1NMBL

The structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQNPDGTVKLLIYYTSNLHSEVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQDFTLPFTFGGGTKLEIRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N9 NEURAMINIDASE
publication title The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 antibody
pubmed doi rcsb
molecule tags Complex (hydrolase/immunoglobulin)
total genus 24
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1995-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nmbL00
1B2WH 3ZSSA 3HI5H 4PS4L 2EE3A 3VXSB 2ZNWA 4FQXB 3ARGC 4ZUUA 4U6VL 4WI2A 3QUMA 2HLFD 3RKDD 4ZFZB 1MHHA 1RJZA 2NXZB 1P4LB 2HWZH 4LRIA 3V0AC 1W8OA 2AXHA 1S7XA 3MRMB 1DBBL 3UZQA 3C6SB 4HK0A 3WJJC 1OGTB 2XA8L 2BNRE 4OZFG 3CSBA 5IHUH 3DMMC 5MENA 2GT9A 3L3KA 1YQVL 5GGSA 4ETQB 1CFTB 5ERWB 2EDYA 3N1MC 5EZJA 4L3ED 3BZFA 2R1XA 5KS9E 4QHNA 4ZUWB 1T4KB 5CJXA 4KRMB 4YFDB 4WO4C 3DVNB 2IH1A 5KW9H 2AK4E 1QRNB 5K59E 4OV6F 1B0GB 3RWCA 5E9DB 5BZDA 4YHIB 2BDNH 4LBEA 3T0VA 1RZJC 4JG1H 4FFYH 3V6OC 4KRPB 1RK0A 1BQHB 3I6LD 3TIEB 1NDMB 4XB8A 1IGCH 3IJSB 2JKXA 5BCAA 3OAZK 4QRQB 4KJYA 5HGHB 4ZPVB 1BFSA 4ZUTB 4AIZA 5D7LE 1X4XA 2HN7B 4P0DA 1NFIB 2ILLA 2VL4A 1IEBB 3UBXI 4MCYB 1K5NA 3V6ZA 4EUPH 1A7RH 1G9NL 5F96L 5BQ7A 2WWMC 2AJZB 3KPNB 2RCSL 4TSCL 5C0FB 4Y1AB 4R26L 1RUQL 1I3RA 2XA3A 4DVBA 4PY8J 3B9EA 5D6CA 3TP4A 4YWGL 1QR1A 4H20L 4U6XA 3HNSH 1GPOL 3P73A 1FSKC 1HHJB 2K3TA 4GG8A 2IG2L 1MJ7L 3IU4H 4F7EA 2D7TL 3MRHB 5SWZB 3QUZC 2Y7QA 2E6JA 4MJIB 4S1DD 3SE9H 4XXCA 4FTVB 2R1YA 2VLLA 5HPMB 5JXEC 1FE8H 4HF5L 4X98B 1TJIH 1TJHL 2Y06L 3KS0J 1QSED 5CEXA 5C0IA 1NMBL 5DR5L 3M1BA 1OWWA 3M17A 4K55A 3VFVA 2O93L 2DOCA 5GGTH 1NAML 3DURA 3KNBB 4PB0H 3V5HA 1FHGA 4EI5A 5BVJB 4WI8A 3I3DA 4FQHA 4X4XA 3JV0A 1MNUL 2X89A 4L9LA 1NGPL 1MFDH 2WBKA 3H8NA 3MGOB 2EDNA 4V1DA 3F7QA 4WTZA 1A7OH 1WISA 4IRSC 1X3DA 5TDOA 5H94B 3PP3H 5IB4B 2KUTA 2PW1B 2NW3A 3MNWB 4LQFL 2QADB 4MJ4A 3QSKB 2GJZA 5DD0L 4ELMA 5I1LA 3EHBC 2DI9A 2FIRT 4IMKC 4MX7A 1BQUA 2BSTA 2CRIA 2MTPA 1D7FA 4LQ1A 2V2WB 4JY6B 5DTFB 3VW3H 4YHML 5HHOD 3KPRD 1EZVX 4OBRA 5J6HB 5FGRA 3SN6N 4R7DB 3VRIB 2MPAL 3IXTA 3C6LC 4K3JL 1YEDB 3DYMA 4I18C 2R2HA 3MBEA 1HINH 3SKUD 1EEQA 3IYLW 3C09B 4MD0B 3HZKA 3PIQB 1I8KB 4D2NA 1P4IH 3QCTL 4JFFB 3W9EA 5TE6L 4N8PA 2QR0B 3JTSA 4MDJA 1UG9A 5JIIA 4YHPA 4N8VA 2P49B 4XZUA 4PJEA 4YAQA 2Y5TB 2VDNL 4FABL 4E41E 4HHAA 3WKMH 4MD5B 4QY8B 5B3NA 4LSQH 2IPTL 3U1SL 5E8DL 3FOMB 5DA0B 3IFNH 5J1AB 4FFVC 5JTWA 4GAJL 3KJ6H 2CO7B 1A6ZA 3BEWA 1A3RL 3LRSB 1V3JA 4LLQA 1FIGL 4NRYA 2DLEA 3DUUB 3PABB 4PRNB 4HBCL 2C3VA 3SO3C 1CU4H 4WFHD 4NN7C 5C0GA 4XRCB 5IB5B 5INCB 4J3WA 1CR9L 4UMGA 3GMOA 1GGUA 2OS7A 1J1XH 3L5WB 4UT9L 1MHEA 2I07A 3OXSB 3A6CH 3IFLL 1MRFL 3SE4A 4X83A 3MBXL 3WIFA 1D5IH 1NKRA 4HPOL 2MHAB 5CCKL 2OTWB 4X5WA 1R5WB 3F12B 1IEHA 3CFEA 3QEQB 3BHBA 4UT7H 5JUEL 4JPVL 2HT3C 5JOFB 1NAKH 3VI3F 3BD3A 2R69H 1FFPB 3MLTA 3S36X 5I66A 3DHJA 3LS5L 3EYVB 4ZXBB 1KPVA 2F8VA 3NIFE 2DJ4A 1OAZH 5IV2B 2CLZB 1M7DB 4F7CA 5C9JA 1U41A 3B9VA 5E1AA 2V9TA 2YN5A 1Z9LA 2ARWA 3UP1A 4CJ0A 5IKCB 3G6JA 3WHXA 4UILL 3VFTA 5HYFA 1GOFA 2C7UB 2UV3A 4LEXH 3VFOB 5D4QA 4IHOB 5CUSH 2HFTA 4ZTOL 3BUYB 3TO4B 1U91A 3OPZH 5C0EB 2EEAA 2VISA 3VFWB 1TLKA 2OXGA 1EBPA 4HS3A 1JGDA 4Z7WA 3HE6A 5C0AE 3GGWB 3O3BA 3C60A 4HIHB 3I2CH 3VFPB 5E2VL 2CQVA 3HA0A 3TYFB 3X14A 2A6DA 1A14L 4RMRA 3CNKA 4PGEB 4XXDA 2QTEA 5DLMH 4F9PA 1FZMB 2FCBA 3CLEH 1N26A 3LKNA 5AWNL 5EBGA 2ARJA 4KZDH 4PGBA 2J8UF 3MJ7A 1I8IB 2VUYA 4HDIA 5GRZA 3FQUA 1FYTD 2G5BA 2DDQL 1HKFA 4JVUA 3TJHC 3WFHA 4IJ3B 5GRUL 4H1LH 1I1CA 3O41A 4F58H 3K7UA 1JMZA 4LGPB 2D4FA 5F3HB 4QOKD 1H8NA 1KJ2L 5I30H 3MYJA 1BIIA 3MRFA 9CGTA 4XVJH 4P23B 1RZGB 4JM2F 2VWEC 4AYFA 4JM2C 5DVMA 5B38A 2R0WH 1CS6A 4HLZG 1G7JB 3K74B 5EZLB 3W81A 4LFHD 4S1QL 4ZYKA 1SM3L 4KHTL 1DQMH 4H8WH 4AH2B 3T4YB 2H1PH 4XC3H 1A2YB 3O2DH 2PO6A 1I9JH 2NR6C 3LPFA 2R2EB 1F4XH 4WV1B 5HY9B 5C70A 5LG1A 4R2GD 2DWDA 1JPFA 1BZQK 3HMXA 1JV5A 1OAYH 1DE4B 3PWPA 3QNXA 4LDEB 1MREL 1Z2KA 5J9PA 1MCSA 2APBA 4KROC 