4NFDA

Structure of pilr l108w mutant in complex with sialic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
120
Chain Sequence
b'MLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQWQSIKGTKLTIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired immunoglobulin-like type 2 receptor beta
molecule tags Immune system
source organism Homo sapiens
publication title PILR alpha and PILR beta have a siglec fold and provide the basis of binding to sialic acid
pubmed doi rcsb
total genus 32
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nfdA00
4R26H 4X8XA 5C0EB 2CLZA 3PP4H 5DS8B 2X41A 4BK4A 4XCCH 1EGJA 1HILA 3MCG1 1J8HE 1U3ZA 1T6VN 4WFFD 3WKML 1V3KA 2DWEA 1U6AH 2ZOLB 5LXGL 4LMQE 3H9HA 4H5SA 4LRIC 2OM5A 3QEQD 4HS6A 4AMKH 3VFNA 1CD1B 1KJ2A 4TTDD 4Y4FA 2EC9U 1TLKA 1FL6A 1IAKA 3ET9F 3ULUH 4P5MA 3D6GA 4EDWH 5BXFA 1OP3H 4ZTOH 2J88H 3BW9B 4F33A 5GGQH 1I8MB 3PQYE 4PGEA 4ZFFA 2QSTA 2CKNA 1FNLA 4L29B 1SJXA 4GG8A 1HIML 5E2JA 1CR9H 3FFCA 2VH5L 4RX4A 1C16B 1OSZB 4MCZA 5EUOB 1D3CA 4KQ3L 5IVXE 1OB1B 5ILTL 1MJUL 3RWDB 4UDUA 4LU5L 1AI1L 3VFPA 1MCLA 5C0NC 2YUXA 3EO1A 2XYCA 1R3JB 5DURB 3VXTA 1NEZG 4PRDA 1YEJH 2VLJD 2R1WB 3QDJB 4K7PY 4I0PB 1JCKA 1JYXA 1DQLL 4PY8J 4R2GD 4MJ2A 2H1PH 5AD0A 1NMAL 4FQ2L 3BQUD 1C08A 2UVFA 4HKJA 3VJ6B 4FQHA 4GRWE 2D4FA 1S7SA 2VOTA 4N8CH 4PJCF 4QRQB 4XCEA 3S4SA 4BQ9A 3GSOB 3CCHA 4JO4H 4D8PB 2OR7A 1BZ9A 4CMHC 1CD0A 4RAUA 2OX5A 3VWKB 4LDOB 3RHWF 3TBWB 4HUNB 4LPXA 5CKGA 2L0DA 4AM0A 5F7HA 4OTXH 5B4MC 2GK2A 4MNHB 4JREB 1MREL 4W70A 3ARGB 5EA0L 1QLEL 2YKLL 3MV8A 4QHKJ 5C0CA 5TQ0L 3IFOB 2J8UF 5I1AA 3U9PH 1AQKH 5EORH 4PREA 2IH3A 4U6YB 2HTLD 1D5MA 4HT1L 5C08D 1IGMH 3MGOB 5C07D 2HJFB 5FOJA 4Y5XB 4HC1L 2CUHA 1A1OB 2NMSA 4PV9B 2ICWJ 2HT4D 4R8WL 5AZ2L 3QUKA 1X5FA 3FQXB 1GL4B 4C59B 1AKJD 1XMWA 5M95B 3BD5A 4DVBB 1FZJB 3MRIA 4R4BA 1W72L 1WAAE 2E3VA 3X3FH 4PY8I 2VZTA 1BECA 3H9YA 1CF8H 4XPAH 3BP6A 4G9FE 3TIEA 3ZMRA 4RZCB 3PJSA 3U0TA 4JRYE 3GMNB 2OSLB 4X5WA 1WITA 1CICC 4EI5B 4Z77B 4CN4A 4EN3D 5CEZH 2YBRB 5BRZA 3UTSE 1VGKA 2K1MA 5MENB 5IQ9B 1TQBB 4GLRH 3QUXC 1P4LB 4FN0A 5HYSA 4QF1A 2PYEB 2R1XB 5DJDA 1TCMA 3CDYA 5CD3A 1XR8B 3LEXB 3O2DH 1ED3B 2YPVH 1FNSL 4NHCL 5ID1B 4XVUD 3PL6A 1ZA3B 4QHLB 1P5UA 3C08L 4WTZA 5D7IF 1FYHB 4MVBC 1X6NA 1JYWA 2EYSA 4LLVA 1T1XA 5D2NC 1FSKB 2XY2A 3L3HB 5AYQA 1T3FA 4LCCB 4G5ZH 4HCRL 3HZVA 3WYRA 2GYSA 3WEXB 5FYKU 4AEIL 4NQCE 5JLZB 2Z8RA 3L7FB 4JZOB 5B21A 2FX8L 1F8TH 4PJEF 1JHKH 5ESVA 1FNHA 5GHWH 5HY9A 5SWQA 2V5TA 2Z8VC 1JPGB 1HSAB 2ICWA 4XCYB 3P11L 2EIEA 2EE6A 3DX8B 4NT6A 5KOMC 3GSWA 5CLWA 4QRPD 4WEBH 4ZO7A 3FRUA 3L6FB 4D9QD 2DQDL 2HN7A 5JOFA 3WN5C 2OL3B 4GKZA 2EDTA 3UBXI 4JKWA 2JJVA 4G7VH 4JM2C 5F44A 4MA8L 3MR9B 4XNQB 2VDKH 5I71C 1X5GA 4XNYL 1ORSA 2HRPH 3EFFA 1TJIL 3KPSE 3GEWB 4POZC 4KVCL 3U9UB 1YEGH 2BC4A 3S5LG 4KJWC 1O7VA 2AJVL 2DJUA 5BJTB 1EFQA 2A6DB 5I1HH 5SWQB 2C3HA 2X70B 2VXUH 4KRPD 2AEQL 1HQRA 1XGRA 3LN9A 5E4EC 4HC1A 3RDTA 1HOCB 1DDHA 5KN5B 1CZ8L 5CEZE 3DGCR 3QHZL 4BFIA 3QIUB 3KPNB 2XQBL 3V6OE 3NTCH 3QIWA 2VQUA 3WLBA 3L7EA 2ARWA 1YNKL 4U33A 3MUGA 1DBAL 1QBBA 3MLXL 5I1JL 2CDGB 4KUZH 3OKDA 1INDL 3RIFK 1ZHKA 4FQ1L 4R4ND 3EZ8A 4PGBB 1HKLH 5KSUA 5ID1A 5D6CB 1JPSL 2Y6SD 4UIKH 2W59A 1T20B 3D85B 4JHAL 3N1FC 1WUNT 4NWTH 5IIEB 5HDLA 3O6MH 3BD4A 1U3YA 3G08A 3QWQB 2H2PC 1FVDB 4L9LC 3ULUC 4XCNA 4TTGA 3ULVF 1AO7E 1A1MA 5FB8B 5JHDA 1BLNB 1MNUL 3F7VA 1ZK9A 5BZWB 5TPWL 5F89A 3VXPA 5DC4B 3B8SA 1XEDA 3LRSB 2W9EL 4XT1C 4QRPE 4HBCL 4BZ2H 2DDQH 3CFKA 4P9HL 4NJ9H 3RJQB 3QWRA 4UDTB 5CEXB 1DUZA 5C8JB 3FQWA 3L95A 1EUTA 3RKPA 1XZ0A 2YS4A 2NY0B 2NY2D 4W4NA 4QRRA 1KIQA 5EBLA 3ROOA 4P23C 4J2XA 4PGCA 5D1XD 3L5HA 3MFFB 1AC6A 4KI5E 5CS7A 5KJRL 3O8XA 4KK9C 4LLDA 5EU7E 3TN0B 3OJ2C 3G6JE 3E1F1 5DFVC 5DJ2A 1YY8B 1D9KB 1LILA 4NO0A 3MLSL 3CLEH 4IRJB 5DMGC 2BXZA 4EDXA 1DBBH 1BBJB 4PJ7B 4RMTA 2XNAA 4MLIA 4P59H 3KPLA 3ZT7A 2RAMA 3S3JA 1SBBA 4WI9A 4QHMA 4V2CB 2GHWB 3P30L 3QUMA 4WJ5A 1WJ3A 1YUHA 4LVOB 3UTSD 5HGAA 2W0LA 2HT2C 4EIGB 1K4CB 4EJ1C 5I1EH 2AJUH 3I3EA 3EDDA 4HHAA 4JRXE 4L3ED 3D18A 1GGUA 2VE6B 4DCQB 3PV6A 5E8PB 2Q3ZA 3RTQD 5FGRA 1LO5B 3ZHLA 1UGNA 1TZGH 2O61B 3VFWA 5JXEC 4XWOC 2YHGA 3SGJC 2A0LC 4GRLA 4AK1A 1T1ZA 1RI8A 3I6LE 1U92B 4HJJH 3ZYOA 5D7LD 1NC2B 1VEPA 1BREA 3CGTA 4NNYA 4MJ6B 5EOCH 1CU4H 4BH7A 1J10A 1C12A 2Y25A 3DMMD 3SCMD 3RVXD 5GS0D 3IXAA 2ZCLH 4JY4B 5FYJD 1BFSA 1UXWB 4F7CB 4JRXD 4L3EE 4MLSA 1RZJC 2P8MB 5FUOH 4ZFZA 2JKXA 2NTSP 4LF3B 5BQ7B 5DD0H 4JG1L 1SBSL 5IROC 1AY1L 1Z9OA 1OAKL 3EGSB 1M7DA 1L7TL 4LP5A 5KOVC 5C09D 3DURA 4I9WD 3RUGA 4M62L 3SE8H 5GZND 4XBPB 4DW2L 3VD3A 3D18B 5DQDH 3EDFA 3EO0B 4CVUA 1IGTA 4FQXA 5DRZB 1I8IA 4HFWA 3U7AA 4LLUA 3KJ6H 3TVMC 1IL1B 1NGWA 4LOUC 2N1KA 1S5IL 4LKXB 2PR4L 5L8LB 2XT1B 4G8GE 3DV6A 1IAKB 4WWID 3IU4H 1I9RH 2ESVD 4H8WH 5F7MC 4X9GA 1MLBB 1OQXA 5LG1A 4DEPC 2MOVA 4J4PD 4G42B 2OMBA 4I2XE 4PJ5B 4EUPH 4HAFA 2KQNA 2VQTA 1H8SA 3RVXC 5DMKB 4GAGL 5CZXC 1KIPA 3MV01 4HXBL 5GPRA 1R3LB 4F7CA 4QY8A 5C6WH 3LZFL 2EEDA 1AQDA 3GMLB 5DYOB 1DUZB 3QI9C 3W2DH 3KS0H 4UTBH 4AH2B 1X5HA 3SDXA 3FB6B 4K94H 3BKML 3BYTA 1TMCB 1CG9B 