4NFDA

Structure of pilr l108w mutant in complex with sialic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
120
Chain Sequence
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQWQSIKGTKLTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired immunoglobulin-like type 2 receptor beta
publication title PILR alpha and PILR beta have a siglec fold and provide the basis of binding to sialic acid
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nfdA00
4N0CD 5GGQL 5D6DC 1SYVB 2LTQC 4N0UB 2NXZC 1FAIH 3TZVA 3SKJH 1K4CB 4AT6B 3MMEB 4GKOA 2XWBA 2VQ1B 5ICYA 1A6UH 1YJDL 3PWJB 3QWQB 1JZ4A 4PBWD 1A6ZA 2CDGA 2MQ3A 3UZEA 5TF1L 2ADGA 4HUUA 5INCA 4OF6A 1YEDB 4K07A 5BXFB 3D39B 3EOBB 4QXWA 5GS3A 2UWEA 4UNTA 3BKYH 5MEPB 1RK1B 1SYSB 3IXAB 3BZEA 4Q7DA 2K7PA 4M43L 4WENB 4HF5H 4K23H 4UIMB 2VDML 6CGTA 1S78C 1QSFE 4X4MA 3TN0A 2IAMD 1IC5L 5K9OA 2I9LA 4YHMH 1QUNA 4HIJB 3SJVD 4NQDE 3RUGB 1QFWL 5GRVL 4ONFL 2NW3A 1F6AA 1F3RB 1PG7H 4NZTL 2AJXH 3W2DH 4WO4A 1UXWA 2VJXA 4GMSH 4DVBA 2X4SA 3FOMA 1XZ0B 5DJ2A 5K59F 5T1LA 3MRGB 3DYMA 3FFDA 1SHMA 1T80A 2DIAA 4M1GH 3QB7C 4KDVA 5HGDB 4PR5A 4LU5L 3EYOB 4WDIA 4XP6H 5E2TL 2IAMC 1GC1H 1HWGB 4OAWA 4RIRB 5B4MC 4GRLD 5KW9L 4ORZC 5MENE 5CIPH 2IPTH 3DHJA 3GSNA 4Q9RL 4Q6IC 4J3WA 3SO3C 3NACL 1MHPH 4F3FB 2XZZA 1KJ2L 1FG2B 4PY8J 5IW1B 3RJQB 3O6ML 1PG7X 3RWGB 3QR2A 4GMTH 2EKSB 5I0DA 1B4JL 3CSPA 4F80A 4I18A 1PJ9A 1U8MB 4HFUL 4POZD 5SWZB 1UWEH 1NKOA 2NY2B 4GRLC 3S88L 2C3GA 2VIRB 4PJ7B 2J8UB 2V17H 2XKUA 3T0EA 1S7VA 5CSGA 1ONQB 1TXKA 2NY1D 4NNPL 4OBSA 4CN1A 3VDCA 2GY7B 2O5XH 1YNKL 2VH5H 5LGHH 1B6DA 1NFDB 2CH8A 2QSVA 1E6OH 3L7FB 3WFCL 4LSRL 5FIEA 2X10A 4NRZB 1I1AB 4DKDC 4POZC 5EU6D 1G7QA 1S7TB 5MP6L 2EKJA 4XZUA 2VXQL 4RSVA 3ZT5A 4HJ0D 2R9HD 1N7MH 3NCEB 4JFZH 3EOTH 3FB7A 4F15B 4OI8A 5INDB 1F02I 2NY1C 4Q6YA 4ALAH 4WFEE 4E0RB 1KGCD 3ZTNH 5C0EB 3PV7A 3C60A 2MCPL 1JRHI 1X5ZA 4LLVB 5GJTL 5HDBF 3RTQB 3TT1H 2CQVA 1OD7A 3VFSA 3ZE1E 4LARH 3HZKB 1ZLUK 1J8HB 1ZLUH 5DD0H 2CLZB 4G6KH 4HJ0C 2IEPA 4HWBH 1EIBA 5JOEA 2E7CA 5KZCB 2X1WL 1HOCA 2LU7A 4JN2B 4DN4H 3MREB 4HKJA 4X4ME 3WNPA 2IBBA 4JM2F 1SJHB 4EN3D 3QA3B 1HXYA 1NSNH 1WFUA 3D3VB 2DN7A 4RA3A 5DMIL 1S7UA 4PJ8A 4PJAB 1F3DH 2J6EH 1LDPL 3LRGA 1L7IH 2EDOA 4FG6C 1JZ6A 2Z91B 3TIDA 2AI0H 2JK5B 1YEJH 1U8QA 4OCSL 5BS0D 3CLEL 4K71C 1QYGH 4JFPA 4GBXD 4EN3C 3ZL4H 2DM3A 3IU3A 4ELMF 3L95B 1YPZA 2JJSA 4FXKA 1FVDA 3WN5B 3CXHK 3TIEB 4BM7A 4QY8A 1Y18B 4YXKH 5C3LD 4HZLA 4LSTL 3N50A 1OARH 5T33L 1J1XH 2XZQL 3FN0H 3S96B 1XF5A 1J5OL 1JIBA 2FEEL 1H8SA 2WWKO 3I02B 1HK6A 2R4SH 4GBXC 4H5SB 2VR9A 4YHPA 4F7PA 4PJFB 2X70A 3QEGL 3G04B 3KPMB 3WE6A 3RY6A 4ZFOB 5KVFL 3V9FA 5E6YA 3PV6A 2V5RA 5CBAB 2A0LD 5HGBB 2J8OA 4MNQB 2AKRB 5DQ9B 1JV5B 3KYMB 4K7PY 4Z7QE 4M7LL 1KB9K 4KHTL 2V9RA 3KYOA 3LS4H 2GJZB 1IKNC 4R26H 5DJYA 1IGIL 4BK5A 3OV6A 1F58L 4Z5RA 1P1ZA 1AKJD 2PN5A 4M6ML 5E5MA 5LJYH 3LDBC 3QG6B 2N56A 1BBDL 2YEZB 1QLRA 1A2YA 5KAQG 4L3AA 5ESVA 5EZLB 1N59A 5F89B 5L2KD 4CVXB 4CBPA 4K3EH 1MFBL 4EKXA 3NFNA 4X6CF 2HKHL 4Y2DB 3BH9A 1HHGA 3M8OL 5J3HC 2RIKA 2HAZA 3ARRA 2GAZA 5LCVH 3MQIA 1AY1H 5SWQB 4Z7UF 1HZHL 3EDKA 4KZEL 4GXVL 1VKXB 1MRFL 5IK3A 1NJ9B 2R2HB 3IJHA 4O5LL 4RAUA 3RX8A 3MLXL 3MODL 5EUKB 3OQ3B 4HXAL 3DMMD 3CFCH 3GBNL 1M1SA 4PJGA 3HB3C 4KI5F 2MCG1 1DJSA 2APVA 5KOMC 4KUCD 2ATPA 5F9WB 3H9SA 4X4XA 3TYGH 5DD1H 2IBZX 3REWA 2HFGL 4G80A 2IPKB 3C5ZA 3MNVA 5HHMD 5IOPB 1N5YH 4YHIA 1G7MB 2HH0H 3C6LA 4JN1L 4KQ3H 1CFBA 1EGJH 1ZA3B 4G6JH 2X09A 2ATKB 5I30L 3KYNB 1C16B 3DMMC 1T0NA 2QL1A 1TZIB 4EBQH 3MXWL 3KS0J 2DLTA 5DJCB 1FZKB 1R5IA 1YPZE 4MHHG 3O6FD 3QIBD 2NLJB 1X5JA 4Q9QL 4MYWB 1Q9OB 3HG1A 3SCMB 3A6BH 1C12A 5B3JF 4YBLB 4GQPH 4FN0A 4UU9A 4MSWB 3NA9L 3OJ2C 1U8PA 5GGRA 3HE6A 1MRDH 4FZ8H 4X80H 3D85A 1PFCA 3GSUA 4DN3L 1EUTA 1QRND 4PJ5D 5F6HI 4J3VA 4UT6H 3H9HA 1P9MA 3QIBC 3ULUE 4KXZH 2AXJA 5TH2B 3INUH 4JAMB 5HHNA 1A1NA 2YBRB 2F54B 3NCYP 1IEBA 1KBGH 3C8KA 1MJUH 5DHYB 5D7KD 1A64A 1OTTD 4S2SB 4F57H 2GJ6B 4WV1A 3AXLA 5ADPL 3DBXB 4G9FA 4NO2A 4X98A 3HE7A 1L4IA 3QIWC 5ICZA 1FIGH 1WC7B 2AK1H 1CE1H 1AGCB 1KG0A 1IFHL 2EIEA 4YAQA 2WANA 4OLXL 1IC1A 2Y4SA 4NQUA 1XH3A 4I5BA 1NBZA 4WU5B 1U3YA 3HC4H 1HHHB 5IQ9B 1OTTC 2YPKB 1B9ZA 2H32H 2ZSVA 2X4RA 3BVNB 4IRJB 4MXWH 3GUTB 3QQ3B 4ZSOA 3Q5TA 6FABL 3KJ4C 4UB0H 1YZZA 5T3XH 1TTUA 5D6CA 1IEAB 1QFWM 4KU1A 5IQ7L 3MCLL 2R0ZL 4HDIA 2HT4C 3C5SA 4I4WA 4U6HA 4BZ1L 1CL7I 1DVFB 2G5BA 3ARBA 1KJVB 1YECH 5CJQH 3BT2H 3S34H 4D8PA 4I77H 3MV7A 1OAUH 4PJGE 5FYJH 1JFQH 1JPGB 1B3JA 3AB0C 3H9SE 3OMZA 1JP5A 3SDDB 4DUWA 2YWZA 2N1KA 3JV5A 4L5FH 3MV9A 4FQIH 3VFRB 4LSVL 5M7QA 3OGCA 1XCQB 3HI6H 4JDZA 4LSQH 3ZDZF 4RX4D 3FB8A 5CP3H 4YH6A 5IV2A 1OTSC 4KUZH 1R5VA 1EFXA 2B8OT 1UFUA 2H3NA 4PG9A 2WK2A 3RU8H 1AQDA 3T1WA 3DO7A 5J89A 3JWDC 5E2VL 4GRWF 3WD5H 3HG1E 4XNYL 5E7FA 3ULSA 4WFHD 4ZFZB 5DR5H 3VXSE 1X5YA 4FTVD 1QHOA 1U0QA 4D3CL 1HILB 2NTFA 1K85A 5HGAA 3QEHA 2BOCB 4HK0A 1GRWA 4JFOB 4LF3B 1J9CT 4JO1L 5JUEH 2QADD 3HUJA 1H3VA 5CSBA 1MCOL 1T7ZA 3E6HA 4Y1AB 4DK3A 5IB5A 1YY8B 2MKWA 4XC1H 1BAFL 4OM1H 4O2CA 1W0WB 3QCTL 2F5AH 4N8VA 3FFCD 4YHLL 