1A0QL

29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
211
structure length
211
Chain Sequence
IELTQSPSSLSASLGGKVTITCKASQDIKKYIGWYQHKPGKQPRLLIHYTSTLLPGIPSRFRGSGSGRDYSFSISNLEPEDIATYYCLQYYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYSKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the crystallographic structures of two catalytic antibodies with esterase activity.
pubmed doi rcsb
molecule keywords 29G11 FAB (LIGHT CHAIN)
molecule tags Catalytic antibody
total genus 54
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qL01
4U2YA 5IW6A 2DBLL 3U0WL 8FABB 5DDHA 2MSPA 5HGDA 1D6VH 1AFVH 1C12B 4UQ2B 3NN8A 3VD4A 3ME0A 3HAEH 3KPRB 1JTOA 1PZ5A 4QF1A 2UVFA 5GRYA 4O5LH 5C0AA 3QO0A 1LEGA 2FL5B 2DQIL 2DYPA 4QTIL 1JHTA 4DAGH 2DI8A 4X9BA 5HTSA 1OAZH 4NRYB 5GRWA 1PG7W 5IKCA 3MRMB 4DUXA 4PJBA 1MPAL 1XGYH 3VWKC 4WI9A 2O26U 4HS6A 3GBNL 4JVWA 1JHLH 2E6JA 3L5WA 4U0RC 1F6FB 1ND0A 4Y89A 4KK6C 1Q9WA 4BSWA 4XPTH 3B9KB 2RCSH 3WFBH 2DS4A 1GC1H 2UZIH 1WBXA 3O4LB 3V0VB 5T1MA 3EYQC 5FOBB 1HQ4B 5F6IC 1WFOA 1X5YA 5EN2B 3S7GA 2WV3A 4F9LA 5FGRA 2XY1A 3PWVB 1FORL 1IGJA 4JR9L 4X80H 3TBWA 4N8VB 3TCLA 5ACZB 4HUMB 2R2CA 4GRLD 4O9HL 5CKGA 2YD5A 3CFDB 3BPOC 4U4BA 2PCPB 4QY8A 3TBVA 4W6WB 5BO1L 1HCVA 5DRXB 3RI5F 2CK0L 4JM2C 4AM0B 3UX9B 4N9OB 5KVGL 3FT4A 2OK0L 3MV11 3QXVA 5E4EB 1EEUA 4KJYB 1MHPH 2P42B 1W8OA 1PYWA 1L7IL 3QA3A 1UACH 2AEIT 1GXEA 2GK0A 1SJVA 1KB5L 2XV6B 3VXMB 5DJ0B 1MCIA 3LZFL 3LV3A 1TZIB 3F12B 4U1JA 2D3VA 3L3DB 5B8CC 3MV9B 1K5NB 4ZUSA 3T4YB 4Z7QE 2AEPL 4S11A 1UM4L 3MROA 4OCRH 1PJ9A 1AR2A 4GKSA 3QDHA 5LQBL 1UZ6E 2X9WA 5J89A 3L5XL 2H8PB 3KPSB 4G3YL 1A21A 4Z7QF 1QFPA 4U1NA 4K9EH 2HLFC 3MC0A 3O41A 5DURB 4XWOC 3UTSD 4I77L 1CYGA 5L6YH 3DMMC 5E2TL 4YHZH 1IBGL 2W0LA 4YXLH 5FKPB 5TDNB 1TPXC 3WXVH 4N0CC 1AHWC 4E41E 2VISA 4KVCL 3GSWA 5HHVL 1A4JB 1MLCA 4LSSL 5IESH 1U8MB 1KTDA 3O6FB 4NT6B 5AG8A 5D1ZD 3MCLL 5GGSY 3DO7B 4Y4FD 4IM8A 2FJFB 4WW1A 2B7DT 3SKNA 2ZOLB 2PYFA 5EIIB 3TGXA 5CUSL 3BD4A 3D39E 4PBWD 4XCCH 4NQDE 2HN7B 4H88L 5DD0H 4MB4A 1I8MA 4U1MA 5B3JE 3SKJL 4MD5A 1R3JA 4MNHB 4CVZB 2FH8A 1F5WA 3PQYD 5B3JF 5I8OL 1A8JH 4JLRA 2QEJA 2PF6A 3QG6A 2YPLE 1NCTA 4YZFF 3D3VB 1LILA 2CRYA 1OARH 1INEH 2HH0L 2X4PA 3LRGA 1CFVH 2RB8A 3BIKA 5IOPB 1EO5A 4HKXA 4HKZA 4ISVB 3GSUA 4YDLC 3FB7A 3KR3H 4I3SH 1JNNL 4P46C 4PJXF 4YPGA 1FLRL 1AO7D 3U9PH 3CX5J 1DQLL 4P3CL 4Z8FH 3DVFA 4X7SL 1H3TA 1DQJA 1T1YA 4PR5B 4HDIA 3MOBL 5AZEL 1RJLA 3IDUA 3OKKB 4H26A 5A1AA 4N0YH 4A2MA 1QUNA 2DJUA 5LKNA 3PP4H 1IRAY 2ESVD 2XQBH 4LLAA 3ZT7A 1UJ3C 3WLBA 3S37L 1LO2L 5D7LD 4X9HA 4UUJA 2YRPA 1KJMA 3NAAL 3RDTA 5GPRA 1W72H 3NPZB 2WUBH 4GAGL 3RKDD 4V1DD 4GBXA 2EO1A 4K3EL 5E08H 4OD3L 1T5WB 4HF5H 4N9GA 1Z0MA 2G60L 4BH7A 1I3RA 3B6SA 1OCWH 3S4SG 1F3JA 2PTVA 4ELKB 4Q2ZB 1G6RB 4LEOB 4UI2A 2MQ0A 4JM4H 4QT5B 3CX2A 4UNVA 5FV1L 3BEVA 1N64L 1MHHB 3EKCA 2PO6A 4HIIA 1I75A 4XBPA 1N7MH 1N6QH 5JZ7D 1QSED 1M05B 5DJ6A 5LWYL 5FHAH 3G5VA 4ONOA 4HLJA 5SWQB 3BW9A 4OSUH 5IWLC 1A6UL 1T03H 3CXHK 1IGIH 1ZWIA 2BMKA 2HVJA 4M7LL 3RU8H 2BVUA 4KZEH 3WE6A 3N1PC 2X05A 1NL0H 4GG6F 2NY3B 4AIZA 1UC6A 1A0QH 4UU9A 4HFUH 4ZOCA 3IETA 4KHTL 4TRPH 4WW2B 4Y4KD 2VE6B 3IGAA 3S96B 5KJRL 3BPCB 3MFGB 4Z77A 5HHXL 2XICA 4FQCL 3RY5A 1XGUB 3L7FA 2FX7L 3KHQA 3REVA 4MXWH 3MX0A 3CFJB 1NBQA 5F89B 3PWUA 5JW4R 2B1AH 4K8RD 4MJ5A 1JGUH 1DP0A 5DEZA 1J5OH 2YA0A 4I9WE 1KJ2L 4Y19E 1YEJL 3AS1A 2J8UA 3EDJA 2B0SH 4WEBL 1KTRL 1BVZA 5C0BA 3H9SD 5CIPH 4Y1AD 1TCMA 4M62H 1AR1C 5GGUB 2Q7NA 3X3GL 1R3IH 1IVLA 2AK1H 4YHML 5HYSB 4LLWA 1OLZA 3QULB 3OR7B 1U8IA 1BZ7A 1NBZB 4L4VE 4UV7H 1LEIB 1BBDL 3RP1A 3W39B 1IGTB 1KLGA 2OSLB 1AQDB 3CFKB 1FFPB 4U33A 1ED3B 1U58A 2ERJB 4O2EB 5INCA 4NO3A 5EZJA 4HS3B 4N68A 5C0GB 5JTWA 5ALBH 3UZQA 4FG6C 3MZGB 1CL7L 2ARWA 1TQCC 4APQB 3TF7C 1S7QA 3TIDB 3TN0C 3QUMA 4Y88A 1MVUB 4XBGB 5EO9A 1F4XL 4YXKL 4Q6IC 4S2SA 3IFPB 3L3HA 5FF6A 3VCLA 4M6OH 4PJGE 3CH1A 3PXJA 2OMNA 5KVFH 3SO3C 4TOYL 4L9LC 4ORZC 4PJGF 4BQ9A 1A6AB 5E2WL 2LE9A 3BZ4B 3TO2A 1KPVA 1NMAL 3O4OB 5HPMB 2B39A 4JFFE 4YUEH 1CLZH 4JFDB 1CDHA 3HC4H 5JDSB 4P4KC 2F54B 4HIEA 1EO8L 3WNPA 5FDYA 2QADB 3QIUA 3PJSB 4PLJC 4ZFOB 1KIQA 1H0DA 4OGAC 3BESR 1U93A 2M2DA 1U42A 3ARGA 4FTVE 5C0EA 4M7ZB 3H9ZA 3HUJE 3JUZA 1CVSC 2QSVA 2HFEB 4NC1C 4ZTOL 3TA3D 1WSST 4QXUH 1HHKA 4LGSB 2GJ6B 3KXFE 3GIZH 3I6GB 1TLKA 1EHXA 2IH1A 1CD8A 2OR7A 3HUJF 3S5LG 2AGJH 2AK4E 1IEAB 3QI9D 5ISZE 3T0WA 2P5EB 4LF3A 5DMJB 3ULUD 5EU4B 3SDAD 4HPOH 3VXSE 3HS0A 1JGEB 1LE5B 3N06B 4WUUB 4EI5D 3PHQB 1V7ML 3VFUA 1EEQA 1AC6A 1XR9A 5C6WH 5CD5D 3T8XA 2AV1B 3S34L 1IM9D 4YE4L 2FEDD 2AXGA 5M95B 1LNUA 1A9EA 2HTLC 4WNQB 5GJSL 3UEZA 5IQ9A 2DLIA 1RMFL 3MNVA 3BMVA 1PX3A 3E2HB 3JWOC 1CBVL 1OM3H 1RQ5A 2CO6B 1RUKH 3HAEA 4XPGL 4JCMA 4FQLH 1LDSA 2NW3A 3C08L 4I0PC 4UB0L 3IXAA 5GS0C 3IFNL 3ET9F 4WDIB 5HYEA 5C0ND 4ZXBD 4UAOC 3MRGB 3LIZH 3MLYL 4PBVC 5MHSD 4KDWA 4PRIB 2C3HA 4TUJB 3RDTB 5IFAL 3LKSA 5E6ZA 5IW6B 4MVBD 3K1KC 1BEYH 2FIKA 2H2SD 5DDHB 5KSAC 5HGDB 5DGRA 3JWNC 3NN8B 1UZ8A 3I50H 4E41A 3TZVA 4PS4L 4L8CA 3QCTL 3V5KA 5MI0C 2R29L 4LSDA 1PZ5B 3B83A 2BY1A 1S7UA 4QF1B 4UV4L 