCTA 4N5ED 3O2WH 2IAMD 1BZ9A 5AYUL 1F3JB 1FL3A 2R2HB 5IJKA 4ODWB 1FL6B 2NLJB 2Y36H 5D96C 5CMAB 5B38G 1JPTL 5DMKB 3KR3L 2VDLH 3P4NB 5DRXA 1U3HB 5CHNA 3M1BA 5FYLE 4X99B 1N6UA 1L9MA 5MEND 4LAJH 4OAWB 4NRXA 4CVXB 3OGCB 5DJ6B 1I1AB 5EO0A 3ARPA 4RISL 1IGCL 2LE9A 2P5ED 5HHPB 1XH3B 1G7QB 3HPJB 1NGWA 2WBJA 3H9HB 4KMQA 3UTOA 1B6DA 4EN3B 1IM9D 4LFHD 3DO3A 4YXHL 1N64H 2VZSA 4NM8H 3EJZC 5C2BL 3ZYOA 4GXVL 1IC5L 4OZGB 1P9MC 5EWIL 2DJSA 2P5EE 4QOKE 4P46D 3ME0A 3T0BA 1NC2A 2NXZB 5DVKA 3NGBB 5C0BD 1T7YA 4E41D 4P48A 2XZAL 5D2NC 5L8LB 4JRXD 1PG7X 1OTUC 1J18A 2HP4A 1C16A 2B7DT 2AEQL 5EUKA 2B0SH 2VR5A 2W91A 2F53D 1F3DH 3QPQC 4UIKL 4HG4K 4X80H 1LD9A 4IMLA 2Y6SD 3ALXA 1I85A 1YNTB 5DDHA 1MJJB 1P5UA 2YD4A 1N0XH 4KHXH 4URTB 5KVFL 3QQNA 4MA3B 1EEQA 4TUJA 3KGRA 4WI9A 4FQ1L 1BD2A 1CDIA 3KPQB 4JVUA 4NP4L 4MNHA 5JZ7C 3HMWL 1LE5A 1HCVA 3BKCH 3Q6GH 3DUHA 3BO8A 3DMMD 4YH6A 5T5NF 1KIRA 4JPVH 1F6AA 1BWWA 3MRDB 1RFDL 2EDEA 4U1HB 1F4WH 4CADB 2NXZC 3P2TA 3L3DB 1T83C 2ZOLB 2VXVL 3MV7D 4U0RC 4ETYA 4JO1H 4YDIL 5KSVB 1ZSDB 4C55A 3DJ9A 3O3EA 3O2VH 4ORZC 1KCUL 1BVKB 3TZVA 1H0DB 5KTEH 3DX7A 3MNWA 4MA8H 4ZTPL 4Y19A 1CGWA 5JXEC 3MRCB 4ZUSB 1UKTA 5EN2A 3INUH 3WHXA 4U6YA 5FHBH 1QLFB 3V5KA 2VYRE 4RWYL 1P4BH 5EUOA 3L3OA 2W0PA 1P53A 1ORQA 2VLRA 3RWDA 4BA8A 4XC1L 4OCNC 3LRSA 1KYOJ 3EZJB 1DQMH 3MRHA 4UT6H 1X5FA 5CINH 3H9SD 3GDBA 3GSOA 5MENB 3FFCB 4HIHA 3ZDYF 1KTDA 4OZIB 1KELH 3P30L 5IQ7H 4AM0A 2XG4A 5EO1A 4X8JB 3F12B 4XNMB 5H94A 2XQYG 2A1WH 4NFCA 2OMBA 5E4EC 3VA2C 3KLDA 1B0GA 1NC4B 1UKQA 1MCIA 2XQYK 1ADQL 3MYJB 4WW1A 4UAOC 5BMFH 1OGAE 1IM3A 4QY8A 1WBYA 1FBIH 2YKLH 3MYZA 5EOQH 4L3CB 2BJML 2W60A 4JZJA 5E8OA 3R0NA 4P2OD 3LEVL 1BVKA 3HHRB 3IJSB 4KMTH 3VXUB 2CR6A 3D85A 1ZSDA 4OFYA 4RGND 5DHVB 4RFEA 1GYAA 4UUJB 1ZA6A 1HWHB 1BX2A 4EDXB 4MHHI 5GHWL 3SN6N 5M7QA 5GGVY 5GIRA 4IRSB 5I19L 2B1HH 5DLML 1YPZE 4M5YH 5C0AA 3CFKB 3NFPA 4GUPA 3L3JB 1LDPL 1A21A 1OAUH 2C26A 5C08B 1A6AB 3MRHB 3AS2A 1UG9A 2YHGA 3B5GA 3HRPA 4Y4KD 4MNQB 4PJ8D 2LAAA 3MLWL