1ZT4A 4J3OC 1I7TA 2XQYK 3AFLA 1FYHB 4XVJL 3V8CA 1YUHB 1IM3A 4G9FE 1DBBL 2RAMA 3GMMA 1X5FA 3SEPA 2OR7A 1WBZA 1OY3B 2QADC 1A1MA 2R0KH 5IBTH 5C09D 4F8QA 2X4TA 5A43C 4Y16A 3VFVB 2DQDH 4QHKI 2BHYA 3B9VA 3BSZH 1WCBB 5DK2A 2DQCL 1U8NB 5JHDD 5CP7A 2EDJA 1WZ1L 3LQAL 1LE5B 3T0WA 1JNHB 1VA9A 1P7HL 4HKBA 2F58L 1DQJB 1ORQB 3SO5A 4LLAA 4H1LH 4HUMB 4JZJC 4WIQA 5EC1A 3NGBC 3P30L 3MBXH 4FMKA 3RY5A 3P9LB 5D7SL 3WKML 5C7XH 1KENL 5H35A 1UWGL 2MQ0A 3P77A 2DKMA 4CL7A 3EYSH 3MV7E 3TT3L 1TMCB 5JR1H 4J8RA 3DECA 3X3GL 5K93A 4IRZH 3IVKA 3AS1A 4PRNA 5GGSB 2ENSA 3MRDB 5C0BD 3JXAA 1X5GA 3MCKA 1VFOA 3LRSB 4X6DB 3TBTB 4OD1L 3S36L 3DX8A 1CFTB 1RZFH 3OF6D 1P4BL 5DD5L 4HH9A 3K4AA 2ZNWA 3U4EA 3AS2A 1M4KA 3WFEL 1UM6L 3NCFB 3T0BA 5JW3H 4JY4B 2QQNH 5HJ3B 5IHZA 1F4YL 2I5YL 3B2VL 2P46B 3L7EB 4XXDB 4R7DA 2PNDA 1FCGA 3VWKD 3ILPB 4AIZA 3GM8A 5F1KC 4HIHB 5E24E 2AXGA 3KXFD 3RIAF 1IMHC 1EEZA 1SQ2N 3D0LA 4P5TA 1LNUA 4H20L 5J56B 2UYLB 3VMNA 1HQ4B 3HUJE 4LPTA 3WFZA 2CXKA 1NPUA 4ENED 2OR9H 3STLA 1MCHA 1YN6A 4S0TD 2VLKA 1R24A 3VWKC 3BQUB 3MGTA 4LEOA 4NWUL 3FQTA 1B90A 1DLHB 1MREL 3H9ZA 4OV5A 4EXPX 2DBLH 1K2DA 4M1CC 4YZFE 3H7LA 4PFEA 2UZXB 4JFFD 3KPRD 3G5VB 2B0SL 1FSKB 1KCLA 2C3VA 4AIXA 7FABL 4U6YB 1UACL 2Z93B 1NQBA 1AI1L 4ENEC 2ZUXA 4ZXBD 1OF2B 3BUTA 3AS3A 4KTEH 4O9HL 4QRSA 1NC4B 4IOIB 4QRPD 2W0PA 4M4RA 4P4RA 12E8H 3DUUA 2R15A 2WUBH 3VXRB 2EEBA 4N5ED 5JXAH 1A4JB 1NLBH 1OSPH 3Q0HA 1INDL 1T66D 3LIZH 4CMMB 4N1HB 2CDFA 5ALCL 4KQ4L 3L1OH 3O3DB 3SE4C 4XCNA 1IQDB 4U6XA 1XGRB 5E2JA 2ERJC 4O51A 3EYFA 5GS2H 5MI0B 2AJSH 2Q86A 4OFVA 3P9MA 4N5EC 1KUMA 4RAVB 4CU8A 3L5XL 3WHXA 1JZ8A 2FR4A 5FGRA 4L8CA 1T66C 3GMOA 4XNXH 1T21B 5E9DA 5E8OB 4GUPB 4OZHA 3V0AC 3CPLB 5ADOL 5I73B 2ZUSA 3ARVA 4LBEB 3FQXB 5EIQA 4X6FB 5MENB 4NNXA 1YC7A 1ZHKA 4XVSL 3VG0H 4X7FC 3TWCH 4KRPB 4UOW1 1I1YB 1KCSL 3QRGL 5GS0H 2AJ3B 2LVCA 3BGFB 1NCTA 1MCIA 3QXUA 5F7FA 2HG5A 1YMHA 3U36B 3WJJC 3FB5B 1FNFA 2DIJA 5FYJD 3QQ9D 2DQHH 3ARFA 3PWUB 2Q76B 4Z9KB 3BHBA 2YUWA 4RFNB 3HR5A 1VESA 1HKLL 3IS1X 4X9IA 3OKOB 1JK8B 5DUBB 2EE9A 2VLJD 4G42B 4XCFL 4DZBA 2R0LH 4UT7L 4PJEA 4P2RA 2GSGA 1RIHL 3BMWA 5DQDL 4HKXA 2WINA 1ZLWK 1CICC 1ZLWH 3WLBA 3EOAA 3QQ9C 2AQ3A 2VLMD 4JFEA 4QT5A 2VLKE 3AROA 1MWAA 1Q1JL 4WI8A 2GTZA 1F6FB 2CKNA 1WFNA 5ICYB 4UIKH 3SDYL 2XN9A 2F5BH 1ZXQA 4XAKE 1Z0MA 2LABA 2CDGB 2ITCB 4XNQB 3VU2A 1J1PL 5IJKA 2NPLX 4PD4J 4HUUB 5I1CL 4EI5C 5INCB 3VXTA 4LAQH 4B41A 1T7YA 2YD1A 4FQPA 2NW2A 4FQQA 2KPNA 4JM4H 1QLEH 1CDBA 4L8DA 5BRZA 2X9WA 3BPLB 3ULVE 1CN4A 2EO1A 5L8JB 3CVHA 5ISZB 1IGFL 3GIVB 1X3DA 3ZKXC 2XQBH 2BC4B 2BSRA 1CFVL 3TN0B 4WVRA 3IAGC 1G0YR 5F8QC 4HUWB 2ZSWB 5K9OB 2I9LB 3KWWA 3PGDA 5TDPA 1AFVL 1F6AB 2WZPD 3THMH 4DVBB 4XCCL 4QRUA 3EJJX 1F8TL 5DUPH 1I3UA 4KVNL 5FHBH 3HNVL 5J6HA 2DJUA 1CLYH 4HD9A 4NQSA 5E9DE 2Q6WA 5A2LH 4DKFH 1OP9A 3MJGX 1CD9B 5D72L 4OAWB 3TBSA 1CDHA 4WW2F 1OVZA 3WKNA 4MLIA 3GSNB 4WU7A 1UB6A 5DD3H 5ID0A 1CGVA 4Y4FA 3KPOA 5BOZG 1OOAA 1J05B 2QQQA 4PGBB 1EHNA 4M61A 1SY6A 4AY0A 4I18B 4LCCA 1CGSL 4Q58C 5D7LD 4DGVL 1DDHA 5KSAD 3RAJH 4HQQH 5DVLA 1WISA 4CVUA 4YX2H 4YDIH 1S7SB 3O11A 1HYSD 2HKFH 1S7VB 2BSSB 3GSVA 5DK0A 2FB4L 4G8GA 5I1IL 1CK0L 3VW3L 1RJZB 5TDOA 1XCTB 1G9NL 2ESVA 4PJEE 1OPGH 1I1CA 4P2RE 5ESQA 1K5NA 4ONOA 4LCWA 5K9QG 1T1WA 1Z3GL 4AL8H 3GRWA 5MEQA 1XIWA 1CR9H 5I1JH 4JFEE 3OKKA 1S5IL 3S4SA 4XZUB 2BJML 1JWSB 4JRXD 1N3NB 4HWEH 2VERN 2W60A 3FB7B 1OT2A 1EO8L 2X6MA 1XF2A 3GSXA 3W82A 3U4AA 1ZT7A 2LAAA 4E9LA 2HMID 2NY2C 1JWUA 5DMYA 3P0VL 3U9UB 1LO5B 4RWYH 2NXYD 1TENA 2GCYA 3KG5A 3KHQA 3BRFA 1A6VL 3W5NA 4GRWH 4B7LA 3R1GH 4LASH 1ADQL 1MJJB 4ZUWA 3B8YA 1BQSA 3UCRA 2C4XA 2XI9A 3QFJA 2W65A 3TPKA 3HS0A 5C0IA 4ZO7A 4RGND 3FMGH 1BJMA 1HOCB 5I1AA 1MCDA 4JY5H 4HKJB 4DGYH 2HMIC 4TVPH 5JQHC 2NXYC 5CEZH 4KJWD 2WNGA 1HXYB 4NYLB 3CSGA 5DRNA 4A2LA 2CRYA 5GRWA 4PJ8B 3W9DB 2ZUUA 4YDKL 3TIDB 4RGNC 3RX7A 2B4CL 2EDDA 1PBYA 1U8QB 5FM4A 1ZTXL 4XRCA 4AEIL 3GKWL 1UZ6F 3D3VD 4XWGL 1TPXB 5MEOA 2CXGA 3IU3B 1YPZB 1YYML 1W72L 4FXKB 1FVDB 4H8WC 5IUSA 1E4JA 4ZUUA 5DXWA 4HZLB 4LLYA 3CJJA 4RA0C 1P4IH 1MVUB 3V0VA 5JNYB 4N90D 4YHNB 2DM2A 4Z77A 1JHLL 2AEQL 1VB9A 1IBGL 3RPKA 2EIDA 4X7EC 5IB2A 3GI9L 3MRRA 1KEMH 4YO0B 3WE6B 2MTPA 3W0WD 3P4NA 3BZDA 3WSQH 1F6LL 5J0BA 4G8GE 3U7YH 5BV7L 1TJIH 5B8CC 1P6AB 4PRID 3U0TA 3U0PA 4LCWE 3HAEA 5GS0D 4ZO9A 3TNMB 1I7RB 5DJYB 4BFEA 4N0FA 4Z5RB 5DJXA 2OI9B 3LKSB 5CGTA 1ERNA 3U1SL 2VR4A 5KSBA 3DGGB 1GYAA 1A2YB 4JE4B 3QPQD 3U7WH 4S1QH 1DUYA 3LMJL 1OW0A 2ZUVA 1U8JA 1D5ZA 1G9MH 4HWUA 3FCTA 1N59B 2DDQL 4HJJH 3OKYA 3UPCA 1DQDL 1FE8L 5GS0C 3G9VA 5F9OH 4XPAL 3CFJA 5A3ID 2DICA 5CJBA 3MRJA 2X4UA 5F7UA 2D4FA 3QFJE 4NFBA 3QEUA 2LQRA 4NUGL 3G5ZA 4W6WB 4YHZL 3VFMA 5F7DB 2E27L 3ZLQC 1XR8B 5CZVL 1KLFA 4YJZL 4RAUB 3IJHB 1CLOH 5FUZL 5BQ7B 4I2XA 1JNLH 4PJGB 2ATPB 1EEYA 5A3IC 3H9SB 4X4XB 4Z76A 3W9EA 4UILH 4FABL 4P2OA 3FT3A 4YBQC 4G80B 3C5ZB 3MOAH 4LLMB 2BY0A 4OTXL 4G7VL 3BIBX 1LEGA 1TZHA 1DLFH 3VDBA 1SJXA 1NCNA 5IHUH 3BP4A 2CLRA 3ARGD 4Y2DC 3IDGA 1AO7B 3QNXA 3GHEH 2NY4D 1KXQE 2HVKB 2JCCF 4JHAH 5FF6B 3OKLA 4R4BB 1KELH 3UBXI 3WFHB 2IWGA 4RISH 