4RFNB 3OQ3B 4RA3A 2YS4A 2DQUH 25C8L 2IMMA 3BWAB 1JNNH 2E7CA 4OLUL 1PG7L 2GSGB 5IW3A 5I15L 4JFQA 4GXUN 1IGIL 4D3CH 2IBZY 2VXQL 4I0PD 3RGVA 4LPWA 2QQKH 4XP6L 4EXPX 4NRXB 1OPGH 2QHRL 2R29H 1S5HB 5JHDE 4Z7VA 3ALWA 1C5CL 5DFTA 1EVUA 4JO1H 5DK0A 3WFCH 1LDPL 1OW0A 2DBLH 3M07A 5EO1A 2WUBL 5IQ7H 1AJ7L 3I84A 5ECJE 1T1ZB 3MRDA 3ULUL 4H25B 3ULVE 3MRLB 3CXDL 3IT8D 1IAKB 2EYTB 1VACB 5KVGL 4HFUH 3KGRA 1CQYA 1F90H 5JPMB 4LCCA 5D7SL 4O4YL 4LSRH 1E6JL 3T09A 1KNOA 4MAYC 4G6MH 3ARFA 5C9KA 1D9KB 4XCEB 1KENL 3WJLC 1FNLA 3BP7B 3ES6B 1ZSDA 3O6LH 3SE8L 1TDQA 1Z5LA 1FCGA 1KB9J 4PJDB 3BKJH 1YEFH 1A1OB 1ZHBB 3FQRB 4BZ2H 5CLWA 1WBYA 2C3XA 2C3HA 2FGWL 4ZAKA 1KLUB 4P2RA 1NQBA 3T8XA 1CDGA 2AJ3A 4N68A 4K71B 1F4AA 4H26B 5HI3C 2FH6A 3WFEH 2MFNA 1DANU 3U36A 3ARBB 4HC1A 2NY1C 1FP5A 3G6AA 3FFCB 4CVWA 1JGUH 1HIMH 2N4IA 1EAPB 1WC7A 4YHLL 3RX8A 1VEMA 3WS3B 4K94H 1HNGA 3SQBA 5T1MA 3GJFH 2OSLB 1CFQA 2A6IB 4JEGB 2I5YH 1ZS8B 1Q9KB 3QUML 2EYRB 3QWOB 3JWDC 3UTTD 4Y4KC 2XZQL 4CMMA 3NPZB 4R90H 3T0ED 1X4ZA 2JJTA 3O2WH 4PLKC 3L3IB 4UZGA 3C2SA 1HYSD 1T03H 1I4FB 1UJ3A 2X7LB 3E6HA 1KJ3L 1JI2A 1JZ4A 5D72L 1X5GA 3DWTA 4NGHH 4JY5H 4X6EB 1U58A 2C1OA 3HZVA 2VAAB 5DI8A 3HNTH 2EKSB 4PJ9D 1VEOA 4J6RH 2JJVA 4FOMA 5IHZA 1JRHI 4J8RB 3TA3B 3HE7D 4RAVA 3S37X 3FQWB 3SCMC 4DFIA 3WDIA 3GI9L 4PY7A 3LEYH 1UH3A 2VN7A 2OL3H 1E27A 1S9VA 3HRZB 4RMQA 1CTOA 3I6KA 3BVNB 4KKCD 1DL7L 1OSZB 4Y4FA 4KKLD 2IADB 5IHBA 3FOLB 4P5TD 3PG2A 4M8VA 3NFSL 4ZFGH 3RWDA 5I18L 3ZKXB 1X7QB 4DN3L 1EPFA 2PR4L 1F11A 3W0WE 1XIWB 5EIIB 2BNRD 8CGTA 5I73B 3GSVB 5ABDE 5I1GL 3LHPL 3P0VL 1NDGB 4U3CA 3BPOC 2IGFL 5I74B 3BO8A 5EC1A 1BD2A 2FX9L 5ALBL 4NSKB 5ADPH 4J3TA 2AXGA 1KUMA 1NCAH 4WCYL 4X99A 4U7KA 4NC0B 3DETD 2AK4D 1I3GL 35C8L 2JIXD 3CDCA 2V2XA 4NC1C 3BPNC 4N1EA 1E6OL 1PYWB 2L0DA 4JREB 5CJ8A 4QRPE 3MNZB 1TVHB 1DBML 4XPBH 4ODWA 5DD5H 2WBJB 3UEZA 4J7RA 1ZLSL 1G7IA 1HI6A 2VIRB 5J12C 3VD4A 4YDKL 1B3JA 2VDQL 2AXFB 4WWKC 4S10A 4HV8A 3MCG1 4MVBC 4HUWB 4RBPH 2HT2C 1IBGH 6FABL 5FM5O 5D7LD 4E0RB 4CKVX 3FO0H 4MHHG 1PQZA 4JFEE 1XGQA 3ARYA 4YPGA 4XP1H 4TNVK 1EERB 1FZJB 4X7EC 3WNMA 4GRMA 4EQ2A 3D6GA 1KJMB 3DV4B 3AMKA 4P59L 5HDBE 4TSAH 3EO1A 1YMMA 5KSAB 5C07E 2BVPA 2QQLH 4JQVA 3FT3B 4XP9H 2HT4C 4IOFD 2AEPH 3EUUA 4LSPL 4QCIA 4WUKH 1A0QH 1OLZA 1XR8A 2HKFH 5CIPH 5HXMA 2NXYC 3P9MA 2ADFL 3V8CA 4LF3B 4GRLB 5DUPL 4NKDB 1UFUA 4LHQB 1JGLH 3BP4A 2XTJC 3V8OA 3A6OA 3DYPA 3PWVA 1A3LH 4LARH 3UTSB 2YPVL 4U6HA 2R0ZH 4FXGA 3MV7E 1CGWA 3T2PA 4UBDD 1KTRL 1INQB 3REWB 3P4OB 5JW4M 2FZ3B 3FQXA 5DQDH 4DQOL 4PJIA 1D5BA 4LCWA 4RMTA 4U1KB 4JRYD 1CFSB 4GKOA 2VAJA 2G5RA 4POZC 3BGAA 1QR4A 2AI0H 4AIXA 4WW2B 2GY5A 5JZ7D 4EUPA 1FCCA 2HG5A 3L95A 5IG7B 4YFLF 4XP4H 1EA9C 1ZVSA 4U1IB 3HG1E 1RK1A 3HC4L 1M7XA 1NC4D 3HS0A 3ULUC 1HQRA 1C8PA 1RI8A 5IM7B 1EHAA 1Q72L 5IVZB 2X44D 3F58L 4C4KO 2H3NA 2PETA 4NQDD 2H2SC 4OD2A 1CD8A 3ZSTA 3T2NL 1Y18A 5B8CA 2PXYD 5JHLL 1FL3B 4C56D 1U8LA 5GGQL 2X9XA 5TDPA 3SBWC 1IGML 5D1QD 2L7UA 3U4BL 1JZ7A 3BQUD 1YYML 1TVBA 3IDJB 5I75B 4Z18A 2Z8WC 2FBJH 1YYLL 1AI1H 3O3DA 4HUUB 2IAMD 1ZANL 4W6WB 5J3HC 5GGTA 1BECA 3TCLB 4DGVL 2AJUL 4GUPA 1FL5B 1J8HE 4GJTB 4U31A 3QJFA 3N1PC 5CJ5A 5GGVH 5EU6D 3IDXL 5DJDA 3VU2A 3OHXB 1KLGB 1N59B 3CSYB 1NUNB 1ONQB 2O61A 1U42A 3QA3B 3GO1L 3V7MA 2OR9L 4NO2A 3C9NB 1DQJB 3IDGA 1EHXA 2EC9U 4Z0BH 4XPFL 5DUML 3LN9A 3OAYK 4NKMB 4PJ8A 5DJ0B 5KJRL 3RZCD 3E0GA 3QDAA 1XF4A 4PJAF 4PYHA 3HAEG 2ZKHL 5E8EB 1CWVA 1UVQB 1RV6X 1YNKL 2Q8BL 3DTXB 4N0FB 2XKNA 1G1CA 4LRIC 4B50A 2ADJA 1E4WL 2E3VA 4KK6D 1J1PL 4XAKD 5J13B 4HK3N 1I1RA 4ZQKA 1VGEH 3GNML 3RIAF 4WY7H 3H7BB 5TQ2H 5CKAA 5LGHL 1DQDL 3SJVD 43CAB 3UAJD 3MLRH 3N0PB 4O2FA 1LE9B 2HFEA 3D85D 5CJXC 5E4EC 4UIKL 5DD1L 4Z7UF 2NQCA 3SDYL 4G5ZH 2M2DA 5IJVB 3QDJE 4ODXA 3QH3B 1F5WA 1INEH 4OV5B 1V7ML 4HS8L 3QIWA 2FWOA 3VFUB 3QPXL 1ZWIB 2HVKA 4Q6IB 5HSFA 2GI7A 4RX4A 3ZDXF 4DOHE 2NX5D 4FQLL 3SE3C 2VLRB 3BYYA 3MO1B 1XF2B 4KKAC 4HX1A 1N5YL 5FK9A 4G8IB 5JORA 4NQED 3OKYA 5B3JF 4YHOL 1BHGA 1Z3GL 2DLFH 2CO6B 1T20A 4LLDB 4NP4L 3BE1L 4E5XB 4LSUH 4P3DA 2J3SA 