3MJGX 5GGRY 5T3ZD 5CIPH 3QEUA 1YNLH 3X12A 1ZLUH 4JFHD 4Y5VA 1DBKL 1KIRB 2FJGA 2AS5M 4GUPA 1E27A 3CSGA 2CUMA 5A2LH 5HHPA 5HHMB 1IKNC 1NAKH 3HRPA 2IADA 4Y16D 3HMWH 2V5YA 1RUAH 4YBHA 1P4IL 4HIHB 5JW4Q 2F8VA 3ROLA 4NQTA 4ZDHB 2VUYA 4M4RA 3MV9A 1A9EA 4IDLA 3MV11 4M4PA 3SDDC 1N2RA 2NY3B 5CLTA 5GGUA 1ETZA 4PLKD 4YHML 2WUCH 4NRXA 3MRJB 4HBQA 3D48R 5I1CH 1QR1A 2ZSVB 4NO5B 3O8XD 3TZVB 4KHXH 5F1IB 4U0RB 3WUWB 1BWMA 2EH8H 4HK0B 4LDLB 1Q0YH 5D1XA 4TYUA 3H3PH 2FD6L 1DQJB 1D9KA 4LAQL 3QI9D 4Q58C 3O3EA 5HHNA 4KMTL 2VL4A 5TDNA 4Y1AB 4WFEE 5SWZD 3I6KA 2V7HB 3V6FB 2PN5A 3Q5TA 4L4VD 4FRWA 4LSQL 3QQ4A 2H8PA 1B0RA 5D1ZB 4Y19A 2HMID 1MWAB 4PJXB 4WNQB 25C8H 3LEVH 4RMWA 3QP3A 4U2ZA 4G8GD 3GSVB 4JANA 3P30H 3WFDH 5C0BE 5E99H 4K3DL 1QR1B 3HA0A 2W9DL 1IKFL 4HWBA 4ODWB 1JV5B 5GGUB 4RA0C 3QXDA 4G80A 1EEZB 2BY3A 2EXYC 1U8MA 3ZTJH 3L5WB 4JKPH 2JIXD 2MMXA 4YQXH 5E2UL 2DBLL 1F58L 2GJ6B 3F12B 1KSRA 4YDVB 3FQUB 1S7UB 3P9MB 4NM8L 1OW0A 1ZLUK 4L4VE 5LGHH 4X98B 3QNYB 3O6FA 2QKIA 3DARA 4KJPC 2FX8H 3BN9C 1JNHB 1SY6H 4BYHA 3LMJL 2IALA 1F2XK 3UTZB 4ONFL 4TNVF 4Z5RB 2DMKA 1QRNE 3BP5B 4YEFA 3QUYA 5ENWB 3MV7E 1SVZA 1EHLL 4P9HH 4MVBD 4Z7NF 1RIHH 4Y2DD 3OG4B 3RWEA 4KI1A 1GOFA 2R4RL 2IEPA 3FL7A 2I07B 1FNFA 4OLXH 2LAGB 5HYJD 2QSCL 3ZYZA 2BNQA 2X4RB 1IBGH 3X3GL 1KENL 1KIPB 2IBGA 5DMKA 4FFYL 4M7KH 1XR8A 1FE8H 4JFDD 4XWGH 3HRZB 4H0HB 3KPRB 5FF6A 3LHPL 3DVGA 4JHAH 1NBQA 1P4LA 2DD8H 3ELAT 5IROA 3GUTB 4M6NH 3EYQD 1FJ1B 2X4TA 3C2AL 1ACYH 1T5WB 3HPJB 4U6VL 4X6CF 1IC7L 1KLGB 3ARBA 3BIKA 3HNSH 3RWGB 4KDTC 5K9KB 1N4XH 2OTWA 1YEDB 3MLXH 4HUWB 3IXTB 4Q6IB 2X6MA 3BT2L 5CP3H 4JCMA 1YYLH 2PCPB 4Y5YA 4GKZB 1RVFL 2LVCA 4M1CC 3RL2B 4LARH 5C0AB 1I8IB 2GCYA 1P7QB 1GOGA 1KEGL 1RZ8A 1I7RA 3GI9L 4XNMB 2DLFL 4XCYA 1HSAA 2NY6C 4XRCA 4R2GB 3NIFE 5CBAB 2CLRB 4BFBD 2IC2A 3SHSA 3MREB 1B88A 3S37L 3BUYB 3A67L 3WFZA 1UYWH 3HFML 4IMKA 4X7TA 4KI5D 4KKBD 4R8WH 3L7FA 4JZOA 5AZ2H 5IB1B 4K8RL 1GGTA 5D93B 4K8RD 4MB4A 2J12B 1EMTH 4WUUE 4OLVL 3OQ3B 1LK2A 1LO4L 2NY5C 1C12B 4JDZB 4N1CA 1RJCA 1P7QD 3FZUC 1LP9F 2B20A 1K3ZA 3NFPB 5TQ0H 4JQXA 3SJVA 4G7VL 3SN6N 5D1QC 5F1NB 1LO0L 5HI4C 2QADC 5ISZA 4HUXA 5IBTH 2MCPH 1PW3A 5DMIH 3O4OB 4X6FB 2EDOA 1A0QH 4LVHB 3ARDB 4X6CB 2FYYB 4V1DD 1WTGT 1F42A 1JYVA 2OQJA 4RNRA 3H2WA 2EXWD 5EOQH 4EI5D 2NX5E 4I1NB 1QR4A 4R7DA 1F4HA 1HXMA 4QF1B 1AO7D 1V05A 3DX7B 2FCBA 2VC2H 3BX7C 4FQHB 4AEIH 4ODUB 1B9ZA 1QFWM 1T2QL 3FFDA 4G5ZL 1U58A 5ISZB 1FCGA 4NKIH 2ARJB 1SEBB 4S0TD 5DD5H 2FX7H 4X8JA 1V3JA 5DR5L 3ZKMC 1YQ2A 4MXVE 1G9NC 3GNML 4OJFH 3EYVA 2R1WA 3O2WH 3QDJA 4WU7B 1YEJL 3EYQC 5JIPA 1NDMB 4RWYH 5DVKA 1N26A 2XPGB 1R3IH 3HC0A 4HDIB 1INEH 3KJ4C 3MBED 1R5IA 5A3IC 2CDEB 3KNBA 1FZJA 1LEGB 2CDFA 5B8CA 2KKQA 5F7EL 4FQJL 3TNMA 1U8LB 2YSSB 2JJTC 3TCLB 4FMKA 4JY6A 4XC3L 4XRCB 1F90H 2QSQA 3I85A 2HJFA 3QDMA 3MGOA 4K94C 5D8JH 3B2VL 2IH1B 1ODAA 1I7TB 5HJ3A 3VXMB 4DJMA 3BN3B 2NY6D 5FHBH 3MJ9H 4XCFH 2H45A 1ZT4A 3VRJB 3P0VL 4I3GA 5CEXA 3OHXB 4NM4H 5IGXH 2R69L 3KPRE 4S1QL 4MNHA 1YEDA 2WWKO 1FZOA 4QNPF 4QXUH 3WNKA 4L3CA 3ARBB 3BIKB 1CF8L 1EAJA 4S1SL 3SJVD 1W72H 2IPKA 4H1LH 3UJTL 4K3EL 2HT2D 4HJGB 3WD5L 2XWJA 4CVWA 1P4BH 2G5RA 2DLHA 5HI4D 5I15H 5F7NC 5GISL 3GB7A 4NCC1 3P4MB 1ZHLA 1KCLA 2HJKA 1J0JA 5D71H 3WN5A 2QV2A 1IGML 2IAND 3WKMH 2IGFL 4MXVF 4BZYA 1A3LL 4XWOD 1UVQB 3WJLC 4LASH 3DROB 3CH8A 1MFCL 3JWDC 3KPMB 3IDXL 3W9EB 3QJFA 4QGTA 5IEKA 2UZIL 4HLZH 3WFEL 3LQAL 3TA3C 3EOAB 4QXGL 2ICWI 2D9QB 4OM1L 2DKUA 4DAGL 4JY5H 2FATL 1A4JB 2VN4A 5BOPA 3W39A 1A14H 2EIDA 3C5ZD 3SDCA 2XTJB 3VGFA 3BUYA 4Q9RH 1W0VA 1C1EH 2XKUA 5ETUA 4NN5C 1W0WA 5LBSL 3ZKNC 2PETA 5CWSA 2KPNA 3MRMB 4I5BB 2X10A 1H3PL 5SWSA 2GJ6A 3F12A 1WGOA 2VLRE 3O2VL 4FG6C 4I3RH 1YY9C 3RRQA 3FT2B 1T0NB 3L3OA 4OV6F 1FFOA 2FB4L 5J89A 1CFSB 1QQDA 3NA9H 3SDYL 2P7TB 3NACL 5A16A 5H94A 1RURL 1E0OB 5FYLH 4XC1L 2H3NB 2Z31D 4DUXA 1L0YA 1CDBA 2HWZL 2OL3A 1KJMA 3RZWA 5DI8B 4GAFB 1AI1H 3RHWK 1MQ8A 3W0WD 4GSDL 4H5SB 4OZIE 4YFEA 5C0BB 1IGYB 3WNNA 4FP8L 5MHSD 4U1GC 2ED7A 3PG2A 4OQTH 3R8QA 2KDGA 4PTTB 4MQ7B 2X4RA 2OR8A 1BP3B 2NW2A 5EU5B 4CADA 5HVWA 3VE0A 5L6YH 4DOHE 5EUKB 5KSAD 5KVGH 1NKOA 4LASL 3T1FB 4W4OC 1WBZA 2YMXH 4NCC2 3QFDB 4KQ4H 3I50L 1ZE3C 2JIXB 1TXKA 4NC1E 1A5FH 2NYYC 3BDYH 4JFFB 4PJFA 4LSUL 2EDHA 3QUMH 3NACH 1QLRB 2QSVA 4LCWE 4JDVA 4R97C 2BXYA 1JGLH 3ARVA 3LD8B 3HAEH 5ICZA 3DMMB 1U3JA 4AEHL 1WWBX 5JIIA 5IOPA 4LSRH 5HI5D 3HN3A 2ZNWA 4QWWD 3O2VH 3OB8A 3RWHB 5DFVD 1H3PH 4Y16C 3LAFA 4GOSA 1KCVH 3DV4A 3AB0C 5MENA 3QXDB 4G80B 1NSNL 4QTIH 3P0VH 4WIQA 2EIZA 5FFLA 1Q9OB 15C8L 5F96L 1HI6B 3TN0D 4Y8AA 2OJEB 4PJFB 4AH2A 1BAFH 3LN5A 1YQVH 5ITBL 1KELH 3DVNB 2AXFB 2OK0L 1T80A 4YLQT 2GITA 4HIEA 5DZNA 1CDCA 4I18A 4FMFA 4CU6A 1E6JH 5C0RH 5D7LB 4NKQB 1F3DH 5GJSL 5DQ9A 5D4QA 1R3IL 3SGKA 5EZIL 3V6OA 2JF1A 2Y23A 2AJXL 3AREC 3QDME 2V9RA 1IGYA 2PXYC 4OJFL 5E00A 2Y7QA 1YMMA 4P5TC 5DD3H 5HHOA 4PREB 1NMBL 1L4IA 1TJGL 5GJTL 3TZVA 3QUXB 3CVHL 3U0WL 1HE7A 3GM0A 2W9LA 5F97E 3OAYH 1KCUL 3SKMA 5MEPA 2VDOL 5IR1B 4JDTL 1KJ2L 1OGAA 1D6VL 3S3SA 3FCTB 2FSEA 4KKCD 5DA4A 5GGSB 4I5BA 2MCG1 3HR6A 1ES0A 2VAAB 4HXAL 