4UUJA 4JFDA 1GOGA 4NM4H 4AG4L 3DRQB 5KVGL 1LE9B 1C12B 3V4UL 4R0LA 1NH6A 2IFGA 4CUCA 2HLAB 1U8PB 5L2JA 5GGRB 3ARGC 3VXSB 2HWZL 2OBGA 3LB6D 4MMZC 5F9WC 3CSBA 5I71C 2O93L 2NY4C 3BD4A 3GSUB 1G1YA 4LFHD 4ELMA 1JGLL 2VXTL 5MERB 3H9HB 1NCCL 2Y06H 5J13C 4FHBD 2EDFA 4LLQA 2J5LB 4XPGL 5CMAA 1HHJA 2ENYA 3G6AA 4UBDC 3F7YB 4YIQB 4EOWH 4OZIF 1IEBB 1FDLL 5D5ME 3LB6C 4NZJA 1MFCH 4P9HC 4OZFH 3AXLB 2GW5A 5C07A 3VMPA 1FYTD 2BZDA 1A5FH 3CX2A 3MV11 2XXMB 4Z7VF 3RIFK 3SCMC 2IC2A 3HE7B 4HPYH 5KSBE 4QOKE 4YBLC 5ICZB 3E2HC 4TULL 4DEPB 1T7XA 2DQUH 1IM9B 1XH3B 4LGRB 5HVWA 1NBYB 3Q3GB 1ACZA 2L0DA 3KS0H 1HEZA 5C0AD 2D7TL 3ARSA 2IGFH 3FN3A 5FYKH 1E28B 5CJ5A 4V1DE 3VD4A 1K8IA 4ORGA 1T7VA 1EZVX 4JG0H 3VGHA 3QJHA 1UKQA 2YPLA 5DJ8A 3SE8L 5JW5B 2KQNA 4X4ZA 5FHAH 1IQWL 5C6WH 4K8RL 3BI9X 1T1YB 4OCYH 4I4WB 4WRLA 5GGUA 1MI5B 3S6CA 4PJCA 2G5BB 5HDBE 1Q0YL 2C9AA 4I2XE 4D8PB 1RULH 1C1EL 4HIIA 2EECA 3WLWD 4CNIB 5F8RC 2VDRL 1B0GA 4OF3A 4WGWB 5EOTB 5IF0B 1UXSA 5FEBA 4Z7UA 5FO9B 1VGEH 1FNSL 3MO1A 4MJ2A 1Q9KA 4WCYH 3TA3A 1R3IH 3RUGF 1VADA 4JDZB 3B5HA 3MLTB 3OXSA 3LV3B 4IRJC 4QHUA 4MNGA 3SGDI 3EYVA 3RRQA 4PRDA 2VXVL 4AENA 2YD6A 3VWJB 5HYJD 2P7TA 5IV2B 4X8JA 2OYPA 1OGTA 3RPIA 4N0YH 4TVPD 1HXMA 2H3NB 4JFDE 3X3FH 5CEZD 4YC2B 4XHJD 3ZYIA 1T1ZA 1DVFC 2AEWA 1T6WA 3L3DA 4GAFB 4RMQA 3EYUH 2EYTA 3ULSB 1DR9A 4IDJH 4MA1B 4LHUD 2I60L 3L3IB 4ETQA 2YUXA 4GRMA 5F7EH 5JXEA 4LQFL 2NTFB 4OZGE 4X6EA 4GG6B 1XF4A 1IL1B 4AM0A 2OXGA 2JJVA 3HUJB 4M1DH 3ZKND 2PXYA 1KEGL 4XHJC 1SM3L 5IVOA 1N4XL 5IFJA 3TBYA 2OL3L 4LLWB 4Q2ZA 4PJ7F 1OLZA 4L4TE 4XXCC 5D6DA 3U0WL 1HSBA 8FABA 5C07E 1IM3B 4KY1L 3REVA 1OGAB 3GMMB 15C8L 4RFOH 2BX5A 1NFDF 4OT1H 5JOPD 4QNPE 1RZ8A 3ZKNC 3CGTA 3QCVL 4GAJL 4MCYA 3I85A 4HC1H 2C7UA 1VFAB 4D94A 1HSAA 3S35X 4HLZH 4JQIL 3U2SA 1KC5H 1JPTH 4NZUH 1DFBH 4JGUA 2R69L 4NFCA 1KPUB 1HQRB 4HKBB 1Z9MA 1MCJA 1YEKH 5L88L 4LSSL 4ZUVA 3FO9B 5E7BA 4MDIA 5D9SB 4JKPH 3WXWL 4H26A 2YPLE 3CZFB 4PREA 5EC1B 4YNYA 5ENWA 2DTSA 3DI3B 5F9JA 3SN6N 1EJOL 1D5IL 1VHPA 3DOSA 1GZPA 5C8JB 4M6NH 5I16A 4PJCE 2WWMD 4XP9L 1AD9B 5F7NC 1ZHBB 3VFNB 4L9LB 1FBIH 4DFIA 3RWEB 4X0KA 2VAJA 4YHOH 3IVKB 2VL5B 2VZ1A 1FAIL 4I1NB 3KLHD 1A6UL 4DZ8B 1VGKA 3AMLA 1Z9LA 3RVXC 1U2HA 3DX8B 4HT1H 1U8IA 5A2FA 4GAYA 3KYAA 1RHHB 3SJVA 4MNGE 4M3JA 4NKIH 3VFWB 5J6GA 2FJGA 4HH9B 4ONGH 4Q6IA 2E9JA 4PJAF 3V7AE 2XY2A 2HFFB 1YQVL 2KUTA 3BKYL 2FX9H 3RDTD 3KLHC 4OF5A 1NAKH 1IT9H 1ZGLP 1CD8A 4Z8FL 4ZODA 1L7TH 4QXTB 1CF8H 5F93C 4JLRA 4EQ3A 4PTUA 4AIZB 1SMAA 1CXLA 4P2QD 2AXGB 3H7BB 3MNZA 5FK9A 2BK8A 1D5BB 5DURB 1F4AA 1BJ8A 4WEMB 4YHML 4NQED 3NTCH 3O3EB 4P5TB 4JANB 1PG7L 3MSPA 3W2DL 1C5BH 1H3GA 2AJXL 5A16B 4GMSL 1ZT1A 1B6UA 2OQJA 2HJLB 1YN6B 3PGFL 5I2IA 1R24B 1AHWC 3UTZB 4PJFF 3FQTB 1BD2B 5E6IA 4TN9A 4XP6L 2ZNXA 2EXWD 2JIXB 1U3JA 5L6YH 3MJ8A 3MJ7A 2FSEB 3DNKA 3L6FA 4QXGH 4WNQA 4ZTPH 2IPTL 4DFHA 4P23B 5F7KC 1MIEL 2UZYB 3RVWD 1NFKA 4M5YL 3NN8B 1B2WH 5B21A 4ELKA 1WVZA 4JR9H 3AGVA 4QRSB 4GMTL 5CHNA 5AYUH 1UWEL 4ZOEA 2EXWC 1RUKL 1YEGL 5FA3A 4HGKC 2V17L 3HRPA 4QYOA 2D7MA 1JUFB 1J86A 3G9AB 3RVWC 3L5WA 3BQUC 5FAAA 5F21B 4KMTL 3SE9H 4FXGA 2O5XL 3O45B 4XCNB 1JHKH 2AJUH 2RB8A 3WNMA 3VXRD 1E6OL 4JO2H 4QHNB 3UO1H 2HFEA 3E8UH 3ZE2F 5EORH 2DQIH 4DVRL 3KPNA 3JVGC 4RGMC 3P9MB 3WS3A 4FXLA 4NM8H 5E2WL 5LAXA 3QUXD 2PW1A 3T0AA 1HHIA 2FR4B 1N7ML 4GG8A 4HFWA 4NHUA 2VB5A 3GMOB 5E9DB 3EOTL 3S3PA 2KH2B 3L5IA 3D9AH 2QHRH 3BP7B 1K3ZA 3UMTA 3ZTNL 5IM7A 1S9YB 2F8VA 4NNXB 5K9JH 5F9DC 3IFNH 3WIIH 4LK4A 3SJVE 4EN3A 2HN7A 4U1JA 5I1HH 4OD2A 4DJMA 1Z9SA 2R23B 4JO3H 4QTIH 1NGYA 2WM0A 4PRHD 1YMHB 5DD0L 4G6KL 2ZOKA 4HWBL 1J87A 1X5IA 4FQXD 1QVOB 3MRMB 3ARFB 5ANMB 4JZOB 5MI0C 3O3BA 3I3BA 1CT8B 4ETYA 4GBXA 1NC2D 2EDRA 4IS6A 4W68A 1F45A 2FNBA 2EC9T 2R39A 4PB0H 4UTBH 4WJ5B 3LVEA 4HS3A 4XP5L 4F7MA 2X9YA 4MAUL 4J3TA 5KS9A 4LIQL 4IMLB 4MXVE 4PGJA 4PJEB 4P2RB 2GSGB 2A74A 2F15A 3CFKA 2J6EL 3IU4L 4FQXC 3F7VA 1G0XA 4K7FA 1L7IL 2NX5A 4JFEB 4XX1E 1YJDH 4FNLH 5D2LF 2AI0L 1DEEB 1IKNA 4N9GA 2GTZB 2G75B 5SX5K 5SX5H 4CGTA 3H2WA 4KKCD 1QYGL 1CWVA 1Z0NA 1FFPA 2NY6B 5IROC 5GHWH 1BBJB 4D9QD 1KF9B 5I6XC 3ZL4L 4N9OB 3VFOA 1NGZB 4XWOD 2VN7A 2J2ZA 5K33A 1BIIA 3NCYS 1LEIB 5DWUL 2VABA 5C0NC 4PLKD 1FFOB 3VXTB 4I0CC 5JZ7D 5HYQA 2VLLB 4QGTA 2R1XA 3L3OB 2NW2B 1N8ZA 1U8KB 3EW3B 4LLUA 5EU6E 4E41D 3DHMA 5FB8B 1L0YA 1IC5H 4L8DB 1EXUA 1ZSDB 4U05A 2CRZA 3RWJA 2K7QA 1AJ7H 3LN4B 4JFYA 2DKSA 5GRVK 1QFWH 1A1OA 2P8PB 1KGCE 4WHTA 5SWSA 4PP1D 3CFDB 3GHBH 4PLKC 1ES0B 4LSPH 3PGDB 3VXPB 4U1GB 3DSFL 4G8IB 3LS4L 4R26L 2FL5B 4QRUB 5FCSH 1NCAH 3VI4F 1FFNB 4YUEH 4MS8C 3MLVL 1DE4B 5JPMA 1KCRH 5J6HB 2VDNH 1P6FA 5KW9H 2C1PA 1V05A 3WDHA 3OR6A 1MQ8A 5M94B 2AK4D 4KH2A 2Q6WB 1OAQL 2ICWB 1NBVL 4PP1C 4I8DA 3TBSB 1KJ2H 3ILQD 1HYRC 3NPSB 2W1NA 4GKSB 5ALBH 4G5ZH 2VE6B 3BPLC 4K3EL 3VXMD 5DYOA 4XNZB 4ZUSA 4HFUH 5CKGA 4BSJA 3KPOB 2DQGH 3IDYC 1ACYL 4CJ1A 1NUFA 4XTRC 2FH8A 3S88H 1BZ7A 1GZQA 4UQ2A 5LCVL 3GO1H 1I8MA 1AY1L 4HUVA 4MAYD 4PJIB 4PGDA 1O0VA 4NNPH 1KCVL 3D48R 5BS0E 3ILQC 2C4FT 3T3ME 3ARDD 3S8WA 1YNKH 5EO1B 3O11B 1KCUH 2VTFA 5FGSA 3GSVB 3CFCL 3QEQD 