5FUCE 4GW1B 5E6IB 4MQXC 1LK3H 3MRKA 3OKMB 4HUXB 1HHIA 4R97B 5CJBA 3IF1A 1Y6KR 4YHYC 4L3EA 3UDWC 2XICA 3KG5A 3OZ9L 1U0QA 2ESVE 1R0AL 2EH7H 3MLVH 4K3HA 5DD3L 3CFBA 3OB8A 2DQGH 4XXCC 3MJ9H 1YECL 1IGTB 2VITB 5J11B 3V0WH 1YY8B 4Z7NF 2VUOA 5SWQA 3HFML 2H45A 1F3RB 1FFOB 2C4FT 1A7NL 1J88A 2W65B 4Y5YC 2QL1A 4F7MA 1TMCB 1BVZA 3HI1B 1LO3H 4U1NA 4EI5C 4NPYA 3GSUA 1KCSH 4OZGF 5IQ9B 2FHFA 2B8OT 5EG6C 1KYOK 1UB5A 3OX8A 1VFUA 4HIEB 4LKXA 5F1NA 5DVNA 3TWCH 4NCDA 3BP6A 1XGUB 2XXCB 1HWGB 2X6MA 2XN9E 1VPOH 3HC0A 4KTDL 2Y36L 3S35X 3ARDD 3K2MC 3PHOB 1CL7L 5DWUH 3RVXC 3MMEB 2JCCB 4PJBF 3TYGL 3LOWA 4HIXL 5FECB 3O9WB 3SKNB 4X80L 2FH8A 5I1CH 5SX4I 1UWGL 2VXVH 3NZHH 4NQXB 3VE0B 5GGRY 4JANA 3AS0A 4HH9A 4IOSD 1QSEA 3QNZA 4KMTL 1G7LA 5GJTH 5DURD 1G7MA 1I7RB 5T3XL 3L3JA 4GG6F 4JB9H 1UT9A 5KANI 4GQPH 1V3MA 1NFDA 5IOPA 3VXQA 5EBLB 1MI5B 5E7FA 2BNQE 4YO0B 4AT6B 2HJKA 5BOZG 1HZHH 3L3DA 4H1LA 1U2CA 3MBEC 5DXWA 3TJEL 2X4SB 3WIIL 1H3TA 4C4KT 3GZKA 5DGQA 3KS0H 4O00A 1J0JA 4LCYA 2Q7YB 1QKZH 5GJSH 3SHSA 3UZEA 1EJOH 5IGXL 3NOIA 4HC1L 5FXCH 4PRHB 5F6IC 5DHVH 5HHPB 1HK6A 3GEWB 3H0TB 4V2CB 3RWGA 1KB5B 4LSDA 3ULVD 1KPRA 2Z9TA 1G7QB 3N1FC 2HLAA 5FO7A 4P5KA 5HYQA 3WEXB 4C55A 3MRRB 2BHZA 3IRZA 1P9MC 4NKOB 3O2DA 3V5KB 4M43L 3ARGB 2EDXA 4OJFH 3R8BB 4M6OH 1SQ2N 1YDPA 4IOIB 5HHOA 3D3VE 3KPRA 4PJHE 5C6WH 3RNQA 3TPUA 2NY2B 5ESVB 4G8FB 1T1WB 5BRZB 1S9KC 3CFDB 4JFOB 3DMMB 3LN4A 5BXFA 4K07A 1P7HL 1L9NA 3MRBA 4G80B 5DVLA 3BAEL 5DMIH 3CH1A 1OWRM 5DEGA 4S0SD 4HMEA 3O3AA 5DK3A 3TV3H 2UZXB 3QDGE 4L8BA 3U79A 3GK8H 4PJGF 5HHVH 1JRHH 5E8PB 4M1GL 1K4CA 3DUSA 1LGVA 3FMGH 4U6TA 1IT9L 1BLNA 3KPPA 4NQCD 4F37F 2V9QA 3QEHA 4OB5L 3BPLC 3JV6B 1XZ0B 1DEEA 1QLFB 3EDEA 2V5SA 3VXUE 4BA8A 2VC2H 4Y4HD 3RNKB 3LZFL 1BFOA 1XEDA 3DOSA 3ZTJH 1RJLA 3BKYH 5CMAA 1JFQH 1F6AB 1WFNA 5A40E 1PEZA 4P2OD 1MCQA 4DUWA 2UWEF 4HK3J 2EEBA 1DQLH 2BHYA 1KEGL 4HMCA 1ZHNA 3TT1H 4ONOA 2GTZA 2QSVA 1CVSC 3C60C 2NY7L 1FSKB 3MPCA 4WI6A 5KBNC 2KH2B 2B4CL 3LQAC 5FKAA 1AGCB 1YJDH 4PJFE 3RJQB 1T22A 2BVQB 4F9PC 1IRAY 2XPGA 3QUZB 3T0WA 1Y0LA 4IRZL 4BJLA 1G9EA 1NH6A 5IW6B 1JF5A 4EOWH 4EZMA 1G6RB 3QAZC 1ACYH 3PWNB 3QQ3A 2OYPA 2AK1L 2FX8L 4YC2C 4PBVC 5EOTB 2DD8L 2VQUA 4PP1C 4IBLT 3C2AL 2FJFA 4MD4B 1KN4L 2JJSA 4I9WD 3EJZD 4XHQA 3Q48A 1QSFB 3DXAB 5HD8D 1A7QH 3S3JA 4OD3H 2K9UA 4EVNB 5JA8B 1B2WL 3GJFA 4RFEA 3HI5L 5HBBA 4DJMA 3W0WD 4KMQA 1PZ5A 1CBVL 5HGAB 3HAEB 5CHNA 1ZMYA 5IFJA 3PWJA 2NPLX 4HMDA 1W0WB 2HWZL 5HHQB 2E7HA 4C83A 3MLUH 4Q97A 3S3PA 3SKMA 3NCCB 3C5ZD 1IGYA 1KLFA 4IRSB 4NCC2 5IHUL 3UX9B 4P57B 4PRIB 2ZUUA 3EDFA 1WBZB 1OTSC 3S5LA 3OG6B 15C8H 1JHTB 1QUNA 1QQDA 2V7NB 4QRPD 1VFAB 1FYTA 3KYNB 3BDYH 5KW9L 2XN9B 1P1ZA 4MNQD 5JIHA 1RIHH 4YGVA 1IAOB 1HCVA 3IJHB 4RGMC 5E70A 4P4KD 4POYA 2BDNL 4K3EH 4JG1L 4FFYL 4ZUVB 5ICYB 5LVEA 1C5DB 3PV6B 4JFED 3C6LB 2Z31B 4NOBA 3GSRB 1QFUH 4I18B 1IGCL 1V8HA 3HKFA 3MRPB 5CJQH 5EU3A 4TTGA 4DCQB 3U46B 4D0CB 3D18A 4OCMC 1S9YB 4ODVH 2OL3A 2W9EH 3UBXA 5I1IH 3ZKMD 4TOYH 3ULVH 3VXME 2L7JA 1A7RL 1G0YR 3HR5B 5C07D 5FYKD 3FZUC 2DYPB 3GSXB 4ZPTA 1ZT1A 2NZ9D 5EO9A 3HNSL 3T1FB 1IMHC 3FO2B 3SDDD 4LCCC 3SGJA 3IU4L 5F1IA 1Z9OA 4MLSA 3NBNA 3VFSB 4OGYH 3ARFC 4GW5A 2HJFB 3H9SE 4P2QD 3SO3B 3RUGE 3FO9A 4NN7B 3SE9L 4YHKH 3VWKD 3P9LB 1FE8L 2BNUB 4EI6A 3OKEA 1TJIL 3MV7D 3CDYA 4OCRH 5I17A 5T1KD 2VLJB 4W70A 2A83A 3W9DB 1T66C 3RWJA 3ZDYF 1AXTH 5GGTL 2KBGA 1KT2B 4ZAKC 2DM3A 1DTUA 3KPQA 2B1AH 4I0PA 3S37H 5I16A 2H2PC 1XGYH 5DZNA 4PB0L 3H42H 1MHCA 3B6SB 1MFAH 3THMH 5LJYH 5LKNA 5K9KA 4MNHB 5DMGD 2AW2A 4CVZB 4ZUSA 3QZWB 1MFDL 4XC1H 3MR9A 5CEYB 3HG1D 2Y4SA 3VRLE 4RAUB 1NGYB 4N1HB 1A7OL 3IU3A 1HSBB 5BJTA 5ESQB 4JGUA 1RUAH 2BY1A 1CXHA 3RWEA 4YDLB 4MWFA 2ERJC 2VZVA 4MZ2A 3ILQD 1MH5B 5CIPA 1LP9B 3F8UB 3WN5C 1BZ7B 1NCBH 5C0RH 1TQBC 1FNFA 5IW1B 1TZHB 5SX5H 3VW3L 3RL1A 4MS8D 4JPIB 1D3CA 1CXEA 2BY2A 3MGAA 4RWYH 4NNXA 4PJBA 1H5BC 2FX7H 2V5RA 4OF8A 2P5EE 1T7ZA 3CH8A 1HINL 3T77A 3MRNB 2IFFH 4OFYD 4ZS6C 3VDBA 3VDCA 3FRPA 4ESKA 1P4IL 5IB2A 3QPQC 3O6FC 4L1DA 1Q9OB 4JJ5A 4JKWA 4GG6A 1XF1A 