4P4RA 5J12B 1LE5A 4OQTL 1C7TA 4Z0XB 1YJDC 2VABA 4JVPA 3DRQA 3V0AC 1JPTL 3BVNB 1ZLWH 2IANA 4OF0A 5HI5C 3RWIB 3BN9D 5IB5B 2QQNH 3C60D 3EOYG 4M93C 3O41A 1RURH 2ZG2A 3ZSSA 2A77H 3JWNC 4HD9A 2E7LC 5TF0A 1MVUA 1U92A 3T0EE 3GI8H 1EERB 4H8WC 1XF4B 2I60L 4LIQE 5FYLD 4HPOH 4XPTL 2G75A 1YEIL 5E7FA 2A83A 5HHVL 4KY1L 4OZFB 1FPTL 5IVZA 4Q2ZB 2FZ3B 2VE6A 4ZUVA 4I13B 4HWUA 1JP5A 3SGEI 1HHGB 1RZKC 1S7RB 1SYVB 2EH7H 1LK3H 2JJSC 2V2XA 4NPYA 4DKFH 1A0QL 3QDMD 3O3DA 3AUVA 4WFHE 3FTGA 4OSUL 4B5EA 4JRXA 3L3IB 3LQAH 5T1KD 3O3DB 4AG4H 1H0DB 2XTLA 2XXMB 3JUZA 4Z78A 4KC3B 4KK6C 3BAEL 3RGVD 4NNXA 5JW3L 1KYOK 1AXTL 1IM9D 4X7FC 1MI5B 1SJVA 1A6TB 4C56A 3MXVL 4M7JH 1FFPA 3ARDA 1CT8A 5DK2B 1RIHL 1P53A 4LFHG 4GQ9L 4Z7UF 3KWWA 3ZE0E 2Z91A 2CO6B 4F2MA 5E8EB 1CDUA 4K3EH 3MMEB 4XNUL 4KHTL 1KIQB 5JQHC 3SJVB 4PBXA 3L1OH 2VR5A 3KPPB 3LKPB 1TPXC 4QRSB 5BW7A 4KVNH 3T77A 1JL8A 4LQFH 4PJFE 4YEEA 4NM4L 5IGXL 5C0JA 5JW5B 3G5XA 3G5ZB 3NPSB 1WFUA 4S0SD 3RVTC 1UH3A 1AGDB 4IIQB 1DR9A 4HEPG 5E2UH 1MFBL 3SGEH 1K2DB 2W0FA 4ORGB 5GRJL 2O61A 5D8JL 1RIUH 1A1MB 3IVKB 5CUSH 1XF5B 1P7QA 1QFPA 5F7EH 5JORA 3FCTA 3ZDZE 2E9JA 5ALCL 1AGEB 1F4XH 2W9DH 1J9CT 5MENE 3TA3A 1K4CA 3IDJA 1WC7B 4Y4KD 3LKOB 5L9DL 1WISA 5IR1A 2EDJA 2CIKA 1GC1L 2H32B 5H35A 4UMGA 1XF2B 4LSQH 1IE5A 3TBTA 3LB6D 4OD2B 4FZ8H 2K9UA 3DXAA 1EHLH 4MAYC 4CVXB 4Q6YA 3V4PL 3GO1H 4BFEA 4O4YL 5D96B 2ZUQC 5FF6B 3D0LA 3QIUA 5GRVK 1BVZA 5F9OH 3TFKC 1RUKH 4W81A 3PWUB 1G9NH 2C9AA 1F6AA 1ZS8B 3ARZA 3H9SD 3F5WA 5GGTL 4S1RL 5FOBB 1I7UA 5T1KA 1I3RB 5AZEL 1R3KB 4ELMF 1M05A 5FEBA 3BPLC 3QAZC 4JKPL 1DFBL 4JFOA 3FQWB 3L95B 2MCPL 3JV6A 4LSVL 3QRGH 4EUPG 4U7SA 4BSWB 3CVHB 4PJCE 3RVWC 1BF2A 3IDMB 3KPRD 4HH8A 4L5FH 3RBSA 4C4KT 4XNQA 3G5VA 3OF6D 5CP3A 5BV7L 4NO2B 1IKFH 1JMZA 1ZGLP 2FBJL 1LEKB 3ARPA 1XIWB 1T0NA 3HMWL 1Z5LA 2VQ1B 2VWEC 1OARH 3FRUB 3L6FA 3MV9E 5C2BH 1CVSC 1OD9A 4ODHL 2PYED 5GSVB 3DX8A 1P2CA 1R24B 2HLAA 2J4WH 2V2TB 1YNLL 3HFMH 3MTRA 3OZ9H 3BMVA 4MDIA 3FO1A 1ZVHA 2IANE 2ZSWA 1ZOXA 2ZCHH 3KYMB 3O11A 3QDJD 1HYSD 1KEGH 3T2OA 4XB8A 5GZOD 1S9VA 3HZVB 1H15B 4N0FB 3HE6A 1QZ1A 3BQUB 2AXHA 4KHXL 3GSRA 2CR6A 4AEEA 1N4XL 3HHRB 3P9LA 1I3RA 4M7LH 4U1KA 1FAKT 1YZZA 1OM3H 5I19H 4L1HA 1HOCA 1PLGH 2EIBA 4CADB 2YZ8A 5HYQA 3BZEB 5KAQG 2J6EL 2UWEE 3SQBA 2CSPA 5C0BA 5T3ZL 4YDVA 2Q87A 3U36A 1T2JA 2VLRD 4H20H 4M7KL 3QEQE 3TFKD 1CLOH 1VFAB 1ZHNB 4JFZL 2GTWA 4KPHH 4NO5A 2BVYA 3WFCL 4YHZH 3CLFL 1QRNB 3HZKB 2OXGA 3OKLA 2R0ZL 4YBQD 5J9PB 1AO7B 5IMLA 4HLJA 2QADD 1U8OB 3C8DA 4UTBL 3PWPA 1A9EB 1L7TH 5KS9F 2XTJC 3LMJH 1JNLL 4MJ5B 4PR5B 5K9JH 5F1SA 8FABA 5IF0A 3T0DA 5HY9B 1R0AL 5FHAH 3KPOA 3U4EA 2CDFB 5B8CB 3FHQA 4ONHA 1GGCL 1M71A 5GSRB 2DBLH 4P3WA 5AG9A 1ONQB 3TH4T 4GRMB 4NUGH 3V5KA 3G9VA 3H7BB 4JZJA 3JWOH 2P5WE 3DVFA 3UTTD 3WDHA 3KPMA 2GSGB 2D03L 2YXMA 3G6JB 3T4AB 3MRGA 5E8EA 4CL7A 1BFVH 3WXWL 5E24E 1WTLA 2ZWLT 1DZBA 1JI2A 2IAMD 2DQGH 3RFZC 5T1LB 1CFQA 5HGBA 4OGAD 3VMPA 3I84A 4X4ZA 1YEFH 2RB8A 4PJIA 1W8OA 4M61B 2R9HD 1FNGA 3JXAA 2JK5B 3UYRL 5EU6E 2Q6WB 4G6KL 4X6CA 4F7EB 1AY1H 4ZXBC 1DQML 2H9GA 1C5CH 4JRXB 5LQBH 3H3PL 3AVEA 1MQKH 1ZVSA 3QAZB 1KLUA 4R97B 3GBMH 3LD8C 1ZHBA 3I2CL 3CH1B 1P9MA 2WUCL 5FYKE 3IJYB 2VDRH 4E5XB 1CYGA 3SPVA 4ZUVB 3BYYA 4Y2DB 2F5AL 1UJTA 2PYFA 5C07E 2ESVA 3LS4L 4CU8A 5FYJL 1JRHH 1H5BC 1D5XA 5I8KL 3GBLA 3MLRH 3VG0H 1HWHB 1R5VA 3X11A 2H2PD 2I9TA 4EUPA 1E4WH 1R5IB 1G9MH 4ZAKD 3GKZA 5E8NA 3WDIA 3O6FC 3U83A 5ISZE 4MJ6A 5HDOA 1QSZA 4LGSB 2AJUL 1DBJL 5KZCB 2WIIA 3TWCL 4P5TD 3MA9H 5TPWH 5KS9E 5E2TL 4NN7C 4X8JB 4Y19D 2NX5A 2Y9RT 3MOAL 1KULA 1T7YA 3QUYC 4NPYB 2X4TB 4L8CB 1JFQH 4YE4H 1IGTB 4XGZA 5DRZA 3M07A 2IPUG 5E8PA 3X14A 3OJDA 2GFBB 5KVMC 3SE3C 1FDLL 5I1IL 1ZVYA 2HKFH 1SVCP 4ERSL 2GT9B 4OCSH 3KVQA 4U0RC 1Q38A 4GW1B 5CD5C 5HGAB 1YNKH 3AY4A 5IHZA 2J5LC 1RPQA 2QQLH 1JFQL 4JY4A 1G6VK 4H8WL 3QO0B 3FQNA 5EWIH 2R9HC 1RJYA 2PR4H 4OAWB 1LO2H 4PS4L 1CXKA 1Z9SA 1FBIH 5JDJA 1V5JA 3HI6H 4GFTB 1YN7B 3RVUD 1LO3L 4JRWA 5KSAB 1A6AB 2DDQL 3TWCH 4YPGA 5B39B 1T1ZB 1HDMA 1TZHB 1VGEH 5C0AD 1VKXA 2W9EH 2J4WL 1M71B 5GSRA 4H26A 1T89C 4I4WB 5F72S 3KPOB 4PGCB 3QNYA 3UO1H 3CJJA 4KVCH 1LO5A 4OF6A 2CLRA 2FJFA 1RUPL 2XQYK 3MRBB 3DI2B 3NN8A 2C4XA 2VDKL 2B4CH 4Z7UE 5JPNB 2HKHH 5IV2B 4JGMA 2NY5H 4NZUL 2V2WA 4IMKC 4IJ3C 4UIKL 4ZOCA 3VXNB 1HKLL 4KGLA 4WI7A 4IHOB 3NCCB 4G8EB 4ZOEA 5DSCB 2DL2A 5CD5D 1CU4L 32C2B 1J8HD 5GHWL 1ZHNA 4P2RD 4G9DA 4P5KB 1N0XL 1QLFA 1B0RB 4LNRA 4N8VA 3DVGB 3NABL 4NO0B 5B39G 4Z7VF 3A0OA 4L4TD 3HRZA 5DC9B 4ELME 4PTUB 4UIMA 3C6SA 5F9WB 3MQIA 3BZEA 4I0PC 3MLUH 1CE1H 2P5EB 3UZEA 4KAQH 4PRHE 1JNJA 3B9KD 1M4KA 2V5MA 5D1XB 4DN4H 4IOSD 1YEGL 2AXFA 3L7EB 1KGCE 4K9EC 5CZVH 5L9DH 3WS6A 2BSED 3FN0H 5FIEA 2FEDC 4NQEA 5CSGA 5ALCH 5EUKA 3R0NA 3N85L 1QBLH 4DUVA 1ADQL 2XZZA 3CLEL 5F93C 2GAZB 1FFNB 1L6XA 5C07B 3DHJA 3PXHA 4PB0L 3ROLB 4Y2DC 1GGCH 5IG7A 4LNRB 4BFGA 7CGTA 4N0CD 3HG1D 4G9DB 4P5KA 1R0AH 4R7NB 5CJ8A 5CGTA 1Z5LB 1WBXA 1QEWB 1FYTD 2JCCA 1RJLB 4G43A 3AU1B 1B0GA 1U93A 1EUUA 5LAXB 1RHFA 4GXUM 3JV6B 4KXZH 1VHPA 5J13B 2DKMA 5GRYA 3MUJA 1MHCA 4KKCC 3FO2B 5CWSB 3PXJA 4P46A 3IKCB 4I0CC 