1EUUA 5C0AB 5FKAA 3QO0B 1LEGB 5TF1H 1UXWA 4P2RE 5D70L 1CICA 2CXGA 2DYPB 3PE9A 1JHTB 2BSRA 4IIQA 3MBED 5IKCB 2DQCH 3D39A 4PJBB 4NQDA 1A7OH 4BSVA 4XXDA 3BP4A 1L0QA 1DEDA 4MXQC 5JW3L 4HS6B 4OGXL 1J8HE 1NCBL 2COQA 3VJ6A 4KKNA 2WBJA 3L5WB 3VWJA 1ND0B 1PLGH 1Q9WB 4BSWB 2YD6A 4GXVL 2YPLA 1T0PB 1WBXB 5T1MB 4K23L 4J3UA 4KTEH 1LMKA 2G75A 1X5XA 5KANG 2R4SL 3MRHA 1IGJB 4P2YA 1FIGL 3GIVA 3RTQD 3TBWB 3Q3GA 3TCLB 3GHEH 1B90A 4L5FL 2CR6A 3U2SA 2RAMA 2AEQH 1PEZA 3LHPL 4QY8B 3TBVB 4M9PA 4Q7DA 3CDCA 1QKZL 4CGTA 4O02L 4BFIA 3FT4B 4AIOA 2GHWB 2NTSP 4G6MH 2JCCF 1PYWB 5EU3A 3EDKA 3QA3B 1MCKA 4KPHH 2IADA 2ICWI 1JF5A 2APFA 3GK8H 2GK0B 1AP2A 1WZ1L 4K07A 4XVUD 3CMOL 4X4XA 2ZG1A 5KSBE 4WFED 5FYLL 4KZDH 1MJJA 3KLDA 1WTLA 3LV3B 2XT1B 1F4AA 4OZHE 1F58H 1TTUA 4MJ6A 5KSBF 4HQQL 2VDQH 4ZUSB 3T4AA 3MROB 1BFTA 4GKSB 3HNSL 1P4BL 3WJLA 4JFYA 4U1NB 4Y5VA 3O41B 1YQVH 3KJ4B 1I3GH 4HT1H 3T3PE 4PJIF 5EOTA 1AGEA 2R2HA 5DEGA 1NFDE 3T3PF 1W8NA 5D2NE 5HYJD 2VISB 5AEAA 4P2QD 1X5JA 3GSWB 5F9OL 1NFDF 1EH9A 4OM0L 3IDXL 1MLCB 4PJ5D 1KTDB 5GQBA 3VRLE 2VDLH 4B53A 4S1QH 3IAPA 2HAZA 4I18C 4WW1B 3RIAK 3SKNB 2PYFB 2R69H 1C7SA 5E8EA 2VLMD 3VRLF 1MIMH 3QQ4A 4U1MB 1I8MB 4MD5B 1R3JB 2J2ZA 1Z2KA 4S1SL 1OSPH 2V6HA 3BKJH 4JLRB 3QG6B 4TUJA 3LKNA 1J0JA 5CEYA 2X4PB 5IVZA 1DANT 3BIKB 3IKKA 4HKXB 4HKZB 2BXZA 3GSUB 5EZLA 3RAJL 2DICA 3FB7B 5C7XL 4YPGB 4Y19A 1I8KA 1W72A 3G9AB 2DQJH 2W0FA 1DQJB 4HEPG 5AAMA 4RZCA 1T1YB 4HDIB 4PB0H 1RJLB 1OAKL 4H26B 4N1HB 3C6LA 4HC1H 3WLBB 3MXWH 1A1NA 4ESKA 4FQQA 1D5BA 4UUJB 1KJMB 2OS7A 4L4VA 5A2FA 4K3JL 3MLVL 5C0CD 4ZQKA 4G5ZL 3BN9D 4H0GA 4PGDA 2WW8A 4GBXB 3UTSE 3PGDA 1D3CA 3BSZH 3T3ME 4OIAA 3BKYH 4N9GB 4NP4L 4MHHI 4BH7B 2GITA 1I3RB 3B6SB 1RUQH 2OZ4L 4OQ1A 1WFTA 5JQ6L 5I19H 1F3JB 3T3MF 3CK0H 5CKAA 1VPOH 3PWLA 3NIFE 3SQOH 2J5LB 1UH2A 1YEKH 3H3PL 4X4ZA 1VFUA 2L4OA 3BEVB 3VFVA 4N5EC 2C1PA 2PO6B 4HIIB 3NIFF 1OPGL 3FCTA 4XBPB 4WV1A 2KDGA 4YR6A 4EXKA 5T1DL 5DJ6B 5F7UA 2P7TA 3G5VB 4Y5XC 4PJGA 5DWUH 1G9NC 3HPLA 1NC4D 2ZZUT 1OQXA 3BW9B 3HZYA 3RY6C 5DC4B 5GS1C 1IGCH 1JNLL 2X89D 3DX6A 1ZWIB 2BMKB 2HVJB 3IXTA 3PQYE 4PIRF 3WE6B 5D8JL 1GL4B 4JFFA 2IAMD 2F15A 1OTTD 1LP9E 4XPBH 3QDMD 4AIZB 1ZHKA 4WWKA 4UU9B 4L8SC 1MUJA 3IETB 5FUOH 3UJTH 1LP9F 3IGAB 3OKOA 1YN6A 1DVFD 1GGTA 5SV3A 1FQ9C 4Z77B 4JKWA 4XPHH 4FTVA 2PETA 2EDWA 2JIXA 5E95B 3HUJA 3ARDA 3REVB 3IRZA 3R06A 3KXFA 3UJIH 3PWUB 4XXCA 1U8OA 3HMWL 3V52H 4MJ5B 4EXPX 3ZYOA 3U30C 1LHZA 2AK4A 3O6KH 1X6LA 2J7LA 1AJ7L 2C3GA 5ISZA 4K8RH 2HA1A 3VXSA 2J8UB 4FQ2L 5D7LE 1FRGH 5FGSA 3B5HA 4JKPH 4PB9L 2JELH 4LCUA 2C4XA 2AJVL 5C0BB 4KAQL 4Q9QL 3IU3A 4V1DE 1WK0A 1KGCD 1RZJH 1ZOXA 2MCPH 5HYFA 1IGFL 4EEEA 4YWGH 2FIRT 2H1PL 4GQPH 5KVDH 4LLWB 3QHFL 3VG0H 1YNLH 1U8IB 1BZ7B 3D25A 4DVRL 4OF0A 1BF2A 1KLGB 2KPNA 2X4RA 4NQVA 1U58B 3DTXA 3NH7L 1KCUH 2E7LC 5INCB 4NO3B 5EZJB 3GMQA 1YMHA 4AMKL 5F7NC 4YHYC 2Y36H 5T3XD 1MY7A 3LB6C 4FHBD 2R8SH 4XGZA 4Y5YA 1NGPH 1BFSA 2ICEA 2NMSA 5ALCH 2A0LC 5JNYA 1J0YA 5FO9A 1S7QB 1GH7A 3INUH 3QUMB 1N5YH 5EO9B 3MJ8A 5AZ2L 3WLWD 4S2SB 3L3HB 1WF5A 5FF6B 3VCLB 2N1KA 4AEIL 1X5AA 3CH1B 2NY2B 4KK5C 5CSZA 3RHWK 2OL3L 1NFIA 1ORSA 2NXYD 3MA9H 3QQ9D 5KSUA 3QRGL 3TO2B 1KPVB 2B4CC 1MFDL 4MAYA 1GGIH 5DRNA 2VDKH 1IT9L 3DWTA 1FG2A 5TFSH 1J8HA 4H25A 1QP1A 2PYED 2VAAA 3BPLC 4UTBH 4HIEB 2CO7B 3QIUB 4NDMA 4NQCD 5KSVA 3CFBA 1KIQB 1H0DB 1KJ3H 3FAXA 1U93B 3ARGB 5C0EB 4PJ7A 5DRWA 1HHKB 3VMPA 1T6WA 4OQTA 2XRAH 1IC4H 1N2RA 3J8F7 2IH1B 3KYKH 2F53D 1NBYA 4OGYL 5A2KH 4UOW0 3MLPA 1T5XA 4LF3B 3NGBC 1P6AB 1EGJL 3WJJA 4ZO7A 1UYWH 2FLBT 3HS0B 1EA9C 3ULUH 2C26A 5EZIH 1MCWW 1RUMH 2VJXA 4R2GB 1EIBA 1M4KA 1HKFA 5L8KB 2J4WL 4QRRE 1LO4L 5EA0H 3VFUB 4IRJC 1XR9B 5BV7L 3T8XB 4WCYH 5KSBA 2AXGB 2GJZA 1DTUA 4NCC2 4LRIA 1LNUB 1A9EB 4OZHA 3WNMA 2QSCH 2F9BT 2W0KA 1X44A 5BRZD 3UAJD 3V0WH 5IQ9B 3MNVB 3GRWH 1JK8A 1VB9A 2DQEH 3V6OE 5D1QD 5B8CA 4LVEA 3O2VL 3W82A 1TTGA 1CU4H 5F72S 3HAEB 3P0YL 1WBYA 2NW3B 3OTTA 4ERSL 3IXAB 2DM4A 1F8TL 1HYSD 2CUMA 1OY3B 4X7FC 5J6GA 2HWZH 5IG7A 1UWXK 1T1WA 3LKSB 5C0DA 4G7YH 5DVKA 1VFAA 2FIKB 2WWKT 1NFDA 1UZ8B 5D2NA 3OKYA 3WUWG 3TZVB 4JRYE 4E41B 3SE9L 1HXYA 4WGWB 2CKNA 3V5KB 4EVNA 5KS9F 4JREC 1FNGA 1S7UB 4MXVE 1MCBA 2ADGA 1G7JA 5FKAB 4PGJA 1UXWB 1CICB 5F8QC 4OLVH 3DVIA 2BSRB 3A6BL 4IIQB 2V2WA 3D39B 4NQDB 4BSVB 4XXDB 3BP4B 3TBSA 2VR4A 1MQKH 3RWEA 4AIXA 4GO6B 3MJ7A 3VJ6B 1IKFH 5BOZG 2WBJB 1VGKA 4WENB 3SCMD 2WK2A 3VWJB 2PUQT 5BXFA 1MFBH 1FL5A 1PDKA 4OCLC 2RHEA 1D5MA 2AQ1A 2YPLB 3OAZK 4M43L 4BSJA 4QCIA 3ULUE 2G75B 2HYMA 4OIBA 4X6CE 3OKEA 3MRHB 5K9OA 2W07A 3ULUF 3GIVB 3Q3GB 4HBCL 3U2SB 2AP2A 1A7QH 4X6CF 4R90H 3DETC 2VR9A 1SM3H 4JKMA 1UWEL 1ADQL 2HKHH 2NY4C 4BFIB 4XRCA 2EDJA 1L9MA 2PR4H 4Y4HC 4RIRA 4JO3H 4YEEA 5KAQF 5EU3B 1MRCL 2IADB 4OLWH 1WWBX 1AP2B 2R1XA 5IVOA 4X4XB 1UJ3A 3DI2B 1MJJB 2VB5A 5E2VL 3FRPA 4LU5H 5TPWH 5JORA 1BVKA 3SBWC 4MJ6B 1CLYL 4RCAA 3UTSA 3QZWG 3NA4A 3BAEH 1K3ZA 4HMDA 3T4AB 5I1GH 3WD5H 4WHYG 4PLOB 3D5OF 4YDKH 3N85L 3QEGH 2DMKA 2ZCKL 4QOKE 5B21A 3HG1D 4QWWC 3STBA 4JFYB 3ZYZA 4Y5VB 2YC1A 3RVWD 3O6ML 5EOTB 1KB9K 2NY6C 1AGEB 2XKNA 3ARED 5DA0B 