5TFSH 5E5UB 4U1JB 3ROOA 5EO0A 2NLJB 1ZT7A 1XGPA 1U6AH 1WCBB 2BP3A 3WKML 1OP5K 1QHPA 4LSQL 4OZIB 1A4JA 3UTTA 4Y4FC 3MRGB 5HI4C 3IFNL 4LSSH 5TPWH 3T0EA 5DUBA 3KJ6L 3X11B 2RR3A 2W0FB 3PDGA 1S7SA 4GKSA 2Q20A 2P42B 1CD9B 5DZLA 1CU4L 4N5ED 2ITCB 1W72B 4PJ7B 3BDBA 4RRPG 2OTPA 4XVUC 4OKVA 4IM8A 5CD3B 5F9WC 4KJQC 4PJ9A 4I77H 1TCRA 5TDNB 1DQQA 1VEPA 3A6CL 3QDJD 2HP4A 3SDAC 2PCPA 4RGNE 1VDGA 1D5IL 3MQIA 4ISVA 3HE7A 1T5XA 3Q6GH 4PJ5D 1MCEA 4KROB 3ZE2F 1BEYH 4UT7L 2BVEA 4EDWH 5C8JA 1NAKL 2R69L 3N06B 1NCWH 3CCHA 3C8HA 1R3HA 4X7TA 1UB6A 1NAMB 3QUXD 3RGHA 1YEJH 3KPMA 2M1KA 2HTKC 1OAZL 4P5TA 5AEAA 2XFXA 1U8IB 4EJ1C 4U1MA 3CD4A 2D7NA 2ZPKH 2HJLA 5FYKH 3WE6B 5HHME 1RURH 3BZ4A 1DLFH 4PJGA 2BNRA 4O9HL 4OF6A 4MXQD 5ADOH 5M94B 5JIKA 4LEXL 1FGVH 1II4E 3QYCA 4PJXF 5CUSL 5ENWA 3PGCB 4BH7B 3OPZL 1XF3B 1H15A 2QHLA 2ESVD 4JQVC 4ONGH 5SX4H 2AK4A 2DM2A 4CU8A 1LEIA 2JIXA 3I2CL 2V5MA 1O7VA 1M7IB 3OR6A 1G9MC 1LE5A 4P46D 3R0NA 4MAYB 3CX2A 4JN2B 4H0IA 5DLML 3QUYD 1UZ6F 3CLEL 2ITDB 1FN4A 3S4SB 3BN3B 4WI7A 5AD0B 4KZDL 2O26U 1V05A 3FQNB 4Y16D 3DGCR 4BSVA 1A9EA 3EJJX 2ZUTA 3GSQB 5D7LA 5F7YC 3CSGA 5EUOE 1GL4B 5F7HA 3AAZB 3FHAA 4F58L 4CUCA 2VMFA 5IT2H 5I30L 5KSBB 1D5XA 4MDIB 3VXSD 4XVJL 4PJCF 3UO1H 2CR6A 3TH4T 1FNAA 4DZBA 5E5MA 3BXNB 3WUZA 4LNVA 4JFYA 2NY1B 2R0WL 4UINH 4MSWB 2YZ8A 4NHUA 3OKLA 4QXTB 3T4AA 2E8ZA 2AJYH 1DQML 3FT4A 2Z93A 1AKJB 3VGAC 5DO2D 5M95B 3EYSH 2H1PL 4XC3L 4JRXE 3O2DL 5C0BD 3NN8A 1I9JL 4YIQA 5I2IB 1EEYB 5FDYA 1F4XL 3CDGA 1CG9A 3LS4H 4Y4KB 1PG7X 3P11H 2C1PB 4Y5XC 4XNYH 1U3YA 1OAYL 4ZG1A 3MJ9A 4PG9A 2X9WA 1GZPB 5L2KB 5HYSG 2X4PA 3C5SB 3HUJB 3BP5B 1PKQE 4XP5H 1WBXA 2DQUL 1GOHA 3P30H 4Z5RA 4JRYA 1R3LB 2NTFA 1JNNL 2VQTA 4I0KA 3GKZA 3BPCA 2WIIA 4R96A 3TZVC 3VGGA 2AV7B 4O51A 5DQJA 5IESH 3IDYC 2YMXH 4D3CL 1I1FA 1IKFH 1QLEH 2QQKL 4Q2ZA 4XPGH 3IDNB 4JZNA 3VJ6B 4Y1AD 5D6DC 4R7NA 1OP9A 2R29L 3QWQB 1AP2B 3SCMB 3D25A 3D39E 2VR9A 2ZUXA 4JO1L 3WFCL 2DBLL 4PJ8C 4UNUA 4LCUA 1MWAH 1ZHKA 4NQDA 3OB0K 5IQ7L 2CLVB 1WK0A 2PXYA 4OLYH 1I7UA 2RIKA 2IBGA 1WF5A 3QEUA 1XCTA 5JXAH 4C56A 4HFUL 2NY3B 1F90L 1EFXB 4LSRL 4HGWA 3GHBH 5GRJH 4GXVL 4G6ML 5D1QA 1K8DB 2IPUG 1YC7A 2CDFA 3BQUA 5SV4A 3SDXF 3HR6A 1F6LL 4HKZA 3FN9A 3BPOB 2YC1A 2F53D 3O6LL 5ICZB 2IAMA 4XPHH 1QBAA 1FBIH 3BKJL 1ND0B 5EN2A 4PG2C 2A73B 3D5OF 4AMKH 1YEFL 4YBHA 4BZ2L 4NN6C 5DFWH 5EU6A 1U8MB 5KN5A 3BPNB 4X6DF 1EO5A 1TJGH 2W9DH 3KAAA 1A6AB 4E41A 2P5WB 3QIWC 3FB8B 1HXYB 3D69A 3VD5A 4L8SC 5J12B 1TPXC 3VXUD 3WFEL 4WWKB 5DRXB 1FAIH 2KZ1B 4R4BB 1B0RB 4G43B 1KGCE 5CLTA 1JGUL 5DHVA 1HIML 1OP3H 3RZCA 1KJ2B 4NT6A 1P5UA 3E3QE 5C0JA 4K94L 2HLFC 3QO0A 3RKDC 2QSTA 1RPQA 3U4EB 1GCFA 3TVMA 3KYOA 3S35H 1IGJB 2QLVB 2H9GB 4QXGL 2BXYA 2I5YL 5CBEA 3DECA 5A16A 1LD9B 2FRGP 3QIBC 5D2LE 4Y19B 1G7HB 1U8NA 4R90L 2OQJA 6CGTA 3O2WL 1CLYH 3RWIB 3SJVA 3L5IA 1T03L 2YZ1A 4YDIH 4FNLH 5D1ZD 3D85A 2PUQT 4LIQH 4D9RE 1ZLUH 2B2XH 4NGHL 4XCYB 4JY5L 3WLBB 1IEAB 4HJ0D 4UIMA 2XWJB 5ISZB 2D9CA 2NXYB 4RIRB 3VXTA 4A2LA 1K3ZA 4J6RL 1YPZF 5F9DC 4FP8H 1I3UA 1PZUB 2P8MA 2HYMA 4K8RD 2NX5A 2XTJB 4JFFD 1GOGA 1HSAB 3UPRB 3FCTA 3NCEB 4ETYA 4E9LA 4NQEA 2B7DT 3KXFB 2GHWB 3LEYL 3QXAB 4LPCA 2OL3L 2APFA 4RQQB 5C08E 2FO4B 5IIEA 4ZO9A 3BMVA 3BJ91 5C0AA 5HVHC 3T0BA 4ELME 4ZFGL 7FABH 4X5XB 2HFFB 4O58H 2DI8A 1JZ2A 4I5BB 4KI5E 4ZNCD 4OZHB 5F9JB 1EV2E 3BJLA 5E2JA 5E94A 4RAHA 4YBLB 4S1DC 2X05A 1MFEH 3MRQB 5ADPL 3RP1A 1FH5H 2F8OA 3K4ZA 4DKAA 1EHNA 1NCAL 4PRBB 2ZUSA 3CPLB 1XCQA 1VKXB 1NGXB 4LHUG 3OR7B 3QEQD 5GSRA 1BM3H 4NQSA 1Q9LB 4JRXB 1EK3A 2ZSVA 3IDMA 4WHYG 4XPBL 5DD5L 1JYNA 4DK6A 5FF6A 4YHZH 2X1OA 3P4LA 1Q38A 3EOBB 3P40A 4BQ8A 3WLWD 4NZTH 1IBGL 4AEEA 1OD9A 3DX6A 3FO0L 5AZ2H 1C16B 3VXMD 1YNLH 4X6BA 2YWZA 3NIDE 4J3VA 3FO1B 4XP1L 1X6NA 2CD0A 3VA6A 4QGTA 1L0XA 2Y6SD 4JGMA 1CK0H 3ARDA 2PYEE 1LDSA 5C2UB 2V17H 3FRUA 3L3OB 4TSAL 3QXDA 4FG6D 4F33B 4H8WC 3QG7H 4G42A 2QQLL 2DWEB 4P4RA 2XV6B 4XP9L 3RTQD 3WXVH 3LQZA 3I75A 3H9SD 1S8DA 4ZUUB 2AEPL 2X1WL 3QUMB 5EU5B 4WUKL 1A0QL 3UTOA 1RJZB 4OFIA 1QG3A 4X6CF 2V6HA 2HKFL 3QQNA 