4NFDA

Structure of pilr l108w mutant in complex with sialic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
120
structure length
120
Chain Sequence
MLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQWQSIKGTKLTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Paired immunoglobulin-like type 2 receptor beta
publication title PILR alpha and PILR beta have a siglec fold and provide the basis of binding to sialic acid
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nfdA00
4F8QA 1CQKA 1MCLA 2YPLE 2R1YB 1WZ1L 3H9SD 3A6CL 2E5EA 3Q2CA 4W81A 4U6XB 3GI9L 2Y7QA 1EHAA 2APTA 4P9HH 3D2UA 3CFKA 5JMRA 4HWZB 2H2SC 1OTTD 3PL6C 3RKPA 3IAQA 5EZLA 2DD8L 4XVJL 5F7FA 3VXRD 2XN9B 5ADOH 1KULA 3CSPA 4JRXB 4CMHB 3LIZH 4G8EA 4U1HA 4GKZB 2D4DA 3MNVA 3CFDA 3AAZB 2Y7QB 4UDTA 3TJEH 3REWA 3CDYA 1NUDA 3D2UB 2XZCL 4I0PD 3MCKB 1YPZE 3FO1A 4PJHB 1VKXA 1U41A 1EAPA 1N64L 4NNXB 2N7AA 3IVKB 2C3HA 4PGEA 4F7PA 5EZIH 3SE9L 4ELKA 4TQEH 1YNTB 2VLRD 5A2JH 1P53A 4PJEF 4ODHH 4QHKI 1T5WA 1XF2B 4KK8C 3DMMC 3CFDB 4CN4A 3VGHA 2Y36L 4F8TA 1KCSH 4G6FB 2ZJSL 1CD8A 5CZVH 4N0YH 1HZHH 1G7HB 2QKIA 2V2TA 4FFWD 4F9PC 5CD5C 1T1ZB 1U8HA 3T3PF 5C0RL 2GY5A 1P1ZA 3V6OA 3S4SB 4NQED 1DBAL 2DJSA 4TVPH 1GL4B 3X3FL 3ULVD 2BK8A 2VLJA 1MVUB 3GSUA 2HFEA 1YY8A 2HWZH 1T5WB 2C7UB 2P8LB 3H9HB 2R0WL 1DTUA 5EWIH 2NTSP 2Z8VC 4K7PL 4YXKL 5ICYB 1X5GA 3H42L 5E6IC 2NXZD 2V2TB 3RUGE 4QHNB 4OZHF 5SV4A 4AM0A 5CJQH 1BQHG 4D0BA 1D6EA 1EMTH 4F7CA 5ADPH 4N9GA 3WFEH 2HFEB 2CLZA 4J3OC 4JHWL 3U2SB 3W0WB 1ZV5A 1FORH 2R0KL 4L4TA 2VN7A 4QHKJ 5C09E 2YHGA 2HG5B 5DUML 2OTWB 2XPGA 1UVQB 1SVZA 3UBXG 1AIFB 4MQXC 2CUMA 3IDXH 3JTTA 4K8RD 5DMKA 1LDPL 3GSRB 4XPFL 5L0QC 4KQ4L 5LCVL 1NBZA 4OKDA 4H8WL 3MBEA 5H8DA 1UB6A 1X5XA 1P7QB 1CLZH 5TDPA 4OAWB 4PJEE 4M6ML 4XCEA 1S9YB 1QFWL 3NCYS 3O6FB 3TA3D 2PW2A 1J05B 1QR1A 3S6CA 2GEEA 4AIXA 1MIMH 5CZKA 3CC5A 4PBVC 4APQC 3OHXB 4OCXH 3T3PE 5LGHH 3CCHA 4RGMB 4BH8B 5LBSH 4PJAE 3LRGA 3GMRA 5EZJA 2NZ9D 4QF1A 1C5CH 1KTRL 2OJEA 4NJ9L 4D94A 1MFNA 3WS6C 3S88L 4EUPG 1QR1B 1FE8H 4X6DE 1OM3H 4PGJA 5IW3A 1TZGH 2Z91B 3IDYC 1IC5H 2IAMA 5MEOB 4NWTL 2O93L 3VG0L 4FQIH 5CJ8A 3EOAA 4QEGA 5SV3A 3T0BA 1HXYA 3CLEL 3L3OA 4QWWC 1I9JH 3DVNB 3G6JB 1SEBA 5TDNB 2P47B 1AFVH 3VGAB 1PX3A 4PJDB 3NA9L 4L8BA 3BPCB 3C8DA 4Y19E 2P44B 3NGBC 3O3AA 2HMID 3U9UA 3MRKB 5I73C 1Q0XL 1G1YA 5DJZB 2W65A 4Y2DC 1AGBB 1ZLUK 4HUKB 2FSEA 2APWA 1INQB 4WV1B 1HXYB 2DLFH 3D18B 1ONQB 5CEXB 1UB5B 3U36B 3MODH 4ODSH 1JNHA 3AY4A 4LOUC 4L8BB 1UJTA 1YEFH 3QIBB 3LD8C 2ICES 3J8F7 4I18C 2YD1A 4G80A 4GAGH 2EH7H 1MCQA 2W65B 3GSVB 1ZVSB 1KJ2H 3ZE0F 1NBVH 2EIZB 4MNQD 1KPVA 2B4CH 3I6KA 2YRLA 4XWOC 4PJ8D 1YEKL 4XHJC 2AEPL 3KGRA 4GJTB 3ZHDA 3MRBA 4J12A 2QR0B 4F3FA 1KFAL 5C70A 2F5AL 4G8GD 3IETA 1C5BH 1XCQA 1UJ3C 3VH8A 1DQQB 5E94A 1AP2B 5IB2B 1LWRA 4NIKB 3QO0A 4KGLA 5DURB 3T04D 1IQDB 4XBEH 3KLSA 2I25N 4PJ5D 1I9RH 1GGYA 4S11A 2VZUA 2LU4A 2HLFD 2O5XH 1XF5B 1G9NC 5DMIL 4U7SA 3QCUL 2E8YA 1KLUA 4FHBD 1RUPL 1YUHA 1Y18B 1R0AL 5EZOH 3VA2C 5D96B 3RAJH 3KYAA 4NKOB 4HPYL 1FO0H 1JNNH 1DBMH 4XVTH 3DX6A 5FKPA 2R9HD 5C08E 4Y16D 3FB8B 1XR8A 2ITCB 4HCRA 5GS0C 3CXHJ 4YK4B 5CZXC 4URTB 2R1WA 3GRWA 4MQSB 5HSFA 1HH9B 5I1GH 1LK3H 2VC2H 2H26B 4LSPL 1XR9A 5DK2A 4GOSA 3UTSA 1S7UA 1YMHA 5I0DA 1D6VH 3NAAL 5HGDB 5ILTL 5JMOC 3ZE0E 4JFDD 1SJEB 2WINA 3STLA 3MV9E 3VI3F 4MDJA 4M93C 4GMTH 1A6AA 1XR8B 4QRPD 1BQHB 1MQKH 3L5WA 3B9EA 4J4PD 3ZYOA 4OLWH 3O0RH 3TPUA 3VFOB 1FFNB 2ESVB 1QLFA 3ARGA 3IDJB 5KSBA 3NACL 3BIBX 4Y4KD 1N59A 1Y0LA 1GC1C 1XR9B 5CP3A 5DK2B 2FJGA 4U3HA 4PG9A 3NH7L 5HYJA 2F54B 4O51B 2OJZL 1T1YA 3LDBC 3JV4B 3PG2A 5BCAA 1A6AB 3UBXB 3EJZC 5EO9A 3QHTC 5DD1H 2D7TL 1IAOA 4TTDD 1AKJD 4B7IA 1S7TA 1QLFB 3AS1A 4RMUA 1RJLA 2XICA 3TIEB 3FHQA 4D0DB 2G2RA 1B3JA 4A6YB 4L9LA 1SJHA 2UZYB 3MGTB 2ZJSH 4PJHF 4DW2L 5C0BB 3QXVA 4MYWB 3HZMA 4XTRD 2AK4A 3LS4H 3S97C 1DEEB 4MMXC 5C0RH 1IAOB 3PIQA 1EHXA 2RAMA 1S7TB 4JFXB 4Q9QH 4FXKA 4X7CC 3C9NA 2AERT 3OXSB 3CVHL 2B5IB 4MDIA 1JPSH 1A7BA 4L9LB 1BIIA 3DVGB 4K7PH 3L5JA 1R5IA 1JPST 1KIUA 1FVCA 3P0YH 3QPXH 3RWIA 1HHJA 4QRRA 4WEMB 3KWWB 4EUPB 1OCWL 4S2SB 3BPNB 1NC4B 4O9HL 3UPCA 5TQ0H 4JHWH 3ARGC 1IGIH 2N56A 1J11A 1ZA3B 2X9WA 1N5YH 2IH3B 3DI2B 1P5VA 5IBUB 3D69A 5DUMH 4CL7A 3KLHC 3IS1X 4Y1AA 3MV8A 3O3EB 3RWIB 1HHJB 3B3IA 5D1QA 2H9GA 3BX7C 5C6TH 5IV2A 4DGIH 5HPOA 1BFSA 1BECA 3IFOB 2VO5A 4P99A 5GSRA 2DWDA 5IVNA 3RVWC 2I60L 1KN2L 2XTJB 4IDLA 4NQUA 4U1MB 4YEEA 3DVFA 1UH4A 2JIXA 1TTFA 1UKSA 2VE6A 1JGEB 2W60A 2XN9E 2YKLH 3IU4H 4JRXE 4Q7DA 2E7CA 3LQZA 4Y1AB 3RL1A 2H2SD 5JR1L 5CJOL 1QFWH 5IV2B 1JWMA 3D85D 1QP1A 4HIHB 1RIHL 1U3YA 3KR3H 4PJHE 5GJTH 4NQXB 1N5AA 5D7JB 2DWDB 2P5WA 3MGOB 4MAYB 2NXYC 5CIPA 5TE4H 1PZ5A 2VZVA 4NQCB 3DYPA 5E56A 3CGTA 4GKSA 5IR1A 3SY0A 1G1CA 4P3DB 1KLGA 4LVHC 1KSRA 5D5MB 1BAFL 4ODVL 2M2DA 3S88H 4JANB 2W0LA 2WANA 2DYPD 3DLQR 2M8XA 4U33A 4XPAH 5J57B 5D7SH 5F7KC 4H0IA 5D8JH 1EH9A 2NY4B 4NWTH 1QFWM 2ARJA 3DMMD 1GYAA 3BFOA 5EU6A 1FSKC 1RUQH 3M8OL 4N0UB 4OTXL 5FO8A 2GJ6A 2DRUA 3PJSA 2AABL 1IAIH 1NPUA 3TT3H 4XX1E 2W9DL 2DQJL 4JRYD 3FQWB 5CD5D 