4JDVA 5ESAA 1LK3L 3QIBA 3TYGL 5DO2D 3KNBA 5KS9E 1I8IA 4NBYB 5DD1L 5ESQB 2VXQH 4KRLB 4LCWB 5D1XB 4M3KB 4MAYC 2HH0L 2O5ZH 5MEQB 4KQ3L 3HMWL 3OKKB 1EGJL 3GSRA 2MCPH 4G6JL 1OCWL 3H42H 3OZ9H 3BAEH 3QUYB 4ZO8A 5LWYH 4KPHL 1IAIM 1VEOA 2W60B 2DLIA 3L3HA 4PJ5A 1X4ZA 5D1QD 4ZNEA 4OZ4A 4WEUD 4PJHA 4EBQL 3QIWA 5GZND 4IRSD 2H2SD 4PJ9D 3GSXB 3NCJH 1KIRA 5DO2C 5GIRB 2EH8H 5J1AA 3QDMD 3O3AB 4UT9H 3TCLA 5DS8B 3U48A 4R90H 5L9DH 3A6BL 4S11A 4WY7H 4CW1A 1A7PH 1GXEA 4ZUWB 2H6PB 4YK4C 3BZ4A 3VGFA 3IDXH 2EDHA 3QFJB 3VXUD 2W65B 3TGXA 2WBJD 2R2CA 3HS0B 4IRSC 2ZOLA 4PJ9C 4UT6L 3VH8A 5CLWA 1ZGLA 3DSNA 1N6UA 4MHHI 4KJYB 4ZAKD 4YWGH 4KJQD 5C0CD 2ARWA 3GMPB 5DQJA 3INUL 2DYPA 5L0QB 3QDGB 3QUMA 1VEMA 4XMKH 3QI9B 3NZ8A 1KBGL 3LN5A 1MJUL 3HMXH 4F57L 1K4DB 2CKBH 3L5JA 2WBJC 4MJ5B 1AGBB 1PGRB 4NT6B 1FIGL 1CXKA 2CO6B 4YDJB 4ZAKC 2I07A 1DSFL 3JV6A 5IEKB 3CH1B 5EBLA 3D2UD 4LSTH 3HC4L 3DETC 1J5OH 1LEKA 2IMNA 4JEGB 3GRWL 5KVMC 3S98A 5EBMB 3OKNB 2EIZA 4X6DF 4LLYB 5GGTA 1IGTA 1VFBA 4OGZA 5HHME 5CD3A 4JRYD 4OUUA 4UB0L 5T3XL 3V0VB 3ECBA 5J06A 4OGAD 2VQTA 4Z77B 1INQA 5IB2B 3MRRB 1W0VB 4JGJA 1JGEB 4W4NA 4V2CB 1YECL 3SBWC 5CJQL 4XCEA 3S34L 4I77L 4IOFD 2QBWA 3LKNB 3QNZB 1JFQL 4U31A 4PGZA 4HAFA 4JY6A 2VDLH 1P53A 4U1IA 1D6EB 4UDTA 4M6MH 1TPXC 3CIQA 3U0PB 5FV2A 2XZAL 1XFPA 3QHFL 4L5FL 5D5MB 2YKLH 1L6ZA 4OGAC 3EJZD 4WI4A 4FQIL 5EIIB 4H25A 5LGJA 5DJXB 2FWOA 3HI6L 4F33A 4H0IA 1C08A 4QOKB 1QRNE 2O61A 3VD9A 4PJ5E 4ZNEE 1MFBH 1LO3H 4F7CB 1DUYB 3LD8B 4PJHE 4I3RH 2OJEA 2HKHH 2EC9U 1QACA 4WHCA 3F62A 3QJFB 4KUZL 3AMKA 3RU8L 2D3VA 2NTSP 1U8HA 4LCUB 4X5XA 2YD9A 3PWLB 4V1DB 2VITB 3FFCA 4RDQG 2J7LA 5D7KE 3CZJA 5DR5L 4O5LH 3MODH 4MB4A 1NMCB 5HVHB 4HXAH 4JZJA 4ZTOH 2V7HB 3UXFA 1TQCB 5C09A 5JUEL 3PWPA 2Y9RT 2OI9C 3ZYZA 4I2XB 3EDDA 4XC1L 3QCUL 2B5IB 4OM1L 3X13A 5JHDA 3TO4D 1WV7T 2F5AL 4XT1C 2Q3AA 1D9KD 1YYLH 5KVDH 3W9EB 1H3PL 3CLFH 3K4DA 4X4YA 4P2OB 3V5DA 3FT3B 3O4LD 1NEUA 1RUQH 4LKCA 3S5LA 1TZHB 3MXWH 2C3HA 3U79A 1QO3B 2IH3A 3BP4B 2CLRB 5CZXD 2ADFH 2R0KL 5IBTL 3OX8A 3UBXA 4BH7A 4KMLB 3UTSD 4K2UH 1I85C 3BSZL 3OHXA 4CADA 5F6IB 3TO4C 1QSED 1D9KC 4XPHL 3NA9H 1MAMH 4UUJB 5BVJA 1H3TA 3I75A 3WDJA 5T3ZH 4DN3H 5GS1B 3HC0A 5L2JB 1ZHNA 2DLGA 1FZOA 1KJMA 4HIEA 3CU1A 2K9UA 3EDEA 1NFIA 4OZGB 5C7XL 2CMRH 5D2NB 1BZ9B 2YSSA 3CDFA 4HCRA 4LLQB 3EYSL 3ROLA 1UQSA 1HHJB 5TGBA 2FJHA 5IB1A 3Q5YA 3RL2B 2F74B 4IRZL 5ADPH 1EH9A 1WBXA 3TBWA 4W6YB 4L4TB 3PHQA 3VWKA 1LO4H 3DROA 4UZGA 5C07B 1P2CB 4WFHE 1MJ7H 4OLXH 3KXFA 1O7VA 4FTVE 4B53A 3LPFA 4G43A 5EB9A 3DURA 4MVBD 4O00A 3IFPA 3HI5H 2A6DA 5JW3L 5C0JA 4GKNA 4NQCD 1HEZB 3VD7A 4JVUA 5GRUL 4ZS7L 3STZA 3FFCE 4YDVA 4K3DH 1K8IB 1MCKA 4KROD 2FGZA 1EBAA 4HBQA 1M7XA 4FQHA 3QJHB 4TNVF 2YPLB 1IM9D 3KPRA 1FZJB 3NIFE 4WEBH 4WWKD 4DQOL 2NY3D 2J8HA 5DD6B 4XP4L 2BSED 2NYYD 4HMDA 5C09E 5DRXA 3ZE1F 1EAPB 1FNHA 1NL0H 1TCRB 1CFNB 4PJCB 2HLFD 3SE4A 2E9WA 3DXAA 4MX7A 4HGWB 4HHAA 3RGVA 1A6PA 2P5EA 4HIIB 4PV9B 2EZ0D 5JHDE 3V7AG 4KROC 4POYA 2NMSA 3I3EA 1JYVA 4HX1A 1LP9E 4FFYL 5E2UL 5HHPA 4WI5A 3U82B 3PABA 4WWKC 4ODWB 2NY3C 5ITBH 3MO1B 4DK6A 4U1LB 3UYPA 2NYYC 4APQB 3F6LA 1V7NL 1MCCA 3LPGA 4OFIA 5TQ0H 2AVGA 4BK4A 1VSCA 4PRDB 4NSKA 5E2VH 4HUXA 2EZ0C 4KTEL 2P7TB 1QNZL 1OGTB 3EZ8A 3G08A 4PRPA 3QISA 1HXMB 2NY0D 3W11D 12E8L 4C56B 2WUBL 4RNRB 4BFBD 3LH2L 1T1ZB 3VRIB 5JXAL 3WJJA 1W72B 2Y1VA 2EYTB 1A4KB 4ETQB 1H0DB 3LIZL 4JO1H 3I9GH 4LGSB 1MCOH 5ACMA 1PX3A 3FZUD 5ABDE 5IVXE 1XF4B 1BAFH 5JA9A 4AM0B 1NCWH 2VC2H 2DMCA 3HR6A 3TFKD 3W11C 2PXYB 1SJVA 1FVEB 3V95A 5IFJB 1HINH 3TBYB 4LRIC 1CICA 2DLFH 4Q2ZB 5TF0A 4U1MA 3QUKB 3SDCB 1DBBH 3VWJC 4YBHA 1FRGH 1AD0B 1FNLA 1CZ8H 4RGOH 3GSQB 3RY4A 2NXZB 5CGMA 4UINH 5LXGH 3LEXA 3KXFE 4YC2C 3PWNB 5HDOA 3QUZB 1AH1A 3VG0L 1MHHA 5DJAA 3TFKC 3TWCL 2GTWB 4Z7QF 3H9YA 1GPOL 4MCYB 3LQAH 3S3SA 1N0LA 4NCC2 1M71A 3I2CL 1MCWW 3OKMA 2B20A 3BXNA 4OZIA 1WIOA 4EI5A 3U2SB 2ADIA 2DQHL 4ZO6A 2W9EL 4Y4HD 4Z7VA 2B39A 4TUOA 4ZUVB 1UWGH 1YC8A 4MDIB 3QXVA 3KPRE 3O8XD 2R4RH 3BP5A 1MCQA 5F9JB 5I1KH 3BP6B 3TT3H 1SYVA 2H1PH 2R0LL 1K9TA 5EUOB 4AT6A 2F9BT 2VQ1A 3B83A 2AGJH 3BEVB 3AY4C 4OD1H 4NZRH 5B38A 1IGJA 4ZMAT 4XVUD 5I8KH 1JPST 1VFUA 3O8XC 1T0MB 2AJVH 1G0DA 1YEDA 5I17A 2F5BL 3D39A 3EOBA 2CIKA 2IAMB 3WFEH 1U8IB 3D0VB 4GAYB 2LU4A 3SJVB 1SYSA 3IXAA 2OZ4L 5J6GB 5EULV 5B3NA 4LAQL 4Q6IB 1R5WB 1TFHA 1SEQH 4JM4L 1QLEL 1CGYA 4XVUC 5C9JA 3J8F7 4XX1G 3RQ3A 4JLRB 4G9DA 3P11H 1U58B 1SJEA 3RUGA 1MCLA 2LAGB 5CJ8A 2XQBL 4H20H 3X14B 4CMHB 4L9LC 1UA6L 4J23A 5CS7A 1G6RH 5FK9B 2DQEH 1YPZF 4GRLB 3WYRA 1XZ0A 1GHFL 1RVFH 5FYLL 3THML 4AQ1B 1UB5B 3UTQA 1UG9A 2OQJB 4G8FA 5HGDA 2EDWA 3ARTA 3DRTB 3HPJA 5DUPL 5C2BH 2Y07H 4RIRA 2QTEA 1U6AH 5FYJE 1CD0A 5D7LA 4DKFL 5E94A 1UACH 3PG2A 1AI1H 1UJTA 1IGYA 1T1XA 4JQXC 4F3FA 3ULUF 1AGEA 3MJ8B 5IW1A 5EN2A 3MJ7B 4WNQB 3RWGA 2EKSA 1FO0H 2NY1B 4OLVH 3BYTA 1U8MA 3NCMA 1T2XA 2VLJE 5TFSH 1HHKB 5T1KD 3O9WD 2VIRA 2ICEA 2J8UA 1UCBL 2X44D 5CHNB 5EU6B 2VLME 1T5XA 3GI8L 1INDH 3F58H 2D0HA 5ALCH 3RAJL 3GJFK 4HQQL 3GJFH 3BKJH 3MA9H 4JRXA 1I9RH 1BVZA 2CJUH 5F44A 3L7FA 4YDIL 5IWLC 2GK0A 2HKFL 1WAAA 