4HK0B 4WGWB 3MLWH 1VB9A 3QDMB 4UI2A 5MENB 4TUKH 2GT9B 3L3KB 1JGLL 4X7FC 3HNVH 4WU5A 4YDVA 1J12A 5GGSB 1KYOJ 4N0YH 1DBJL 1A3LL 4LARL 5D2NE 2Z92A 3BZFB 2R0ZL 2LTQC 2HA1A 5JPNA 1CDIA 1KIQA 1CT8A 3X3FH 3QHZL 3OAZH 5F7FA 5DQDL 3GSOA 3DV6A 2YK1H 1Q0YH 2AJSH 3RWCB 3VD3A 4QXUH 5BZDB 4QGYA 3SGKA 3U9UA 4L3CA 4LBEB 4BFBD 4KHXH 1MELA 2E6QA 2AAVA 1B6DA 2AI0L 3RAJH 4HS6A 3VGDA 3IFPA 1Z6JT 3MFFB 5GHWH 2X1QA 3EOAA 3AB0C 4BQ9A 4KJYB 4XP4L 2GK2A 2ICEB 5HHNA 4AIZB 5EU4B 5EBMB 4OBSA 3K81A 1QSVA 4D8PA 1K5NB 3EDKA 4WIQA 3V6ZB 5EC2A 3TNNA 3BD4A 5DMKA 1Q1JH 3SEPA 1OQXA 4DVBB 3CJJA 5D6CB 4H0HB 1QR1B 1TNNA 4U6XB 3BIBX 3P73B 5DJ6A 4YHYB 4GAYA 4GH7B 1A6VH 4GG8B 3VXNA 1SYVA 5GSVA 1DBAH 4F7EB 2P5ED 2FBJL 4K8RH 2Y7QB 1AI1L 2Z0BA 3V95A 1UYWH 2R1YB 2VLLB 4NQCA 1N2RA 4WU7A 3IAQA 5CWSA 5GGVL 3OGCA 5C0IB 1UZ8A 1T21A 2EO9A 4Y4HA 3VFVB 4Y5YB 2DQFA 2O5ZH 4W4OA 3LCYA 3DURB 1ORQA 4K23H 5D5MF 1JYVA 4F3FA 4PIRF 1DSFH 3V5HB 3RDTD 3RU8H 4P2OA 4EI5B 4Z0BL 2AJXH 4K94C 3OGOE 4WEBH 1R3KA 4AG4H 2ED9A 4FQHB 4X4XB 4YLQT 4ODUA 2W0KA 1EUUA 2VOTA 4OFKA 1ES0B 1SJXA 1Y6NR 1ZT4A 3KPSE 1RUPH 4ZSOE 1D9KD 1GZQB 4OLVH 4V1DB 4QLRA 1MLBA 5E5RB 5DK2B 1DUYA 3WKNA 3P77A 1NANI 1KCUH 1VGEL 5TDOB 3CFIC 1TTUA 4WY7L 3EYFA 1DZBA 1V3KA 2GJZB 3O2VH 5TQ2L 5I1LB 4TQEH 5T1DH 4J1UA 4MX7B 5CEZH 3MLRL 4M5ZH 2BSTB 2YRLA 3TBYA 3RVUD 2NXZC 1U2HA 5LGJA 1GC1H 4G5ZL 1SBSH 5GXBB 1INEL 1CDUA 1N5AA 3LRHA 3UYRH 5L88H 3O3EA 1MJUH 3LB6D 5C71A 3IXTB 4YXLH 3TFKC 2R2HB 3L5JA 5A2JH 3MBEB 5K9JH 5KTEH 3W0WA 5HHMD 3KLDA 2XRAH 3HZKB 4IDLA 2EIEA 2DF3A 1SJEA 2ID5A 4X8XA 3W9EB 3K1DA 4PP2B 1YEEH 2DLFL 5F6IB 3JTSB 4MDJB 4XNQA 3C5ZA 1NPUA 4YAQB 4XZUB 2MPAH 4PJEB 4LSUL 4KRPC 3C8KA 4HHAB 1A9BA 1LK3L 5DEZA 1KSRA 5BV7H 1EGJH 1DN2A 5T3XE 5H37G 1AO7D 4R2GC 1A6ZB 3BEWB 4GO6B 4QRPA 2EZ0D 1T89A 1T5WB 2W0LA 4L1HA 4LLQB 4PBWD 1A8JH 2R23A 3QQ9C 2W60A 4MNQA 2EH7L 3MLVL 4NRYB 2ZNXA 3V4VH 2ED8A 2DQGL 4Z6AT 5C0GB 3BN9C 3MJ9L 4P4KA 1FVDA 2OZ4L 4G7YH 5D1XD 3V0WL 1X5FA 4JFEA 1RZ7H 3RA7H 1D6EA 1MHEB 2I07B 1ZK9A 1WAAA 5F88A 4R9HA 3WIFB 4I0PC 1I3VA 2NY6C 1LO3L 3CFEB 1KCSL 5MEOA 3BHBB 3LEXA 3MFGB 1BQSA 4DW2H 5C07A 4XCCH 3MLTB 5I66B 5J8OA 4X4YA 3BPLB 1ED3A 4OZFH 4TNWK 1XIWD 1KPVB 3JZ7A 3OKDA 2CR3A 4BH8A 5DGRA 4P9MH 2CMRH 4FS0A 3TWCL 3SDDA 1N3NA 1AR1D 4KDTA 4F7CB 5C9JB 5I1AA 1F3DH 1VPOL 4CDHA 5E1AB 3T3PE 4RMUA 1YN7A 2EDBA 5DWUL 3G6JB 2UY7A 3WHXB 1C08A 3VFTB 3J8F7 4P2QA 5GS0H 1UCBH 2I9LB 3VWKA 5I1CL 3L6FA 2VXVL 1U91B 2G75A 1KEMH 2VISB 2NY5C 3MV7A 3NZHL 5CJOH 2FLRT 5T1KA 3JUYA 1ZHLA 1JGDB 4BZYA 3HE6B 4Z7WB 3O3BB 3QG6A 3C60B 2GAZA 4OIIH 1A47A 5GJTL 3S88H 4F8TA 3NACH 2PYFA 2VL5A 3X14B 4I2XE 2A6DB 4JB9L 4OM1H 1O0VA 4E42A 3GBNH 2ZOKA 4XXDB 3LKNB 2J7LA 1H0DA 1HZHL 2ARJB 1L7IL 3QAZB 4PGBB 2W9LA 3MJ7B 4HDIB 1I8MA 3DUHA 4OQ1A 1FJ1B 5T33L 3FQUB 3DROA 4WEMB 2G5BB 3ZE0F 1VGKA 4XHJD 4YC2B 3HG1A 1QKZL 5GJSL 3D39D 1EJOL 4Q6YA 3WFHB 1C1EH 3FB7A 1J1OH 1RZFH 5J4MA 3O41B 2JJUA 1BIIB 1X5YA 3MRFB 2XWBA 3QI9D 4UQ2B 4IRJD 4HD9A 1WT5A 3R8QA 1TCMA 5FHAH 1KTDA 5B38B 1D5MA 3GRWH 4QRRE 3MRIA 1HYSC 4OJFL 4ZYKB 2VTFA 4G6KH 4M6OL 4PTUA 2MCPH 1M05A 4QHKI 2R4RH 2P1YA 4WI5A 4PJ9C 2G9HA 2VE6A 1RVFH 5DMIL 4DUXA 2AEIT 1MCWW 4HFWA 1U8QA 2DWDB 2EE6A 1JPFB 4MHHI 3TV3L 1JV5B 4OFYA 3PWPB 3B3IA 1U8OA 3GK8L 1X5ZA 5HHVL 1DJSA 1JRHL 5J9PB 1EIBA 3ARQA 4RGMB 3FMGL 3TGXA 3WIHH 1KGCD 1UENA 2FR4A 3LKQA 3WFZA 3PNWB 4KKCC 2MKWA 1J86A 1T80A 1RJCA 4P5TC 3V0VA 1BP3B 3H9HA 3D0LA 4X9FA 4GKZA 4BKLA 1MWAA 4NJAH 1ZEAH 3BKYL 2A9NH 1LILA 2P47B 1UM5H 1HOCA 3Q6FA 4PFEA 4Z7VB 3QXVA 3VXPB 2XNAA 3OJVC 2VABA 5I0ZA 5DK0B 1DQLL 1EEZA 2BSSA 5GZNC 1AGBA 3TT1L 4AIOA 2ICWI 5EO1B 4D9RD 2H8PA 2FNBA 3MRDB 3DETC 4L29A 5DJ2B 3QDJA 1A1MA 1UKQA 1EJ6A 3PGDA 4LCCB 1YJDL 2ADGA 4KDVA 2UVFA 1KNOB 3ARFB 2QQQA 3BIAX 4NM4H 4PJ5A 4PJIE 2NY4D 2FEEI 4LCWE 3TO4C 2YA0A 4EOWL 1ZSDB 1Z5LB 1ACYL 1DCLA 3QUXA 2J8UE 4CGTA 2BOBA 1WWAX 2GITA 2Z35B 1CL7I 2VDRH 1C12A 4ZAKB 3MOQA 5TF1H 4P2RB 5C08D 3T8XB 2FL5A 1WTGT 1A7QL 4OD3L 2AJ3B 3UROR 1H9VA 3EOTH 5DA4A 4S0TD 1I7TA 3K46A 3U36B 2MQ3A 