2NW2B 4HWUA 3KPMA 3FRPG 1MRCL 4R2GB 2X4RA 2VWEC 5BQ7A 5IQ9A 3MRLB 4Y5VA 5EULV 2R2HB 2RJMA 5F7UA 4XCFL 3H6JA 5CEZE 5IB1B 1IGFH 3DUSB 2BSED 3SKOA 1NCBH 3P40A 2VLJE 4Q0XH 1EERB 3G6JF 1K2DA 2ZNXA 1BOGB 3PJSB 4WCYH 3W0WE 4L4VB 3RVVD 3ESVF 4PJDF 2XG5A 4XP1H 4JR9H 5BQ7B 2X4RB 3JSSA 4X99A 5E8DL 1OHQA 1KN4L 2D31A 1IT9L 4LRIC 2DQIL 1IAIM 3MLTA 4J2XA 5T5FL 3B4NA 4Y4FA 3ZDXE 5IMLA 4BK5A 4PD4J 5I66A 1F8TH 3DIFB 5JHLH 1WLHA 2FD6H 4GQPH 4ZNCD 3WO4B 4YHZL 3HE6C 4L4TE 1RIUL 3PQYA 4C56D 4GBXA 3KPSD 1SYSA 3NFPA 4MQXD 4TTGA 4OBRA 5ESVB 1GOFA 3D9AL 4X99B 2D31B 4QXTA 2R39A 4XPGL 4QY8A 4KFZC 4NO5B 1INEH 4OZFG 1XCTA 4AK1A 3P4NA 3PP4H 2B39A 3OX8A 4ZXBB 3KYKL 1CLYH 2LQRA 3RP1A 4JO3H 5F3BA 5KSVA 1FCGA 4D9LL 1JNLL 4JFZH 4U3XA 1A7OL 1QSFB 2JK5A 3VD5A 1DQJB 1PW3A 5D1XB 3SDDB 5E8NB 4FTVB 1AXSA 2PF6A 2R4RH 4ODUA 4XCCL 3QZWB 3EW3B 1QQDB 1RY7B 1PBYA 3OX8B 1XGTA 3QCUH 3MA7A 4TUOA 3CSBA 5F3BB 4AG4L 3EOTH 3EHBC 3KYNB 1H3XA 4N0FA 4LKCA 5GHWH 3KDMA 1U8PB 3VGEA 1F3DH 3G6JE 3HI6H 4HD9A 3BD4A 4PJDE 2YA0A 5C9JA 1CFBA 1NMAH 4WI5A 1NSNH 4M7JL 4Q74A 3IT8D 4JDZB 4X5LA 4YE4L 2R29L 4JFOA 1AI1H 4KTDH 2Y5TA 1AGEA 4K8RL 2HKFL 4QWWD 2DBLL 5IJKC 4TUJA 2EXWC 1LGVA 1AXIB 3MOQA 4GBXC 3ULUD 1B0RB 2HKHH 1NCUA 3WN5C 4WW1A 3SE4A 2UZIL 2WSKA 3WSQL 3N50A 3BKCH 4Y2DD 4HIEB 5IIEA 3OKDA 2QLVB 3UTQB 1CBVH 2FIKA 3Q48A 4G6KL 2UUDH 2C3VB 4HZLA 3TFKC 3L7EB 4OLYL 4LOUD 4R4BB 5F7YC 2FJHB 3ROLB 3BEWB 3QUZC 1ETZB 3X3GL 4K55A 2UY7A 2DQCL 3A6BH 3F7PC 4DGVL 4CDHA 4UIKL 5C6WH 4OGXH 1K6QL 5ICZB 4Y88A 1OAUH 35C8H 4XWOD 2X10A 2JJSA 4XHJD 2YPKB 4G8IA 1CGSL 4HS8H 2ADJA 3OXRA 4O4YH 3IFLL 3P9WB 4DW2H 3H3KA 3ZSSA 4BQ9A 2JELL 2AEIT 3RRQA 2WP3O 1MCHA 1GZQA 4WGVB 3MOBL 4JPKH 3VFWB 3OKOB 3HC4L 2FHCA 3CK0H 2FX8H 1U2CA 4BJLA 5I1HH 1SQ2N 2C5DC 1ZOXA 2UYLA 3MZTA 3BW9B 3EFDH 2ARWA 3QEQA 5TE6H 1BVLB 4C59B 4EDWH 2YSSA 2AJYH 1IGTA 1UKQA 1GZQB 1T0NB 4LCUB 5EIIB 1ADQL 1P4IH 4DKEH 4J3UA 4L3CB 3QUXC 1OPGL 1OCWH 2CRMA 3LB6C 1I9EA 1ZS8A 1WCQA 3TVMD 4EI5A 5DRXA 4LK4A 1RIVL 3GSXB 3ZT5A 2ZCLH 4KK6C 5C7XL 5GISL 3RTQB 4YHNA 1P6FA 1M05B 2HH0H 1M71B 2BOCA 2E6JA 5J6HA 1IC7H 4M8QA 1LO5B 4PPTA 5ISZB 2FR4A 2X70A 1UZ6F 4RMSA 5DK3A 5CZXD 1G7IB 4ZUUB 4HJGB 1ZS8B 1Q38A 5JA9A 2MCG1 3O2WL 1XIWA 5CSGA 4JPIA 1MCNA 3WJJA 3T0EA 3UTSE 4XAKE 1M7XA 5F7HA 5DD6B 3ZKQD 3G5YB 3MJ9A 2P8PB 1HSAA 5FYKL 4LPVA 4XC1L 2NPLX 3QWOA 3MX0A 3PF2A 3L95A 1BJMA 1QO3B 2DAVA 4BKLA 5D7IA 4DWHA 3ET9F 4K7FB 1CFSB 2VKXA 4LQ1A 2X4QA 1MFDL 5IVXA 3EJZD 4CVUA 1HSAB 4BSWA 2AJ3B 2E6QA 3C87A 4POYA 1YC7A 5C0BE 3VRLF 1UG9A 3QUMA 3FFDA 1CCZA 4PRIA 1IGML 3THML 1ORQA 1SBBA 2UWEA 4BKLB 2CMRL 3C09B 4Z6AT 4U1IA 1IE5A 1UXSB 4RFNC 2XRAL 5AYUH 3B9KA 5DMYA 4JFEB 2YWYA 3VG9C 4ZUSA 2E7LA 5D5MF 3PWPA 5DEGB 3O6LL 2RCSL 1BQSA 1HOCA 1HNGA 3IRZA 2AK4E 2OTUB 1HNFA 4YQXL 5KVEH 4KXZH 5M7QA 2Y07L 3LH2L 1CTOA 2UWEB 2WWMC 1MCWM 3B9KB 1QFWI 4X6BB 3SO5A 1BBDL 2CDGB 1INDH 3MMEA 5DD0L 4P5TD 4Z8FL 1KCRH 4JO4L 3D3VB 5HI3D 5HDBE 5B4MC 2OI9C 1OSPH 3WO3B 1UEMA 3O6KL 3C5JA 2GITA 3LQAC 1IT9H 5AZEL 3CH1A 3BSZL 5JOPE 2P7TA 2X4OA 3O8XA 1ZGLB 4U05A 3E6FA 4NRYB 4AEEA 4RWYL 4R8WL 4WFEE 2OL3A 1W72H 3N9GH 1KT2A 2XTJE 3FQRB 1K4DA 2XQBH 2J4WH 4Y4HD 1JGVL 3VXMB 3QT2A 1MVFA 3P4MA 2OCFD 5MENA 2R56H 4Y1AE 2HYMA 4NPYB 4X5WA 5DJXB 3T77A 4KH2A 1AE6L 4DQOH 3RVWD 5IEHB 3CMOL 4BZ1L 5FHAH 4ZFOL 4LLUA 1IAII 2PR4L 2BRRL 5SWQB 1Q9LA 4R96A 1BQLL 3VRLE 2AXHA 1ORSB 4KTEL 2B0SL 1KT2B 3ULVH 4ZPTB 4P2RD 5HPMA 4JO2H 2JLLA 4AMKL 4P5MA 3P4MB 3TNMB 3LKRB 1B90A 3QB7C 3T77B 2QQNH 4XCCH 1VERA 2PTVA 4NP4H 3WEXB 2NXYD 3V9FA 1I3VA 2QHLA 3MZGB 1RPQA 3FFCA 3H0TB 5FXCH 3TN0B 1WT5C 4FG6C 1KYOJ 5E1AB 1C7TA 3EUUA 4LSTL 3VFGL 2WUBL 5HPMB 2XOTA 5J1AB 2Q86B 1YJDC 3AM8C 4G8FB 5BVPH 3MJ7A 4XCYA 1FFPB 3MRFB 2H1PL 3BRGC 5DJ0A 2E6PA 3F6IA 4NZUH 4Z7WA 2JJWA 5C0AA 1E0OB 3X14A 5C92A 2R29H 3MROA 1DEDA 2HVJA 4KMQA 4JM2B 2DBLH 5EIQA 2EH8L 4I3SH 1OARH 5GS2D 3SN6N 2F8OA 2YD9A 2F9BT 4TULL 4L4VE 4NO2B 2VZ3A 4RMTA 2R69L 2X89A 5HHPA 2VLME 5T33H 4Z7WB 3NA4A 5C0AB 2CD0A 2Q7YB 5E08H 2YEZB 3TEUA 4C55A 2HVJB 1Q94B 4U1NB 3WD5H 1V7MH 5T1KB 1ZKAA 1EZVY 1F4WH 5L7XH 4R90L 1HYRC 5D6CA 2BCKB 2DQCH 4G9DA 4HUVB 2YOCA 3TWCH 2AXFB 4YHYC 5IVOA 3B5GA 2X5PA 1CE6A 3UPRA 3S96A 4X7DC 4JQXA 2R0ZH 4GRMA 1FG9C 3BWUC 3INUL 2JF1A 4R7DB 1A0QH 3VJ6A 1CGSH 1CL7H 3C2SA 5HHOD 2HN7B 3CLFL 1JGLL 3TCXA 1KPUA 2P5EB 1HHIB 3P9MA 3B2UC 3L1OL 4JQVA 4GKNB 1QSFE 1RZ7H 3D0VB 4L3ED 5I15H 3HLAB 2CK2A 4AY0A 1RQ5A 4RWHA 2VN4A 1EBAA 4FTVE 5INCB 3K0WA 4X7TA 1CG9A 1UKTA 3QQ3A 3UPRB 4GRMB 4ZD3H 4OQ1A 2EYRA 3VJ6B 4JN1L 4LHUG 3UJJH 5KS9B 2X1QA 1D5MA 1RUAH 4KJQD 4P23C 1SYVB 4K94C 3SGDI 4NCC1 4UB0L 1XGPB 5BS0A 5IEKA 2ENSA 3T3ME 4H1LA 3MRRA 4LLYA 1A3RL 4HJJH 4I4WA 4NBZB 3RX5A 4ENEC 1LO3H 2HP4A 3MLRL 5JOFB 1CG9B 2CLRA 3I3DA 3EHBD 1RJCA 3PP3H 2Q8BH 1D5MB 4GAYB 4KKLC 4QXUH 5MHSD 1A6UH 1XGRA 1F3DJ 4BELD 3E2HC 3BYTA 3FQTA 1ND0B 1MJ7H 3IRPX 1AY1L 3HNSH 4WTZA 2ATKB 4I4WB 5FKAB 3D48R 1LD9A 4HUXB 3GMOB 2Z4QA 4M43H 2CLRB 2VLKA 2BNUA 2XWTB 4QTHA 4JRWA 3LN9A 1DQDL 3QUYC 3U9PL 3TBVA 5JORB 4U2ZA 3MV11 4ZG1A 1QBLH 4R7NB 1I85A 2EXWD 4TSBL 2A0LC 4OFYD 