4NIKB 2R2HB 1R5IA 5D9SA 5D1ZA 5DEGB 1OAQL 4Y4FA 1ZEAL 4PG9A 5JW4N 3PGCA 1INDL 3ARBC 1BZ9A 3DGCR 5KTEL 4MA1C 1UB5A 4JAMA 3BRGC 4PP1D 5F97E 3PQYA 3QUZC 3IDYB 1C8PA 3TYFA 3EYSL 2P5WD 5E8EB 1FGNL 2YK1H 3BFOA 1LP9A 1GGCL 3BVNA 3QQ4B 3DPBA 1MWAL 2WUCH 3PHOA 5DJ2A 5K59E 5HBBA 4N0FA 5B38A 3BKMH 5GSVA 3TYGL 4YDIH 4KROD 4V2CB 5K59F 1KPRA 3D69A 3LKNB 3FL7A 5CEYB 5IVZB 1ZGLM 3O0RH 5F1OB 4PRNA 3CFCL 5EZLB 2V7HA 4LSUL 3BP7A 4Y19B 5TF0A 1I8KB 5DVLA 1W72B 3AFLA 4CW1A 5SWZE 5D7LA 2W0FB 4WFEE 4RZCB 2D4DA 4HGMA 3ZTJG 4V1DA 1LQSR 6FABH 3C6LB 3WNKA 2KL6A 4L1DA 1A1NB 5BVJA 3BKCL 4ODWA 4FQQB 1D5BB 3LN5A 1AI1H 4LFHG 4L4VB 5J3HD 4ZQKB 4ODTH 3EIFA 5E94A 5EOCJ 1RZFH 4PGDB 3LPGA 3PGDB 1CIUA 2ZUXA 5I1JH 4M6NL 2GITB 3T0AA 3UBXA 4KHXL 2NY0D 3HZKA 3PWLB 3HFMH 2HT3D 1CF8H 5E99L 5C09E 4OD1L 4PJ5E 3VFVB 4Q74A 2C1PB 1CVRA 2YWZA 1CXIA 4ZS7H 3ULVL 2P43B 3FCTB 4C56E 4WV1B 1FDLH 4YR6B 4L8DA 2P7TB 1OHQA 1WQVT 4DN3L 1F2QA 2R0LH 1I7UA 4PJGB 3HPLB 4YO0A 4Y8AA 2AJXH 4OZ4B 2RFXA 3HZYB 1SYVA 2JJSC 2DKMA 4Y4KA 3DX6B 2I5YH 4FFVC 1SHMA 4H8WL 3IXTB 4L9LA 4CKVX 1L4IA 1IJ9A 5I8EA 4MYWB 4Y2DC 1NGZA 1DEEA 4JFFB 1DQTA 4DTGH 3QG7H 4RMQA 3NABH 3T0EE 4H1LG 1ZHKB 4WWKB 3K3QA 1MUJB 2JKXA 3OKOB 4XWGL 2VN7A 4UDUA 1YN6B 1MFNA 2Z9TA 4YDJA 4YK4C 5EU6D 1MCSA 1YA5A 3W5NA 4P4KA 4DEPB 1CFTA 1JPFA 4P9HL 4GG8A 3GJEA 3FAWA 4FTVB 4L4JA 5ADPH 2XI9A 2LAAA 1NMBL 2JIXB 3HUJB 5ITFA 3ARDB 1KV3A 3FZUD 3R06B 3STLA 3KXFB 4J3WA 1YEHL 1U8OB 4LAQH 2D0HA 4PD4J 2EDBA 2AK4B 2OX5A 1H3VA 2R56H 1R5VA 3ALPA 3VI3E 5ISZB 4FRWA 2YRLA 3MPCA 2WLYA 3VXSB 1U6AL 5AD0A 1S7WA 4LCUB 3VI3F 5F7EH 3DUUA 3IU3B 4XP1L 4NN5C 1H3PL 4QRRA 3UMTA 5GGRY 1S9XA 1KJVA 4RRPG 3RA7H 1ZHLA 4YIQA 4R0LC 4LLYA 5F96H 5C07E 1YNTA 3LEYL 2YPKA 3HI6H 3QNYA 4NN7C 3D25B 3EZ8A 1KFAH 3KDMA 3V6OA 3DURA 2YXMA 2X4RB 2W92A 4NQVB 2DQHL 3DTXB 4XZUA 2E9JA 5IR1A 2W1NA 4NZJA 2P4AB 3JXAA 3GMQB 1YMHB 1HKLH 5J56B 4S10A 3WMSA 2DKUA 5LGJA 4PJ8C 4LRNH 3P9LA 4XGZB 4Y5YB 3S37X 4KXZH 2ICEB 4ONGL 2QQKL 5T3XH 5JNYB 2C3XA 5FO9B 4Z7UE 4OLUH 2AABH 5LGHH 4OLZL 3UYRH 1CGUA 3LQZA 3VFWA 2IQAA 2D03L 3BGFB 3MJ8B 4JRYA 2C3VA 4Z7UF 2C1OA 2ZUSA 3LY6A 4K2UH 5EC2A 1PG7X 1ZANL 3A67L 4DW2L 5EO1A 4M1DL 1CXEA 3QDME 4CRPA 3SE4C 2VUOA 5CSZB 2DI9A 4KY1H 1NFIB 4LHUD 3WHE1 1ORSB 5KSUB 3TESA 4MAYB 2BFVL 1MFEH 5DRNB 4G6KL 1Q0XH 3I3DA 1S7RA 5CJXA 1FG2B 1J8HB 3MRKA 4H25B 4C4KT 5B4MD 5CMAA 3G04A 4LSPH 3TA3A 4KK8D 2QR0A 2AQ3A 4ZAKA 4PY7A 3SKOA 2VAAB 3SE3A 3B4NA 4NDMB 1XIWA 4LHJB 5KSVB 2R4RL 3CFBB 3RUGE 5CCKL 5LCVH 1B4JL 4RGND 1KN4L 1JGVL 3SDAA 2EXWC 4PJ7B 5F6IB 1I1AC 3VFOA 4X6CA 2ITCA 3LOWA 5DRWB 5E8OA 5I75C 4HKBA 3EFDH 3N1FC 4JPKL 2XZQH 4MD4A 4EI5A 1N2RB 5CINH 1JTTA 4LIQL 1NBYB 5DMIL 2LTQC 3MYJA 4BZ2H 4KKBC 3BPOB 4PGEA 3VG9C 2UYLA 1T5XB 5HVGB 2NCMA 1IM9A 4WVRA 1P7KA 4JM2B 4XBEH 3GRWA 4J4PC 1WEJL 4LCIL 1M71A 2Y6SD 4HXBH 1RZ7L 4HJJL 1JZ4A 2W65A 1BF8A 4FQXD 5KVGH 1ZK9A 4YHOL 3VW3H 1VACA 4RGOH 3R8BB 5DHVH 3VGHA 2ADFL 1MAML 2WWKO 4X6DE 4DFIA 5KSBB 1YYLH 1VGEH 2GEEA 2GJZB 3PWNA 3WFDL 2D7MA 4OZHB 2I07A 4NBXB 1KUMA 4M7LT 4ZXBA 1KULA 1KB5H 5T3XE 4YHKH 4X6DF 4X8JA 1JK8B 5B8CB 1L7TL 1GAFH 4WU5A 1BLNA 5J1SC 1JGLH 1WBYB 3PGFH 4U3XA 1INQA 4QOKA 3RVUD 3AMLA 3V7MA 4XP6L 4YX2L 5J6GB 2GQHA 3HA0A 5EC1A 5IG7B 1NLDL 1T1WB 4JY5H 5C6TL 5C0DB 5AAWA 1VFAB 4A6YH 1NFDB 2EECA 1HWGB 5F7MC 5D2NB 1ITBB 1QFOA 3SHSA 1HXYB 4EVNB 3UC0H 1FNGB 1IBGH 4LARL 4JHWL 2R0WH 3F65A 3K4DA 3QWRA 2ADGB 3IRPX 1G7JB 2RJMA 2HFTA 4H5SA 1J1OH 2PYEE 3JTTA 3C2AL 3NACL 4NQCE 2V2WB 3GKZA 5F3BA 4RISH 3P11H 3EHBC 5H8DA 5HDQH 3TBSB 3MCLH 3MGAA 2J12B 5DJXA 1Z3GH 3RWEB 2NY7H 3P4OA 3MJ7B 1JF6A 3WS6A 1GHFL 4KVNL 1VGKB 1PFCA 3ARZA 1X5LA 3QCUL 1UENA 5BXFB 4UT9L 4DVBA 1FL5B 2F53E 2FSEA 1FBIL 1D5MB 2AI0H 2QQNH 4JO4H 4QCIB 4D3CL 2VTFA 1MI5D 3OKEB 5K9OB 2OJZH 4TTDC 2MQCA 4LVHC 5DR5H 5CWSA 2HH0H 1NFKA 3LKRA 4XNQA 3GEWB 5FYJU 4MJ2A 5JW4M 3G6JE 4GKOA 4MA8L 3U7WH 3CXDH 5SWZA 2EE9A 2MCG1 4XRCB 4FQ1L 2XA8L 3CFIC 3G6JF 4RIRB 3SO5A 1NH6A 1DQLH 4K3GA 4PPTA 3DHMA 1F6LL 3B8YA 4NKOA 4OCYL 2HVKA 2F58L 3GO1H 3CC5A 2R1XB 3F7VA 2O5YH 2EDTA 1UJ3B 3QXTA 1UCTA 4NWTH 5FO7A 1A6VH 1KLFA 5JORB 4F7MA 1BVKB 1DQML 3PWJA 5C71A 2WWMD 1HNFA 2BNUA 3UTSB 4BFEA 1S9WA 3QH3A 25C8H 4ODVL 3TLRA 4X7DC 4LPXA 2ZOKA 2KH2B 3TVMC 1PG7H 3BI9X 3CSGA 5C09A 3N9GH 3O4LD 3L6FA 4IOFD 4PJ5A 2YC1B 3RGVC 2VLJE 4OKVA 2XKNB 2Q8AL 4C56A 3NTCH 1R5IB 5D9SB 5D1ZB 2UY6A 4Y4FB 4PG9B 3ROLA 3PGCB 1JYNA 4BKLA 4EOWL 3VH8G 4U0QB 2X1QA 1BZ9B 2APBA 1AY1L 3DX8A 1U2HA 3KG5A 3QUYC 1OD7A 1UB5B 2JJWA 1DFBH 4JAMB 1FSKC 1UA6H 2OYPA 5L7XH 3S88L 3PQYB 5GS1A 1JPTH 4LDEB 1I1RA 1NLBH 3TYFB 2Z8WC 4LPYA 5IF0A 1LP9B 3LQAH 3T0EA 1FO0L 4M6AA 3VGAB 1C7TA 3PHOB 3VXMD 5DJ2B 4N0FB 2VMFA 4L1HA 5B38B 1QR4A 2F5BL 5FUCC 3KLHC 3F7PC 5GSVB 3HLAA 2A38A 3BZDA 1GIGL 4FOMA 4Q9RH 5IHBA 3JWDL 3Q6GH 3NCMA 1KPRB 3D69B 3EAKA 2X10A 4MLIA 5E2UH 4EDWL 4KQ3L 1FN4A 2O5ZL 2I27N 4PRNB 4FNLL 4R4BA 2V7HB 2FX7H 1XGTA 3VDAA 1J11A 5EUKA 1MF2H 3BP7B 4KI5C 3I3EA 3D2UD 4CW1B 4OCXL 5D7LB 4AT6A 1T66D 5L2KE 1FNSL 5IJVB 4G42A 5C86A 4V1DB 5D93C 1J1XH 2DLHA 1KB9J 4K71C 3MOQA 1C5CH 1E4XL 5GGRA 