3KDMB 3G6AB 3WBDA 1JF1B 5DDHA 2ESVA 5E24E 1WC7B 2ZG1A 2GJJA 3ECBA 4KI5D 5FV2A 4IOFC 2B1HH 2W07A 3MLUL 5EBWA 3SPVA 3DRTA 1CFQB 3B2UD 4P46A 3MOBH 4QXWA 1JL8A 3QUYA 2LU3A 4XNXH 2ERJB 4CMMB 5KSUA 3ZYZA 3H9ZA 15C8L 2FYYB 4Y16A 3BDYL 1H8OA 1UJ3B 4OAWA 4J4PD 4CU6A 5IFHH 3E6HB 4UBDC 3WO3B 4NNPH 1B0WA 1OAXH 3CUPA 2R9HD 3DSFH 4GQ9H 4K3EL 2XY1A 4LMQE 1U58B 2C1OB 1I9EA 4WV1C 1A6PA 5DI8B 1GH7A 5CP3H 2HRLA 3VXSA 4ZODA 3WMSA 1QFUL 4XWGH 5CJQL 5JZ7C 4ODVL 2W9EL 1VFBA 3KPTA 5I1IL 5IHZB 2PYED 5F7NC 3ULVL 4RAVB 3TBSA 3O6FB 2VXTH 2X4NA 3ARZA 5EIVA 1R5IA 4AENA 1E27B 4ETQA 5C0BA 4CN4A 5GS2H 4GT7A 4ZOEA 5JQHC 3I6KB 4Y4FB 3NMEA 2X40A 3EAKA 2PXYC 2HH0H 4LK4A 3MRJA 3RWDB 3OTTA 4YXHH 5E6YA 1J18A 1K85A 5K33A 4OGYL 3OSKA 4DTGH 3BQUC 3BZEB 4YHKL 4JKPH 3BO8B 5EC1B 1BD2B 4R4FH 2IAMC 4OCRL 2DQTH 3IJSA 5GGUA 3P3YA 2AXGB 5F9WB 4X99B 2AERT 4QHUA 4ZUTA 5E08H 5KOMC 5DFVD 2V2XB 4HT1H 1AXTL 3IGAA 3SDAB 4MCYA 4UUJA 3TN0D 3KWWB 1QFWH 4HLZH 2B1AL 1GYAA 3S37L 1SJHA 1XGYL 2AJZA 3H42L 4ODWB 2VR5A 2DS4A 2VDKH 4Y1AA 1MFAL 3THML 4PGZA 5BO1H 4PJDF 2V2TA 1G7IB 1HI6B 4GMSH 4Y8AA 5DHYA 4HV8B 5E2WH 4NO3B 1QBBA 4XC1L 3D87B 3RZCC 3MXWH 1FYHB 1PQZB 2GCYA 5I1KH 4JG0H 4MZ3A 4YPGB 4Y2DD 3CFJA 3D3VA 1RZKC 3TVMC 5MEQB 3ME0A 5ACZA 1T0MB 4GRMB 4KK6C 4A2MA 2BK8A 1RUAL 4X98A 2F53A 4R8WH 1NANH 1YMMB 4JY4A 2BVPB 5DJZA 3ZT5A 4TTDD 1BJMA 1NCBL 5C0RL 3PUCA 2G2RA 3I6LE 2J12B 3FN3A 4CNIA 4QCIB 3RWHA 2DJSA 1FO0B 2R56H 3Q3GA 1XR8B 1KPUB 1A6WH 1R3IH 3CZFA 2E7LA 4HH8A 4RWYL 3P9MB 4KKBC 5CGTA 2FX7L 3TNMA 1X5XA 3BP4B 3VXUA 3QO1A 2IFFL 2I24N 3PWVB 2HTLD 4NHCH 4U6HB 4PRHD 4FXGB 4Z77A 1WIOA 4KUZH 1G0XA 1UGNA 5H94A 1AHWC 4LSVH 3FQXB 5TFSL 3SKOA 3E1F1 3MNWA 3EW3B 4PJIB 3O8XD 1CDYA 1D5BB 5GS3A 1U6AL 3K4AA 5JNYA 5GS1A 3BKCH 3KPSD 1RZIB 3ARGD 4G9DA 1JTOA 4LSSL 5TPWL 4ZFOB 4EUPB 2V2WA 4JY6A 5DTFA 4XPTH 2JLLA 1BMGA 4PJFA 1QTYT 5D1ZA 3K80A 1ZVSB 4JVWA 1IKNC 1RK1B 2D0FA 3DMMD 3HS0B 3CIQA 4FHBD 3VGAB 1HQRB 2Y9RT 1YEDA 2H3NB 1GHFH 2X09A 4X9BA 1UH2A 4OD2B 2Q1EA 1YJDC 4MD0A 5B8CB 1LWRA 4WO4D 4I77L 2X4OA 4X4ME 1U8LB 5LQBH 4JFFA 4D9QE 3GMPA 4Y5XB 5JW4N 5IBUG 2CK2A 1S7UA 4NC1E 1JPSH 5TDPB 4L4VE 2N56A 3Q6GL 4HIIA 4QY8A 2BFVH 1BEYL 4EDWL 1NCWL 5J1AA 3T3MF 4WI3A 4GUPB 3BIKB 1YEJL 4OUOA 3O4LE 3LRSA 3QJFB 4CW1A 3PABA 4PRNA 5DJDB 2ZPKL 3STBA 3IDYB 1R6VA 1YA5A 5FYKL 4ENED 1RURL 3G5XB 1DLFL 2WWMD 2E8YA 3NCBB 5ADOL 4X9GA 1FGVL 3IDGB 1VCAA 4IEFB 5C09E 4G9FE 2GFBA 4HWZA 1UM4H 2R15A 4PJ8B 3UPAA 3S3SA 1PGRB 1WV7T 3OXSA 4O2EA 5FGCB 4DGYH 3CC5A 2OTWA 1R5WA 3QWRD 3QEQA 3RX5A 2XKNB 3WUWG 3K2UH 4O2CA 5B39G 5JXED 4ZQKB 2IPKA 1DDHA 4XBGA 5IVXB 5IP4A 2YD1A 3HN3A 2KL6A 4LMQI 1VA9A 3AU1A 3U6RA 1CXFA 2EKJA 5F7UA 5ALCH 4O2FB 3PL6D 2HFEB 4NN6B 4PLJD 3AC0A 1L9MA 3DXAD 3VXMA 2YUXA 1J0YA 4ODXB 3V7AE 5T1LD 5IT2L 5C2BH 3QIWB 4MQ7A 4GRLC 4Q9CA 2FWOB 2XI9A 3D1MC 4JFDE 3SGKC 2BOCA 3UO1L 1YN6A 2HVKB 2X4QB 4L8SB 4P49A 1TPXB 3ULVC 1DQDH 5A2IH 4HIHA 3PQYD 4UINL 1S78C 3RTQA 1V3LA 5FK9B 5JORB 5JW5B 3H9SA 4PGEA 2AJYL 4LFHG 3RUGA 4Q7DA 4N0UE 1EGJA 3EYSL 1T20B 4DGIH 2FJGA 3LIZH 1OTUD 2P7TA 5I9QC 4LLMA 3EHBD 4F8QA 5CSBA 1NFKA 1I8IA 4WW2F 3PV7A 4P3DB 2WINA 3LS4L 3TH2T 3ILPB 3LKSB 1BQHG 2FGZA 4TNVF 5T5FH 4H5SA 3P11L 3MRKB 1A4KB 1HHIB 3IF1B 1K3IA 4XNYL 3DRQA 5F7EH 4JPWH 2R4SH 4L3EB 1OSPH 5F3HA 5HI5C 2EDFA 1T3FA 3OV6A 5ILTH 4APQD 4XP5L 5LGKA 4TUOA 3CFBB 3P30L 1N6UA 2KQNA 3GMMB 4B7IA 4ZTPH 4ODBD 3QULA 4B53A 3IS1X 4LPTA 1WCQA 5SWQB 5LXGH 2K7PA 5IESL 2YMXL 4KAQH 3GBMH 3T4YA 4WFGE 1IKFL 1QLEL 4NFBA 3CFKA 4XPGL 4W4OC 1A2YA 4PV8A 4OZFA 5I1EH 2FBOJ 4OFVA 4F7MB 4U1NB 3MV9E 3GSUB 5DJ8A 5JW3H 1WTLA 1OOAA 1KIPA 1MWAL 4QRRD 4FFVD 3AM8A 1S7RA 5CBAA 4OKDA 3CU7A 2YPLE 1TQCC 1UB5B 1GGYA 1TZIA 3OX8B 5HDOA 1QP1A 4OLYL 3JWOC 5HVHB 1L7TH 5JXAL 4LKXB 4TVPE 1ZTXH 3GIVA 3OG4B 2PTTA 4PJAE 2Z8RA 4GS7B 4IDJH 4LKCA 1FYTE 4M7KH 1FVEA 3GHBL 5GRJL 1KTLB 1L0YA 2I60H 3HC0B 4LVOC 3NH7H 2VLJD 2P5EA 4QOKE 5D7IB 2GSGA 1MCIA 4XPHL 1FBIL 1Y6MR 4AMKL 1MQKH 4JANB 3AMLA 1RZJH 1J11A 4HH9B 3B9KD 1QSEB 4HWNA 5EULV 1TJGL 2W9DL 1JNLH 4Z7UE 