4RISL 3CUPA 4HLJA 4QOKA 3UTPE 2PYFA 4K9EC 4JQVC 5L2JB 1PG7L 1NGZB 1LD9B 2DQDH 4YXHH 3ARRA 4XC1H 2CXKA 2VLKB 4LKXB 5KN5B 3RY6A 1WWBX 4O58H 2AGJL 4B0MM 2DM4A 5F1OB 3PV6A 1TJHH 3TFKD 4XNXH 1CXIA 2M26A 4YPGB 2PETA 1NCWL 4QOKB 1NUGA 1Q8MA 2K7PA 4KVCH 5BV7C 1E4WH 1OAXL 3B43A 3GBML 3GM8A 6FABH 4WTXA 3EJYC 1NC2B 4QHMA 5E4EC 3QAZB 5CJBA 3VWJB 3MJ8B 3VWKB 2A83A 1NDGA 5JHDD 1EFXB 1HCVA 3FT3A 2J6EA 2HJKB 3P4OB 4OF0A 1K85A 2W0PA 3VXSA 3ZTJG 5MI0C 4GXUN 1BBJA 1S3KL 2ZWLT 3LHPL 4CDGC 1PY9A 3V6ZA 4L29A 5DVLA 3GK8H 1WF5A 5SWZA 4HF5L 5FYKU 4W4OA 1FC2D 3NCJH 1FIEA 5J7CC 1GOHA 3QFDA 3ULUL 4IRSC 1MCOL 2NX5D 3MLYH 4JFQA 3RA7H 2WBJA 3HNVH 5F7EL 4AQOA 3BPLC 1IVLA 3QDGB 2QQKH 3F5WA 3V7AE 4HGMA 1TVBB 4MJ4A 1B2WH 3CVIL 3U7YH 5DS8A 3TT1L 3WIHL 1J1PL 3LB6D 3T0XA 1OAYH 1ZHKA 3QFDB 1CFQB 3RBSA 1FNEA 3BKMH 4OV5A 1P2CB 5IW1B 2EKSA 4RWYH 4LAQL 4KK6D 2GHWB 2ERJB 4LCCC 3DO7B 1SY6L 3HE7A 1ZHBB 4JM4L 1P9MA 4ZUWA 3V5DA 4OZGB 2YPLD 4FABL 1YNLL 5IHBA 5B3NA 1RUKL 5DD3L 4FQXB 5DS8B 4OD3L 4CMHC 1E4KC 3DURA 4X4ZA 3IAPA 2QHRL 3OB0K 1CE1H 2J88L 4L8SA 3UPAA 4XB7A 4LSQL 1I7TA 1N3NA 4BZ1H 2OZ4L 3EO0A 3RWDB 2D9CA 2ZPKH 4XAWL 3KLAB 3VFMB 3HAEA 3FJTA 4NCDA 2M1KA 3MOAH 2PO6A 3IDNA 1NCCH 4F37F 1KENH 1T3FA 4KXZI 3L5XH 3T0EE 2NY3C 3DURB 3RVXD 1CDIA 3MO1B 5EOQH 5F44A 4G42B 1N3NB 3EO0B 4IRZH 4OJFH 3PWVB 2DTML 4M5ZH 5GQBA 4LSTH 2QSTA 1I8LC 3P11L 4NN5C 2K9UA 1A7PH 4JFEE 3E3QC 4EIGB 3GMPB 2BSTA 3ZHKA 5IVXE 4ZUVA 3K8LA 5KVGL 1T89A 5J6GB 4IIQB 4JKWA 3E6HB 5E4IA 4U31A 1G9MC 1UEYA 3QDMB 4O5LL 3VI4F 1ACZA 3M45A 4HDIA 2UWEE 3BZFB 3WLBB 5J0BA 5SX4H 2VQTA 4GSDL 1GGBL 1U2HA 4LHUB 1MHEA 3PWUB 2EDTA 4HS3A 4D0CB 3DTXA 3M1BB 1ZLUH 3D3VE 4HK0A 3QEHB 4ONGH 1OAKH 2MCPH 3B9AA 4JFFA 2BX5A 4NKDB 3W9DB 2KUTA 2WWMD 4ERSH 1CIDA 1A6WH 1QSED 4UV7L 3BH8A 2EYSB 4JM2F 4HDIB 3H9ZA 3QUKB 1Q9KA 1BVZA 3L5IA 1S7WB 4EVNA 1E4JA 1TJGH 1L0QA 3PABA 2D7NA 3X13A 1E28B 5B4MD 5C09D 1DL7H 1X5AA 4XI5C 1Z5LB 2OTPA 3VFPB 2ZKHH 4PGCA 3VXME 2VABA 2DMKA 5GRWA 4W4NA 1G7QA 5AWNL 2VDRL 1M7IA 3O6FC 4IS6A 3U30C 2GJJA 3QFJA 4HKJA 3T2NL 1UH2A 3PABB 5GIRA 1YEJL 1OGAB 5A43C 1YYLH 3CLFH 3OAUL 4PTTA 4S1SH 2DQHH 3ARBD 3A67L 3RKDC 3OKNA 4XXDB 3DETD 4V1DA 4PGCB 4EN3A 2OK0H 3A6OA 1IAKA 4G6AD 4RGMC 1OF2B 3TO2A 4GRLA 4NO3B 3N85H 4XVSL 3MRIB 3ULSA 5MENE 5ITBL 3KPQA 5IHZB 1WWAX 3TIDA 3UO1H 5I1LA 2Z92A 4UU9A 5TDOA 2PYEB 4NQDB 4HKJB 2DMCA 5GIRB 2GAZA 4QXGH 3C60A 1H3PL 1U8MB 5DHVA 4E41A 1H3GA 2OXHA 2FO1A 3OKNB 4V1DB 2I26N 3LPWA 4GQ9H 4GRLB 4P2OD 1OVZA 2ZP0T 4YZFF 5CSBA 4HG4J 1NMCB 5FUOH 5CAYB 4FG6D 3JWOC 3FN3A 3U4EA 3VXUD 5KS9F 1CU4H 3HZVA 4LSSL 4JFPA 1A1NB 5IT2H 1N6VA 4UILH 3RGVA 1Q9WA 1AY1H 2VXQH 1DSFL 3OKLA 1P4BH 4CN6A 1S7XA 3AS0A 4M6AA 4N5UA 4YHPA 1P5UA 4Z7WE 5I75C 3U9PH 5C0AE 1J87A 3QIBC 1L0YA 1S9XA 4WI2A 3H3PL 1MFEL 4KUZL 3C2AH 3UZEA 1MEXH 2BXYA 5I17A 3RDTA 3OKLB 1T2QL 1KV3A 4NJAH 5FDYA 4HKZA 3RY5A 4HUUB 2AGJH 2YS4A 1WZKA 4JFHE 5C0DA 4L8CA 2I9TA 5T5NF 5DDHB 4JQIH 1NMBH 4RQQB 5EPMB 2YR3A 4AL8L 4PRNA 2PXYA 2V5MA 1I7ZB 2XNAB 4R4FH 3TH2T 5I17B 2GIYA 3LKNB 5HVGB 2P5EE 4YDKH 3O3BA 2DJUA 5MP6H 2EDQA 5FYLD 3VDAA 2FIRT 2QADD 2W59A 3NIDF 3BUTA 4RZCA 4L5FL 4V2CB 5DA0B 1AXTL 1JFQL 5DFVC 3TJHC 2X4PB 4X8XA 1MIEL 3MUGA 2QSCH 2OSLA 3ARYA 4U1GB 5KSUA 4UBDC 5FECB 2APVA 3QG6A 4YZFE 2K3TA 2NY5C 2R8SL 2MHAA 3DROA 5CILH 4B50A 4RRPG 4MNQB 5KS9E 3D39A 2Y06L 5MERA 5ENWA 4DKDC 1OAZL 3BI9X 4B53A 4Y5YB 5C07D 1U8NB 1VGEH 2JB6A 5TF1H 3KPLA 5C0FB 1S7SB 2HRPL 3W2DH 1JPFA 4TRPL 2VXSL 4NDMA 2MJWA 1QRKA 1L6XA 3RNQA 3MQIA 2I07B 3P77A 2O5YH 4EZMA 4P23D 1CFVH 2MHAB 5F7EH 1F90H 3DROB 4JHZA 4G7YH 1EEYA 1FVDB 1XGYL 4YK4C 1ED3A 1MJUH 4O00A 4O2CB 3G08A 2R23B 4ENED 5BS0E 2JB6B 1URLA 4NOBA 1JHTA 1JPFB 5JPNA 1U8IA 5C08D 5I19L 3I3EA 1MLCB 3EO9L 2DLGA 2W1NA 3BGFC 4S10A 4YEFA 4IHOA 1GHFL 5C2BH 4I8DA 1T83C 4KKLD 1YC8A 1I7UA 3QIWA 4RAVA 3FOLB 1JWSB 1ED3B 2WNGA 4P2CG 1RUKH 3JXAA 3KYOA 4M7ZC 2BVOA 1KELH 5FDWA 3DXAB 4OD3H 1PKOA 1SMAA 4ZMAT 4G7VL 1U8IB 3PDDA 3W39B 3QUYD 1PKQB 3LKQB 2F53A 3K8KA 3J7HA 3QXAA 5DVNA 3G5VB 5IBTL 3B83A 3QJHB 4P46A 4PJ7A 4YO0A 2VLKE 5I76B 2COQA 5FYJH 2A0LD 5IB4A 4MSWA 2EC9T 5CHNB 4OZGF 3MLXL 4EI6A 2BNQB 3TCLB 3Q6GH 3HR6A 1AO7B 2BVOB 2Z35A 3AMKA 3O3DA 4PB9L 4QOKE 2IPTL 4UT7L 1U3HA 1KTDA 3HRZA 2F53B 4Z77B 3RZWA 1E27A 4IDJH 3EYSL 2VZ1A 3L3JB 1G9NH 3BQUA 1MAMH 3I75B 2EDWA 2BVTA 3VD4A 1YEGL 3CFIC 2AJUL 4LASH 4UQ2A 2Z35B 1CGUA 3MYJB 4I0KA 1FLRH 1GOGA 4XMPH 4EXPX 1DBJL 1NKRA 1PJ9A 4OLXL 4XMKL 3REVA 2YC1A 3GHBL 5IQ7L 5B8CB 5D93B 4N0RA 5E8OA 2EO1A 5ANMA 3BQUB 2IPKA 3GKWL 4OLEA 5GS0H 4L9DA 4LF3B 4I1NB 5ABDE 3BPNC 4NSKA 1X5HA 5INDB 1NDMB 2N4IA 4N8VG 2DJ4A 1FNGA 1FPTH 5IFJA 4WI4A 1Y6KR 3VFTB 2A1WH 4IRSD 5E9DA 1RD6A 1QFUL 2JJUA 3NZHH 8FABA 3UDWC 4MD4A 4IMKA 4WNQB 5ICXB 1PYWA 1UENA 3RL2B 5HXMA 4LIQL 3HG1A 3IKKA 1D9KB 5F7NC 1GC1H 1ZVHA 2GTWA 4IRJA 4GW1B 4KJYB 5M95B 3RWEB 3GO1L 3U82B 4PYHA 1TZIB 3RZCB 2X4NB 3MREA 1J8HB 3OPZH 1DQMH 4OUUB 4HK3N 1N2RA 1HEZB 3CXHK 5ESAA 5IFHL 3HG1B 2IANB 4CMMB 1JTOA 2XN9D 5D7JC 5EUKA 1FZOB 4JRXD 1MUJA 1D5XA 4MAYC 3WS3B 4ONHA 4BQ8A 3FO9A 4WWID 5SX4I 3D2UD 