2EIBA 1IAOB 2OM5A 5FDYA 4HGMA 3O9WC 1JYWA 2HFEB 1M7DA 1J0JA 4AL8L 2X89A 4MD4A 4F58H 4IDLA 1JF5A 5I1JL 5INDA 4OSUH 2OCFD 5HHXH 1CLZH 4E0RA 3WS3B 4H0GA 1T03H 4YPGA 5HVGB 5DMJB 5DJ6A 5LAXB 4UV4L 2COQA 1HHIB 4LLVA 4HWEL 2I26N 4NHUB 4XVSH 1JWMB 3RTQA 4KKBD 1KCSH 3FOLB 5IJVA 3BISA 1H3UA 1JF6A 3HZKA 4PJGF 2N7AA 4BH8B 5K9QI 5EZIH 2CLZA 4EN3B 4RWYL 2HN7B 3TC9A 4U1JB 4M6OH 2NY7H 4OD2B 3R1GL 4LASL 2YWYA 3EAKA 4L4VD 5GGVH 1U3HD 4ZUTB 2ZOKB 1DBJL 4EUPG 1HKLH 1PZ5A 1SJHA 2AAVA 3HFMH 5BS0B 2A6KA 1KB9J 3O3BB 4R4NC 5TE6H 4JY5L 1WTGT 3D3VA 2YPVL 3LKPB 4GBXB 4DGYL 4TVPL 4IS6B 1KB5B 2YA2A 5CEZL 1TIUA 2WUCL 3GMNB 1Q1JH 1Q72H 4P4KD 3BN9C 2JK5A 5KS9B 5FCUH 4HZAA 5D7IA 4EUPB 2DL2A 3F7VB 3R0NA 3SDYH 1DL7H 2DWEA 4J4PC 3QWRA 4N9GB 5D7LE 3NBNA 2V5YA 3L95A 1FN4A 2OL3B 5F3BB 1NDMA 1FFPB 3TIEA 3TP4A 4R6UA 3W0WA 3BPOB 5F1NB 3UJJL 4DWHA 4P4KC 5C08B 4YLQT 3JUZA 3S96A 1RZGA 2YD5A 1XGYH 3GBLA 3V6FA 1DP0A 4PJFA 4MWFA 1ZAGA 3GB7B 4OLWL 3KPMA 3MUY1 5HYQB 1E4KC 1K8DB 2J8UE 1P4IL 4P46D 4YR6B 2BVPA 1WBYA 4WW1A 1CFVH 3CFBA 4J2XA 1AKJB 4L3ED 4V2BA 4JRXE 1KEML 3CSYB 4F2MA 4JFYB 2AKRA 4MNQA 5DQ9A 1YN7B 1AFVH 2QSQA 2GFBB 2GJZA 1WAAE 1MY7A 1G7HA 1WIUA 1TJIL 5L2KB 2Z8VC 1MCPH 4KVNH 1T2QH 4P48A 1S7RA 4RMWA 4P46C 3TVMD 3C6SB 1IRAY 1LMKA 1RZKH 3UPRA 4M9OA 3V0WH 1I8KB 5EZLA 2PETA 4CVXA 4RGNE 1KTKE 3GFUA 4S1QL 2R0WH 1G9ML 4Y2DA 4CVWA 2VDKH 4HS8L 2DS4A 2FJFB 3L3JA 3DMMB 4HJJL 4KJPD 1J18A 3LQAC 5DYOB 5F9OL 5IP4A 2P24A 3F12B 1CGSH 3LQZB 2QQKL 5I74C 4DGVH 3ZYJA 5IGXH 5SWQA 4P9ML 1N0XH 1BZ7B 5HHMB 4BYHA 2Y36H 2DF3A 2XWTB 1GZQB 3KPLA 2R2HA 4UQ2B 1CXFA 5IB3B 4U1GC 1LDSA 2MKLC 4U1HB 5I1IH 1FC1A 1NAML 2WIMA 4WUKH 1YEIL 1AE6H 3ARGA 3CDYA 4M48L 4OFYA 3D3VE 4KJPC 2PW2B 5FDWA 2WBWB 1Z3GH 5IOPA 1JNLL 1ZK9A 3RNKA 2BXYA 3T2PA 1INEH 3O6FB 3QIBB 3BJLA 1A9EA 5DSCA 1ZA3A 5HD8C 4UILL 1I8IB 5ITFB 5D7IE 3NPSC 2HP4A 1RUAH 1TZIA 2FEDC 3GSRB 4N90E 4PLJD 1FZKA 2X1QA 3DV6A 5IHUL 4A6YL 2R8SH 2E7MA 4YDLB 1QRNB 2NLJA 5CGYD 2UZIH 3L3HB 3HUJF 3P0VH 1BFOA 4PJ5B 2ARJQ 3O6KH 3W0WE 3CC5B 3SCMA 4PJHB 1A6VH 1NEZG 1KELL 4MA7L 2EC8A 5CSZB 5C9KA 4MSWA 1AIFA 4RISL 5J1AB 3U4BH 1UEYA 4GSDL 2L4OA 4NM4L 5CIPB 1GVIA 3TCLB 4PRIE 4PGEB 4YZFF 2FX8L 4CW1B 3MLYH 3MCG1 4PLJC 4OB5H 5T1DH 3WXVH 3TYFB 4Z0BH 4X9FA 3GSNH 5CGYC 5TH2A 2HRPL 4LDEB 3KJ4B 1NEZB 2F54A 4KTYA 2Y06L 5GQBA 1ZWIA 3IKCA 3K80A 4TSBH 2K3TA 5DHYA 4S2SA 4HAGA 5JHLL 1RURL 4YDKH 4IMKC 5C0AA 3DBXA 4EOWL 2JE8A 3MOQA 3NZ8B 2LV4A 1GIGH 1WC7A 1MFCL 1ZTXH 2Z31D 3WFDH 1AGCA 2RFXB 4NJ9H 3SY0A 1WWBX 3UP1A 2FO4A 2R1YA 4TSCH 4HPYL 3MRCA 1YYMH 4X6BB 4NUJB 5IQ9A 1LO2L 2YPKA 3JV6B 4LPYA 1I9IL 3LS5H 1IGCH 2DQUL 3BVNA 4IRJA 5EU3B 5J12C 3GUTA 3QQ3A 1TQBB 4M03A 3I50L 1I9JH 3C5JA 5FYKL 2CUIA 1G7LA 2Z31C 3I3DA 4HPOL 2W0FA 3CFIC 4LPVA 1P5VA 2AEQH 4ZPVB 4JG0L 3GI9H 4JQVC 1DVFA 1PY9A 4OUUB 2Q20A 4QXUH 2I27N 1JPGA 5BV7H 3SGJC 4FZEH 4IBLT 4L9DA 4XCEB 2XA3A 1V5JA 4M7JH 4OFPA 4NKQB 2P4AB 3VFRA 1Z5LB 4JY6B 3TM6A 1XCQA 4R2GD 4U1IB 4OCMC 3MPCA 2OTUA 2YN5A 2Z92A 1I1RA 1MVFA 2GJJA 4LHUA 1VGEL 3X12B 4JKKA 3BPCB 3TF7C 2Z35B 5LGJB 4YFDB 1HKFA 4XXCA 1R3IL 5JOFB 4FTVB 2BVYA 4EEEA 4EQ2A 4F33B 1MHEB 2YC1A 4RMRA 2O61B 1A6AB 2FBJL 2OJEB 1HCVA 2QV2A 2UVEA 4N0YL 2AQ2A 1IZKA 4WHDA 4PG2C 1YDPB 1KPRA 3UYOD 3X3FL 3VFTB 4H88H 3FFCB 3EYUL 5FOBA 3F7QA 2F19L 4IDJL 2VZ3A 4U2ZA 2BOCA 1FLTX 4LF3A 4XVTL 1QSFD 4MQXD 3STBA 5CZVH 4BQ8A 1FYTE 4L8BA 2Y5TA 2FEEI 4JZJB 3S5LG 2XOTA 2OXHA 2FECL 4BFIB 2EYSA 3NGBB 4NQDD 1KIPB 1W0WA 3S35L 3UBXG 4Z7WE 2WP3T 4FABH 5T5NG 4KK9D 5C0FB 3QDJD 1YUHA 5JHDB 4G7VH 5C0AE 4K3JH 1F90L 3FT4B 3ULVF 3CUPA 4MQXC 5SV3A 4X4YB 1MAKA 2D9CA 5TPWH 1LP9B 4QRRD 3V5DB 2RBLA 3M07A 1PZUB 3VFVA 3ULUH 3S5LB 1WCBA 4EJ1C 1ITBB 3QO1B 2IH3B 1U8NA 4GQ9L 4OT1L 4TYUA 4OKVA 3UBXB 5I15H 4KC3B 4HC1L 1XEDA 1LE5A 4CADB 4X7CC 1ORQA 5AG9A 1T20B 5BVJB 1KC5L 1FP5A 4NZUL 1DFBL 3I75B 3AREB 2WIIB 3P9LA 5FYKU 1H5BC 1EMTH 5C0BB 1WITA 1YEKL 3RVUD 5DVNA 1S7XA 1MCFA 2VXTH 2X4PA 4JKPL 3HC0B 3CX5K 5EC2B 1ZHNB 4X9BA 3CMOH 2V9TA 4HIEB 4Y5XB 1CBVH 4XPGH 4R7NB 2C1OB 1CVRA 2YRPA 5IVXB 2FRGP 3VGEA 5GGSA 2QEJA 1YNLH 1NCBH 3ROLB 5HYJE 1F3JB 3PQYD 3LRSA 1G7IA 5IB1B 4MJID 4OIIH 1FBIL 2AP2A 4TVPE 3QBTB 4W4OC 3RZCD 4YHOL 1W8OA 5CEZE 4D0DA 2FLBT 1GGUA 1FORH 1FL6B 3ZSTA 1KPVA 1CFTA 2QSCL 3TZVD 5J57B 1AHWA 2M8XA 3PHQB 2YUVA 3OG4B 1UJ3C 4ERSH 1DQTA 2DQTH 4FFVD 3KXFB 1BVKA 4GW4A 5HJ3A 3DURB 4NKIL 5GS1C 4PJEF 2D7TH 1AXIB 2NZIA 4M00A 5FA4B 1EAJA 4U1NB 4XXDA 3RZCC 2A6DB 3PXHA 5C0JB 4GKNB 2FX9L 5D2NC 3STZB 4EDWL 4I0PD 4YDVB 1H8NA 1IQWH 4S10A 1WGOA 3IDIB 1HQ4A 3KLAB 1FAKT 4JFFB 1T7WA 4P2YA 3E6FB 3KPRB 2P45B 2YD2A 3D5OF 3QZWG 2CD0A 3NTCL 3DLQR 2A73B 1G9NC 5JOPE 5DRXB 3BQUA 2VDRH 5EIVA 3TJHC 4ZXBB 1N2RB 1ETZA 3GMQB 4I0PC 3QWOA 4QRPB 4WTWA 2ERJB 3AC0A 5T1LD 3MUZ1 3JVGA 4U6YA 4HX1B 2GUOB 5BW7A 2A6IB 5L6YL 3NFPB 2VZUA 4XMLH 3PABB 3QZWB 2VXVH 4TNWF 4ZTPL 3ROOA 1NC4A 1FGNH 3KHOA 4IOIA 2DIBA 3FRPA 5BZDB 4ODXB 4BZ2H 1LO0H 1ZVHA 3VXRA 3T77B 3RI5F 3NABH 5TDNA 4R97B 1A4JA 3G08B 5AYUL 2I60H 3HLAB 5DMGC 4LAJH 3O3DA 2QQLH 1JTTA 2X1PA 4NOBA 2H32B 3RGHA 1NANH 1XGRA 