1RU9H 1G7JB 2V7HA 4JQXC 3V6FA 4HV8B 2PO6C 1NBZB 1ZS8A 1DLFL 1CL7I 3TZVC 2HA1A 1TCRB 3JWOC 4WGWB 1A22B 4J3TA 5BVPL 2YKLH 5DEFB 3REWB 2BY2A 1YJDH 4OGXH 5SWSD 2YK1H 5J06A 1JPSH 3AREA 3QDGE 4G6MH 3IF1B 2LTQB 4OTXL 3DXAB 2V5SA 1QSEA 3JVGA 2WWKT 4OUUB 3PDDA 4PLKC 5DMYA 3JV4A 4G8EA 1VFBB 2RHEA 1OSPH 1DN2A 1RHHB 1HHIB 1FPTH 3FZUD 3S8WA 3MZGB 1ITCA 2FECI 1MELA 1CN4A 2JB6B 5DJDB 1YEIH 4PGDB 4HEME 3DX9B 2QQKH 4P46C 3VI4E 1RZGA 3MRBA 3OBAA 4P3CL 1U3HB 3SGJA 4ZODA 1U8JA 5IQ9A 5DD6A 1DQLH 1TZIA 4EI6A 2E5EA 4HMEA 4D0DA 3B9EA 2X4UB 3I6LD 4JM2D 2A9ML 4MQXD 4RISH 2FBJH 2J8HA 4BH7B 3LKPA 1ZT4B 4JHWH 4OGYH 1VFUA 5IEKB 1R5WB 3QIBC 3W9EA 2ITCA 1U2CA 3OX8B 1GOHA 3FAXA 3LKRB 2BNRE 4F57H 3K2UH 3OWEA 3WN5B 4FFZH 4KRPC 4LCIL 4HGMA 3P4MA 3MLYH 4Y5XA 4LGPB 4U31A 4C58B 4HWNA 1RK1A 3R06B 1L6ZA 2VDOH 2CQVA 1NDMA 2PTUA 1ZHBB 3IDGB 1U8KB 1OAYH 5JDSB 5GGRB 4HF5L 3K8LA 4OLZH 2NX5B 3GSXB 4PJ5D 1XGUB 2VIRA 2FH8A 3VWJD 4F7EA 2VZ1A 4OLYH 1U0QA 4PJ9B 4PJXE 5SWZB 5JOEA 2GSIB 2DQTL 5T1LA 4PYGA 3BGMA 1F4XL 4LLDB 5C0RL 2FYYA 2A83B 3PP4L 4UINH 3UTOA 1U8LA 3QPXL 3TYFA 3GMOA 1CTNA 3PNWA 4FQXC 3TJHD 3TYGH 4JPKH 2VL5B 3MRNA 5GRJH 2ITCB 4PJAA 4HCRA 2XPGA 3H6JA 1KN4H 15C8H 2DBJA 1J7VR 1HXYA 1T1YB 5SV4A 2K7PA 1CK0L 1QBMH 3O6KH 1UB5B 5BO1L 3SY0A 3GHEH 3O4LD 4CNIB 1PY4A 1OAZL 4Y16B 1KJVA 4KVNL 4UUJB 1G7LB 4ONHB 1K5NB 3MCLH 4OKVA 1BGXL 5JHLH 1IT9H 4FOMA 4Z0XA 2JK5A 4P48A 3PHQB 1KCSL 5JHDB 4YXKH 1BX2B 1JF6A 2IAMC 3DYOA 5SWZA 1DTUA 4WWKC 3T2NH 3VWKD 3VXSD 3H9ZA 1KB5H 4NSKA 2VN7A 4IRZH 1QUNA 2HTKC 3QI9A 5IJVB 4PP2A 1QO3A 3VRLE 1IEBA 5FA4A 1FH5H 2YMXL 2AQ1A 3BAEH 1P7HL 4XCCL 4GKNA 2BERA 2IFFL 4HUKB 4XHJD 3WIFB 3TM6A 3FT4B 3VXUD 4C56E 4C83B 4Y4FB 2D2OA 1P5VA 1VFAA 3EYFA 2EYTA 3TT3L 4NFBA 3MRKA 5MEOA 3I3DA 1KFAL 1MPAL 4JVWA 1TTUA 3WO3B 4P57B 1FVCB 4N1HB 2EH7L 1BD2D 4JREC 3TN0A 4QRUA 2AV7B 2AI0L 2R0WL 4C57C 5HYQB 4KK5D 4NBZB 5ADOH 3S36X 3RTQB 3QEHB 2I07A 3D2UA 3OKNB 4XC1H 1VFMA 2Z31B 4MB3A 1CICA 3VGGA 5IT2L 2ZPKH 4M1GH 5C0AA 1NMAH 5J11B 5CP7A 4ELKA 3HE6B 1A6VH 4M6ML 3EFDL 4ODVL 4FQXD 3TJHC 3BW9A 4TULH 1H3UA 1WQVT 3HZKA 1DBML 5HSFA 5D9SA 2G5BA 4UQ2B 3A6BH 2J8OA 4C54A 1FZMA 1S9YB 3LKSA 3QWOA 1AKJA 4PBWD 1FFRA 4RRPG 3QUYD 5FCUL 2EKSA 1MAJA 2QADB 1GCFA 1WCQA 2F19H 3SBWC 4L8DA 4KKNA 1CDIA 5MI0C 1MPAH 2BSSA 3QPQD 3AXLA 5TGBB 3QXTA 4GXVL 3EJJX 4JDVB 1I1AB 2IFFH 2APXA 3CFEB 5L2JB 2MSPA 4JDTH 3P9LB 5HVGB 1QSEB 3W11C 2IGFH 2JIXA 1VEOA 3IF1A 2X1QA 2EYSB 5D1ZA 3ULUD 3DUSA 2VLLA 3K1KC 2Z31A 1FAIH 4OFYA 5EU5A 3RTQA 1WT5A 2VAJA 4OI9A 5B3NA 1ZT7A 2C3VB 3L3GA 2DQCL 3QG7H 3DX6A 2BSSB 4AT6A 1BJ1H 1JZ7A 1A1NB 1GPOH 4JFDE 1K8IB 2YOCA 1CQKA 5E08H 4PRIB 2HLAB 1R24A 3I75A 1NFDA 1U6AL 2YXFA 2EYTB 3NFNB 4YH6A 3V95A 3DWTA 3QNXB 2G5BB 1JIBA 1T6WA 4KK5C 3G6DH 4UQ2A 5GXBB 4NGHH 3MRJA 5IVNA 1ERNA 2YPKA 2JELL 2BZDA 4Y4HA 4WFGD 4ZSOE 1BD2A 3IDIB 5I6XC 1I8KA 1QO3B 4JM2F 4X7SL 5JW4N 1WBXB 4QHNA 4F9LA 2YRLA 4B0MM 1OY3B 4PJXA 5F96H 5INDB 3CDFA 4LCUB 3GSWB 4GRLD 2Y72A 2FJFB 4J3XA 5DFTA 1LP9B 5FOBA 4NC2B 2XWTB 5AAWA 2FNBA 3C5ZC 4XBGB 3WHE0 2J1KA 2ZUSA 3F7RA 3QUKB 3VXRE 4EOWL 3W39B 3OPZL 1DBMH 3SDCB 5TDNB 4J1UB 4OLYL 4P9MH 5MEQA 2XRAL 1GPOL 2IAMB 4LSRL 3EFDH 3VMNA 5HGGS 4OCMC 4JO1H 2X1OA 4NKIL 1IGIH 1ZAGA 4WRLA 4M1GL 1NEUA 4P23D 1OAYL 3KPPA 1J18A 3K74B 4TSCL 1QYGL 4TVSa 3TBSA 3KLAA 4QY8B 2UWEA 2VR4A 4M9PA 4UT7L 3ZDXF 1KTRL 4NQSB 5I9QC 4Z9KB 1HINH 1PQZA 2VLRA 1XCTB 1VERA 3THMH 3PE9A 4GW1A 4UIMB 5IJVA 4M6AA 4YHOH 3TBWA 1FFPB 3VFUA 3TC9A 3EYUL 4NUJB 3SKJH 4U1MA 1BZ9B 2DS4A 4YDLC 1MY7A 1YEKL 1MFDL 5CHNA 3X14B 1A7RH 1QLFB 3S4SG 5HHPB 1U8QB 4JN1H 2F19L 4KDWA 4ZQKB 2E6PA 3UDWC 3DYPA 1OW0C 3V8OA 4L9LB 3KYOB 3SKNB 1AFVL 5JW5A 3RY6A 3IFLH 1T22B 5F3BB 1I9JL 3S3PA 5SV3A 4ODVH 4IOIA 3KHQA 5C3LD 5F7UA 1UADC 4JG0L 4YXKL 2A0LD 1IGJB 1P9MC 1KUMA 5IT2H 4CVZB 4B7LA 3MOBL 2EDEA 1J05A 4FQLH 3WNPA 1YYML 2X9XA 5I1KL 2Y07L 4GW5A 3PDGA 1OSPL 4LRNL 1C1EL 3LPWA 4ZPVB 4UI2A 2R0WH 4E5XA 4P2YA 4C4KO 4NZRH 4YHNA 2Z93A 4JO2H 4WO4A 1I1AC 2IG2H 2RR3A 1KTDB 4H25B 5ACZA 2APWA 5GS2D 2OJZL 4QRPA 1FVEB 2DF3A 3PWJB 3ZTJG 1S9WA 1MLCA 4OCRL 2ZUVA 4K71B 1MFCH 4UINL 4ALAH 1UC6A 2N7BA 3KG5A 3SDXF 4F37F 2KBGA 5DDHA 1T03L 1KENH 4DCQA 1PDKA 1KB9K 2EECA 3OR7A 2EDDA 1EO5A 3DX9A 3UBXA 4OCYH 2EDBA 4OLWH 2VLJB 2ZG3A 3JVGC 4M5ZL 3ZZ1A 5FGCB 4OZFA 5D72H 4W4OA 1FORH 1UM6H 2Q86A 4WEMB 2NR6D 5L8KB 4NHUA 4MWFB 1PBYA 4AIOA 1ZEAH 3G6JA 4JQVA 4KTEL 4WO4B 2AJ3B 3NFPA 1MOEA 2E6JA 4YWGH 4XP4H 1N64H 4NNYB 4G8IB 1OAQH 1Y18B 4ZPVA 4XNXH 4OZHF 3P0GB 3VGBA 3DUUA 1FHGA 2AXJA 2PTVA 2P46B 5E5MB 1UWGL 3NCFB 4XPGL 4PB0H 3QJHA 5IK3A 3BZFB 2NW3A 1UQSA 3VH8B 3IFNH 4WHCA 1XGYH 4PY7A 5HYFA 2X09A 4OUOA 4M00A 2CK0L 3OXRB 5DRNA 4U6HA 4DGIL 4ZYKA 4RFOH 3TH2T 5HPOA 5D5MB 2QR0B 1URLA 2DQTH 4CMMA 2A9MH 4TTDC 1T21A 25C8L 5FYKD 4JFYA 3RWGA 5D2LA 3WFHB 5J3HD 5INCA 1T5WA 1FC2D 3DYMA 1FJ1A 3L5XH 4KZDH 4R6UA 2Q6WA 2OI9C 5DMJB 5IP4A 3FRPA 3MLUL 3KXFD 4KRPB 2R39A 5IG7B 2GTZB 1BIHA 3SO5A 5E00B 1FVDA 2RBLA 3C5JB 2QHLA 2FO4B 3RU8H 2DQJL 3WO4B 1S78C 5DHVB 4YR6A 2EZ0C 1G7MA 2ICEB 3T0EA 3MV8D 2CDGA 3W81A 3K4DA 5MEND 4F3FB 3GSQA 