5ITBH 1R3KA 2VDQH 3T4AA 1ZEAH 4OD1H 4ZFFA 3O2DA 1CF8H 2VXUH 5FOBB 3LSOA 1C5DA 3DSNA 5T1DL 1NAMA 3ZO0A 4WUUA 1HCFX 1S5HA 3EBAA 3FO9B 4G6FD 3BOVA 3BPOC 1IKFL 3TV3H 4PREA 4XPHH 1LP9A 4PR5B 3GHEL 1F6AA 4JAMB 2JE8A 4LPUA 1FZKB 1KCVL 2W9EL 4KK9C 4M1DL 4R2GC 4KHTH 5J06A 3QDME 3A0OA 5D70L 4P48A 1DQLH 1F11A 43CAA 3B8YA 2E8ZA 1RHHB 1IC4L 1A8JH 4P4KA 1BEYL 1DSFH 2Y23A 4ZS7L 3U0WH 1JPGA 3AREA 4LSUH 3HZKB 2RBLA 4PLJC 5K9JL 2IQ9H 1U9KA 2I5YL 5CEZD 2NY7L 1SM3L 4S0SD 1J5OH 1BFVH 5FV1L 3CH8A 2DQFB 1F11B 1KJ2A 1FZJB 5FCUL 3W0WD 3K74B 5IMKA 1NGXA 4P4KB 4NN7B 4XMLH 4MJ5A 3HMXA 4MHHG 3U0TB 3WO4C 1JWUA 2E27H 3KPNA 3KJ6H 2DQEL 3BGMB 2E9IA 1N6QL 4ODTL 3GI8H 1QLRB 4HMEA 1NGQL 3IDGA 4NKQB 3FAXA 3SGKA 2X09A 4LHJB 4OCYL 1FP5A 1JRHL 3UC0H 4ZXBC 1A1MA 1MAJA 1QRNB 4ODBD 1P7QD 1S7RB 4RX4A 4H88H 3G6DL 4OFPA 5T1MA 4U0RB 3V5KB 4Y7MA 4JB9H 1CVSC 3S5LB 2ZUVA 4GRWH 3KPNB 3MRDB 2WUCH 4F7EA 3O6FD 1A02N 2R2EB 3IFPA 4WO4B 2B1AH 4Z0BH 1WTLA 1EX0A 5D1XC 4OLVH 4KK5C 4JZNA 3SDDC 3BEVB 3RVUC 3ILPA 4Y8AA 1U58A 4KZEL 3IDGB 4DKFL 5H37G 2DF3A 3P0GB 5ACZA 4NQDE 3OKMB 3RWGA 2MWCA 3C5SA 3PHOB 5DA4A 4X6EA 5L6YL 2X40A 4LBEB 4V1DE 1PG7W 1N4XH 1FO0A 2XQYG 2ZOLA 1N0XL 3SE3C 4JY4A 5GS2H 2L7UA 3AREC 4EBQL 5JZ7D 1LQSR 1X7QA 5HHXL 4O2EA 4JZNB 3F7QA 3ILPB 1HN1A 1U58B 3BP4B 5IJVA 2ZCKL 5T1LB 2ORBL 2IG2L 1T2XA 4MD5B 4DZ8A 4UQ3B 2VDMH 5DK0B 1H9VA 1VA9A 1XGYH 3ARFB 5DO2D 1E6JL 3QI9C 4Y89A 3RHWK 2ZOLB 3V52L 2NYYC 5SWSA 2D03H 4PP1C 3VMOA 4O2EB 3T1FB 4RMQA 2OR7A 3LQAL 2HT4C 1AHWA 4JPWL 5I30H 2DTSA 5E2VH 2IFGA 5I1JL 1UADC 1VCAA 3DGGA 2G9HA 3SGKC 4XP4H 5BW7C 1DLHB 1E4XL 3HPLA 1ZGLP 2Z31C 4M1CD 5SWSB 3GSNH 5I8CA 1YEIL 2GSIA 4FNLL 3LRSA 1UT9A 5IW6A 3HI5H 3QIBD 2X7LA 3C8KB 5CWSA 3VDCA 4OFDA 3I6GA 4Z7UA 4ZQKB 1EBPA 5DRNB 1SBSL 5E6ZA 5D6DA 2VITB 4BA8A 2VXTH 3GIZH 3HPLB 5TGBB 3OJVC 1LK2A 3IKCA 3KS0H 4HIJA 1DLFH 5C8JA 4M7KL 3D25A 4CU6A 1KB5H 2CUIA 5TPWL 4EIZC 5FM5O 2X7LB 3HUJA 5CWSB 5JXEA 3U7AA 3I6GB 5DRWA 1HXMB 1VGKA 4UV4L 1MI5A 4PD4K 1FCCA 1OW0C 5EBWA 4WY7L 3QNYB 2XA8L 5DURD 5HGHA 1T21B 3ZKXB 5LQBH 1MFCH 1VFOA 1YJDL 4YHMH 5DFVD 4XCNB 1LNUB 5JQHC 3TJHD 4NNYB 4U1SA 1DBJH 4J6RH 3GHBH 4UBDD 5IQ7H 2CSPA 3AS2A 4BUGA 1CFTA 1U3JA 3QDJB 4J1UA 5T3ZE 1T7XA 1QA9B 5DRWB 1K8IA 2QQLL 4BYHA 1VGKB 4CKVX 3NZ8A 1RJYA 1XZ0A 2D0GA 1YMMA 4MD0B 3IU3B 3RPIA 3BN9C 4OZFA 1ACYH 5FV2A 1PLGL 1XGUA 3MLUL 4U1SB 5BOPA 4M6OL 3DSFL 2ZOKB 3RU8H 1RFDL 3NMEA 2GUOB 1K3IA 1A47A 1E6OL 1NANH 3QA3A 3MLZH 2X4TB 3OR7A 2IALB 4QRQA 3HMWL 5F93C 5IK3B 5D6DC 4H25A 1FIGH 2XA3A 3IFNH 4M7LL 1CI5A 4U2YA 3DV6A 4U49A 2BFVL 2QTEA 4X6CB 5EU7E 1YEEH 5ITFA 1TPXB 3MRHB 2V5YA 1BLNB 4HGWB 1BVKA 4XWGL 4XGZA 3SCMC 1KEGH 4NWUL 2ESVD 4NNPH 4QRQB 4G3YH 5DXWA 1GGTA 5GZNC 2KZWA 4MA1B 3ARDA 2VXVH 2YD2A 1D5ZB 3CFEB 4XAKD 3ARQA 3CX2A 1WZLA 2F54D 3DV6B 1AO7E 3LMJH 3QHZL 5D72L 3UJTH 5CINL 5H94A 1ZHLA 4MJIA 4MVBC 1SEQH 2F53E 4ODWA 2QJDA 2CR3A 3TBTB 2OR8A 1QKZL 4Z95L 4XGZB 3D0LA 4PJ7E 5FIEA 1HILB 1P69B 4OZIB 1BD2B 1KTLA 1I1AA 3WUZA 1QEWB 5I1DA 4EJ1C 5HBBA 1EAJA 3C09C 3RGHA 2YK1L 3GMQA 1S9WA 3RWJB 4E42A 3WUWA 5C0BD 1ZHLB 1MCPH 4U1KB 3QIUA 1QNZH 4ZAKA 1RUMH 2ZUWA 1AGFB 1F3RB 2XZQH 2EE9A 3MCLL 1CR9H 4X4XB 1KCVH 4ZO7A 1YQVL 3F58H 4L8DA 1MWAL 4TVPE 4H20H 3GB7A 5I1DB 2VL5B 1J9CT 4H8WC 1UM6L 2FATL 1HHHA 2B20A 1EJOH 3GMQB 1BEYH 4E42B 3WMSA 4S1RL 1IKNA 5CEYA 4QRUA 2DM2A 4POZC 1IAMA 1A5FL 2I5YH 1NEZA 2PCPB 5IROC 5ANME 5GRJL 2X05A 3PXHA 1NC4D 2BDNH 1EPFA 4WW2C 3NN8A 2D7PA 3GJEA 4M48L 3VFUB 3JWDH 3QRGL 4P4RA 3ARPA 4K9EL 3C5ZB 4KGJA 5CEYB 3I6LE 1R5VA 4DGYL 1LEKA 2LAAA 3BT2H 5JOPD 3MRQB 3MUJA 1IM9B 3IDMA 1N6QH 3E8UH 4N1EA 4P3CL 2DKSA 5HI5C 4FQPA 3SKJL 3BAEL 3HG1E 2C1OA 2IANE 2XTJD 4OCYH 1QG3A 3C6LB 3Q5OA 2R1XA 1J0KA 3HZYA 3UTZB 4JJ5A 2H45A 1CICA 2B2XL 3GJFB 4P4RB 5ID0A 3G6DH 5BV7L 1FYTA 3FT2B 4Y1AD 1Z2KA 1LEKB 4F9LA 4TUKH 3IF1B 3RX7A 1WFNA 1FL3A 3MRCA 1ZVYA 5EO1B 1G7LA 3MR9A 3GGWA 4P2QB 1FJ1B 2AJSL 3N1PC 5EOTB 3SJVA 4NZDA 1NGWB 3EYOA 1VESA 4NO0B 5D7JD 1YEHH 4CJ0A 1RU9H 4MAYD 1JGUH 3V4PH 5AYQA 5GGTL 1JHLH 1NGPL 1ZT7B 2OQJB 4NQCD 2AK1H 3TN0C 5ID0B 3WNMA 2X1XR 5LGJB 4WEBL 5IKCA 3UTTA 1OT1A 3KPOA 1IKNC 1KJMA 1DN0A 4EOWL 5CJXA 3EO1A 9CGTA 2I9LA 1JZ7A 3OJMB 5E99H 3GGWB 5DMGC 4ETQA 3EYUH 3EYFB 1S8DA 1DANT 4LNRA 2WW8A 1IGYB 4PJ9B 4WWKB 4G6ML 2NY4D 4PBXA 2JCCA 2BVPB 3BVNA 1GZPA 3SO3B 4GO6B 4YHLL 4KHXH 3P30H 2WM0A 3N06B 3ZMRA 1RZ8A 4JM2C 1FG2A 5IB5B 1TCRA 3JVGA 1KJMB 1O7VA 5CSZA 4FQQB 3EO1B 4NUJA 4U7KA 2I9LB 1FRGH 4KK9D 4R2GD 3W82A 5F89A 1RZJL 1P84J 4CUCA 3MRNB 4WRLA 4QHUB 4LNRB 3QCVL 4IOIA 5D1ZB 3K80A 4JCMA 2JCCB 3L3IB 1MJ8H 4LLMB 1MFBL 3OQ3B 1RZ8B 5I18H 4L4VD 4XNYL 4OCMC 4PLJD 4OT1H 2VLMD 5E6YA 3PWNB 1JN6B 2EDDA 1UCBH 4Q9CA 2FB4L 4MNHA 3DUUB 5BXFA 3IJHA 2EE2A 2DQUH 3LRHA 4PJXF 1WICA 4K23H 5J3HC 3O9WB 1MF2H 4ISVB 3M17A 4DVBB 5F1NA 4JZJA 4MLIA 3MV7A 5KW9L 1GGCH 4LLWB 3ZSTA 5E8EA 5CGYC 1QRNE 4NC1C 5D2NB 4X9IA 3SDXB 1U6AH 4ZPVA 2CPCA 4Z7VA 2VJXA 1H0DA 5EUOB 3HHRB 2R4SL 3CXDH 5CMAB 3TM6A 2E3VA 2ZCHH 4ZXBD 4YUEH 5HGBA 4LPCA 3QWRA 4W70A 4NUGH 2XA8H 3BHBB 3R1GL 4KRPB 1AD9A 5IWLA 1QSFD 2R2CA 5HHVH 