3IYLW 3T0ED 5H2BB 3SE9L 2AJYL 1SBSH 1KEGH 1KTDA 1CIDA 1JHKL 1QG3A 2AJUL 1N4XH 3QYCA 3DVGB 4ZPTA 4Y5YB 5CEYB 3UO1L 2Y5EA 3E8UL 5EORL 1T21A 5E8OA 3JV0A 4GUPA 2DQIL 4U4BA 4APQC 4DCQA 3EDJA 4PRHA 4NM8L 2B4CC 4X6FA 2ZUTA 4FQXA 3V2AR 3PHOA 3B5TA 4JFXA 3ZDYE 2GYSA 1I1YA 3OKDA 2QHRL 3QCVH 2AJ3A 4P2QE 1IAIH 5TE4H 3LEXB 3VE0B 3C60D 5F97E 3WIIL 5IROA 1MHHB 3FB5A 4NQEE 1QBML 5I1HL 5I66B 2VLJB 1M71B 5CWSA 2QR0A 3GIZH 3BXNB 2DMBA 4NWTH 2AQ1A 3A0OA 2ADIB 3S9DB 3OKOA 1EJOH 1D5IH 5DUBA 4JREC 5B38G 1QFPA 2NCMA 5F71A 4NHCH 4WFFD 3SE3C 2A9MH 4PB0L 5BV7C 3SDCC 2XQYG 3CU7A 3NFSH 3M1BA 4O4YL 2EDEA 3Q6GH 3IS0X 4G6MH 4P5MA 3QUZC 3ZYOA 4FNLL 4ODHL 2D31B 1F2XK 4HULB 5B38B 2ITCA 4XNQA 1IGJB 1EBPA 2V2XB 1FL3B 1R6VA 2BVTA 3RL1B 5GHWL 5I17B 1MJ8H 1XGQB 5JORA 1UZ8B 3N85H 2ZKHH 4N0CC 2CIKB 4E5XA 1YQVH 4XI5D 4H1LG 3R8QA 2XWJA 3SGEI 3VXRE 2Y25A 2BNUB 3GMRA 3QP3A 1EDQA 4Z8FH 4JJHA 2XTJD 3ZT6A 5EBWA 5ISZA 1MFEH 1Q0XH 1T04B 3GIVA 1A6WH 2VYRE 4PLNC 4POUB 5IIEA 2BC4A 1G7PB 3WIHL 4U6TA 1MCSA 1MNUL 5C9JB 2YHGA 1IC7H 1TETL 4HUWA 2ZSWA 1AJ7L 4G9DB 3RWDB 4KZDL 1SJEB 1QRKA 3CAFA 1A7RH 5A2JH 3MV8D 5I19H 1WZMA 3VXQB 4H1LB 3GHBL 3RKPA 3SKMA 4LSPL 2GEEA 2OLDA 2XTJC 4OFDA 5EU4B 3PGFH 3VXMA 1BEYL 1YEEH 4MQ7B 3MRQB 3UTQB 5F88A 3P0YH 4PUBL 4G8FB 1NCAL 1LQSR 4ZOCA 2HRLA 3HPJB 1JTOA 4ZOBA 4YUEL 4PRHE 1KCRL 5KTEH 2VDNL 4KVCL 4BQCA 1ZGLM 4MAYA 5D7LB 5AZEH 5KSAB 2ICWI 1S5HA 3FT2B 2I9TB 2ARJB 1MIEH 1FNEB 5E94B 4M5YH 1JZ7A 1IGYB 1T1XB 1AGEB 3C9NB 1J05A 5EN2B 5ALBL 2Q8AL 4G5ZL 1FV1A 4PGBA 5FM5M 1QBAA 1R3LB 4YHYC 5HPOA 2DQGL 4CMHC 1ZOXA 3NZHL 1RUKH 5D5MF 1YEGH 3WHE0 2ICEB 4LDOB 4JCMA 3GO1L 1T5XB 1S7SA 5FO8B 2BSSA 5KSBF 5J4MA 4KMTH 32C2A 4JRXB 1PYWB 1RJZA 3PHSA 1XCTA 3MRNB 2P43B 3IGAB 1KCUL 2GK0B 3EO9H 4IRSA 1BIHA 2FGWH 4K9EH 4DVRH 4Y7MA 3MZGB 1A3LH 4NBXB 2NXYB 5E2WH 1S8DA 3O2DA 1JWSA 1N3NA 1M7DB 3Q6FB 1VENA 4MD4B 2O5ZL 5ICXA 2PTTB 2ZWLT 3C6LD 1CXHA 1T3FA 4YPGB 4E41E 3ZE0E 1PKOA 5DJ6B 3H42L 3VXUA 3OZ9L 3BAEL 5HY9A 1A3QA 5LWYL 4XPTH 2WBJA 3U9UA 4RGNB 1BVLB 1LO5A 5IESH 2YXMA 4J6RH 5IJVB 4K8RD 4M7KH 3UJTH 4ZAKA 1RZ7H 3NCJL 5D71H 1MJJA 2XKNB 1M05B 2EH8L 3KYKH 2YRLA 4RDQF 3GK8L 4JHBA 2EXYD 4PJDA 4UT9L 3CD4A 2R9HC 5L9DL 4R90L 2RR3A 1I7UA 4WY7L 4XBEH 3T65B 1A7PL 3C09C 4Z78A 5ISZE 3IDXL 3HE6D 4WUUD 4O02H 3D85D 1PZ5B 4N8PA 4K8RC 1CXIA 2AK4E 4YXHH 1KULA 5KOVC 4NYLA 2A6KB 4XP5H 3IDUA 3HNSH 2HFTA 4MAUH 4LIQH 4YWGL 5HHQA 2EXYC 1UM4L 1OAXL 3D2UA 3W9DA 3QNYB 3KAAA 3IU4H 3SBWA 5C70A 1MFDL 1ROWA 3VXME 4XMKL 3ZHLA 3ULVH 1DBAL 3HMXL 1HI6A 1U41A 1WSST 3LSOA 3MA7B 5D7IB 5B8CB 2CKBL 5FUCE 3BD3A 2PTUA 4OZGF 2DWEB 4L1DA 1TITA 1J7VR 1HIML 3MNWA 4NO5B 1FN4B 4XPFH 5DWUH 1NDMB 1CI5A 3C8HA 3T3PE 3W0WB 3WNNA 4CN4A 1LHZA 1MUJB 4CU6A 1RUPH 2QSTA 4NBZB 1AP2A 1QQDA 1MVUA 5JNYA 2JB5L 4YHNA 1RZGB 4HKZB 3V6FB 4PRIB 1OAYH 1X6NA 3P0GB 3LRHA 1K6QL 4MWFB 5DEFB 4YO0A 2WW8A 4CN6A 5KVEH 1U91B 3EDFA 4X6CB 5HI5D 2BVPB 1WBYB 1SBBA 4WW1B 4R8WH 5KANI 3C08L 3CFBB 3D87B 5C08D 3TBVA 5E8PB 4QNPF 5IT2L 4F2MB 2A1WH 1Q94A 3GSWA 3DSFH 1RZJH 2VXUH 3ARBD 4BKLB 4L8SB 1G7HB 3TNMA 1I7RA 3MV7D 3WO3B 4GLRH 3MLVH 2VDLL 3QDME 3LKSA 1S7RB 1G6VK 3BPOC 4QCIA 5IBUG 3DGGA 4XH2A 3RVTD 2YUZA 2YKLL 3BPNB 1OAQH 1NBVH 1ULVA 3UPRB 2A0LC 3DJ9A 5E1HB 2VZVA 3MV9D 4GAGH 4FQCH 3ZTJH 3CVIH 3VXUE 3NH7H 3ARBC 4PJCF 1LO3L 4G7YH 3IJYA 4I3RL 4ZD3H 1KXVC 2GSIB 1ACYH 1MFNA 5C0CE 3I6GB 3L3JB 1MWAH 4Z7OE 4PJDE 1I85A 1EFXD 3VI3E 3TO4A 1EV2E 5IBUB 3RVTC 2P24B 1D9KA 1TTGA 2YZ8A 1KCVH 5F7DA 3O4LA 1X9QA 1XR8A 3AU1A 3C2SA 5IFAH 3DVIA 3KPLB 1U8LB 2DBJA 5BQ7A 3MRBA 3V6BR 4ZTOL 1LK3H 3ARGB 5I71B 2NY4B 4LLDB 4LFHG 5FDWB 5SX4I 5FKPA 1E27B 4BSWB 1QSEA 4LLMA 5D93B 3RNKB 4L3CA 5J13B 3HMWH 4FQJL 1YYLL 3GDBA 1A9EB 5KVDL 5GSRB 5DSCB 3CLFL 1T2JA 1CDCA 1OCWH 2HTLD 3CVHH 4ZFOL 1AO7A 4KPHH 3V5HB 4EI6A 1RUQL 2MQCA 2HVKA 4HEPG 4JRYE 1M7IB 5FF6A 4R4BA 4HV8A 4Y19D 1J12A 3WFHA 5J11C 3DV6B 2ADFL 2BY1A 4PGCB 1BFOB 1EX0A 4K2UL 4F7TA 3DRQA 1LE9A 4Y16D 4EDXB 3RI5K 3E2HB 1AIFB 2HLAA 3UTTD 3I6KA 1KJ2A 1MAML 2HTLC 4QRTB 3VXSA 1U9KA 5T3ZL 2AW2A 2FZ3B 5MERA 3ZDXE 1KLUB 3BIKA 4JB9H 2HT3D 2E8YA 4BELD 3O6FC 1FYTB 1RHFA 4DTGH 2CK0H 2CMRL 3F7YA 4YIQA 3BDBA 3TNNB 4UTAH 3WMSA 4Z7WB 4F9LC 1ZWIB 3IKCB 2CSPA 1SY6H 3P73A 4NQXB 5DT1H 1MCNA 4YDLC 5C0AB 5F1IA 1URLA 3P9WB 4PS4H 2M1KA 2HT3C 3MLWL 1LO4L 1X44A 1HH9A 1GC1C 1DSFH 1MJ7L 4JKLA 4FP8H 3SY0B 1IM9A 2FO4B 2R1YB 4DW2H 3EGSB 4XPBH 1NBYA 3Q3GA 3MRCB 1JF1B 1E28A 3G6JA 3UDWC 1BFVH 3HI5L 3GRWH 4BSVB 1XGUB 1FPTL 2FHCA 1N6QH 4IOSD 1UM5H 3C5JB 3RA7H 1G7LB 5JW5A 4K3DL 5CZKA 1JRHH 2W0FB 35C8H 2IPUK 1CXEA 2CRIA 1T1YA 4OF0A 3O4LE 5JIHA 2YS4A 4GRWB 1MI5A 5E00B 3AM8C 2OSLB 4B0MM 3MZTA 4LHUG 2MHAA 4Q9BA 4WEBL 1PG7W 4CNIA 4NGHH 1NL0L 5GPRA 2JKXA 3UTSE 3B5GA 2WAHA 5EOTA 5HYJB 3KR3H 2XZAH 5IF0A 1QSEE 3QIUD 3QHFH 5FO9A 3EFFB 5D7JD 2VLKD 1J0KA 3PNWA 1JGDB 4HXBL 1FZMB 3MLTA 2OTUB 3LV3A 1AO7E 2Z92B 4LRIA 2XFXA 2GIYA 4LHUB 1TQBC 1BOGB 5ITBL 1HH6B 3G6DH 3VWJA 3P4OB 5TQ0L 4XAKD 2YC1B 3K1DA 1A8JH 1EHAA 1LD9B 4MXVF 2A77H 1MOEA 3MTRA 3QIUC 5D7JC 5HXMA 4C57C 3L3IA 1KPRB 3WUWG 1KT2B 4GG6A 5FOBB 