1DE4B 4YHMH 4O9HH 5DRXB 4U1HB 2B5IB 4IDJH 1NCUA 3KPNA 4Z5RA 5IB2B 3MUZ1 4TUKL 5DJ6B 1DDHB 1XH3A 3MBEC 5GZOC 4M93B 3U4EB 4TVPL 2HFGH 3EOBB 2A6DA 3DETD 3EO9H 2CRYA 1U95A 1P2CB 5CBEA 5GSVA 3VH8G 4LKCB 3RWHA 2P24A 4O00A 1X5LA 4MJ5A 3D69A 4ETYA 3MNVB 4J3UA 4Q7DA 3LKSB 3CZFB 3MBXL 4P3CH 2BVQB 3S96B 2WINA 4PJIF 3B8YA 3VFRB 5HI3C 2YD7A 5TE4H 4ODSH 2EYRB 2NY6B 4JPVL 4ORZC 1SEQL 4PB9L 5EC2B 5E0QA 1YYLL 3B3IA 3PWLA 4XVTH 3C9NB 3R4DA 4NT6B 2I27N 2GUOA 5LVEA 2RIKA 4MQTB 3UAJC 2EDNA 5GGSY 3QEHA 2Z92A 4NQDB 4RGMC 2XI9A 2F54A 1Z0NA 5I1IH 4LSSH 5EBMA 3ZTNH 3CC5A 3GZKA 4ZUUB 4KMLB 5IWLC 1WWWX 1H3TA 7FABL 1HDMB 1TZHA 1KCKA 1WFTA 4HQQL 3RPKA 5B38G 1J5OH 3WUWA 1S5IH 3FT4A 4YHIB 3BRGC 4OLXL 3QO0A 4DVRH 4GKNB 4PG2C 4L3AA 3QUZC 1UB6A 3T0BA 1FLRH 4XB7A 1U8PA 2W38A 3QEQB 2WM0A 2YD8A 1NGYA 1F45A 2BHUA 3S37X 1OAKH 4XZUA 3T4YB 3VG0L 5DD0L 2AXGB 1T0MA 2Y5EA 1Q1JH 1MCBA 3MPCA 1Q9KB 2LFGA 2FBOJ 2X4NB 4HJGA 3RKDC 1W0WB 5CJBA 4YXHL 3VD7A 3MYZA 3C87A 3VU2A 4GUPB 3IKKA 3DO7B 1IQWL 4L3CB 2CH8A 3BXNA 1KJVB 3SGDI 3G5XB 3EJZC 1ZTXH 4AIXA 4LRIA 4ZUSB 1X4XA 4MD0B 3S36H 4KRNA 4LMQI 4JRYA 1JF1A 2HFTA 3S98A 1JHLL 5I17A 3RVWD 2B4CL 4F3FA 1B4JL 2HVJB 5DEGB 2IH1A 3VXMA 4DUWA 1TZGL 3MMEA 5BRZD 1RUPH 3NIFF 1KXQE 2NX5D 2VDQL 3I02B 4PG2A 4R4BB 1TVHA 1KPVA 4JGJA 4YR6B 5DHVA 5GS3A 3LEVL 3OMZA 4ZUTB 1YMHB 4F8QA 3GKWL 5CMAB 1NQBA 3IJHA 4ZFGL 2MHAB 1PD6A 5EZLB 4ONGL 2DLGA 4Z7QE 4X99A 1OCWH 4PJDA 3WXWH 1V3LA 5JO5B 2OYPA 5M94B 3ARBC 1UKTA 2VDQH 3HI6L 4QLRA 2JJSA 4KMTH 4OZGE 1RMFH 4WU7A 1S7WA 4Z76B 5JR1L 1NUFA 1JHLH 3ZKSD 1TENA 5CIPA 2YD9A 3VXSB 4I18C 4HWBL 5FA4B 4GG6B 2NNAB 2WAHA 5D6DA 1NCCL 4ELMA 1NGWB 1RZKL 2OSLA 1DP0A 3I6GB 4M6OH 2WSKA 3WLWC 2ZKHH 3B5HA 3EJZD 2QR0A 3Q2CA 4K07A 4M61A 4LL9A 5BZDA 1IFHH 4GKSA 1CBVH 4U1NB 1REIA 3K7UA 4YXHH 2LVEA 5EIIA 4GMTL 1HZHH 3S4SB 3EGSA 2NY5L 2I9TB 4MA7L 4DVBA 1Q1JL 4LSTH 4NKOA 2F58L 4R3SA 4ZUTA 4QXWA 4ZFZB 5BQ7A 1RQ5A 4DOHB 3FB8A 4M7ZC 5I6XB 5IB4B 1OP9A 5E9DD 1NFIB 3P77B 2HYMA 3BGFB 2BRQA 3CMOH 5GGVL 4JDZA 4GW4A 4QOKB 3ULVH 3VXTB 5IB4A 1DQTA 1LO3H 1P7KB 2X1PA 2VL5A 3N0PB 4HQQH 1NC4B 2DQHH 1J5OL 1ACZA 3BJ91 5IUSA 3L9RA 3DO7A 4U1LB 3LDBC 4GBXD 1E4XH 1XR9A 3P4OA 1U8JB 3O6ML 4NQDE 4IM8A 3MACL 8FABB 4CBPA 3UPRA 4S1DD 4HXBH 1QKZH 4GKSB 5C08B 3GSOA 5EG6C 2ZKHL 3GBML 4YC2C 3HS0B 4HPYH 4F37K 1DVFA 4HWBH 1NFDF 4ODXB 5TE6L 1N0LA 1UB6B 3NTCL 5BXFB 2DLTA 3KXFA 5TF1L 1PKOA 2DLEA 2IFGA 2OMNA 4RWHA 1ITBB 3JSSA 1C5CL 1GIGL 5FAAA 5D7SL 1RMFL 2Z93B 1EAPB 4EBQH 3TJEL 1MWAH 3H7BA 1N6QH 1CFNB 4Y1AD 4IRJA 5D5ME 4IRSC 1CDYA 1NCTA 5F3HA 5GGTA 4B50A 1DBJH 1FQ9C 3B9VA 4F58H 1OLLA 4D94A 2PW1B 5IB3B 3GKWH 3QXVA 2W92A 3N1QC 2DTML 4LEOB 2HFFB 3H8NA 4LLMA 4M62H 5DD1L 3ARFB 3AS3A 3WIIH 5C0EA 4N0UB 3RWEB 5ERWA 1BZ7A 1DL7L 1GC1C 1QG3A 1JRHL 2ILLA 1RZIB 1T22A 1ZANL 5F3BA 4NO0D 1AXSA 4LSVH 5FM5O 3CSPA 1DQDL 2Y5TA 3E0GA 3IDUA 2VDRL 2NQCA 4HUWA 5EC1B 1A4KA 5JUEH 4PV8B 3RL1B 3CXHK 3P11H 5EU6A 4WU5A 1U8QA 5FHAL 3O6FB 1MQKL 1BLNA 1JHKL 4N5EC 1KJ2B 4UT6H 2XN9E 4MCYA 1ORQB 2FEDD 4ZUWA 2P47B 3QCVH 2FSEB 4G6KH 3L5WA 2LU3A 5DJ8A 3UXFA 4YXLH 3H0TB 5DJZB 2BRRL 3O81A 1FLRL 2MKWA 1VFBA 2WP3T 3RGVA 2DQGL 5KW9H 2CRIA 1EK3A 1W2KT 1GC1H 2W60A 3NCBB 3KLHD 3MUGB 1YNTB 3NPZB 3AM8C 4D9LL 3AREB 2WK2A 4PP1D 1MSPA 2NXYC 3EJYC 1YMMB 3PQYD 1JMXA 5T3ZH 3O9WC 3BWAA 3TEUA 7FABH 4RFOL 1EO7A 1SJEA 1CGXA 5TQ2L 9CGTA 1MAMH 4J1UA 2ZSWB 1GGBH 1XGRB 5C0ND 3C6SB 1OL0A 2ENSA 3IU3B 4XBGA 3V6ZB 3O3EB 5HHNB 4QXTB 3IJSB 1CXIA 1HCVA 3FQRB 1TJHL 3HR5A 4BH8B 3D0LB 3D39E 2BX5A 3HCVA 3BEVA 4YO0B 5KJRH 2HVKB 2GITB 4XVTL 2R1YB 4CVXA 5F1IA 3JV0A 2JTDA 3PWLB 5IKCB 4Q9QL 3REVA 5T1DL 1NLBH 1ORSB 1QFUH 4OIAA 2ZNXA 3EFFB 2H32A 5H35B 5DSCA 2FJHA 2JCCB 3T0VA 3UJJL 3R0MA 3OKOB 4YHKH 5C1MB 3UPAA 4ZNCD 3CVHA 3E6HA 5ESQB 4HWEH 4NJ9L 1IVLA 3OZ9L 4GQ9H 1MF2L 1I1CA 2DIAA 5SWSB 5DJCA 4MJ4A 3QQ4B 4LHQB 4X80H 3R1GH 3WFCH 2NY4B 3LCYA 4KPHL 1KTKE 4MAUL 1CLOL 1E27B 1YECH 5DUPL 3QBTB 4XAWH 1DSFL 4Y5VB 2OP4L 3QXAA 2B1HL 3WEXA 4UV7L 3BWAB 3G5ZA 4AG4L 4OD3L 4NQEB 1PY9A 2OJZH 3T0WA 4MJIB 1JZ5A 2IG2L 4X6DB 4LLVB 5DYOA 3GMLA 3BP7A 1T1XB 4U1HA 4MA3A 3V6OC 4FQ1H 4MAYD 2AJ3A 1OM3L 1BHGA 1INDH 3CFIC 3WNLA 1DANT 5JA9A 3PL6B 3H0TA 4LNVA 1UZ6F 2Y07H 2DMCA 3IDJB 1X4YA 3LEXA 2FO4A 4N8CL 4I9WE 1VA9A 3AM8A 1UG9A 2DM3A 5JORB 4AQ1B 3VXRD 5F9OL 4HPOL 4HIHA 2O93L 3DETC 2PTTB 3C8KB 1AKJB 1Z3GH 4L8CA 4LVNB 5BS0E 1U8IB 4FZ8L 3SGKC 3EZJB 1S3KH 1K2DA 2W0FB 2WQ8A 2XKNA 4ORGA 3DV6B 5EOTA 4YHLH 4L3EB 3PWJA 1EEYA 1HN1A 5HHXL 5I75C 1FIGH 3MSPA 4UILH 2YPLE 1S8DB 4N8PA 3EHBC 3FT2A 3EUUA 5D5MA 1HHGA 3VXOB 1I7TA 5HJ3B 2A1WH 4E9LA 2F9BT 4ZYKB 1U36A 4PJEB 2FZ3A 4PG9A 4WO4D 5ETUB 1MFDH 3UAJD 5C6TL 2VXVL 1U8HA 2XN9B 4NKDA 3HAEB 3GM8A 1PKQE 5IBUB 1D6VH 3VWJC 2NZ9C 1CT8B 3BPNB 4R4FH 1BQHG 3P40A 4YHOL 1KOAA 2XQYG 2EEBA 2H6PB 5DK3A 4R96B 2MQCA 1MVUB 4N90E 1T4KB 4OFKA 2H26A 1F8TL 3RQ3A 1E28A 1G9NL 4MXQD 4XP4L 3STBA 1QYGH 2OZ4L 5C6PB 4YDKH 4YWGL 3GMQA 1K3IA 4FTVD 1TJGH 5GJTH 3GMMA 3FJTA 1ZEAL 4HCRH 5DT1L 1AE6L 1UVQA 3MLWH 5DD3L 4L9LA 4ODXA 4PP2B 1IQDA 3VFWB 2QEJA 1WBYA 3AC0A 4MNQB 1SYVA 5EN2A 2LTQC 