5EA0L 5MEPA 1BJ1J 2LU7A 4QYOA 3JVGC 4X8JB 5D1XD 4HKBA 3TO4C 1NLDH 5TQ2L 3SDDD 4FTVD 5EORH 3RVUD 1H0DB 1EO5A 2R2BA 3KXFA 2GK0A 4J8RB 1QFHA 4PV9A 5DJCA 4DTGH 4NGHL 2QV2A 3OV6A 1KTKE 5E00B 5CEZL 4GLRI 5TFSH 1ULVA 1EIBA 5FUCE 1PLGH 1W8NA 5L2KB 4NM8H 1HKLH 5GGVH 2FO4B 1NCDL 1CFNA 1YNKH 2MOVA 4HKBB 5F9JA 4OGYL 3UJIH 5CP7B 1DVFB 5HGAB 2ITDA 5F88B 1M1SA 1GPOL 4PV9B 1KXTB 5HHQA 1DBKL 1E6OH 1KYOK 4XBPA 5DUBA 4JKLA 4CNIB 1WC7A 3RWCB 2BMKB 2NYYD 2IGFH 5DUPL 2DKUA 2VH5H 5HDOA 3ALWA 1ZMYA 4PP1D 3RVTD 4F37K 2BFVH 4PRAA 1XGQB 2HT4D 4I2XB 5SWSE 1YA5A 3WFCL 2EC8A 4FZEL 4KRNA 5FYLH 1R5WA 3IXAA 4ZTOH 2WQRA 3OB0H 3BP6A 4LLDB 1DUZA 3MBXH 1WC7B 3TESA 4YNYB 5DJ8B 4J3TA 3QHFL 4OD2B 4F57H 4X6CF 2CDFA 2BNRA 3QEGL 3FAWA 4PRAB 5GGRA 1NBYB 4YR6A 4YFLF 4R0LC 3RIFF 2HJLA 3TH4T 4AH2A 1IEAB 1R5WB 1ZLWK 3VFRB 4KAQH 3VWJC 3QAZC 1I8IA 3VWKC 2IH1A 2XACC 4YDVA 3EYVA 3KS0J 1U0QA 4K94H 3SE8H 2CDFB 2V5SA 1TZHA 3W9EB 1ZWIA 1GAFL 4NHCH 4ZFZA 3FB7A 1T7ZA 1UWXK 4OLZL 1NANI 4YR6B 1BZ9B 1HHKA 1OWWA 4KI5F 1KNOB 2HLAA 3H9SA 3MCLH 4OZIF 1YQVH 3JWOL 1I8IB 4RMVA 3GMNB 1MHPH 1B88A 4YDVB 2Y6SC 5KSAA 3EYVB 4RFEA 1QSZA 4OCWL 2FATH 2W0FB 2WLZA 4JG0H 2V5TA 5HYIA 3BZ4B 4PGBA 3FB7B 1IBGH 4MCYB 4ETYA 4JREC 4KQ3L 2AXJA 1OLZA 3EFFB 4QCIB 2H32B 4UT9L 1HQRB 1A22B 5BRZA 5F72S 3L9RB 4I0PA 4WFFE 3UZQA 5J13C 1FDLH 4JVUA 1YMME 4LCYB 1RK1B 3R0MA 2VLRA 3RTQD 2CIIA 2ERJC 4K9EH 4HXAH 1S7QA 3FQXA 4PJFB 4Q6IB 3LKPB 4JGMA 2A9ML 4LVNC 2ED7A 2D2OA 2V17L 4FQXC 5ISZD 1F58L 1P6AB 4X6CE 1U42A 3PWJB 3SKMA 5GS1B 5BRZB 4RBPK 3VU2A 3MUY1 2AI0H 4M61B 3OTTA 3TZVB 2H2PC 1CVRA 5I8KL 1HYSD 1IQWL 4KPHH 4NQEA 1J0JA 1W72B 1A7QL 1J1XH 3FCTA 3RI5F 5JUEL 5ID1A 1T2JA 3OJDB 4XNUL 4AENA 3BZEB 4P57A 4BH7A 4D9QD 4CVWA 3IGAA 4HFWB 5E8PA 5IB3B 2P43B 5HYSB 5I1CL 5JW3L 5BZWA 3MSPA 4K07A 4X7SH 3TNNA 4XC3H 1UH3A 1DJSA 1LE5A 4RAUB 3H8NA 3WE6B 3WXVL 4KI5E 2ED9A 4NFCA 5GGTH 1BD2E 1OTTC 2WP3T 4GUPB 4WHYG 2FWOB 1OD7A 4MVBD 4NM4H 4Q9RH 1A14H 1D5BA 3IGAB 3SQOH 2E7BA 2BJML 4Q97A 2G60H 3QEUA 3TBWB 5CCKH 3U83A 5FFLA 2FH8A 5FO9A 3K81A 5GRZA 4IIQC 1QVOA 3QISA 4PLKC 1QPXA 4O02H 5FGBA 4JFED 2A73A 2OYPA 1TQBB 2DQTH 3S36X 1A9BB 4UOW1 1JUFB 2QBWA 1YPZB 2IADB 5B38A 4K3JH 4K3EH 2KZ1B 1NJ9A 1HDMA 2DL9A 4DK3A 1C8PA 5FO9B 2X4UA 5BMFH 3TA3A 4BQBA 3HNTL 2CGRL 3B9KD 4KU1A 4HCRL 1HWGB 4MLSA 3AROA 4MAUH 3GRWL 1U95A 4N5EC 1LE9B 1ZLSL 4POZD 3D3VD 5HVWA 3VXQA 1JBJA 1KPRA 4OM1L 2NY0B 3V7MA 1NJ9B 3S3JA 2J8UA 4YBQC 4QRSA 2YA1A 5EDXA 2CRIA 1AQDA 3L3DA 5HJ3A 3U1SH 1BZQK 3EKCA 3QULB 2VDKL 1X4ZA 3BKJH 4QNPF 4M5YL 1PEZA 1U8KB 4X80H 1KPRB 3NFSL 1HSBA 3PNWA 3VXMD 3MXWH 2V2XB 5HI5D 4YBLB 1ROWA 5GJSH 2R4SH 1R3IL 1GIGH 3FN0L 2IBZY 5F71A 3S37L 1UWEH 4HS6B 3R1GH 3KPRB 4PGDB 4RAHA 1PQZA 4XPTL 2CLVA 3SDXF 1KIQA 1DE4A 3HTLX 4MA8H 4ZSOA 1FYTE 4N8CL 5EUOF 2XZAH 1KG0A 3VXOA 2I24N 5JO5A 4P0DA 5IHUL 2ADFH 2HTKD 4KKCC 1G9MH 1JJUA 5DJYB 3TN0D 5JDSB 2Q87A 3LN5A 5K59F 2Y5EA 4GW4A 1OOAA 5ERWA 3FB5A 3ROOB 2GJZA 1A6VL 4F7MB 2GKIA 2LU3A 5LJYH 3UTTE 4OGYH 1IZKA 1D5IH 2ATPB 4PJ8A 1G6RH 3MACL 3F12A 4PV8B 1GRWA 3ORJA 1EVTC 3U6RA 1R3LB 4PP2B 4G8GA 3EDFA 5B22A 3ZKMD 1HHGA 4JM2D 5EFIA 3EOBB 4TPRH 2JCCE 5HYFA 1F42A 4PJAB 2HFGH 1FV1B 1I4FB 1WCBA 4RGNB 5IG7A 3QH3B 4QNPE 1XH3B 4OBSA 1BHGA 5EU4A 1WFTA 4X6DB 5C0AD 4Y5XA 4YLQT 5DJDB 4PJ5A 3CU7A 4LSVL 2BY1A 3WXWL 3RNKB 2QSQA 2HMIC 4Q6YA 5T1KD 3AB0B 1P7KA 3BP5B 3QEGH 5D7LA 2AV1A 4U1JA 4NQVA 3WL9A 4Y19B 5HHNB 4G5ZL 5JQ6L 4PJGB 5J3HD 1UM4H 1A7NL 4JFHD 1PSKL 3AXLA 5EUOE 1CT8A 2H6PB 4X6FA 5TH2B 4Y16A 4U1GC 5CGYD 1VFAB 2FYYA 3S34H 4K71B 5HDQH 1P7KB 3U0PB 4NYLA 1RZGB 3MV7E 5GSVB 1GAFH 2P5ED 5D7LB 2AV1B 5KZCB 1B0GB 5FOJA 4WU5A 1R3JA 5K59E 3U79A 3I50L 4UTBL 1N6UA 1YN7B 4HV8B 4JDTL 3PHSA 2A6KB 4Y5YC 4Z7VE 3T8XA 4JFDA 3OAYK 1IM3B 1RVFH 1CT8B 4U6HB 4D8PB 1CLOH 2HAZA 3QJFA 3WFZA 3QO1A 2X1PA 1UM5H 3SDYH 3B6SB 4QRPA 4J4PA 4RIRB 4DCQA 1NAKL 4XPBH 3GSWB 4GG6A 3SDCA 4PJBB 4Y4KA 4LCWA 3MUZ1 1R3JB 5L2KE 2BVQB 2WIIA 3BRFA 5EU5B 2IF7A 4P5KB 1FZMB 4KVNH 1EVUA 3S4SG 3T0AA 2P24B 3QO1B 1I1YB 1W0WB 4OF5A 1R3HB 4DVRH 3CX5J 3ECBB 3DV4B 4RFOH 1OT2A 2AEQH 5IFAH 1AKJA 2VZOA 4XX1G 3SDCB 4LCWB 1HINL 4CJ1A 3MJ6A 4QHLA 4UOW0 4UNTA 4I2XE 4HG4K 1F4YL 5EU7C 2YXMA 1WGOA 2EC9U 4ZFOA 2ZG3A 5F97E 5FYJU 1JHKL 2YPVH 5HYQB 1WSST 4PJFF 4OZ4A 4X98A 5DHVH 4K3DH 4XNUH 3FT4A 4GXVL 4XH2B 5AZ2L 3WNLA 5F3HB 2R0LL 4XP6H 5I8OH 2VLKD 5D2LA 5F6HI 1A4KB 3MRJB 1QBML 3T08A 1C08A 3W11D 1J10A 4HEPG 1MRDL 5C0CB 2CKBH 2F19H 2V7NA 1MFAL 2NY5H 2ZUQC 1RSFA 2NNAA 3VFVB 3RWHA 4QOKD 3TBYB 4MWFA 1L9NA 1T1WB 4FQLL 1S5IH 3QCTL 2XKUA 2GSGB 2DS4A 4PS4L 3MV9B 2Z93B 1KBGL 4KC3B 2EO9A 5A16B 3V8CA 3R06B 1NL0L 4HWEH 4WJ5A 5C0GB 1NC2D 1RURL 3VWJD 1GGIL 1EFXD 4ONOA 4FQCL 1CDGA 2ID5A 3SDAB 3U4BL 4EDXB 5B8CC 5E2WL 5F1IB 2NTFA 4RGOH 4WHCA 2PTTA 3T4YA 3HR5A 1MJJA 4HIIB 3HC0A 1T22B 1C16A 4LU5H 2EDOA 3RIAF 1ZHNA 3LKSB 2FECL 5F7DA 3V95A 5F9WC 4F33A 3CIQA 1XFPA 1MLBA 1AC0A 1F4AA 3SPVA 3PL6A 1BFOB 5CBAA 3BDYH 3FMGL 3D85A 2NTFB 4YHKL 1HH6A 3QDGD 4YWGL 2IFFH 4U1LB 1YPZF 5IGXL 3HPJA 2Y72A 2D7QA 4OIIL 3P0VH 1CTNA 4YGVA 4PJFE 4PY8J 5FA4B 1TTGA 4UTAH 