3HZMA 1IL1A 3T4AB 3QO0A 3I9GL 3DV4A 4KWUA 2IALB 5MHSD 4L8BB 5C0GB 2Y5TB 3QCUH 2EYSB 4LLWA 2G9HA 1NCWL 2VC2L 4FQ2L 1ED3A 1H3PH 1G9EA 3GEWB 3L3GA 3WUWB 1HINL 4NQCE 2X05A 5I75C 3OG6B 2DLFL 5EU5B 3NAAH 4OM0H 3LEVH 1OGAA 3CUPB 3HPLB 4PB9L 4XC3H 1FRGL 3AY4A 1CZ8L 1RK0B 4RGOL 4OLYH 3FO1A 4UINL 5LXGL 3QRFM 1VFAA 1D5MA 5ID1A 4OCWH 3O8XA 4XPHH 2ORBL 4OKVB 4KK8D 2PYED 3G6JE 1KPUA 3HAEH 1HQRA 5L7XH 3KPQA 4N68A 4JRWA 3FO9A 5D9SA 3CZFA 1PW3A 3DX6B 4FQLL 4AMKH 4GT7A 4ISVB 5C8JA 1S7XB 2IH1A 1MI5E 2X4PB 1BFSA 1SMOA 1MLBA 4KK8C 2R4RL 5D70H 1AD9A 1I4FB 1MH5B 5I1KL 1ZHBA 4X99B 5ILTH 3VFNA 4L9LA 3RWEA 3ARED 2H1PL 2VL5A 1RAMA 4NC0B 1JI1A 5I1DA 1UVQB 5KN5A 2AGJL 1G7IB 3QDHA 4P5KA 4UQ3B 3VFUA 3K1KC 4DZ8A 1CFSB 4NZRL 2IG2H 3RDTB 3WO4C 4D0DB 1GGYA 2V2TB 1OP5K 1OP5H 3G5YA 3T3MF 5I8KL 1KPVB 4J1UB 1RHHA 2AJVL 1AHWB 2E6QA 3T4YB 3VFWA 4LEXL 3A6CL 5DGRA 2BERA 3ZKQD 3NVQA 4NJAL 2XN9D 4QO1A 4P2QB 4R9HA 3AREC 3FONA 2HFFA 1BVKB 4GW4B 4JQXA 1U8OA 4NQEB 5KS9F 4YXLL 1S9XB 4LSUH 5GRUH 4ZS7H 5DEZA 3TV3H 4QXTA 4ZS6D 3BOVA 1H9VA 1DTUA 4Y5XC 1SEQL 5F96H 2H8PA 4JPKH 4Z6AT 3H7BA 1D5BA 1UYWH 1CIUA 1D5XA 5E8DH 4QLRA 4GG6E 1O7SA 3P11L 5BRZD 4DQOH 3O3EA 4GW1B 2DB8A 4XP4H 4JANA 1CE6B 2P48B 3QPXH 5A16A 5DRWA 1G6RL 2JF1A 1A22B 2DQEL 3HNTL 2HJLA 4G6FD 5IJKC 4KKLD 1KLGA 1RVFL 5IWLA 1XMWA 3IAQA 4OZFG 4ZS6C 3QSKB 3UTZA 3MYJB 3NMEA 3FRPG 5HBBA 4XBGA 5IBLD 1BD2A 1JBJA 3UTPD 4FFYH 5E2UH 1ETZB 2JIXA 3O9WA 5C2BL 4MMXC 4LVNC 2Y07L 3QWOB 1U6AL 1RUMH 1FCCA 2FSEA 1DQMH 1OGAE 3LPWA 1V7NH 4P23A 4RGMB 3RBSA 4C4KO 5DZNA 3JV4A 3NN8A 4KKLC 2VXSH 3ROOB 1QNZH 2P44B 4OZFB 1FO0L 4OLVL 3DUHA 4Y4FD 2A83A 3LH2H 5TFSL 3GNML 4HIXL 5TDNB 2H9GB 5BJTA 1JUFA 5BVPH 3F58L 1J88A 1LWRA 3V52H 4OLZL 3BKJL 3MA9L 5ACZA 1CVSC 3QUXB 3MLRH 4OLUH 1I9RL 3O45A 4ZXBC 2CJUL 5J1TC 4QHNA 1H8OA 4U3CA 3Q48A 2H26B 2IBZY 4G8GD 1QHPA 3R06B 1AXTH 4FFWD 1KTDB 4XBPA 5I9QC 3QULB 5A2KH 5GISH 3NPZB 3JTTB 4ZPTB 3HZYB 2ESVD 5FKAB 3RWFB 4F58L 3IJSB 5AD0A 1Z9OA 3CDGB 4EIZC 4OSUL 4E42B 5HHXL 4DCQB 1CLZL 1XIWD 3OSKA 1CL7H 3BP7A 4K3GA 4PRHB 5LKNA 5B39G 1T03L 5AZ2H 4FQXB 1S9YA 5T3XD 3PHOB 3ARUA 4P3WA 5KSVA 4JFXB 4LCIH 1AGDB 3OKDB 4J4PA 4R97C 5IG7A 1GPOH 1FFQA 4FFWC 1Y6NR 3I2CH 1NC2B 3UROR 3TH2T 2R23A 4N1EA 1UH3A 5EZIL 5I6XB 3NCCB 3BRDA 1QVOA 4M6OL 2NY7L 3MRMA 5JO5A 5ANMA 1XIWC 5CWSB 2QR0B 4ZDHB 1ZVYA 4JZOA 2W9EH 5GGVL 5B39B 3HRZB 3I6LD 4NCDA 3X11A 1CT8A 4AH2A 4KRNA 1E4KA 4Y5YC 4A2MA 4NN7C 2KZWA 4WJ5A 3HFML 3ZO0A 4OCNC 5K9KA 3X17A 4PJHF 5TE6L 1EEUA 1F97A 4IMLA 4O2EB 2MJWA 3FRUB 1CYGA 3G5XA 3ME0A 1Q72L 3M1BB 3WIFA 1DEEA 1UC6A 2P42B 3TEUA 4L29B 2G75A 5JPNB 5FCUL 1BD2E 4P5MB 1NGWA 3SGKA 4P46A 1BBJA 1KCKA 2FYYB 5JMOC 1DL7L 1BQUA 5IMKA 1D6VH 4E41B 3FHQA 1NGZA 4MLSA 2E7HA 3T1FA 1LEIA 1RQ5A 3MROB 4CAGA 2OZ4H 2EDYA 1FFOA 1OLLA 1DQLL 5JORB 2IFFL 4G3YH 2VLLA 3UZQA 4E5XB 3L3OA 1U8KA 4NN6C 4WW2B 2XWJB 2ZG2A 1OP3K 1OP3H 1XGYL 5FB8A 4LCYA 4KDTC 3GMRB 1ZSDA 5DHVA 3LN4A 5EBWB 4RMTA 5JQ6H 1JPFB 5IIEB 3IDYB 2P8PA 1UA6H 1UCTA 1A6TA 4FMFA 3CFDA 1ES0A 1KYOJ 2EEAA 1GHFH 2AK4B 3LZFH 3VXPA 5FYLH 4G8IA 1T0PB 1NCDH 2Z8SA 2J1KA 4G6AD 1MFAL 1A14L 5HYIA 3MBED 2FL5A 3SKMB 3SOBH 1BGXL 1FFNA 1DE4A 1MCPL 1T2QL 4AJ0A 3VXMB 5C0RL 1ODAA 5DC0A 5F88B 1MSPA 1RZKL 3N1FC 4HG4J 2ICWA 4WTZA 2A6JB 4L4VE 4ONHB 2C3WA 1I1FB 2EDBA 2ZUWA 3V0WL 4GKSA 5IFHL 4MAYB 2IF7A 2VE6A 3QT2A 1S5HB 2EDTA 4G6AC 3DVFA 3MBEC 4DUVA 1A7QL 2R0WL 3ARDB 2VDKL 2VAAA 1FV1B 1KFAH 5KG9B 3QEQB 3K46A 2XPGB 1UCBH 4Y5VB 3GI8H 3WS6C 4PJIA 5IGXL 5ANME 3ZT7A 1N0XL 1X4YA 1RFDH 4D0CA 4KHXH 2Y36L 1XR9B 3ARZA 2F53B 5EO1A 3WL9B 5DRZA 4YK4B 4WUKL 1AE6L 32C2B 3CMGA 3ZKMD 5C6PB 2QJDA 5D1QB 2N4IA 2MOVA 5HI3D 3PXJA 2MWCA 4U3HA 4IRSB 4PJ9B 5D1XA 5BO1H 5KSAC 1INEL 2BRRH 3BRGC 3VXNB 2X4QA 3QDMB 1W0YT 1S8DB 4UV4H 4BZYA 1WWAX 3IKKA 4BA8A 3QUYA 5BCAA 4H0HB 1HYSC 4IMKA 1VCAA 5ICXB 1RUAL 3QG7L 1P7QD 1T3FB 3NIFF 4I48B 1JGUH 2Q8BH 3ZKMC 3VXUB 4L3EE 5GIRA 5HY9B 3MRIB 2WBJB 2R8SL 1BX2A 3OJDA 3UJIH 3O3AA 2UZIL 4JM2D 5DS8A 5DLMH 3O6KL 2XG5A 4ZAKB 3BW9A 5JLZA 2X4NA 2H6PA 5C0CB 3U4BL 1IGMH 4W70A 4PJDB 3KPTA 1N64H 4JFDD 1DBJH 1LP9F 1QEWA 1I7UB 3DX7B 2VDQH 3MLYL 4Z78B 5I1EH 4OB5L 5T1DL 3WXVL 3WFBH 2Z31A 5IEHA 4Z0BL 4KJYA 3PP4H 2YPVH 2YMXH 3GSNL 5HYSG 3R4DA 4JM2C 4ZNCD 2IBGA 3GMPA 2WUCH 1NUNB 5T5NF 1FVCB 3QDGA 2IQAB 3Q1SL 3QI9A 2DQJL 1U36A 3BUYA 5HHQB 1UWXK 1UWXH 4TSBL 4R96A 3SGJA 3D2UB 3N1PC 3VGBA 1E6JH 1X5LA 1K4DA 3QXDB 4MJ5A 4UNVA 1AGBA 4NT6A 4O2FA 4IIQC 1BQLH 1ZANH 1GIGL 1HI6B 4YDJA 3LSOB 5JIPA 2XZCH 3WFDL 1PAMA 4NJ9L 5HYSB 4KJWC 4JRYB 5GSVA 2BNQD 1DBKL 3CH1A 5IEKA 4TSCL 5KSUB 5IVXF 3UJJH 5HDQH 3MNWB 3MLPA 1V3JA 3F5WB 2BHUA 3LS5L 1IGCL 4XAWH 5EBMA 3OKNA 5GRJH 4OLWH 1AP2B 1QQDB 5GS2D 1I9JL 4C83A 4U3XA 2G2RB 1S7QB 4U1KB 5GRXG 4Z7NE 5HYFA 4K7PX 1GL4B 1BFTA 4PJIE 4PG2A 1ZVSA 1TZGH 1GGCL 1U92B 1W0VA 2OJZL 3A6OA 1JGEA 1JNJA 5HDLA 5EA0L 2AABH 4QXUL 3SDAD 2WLZA 1IJ9A 3TBVB 3LKNA 1YEFH 3QNZA 4WI6A 4JJ5B 4FZEL 1Q94B 3GSWB 4LMQI 5F7LB 2HJFB 1D6EA 5J9PA 4P3CH 3L9RB 1DN2A 4NKOB 5D5MA 4M7JL 5EIIA 2OMNA 4NFDA 3O3UN 3VRLE 4QCIB 4QOKA 3O2VH 3BGMB 4XH2B 3SDAC 