3BUTA 3DBXA 5C07A 5BVJB 5JR1H 4ODWB 3LN5B 3PL6D 5I73C 3F62A 3LDBB 3OBAA 3PDOA 5GRZA 1OAUH 5JPNA 5E94B 3MACH 1U3HD 4LSVH 4GSDH 3KGRA 5K93A 1T1ZA 3UBXB 4NZUH 2P46B 3HZKB 4WFHE 4Z7UA 4YHLL 4JGMA 2X89A 5EU5A 3BZFA 1T83C 4L8DB 1V5JA 5DZNA 1HYRC 5DSCA 1I7UB 2IWGA 1RIVL 3QDMA 3VFTA 1NMCB 4YO0B 2RFXB 4DGYL 1SYVB 4GKNA 4Y4KB 3SGJC 2ZUUA 4M8VA 4L9LB 4H20L 2EEBA 5JA8B 1ZT1A 1DVFA 4NQXA 3V2AR 4KJPC 2EDEA 4NQTA 5I8EB 5CGYD 1NGZB 1DEEB 4JHAH 1BQLL 2IPKA 3HNVL 5FECA 4LVOB 3QUXC 4UDUB 4YDJB 1S7SA 4LEXH 4P4KB 2VDOL 5C0NC 1CFTB 1JPFB 4RAUA 3RUGA 4GG8B 4YBQC 1YEFL 2Z4QA 3GJEB 5ITFB 4HGWA 3FB6A 3Q6FA 3JV4A 4UIKH 4HWZA 3STLB 1CE6A 2GY5A 4M7JL 1FAIH 2CRIA 4PJDF 4M5YL 4YC2C 4ZTOH 4F58L 1IZKA 4K55A 4ELMF 1KTLA 4P2OD 1R5VB 3IFOA 2I9TA 3ZSSA 5L88L 3RZCD 2V17L 5AD0B 1S7WB 4GMSL 2AJYH 3S98A 1MJ7L 1PY4A 3DUUB 3U9UA 4QRRB 5IK3A 4JJHA 1S9XB 1OSZA 1BFVH 1KJVB 3A6OA 4GLRH 1ZHLB 4L3AA 4YIQB 4LLYB 4X6DA 1KYOK 1DQDH 4IRJA 1YNTB 3VFGL 2YPKB 4DZBA 3QNYB 1RVFH 3O3BA 3CVHH 3S34H 3KDMB 5JUEL 3DURB 2VABA 2NY3D 4XZUB 5IR1B 1NSNH 5DUMH 5D72L 2YPVH 3GSNL 1YNKL 1CBVH 4X5XA 4J1UA 1PQZA 3UTPD 5LGJB 1WGOA 4HUVA 1GOGA 1JPSH 3P9LB 2CGRL 1ZVSA 4C4KO 3U4AA 3LQZB 3VFWB 2IQAB 1DBBL 4QHKI 5IBUB 4XPAL 5TQ0L 4GMTH 4JRYB 5GGVH 2C3VB 3JTSA 4M1CD 3N1GC 5DZOA 2C1OB 2H3NA 4G43A 5EC2B 1S5HA 2WNGA 4G8IA 5EO1B 1FFRA 3KJ6H 4CVXA 4PS4H 5EWIH 3ARXA 4PRHD 1FAKT 4XVUC 3VRJA 4FQPA 2PYEA 3VRIA 2VSCA 5IBLD 4NQCA 5EU6E 3LD8C 3UTTD 1D9KD 3MLWH 2XOTA 1S7RB 3MOAH 4CU8A 3GGWA 3MXVL 3MRKB 5CMAB 3G04B 1VSCA 3TA3B 2ATPA 2BY0A 3IB4A 1CDIA 2QR0B 4ZAKB 4PY7B 1JFQH 3IJHA 3SKOB 4CVUA 5I1EL 2F53A 1XIWB 1KT2A 1AXIB 5DO2C 2E27L 1T0MA 3SDAB 3VFOB 4PRPD 4X6CB 2ITCB 4XAKE 5E8OB 4HKBB 4JGUA 4KJWC 2FB4L 1AGCA 4MD4B 4XVJH 4EI5B 4YQXH 5DHVA 4KMQA 3BQUC 3MYJB 1G7LA 4AEEA 3G6JA 4OFPA 4PGEB 2UYLB 5E7FA 5BV7C 1IM9B 4HLZG 5DQDL 1KB5A 1ZLSH 4C59B 1P7KB 1LO3H 1H8NA 1LD9A 4KKLD 2DLFL 1M71B 3GMNA 2M26A 5FOJA 1NC2A 1QKZH 4TSCL 2W65B 5E8NA 5D1QA 1BQHA 2CJUH 1EJOH 4JPVL 4ALAH 2BY2A 5BMFL 1VACB 3B9AA 3QJFA 1TETL 3I6LD 4NN6B 3F7RA 3PWNB 1AGFA 5DMKA 2I07B 3OJVC 4ZXBB 4X8JB 2NY5H 1UGNA 4XC1H 2BDNH 1BJMA 4A6YA 4WU5B 5HI3C 1I85A 2GFBA 1BLNB 5DJZA 4JFDD 4OZGE 2CH8A 5F9DC 1INQB 4QOKB 4JZOA 1O7VA 4YNYA 5FIEA 5DFVD 1V3KA 1JWUA 2EZ0C 2ZWLT 2DTML 3VGEA 4OZGF 3SKUD 3ZE0F 2VLJA 1MCFA 4M48L 5MERA 4JFOA 2R15A 5LVEA 1G9EA 3GKWH 4M7KL 2GJ6D 3O9WD 3QXWA 2P44B 4NSKA 4HIHA 5DMYA 3ARBA 3CLFL 5I74B 4EIGB 3HE6A 1Y6NR 2PXYD 1MIEH 3OXRA 4H5SB 1FVCA 2NYYD 4UQ3A 1I3VA 4UMGA 3SCMA 1FZMA 3JTTB 3ARFD 1A7PH 3CAFA 5T1LD 4OM0H 1AD0A 4YXHL 4OLYH 4ETQA 1K6QH 3CU7A 1ZGLA 1CGTA 4WUUD 2BXYA 4XC3L 5F3BB 4FXGA 5E70A 1P5UA 5GS3A 2R0KL 5IIEA 4RGNE 1F2XK 2EE2A 3EYUH 1IQWH 5DJXB 3P4OB 5E8DL 1FH5H 2FX8L 4PGZA 2XKSA 4DVBB 2FSEB 1FV1A 2QKIA 2CMRL 5DLMH 4GAFB 3EO1A 5ICXA 5JOPD 1MHCA 1EV2E 1A6PA 2EDKA 5CWSB 4K7PL 5BW7A 1QBLL 2YD7A 3LKRB 4MCYA 4XNQB 3MRFA 5I1IH 3PIQA 4PRID 1T7WA 2ZG3A 3SDCC 2JJUA 5SWZB 2I25N 3O3DA 4X9IA 5L2KA 5C7XH 2IPTH 2BZDA 1WLHA 3IVKA 1G9MH 5FGBC 3X3FH 4ODBD 1MJUL 4WIQA 2CIKA 3FO9A 4NKOB 2VXSH 2HVKB 3CC5B 3F7VB 3WN5C 3RIAF 2NR6D 3BT2L 5C0AD 4Q0XH 2E3VA 1XF4A 4BFGA 1FGVH 2B1HL 5BCAA 1IE5A 5FO7B 5JIKA 2DYPD 4F7MB 4FQHA 3PWJB 3PF2A 2YWYA 2BNUB 1E4JA 1Q1JH 1FVDA 3RY4A 4KGLA 1JRHH 2DQDH 4F15C 1S9WB 1WAAE 3AREA 3QH3B 5DT1L 4N1CA 1RZKL 4IMLA 4OM1H 4XNZC 4U1GB 3TWCH 1CL7I 2QHLA 2ZOKB 2OI9C 2G2RA 1WAAF 4XHJD 1GRWA 1ZLVH 4K3HA 1KEML 1KOAA 1S5IL 5C09B 2D0GA 2HMIC 3L6FB 1UM5H 1RD6A 2OZ4H 3P4MA 3G6DH 3DIFA 4OKVB 4AYFA 4C56B 1LK3L 1ERNA 3B2UC 3ROLB 4WEMB 1KELL 5KZCD 1TJHL 4BKLB 3ZLQC 4RDQG 3DX8B 4U6TA 3FO2A 1F02I 4OV5A 4K3DH 1G6RL 3DUSA 2IJ0C 5GS1B 1FNFA 1S7VA 2EDDA 1ZLUK 3TCXA 2ZUVA 5IF0B 1S78D 1T3FA 2AQ2A 4Y2DA 3QEUA 4NZDA 5EIVA 2E6PA 3T0EB 1HH9A 4EIZC 1NANH 1B9ZA 2P1YA 1VDGA 1MI5E 1HHGA 4Y16C 3V95A 1JPGA 3VGDA 1URLA 3HLAB 1XT5A 2Y07H 3OGOE 1SJEA 1MCWM 1Z6JT 2ZUTA 1Z0NA 4KDTA 3X12A 1IC7L 4D8PA 1FN4B 5CSBA 1KCRL 4R4BB 2FHFA 4PLKD 4Z0BH 2D9QB 1XGTB 5EUKB 4CJ1A 1OWRM 2WIIA 2Q3ZA 4AT6B 1HIML 1QFWM 4G42B 2EIEA 4P23C 2D7PA 2BVEA 5GRUL 4R4ND 4S1RH 4UT7H 4HWEH 1F6AA 3BGMA 3C9NA 5GGRB 3DBXB 3FFCE 5C07B 3OPZH 3ZKNC 4R0LA 4I3RL 3PDOB 5DS8A 1BWMA 5JPNB 3QIWC 5EBMA 4G6AC 1DL7H 1H5BA 4LQFL 3ULVC 1T1ZB 1ES0A 3HB3D 3G5XA 3SDYL 3Q1SH 4YHYB 3ESUF 5JHLL 2NXZD 3KYMA 3QDAA 3BIAX 3RWHA 2P8PA 3WIIL 3I6KA 4Z7UB 1JYVA 3UYPA 5EU5B 4H8WC 2ICES 3BZFB 3AM8A 4IBLT 4QHUA 4NKIL 4JQVA 2EKSA 4HIXL 3GHBH 5DSCB 5IUSA 1L0XA 1MHEA 1QPXA 3THMH 3QDMB 2CDFA 3SOBH 3VFTB 3WFEL 4WWID 4W81A 3WHXA 5FCUH 3DX7A 5T33L 4GKNB 4PJFE 1HOCA 1L6ZA 3GI9L 1TZGH 1ZT1B 1DVFB 4NQXB 5EU6A 5IT2H 1BAFL 2NY1B 4P9HC 4DQOL 1QHOA 5CJ5A 3AGVA 4KU1A 4B0MM 2IPKB 2VUYA 5FECB 2R9HC 1SY6H 3S9DB 2CLZA 1RPQA 4PP2A 2VXVL 2V2TA 1IT9H 3O8XC 1S7SB 3NCJH 3BPLB 4X9FA 5FM5O 5HJ3A 4RAUB 4XVSH 3RUGB 2HKFH 2Y06H 4M61A 1HZHL 1KXTB 2Z4QB 4GBXD 1NCAH 4WFGD 3MUGA 5KVEL 2JE8A 2IGFH 4JO1H 2CPCA 4HGWB 2D7QA 4IDJH 3FB6B 3Q6FB 3JV4B 5IB2A 1I1AA 4HWZB 1CE6B 3W11C 3KYNA 3N50A 4XH2A 4O58H 2BVOA 3VE0A 3VXTA 4UTAH 1J8KA 3OX8A 1KTLB 5JOFA 3IFOB 4ZFOL 2I9TB 4JB9L 2HLAA 3HAEG 