3RZCC 1DZBA 3FL7A 3PL6B 5CBAB 3WIFB 5BRZE 4YFEA 2VQ1A 3VW3H 3K2UL 1UACL 2EEAA 2DYPA 4M6NH 1S7VA 1HH6B 1TJIH 5C0JB 1JV5A 1AJ7L 3GMMA 2AJXL 4YHIA 4HWBH 5EOCL 3DMMA 1KCUL 4FQXD 2A77L 2XKNB 5EU3A 4IEFB 4A6YH 3NCYP 1FNSH 4JRYA 1UYWH 1EK3A 4F9PA 2H2PD 1L7IL 4PJCB 2PW1A 5JIKA 1AR1C 1MHHA 3MNZA 2Q76A 3WJLC 2SEBA 1JV5B 4HULB 3ELAT 1T66C 2VDOH 5K9QG 4FZ8H 3JWNC 1PAMA 4XPTH 5JIPA 1YDPA 5I74C 1J0IA 3ULVE 1VDGA 2BOBB 2CDEB 1U8OA 1T1XA 1K5NA 1HIMH 5E6IA 5KVDH 1OQOA 5DRZA 5EBMA 1IL1B 2ICWB 2BSRA 4NFBA 1FN4B 32C2B 4EUPH 1T0MB 2FX9L 1WBXB 5GRYA 5BZDA 1YDPB 2C4XA 3FOMB 4LEOA 1B6UA 4U6VL 1UZ8A 1K5NB 3W5NA 4OLUL 2G75A 1F4XH 4JPVL 5E6IB 5FUZL 3JV6A 4FFVC 3AGVA 3SGEH 3CFKB 4C56A 3KPSA 4WUKL 3X11A 4AEHL 5EBMB 4M1GH 3HCVA 4HUNB 1YEDA 4I3RL 3VH8G 4PLKD 5AD0A 1IMHC 3QDMD 5EZLB 3C6SA 2LVCA 1A3LH 3UYRL 4LP5A 4TOYH 4LHUD 4G8EB 2HRLA 3VXPA 4U1HB 4X5XA 3MNVB 1V8HA 2MNUA 4UDTB 1I9IL 3REWB 1CGYA 3PE9A 4NN7C 3FO1B 1VKXB 5I1EH 1EAPB 1Q0YH 4FFYH 5JNYA 1YEDB 4PGEB 3WNNA 4F7PB 4PLNC 3WCYA 3MYZA 3O11A 4ELKB 5L0QB 4PJAF 5HTSA 1JZ4A 4N5ED 5HDLA 4APQA 5F9OL 3SBWC 1KCKA 2L4OA 1V3LA 1F97A 5ACLA 4FMKA 4QTIL 4WU7A 4WI3A 1N26A 4X6DF 4YBQD 5BVJA 4N8VA 1G7PA 4JG1H 2X1WL 4UAOB 3R4DA 1ERNA 2AJVH 5I16A 2QKIB 5KVMC 4U0RC 3RVVC 3WS6A 5JQ6H 3MJ9L 1JZ5A 1U8HB 1P1ZB 1T5XA 4R6UA 1T7VA 4WO4C 2OS7A 3SOBH 1OAQL 4APQB 1L6ZA 1VPOH 2VLJB 3GSUB 1OGAD 1YY8B 3BIKA 4X7EC 3VA6A 3KYMA 5I8EA 4FFZH 1MRFL 5T3XH 3KPRE 4PJGF 5DJ2A 3FTGA 1JGDA 15C8L 3ALXA 4AM0B 2DBJA 4D0BB 1D6EB 1QLEH 4F7CB 5J12B 4V2BA 2PYED 3QUML 4NQDD 1OL0A 4N9GB 4C4KO 5ALBL 3AU1A 4DN4L 2CLZB 4Y2DA 5DQ9A 1T04A 3KYMB 3V6FA 3S35H 1GH7A 1RULL 1T03L 4L4TB 4V1DD 4EN3D 1AGDA 4DUWA 4J3WA 4LSRH 3V0WH 3ARFC 3WIHA 4GRLD 4KKCD 4YDIH 2XPGB 5AEAA 5EBLA 4ORGA 3CFCL 4NBYB 4I77L 4I18A 5A40E 1FFOA 2CUHA 3JTTB 3MLWL 3MLSL 5H35A 5DMKB 1KJ3L 1ZTXH 5DQ9B 5I1AA 1NBZB 2BY0A 4R4NC 4PJBF 3MBEB 4R26L 1H8SA 1UB6B 4DZBA 4PB0H 3MRPA 4UT6L 5TDPB 3RPKA 1FH5L 4Z7NE 1NCTA 4XCEB 4ORGB 5IESL 2NW3A 4RGNE 2EEBA 2PW2B 3QNZA 4XBGA 2IWGA 3WNKA 2B8OT 4CBPA 4GAJH 1UJ3A 3O2DH 5ALCH 5CD3A 1JK8A 4Z78A 2O61A 3CC5B 4DZBB 3CCHB 3O45A 5FM8A 1NAMH 3GMRB 5B39A 5EZJB 4GMSL 5IBUG 5DLML 4QF1B 3ISWA 1RJZA 2J2ZA 2OJEB 2R0LH 3K4DA 2JJTC 1F00I 4P9ML 1DBBH 3ULUC 1QBMH 2Q1EA 4PJGE 5CD3B 2F8VA 2J1KA 2IAMB 5DQDH 1SJVA 4KJWC 3GBNH 5CKAA 3EOAB 2CIKA 1HK6A 2OLDA 3L3OB 3G6AA 3MA9H 4OKVA 1RJZB 1SEBB 1U8LA 1FFRA 3QDAA 5D7LE 4K7PX 5LVEA 3EDDA 5EO0A 1YECH 4HEME 3RBGA 3O3AB 3Q6FA 4JLRA 5EIVA 3U9UB 1OP9A 1Z3GH 3H2WA 4MB3A 2IJ0C 4G6JL 2FSEB 2CIKB 2LAGB 1WTGT 4CU8A 4OM0H 5TE7H 4LARL 2MKLC 4OKVB 1HQ4A 1QYGL 1JMZA 3HMXH 4PJBE 1RZKL 5EO0B 1CDUA 1JNJA 4UINH 1JNHB 3F62A 5T3ZD 2IMMA 4JLRB 2Q8AH 4ZYKA 1UQSA 4G80B 5ECJE 5LWYH 2OBGA 1FAIL 12E8L 1B4JL 2ZUSA 5H2BA 3PGFH 4HHAA 1BGXH 1KPVB 4KTYA 1FNLA 3I6KB 1ZSDA 5JXAH 4H0GA 4OCSL 5FYKD 5KTEH 1UXWA 4LCWE 2A2QT 2DLTA 4HFUL 3MRBB 3FKUS 4F2MA 1UA6L 1IEBA 1H3WM 4F3FB 3KJ4C 4S1DD 3V4UH 2NY1B 3IETB 4HT1L 1XCQB 2PNDA 3OZ9H 1XF4A 3TYFA 3FHAA 3VH8B 3O6ML 3I9GH 4PIRF 4JHAH 5E94B 1LEGA 4LQFH 5E2UH 2ADIA 2VISA 3WIIH 3QO0B 2YRPA 1RZFH 1ZSDB 3TVMC 4ELMA 2EYTA 1FGVL 4M62H 4BSVA 1ZANH 2MPAH 4S1QL 2A74A 1T20A 5EBGA 5BO1L 3DXAD 4JJHA 4QGTA 1I1FA 1IEBB 2CJUH 3OF6D 4DN3L 3BUYA 3PGDA 3DYOA 2VDLH 4MQ7A 3TYFB 1P7HL 2B1HL 4BZ2L 3EYQD 4XP5H 1CDYA 1LEGB 4CW1A 2BNQD 4AYFA 1J86A 1A21A 4KI5C 1KLUB 5C0CE 2CRZA 3NFNA 4JY5L 4X0KA 1OGTA 2EXYC 1AO7D 4YDLC 1YUHB 4BSVB 3I85A 1I1FB 4KROB 1WZ1H 3A6CH 1NQBA 2NMSA 3BUYB 4PJCF 4P5TA 2F53D 2OX5A 3GI9H 5K9KA 5MEQA 3DX6B 5FKPB 1EO8L 5AAMA 3FO0L 4RA3A 5F70A 3P9LA 2R15A 5J11B 2CRYA 3O4LA 4HC1L 3K1DA 2R1WB 4FXGA 4B41A 2DD8H 4XVJH 3PGCA 2ENYA 3T0DA 3ZL4L 4KZDL 3UTSB 4YX2L 3VMNA 4U6VH 1S7UB 1YMHB 5HGGS 3UBXI 1C1EL 2WINB 3STLB 2XZCH 4WUKH 4MDJB 3QZWG 1TVHA 1N64H 4JKPL 4LPYA 4N1HB 3BQUD 5AAWA 3L5WB 3P9LB 3SE9H 3O4LB 2O26U 1DFBL 1V7NL 2YMXL 3TPUB 3ARGB 4KV5F 4NN6B 5KSBB 2ZG2A 1MCRA 1N59B 1Y0LB 3O41A 2FJGB 2DDQL 4HXBL 4PG9B 5HYJB 3EDEA 3B8SA 3DOSA 2Y36H 1T1YB 4HX1A 1F4HA 4P2RA 1IFHL 5FF6A 1AD0A 4LEXL 1TVHB 3C5ZC 5EO9B 1CK0L 3MRMA 2GFBA 4I48A 1J8KA 1DBAH 1TETL 2GK2A 3X3FH 1HI6A 1D9KD 1RJLB 2WK2A 4LDLB 2G2RB 3F8UB 2R0WH 4HPOL 4XNQA 4YPJA 3T65A 3FONA 1I8KA 1JPTL 3I6LD 1SJHB 4HX1B 3VDBA 3C6LC 3RZCD 5FF6B 3OGCA 4YXKH 1J8HD 3HZMB 4J3SA 2AK4B 3H42H 4P5TC 4FP8L 2YA2A 3G9VA 3MRMB 3WLWD 5HI3C 3ARZA 3PIQB 1NCAL 2HVKA 4PJCE 5DGQA 1OAQH 3HG1D 4FXKB 4W68A 3C9NB 2IAND 4FQJL 1U93A 4AJ0A 1OB1A 1SHMA 4MDIB 2B7DT 3PDOA 3SGEI 4OZFH 1I8MA 3FONB 2EZ0C 2R0KH 1BIIB 4MQTB 3B2VL 3SKNA 3L3HA 1R5IB 1FVCB 1AR1D 4G43A 1H8OA 2J8OA 1U91A 1RMFL 4QRRB 4Y4HC 3IDIA 4JRYE 3BH9A 3O2VL 5C1MB 1DANU 2FLRT 5D71L 3NBNA 2HVKB 2W91A 1A2YA 1T66D 1LDPH 2YD6A 4WI7A 4XPFH 5ALBH 1U93B 4OI7A 1TXKA 4KQ4H 1OB1B 5LCVH 1N7ML 1OP5K 4EQ3A 5DZOA 1X5FA 4H8WH 4UMGA 2J6EL 2FX7L 5KJRL 4PJ9C 4WWKC 4NKMA 4KV5E 3WNPA 3D69B 4M6MH 3MV8B 1NFIA 4YBHA 4X4MA 3B3IB 5D1QB 3BH9B 2H9GB 3ZDXF 4LRIA 3MLSH 2C9AA 3S98A 1GJIA 5GSRB 4K3HA 4RMRA 3BKYL 1A6TA 5LAXA 2H41A 2IPUG 6CGTA 5D1ZC 1QHOA 2CQVA 2JIXB 2VE6B 2W60B 4LFHD 3HE6A 4FFVD 3LQZB 