4GW5A 4I9WE 4F7CA 3QDAA 5GJSH 1ZMYA 1A47A 3K4ZA 3QJFA 1Y6MR 3TA3D 4LRNL 4HS8H 7CGTA 4U1SA 4LCUA 3IJYB 4KI5D 3PWLA 4V1DA 2VITA 2QQKH 3TH4T 4P9MH 3VD5A 4KK5D 1TDQA 3QDJA 4QTHB 4H88L 3TO4B 4Q74A 3RIAK 3RX5A 1D9KB 2O5YL 3QPQC 3IDNB 2V7HA 1NAMH 1YEIH 4JO4L 4QRRA 1FHGA 3O4LB 3KGRA 4L8SC 2BHZA 3AU1B 4M48H 1H5BA 2FHFA 4RFEA 2PUQT 2EICA 3MRBB 4KK6D 1QLFA 2DJSA 4GXUM 2RJMA 3QDGE 3BPNC 3RWHA 3UTSB 5FKPB 4XHQA 1QSEB 2NR6D 4L3CB 4UI2A 4M4PA 4K3JL 1U2CA 2ZUQC 3PJSB 1UH2A 1QO3A 5TPWL 3H3BC 4A6YH 4W4OA 4EI6B 3ULUL 4HV8B 4MA7H 1FH5H 3OL2A 2FDBP 3EOYG 5I76B 1U3ZA 2ITDA 1UJ3A 3B3IB 4GSDH 1NDGA 2R56H 5I15L 2AXHA 2P5WD 4F7TB 2NR6C 5FYLD 2FX8H 4DAGL 3LHPH 3VFPB 5GS1A 5JDSB 3I6KB 3ARXA 1KJ2B 2AEPL 3RZCA 4S1SH 1L9MA 2M26A 1EMTL 1S7WA 4OZGA 2HRPH 4WTXA 4JHWL 2FH6A 4GS7C 5D2NA 5D93C 3BIKB 1BZ9A 3MLZH 3CMOL 3MOBH 4JZNB 1CBVL 4DGIL 1S78D 2D2OA 3MRFA 3RL2A 4OIAA 5JHLH 1RURH 5DJZB 2F74A 5CAYB 5EZJB 5IMLA 2WV3A 2Y6SD 5C6TH 1YNLL 3R0MA 5DVMA 1NCBL 4ZOAA 4L4TA 1T22B 5CJXC 1FGVH 5CINH 4OIIL 3P73B 2KKQA 1P2CA 3PDGA 1ND0B 4MDJA 4NQCB 3V6OE 5F1IB 1J0IA 2BOBB 1FORL 2P8LB 2DOCA 4I0PA 4NPYB 4KROB 1CDYA 1GAFH 1HH9B 3T0VA 1Z6JT 4OI7A 2P8MA 1D3CA 1LO2H 4ERSL 1VERA 2DQTL 1I9IH 3FTGB 1OSZB 2Y6SC 4WWKB 2NY3B 3F6IA 3I50H 1HWHB 2IADA 2FD6L 5B4MD 4KDWA 3G6JB 1QFUL 25C8H 1P84J 4HPOH 3OR7A 2APBA 4CRPA 2XTLA 3QDJE 3FQNA 1ADQA 1FZJA 4QRQA 5DD6A 2B2XH 4QRRE 2R29H 5J8OA 1EAPA 1TCRA 1CFNA 2VDPL 2AERT 1EHLH 3OXRB 4YFLI 4HGWA 2MHAB 2VDOH 4PV9A 3BIAX 5IHLB 1VPOH 3LKOB 4PLOB 4PV8B 5E8EB 3PDOB 4KXZI 4OGYH 2A38A 3TESA 4ODWA 2NY0B 4U1LA 4Y4KD 4M7LT 3DUSB 4APQA 3NIGE 3PNWB 1IAMA 1MLCA 1X5AA 5E6ID 3VD3A 5EFIB 2XFXB 1ZKAA 1X5XA 4XMLL 1YMMD 2PO6D 5C86A 2FBJH 1EERB 3TO2B 3WLWC 1DN0B 3K8MA 2CKBB 1FGNL 3U7AA 3SKNA 2WBKA 1XF3B 4ZYKA 3OJVC 3QH3B 3QUMH 4BZ2L 4C56A 1LO0L 4RNRA 3KDMA 1CCZA 1EVTC 5DVKA 3VRIA 3P4MB 1W72A 1IE5A 3NABL 1A4KA 2F19H 4Y4KC 4Z95L 3PQYE 3OAUL 4MJIE 1H0DA 1F00I 2WLYA 4PYGA 4HH8A 1F4XL 4XVTH 5E6IC 3E3QC 3BD5A 2PO6C 2QQLL 2CR6A 3BWAB 3HZMB 1KTRL 3LAFA 5D2NE 1PLGH 2CUHA 4YGVB 3MGAA 3FAWA 3MXVH 3OAZK 3QO0B 3OAZH 3S35H 4TRPL 1R3KB 3DV4B 5LBSL 1SBSL 3BKCH 1FVEA 2BDNH 3SE3A 4G8EB 4M93B 2G9HB 1MIMH 1F90H 1GGIH 3QUKA 3SDCA 5HYEA 2BSTA 1ED3B 2J8UF 3L3GB 4HBCH 5GGTH 3JWDH 1AD0A 1NGQL 1B0RB 2UWEE 3GSQA 2AJZB 3S37H 3OB8A 3PWNA 5FO7B 3QUZA 2GTWA 4GQ9H 2BP3A 4FRWA 4FG6D 4UAOB 4Y4HB 5DFVD 5D1ZB 4HWZA 3NIDE 3O41B 5H37H 1IAIL 1WAAF 3FO1B 4QHLB 5TE4L 3SKUD 1D5MB 5ID1B 3O8XB 1CDJA 2OTWB 4JCLA 1CU4L 1BWMA 1PQZA 4WHYH 3GIZL 4QF1A 1WQVT 3KPQB 5KJRH 4RQQB 1MF2H 4NWTL 3S3JA 3T2QA 2WQRA 5DFVC 4MD5A 3BKMH 5IKCA 3ET9F 4XNUL 1L6XA 2YD4A 3S37X 3BP6A 2IH1B 4NHCL 5EBGA 1N5AA 3OBAA 1AQKL 1MLBB 5EUOA 2A9ML 1HDMA 5I1GH 2NNAA 1NUDA 3BEVA 3NFSL 1IAKA 1TJGH 3FQUA 2HJKB 5I1DB 3Q6GL 4G6ML 3KPPB 2QSCH 5KN5B 1T0MA 3VFUB 4P5KB 1MHCB 2NX5D 3RVVD 4U0QB 2IAMA 4Q0XH 2X7LA 3D0VA 3G5YB 2WWMC 2BNRD 2PR4H 2A2QT 3N06B 1NGXA 1G9MC 3MV8A 1MJ8L 1R5WA 3N85L 1YA5A 1XT5A 2ZKHL 3FO0L 3T0EE 5F7WC 3FONB 1XF1A 4UOW0 1U8OB 3HCVB 1SVZA 3LKQB 4C56E 4RRPG 3UX9B 2AV7A 3H3PH 5D7IF 3DVNA 4U7MA 4EDWH 3RVVC 1U58A 1MFEL 1Q0XL 1A6WL 1OQXA 3WCYA 3X14A 2H8PB 3QXAB 4UDUB 4GRLA 1IC7L 1XAUA 4PRAB 3U30B 1D5XB 4XP1L 3RZWA 5J3HD 1C7SA 5E8NB 1A7RL 2BY3A 1UB5A 5HGHB 5I19L 5DRWB 2Q7YA 3I84A 5F72S 1ZLSH 1I9EA 3RDTC 1M6OA 3DRTA 5SWSD 4HSQA 1KLGB 1OB1A 1YEEL 3KLSA 1KNOB 1KXTB 4XBGB 4XCYA 3B9KD 3P0YL 4D0BB 3HB3D 4GJTB 3AS0A 5T1KB 4P59H 3O9WB 3DARA 4M8QA 3VCLA 3H8NA 3SQBA 5KTEL 3EYQD 2SEBA 2EH7L 5HPMA 4HJGB 5AZEL 2MSPA 3JV4B 4HCRH 1KN4L 4KTDL 4X7SH 4WFFE 1HHKA 4P49A 2DI7A 3B9KC 5EU6A 3UC0H 2A83B 3WNLA 1QKZH 1TVHA 1LK2A 4HEME 3EYQC 4OD3L 2D9QB 5BJTB 1SEBA 4KV5E 4X9HA 3DTXB 1HE7A 5ACZB 4R4FH 2AJYH 4ODVH 1IAOA 1J0ZA 1DANT 5IVNA 3EO9L 5IW6B 5EUOE 3CFEB 4KKAD 2FGWL 2R1WB 4K9EL 2O26U 4NCC1 4XBPB 3RBGA 1A3LL 1JL8A 5KAQF 1DUZB 2R2EB 5FYKD 2ZUYA 2XTJE 1JWMA 5AD0B 3FOLA 4L4VB 1U3HB 2W91A 2Z4QB 4M5ZL 1UH4A 4BJLA 1WUNT 2Z0BA 4BH8A 4WUUA 5KSVB 4XPTL 2EYRA 2ZCKL 1E4XL 1WF5A 2B1AL 3BDYH 5D2LB 5IESL 1QBMH 4J6RL 5IG7B 4KKAC 4ZFFA 4M7KL 4OBRA 3MV8E 3UJTL 2E6PA 1RZ7L 5D71L 3QIWD 4J7RA 3KYKL 3BE1H 3QUXC 4ZUTA 5ACLA 4S1RL 2BRQA 4P4KB 1KIUA 4OQTA 5JO5B 4XBEL 2I25N 3SQOL 2J88H 5BS0A 2QLVB 2V9QA 4UV7H 3SGDH 3X11B 3LKPA 4QHMA 4O02L 4AH2B 1KB5A 1D7FA 2B1HH 4YXHL 2FCBA 5TJWK 3GMNA 1CQYA 5K9KB 1LVEA 3AAZA 3HNSL 3MJ9A 5BZWB 1R3JB 2C26A 4O4YH 1NLDH 4EUPA 4JPIB 2G60L 2HT4D 3LKRB 1RU9H 3G5XB 1UENA 2DYPD 4ODHH 3WIFB 3H0TB 3ULVL 2ZCLH 3MUGA 1C5CH 2OL3A 5F3BA 3BH8A 1PY4A 3D25A 3KJ6H 1NGWB 4P46B 1I3RA 2X4OB 5F1NA 5IMKB 5FUOH 5C08A 4L3EB 3CH8A 1MEXH 4XPFL 3HI1A 3T1FB 2D0GA 5IW3A 3CK0H 5EPMA 4Z7WF 1I3VA 3FJTA 4NNYB 5D96C 1RUPL 3GB7A 4YEEA 1K8DA 1NCUA 4YR6A 5I18L 3QFDB 1CTOA 1EZVY 2XG4A 4YHKH 3WIHH 4KKCC 1MNUH 1OAYL 1AKJA 3N9GH 1OTSD 2VUYA 4LCYB 5DA4A 1TETH 3QQNA 5DHVB 3TVMB 3P2TA 3CSYA 5KVEL 3BO8A 2VLRD 4KZDH 3VGAC 4ODBD 1YN7A 1H3WM 4U6VH 2UY6A 4XWOC 3IETB 5I74B 4R8WL 4WTZG 1F4HA 1GGBH 2GFBA 4MJ6B 1A6TB 1RSFA 3IFOB 2A1WL 5L2KA 1A9BB 1P4LB 1QFOA 3EJYD 1RZJL 2VXUL 3BN3B 1NGPL 3SDXA 3T0XA 5JZ7C