1G7MB 5J13C 3L3JB 3CDFA 4I3SH 1MCDA 1Q9WA 1CL7H 3EJZC 1CI5A 1NFDB 3RDTA 5HD8C 2HJKB 3L3DB 4H1LB 1FAIL 5K93A 1VACA 3ZDXE 1XGTA 2MQ0A 1F3JA 4LCYB 4XMPH 4CADA 1D9KA 2B5IB 2LQRA 4XCEA 3S35L 3ZHDA 5B3JE 4HAFA 3GRWA 3C5ZC 2D0HA 1MIEH 3QISA 2GTWA 1A1NA 3RWGB 2M8XA 4G8EA 3QR2A 3FQRA 4OQTH 2HLAB 4EN3D 4P5KB 4WHTB 5C7XH 5HYQB 3BH8B 1ZOXA 1L6XA 4YDIL 2FIKA 4FNLL 2OX5A 5T3ZE 3G9VA 4CU7A 1T89C 4LIQL 4OCNC 4DAGH 2BJMH 4XX1G 2B2XL 1JWSB 1MJ8H 2HVJA 1YDPB 5HHOB 2HMID 3KPRB 4WI4A 3RNQB 3TPUB 1FNGA 4M9PA 1OGAE 4P4KC 5E6ZA 4HIJA 5GGRB 4FP8L 3TJHD 5BXFB 2HFGH 1WITA 2VO5A 3MRBB 1T1YA 2Y07H 3CH1B 3WIHA 3RJDA 4Z7NE 2LTQB 1IC5H 5DEGB 5E8NA 2C26A 3O3AB 3ZKMC 3DVIA 4H0GA 5DHXB 4L8BB 3T0DA 3HAEH 1ZS8A 2QKIA 1AXSA 1K4CB 3DUSB 5TH2A 1ORSA 2IQAA 4XVSH 1BLNB 3KPPB 4JM2D 5J11C 4OZGE 3L3IA 2SEBB 2P8PA 3WNOA 2JELH 2VZTA 5IBLC 5I8CA 5D7KE 7FABL 1DEEB 12E8H 2DBJA 3GJFK 1NBYA 1AO7A 2E7BA 3AB0B 3CFCH 4O58L 4DKFH 4KDTC 2BMKA 1UQSA 3QFJE 5B22A 1NUGA 5IMKA 1RJLB 4OUUA 5CMAB 4PR5A 4POUB 3AGVA 2VB5A 2EKSA 4Y5VC 3VWKC 1MFEL 1FH5L 4PJBE 5KVEH 1ZHNB 4K2UH 5D1XA 3P0YH 3C5JA 2GTZB 3GMLB 5EUOA 1IAII 4OI7A 1FRGH 2WM0A 5IBUB 5JDJA 2D31A 4GRWB 5E56A 5BW7A 1BM3L 5FIEA 2JCCF 5FKAB 5I71C 4U6YA 4YHZL 4GG6E 2XPGB 1Y0LB 1MCPH 5L8LB 2LABA 4OF5A 2JK5A 4L8CB 1BAFH 4NZTL 3QQ3B 1A02N 1WGOA 3DPBA 1CGSH 4N8CH 5GGSY 1VESA 3LPGA 1TZGH 5AZ2L 3MRCA 5TE7H 2W38A 4U7MA 3T0EE 1YNLL 4TRPH 1FNEB 3GSVA 4LLYA 4HWUA 3EFDH 1JE6A 2FJFB 4XI5D 2P44B 3GSNB 1CK0L 1JUFB 1ZLVH 2APXA 5FB8B 2GJ6E 4NSKA 2V17L 4LL9A 4UTAH 4J3XA 3U7YH 5IHLB 4RISH 3QG7L 5KSVA 4J12A 2J4WH 2Q6WA 3G6DH 4RMSA 2PW2B 1PYWA 3WXVL 1E4XH 1PZ5B 2D7PA 4RDQF 1AIFA 5H8DA 5CHNB 4KI1A 5IFJB 3C2AH 3PWJB 3LV3A 2YXFA 5F89A 4MS8C 4M8QA 3SKMB 2CGRH 3NIGF 1IGYB 3MLWL 4DKEH 4HUWA 5CFHA 2BVYA 4TUKL 1J0ZA 3VGHA 3HNVL 1I1AD 1YY9D 1S9XB 4N0YL 4WUUE 3S5LB 3QBTB 5A3IC 4YEFA 1UWEH 1CBVH 1QQDB 1JGEA 3TBTB 3HC3H 3X3FL 3NABH 1CICD 5CP3A 1GGIH 1WZ1H 3D39A 4YGVB 2NY2C 5K9QG 4QWWD 2OJZH 4LEOA 5HI3D 2YK1L 1Q0YL 2AJSL 4PJGE 3MLXH 4QXUL 4RBPK 4KHXL 1DR9A 2X42A 3ZKND 3E8UH 3RAJL 1CFBA 3QI9A 2GEEA 4IRJA 1MCHA 1MCCA 5D7JD 4BSWB 5GHWL 1SEQH 5EU3B 4MA1C 4ORGA 3VFNB 2OL3B 1U8JA 3UBXB 3ZT7A 4LLWA 1P4BH 4P2YA 4EXKA 3IVKA 4Y4KD 5HGBB 3VFGH 3AY4A 4PLKD 1Q1JL 4ZPTB 2UYLA 4GW4A 1ZT1B 5I8KH 2UWEE 5EO9B 1GIGH 5L2KD 4R2GB 5JDSA 3F7VA 1A6VL 4BQ6A 1DBAL 1OM3H 5F1IB 2BCKA 4GW5B 4PLNC 4ZDHA 3L5XH 4K8RL 1X5IA 1UYWL 4EI6B 3OBAA 3OKEB 3QJHB 4Z76A 1UXWA 1BX2A 5I17B 1IZJA 2XQBH 3W11C 4FQQA 3CU1A 4K7PY 5CSGA 3QUXC 5IG7A 2A83B 3RWJB 1JGVH 3SCMD 2O5ZL 1TVDA 2IANE 2OK0H 4RMWA 4K23L 2E27H 3KPOA 5F7MC 4I0PB 1FIEA 43C9A 1FNSH 1DSFL 2NY6B 5FUCC 2UZYB 5D2LA 1MHCB 3RU8L 5JR1H 4MXQC 2AJXL 4LVEA 4WEBL 4U1HA 4R0LA 4AG4L 5K9KB 1FL3A 5HVGB 3MGTA 1W72H 3MODH 4ZUSB 1RQ5A 3ALPA 1KF9B 3MR9B 1RUPL 3MA7A 2EE2A 2YD6A 2EDRA 4OLVL 5E2TH 2E7MA 2I9TA 4ACPA 3IU3B 2GUOB 1KCUL 5BJTB 3NFNA 1I9IH 1K2DB 3RWEB 1JK8B 2OR7A 1HNFA 4D9QD 1U8KA 4JRYE 5SWSE 3O2VL 4N0CD 5FO8A 4TQEL 3TLRA 3WV0A 5T1DL 5CEZL 4L4VD 5CIPB 2ZCHH 1KLGA 1RUMH 4M5ZL 4Y16C 1BVLA 3JVGC 1GC1L 1RIVH 3C9NA 2QJDA 3F7RA 1SBSL 3RL1B 2LAGB 1KIRB 3UTQA 3Q5OA 4NKMA 5C08A 5HYEA 3VXRE 3O4LD 3UYRL 5L88L 3JV4B 4NNXB 2HT2D 1MJUL 1N8ZB 4YXLL 5J1TC 4RNRB 1BPVA 1WIPA 1X5HA 4NQDE 5K9JL 1RZ8A 3T77B 5KTEL 3DTXA 2XRAL 4N0FA 3ARUA 4JDVA 3S8WA 3MUZ1 3DO7A 2EXYC 2X70A 4C56E 3KLAA 4N0RA 5ETUB 5IB2B 5C09D 1UXSB 1YEEL 4G9FD 4EQ3A 4JJ5B 4Y19D 3G5ZB 4W68A 4S2SA 2ATPA 5EO0B 1XGPB 4GKNB 5JOPE 2Z31C 3MACH 3UTTB 3ARVA 5BV7L 1EGJL 3B8YA 3T0EB 5DUBB 3T2QA 4XH2A 4NC2B 2W92A 4QT5A 1B4RA 4J4PA 5EU6E 1S7SB 2NXYD 4GKSB 4MA8H 1ZWIA 3V4VL 2GK0A 2F54E 4I3GA 5AYUH 2XTJD 5CILH 2ZCLH 2Q76A 4G7YL 1XF2A 2P46B 4OKVB 3A0OA 1FLRH 3RA7L 1RZ7L 4PJ9B 2XQYG 1TCRB 4F7TA 1DQQB 1UEMA 3O6MH 1K6QH 1HILA 4R3SB 4QNPF 4PRAA 1P6FA 2PYEA 4FZ8H 4JFDD 1CGUA 3ZDYE 2F74B 1MAMH 4ISVB 3HE7B 1T5XB 2VERN 5DRZA 5E03A 4HPYH 2D4DA 4POZD 4BFIB 5H2BB 4LAQH 4DW2L 3VMPA 4NQVA 4XAKE 4XCCL 3CCHB 2VLMD 1R3HB 1UB6B 5F6HJ 4P9ML 2CMRL 3KPMB 2CUIA 1H3GA 4P5TB 3JWDH 4OIAA 