3CVHA 2BVQA 1VFMA 2PO6D 2I60H 1JNJA 1P4IH 5I8KH 3QAZB 1DUYA 4Q9CA 3IAGC 1HSAA 1NAML 2EH7L 2JLLA 4J4PA 3RHWF 3U9UB 1B0WA 5JXAL 3K2UH 5B39A 1FZOA 5IK3B 1OSZB 2P49B 1WFUA 4ODHH 4X6DB 2DDQH 4IRJB 3GSOA 4DZBB 5HHNA 3O3BB 4AEFA 1QYGL 1YYMH 2NZ9C 1RJCA 2QTEA 4PG2C 2VABB 1E4WH 3TO4D 4EQ3A 4OZGA 1FNEA 1ZTXL 2XY2A 4G7VL 2FEEL 3V9FA 4X5XB 5GHWH 4J1UB 1C1EH 1PQZB 1MFAL 15C8H 2QQLL 2YS4A 1A7BA 4NM8L 3O2WL 4HUVB 3ZKQD 1V05A 1EZVY 2CKBH 2NNAA 2P48B 1HHHA 3P0GB 1ZVSB 5EU7E 1EERB 4LHUA 3DV4A 3MLRH 3OAZH 5D7JC 3RVVC 1F00I 2VWEC 1J86A 2A6IA 3Q5OA 1CE1H 3C09C 3JTSB 2H3NB 4G43B 3JBG7 1S5HB 5EB9A 4G8IB 3MUY1 5I76A 1KBGL 4JREB 1Z9SA 1OTSD 3DNKA 3EYOA 5GISH 4CVXB 1TCRA 5ICZA 2ORBH 3VRJB 1T7VA 2PYEB 3VRIB 1YECH 1C5DA 3E8UH 4FFZL 1SYSA 4NQCB 3OAYK 4WO4D 1MCDA 1FFQA 2YKLL 3S35X 4YBHA 5E4IA 3GGWB 1IFHL 4HPYH 2ATPB 1MLBA 3IJHB 2XQYK 2F53B 4U6YA 1NKOA 1KT2B 4OB5L 1LDPL 3F58H 4XT1C 4NKDA 1T0MB 1SMAA 3F7YA 4NHCH 3MBXH 4DKFH 3TP4A 3MLUH 1OT2A 2XTJC 4GAJL 3V6BR 1BD2D 1AGCB 1KCKA 1IAIH 1PSKH 4TSBL 3KVQA 5DHVB 2GUOA 5IBTH 1UKQA 1E27A 1G7LB 3LN4A 3G6JB 2MMXA 2HRPL 1YPZA 4N8CL 1KB5B 4HBCH 4LCWE 1LD9B 3BYTA 3SEPA 3MO1A 2NY4B 3MRIA 3GMNB 3E6FA 3GUTA 1PAMA 3FB5A 1NC2B 3U7YH 5DJYA 5E8NB 5D1QB 1BQHB 1Y0LA 1UKTA 3HRPA 4BQ8A 3ZE2F 3QJFB 2Z93A 3WXWH 5J13B 4F8TA 3AS2A 1AGFB 2ZUWA 4G80A 4P99A 5DMKB 5I1HL 4P5TD 1SBBA 1O7SA 1X4YA 4OD2A 4TNVF 1A5FH 1QSFE 2C4FT 1ZLWH 4A6YB 1HN1A 5E2VH 1WAAA 2GFBB 5DJZB 3T04D 2P8LA 4MQXD 4XMKH 3EOYG 4JZOB 1NGQH 2DQFA 4YNYB 5JW5A 3NPSC 1JWUB 1MCQA 1AXTL 4QXGH 1U95A 1B3JA 3T0XA 4JRWA 5F6HI 2VLJB 4HCRL 3KPQA 1ZA3A 1D5XA 4PRHE 3VXUD 3RGVA 1RZGA 1BM3H 5MERB 4JFOB 3GMLA 7CGTA 4GUPA 3UTTE 3SKMA 4NSKB 4HIHB 3IU4L 5IGXH 3ARBB 3I9GH 1NUGA 3HE6B 3BJLA 1BJ8A 3EDDA 1KG0A 3OXRB 3QUYA 1FVCB 32C2A 4UQ3B 3MNWA 1FZMB 3MCG1 3O45A 3V4VH 1AD0B 4NWUL 3VXPA 4ETQB 2W9DL 1ZGLB 4GRMA 4AJ0A 4R2GD 3GBLA 4FXGB 1CFNA 5IIEB 4XP9L 5J9PA 2UWEE 2AJSL 5KG9A 4EN3D 1JBJA 1A4KA 3QR2A 1CDUA 4JN1L 4PRPE 4ZTPH 1MI5A 1EK3A 1NCUA 4PV9A 1M7XA 5L8JB 1EPFA 1P9MC 2BCKA 1FV1B 2QKIB 1DBJH 2APVA 3GI8L 2QHRL 4RWYL 4KRPD 3EO1B 5ICXB 4M3KB 1A6ZA 3GM8A 1MHCB 1AQKH 1FL6A 5ENWA 4FQJL 1M1SA 1NAKH 2IPUG 3HI5L 4LASH 5IFHH 4MCYB 2LVEA 4MCZA 1EMTL 3MRFB 4N90E 3PIQB 3WO4B 1QFWH 3I6LE 3O3DB 4POYA 5L2KB 4OJFL 2VR5A 1JMZA 1RV6X 5T5FH 4FA8A 1H9VA 3IVKB 3TZVD 3UXFA 4QHLA 3CZJA 2HRLA 2CIKB 3FO9B 5TE6H 3V4PL 1NEZA 3HC3L 5JA9A 1AH1A 3FFCA 4URTB 4ZOBA 4GKZA 5IROA 2CUIA 5JDJA 1XF4B 1RSFA 3BE1L 4KWUA 1CICD 3EJJX 2OZ4A 4FQHB 4LSQH 4AG4H 3D39D 2W9EH 1CZ8H 4NQDD 1FVDB 1KENH 1EDQA 4FP8L 3B2VH 3W9EA 3AREB 2H2PC 5DGQA 5EORH 2E8YA 4OFYA 4IMLB 4LMQE 1WC7A 3FZUC 1I7RA 2G2RB 4JZJA 5DMGC 3VWJD 5CJQL 1FZKA 1T0NA 1UT9A 3P4MB 3IFLL 1MVFA 3DIFB 2EIZA 2VDNH 5DTFA 5B22A 5HD8D 1PEWA 1RURH 5D7IE 1T83A 5FYJL 1MCPH 3S35H 3FO2B 4OV5B 3HCVA 5D7IF 3DUSB 4JZNA 4E9LA 4PJFA 3HR6A 4MA3A 2ZSWA 1WFNA 1S7VB 5ADOH 3WFCH 4KMTH 4KROB 3E3QC 3JWDC 2YXFA 3HRZA 1T3FB 1F13A 3TT3H 4Y2DB 3S4SA 2BRRL 3QEUB 1CR9H 1HH9B 5ITBH 4MDIA 5JOPE 3OB0K 4NNPL 4LDOB 3DRTA 1HHGB 3QHZL 1JPGB 2H8PA 3GMMA 2QQQA 3DOSA 3S36X 4K94H 1SJEB 5A3IC 2IFGA 1PKOA 2X44D 2E9BA 1GPOL 4YLQT 1IGMH 3D2UA 3C5JA 4PRIE 5I1KL 3V5HA 1DANU 4I0CC 5IMOA 2MTPA 1U8JA 5GXBB 4OCWH 3X12B 3LVEA 4P9HH 3RNKA 5D7KD 2MOVA 3F6IA 3QYCA 2VQTA 4D8PB 4XP5L 3FQUA 2IMMA 4KK9C 2X6MA 2HFGH 4MMZC 1A6WL 3ARTA 3ARSA 2BOBA 2YMXL 3SGDI 2WIIB 3NOIA 3PL6A 4B41A 4N0UE 2DB8A 1U6AH 1U3HA 4XP4H 1F6AB 3BGMB 3C9NB 4H0IA 4C57C 3BX7C 4R0LB 4ZD3L 4KK8C 1MRDL 2X4UA 3NIGE 2IQ9L 2NY0B 5DS8B 4X4YA 4XTRC 4LSRL 1RFDL 3NIGF 5EBMB 4X6EB 1H5BB 1DN0A 1WITA 1GVIA 1ES0B 2ADJA 4NHUA 4WTXA 2DD8L 1ODAA 3G5XB 4BM7A 4OIIH 2E9IA 5JXED 3KYMB 3RWHB 5CBAA 2P8PB 3MRQA 3I6KB 3U46A 1RUAL 4QHUB 1DE4A 2LQRA 5BVPL 2EKSB 5MEOA 3OAUH 2YOCA 1MHEB 3DSNA 2CDFB 1SY6A 4I9WD 3DO3A 2BVPA 3WHXB 3DX7B 4Y19D 1CLOH 2OR9H 3MR9A 4M1DH 1HOCB 1Q9KA 4NOBA 5EU6B 1MJ8H 2BC4A 4I2XE 3R8QA 3V8CA 2F19H 4QYOA 5C2BL 3QCVH 5C0FA 1OP9A 3SE8H 4PJHE 3C6LD 4CADA 1H15A 2X4OA 2YRZA 4ZFGL 5F9WC 1QBMH 2A2QT 4QRTA 4FN0A 4BK5A 2CLZB 4PP2B 4PJHF 2V2TB 4U1LA 3QPQD 4U7KA 5HJ3B 4QO1A 5EZOH 3MLSH 5DUPH 4M61B 4P2OA 2XTLA 3CU1A 4PJ9C 3ZL4H 2A6KA 3MUGB 5I15H 1UWGH 1QLEL 1A1MA 1AE6L 1KC5L 5EO0A 3RZCA 1EX0A 5IHUL 5IB2B 1I1AB 5I75B 3KYNB 5I9QB 4XH2B 2BVOB 4HWBH 3VE0B 3VXTB 4KRLB 3OX8B 4A2LA 5DUBB 1KIRA 4D0BA 5JOFB 4JPKH 2LTQB 2HLAB 3JSSA 4LCWA 3CVHB 3VG9B 1S8DA 2BVQB 2ZSVA 3GSQA 2ICCA 2QSTA 3DHJA 1DUYB 4GAYA 1HSAB 3CLEH 2Q6WA 2WQ8A 5B39B 4WTZA 1FZOB 2EH8H 2DBJA 5CILL 1YJDH 1HDMA 4HH8A 4RFOH 2Q8BH 5EUOE 3SDDD 2CKBA 3GSOB 3IDGA 4F57L 2IFFL 2GT9A 2EXYC 4HX1A 5GRJH 5HHNB 2ADFH 1QSFA 1RK0A 1CGVA 2NW2A 1I7TA 2V5RA 1K3IA 4OZGB 4P59L 5I6XB 3S5LA 2K7QA 1FNEB 3MGOA 4J3SA 3NZHL 4LOUD 1SBSL 4POZD 3TV3L 4UT6H 3U1SL 2NNAB 4B7IA 1HHHB 4LMQI 4FTVD 4LHUB 1EBPA 4PRHA 3DV4B 5DFTA 1D6VL 3QWQB 1AFVL 2JIXD 5GZNC 3ARDD 4ENED 2BNRD 1NLDH 2A6IB 5KOMC 3UTTA 1NUNB 1D9KA 3KPNA 2A77H 5I76B 3BD3A 1Q8MA 3EYOB 1TCRB 5ICZB 2BSED 5ACLA 5JO5A 4LARH 4JHWH 1ETZA 3VXSD 4DAGL 1G7PA 1C5DB 1OAZL 3KPPA 3DRQA 3S36H 1SYSB 1O5DT 3LCYA 3W81A 1XGYL 