4RAUB 3CNKA 2VLJA 3M1BA 5F88B 5C08A 1PG7X 2AEWA 5DURD 4X6DF 2JCCE 2VSCA 2Q76B 3VD4A 1AXTH 1BIIB 1T1WB 4B7IA 4KGJA 3VJ6A 3BQUC 4KTDH 3WJJA 4LSDA 1G6RL 4NYLA 1MJJA 3TV3L 1BFTA 1BPVA 1YQVL 3W0WA 5ITBH 3SKMB 3OG6B 2IPUK 4XAKD 4RSVA 2BVEA 1I9IL 2BDNH 5TDPA 3KLAB 2ITDA 2F53B 2BVPB 1RIVH 4GJTB 5DK0B 1MFBH 2ICES 2NZ9D 3IXAB 4G6FB 1UWEH 5AAMA 2D0HA 1S7TA 4UQ3B 3W82A 1I4FA 2AK4D 3SE4A 4EDXB 3VFSB 4JZNB 3KYKL 3VFGH 5E95B 1T0PB 2XTJD 1VPOH 4HH9B 1T4KA 4Z6AT 2IAMA 3H42L 3ZHKA 5HTSA 4EUPB 3GMOB 3F6IA 4MHHI 3SGDH 4F9LC 2WMPA 3MOBH 4PRNB 1OB1A 1LEGA 4XNUH 1DN0A 3WHE1 4JKLA 2J8UB 1BD2E 1RZ7L 1UH2A 4S2SA 3SDCD 5DRWA 3FFCB 3CH1A 3QDAA 3BDYL 4LBEA 4GG8B 3IFLL 4L29A 1A5FL 5C0CE 5LCVL 1ZV5A 2FL5A 4KJYA 1HI6A 3RY4A 5D5MF 4QHMB 5CIPB 1OVZA 2AJSH 3PHSA 2HLFC 1QRNA 3P0YL 3U9PL 5IQ7H 1S7WB 5E5RB 3PABA 5EUOF 5EA0H 3BEWA 3OB0H 4LK4A 3C8KA 2NY3D 3DX7A 2C3WA 2SEBA 1NGXA 4PJDB 4N0RA 3EYUH 3NZ8A 1A8JH 3QWRD 3MRHB 4L8SA 1JGUL 1J0IA 4CU7A 5MP6L 2IQ9L 4MAYA 2C3VA 3L3GB 3NIGF 5FO9B 1HINL 2ZOKB 2WQRA 1EXUA 1KCUH 4JO4L 1OD7A 4WV1B 3VCLB 3MRGB 1DUYA 2O26U 3VGAC 2BNRA 1P1ZA 4MNGB 2GSGA 5C2UB 4URTB 5ICYB 2UUDK 4XPTH 4ZNEE 2HG5B 4P2OD 1UEMA 1IGIL 4K23L 3KDMA 3WLBB 4RIRB 5C0FA 4K23H 3T1FA 4WHYH 2VZUA 4GRMA 4X4MA 2X05A 2AJXH 3VE0B 4P9ML 3QR2A 5CFHA 4JFHE 4Y2OA 3MLZH 5EBWB 5LBSH 4RAVB 4JE4B 5DVMA 1T5XB 5GJSH 1JUFB 1YEEH 5CGYC 4Q9RL 2IQ9H 3ULVC 2BSRA 1A14L 3P4NB 4NQVA 3SQOH 1FYTB 4XCNB 4BM7A 4U2YA 4UOJA 1RUQH 5EBGA 1IARB 1HCFX 4HXAH 4Y5YB 3DMMA 3BGFC 2PCPA 2V9QA 3JV5A 2AABL 1WEJH 5KVDL 1OGTB 5DXWA 4JPWL 4PJ5E 1CFSA 1K4DA 4ELKB 1NBYA 3C2SA 3GUTA 2VJXA 5GGQL 2VR9A 3QFDA 4GS7B 5ICXA 5FDWA 4LGRB 3J7HA 4OB5L 4XMKL 3FQRA 4BH8A 3U0WH 3U36B 3ULUL 1FO0B 2HT3C 3FB7A 5AUMB 4MQ7A 4CDHA 5K9QI 2CXGA 2R2BA 3VRLF 4WHTA 1IT9L 4POZD 5KBNC 5CJQL 5LXGH 1W72B 1QFOA 5D7JC 1OAZH 2R69H 4S1QH 1AP2A 5T1MA 1KJMB 4JRYD 3GHEL 4X9HA 1MCQA 2ZSVA 3C6LB 1VACB 4OF8A 4PGZA 3BH9A 2I26N 4EIZC 5C7XH 3A6OA 3CFEA 3SCMA 4LCWD 1IAOA 1QEWA 4AEFA 2QKIB 1BZQK 4RMSA 1LEIB 2ORBH 4FP8H 3QIUD 2V2TA 4GSDH 1U9KA 2DQIL 4WI6A 4ZSOB 4ENEC 1KT2B 3VGHA 4M03A 2E6QA 2GAZA 1T5XA 3MLZL 1IGCL 5EPMA 2AJYH 3F7QA 2EEAA 2LU4A 2C4FT 2ZZUT 4GAJH 4M6MH 5IB2A 1G1CA 1P6AB 5DR5H 3TA3D 4AEHH 3QO1B 1S7VA 5I16B 1AXSB 1JGLL 1IAIL 4QRSA 3VXRB 2ZPKL 5H8DA 2VXTL 5EO1A 4LSPH 2VDNH 2P1YA 3MRNB 2NXZB 3F7YB 2I5YH 3U7YL 3ARFA 3GSUA 2ICEA 3WUWG 1N5AB 2Z91B 4F2MB 5DTFB 1FCCA 3U6RA 1AR1D 1V7ML 4KK8C 1TETL 3MA7B 4GG6F 4ZTPH 2C1PA 4UNUA 4ZXBD 4QKXB 4R4FL 3AAZA 3NH7L 4LCIH 4C56B 1EVUA 4XXDA 3V0VB 4RGND 5E2WL 3HC0B 2VDLL 3UROR 3X13A 5CGMA 1D5MB 3TT3H 4PIRF 5TDOB 4QXGH 5HYSB 5EIVA 5K59E 4FFVD 3S35H 5SX4H 2E8ZA 1T7XA 4HS8L 32C2A 4Z78B 4DZ8B 1H0DA 1IZKA 5E70A 3CXDL 3U1SL 1YY9D 5FKAA 3ARGA 1QNZL 3KAAA 1MEXH 1FYTE 2Z31C 2ZUXA 4ODTH 2WANA 2X89D 2V2WB 3OHXA 3K4ZA 4HULB 1EHAA 5FECA 3E3QC 4HSQA 3VXUE 4C56D 3ZYJA 1JE6A 3NA9L 1Z3GL 3BPOB 4O58H 5GRXG 5TDOA 3H3BC 1KCSH 1J1XH 3V0VA 1NC4D 4KV5F 3ZO0A 1MCOL 1BGXH 3TCLA 5JHLL 4S1SH 3T65B 4HKJB 1Q8MA 4TSBH 2QHRH 5E5MA 3FQTA 1KIRA 2B2XH 3BZ4A 5B39A 3U6RB 1NEZB 5BVJA 1JPST 1N5AA 4OZFH 1VPOL 4RAHA 5C0JB 3OX8A 3O4LB 5BO1H 4J12A 3IGAA 1HXYB 1T1YA 5FHBL 2VDMH 1LK2B 4U6VH 4OM1H 3QHTC 2KZWA 2VERN 3T0ED 2BDNL 4YK4B 4MWFA 1FL5B 1IEAB 1JGDB 1IC5H 1Q9WB 4UV7H 4R2GC 4FQJH 1LE5B 1PZ5A 4TVPE 3TO2A 1YECL 1BIIA 5FYJE 4TQEL 3CPLB 5J1TC 2E7BA 5D93C 4ZSOA 5C0GA 4JQVC 3R1GL 4RWYL 2GCYB 1N8ZB 3MYJB 5EN2B 4PJGE 1LMKA 2CMRL 1S9WB 1MCKA 4KFZC 1A7PH 3D3VA 4H25A 2OTWB 4K55A 5GZNC 5D1QB 4OUUA 2R0LH 4X83A 3Q5OA 1UKSA 5JDSA 4CJ1A 1EX0A 4RQQB 3ZE1E 1KCRH 3QNZA 4Q9QH 1MIMH 3OXSA 4LCWA 5BOZG 5LGHL 4X99B 1FO0L 2H6PA 3ALXA 3UPCA 3QHFL 1U8HB 3K2UL 3IKCA 1UWXH 1F90L 1IGJA 3QUZB 1TVHB 4F7PB 5CBAA 1LO0H 1QSVA 1MAML 2VYRE 4IOIB 3E8UL 5EULV 4QCIA 1Q72H 3UZQA 3ZL4L 1RZ8B 4JHWL 4TOYH 4DFIA 4P2QE 4XP5L 2X4SB 1FNEB 3TNNA 5DZOA 4RISL 4X6CE 2ICCA 4TUJB 4UILL 4PP1C 1OPGL 4G43B 5DJYA 3O9WD 1CL7H 5FYKL 1MCWM 3BVNA 5KW9L 4OF3A 4U1JA 5ADPL 5DWUL 1TZIB 3T0AA 2JE8A 4OCWH 4EN3C 43CAA 1HSBA 1FGVL 3QULA 1U3HA 1OF2B 3S9DB 3B9KC 4L4JA 3H9HB 2F74B 4JAMB 5I9QB 3G08B 5J0BA 2AXGA 5BS0D 3IRZA 1CTOA 5C07A 3NGBB 1HHIA 5D7IA 2GJZA 2BNQB 2R2HA 1U8PB 2VO5A 1AGBA 3RUGF 5IBLD 4PRPD 3SDXE 4N8VG 2B8OT 3C2AH 3ILQC 2AQ2A 3U4AA 1AGFB 1DQDH 3TO4A 5JXEA 3BP5A 3NOIA 4OD3H 1AD0B 4XNZC 1NCBL 4NQED 4PD4J 1CFTA 1DL7H 2BNRB 4EXPX 4XWGL 4BQ6A 1CVRA 4F7MB 2DQEH 4PTTA 3HB3C 4X9IA 3UO1L 4OGZA 2V7NA 5D6DC 3GMRB 4E0RA 5C09A 6FABL 2CKBA 2Z8WC 5D1QD 3K8KA 1U8MB 3PABB 2WBKA 3BRFA 3UZVB 1BFOA 4LHUG 1QQDB 4KZEL 5CJXC 3CFBA 3BISA 1RVFH 3AS2A 4PFEA 3LEYL 3FOMB 3L3OB 4JANB 3C09C 5IKCA 3CXHJ 3CFJB 4JFPA 1WV7T 5FB8A 3MNVA 4M43L 2D0FA 2EE2A 1F58H 4LKCA 2NY3C 2J8UA 4AJ0A 5HHME 4ZO6A 5IOPB 1IAII 4WWKD 4TVPD 4A6YA 4ZXBA 1NCWH 1X6LA 3IU3A 4RX4D 3D39D 5IVXF 1GGBL 3DPBA 3MACH 1JTOA 3JUYA 3MFGB 4YE4L 5TQ2H 2EXYD 3GJEA 5JW4R 4OF5A 4PGBA 3QEUB 4FNLH 4S11A 1GGYA 1CG9A 1CDGA 1FE8L 1XIWD 4AL8L 5KTEL 4Z7UA 3FONB 2XA3A 2QSCH 4ZG1A 5FDYA 2P5WD 3KJ6L 1BOYA 4MD4B 1ZT1B 5L2JA 5DQDL 2EDYA 3KYMA 1WCBB 1JZ4A 4YXLL 2GJZB 3FO1B 3D39A 1X5KA 4XPHH 2FRGP 