5HHOA 3RL1B 3GSNA 5DWUL 4GKOA 4NJ9H 1EXUA 2YZ8A 1JWMB 4L3EA 4E9LA 3B5TA 3BESR 4C56E 2DLEA 3RIFK 5FK9A 1N5AB 3V5HA 2P5WB 3FRUA 5CIPB 1PZ5B 3CDGA 3V7AG 2IBZX 1CZ8L 2EDHA 2BC4A 4XXCC 3VG0H 4OSUL 2FGZA 4GKSB 3O9WC 3HE6B 5IR1B 3SY0B 4P4KD 1KIPA 4UDUA 2AVGA 1LILA 3CLEH 3I02A 4GMSH 1V3MA 5FO7A 3RFZC 1KLGB 4DUVA 2RFXA 1EXUB 1KB5A 1EV2E 3NA9H 5GGQL 1J7VR 1F3JA 2J5LB 5D2NC 4AEIL 3CZFA 3V6OE 3FRUB 1Q0XH 2ARJB 3GSQA 5L88L 5EU6B 3LEVL 1ZLWH 5FO8B 1QRND 1QR4A 2GJ6B 4NHUA 3LN4A 1KEML 3KPMB 1KACB 1CDJA 4WO4D 5IQ9B 4Y5VB 2WV3A 1UWXH 3CZFB 4DAGL 3VGGA 3SKOB 5AUMA 5J4MA 5CFHA 1K2DB 1KIRA 5IJKA 3HC3L 4NHUB 4JO1L 5DI8A 3WYRA 1YEKH 5C0IA 2AEPH 3LN4B 1IJ9A 4OFYA 2XQYK 3NCEB 3WN5A 2F5BL 1KFAH 2F5AH 1DVFC 1W0YT 3MLTB 3OAZK 4Y4FB 5T1LD 1B4JH 5IMLB 5I66B 2DB8A 1JP5A 3ARFD 3PHQA 2W07A 3PQYB 5DFTA 4GBXB 4QRTA 1SYSB 3RI5K 3NFPB 3IXTA 3G5ZA 3QUZA 4KJQC 5D9SA 1DDHA 4NQSA 3S36L 2YBRA 4QXTB 4YAQA 3CFJA 4I5BA 1BM3L 4R4ND 4YXLL 4QY8B 1MCJA 5DMIH 1Q1JL 1XCTB 3P4NB 3FB6A 2FZ3A 4X9FA 1FGNL 4HLZG 5IVZA 5JHDA 3HS0A 4IOFC 4PJIA 4RBPH 5KSVB 4C83A 3GJFK 1NBQA 1AGCA 1RUPH 1R0AH 1IC1A 2JK5B 3IXTB 1FBIL 3QUZB 1KC5L 5SWSD 4HPYH 2OM5A 3Q1SL 3K4ZA 1AXSB 3CPLA 4ODUB 1P84K 1W2KT 4TSAL 2VNCA 3FB6B 2FZ3B 3ES6A 5FYJE 1XGTB 1WQVT 3MA7B 3HS0B 4TUOB 4NRXA 2NY2B 2VAAA 1I3GL 1AGCB 2NCMA 4LSPH 1MCBA 3MV01 5EH1A 2NX5A 2EDLA 3ALPA 4N0FB 3VRJA 4LKCB 1MOEA 3KDMB 3NAAH 3ZZ1A 5ILTH 2IQAA 3FQNA 4HKXA 3QUXA 4LLVA 3KG5A 5C9JB 3SGDH 4KJWD 2VLLA 4JFOB 4NRXB 2OR9L 2Y5TB 3NACH 1AGEB 2GCYA 1JCKA 1NGYA 1BX2A 3NH7H 4TUJB 1FVEA 1NLBL 4JHBA 2OJZH 1NH6A 3FQNB 4ZODA 1BF2A 2AKRA 4HKXB 4WW1B 3QUXB 4MXVF 4HUWA 1LDSA 4XNZB 3LAFA 3QDJD 4R3SA 5DFWH 2D7TH 5IIEB 2G5BA 3OKDB 1V7NH 3WHXA 3B5HA 2FIKB 1MCIA 1S9VA 7CGTA 2O5ZL 5DEFA 4HZLB 4WFGE 1MCKA 2VDNL 5J1TC 1UWGL 4Q6IC 5KSBF 4WFFD 5M94B 3U4AA 1X5LA 5GS1C 1S9VB 2JB5L 3CVHH 5TJWK 4G8IB 3TZVC 2ADJB 3OXRB 4FN0A 1Q72L 3B9DA 3MGAA 4RNRA 1EHLL 2N1KA 3OR6A 2A6JA 4MA7L 4GG8A 1CXKA 3DRQA 1B9ZA 4MX7A 1IEHA 4O9HH 4HQQL 3D87B 3UROR 3DX7A 2UYLB 2DLIA 3OJ2C 4LMQI 1YN6A 3QEQB 4CADA 3WBDA 3MTRA 2YSSB 1IGTB 4UNVA 4X4YA 4Q2ZA 1S9KC 3TBSA 3RUGA 3NTCL 3L3GA 4TSCL 5T3ZL 4KI5D 2F74A 4EI5B 3RWFA 3DX7B 2EXYD 4MXVE 1BD2D 5DRXB 3QBTB 1QSEA 2I60H 1KN2H 2GT9A 5HDBF 3VG9B 1XF1A 1II4E 4YHNB 5KG9A 1T4KA 5FM5M 2P8MA 5J6HB 2BOCB 4WI8A 4M8QB 5FA3A 1OTUC 5KAQG 3EJJX 5JR1H 5CJOH 4XP9L 1JF1A 2FR4B 2X70B 4CRPA 2ZZUT 1TQBC 3QQ9C 3VRIA 4QO1A 1RIHH 1CIUA 3RVXC 1OP3K 3RWFB 5CUSL 1I7RA 4ALAL 1H5BA 3ZTNL 3GEWB 3O4LE 1XIWB 1OTSD 5KOVC 5KSBE 2XG4A 2ZSVA 4JPIB 5KG9B 1PEWA 1CD1A 3ZYIA 3T0EB 5FA3B 5HYJE 4CU7A 4KDVA 4QT5A 3LEYL 2HJFA 2YD8A 1CXEA 2EE6A 4PJEA 1BAFH 4ODVH 4GW5A 3QWOB 2NY0C 2NLJA 1M7DA 4P9HL 3L95B 2AJZA 5D7IB 4KUCF 3M8OH 4OSUH 4OTXH 2AABH 2X4QB 3F7YA 5IVXB 3C5ZD 4H1LG 2W9DH 1ZT1A 2DQJH 3IJSA 4QT5B 5E03A 3LIZL 3JBG7 4BSWB 2XFXA 1A9EA 1V05A 1A6ZA 4N90E 1MRCH 1IM9D 3QUMB 1M6OA 3FFDB 4PRIB 3TJEL 4NOFA 1ORQB 4F7TA 4XCFH 5I6XC 1WT5A 4YBLC 4U1IB 4OZHA 3U7WL 5T5NG 3VXUA 3C6LD 4TQEL 4DJMA 4ZUSB 3F7YB 3IJSB 3PWPB 4ODHL 2FJFA 4UIMA 3AM8A 1HOCB 4OF3A 1KCSL 4GRWE 5E8DH 5CZVL 1KN4H 4N0YL 4P2QD 4QRRE 2DQIH 3CSYA 5CLTA 1HZHL 2H8PA 5T5FH 4NO0D 2EZ0D 1H5BC 2EKJA 5C86A 1QBAA 3MFFA 3OAYH 3TGXA 4TVPL 3MMEB 4JY6A 1WAAA 4YHZH 2HWZL 1RIUH 2FEDC 1JYVA 3VD7A 5EWIL 1CGVA 3ARBC 5A1AA 1F2QA 3D9AH 3MV8E 3C5JB 2GITB 3DETC 2VWEE 3CH1B 4G6AC 2P7TB 4XPGH 2X4OB 3O8XB 4G9FA 3E6FB 4YDJA 3GMLA 5CJQL 3CU1A 3KYKH 3KPPA 4PJ9D 4WWKD 1EMTL 1FAKT 5FM4A 2H3NA 2WLYA 5ADPL 2OL3B 3WFEL 4D9LH 2VERN 1JNLH 1KJVA 3QDHA 1K4DB 1A7OH 2PN5A 3ZT7A 3UTTD 4LNVA 1FORL 5MENB 4X5WB 4FQHA 4X4ME 1VFBA 3NPSC 5DSCA 1ZA6A 4P2OC 4RGNC 4OI8A 4G9FB 1Q1JH 4JFYA 4LLUB 4YDJB 5CBEA 1Q9LB 3KPPB 3ARTA 4R96B 5D1ZD 4NCC2 4PY7A 3IDXL 2P5WE 5FCSH 4LHQB 4AG4H 3L7FA 3QPQC 4P5MB 3AB0C 5HHOE 3WHE1 1XEDA 1CLZL 2ZSWA 4Q58C 5DSCB 5C07A 4YHYB 1U92A 1CXLA 4Z76A 5EN2A 4M7JH 3FFCB 4YE4H 4HAGA 3O9WD 5ACMA 1B4RA 1KXVC 3T3MF 5C0EA 4K2UL 4K8RH 2HKFH 1MIML 4P23A 3VCLA 2V7HA 5EU6E 1WISA 4OCXL 2GJ6E 5LGHL 5EC1A 5E1HB 3MJ7B 4XCYB 5LBSL 2ZSWB 3RIAK 5DJ0B 2UZIH 5A2FA 3WSQH 1U92B 5EN2B 3VFSA 4NRZA 3X14B 4M3KB 5C08A 4Z7QE 3AUVA 3MROB 1MWAA 3Q3GA 2OR9H 2Z9TA 1OM3L 1QPPA 1TZGL 2V7HB 4KRPD 1IC5L 4G6KH 5DVMA 2RIKA 1ZT4A 3HRPA 1H8NA 4OLYH 4WIQA 5ETUA 4FQIL 3ZTJH 3VXNA 2IC2A 1EGJL 3X3GH 3S8WA 5HHPB 3BO8A 1H3VA 1I9JL 4R9HA 1AFVL 1NUNB 3QUYA 4P2YA 4DGVH 4UIKH 2QADC 1K6QH 2BVEA 3HAEG 4ZUTA 3QQ4A 5J9PA 2X41A 5L2KD 3IFLH 1W8OA 1GXEA 2DLFL 3PQYE 1DVFD 2JELH 5D6CB 2C1PA 2V6HA 3MOBH 4G9DB 3MODL 4ODSL 3HC4H 3DHMA 1CE6B 1YEFL 3S96B 4GAGL 2BY3A 1KPUB 4OCRL 2WBWB 1KJ2L 3P9MB 5A2LH 1NBVL 4MNGA 2B4CL 4AT6A 2C1PB 4H26A 4CN1A 3IS0X 1ADQH 1WEJL 2ZUUA 1PFCA 1OPGH 4X7TB 1MH5A 3QQ3B 4IOFD 3DRTA 4EXKA 2EYRB 1C5BL 5GGTA 1RIVH 5JHDE 3DBXA 1N8ZA 1U3ZA 1TENA 1UGNA 2X2YA 4BUHA 5C7XH 5GISH 5BS0B 5IEKB 4H1LB 5I2IA 1CGWA 4Y8DC 3MRRB 4LLYB 5E4EB 1FHGA 4M4RA 5LKNA 5F6IC 2Q3ZA 4XBEL 3NTCH 2W92A 5J56B 4IRSA 3DRTB 2EDRA 1A4JA 3O2WH 2O5XL 3OKKA 3SDAC 1XGRB 3WKML 5IM7A 4XNMA 3PDGA 3FQTB 2I27N 2BSSA 2NR6C 1TDQA 5IP4A 5EZOL 4TNWF 4OFVA 