2HT2D 1MNUH 4HK3N 1KCVH 1K85A 1A7RL 1Q72H 1QFUH 4RGNB 1C08A 1U92A 2UWEA 4OFDA 1NBVH 4PRPA 1JHLL 2BHUA 2WAHA 1MLBB 1CG9A 4XPTL 2RCSL 4HUWA 4ZO9A 3WFBL 2UZIL 1GC1L 4U6YB 1SJHA 4XPFH 1JI2A 5I8CA 4TSAH 4LIQE 4NKDB 3B9KC 3L3KA 3F7YB 5GSRA 3CUPA 5DVMA 4ZS6D 3M8OH 1JHKH 3H3BC 5GGQH 4X80L 3FRPG 4KXZI 2QV2A 4S1DC 3ZKXC 5H35A 2GUOB 2WBWB 4LBEA 35C8H 4MS8C 1E27B 1DBAH 3LN4B 5FK9A 3MNZA 1YPZB 1TMCB 3UPRA 3S6CA 3MO1B 1MHPL 3MRIB 5HGGS 4MA8H 3E6FB 3GUTB 3FB5B 1UACL 1XGRA 5DJDA 3TJHC 3IAQA 3FN3A 5DJYB 4G6JH 5FGBA 5IP4A 2F8VA 5GGTH 1Y0LB 3I2CH 4X7CC 1V7NL 2Z93B 1MFCH 1PBYA 4HJ0C 4HAGA 4OF5A 3LQMA 3VGFA 4G80B 5CZXC 3BYYA 4OD2B 1E4KC 4MQTB 3SGEI 3OZ9H 1OTUC 4OCRL 5E2JA 2P8LB 3VGBA 1DQMH 1J8HD 2ZG2A 1U3ZA 5F70A 2DQFB 2CQVA 3O9WA 4K9EL 5JW5B 1SMOA 2DQUH 3U6RA 1U95B 1N6UA 4KK6D 2PXYA 1U8HB 5L6YL 4YHZL 3KPQB 1ZA3B 4YXLL 1D5XB 3EYQD 3RGVB 1RZGB 3WXVL 3ARFA 5B38G 1I9IH 5D7IA 5T1LA 3GMLB 5D4QA 4GUPB 4CDGC 3SKMB 1YEGH 3FMGH 5BS0D 3MLXL 2GI7A 1KG0B 4WRLA 3QUYB 3NBNA 2GKIA 32C2B 3MNWB 1KXQE 4M4RA 5AYUH 1M6OA 4JM2D 1FSKB 3O6FC 3O45B 1T22B 3VXPB 2X4QA 4XCCL 5DD0L 2JB6A 4GRMB 3IJSA 4XX1E 1KNOA 1G6VK 2XZZA 1CFNB 1ZA6A 3W0WD 5J9PB 5I30H 5KG9B 4G8EA 1VCAA 1A4KB 4YFDB 3EOTH 1MI5B 1CD0A 1X9QA 4PV9B 4NNYA 2CXKA 1BD2E 1ACZA 2BCKB 1JZ6A 1JCKA 5KW9H 3SGKC 1F4WH 1CTOA 1OARL 4FXLA 4WHYH 1A6ZB 1INEL 4MNGE 1CFVL 3ZYIA 5E9DE 1QO3A 1YDPA 4OI7A 1E6JH 1FL6B 5ENWB 3KR3L 1YY9C 4I3SL 3UTOA 1RIHH 2D9CA 4LP5A 2FRGP 5MEPA 3U9PL 4MCZB 3AS3A 2HLFD 4Z8FL 1A1OA 2XYCA 3BUYA 4XWOD 3BEWA 1M7IA 3DMMD 4I4WA 1XGPA 3UBXG 4N0UA 4N0YL 2FZ3A 4QHLB 3PP4L 1CDCA 4N0CD 5D93B 2XQBL 4X5LA 2QLVB 1WWAX 1NEZB 3FFCB 3X13A 4GKZB 3IJYA 1RZKC 3S3JA 1UQSA 1W72L 2O5XH 2FD6H 2WUBL 3RWIA 2B8OT 1U3YA 5D1XC 5E08L 5DA4A 4HF5L 2ZKHH 3O81A 3W9EB 4RBPH 3VXUE 1NCDH 2VXQH 2BJMH 3H3KA 2JJTA 4NO5A 4IMKA 1OCWL 1WC7B 1I7RB 4JZJB 4HGKC 3DVGA 5TDOA 4JM4L 3MSPA 1FZKB 1T0NB 2UV3A 2VDRH 2EIZB 3T09A 4OZFH 5ACMA 3GSRA 1N7ML 5DTFB 1N6QL 3B9VA 3VI4E 2VERN 5FHAL 4IS6A 5I71B 3NVQA 4U6HA 3LKOA 5GJTH 4W4OA 5IMMA 2PNDA 4JRXD 3HCVB 4OSUL 4KTDH 3TH3T 1T03L 2CDGA 3WSQH 4JZNB 4PJFB 4P46D 1J88A 3NFSH 3OR6A 3RU8L 4KZEL 4MA3B 1EAPA 1RIVH 2ZSWB 1QR1A 4F37K 3L1OH 4I2XA 3GSVA 1NL0L 1B0RA 1I1YA 1LEKA 3HRZB 2A83A 4PJHA 5DK2A 3S4SB 1OB1A 4H20H 1A0QL 1QG3A 4HFUL 1T2QH 2CDEA 4TRPL 1IAMA 3O3AA 5I66A 4MDIB 3DRTB 4JFQA 3P73A 3GMMB 4WW2C 1RIUL 5D7SH 3MLZH 3O8XA 5EOCH 1UZ6F 3VXQA 5LGKA 3D2UB 4WFFE 3C5JB 3V5HB 4MXWL 4E0RA 5IMOB 1NCCH 4MAUH 1U8JB 3RNKB 3HZMA 4CNIA 4NJ9H 2B1AL 1JGUL 3FQUB 1O0VA 1J5OL 3O11A 2BOBB 4GS7B 3RPKA 1EXUA 4NM4H 1OAYL 4NNXA 4YDVA 5SWSD 3PL6B 2B0SL 2ZPKH 3RX7A 1IC5H 2YUXA 4M62L 2V17H 5FYKL 4JDTH 1U3HB 1R3IL 2AK1L 3DECA 4WY7H 5EUOA 4QKXB 2DI7A 4K7PX 5IBUG 3GDBA 2X4UB 4UV7L 5DJCA 1JE6A 3T2QA 2W38A 4X4YB 2L7UA 5EFIA 4NQUA 5IQ7H 3K8LA 4PG2A 5K9JH 1DN0B 4CAGA 1J1PH 1IKNA 1YEIH 2ERJC 2VDPH 2R2BA 2ADJB 4NHUB 2YZ1A 3QEQD 3ILQC 1N0XH 5J11B 4ZPVA 2B20A 5F6HJ 3MTRA 3PWPE 5CBAB 1BWWA 3MRQB 4DKDC 3U46B 4APQC 3ARVA 5D7JA 1DE4B 4P2CG 1N3NA 4M6OL 5MEOB 2AXFA 5E5UB 3ORJA 2A73A 1DBBH 2RIKA 3MRRA 4OT1H 2BVPB 3MR9B 1OW0C 5J12C 1Q9KB 3IS1X 1AKJA 2GK2A 3FQXA 2BC4B 2J6EH 2EKJA 4QYOB 3LD8B 4YUEL 1CN4A 1CLZL 1QRND 1TFHA 5C0FB 4FZEH 3HC4L 3O4OC 4CADB 5KAQG 4WUKH 1H15B 2X4OB 4HWBA 4QRTB 5D7KE 5FO8A 1U3JA 4LPUA 4U1LB 2EDNA 4KH2A 4OLXH 1XH3A 3NIDE 2QADC 4ZNCD 4P2OB 3QFJE 4XCEA 2A6KB 5GRVL 5EO0B 3RZCB 1A1MB 4ZFZA 2LVCA 3NIDF 4QXUL 4DWHA 4M7ZC 3GIZL 1H8SA 1T89C 2AGJL 1KIRB 4D0BB 4HPOL 4LCWB 1S8DB 2ZSVB 3GSQB 4NZTH 5I17A 3FKUS 4JPWH 5I1CL 2AJUH 4GAYB 5CJ8A 3TN0D 2IG2H 3C60C 2Q6WB 1CFSA 2X1XR 4DGVH 3IDJA 4FMKA 3TO4A 1BIHA 5E6YA 2FBOJ 4NFBA 4IDLA 1HDMB 5F7FA 3OB8A 4Z95H 2XZAH 2CKBB 3IDGB 4NYLA 1N59A 2YD8A 2GT9B 4HX1B 1HI6A 1QSFB 1NGXA 1RK0B 1OM3L 1RUKL 2NW2B 5TE4H 3UO1H 1I7TB 4FQLL 3S5LB 3MGOB 5F1SA 4EJ1C 3F7QA 4TUKH 3VDBA 1CXFA 3LIZL 4P4KD 2EDRA 2OLDA 4PLJD 1CTNA 3OL2A 1BEYL 1TJGH 4PRHB 4TVPH 5FA3A 4OGAD 3RDTC 4HWUA 3I50L 2HJLA 4GRWH 4WO4A 3UTTB 1D9KB 5K9QG 3KPNB 3L7EA 2KQMA 3RFZC 4XCFH 4JG0H 5F1KC 4LCCA 2E9WA 5TF1L 3F8UB 5JO5B 1ETZB 3ZTNH 2FECL 1G7PB 1ONQA 3KPPB 3DRQB 3HNTH 2DQCL 3U4BH 1A7OL 3O2DH 5E1HB 4M93C 3U4EA 3B8SA 4KFZC 5IV2A 4U1KA 1R3HA 4QRRD 4QNPE 1CXHA 1C08B 1U92B 2UWEB 3QDJD 4PRPB 2WSKA 4O4YL 4NPYA 3E0GA 1BD2A 1ZT4A 4QNPF 2R0KH 1KIUA 1CG9B 4TQEH 5CZKA 4HUWB 3OQ3B 4U6XA 4XHJC 1SJHB 5E8DH 3OJ2C 2HTLD 5I8CB 4KTEL 1JL8A 3BZEA 3L3KB 3WUWA 1F4YH 4FZ8H 2R2EA 4MNGA 5ID0A 5HXMA 5GSRB 5E9DA 3CUPB 4RGMB 5E6IC 1TNNA 3ELAT 1QSZA 5GGTA 2M8XA 2BNQD 3GHEL 4ZUUA 4I0PD 4F9LC 2AEQL 5GS0D 2CIIA 4J6RH 5H35B 4LBEB 5EBWA 3FN0H 2PKDA 4R7DA 3HHRB 4HULB 1V8HA 5FK9B 3ROOA 2DAVA 3MNZB 4TPRH 5FDWA 4F9PA 3FO1A 1Q0YH 2VC2H 3BGAA 2ENSA 1QBLH 2N56A 3RVTC 3UPRB 4G6ML 1QSVA 5GZOC 4P5TA 1NCWH 5TJWK 4JRYD 5KSAD 4KPHL 1XGRB 5DJDB 5TE7H 1E4XI 4NBYB 3GK8L 3OJDA 3GBMH 4Q58C 2XN9E 1BX2A 1CGXA 4RFEA 1DLFL 1DR9A 1TENA 3T0DA 4TVPE 5T5NG 1F3DJ 1P69B 4XB7A 1ZLUH 2OJEA 3VXUA 4GRWE 4F15B 2IBZY 2BOCA 2KQNA 4MXQD 3GMPA 2BNRE 4ZAKD 3O9WB 4GRWF 1U41A 1YQVL 4L9DA 3U6RB 1XIWD 1I3GL 4HT1L 2MPAH 2PXYB 3AROA 4MD0A 