2G60L 5JMRA 2GT9A 3OTTA 2EC8A 1SY6L 4G6AC 3VA6A 2WV3A 4MA7H 5I76A 1MCPH 4MQXC 1ZSDA 3VW3L 3VFOB 1J0KA 1MFAH 2KZ1B 2WWMD 4Y4FC 1Y0LB 1OOAA 5EU6B 1CGYA 4XPFH 5LJYH 1DJSA 4RFEB 4QRRD 3BWUC 4LKXA 3HE7A 4YHPB 2P7TA 1M7XA 2NY1B 5DJYB 1FFOB 2DKSA 4HKZA 3TPKA 1HYRC 4CW1B 5I2IB 2COQA 4FQXB 2HKHL 4K8RC 1QSED 1Y6MR 1DQMH 2BNQE 3VRJA 4N9GA 3UYRH 4HFUH 3QUXD 3ZT5A 1NUGA 4NQDD 3O6LL 4WDIB 1JWUB 3ZDYF 3U0PB 4P3DB 4UTAH 1M7DB 2NY2C 4KRMB 3V5DB 1KTLB 3P73A 4JN2A 5JLZA 3FAWA 4E41D 4PPTA 5K9OA 1MAKA 2RQ8A 2YD5A 1JNNH 4L4VB 5JPMA 4P57A 3STLA 4U7KA 1B6DA 3RWJA 4FXLA 1HNFA 2D4DA 3DI3B 4P2QA 1HEZB 3V9FA 3O2DA 1MWAL 4R0LC 3BSZH 5D7SH 3WIFA 4C83A 5HYIA 1ZVSB 5TF1H 5F7FA 2ZCKL 4PRHD 1Z9LA 4APQD 2F15A 1VSCA 4G3YL 5CILL 4YHPA 3MOQA 5I1CL 3T08A 4YBLC 2D7TL 3TPUA 2PO6A 3LH2L 3KR3H 5BS0A 2VDPL 1BX2A 2XWJB 2PXYB 3QIUC 2DAVA 3DURB 5CZKA 4APQA 2CK2A 3WSQL 5ANME 1NCDH 2IQAB 4HGWA 2D31B 5CEYB 3O45A 3MOAH 1GGIH 2V9TA 5L88L 4G9FB 1KTDA 3D25A 4CNIA 3ZE2E 5L0QB 2DICA 1ZXQA 2R0ZH 1NUNB 5GGVH 4LVOC 3PJSB 4RZCA 3U0TB 1NFIA 3P77A 4DVRL 2AK4E 1NL0L 1AGCA 1TNMA 5DQJA 5EIQA 4K94L 1G9ML 4JFZH 3QDMB 5L88H 4Y4HC 5DJ2B 2ID5A 4UBDD 3HTLX 4GW5B 4JY6B 1A6WL 2J7LA 3CVIH 1SBSH 5DK2A 3MNWA 1MRCH 3H9SE 3MREA 1GH7A 4QOKE 1AR1C 1D5XB 4NWTL 5D7JA 5C09E 3CX5J 1M7IA 5EUOA 5EIIB 5E6ID 3QB7C 2GI7A 2ZCLL 4QRRB 1E4XI 3RKDD 3BD3A 4EVNB 3ES6A 5DFWH 3RL2A 4HUUA 3RGHA 5C0CB 1ZA6B 2BMKA 4PGEB 5HDQH 5J9PA 5C08E 4P5MB 2FJHB 4Z76A 2DOCA 4AM0B 4YBQC 3JBG7 3NMEA 3VWKC 1EIBA 4YGAB 5CAYB 2VLME 5SX4I 2KQMA 4OM0H 1P6FA 4FXKA 5ELIA 3BEVB 2ZUTA 1Z9MA 1I1RA 4Y4KA 3N1MC 1D9KC 4R7DB 4JKMA 1RFDH 3M17B 2XFXA 1A9BA 4XBEL 5KZCD 3AAZB 4ODHH 1BEYH 2HFGL 1BFVL 3MFFA 1QSFB 1WZKA 1QOKA 3LKRA 5F1NA 1WWAX 1K8DB 4XNYH 4U1KB 5BV7H 4Q9CA 3QFJB 1PG7W 1NCBH 4MA8H 4F80A 4HMCA 4D9RD 3ZKND 1LD9A 4JZJB 1ZLSH 3GSNB 4J3OC 2A73A 3S36L 3D5OF 3MRLB 1S9VB 3UTTE 1ZTXL 2E9BA 3GRWA 1Q9LB 5ALBL 3O11B 3ULVE 2BNQD 5DJZA 3WLWD 1B0WA 2ZUWA 3HMXH 3RPIB 2F5BH 2WIMA 4X4XB 1BMGA 5I8CA 1WK0A 5K9JL 1IILE 4Y7MA 5FUZH 5FXCH 1XGQB 3RVVC 3PHOA 5IEHA 1UCTA 5IW6A 2VLKE 3VWJA 3RZCB 43CAB 5A43C 4F7TA 1U8OA 4GMSH 4K9EL 1A3RL 4KZDL 5L7XH 3S34H 1FC1A 5IFAH 2APBA 4YFLF 4PV8A 3RL1A 5A2JH 3JV4B 5FYKH 3CLFH 4MA1C 3RY5A 4WW1A 5FA3A 5MERB 1I1FB 5ANMB 5KTEH 2BNUA 1LD9B 3N1GC 3DTXB 1VEMA 1FGNH 1MHEA 3JZ7A 4DGIH 3F5WB 4HS3A 4PD4K 2CK0H 4LEOA 4ETQA 4JPIB 2IBZY 2Q7YA 2NY0D 4WI4A 4JLRA 4YDIH 2XFXB 4JR9L 4DTGL 4M43H 5I1JH 3BQUA 1C8PA 1G0YR 2PW2B 4KZEH 5T5NF 2W65B 1B4RA 1F4YH 5H2BA 5L2KB 2IALB 3W5NA 1NAMB 3MXWH 2FECL 4TPRL 2AK4B 4LVNC 4WW2C 1FIEA 3WDJA 1FG2B 1AH1A 3SE4C 4XPBL 2E9WA 2VXUL 3KYNB 5JOFB 5I75B 5EO9A 3KPTA 4HKXA 5KSBA 4OLWL 1QD0A 4TVPH 1MI5D 2P5WB 3V52H 1MNUH 2VQ1A 3G6JF 5ESVB 4OD1H 5JW3H 4FXGB 3PGCA 4HIIB 5C9JB 1JHTB 2X40A 3VI4F 3BHBA 4KI5F 1H3WM 1I7ZB 5E6IA 1JGDA 1BF8A 4NOFA 5J7CC 3ARQA 1UJ3B 4LLQA 1C5BL 4RGNB 3QRGL 1U42A 1J87A 3RVUC 1Q0XH 1UM4H 4JFOB 2VDML 3VXQA 5HHQB 3PQYB 5KS9A 3ILQD 1QACA 4MNGA 3S97C 3FB8B 2P49B 4J4PC 2GY5A 5IM7B 5C92A 1KPUB 4JHBA 4LRNH 4RRPA 1F2QA 2DQJH 3HLAA 3T3ME 2VLKD 1YYMH 5EUOE 4JO3H 3E6FB 2NXYB 2O5ZL 3STZA 2X4QA 1MI5A 4O4YH 4OLEA 1MHHB 2AEQH 5DI8A 3D3VD 4NN6C 3WIHA 3L5XL 3NAAL 3ARDD 4AZ8A 5I1HL 4RGOL 3I9GH 4WTZG 1OT2A 1KB9J 2X4OB 3H3KA 3ARFC 3CAFA 3VXSA 2VITB 2LU7A 1T21B 3KPQB 1FNSH 1N2RB 1YC7A 2F8XC 4XH2B 3LQZB 3IRPX 3WO4C 4HFWB 3NBNA 4M7LT 4MXQC 2NXYD 1J12A 1NGQL 4J4PA 1KF9B 4QEGA 5HD8C 3CCHB 4OZIB 1QHPA 3OXRA 1DN0B 4LHUB 5E2WH 5IVZB 1MRFL 1ROWA 1UQSB 2BCKA 1PX4A 2C3XA 1RUML 1KJ2H 4IIQA 5HHOE 1A4JA 3HLAB 4M02A 4KMQA 3QZWG 1EGJL 4TUOB 3THML 5EZJA 1JWUA 3CSBA 4U4BA 2YN5A 1RJZA 4LQFL 5L2KD 4ZTOL 4Q6IC 3T77B 1K6QL 4P2OA 4P23B 4LSPL 1XIWC 5I1AB 2R0LL 2VXTH 4HKZB 1NMBH 2BVOB 5IMKB 3RWIA 1KNOA 4UV4L 3QQ9C 1B2WH 1ZWIB 4MDJB 4WY7L 4HUVA 4GAJL 4NYLB 2B1AL 4GRWF 3GJFA 3MXVH 4X6EB 5F7YC 1HH6A 4PJ5A 1T03H 5I76B 3MLPA 3WE6B 1E6JL 1I1AD 4HKXB 1JPFA 1ZGLM 5D7KD 4XVJL 2OK0H 3WXVH 1FZOB 2MTPA 4LIQL 2AKRA 1I8MA 3T3MF 5E4IA 2YA0A 3QUZD 2W07A 1E4KA 3LS5L 3C8HA 2M8XA 4Z7UB 3O3AB 4P4KD 5DUBB 4WCYL 4OIIH 2R2EA 1PAMA 2O5XH 2OL3H 3GIZL 2HLFD 5HYEA 2QHRL 3O8XB 3TZVD 4XPAL 3D0VA 4PRAA 5A3ID 2BHZA 3QEGL 4FQ2H 1YMMD 4A6YB 2IWGA 3GI8L 1FZKB 1WIPA 4O58L 4KXZI 5HD8D 2YD4A 2CGRH 3OKEB 3IETB 1R5WA 3ECBA 1I8LA 5C8JA 3UCRA 4IRJD 5IVXA 3O41B 5KSVA 1KLUB 2QQNL 3U2SB 4ODTL 1S8DA 1WFOA 2L7JA 5T3XD 4ZFFB 5E6YA 4DZBB 4POYA 1IKNA 1OGTA 1QSFE 3VFTA 4NZJA 5L6YL 2H9GB 3WS6C 5KVDH 3VXPB 5ILTH 3VFRA 4HWZA 5F89B 1FL6B 4P2OC 4I3SH 4PJIB 4PJGA 3KLDA 4HS6B 4NQCB 1RZGB 5JOPD 3PDOB 2Q8BH 4HHAB 2OQJB 4X7CC 5TH2B 4WTXA 1QVOB 1TETH 4MJID 3WL9A 2ADIA 3O3BA 2XZCL 3SDAC 3QA3B 3BOVA 1QLRA 5DEZA 3A6BL 4RGMB 4KUCD 1OWWA 5DJ6A 2W91A 3C60B 3MUY1 3ZE2F 3MRLA 4PJBB 1QSEE 5JHDD 4LCYB 2W1NA 2ADFL 1PKQA 2FB4H 4G8FA 4AMKL 5HHOB 1ZGLA 2ADFH 4N9OB 1YDPB 3BPCA 4Y4KC 3VG9B 1YY8A 3WUZA 3T0EB 2B0SH 4WV1A 5J6GB 3QG6B 2QQQA 4X7TB 3C6LC 5ADOL 3FT3A 5IJKA 3LN4B 5D7KE 2OR9H 1MCWW 5TH2A 1MRDL 5EBLB 3M17A 2F74A 4JAMA 1MHCB 2CJUH 4M1DH 1N3NB 3DVNA 4FQPA 4PJEE 4HX1B 4YDJB 1D5ZA 3MJ9A 1BAFL 1CLCA 1RK0A 3WHXA 2H3NA 