5FYKH 3RAJL 2Z4QB 2R1YA 1FO0L 4QTHB 1DBML 1X5JA 2BNUB 2VSCA 4XVTL 3PWLA 4U6XA 3TBVB 2ED8A 3D5OF 4HWZA 1NUFA 2DM3A 4LCCA 3LEXA 3IYLW 3MUHL 4XNMB 2D0FA 3CUPB 2PYFB 3CFBA 1MFDH 5I1GL 1LK3L 2AQ1A 2MQ0A 2VC2L 4P3WA 1E4KA 3BE1L 4GKZA 5F8QC 1D6VL 1A6PA 3PWLB 3AAZA 1IGMH 3THMH 3DHJA 2YXFA 4DUXA 3MCKA 4PJHA 3IVKA 4GMTL 3PV6B 5KSAD 4NNXA 4LCCB 2CMRH 3LEXB 2WMPA 1MQKL 2XRAH 4OLWL 3EOYG 3O0RL 1YNTA 1MY7A 4MB5A 3CFBB 3O6LH 1F13A 2RCSH 1BP3B 3QXTA 4NC0B 4DOHE 1XF2A 4CVZA 4QHMB 1MCDA 5D7KE 3QSKB 2A83B 5BRZD 4YQXH 1NDGB 2Y07H 3LH2H 5D7IF 2Z0BA 1G7HA 3FT3B 3TZVD 4OGAD 1T1ZA 1QACA 5DD1L 2QSVA 3CX5K 3S4SA 3U7WH 1I8LA 2LABA 5DHYA 5IVXF 1BBDH 3VXSB 2D0HA 1BBJB 5DD0H 1MVUA 4Z8FH 4PBWD 4JO4H 2NY3B 4L29B 3V6ZB 3WHE0 3QEQE 3NOIA 2P8LA 2C7UA 3H9HA 5SWZB 4CVZB 2F8XC 4FQ2L 2ZUYA 1CDBA 3O6KH 2UWEF 3NPZB 1HWHB 1RZJC 5AZEH 3BSZH 5ICYA 3U46A 3LS4L 2PUQT 4QHNA 2GY7B 4JFQB 2WBJB 3BP7A 4QXWA 4R8WH 5DHYB 4FRWA 1QD0A 1VSCA 2K7QA 4NN5B 4Q9QL 3F5WB 2Q7NA 2GQHA 3U2SA 1JGVH 3W0WA 1UFUA 1JPSL 1X6LA 1ZHKB 4X9GA 1G6RA 1FNEB 4D3CL 3U46B 1K3ZA 2HG5A 4OV5B 1AE6H 2XYCA 2OTWA 1BJ8A 3CMOH 3MXVL 3P0YL 2EKSB 3QPXL 1CQYA 1UVQA 2PR4H 2BRRH 3F6LA 2RB8A 1AIFA 3BP7B 1BQLH 2P45B 1LO4L 5I1KL 1QSEE 3HE7B 4WENB 4ZUWB 4KTEH 3V5DB 3GSRA 2B0SH 5GGVY 2KQMA 1OTUD 3VFNA 5TQ0L 1IGIL 1IGCL 4AMKH 3QQ9D 5DVOA 1VENA 1PG7X 3JZ7A 1P7QA 1N5YL 1G6RB 4EQ2A 2VYRE 4L8SB 4OAWA 3MNWA 1I7TB 1X6NA 1JTTA 1S9YA 3LS5L 5HVHB 1G9EA 3O6FA 5C6TL 1J05A 1WAAF 4XVUD 4C54A 4DGIL 3HAEB 4BQCA 2F15A 3VFGH 3VFNB 2WUBH 2PO6B 3IDNB 5D7IE 1T3FB 3OHXA 4KDWA 1AH1A 5F9AC 4BH8A 5F96L 2NY0D 2RGSA 4HW6A 3IU4L 2YKLL 2H1PH 2Q3AA 3MNWB 2V9RA 4UAOC 4MGXA 1YQ2A 4PRIE 3U30B 4PRPA 1WITA 5GJTL 3KR3L 3V6OC 4K2UH 2YUXA 4WTWA 2Z91A 5TE4L 5MEOA 2EH8H 2BSTB 3BMWA 4TULH 5K33A 3BJLA 3PWPE 4ZUVB 1IILE 3OB8A 1Z9LA 3VXTA 2R69H 1A3QA 3DARA 1FL5A 3DVNA 3G6JA 3VGDA 5TDNA 5DYOA 1FNHA 2XIDA 3T2PA 2YUWA 3LY6A 4PJDA 4PRPB 4XPAL 3BPCA 5D7SL 5J12C 2WIMA 2C4FT 5D8JL 3MRKA 2L0DA 3KPRD 4OZHE 1MHEB 3VXUE 4BFBD 5DQJA 5DJZA 4HS3B 5E95B 1AGBA 3DTXB 1RUQL 2E9BA 4HK0B 1INQA 1EGJH 4WV1A 4Z7WF 3VXTB 3D18A 3TT3L 4JFFB 1IAIL 1ONQA 4R90H 1FL5B 4JZOA 5DYOB 5CEXA 1UB5A 3U36A 3BH8B 3ARVA 1Q9KB 2VTFA 3QG7L 3QIBA 4EVNB 1EJ6A 3INUH 1IGFL 3X13B 3ZKND 1J18A 2FEDD 2JTDA 2VAJA 4GH7B 5DQJB 1A1OA 3GSVA 1NCBL 1JGLH 1TITA 1ZVSA 1WAAE 2P46B 4Q0XL 3MBEC 3L1OH 2EIZA 4WCYL 4UUJA 2VABB 4JZOB 2UZXB 4AIZA 2Y9RT 1G7QB 4XP1L 5I75B 4DEPB 3N1GC 4JR9L 1M7IB 4IS6B 2QR0A 4G9FE 3QFJB 1DR9A 1CD9B 5JZ7C 2GW5A 2VIRA 4JN1H 1F5WA 1A1OB 4PTTB 3K2MC 1DQQA 4OCRH 1AP2A 4EN3B 5IB2A 5KAQF 4UB0H 1F8TL 1IAKB 4A2LA 5JHLL 1AR2A 2FD6L 4UUJB 3TO2B 4RGND 5DO2C 4AIZB 2VR9A 4PRHA 3ULSB 1WEJH 1A3RH 3KPQB 1IQDA 3MLRH 2GI7A 3TIDB 5I1LB 2Z92B 1VFMA 4UU9B 3VGAC 5TDOB 1T0PB 5FYLE 1LO0L 1UCTA 2GAZB 3QPQD 2VIRB 3FFCE 2VL4A 3C60B 4I13B 1XF5A 2CKBA 1INEL 5DHVB 3PP4L 4E41B 2IAMC 2A6IA 4ESKA 1CLYL 4JO3L 4JFZL 1O7SA 4PRHB 4WV1C 1Y18A 5I71B 4JKKA 5HI4C 4Y19D 4NKOA 1EUUA 4M1CC 3D1MC 5C07E 1DQDH 2R4RL 4QKXB 3U4EB 3HZVB 2CKBB 3FB8A 4JFPB 2ITCA 4TSBH 3P73A 2A6IB 3WKMH 4RISH 2FL5A 5DC0A 1WV7T 5D7LD 5KZCD 3EOTL 3RGVB 1HH9A 1Q9WB 4I9WE 2H26A 1PG7H 2A38A 1S7XB 5GHWL 1L9MA 4YHPB 5HGDA 4GFTB 2VSDA 1NEUA 3LQMA 1SJEA 1OLLA 3AY4C 1T83A 3HI6L 1NMAL 1S9XB 4MA3A 3P73B 1BQHA 1NSNL 2FL5B 1NCWH 1AI1L 4KTDL 1FFNA 2ESVA 3VFOA 3IDJA 2MSPA 1VADA 3WDHA 4RA0C 1OAXH 3RDTB 3GBMH 4WFHE 3BE1H 1JIBA 2F54A 4O51A 3BGFB 2V2WA 4HKZB 2HKHL 3JV4A 5IBLC 1BZ7A 5C0DB 4L8CB 2I9TB 3UBXA 4MA3B 2NY1C 3BKCL 3CNKA 2AEWA 3E0GA 4PRNB 2PXYB 4RDQG 4LFHG 1CBVL 1VADB 4M7ZB 3SDCD 1S3KH 3LHPH 4HWBA 4LCWD 1VB9A 3TIEA 4D0DA 3O3BB 5HYEA 4HF5H 2OP4L 2XKSA 5HHMB 4A6YA 2V2WB 3MGTA 1SVCP 4RZCB 5D96C 5C0BA 3ULUH 1BZ7B 5KSUB 3MUGB 2OSLB 3B9VA 1DEEA 3HI1A 3R0NA 3QG6B 3A6BL 3BXNA 1MCOH 4LCIL 4BM7A 3CDFA 3K7UA 4OGXL 4JFXA 1OAUL 35C8L 3D39B 5MERB 3OXSA 5ENWB 3CVIH 3BIAX 4HS8L 3TT1H 3WIHH 4MNGE 1J1PH 2EICA 3JV5A 4FQ2H 3IB4A 3KPLB 4OF6A 5GRXG 4O4YL 4GT7A 4NDMB 4KROC 3DVGA 3RNQB 2HTLC 1X5IA 3P77B 3HI1B 4S0TD 3N1MC 4LAQH 4JPKL 3BXNB 2VZSA 2J3SA 5C0CD 4LPTA 3KWWA 4EUPA 3T0VA 4S2SA 3CK0L 2FX8L 1SY6H 1NC4A 1EEYB 4JM4H 5I1HL 5J11C 4FABH 2AQ2A 1YNLH 5DD3H 1CD0A 1ZA3A 3G08B 1OP5H 3EFDL 3MV9D 3S5LG 1JHTB 5JPNB 2EDFA 4HBCL 5TE6L 2IH3A 2QHRH 4D3CH 2J88H 4EDWL 2AJYL 3UDWA 4IHOB 5E7FA 4LSQH 5GXBB 3MXVH 3O3EA 2OZ4H 4HWNA 4DKEL 1P4IL 3SDAD 1I7UB 4XAWH 4FXLA 3QIWB 5JLZA 1LO4H 4RAVB 5I1KH 3L6FA 3VI3E 3IFOA 3RJDA 2NR6D 1FL6A 1IGCH 4NN6C 3KYOB 5FDWB 2ZCLL 3C8HA 1XAUA 1QBBA 4U1MA 3Q5TA 1JGEA 2HH0L 1IC7L 3QXAB 4P46B 4PJ7B 4YO0B 4JVPA 2EDJA 3LS5H 5IMMA 2ADGA 4LDOB 5IB4B 4MSWB 3GZKA 5JLZB 4EI6B 2DTMH 3L6FB 4HIHA 3WKNA 4NQXA 5JDJA 4R97B 5D7JA 1FL6B 3MGOA 2Z8SA 4MAYA 3P11H 3O3DB 3ZLQC 5E5RB 4NQCA 1U3HB 2B5IC 1KTDB 3HRZB 5KVGH 4L9LC 3VE0A 1E27B 1ITCA 4P3DA 3PL6D 4LL9A 5IMMB 1ES0A 2ADGB 5D5MA 4O5LH 4JANA 1MSPA 4GSDH 3ZT6A 3CJJA 1GGBH 4UQ2B 3VXSE 4FS0A 2DIAA 1T80A 4TNVF 4PUBL 4N0UA 3VE0B 2G5RA 3REVB 2YC1B 5SWZE 2GYSA 3FQWA 1JZ2A 5E8OB 2NW2A 1ES0B 1OQXA 2IEPA 2VMFA 4L1HA 5ANMB 2IPKB 1WIUA 1WBZA 4UV7H 1TCMA 3E1F1 1O0VA 3MRLA