2AXHA 2DKSA 7FABH 5CZVL 3KJ4C 3ARFB 4NGHH 4ODSH 5D7IB 5T1LB 4ZYKA 1DLHA 3WIHH 5LAXA 4HD9A 4NUGH 1DZBA 3D9AH 4OQTH 4EN3A 4ZO6A 1VEPA 2VDLL 4S1QL 5JIIA 3CJJA 1UM6H 1M6OB 4KV5E 2R69L 2X4QB 2JB5H 2JB6B 1MIML 3IJSB 1KNOB 5T3ZH 1ZA6B 2XACC 2Z35A 5D5ME 3LEVH 1A9BA 4G8EB 4IRSC 1EUTA 1OSPL 3VFSA 3BKJL 4NNYB 5J06A 1BP3B 3SY0A 4RX4D 4K7PY 1ITCA 1B6DA 4YFLI 2AJZA 4GW5A 4MWFA 1QO3B 1YDPB 1BQUA 4QOKD 5FB8A 5HSFA 3LS4H 5JHDE 4JQIH 1KEGH 1S3KH 2RR3A 4UINH 1RUPL 3E1F1 5MEPB 1IC7H 4DN4H 1A1OB 4JFZL 3BUYB 1LWRA 4JFEE 3BEWB 1AC0A 1TQBB 1M7IB 4PB0L 4I4WB 1XGPB 2AS5M 4N0UB 1KN2H 1MCNA 5GGSA 1WZKA 2FZ3B 4XCNA 4HC1L 1ULVA 3RVXC 1I3UA 4JGJA 1CGSH 4UDTA 3UTZA 1I8LC 3MXWL 4QRSA 3QWRD 4F80A 5C2UB 3X13B 3IJYB 1A7NH 3NA9H 2EEAA 2GCYA 1UQSB 2IF7A 3KLAA 3RWIB 5A2JH 3MRJA 4OZFA 2X1PA 2VXTH 3BSZL 3BKYL 4PRAA 4FABH 4NO5B 4PJ7E 1RUQL 1SEQL 5I19L 5KZCB 3B5GA 3CK0L 3DVGB 3SQOL 1YEKL 5TDOB 4PJ7F 3PWPA 5BS0E 5HYIA 2LV4A 2IEPA 3KPTA 4JFPA 2VDMH 2ATKA 3GSRB 1XF1A 2VLLA 1OQOA 4IS6B 5T3ZE 2OTUA 1JVKA 2ZUQB 3RNQA 1S9KC 4U6HB 3EJYC 3LKOB 5IMMB 4JM2F 4YBLB 3W0WE 3DX9A 3L5IA 2CDGB 3QIBC 4GW4A 5HDBE 1FJ1A 5SWZD 3OR6B 1QR1B 1EAPB 3HN3A 4UOW1 5F71A 4I2XB 4AZ8A 3GSVB 1B0RB 5HDBF 1I1YB 1LEKB 2A83B 4PJHB 5DK2B 1OB1B 3GI9H 5A2LH 2CDEB 4L3ED 4OZHF 5FUOL 4MLSA 3UJTL 3O3AB 5I66B 3MODH 4JFQB 4P9ML 3P73B 1JZ7A 1JRHI 3BO8A 1TJIH 4G8GD 2AV7A 3O8XB 4MJIE 4XPHL 2FGWH 3VXQB 3QFJA 1GGBH 2VXVH 3LS5H 3HE7C 4P57A 5L2JA 4E0RB 2DQTH 4PRDA 3DJ9A 2XA3A 1Q9OA 3HZMB 3UJIL 4CNIB 3V52L 1YZZA 1PGRB 4MGXA 3BD5A 3O6KL 5C92A 1R5WA 3O11B 4K8RL 5C09D 4ZSOE 1EXUB 2KUTA 4NNXB 3D0LA 4YDVB 1I9JH 2VITA 2WP3T 4JKPL 1EFQA 4N5ED 4C56D 3C5SA 1Q94A 1D5IH 1RZJL 2X70A 3ZKMC 2F5AH 2ED7A 2MCPL 4XMLH 3JVGC 4YWGL 5KVDL 5HI4C 1T6VN 5EUOB 3VG0L 4X5WA 3CMGA 4D9RD 5DJCB 3VD5A 5B3NA 1EBAA 2R23A 5SX5H 2NXZB 5JXEA 5EFIB 4EDXA 4J12A 4FMFA 1KCUL 3OAYH 4OCNC 3T0ED 3ZDYE 1QYGH 3FQTA 3PG2A 2R2BB 4F2MA 2Y36L 3ZDYF 4ZPVB 3BDYH 4GQ9H 1I8IA 5ALCL 4JRXE 3TFKC 3INUL 1PKQE 4JY6A 4CU6A 2J6EA 2ICWA 1N5YL 3BXNA 5TDPA 2GSIA 3PV6A 5D7JB 3AUVA 5J6HA 1N3NB 5D6DA 2AXFB 2XZCH 3C09B 2GJJA 2A73B 3MRRB 4G9FD 2EYTB 2NY2C 3MA9L 5IEKA 12E8H 1AKJB 4JDVA 3FQXB 4LLMA 2WMPA 1GGIL 3BIBX 2VDKL 5TFSL 2XWBA 4OI9A 5MP6H 2V5MA 1AD9A 3BPNC 4UTBL 5C07D 3WNOA 5FO8B 1DN2A 2BERA 2HT4C 2J8OA 2QBWA 1SVZA 1XH3B 3UDWC 1KJ3L 5CBEA 1BQHG 2ZJSH 3QIUC 1AIFA 4XCEB 1DQQA 4M6MH 4I0KA 1MEXL 3VMOA 4ZFZB 3ARGC 5SWSE 4OB5H 4LGRB 4X83A 1IC4L 3KYKL 4W4NA 1EHNA 1IGYA 4QTHA 2MNUA 3LB6D 4XNXH 4OZ4A 2VLRE 1UYWL 5DD1H 3SDDA 2A0LD 3ULUL 5EZIL 5I17B 1RUML 4P4RA 3R1GH 5JW4Q 3RWCA 1CFSB 1A3LH 3VFPA 1QRKA 3IDJB 3LN9A 3TO4B 5EA0L 1YEDA 3UJJH 5BJTA 5F7DA 4WCYL 4CVWA 2XN9A 4KK5D 1ZLVK 4NYLB 2X4TA 2QSCL 1N59B 3PNWA 1DCLA 1E6OH 3V0WL 3C5ZC 4R4FH 3QEQE 3GRWL 2DQEL 1HI6B 3FHQA 2NY1D 1NGXB 2NPLX 5DI8A 4DKAA 1JIBA 1CU4L 1E4KA 2Y4SA 5FCSH 1ZT7A 2OMBA 2Z91B 2B2XH 3OKDA 1OGAD 1N4XH 2BNRA 4TYUA 3HPJA 5AWNH 5CEZH 1DBMH 3D85A 2X41A 3CX5K 1S9YA 3MA7A 5HVHB 1LVEA 3T1FA 4G7YL 5FA3B 1RY7B 3O2DA 2Z31C 2HJLB 4BQ6A 4WTWA 3X11A 1DBKH 4WO4B 2R0ZH 5TQ2H 2E6QA 4HCRH 2M1KA 3H42H 3L7EB 1J9CT 1QRNE 4LCCB 4QGTA 2VXUL 1JWMA 4OLVL 5BQ7A 3MV01 4NZRH 1ONQB 4QRUA 4DKEL 1GC1C 4KJQC 4LPTA 3U4EB 2CLVA 4KUZH 5IV2B 2D31A 4IIQC 4U1KB 1MQKL 1R3HB 5D5MA 3HMXH 2DIBA 3CXHJ 1IKFL 3GZKA 4JQXA 5F93C 2X9XA 2WM0A 4NPYB 4IRJD 2FATH 4NUJA 3ZE1E 1MFBL 1BD2B 1ZT4B 2N7BA 2WBJC 1ORQA 4U6XB 4XAWH 4EI6A 5GS2D 4FQIH 3BZEB 3MUJA 3WUWB 3I02A 5CLWA 1KPUA 2K3TA 2R2EB 4MNGB 5ID0B 5E9DB 4HEME 1MCCA 2YUZA 3CSPA 4M1GH 5JHDA 4AEHH 3JWOH 4ZUUB 3V6FA 1A7QL 3T2NH 2CIIB 4R90L 5EBWB 4XVTH 1SM3L 4R7DB 5GS0H 2A9ML 3ROOB 2HKHL 2UZYB 5FDWB 4JFEA 3FO1B 4PLNC 2PR4L 3MYZA 5CJOH 4YEFA 4JO3L 4P5TB 4OLWL 2I24N 3KHOA 2X4NA 3TH4T 3OJDB 2DWDA 4C83A 3VWKA 3P30H 5CEZE 3T0VA 4MX7A 5CGMA 1BX2B 4LU5L 4PGBA 1JGDA 4X6BA 4K9EC 4RFEB 1U8KA 3ZO0A 1LK2A 2J88H 3BAEL 2ARJQ 3O3EA 2AAVA 5D1XA 5I1GL 3WD5L 2OJEB 3VXUB 3OG6B 4YHNA 1TIUA 5M7QA 2APTA 3QEGL 3WIHA 2BOCB 3RWGA 3GMPB 1ZHBA 2DIAA 4M5ZH 4XNYH 1QNZH 4NC1E 3WJLC 1MSPA 3OB0H 5BS0A 4Y5VC 4MD0B 4ZFFA 2OXHA 3WFZA 4JM2A 5CJQH 3Q0HA 2WANA 1EAJA 1OVZA 4ZYKB 1QLRA 1DLHB 2V5SA 5LAXB 3QPXH 4L4TA 3W0WA 4X7EC 3QDJE 4EN3B 2XWJA 1Z9LA 3DETD 4OF7A 5DJAA 5IMLA 1XR8A 3U79A 5L0QB 2NY4D 3KAAA 2UUDK 2YK1L 3IDYC 4I48A 4JE4B 4JANA 1NC2D 2VAJA 3LKQA 3QT2A 4Y4HD 4OCSH 4KRPB 2Z35B 4FFYH 5FHBH 2WUCL 1A9BB 1CK0H 2FX9H 2C5DC 3BKML 1WUNT 3VFSB 1U8NA 2BNQE 2X1OA 3SY0B 4PJCE 4IJ3B 4YDIL 4MJIA 3KNBA 1UH4A 4FFWC 3EZJB 5I18H 2AJZB 4JG1H 3VH8A 4PJCF 4GW5B 5D71L 4JVUA 4MWFB 5C08D 1XF2A 4JHZA 2G9HA 4PGCA 3DMMA 4CUCA 3O0RL 3MJGX 5FB8B 4WI7A 1AHWA 5SX4I 4QWWD 2ZNXA 1BOYA 4ZSOA 1EHLH 1RK1A 4XP5H 3V4UH 2VLJD 8CGTA 4HZAA 3MZTA 2NY6D 4MXVF 2V7NA 3HR5A 2G5BA 2X40A 5GGSB 6FABL 5ESQA 4XCNB 1FPTH 5DXWA 3U83A 3ARBD 4UDTB 3UTZB 3HE6D 3TM6A 1RULH 4QRSB 4PV8A 3C6LC 3RJQB 2OP4H 4X0KA 4AQOA 4TNVK 4JFXA 2VN4A 1AI1L 3SPVA 4Z7VE 2GCYB 3KLAB 2C3WA 4ODTL 4TULH 3QUZD 4EBQH 5CEXA 1RZFL 3TBYA 3MRJB 4OZFB 4Z7VF 4R7NA 4O00A 5I1JL 4PRAB 2FEEI 4R96A 2GTWA 1ZHNA 1BGXH 3HFML 1CF8L 1BJ1J 3W2DH 3PWPB 4JRXA 