1MCEA 3WFEH 3MCKA 43C9A 5IMLB 3RDTD 1A02N 1KEML 3RI5F 4IRSA 1JTTA 3TESA 2ATKB 3WIHH 2DIBA 1E4KC 1KCVL 4LPVA 2J88L 2HVKA 2ADJB 4U6XB 3V7AE 1U8NB 5E7BA 3W0WE 4H88H 2EXWC 1C7SA 4EI5C 5JQ6H 4X7EC 4GBXB 1EO8L 4OLUL 4AT6B 5LGJB 1BOGA 5E1AB 1RULL 5FGBA 3LSOA 3UJTH 3PWVA 3WJLA 4OZ4B 4YK4C 4UNTA 5DUML 3UEZA 3FO0H 1AJ7H 4JFFA 2HJLB 2WBWB 5ITFA 3AMKA 4DGVH 2D7NA 3Q6FA 1MJ7L 3SOBH 3QUYB 5ENWA 4KQ4L 5E9DE 5I30H 1CK0H 3O6KL 5KVGL 1S7TB 4UQ3A 1IGFL 4JPWH 1WZ1H 4X5XB 3C60A 1ND0B 4NQCD 4TNVK 5FYJU 4EZMA 4UOW1 4UOW0 4XC3H 3O45B 4ZAKC 1DQQB 2Y4SA 3UX9B 2X1WL 4X98A 2R1XA 5LWYH 5BJTA 1EV2E 3OKMB 2BC4B 3PDOA 1AIFB 1M6OB 4M5YL 4NQCA 1UZ8B 2EC9T 4R0LA 4YJZL 1EEZA 4JZJC 3NZHL 3BPOC 1F3JA 1MCIA 5HDBE 1IEAA 4DZBA 1X5XA 4OBSA 1F11B 3QRFM 3D1MC 4UV4H 4PRPB 4O5LH 1BJ8A 2J8UE 5E8DL 4RMRA 2HTLC 4WNQA 4MXWH 4QHUB 3V0WL 2V17L 1R3KA 3BP4A 5A2KH 3OGCB 2ERJB 3ARBD 4JM2B 4K7PH 1I7UB 3NFSL 4PRHB 4M8QB 3MRIB 1HK6A 1VADB 3B4NA 2HFFA 3I6KB 2RCSL 2AV7A 4EN3A 3HAEA 4BSJA 5F3HB 1NJ9B 3KPSB 1KFAH 4F57L 2FX9H 2F54D 5IBTL 4WDIA 5AYUH 1XF1A 3UJIL 2EDQA 3EOAA 4QHUA 3IFOA 3P4LA 3F8UB 4OGYL 3IYLW 3E3QE 3QJFB 5ACLA 3P0YH 3U7WL 1NFKA 2FGWH 5E4EB 3KXFB 2ARJA 1NCAH 1U58B 4AENB 3TBYB 1NAMH 4OCXH 3NGBC 1G1YA 2M1KA 2NTFB 5B22A 3TO4C 3EIFA 2B5IC 2XWBB 4KWUA 5GISH 1UYWL 4OZFG 4RGOH 1RZ7H 5CSZA 2G2RB 4O2CA 4I0KA 1LVEA 5EB9A 3RIAK 3T0EC 3DO3A 2WBJB 2GFBA 8CGTA 3T2QA 4LPCA 4XCEB 3E6FA 5D1XC 4U1MB 1TTGA 2DLFH 2F54E 2NY4D 3IAQA 3MLTA 2O5XL 3GIZH 3SBWA 1AHWA 1MFEL 1G7HB 4OIIL 4Z77A 1P7KA 1EA9C 3BT2H 1EJOH 3OAZK 3MJ7A 4X6BB 3TBSB 3F62A 3RZCD 2PNDA 3GMNA 2BVOA 1PYWB 5JHDE 1II4E 2ATPB 2HP4A 1KN4L 2NY7H 4X6DA 1Q0XL 1UM4L 1AQDB 4XVSH 3QO1A 4LPUA 4LLQB 1RJZB 3O4LE 1CGSH 1UCBH 3KWWB 3RWDA 2B1HH 2QTEA 3TNMB 3LSOB 2OTPA 4I77H 2MFNA 1DLFH 5CJXA 1A1OA 2APVA 4MAUH 1RU9L 2IPTL 3WFBH 4OV5A 4QRRE 1BVKA 3MNZB 5BZDB 1NDGB 2IH3B 3IFPA 4C55A 4NNXB 4X80L 4R90L 5CCKL 4N68A 3JWDL 3MLVL 3EW3B 4LPTA 4BQBA 1XGUA 3LQZA 3ARDC 3PWNB 3EAKA 3FTGB 4WFGE 1MHPH 4OKDA 1QSFD 3GHBH 1NKRA 3RJDA 1KLGA 5ABDE 2N56A 1F4YL 2V2XB 3DBXA 3S88H 1T89A 5I1GH 2ESVE 4PLOB 1RZJH 2VC2L 5D2LF 2RJMA 3RIAF 5T1DH 4N0CC 1ZMYA 5CJOL 4NM8H 4PJ7E 2X4QB 4Q2ZA 3GGWB 4HJ0C 5C09B 5I1LA 3PF2A 4JFED 1YN6B 3RBGA 3HNVL 3NIDE 5DMIL 4X6FA 4LF3A 5DO2C 3VD9A 3O9WB 1JI1A 1QPXA 5I66B 4XI5C 1G7QB 1V8HA 5JZ7C 3FB7B 3T4AA 4ISVB 2DMBA 5J6HA 4D3CH 3QSKB 5E9DA 2BNUB 1DVFC 2XTJE 4B41A 3EHBD 4IMLB 4LOUD 5CZVL 5IB5A 1EMTL 4MD5B 5I18H 4PRPE 4XP1L 1NPUA 5HHXH 5FM8A 4LLYB 4HGKC 4D0DB 2C5DC 4IOFC 3A67H 3S34L 2EKJA 2BRRH 5DD6B 1U41A 1CE1L 4NO3A 2YA2A 1WIOA 2NY0C 5IW6B 4KDVA 4V1DB 4DWHA 3CUPB 4K3JH 4HG4K 2O5ZH 1OSZA 4MCZB 1FYTA 1T2XA 4PR5A 1I7RB 1OWRM 2UYLB 5KSBB 4E41B 2VLKB 1UACL 5JA8B 3VDBA 3S5LB 1N0XH 5ID0A 3EJYD 4DQOH 1MJ8H 1A7BA 1F4WH 1QPPA 5I0ZA 2YPLB 3F65A 1RZFL 2DM7A 1N7ML 3BKJH 3HPJA 1BBJA 4M6NL 2A73B 3LQMA 2GTWB 1F97A 5GS0H 1UA6H 1YJDL 1FN4B 1HQ4A 1ZANH 4AIZB 3LHPH 4ODBD 2Y7QB 1T66C 3ULUE 2OP4H 1G7QA 1P4IH 1KXTB 3DRTA 4G8GA 3U30C 1WLHA 5IMOB 1WFNA 5GRZA 5F9JA 4G8GB 2Z92B 4NQDA 3GGWA 2YD1A 1OHQA 3E2HC 4XP6L 4A6YH 5DS8A 1MHEB 4I2XA 1MF2H 4NJAL 4XTRC 5KANG 4LCWB 3FN3A 3T09A 2A6JB 3DTXA 4HJ0D 1T04B 4PLJC 4MX7A 1G0DA 4DK3A 1CFNA 3ZKXC 4UDTA 2VWEE 4G9FD 5J1AB 1TQCC 4N0FA 5EC2A 5B38A 3CFKB 4G6FD 4NRXB 1GIGH 3WNOA 4CMHB 2EIZB 3ESUF 1INQA 1DLHA 2QQLL 3RWFB 2IBBA 5BMFH 2R56H 5ID0B 3F7VB 4U3XA 5BZWA 1CD9B 2VLKA 5FUCC 5J4MA 2C4FU 1BVKB 3MNZA 1OTTC 3OF6A 4X6EA 3PHQA 4M48L 4NO3B 2XIDA 1G6RB 1OAXH 5KSUB 1I9RL 4QRTA 3CX5K 1ZHKB 3LIZH 1FL5A 3SEPA 1PVHA 2R4SL 2CRZA 3WFDL 4BSWA 5L2KE 5HYJB 5IMMA 3TVMB 1NL0H 1JJUA 3L5JA 4GW4B 4QOKA 1X5IA 5FK9B 4P23A 3MGAA 1M05B 35C8H 3V4VL 4I48A 3QFJA 2BVPA 5DK0A 3O4LA 3VDCA 1KN2H 1DANU 2E7HA 4KKAD 1E4WL 1GGIL 5K93A 4PTUA 2BCKB 2P8LB 5FUZL 4DEPB 2O5YH 4MZ2A 5GGVY 1HZHL 1BQUA 2MPAH 3OR6A 2LV4A 3B9AA 3MROA 3TVMD 1RY7B 4JFXB 1JK8A 2YPLD 4MMZC 2YRPA 4KROB 2BOBA 4OZGB 1NMCC 1X9QA 3I6GA 4JQIL 2E7CA 3ARYA 5EOCL 4GRWH 4EKXA 4WUUB 2PUQT 4XH2A 1JGEA 2XZQH 2ZUQB 2BY0A 4PJXF 1AXIB 4HJJL 5KSBE 1ZLSL 1EHXA 3GMMB 1S9XA 3TF7C 5KVEH 3RX8A 4NDMA 3KPSD 3LPFA 4Y89A 4ZDHA 1HEZA 1RUAL 4MMXC 5AWNL 5DD1H 4EVNA 2UY7A 3CIQA 3U46B 1W8NA 3B6SA 2AJZB 3OL2A 4OCLC 1BEYL 2MHAA 4V1DE 2J6EA 2BK8A 2B4CC 3G04A 4JN2B 2AERT 1RFDL 2VXQL 3MNWB 4P49A 1YMHA 1G7PA 2A6IB 5FO7A 4OM0L 1Y18A 1I1YA 4MNGE 3FB6A 4OFYD 2IMMA 1LO2L 5I8EA 2APTA 2FIRT 1B4JH 2RFXB 4PJHB 3HZYB 2GJJA 1NC2A 3LZFH 4PRPA 3SO3B 5FGCE 2XA8H 4NHUB 4NUGL 4U1IB 2XZQL 4GAGH 3Q48A 1MI5E 3OAUH 4OZGF 4P5TB 1HHJB 4FXGA 4HIIA 1Y0LA 2HKFL 2AJZA 5C70A 3LV3A 3PV6B 4NCDA 1FDLH 4GAYA 1A6TA 5EO0A 4QO1A 1MCPL 2UUDH 4JVUA 3LV3B 1MLBA 1WZMA 3PP3H 3IU4L 1MRCL 3CZJA 1VGKB 2R29H 5BRZB 2A9NH 4L8SC 4KI5C 1XFPA 1PG7L 1OAUL 4N90D 4NKMA 4PRBB 4EEEA 4OFIA 5JNYB 1TITA 1KN2L 4U7MA 4Z7VB 3TT1L 2NLJB 1KG0B 3F7PC 3MODH 2W65A 3DGGA 3MODL 5TE7H 3ZE1F 4YHIA 2AEPH 1WT5C 3EO0A 1NUDA 3TCXA 5E8NB 1EEQA 1KC5L 3V4UL 3MROB 4IBLT 5DGRA 4U1SB 1I1YB 5IW3A 4YDLB 1BM3H 1EPFA 2YUVA 1SYSB 3STLB 3KPSA 4KRLB 5F1KC 3MLRL 5E8OA 3P3YA 1QFWH 5HYJE 3VXMD 5K9OB 3DUHA 4ZUUA 3CC5B 5FUOL 3KGRA <