1N8ZA 1C5BL 1KCSH 1PKQA 4ZS7L 4JFPB 3C87A 4P46A 4KKAC 2ATKB 2DQGL 2E7HA 2VLLB 3K8KA 2Y5EA 1ZKAA 5EOQH 5I0DA 2MQ3A 3H6JA 5L9DH 2OTUB 4WV1C 3UZVB 1A3RH 4NJAH 3RNQB 4RWHA 1CQYA 2AJXL 3CH8A 3DX9B 5HHMD 2I5YL 4GW4B 5C8JA 1FJ1B 5IHLB 3EO9H 5L2KD 3QG7L 3WL9A 3NABL 2P45B 3VA2C 2WP3O 2BHYA 4WWKC 5H37H 4PTUA 2Q87A 3C2SA 1WZLA 3BO8B 1A14H 2AV7B 3DSFL 2HJFA 1FL3A 5ADPL 3QFJB 3TT1H 3MUHL 4P57B 4UILH 5L2JB 4PRDB 5SWSA 1WT5C 3LMJH 4ACPA 1Q9OB 4BZ1H 4LAQL 1NAMA 2R56L 1R5WB 1P4LA 4WFHD 5CAYB 2VLRA 3WKMH 1UFUA 3D0LB 2VITB 4UZGA 1Q9LA 5F7EL 5IWLA 1LO0H 2EE3A 3PABA 1ZLWK 3C5SB 1U8LA 3RWDA 1Q94B 3AAZA 3C60A 1ACYH 2X70B 4YH6A 3RA7L 1K2DA 2R1WA 4LHUG 5F96L 4XI5C 1RHFA 3ARRA 3GNMH 4OUUB 1KXVC 3HI6L 4X5WB 2XG5A 3WUZA 1G9NH 1F4HA 3QEQA 3FO0H 3VFRA 1KFAL 2R23B 4FFVD 3EOBA 3CVIH 4EDXB 5CP7A 4WI8A 4F57H 2FLRT 4Y2DD 3P40A 1IM3A 5KBNC 3FQTB 1HKLL 1I9RH 4F2MB 3WDHA 4S0TD 2EC9T 4X7TA 1FFNA 1BQSA 1I8IB 5T3XL 2Z8SA 3NZHH 1JZ3A 4OLUL 2AABL 5LGHL 1CFBA 2VH5H 3UYRL 4JY6B 4IRZH 4QHMA 2ICWB 3GM0A 3BXNB 5TDPB 4KRNA 2GSIB 3PV6B 5J6HB 4K2UL 1HHJA 5IJVA 3BGFC 3FQRA 4HXAH 1QRNA 1WISA 1PW3A 4DGIH 4KY1L 4L3EE 4R8WH 5IEKB 1MRFL 4BA8A 4WHTA 3QB7C 4JDVB 4LLMB 4F7TB 1YMMD 4G8GE 1MFEL 1Q0XL 3MJ9H 2XWBB 4MAYC 3QEHA 4LSPL 4OGZA 2V9RA 4DCQA 1AD9B 1A7RH 4NFDA 4Z5RA 5LCVL 1GYAA 3UROR 5CBEB 1AIFB 1DQQB 4RMRA 3EFDL 2ED8A 2XZQL 3TN0A 1HCFX 2ZCHH 5CINL 2QL1A 5E6IA 1WIPA 1IGYB 4BZ2L 3ZKSD 4EZMA 3GJFH 4Q6IA 4QTHB 2Y23A 3ZKXB 3CFEA 2OM5A 4PJ8D 3CD4A 4XBEL 2HTKC 3SDDB 3S97C 2FYYA 5FUZH 4D9RE 4HAFA 3WJJC 4HXBL 4P4RB 4DJMA 3RWCB 5J1TC 3VFPB 3VW3L 1YEDB 4RGOL 5BJTB 4OTXH 5F7DB 1YYLL 5MENE 1VGEL 2XN9B 4LNRA 2X4TB 3ZHKA 3PNWB 4XCYA 4F7PA 4YHKL 2VSDA 4YPJA 1V7NH 4LRIC 5FFLA 5HI5C 1GAFL 5DI8B 3VFNA 1EFXA 4ONFH 1JGLL 4GRWB 4R26L 3PGFL 1ZT7B 4HCRA 3OKDB 2B4CH 1R6VA 2BNRB 1MCOH 3HPJB 3D85B 4DZ8A 1S9YB 3MA7B 3T1FB 3MCKA 4JY5L 2NZIA 4G9FE 4MSWA 4A6YL 1SEBA 2D4FA 4XAKD 5DD5H 3P4NA 4HZLA 2EXWD 3X11B 1I1AD 5J0BA 3HMXA 3UC0L 4KQ4H 1I1CA 5D2NC 2R0WL 4PFEA 2OXGA 4HW6A 1XFPA 3QDJA 4J3OC 1J1OL 5ABDE 4NQED 5CGTA 4KKBD 1JWMB 5BQ7B 4U6VL 2N4IA 3AU1A 3MLXH 2A9NH 4QRUB 1DSFH 4J4PD 4RISL 3P11L 2CLVB 5HDQL 2D31B 2NX5D 1Z3GL 5D5MB 2NY7L 2WLZA 3FN9A 1F90H 1FC1A 2YD3A 4IRSA 4NUJB 4PUBH 2BNQA 4I0PA 1R0AH 4PJCA 1ORQB 2AI0L 4EI6B 2QQNL 4YZFE 4RA3A 4GRLC 4JO4L 3FTGA 3I02B 1KPUB 1NEZG 3RPIA 5GS2H 2O61A 1EVTC 4B7LA 2OJZL 5JHDB 1KSRA 5DR5L 4Y0GA 5KSAA 2Y9RT 2ZCLH 3V6FB 3RRQA 2DBLH 3U0WH 4PJXE 5EULV 3U7WL 3CXDL 4JFEB 5HVWA 4KI1A 4NFCA 2Z8VC 3QISA 5I2IA 2MWCA 2HFFA 1NDGA 2E5EA 3OV6A 4N8VG 3OXSA 3ES6A 4GFTB 3ZT5A 5JIPA 2NQCA 3GMOA 2X4NB 3UPCA 3GO1L 1MQ8A 2DQIH 2DRUA 2DWDB 2O5YL 1ZVYA 3OF6D 4QTIH 4C83B 1D7FA 3VWKB 1I8LA 3G9VA 1OGAE 4Z7VA 4MX7B 4NWTL 1MPAH 1X5GA 1A6VL 4PGBB 4X6BB 1JGDB 1HEZA 1U8KB 1LK2B 2C4FU 1J18A 4U0RB 3GBNH 1B4RA 1BHGA 3O3EB 5D1XB 25C8L 4YHNB 4KTYA 3EHBD 5IW1A 4E5XA 3RWGB 3RUGF 2FBJL 1ZHBB 1PG7L 5E24E 4GOSA 3IDIA 3MRDA 1D5ZA 3N9GL 4OF6A 4BQBA 5BS0B 2ZNWA 4ZFFB 3S8WA 1FORH 1CLCA 4JR9H 5A16A 3NTCL 4O9HH 2ZUYA 3BDXA 3EYVA 2Z0BA 5D1ZC 5BO1H 1QLRB 4QRQA 1BPVA 2CK0H 4Y4FC 4TTDD 1DFBL 4L4TB 3W0WB 3EO0A 3D0VA 3AS0A 2OK0H 1UA6L 2XWJB 5L7XL 5LXGL 5DJAB 5IMLB 1JPTL 1L7IH 1XR8B 3ARPA 3QIBA 2DM3A 2VO5A 1NLBL 2ITDA 4RX4A 3DI3B 5FYLD 3LQAL 4I48B 4GG6E 4JANB 3LKQB 4TNWK 3LZFH 4UNTA 3VGAC 1U8NB 4B5EA 4LLUA 1V3JA 4OCMC 2YR3A 4P49A 2AEPH 4Q9RL 4MJIB 1UM4H 3KNBB 3Q6GL 5LQBH 4D2NA 3T65A 3L5XH 3VH8B 1RIUH 4G3YH 1XF2B 3DGGA 5E2UL 3HE7A 2G9HB 4PGCB 3DMMB 1H3UA 3S3PA 4I77H 3PV7A 3MV7D 1TPXB 5E2TH 1AHWB 3LH2L 1MF2L 3TVMD 3WIFA 4ZSOB 4CN1A 5C6PB 1RK1B 1J7VR 1EVUA 3RGVD 3TH2T 4KVCH 3PP3K 2V7NB 3HR5B 2G5BB 5HHVH 1OAYH 1J1XL 3QO1A 4KDVA 3MJ6A 4LSSH 1FNLA 5ESQB 3FRUA 3EBAA 2VLKD 4I18A 1C5CL 3RKDC 4F37F 4P48A 3JVGA 4PV8B 5JR1L 1QBAA 3QUYD 4X0KB 4JFXB 5CUSH 3SPVB 4RA0C 4H88H 2PTTA 3MQIA 5FYKH 1OAUL 5CEXB 1OP3K 3SKJH 2MHAA 3LDBC 3MACL 3TBYB 3DLQR 4LSVL 4GSDL 4R7NB 5I8OH 3U7AA 1GJIA 4YGVA 3CPLA 4NZUL 4R96B 2GTWB 3JV5A 1ZHNB 3ISWA 5JZ7C 4Y2OA 1W2KT 4JRXB 1FYTD 1N8ZB 3KLHD 4YDLB 5AG9A 3BP6A 1PKQB 3BRFA 4LLVA 4P46B 2DWEA 3I84A 1JNNH 4KKCD 2HG5A 1K8IA 1FLRH 2MKLC 4P3CH 4OF3A 4X7SH 5JOEA 3M07A 4L3EA 4M03A 2AVGA 4DOHE 2H32H 5DJ8A 4F33A 1NMCC 3MOBH 5AZEH 5EDXA 5C8JB 4G8FA 4KI5D 3B9EA 2FNBA 5DD6A 4Y4KC 2Q86A 5J12B 3M1BA 4G8GA 1I7ZA 4JHAL 3S37H 1LO2H 1UB6A 2YD4A 3WL9B 1V3LA 4HJGA 3IF1A 3EDEA 3NAAH 1B0GA 5C08E 3FFCD 3MRNA 4GAGH 2D2OA 4D9LL 4LEXL 4PTUB 4K3EH 4LVOC 3ULSA 4OD3H 2YBRA 2HJFB 4WTZG 3EW3B 1FL3B 2G60H 4K8RC 1YUHA 3UDWA 5K9KA 2VZUA 5SWSB 4UIKL 2OTPA 1Q38A 4OFYD 1FAIL 1Y18A 1NAMB 1N64H 1RZJC 3F5WA 3SQBA 3I85A 4RFNC 1P4LB 4Y5XA 2EICA 1IEHA 2VLRB 5FYKE 3X14A 5LWYH 1L9NA 3AVEA 2AJYL 1IAKA 3RY6A 1Q9LB 4EUPH 5HDOA 3PABB 5E03A 1JYWA 1U8LB 3RWDB 4ZG1A 5E5MA 3AAZB 3C60B 1BFVL 1A6UH 1X5ZA 2KBGA 1K2DB 5I1CH 1RHHA 2R1WB 4M7LH 4OKDA 1DQDL 5MENA 4NCC1 3KPOA 1A64A 1RVFL 3CVHL 4L8SA 2SEBA 3QEQB 3VFRB 4HV8A 3C5ZA 3EOBB 4PY8J 4KHTH 5CP7B 4KJPD 4HFWA 4L8BA 1IQDA 3V6OC 1NSNL 4MNQE 5DUML 1IM3B 5KJRH 2VYRE 2YPVL 5HYSG 5DC9B 5BZWA 4RSVA 4OLEA 5HHXH 5DVOA 4FQCH 1JPSL 3EJZ