2XFXB 3WO4C 3SJVE 3DI3B 2CRZA 3SDCD 1U3HA 2HJLB 2R2BB 2QSCH 1LO2H 3BZ4B 2BNRB 2H2SD 4DZ8A 2VITA 1LK2B 4HWBH 5IEHB 1DVFD 5GS0L 1UCBL 3G08B 1YY8A 5ENWB 4WDIA 4DFHA 3O81A 5D2NA 1NLBH 1KEML 5KS9B 4RGOH 1H15B 5CJOL 2W65A 3RVVD 3MJ6A 3RPKA 3MREA 3U48A 2EDQA 4IIQA 2NX5E 3WNNA 2AK4B 1LEIB 2JIXB 4OIIL 3S88L 3NACL 1CTNA 1HH9B 4O9HH 5ESAB 3TN0A 1FG2A 1UWXH 2LU7A 4OM1L 1LE5B 4NQEE 3GBNL 3D2UD 5IQ9A 4YDLC 4L4TE 5I1HH 2E7LC 1ZV5A 1BVKA 1ULVA 5HHXH 1FN4B 1LP9F 1M6OB 2DLIA 1BFVH 2WK2A 4WFGD 3GMQB 3UXFA 1CN4A 4BSVB 1A9EB 1RULH 2FB4H 5D7LB 2P24A 3MV9D 1C1EL 2D03H 5TF0A 1J1OL 1RZFL 2IBZX 4Y2DA 5I0DA 1IM9D 5EWIH 4M4PA 1HHGA 2YPLD 1D5XB 1XGRA 1U9KA 4NQXA 4TVPD 3BRGC 2X4UA 1QSZA 4DZBB 5FHAL 1JHKH 4JFYB 3GRWL 2XOTA 4KVNH 5D1ZC 3PDOA 2UZIH 4G6KL 5KOVC 1HN1A 2DQJH 2Z93B 3FT4B 3QDMD 4TULH 2MCPL 4YO0A 4AT6A 1P7QD 5F3BA 4OZIF 5FDWA 3WSQH 3NN8B 2R4RL 4YIQB 3CDGB 1CG9B 1U36A 5DJCA 1WWCA 4KDWA 5CD5D 1G9NC 1RVFL 2FATH 3V79C 4K8RC 3ULSA 4ODTH 3AS3A 4AL8H 3S96A 3EYOA 4PG9B 4PRHA 4D9LH 1AD0A 4PJ7F 2X4PB 4BM7A 3DGGA 1CIUA 4XGZA 1WBXB 1A6UH 5IROA 3WIHL 5L2JB 5J89A 2YHGA 3O8XA 4Z5RB 4NUGH 1GGCH 2NTFB 4X8JA 2YKLH 3R06A 1F4YH 2WIIB 3KPSA 4ZSOA 3ARGA 3OB0H 4R96B 1PY4A 2OTUB 4JZOA 1AQKH 4O51B 5DQJB 4NJAL 1ZEAL 1I1FB 2DTMH 2A9NL 3MA9H 5ESVA 4Q2ZB 3F6LA 4JZNB 4AM0A 1T1WA 1UM5L 3DMMA 3FT2A 4NO5A 3D25B 4MQXD 1KFAH 2ICWA 4FFZH 5I19H 4LCUB 1AGFA 1ZHKB 3NGBC 4NQDB 4F15C 5T3ZD 4PJXE 5A1AA 5ID0A 2PXYB 1ZA6A 1I7UB 4WO4A 3EYQC 1XCTB 4G8GE 4ZFFA 4UDTA 3BGFC 3RI5F 1OGAD 1IAIH 3PWLA 2PTUA 2P8LA 4HGWB 1JP5A 4M61A 3L7EA 3MTRA 2CDFB 3BQUB 3D0VA 4NM4L 4HKZB 3V6OA 4L3AA 2YC1B 1UZ6E 3TBWB 4PV9B 1H3XA 1OAUH 2IAMB 4WFED 4HG4K 2XWTA 2MMXA 5EN2B 3WLWC 5C92A 3L5HA 4JZJA 3SO5A 1UKSA 1F6AA 2VDRL 5KN5B 4GXVH 5TF1L 4E41B 2AVGA 4GAGH 1WSST 2EDEA 3D69B 3MV8E 2EICA 4PY8I 4JHBA 5D7KD 4P9HH 3EOTL 3GBLA 3MUGA 4FG6C 3CVHH 5TJWK 5FUOH 3UZVB 1Z0NA 4V1DD 4PJCE 2FEDD 4JLRA 3QFJD 4YK4B 5JO5A 1U95A 3RZCB 3RTQC 4NT6B 1LEGA 1M1SA 5C0JB 2B1HL 5KSBF 4OQTA 4F9LC 3QWRA 3TVMB 3KYOB 5E00A 3MOBL 3ARED 3BSZH 5JXEA 5CBEB 5A16B 2B0SH 4XNXL 5EH1A 4CDGC 1U8NB 1EUTA 2OQJB 4NQCE 1NUDA 7CGTA 1EMTH 1N0LA 5DVOA 3OJ2C 2XQYK 3PL6A 1VERA 3D85B 5IFHL 1JNJA 1MPAH 2KKQA 3MOAH 3DXAA 4NNPL 3MZGB 1OAXL 4X7CC 3DIFA 3LRGA 1A7BA 3FFDB 4QXGH 4JDZA 4EVNA 3DSFL 1T0NA 4GQ9L 5T1LA 3V6FA 3B5HA 4UIMB 2R0LH 1MUJA 5FGBA 5E99H 3VXTB 1IL1B 3HAEA 2CIIA 4XWGL 1CF8H 2P8MB 2NX5B 3UYPA 3PQYA 3FCTB 3HUJF 2GJ6D 2ZG3A 3ARRA 3RVTC 4TVPH 5L8JB 2VXTL 1AHWB 5IR1A 1WFTA 3I6GA 1F97A 4WJ5A 4XWOD 3MYZA 1BOYA 3AM8C 1JHTA 2OLDA 3LSOA 2V7NA 2A6JA 4IMKA 1VFAA 5F7DA 3RIFK 5JLZA 5C0AB 2HH0L 2FSEA 4YFEA 1FAKT 3GMRB 4YXHL 3EO0A 4I2XA 5IWLA 1UH4A 1BGXH 3W39A 3IJHA 5HYJE 3JBG7 1W0VA 4OF0A 2OJEA 4DTGL 2D7OA 4YBQC 4BUGA 4APQA 1G7PA 5ICYA 5C0CE 1NUFA 4JKPL 4ZD3H 4WUUD 3PV6A 3VG9C 5E94B 3SDXE 4I9WE 4R4FL 5EFIA 4PBXA 2DQTL 4X9IA 2YBRA 1SYSA 2NY3C 5E08L 1XCQB 4N5UA 1JYWA 4HT1L 4LRNH 2ATKA 1NC2D 1QFWL 5GSRB 2VLKD 4M3KB 2EIDA 1OF2A 4X6DE 2ZSVB 3IDMB 4PD4J 1A7PH 4WHDA 3VCLB 2VDKL 2CH8A 3GSXA 2Y5EA 5BO1L 3ZHLA 4GMSL 4L4JA 4K9EH 3MV11 4QRRA 4KQ3H 3G5VA 1FORH 2IQ9H 5E2WL 4ONFH 3MXWL 1PDKA 1R5VB 3F62A 2OXHA 3DX6B 4YDJA 5BOPA 5I1KL 4JG0L 2HJFA 4X6BB 4JQIH 4RMVA 5T3ZH 4MNQE 1U8HB 3P9LA 3ARDB 1LNUA 2BNUA 5IF0A 1AH1A 4QTIH 2WQ8A 3FRUB 4M1CC 3QXDB 2CUHA 2VLJA 5F6HI 3MCLH 4R8WL 1FV1A 2D0GA 2YRPA 4LHUD 3N1QC 4G6FB 1NSNH 2E9WA 1DP0A 3F5WA 3KLHC 4P4RB 4RGNC 1JNHA 5I1DA 3LQZB 3RVUC 5ANME 3B9KA 4RDQG 4WRLA 2R56L 3LD8B 5D70L 1WAAE 5DURB 1FDLH 1A6WL 1R3IL 3P2TA 5EUKB 1YUHA 1RMFH 2GKIA 2KZWA 5JQ6H 3T1WA 3LB6C 4WU5B 4YDVB 1GVIA 3FQTB 4HEPG 5FYKE 2IAND 2Z92B 1E4KC 4KRNA 4NHCL 1NGYA 4HW6A 1U3JA 5JPNB 4KUZL 1CE6B 1KIQB 5ICXA 5JHDB 4LSVL 4IMLA 1KTKE 3GSOB 4XNMA 3DV6B 3QEGH 2A1WH 4MYWB 2LU4A 1AGDB 3U9UB 4L3CB 4P2QE 4Z7QF 3LQMA 3BKCL 4Z95H 1AFVH 3QQ4A 5F9OH 1LMKA 1DBJH 5HJ3A 5EOQL 4HS6B 3QCVH 4U1GC 3V4UL 4EN3A 3PXHA 4XPTL 3INUH 3QHZH 4K7PH 1JPTH 2VXUH 1AXIB 4P5MA 5HHNB 2BRRH 1KC5H 5SWSD 5FHBH 2GIYA 1JHLH 5IVNA 4U33A 1GHFL 3EGSA 5EC2B 5I9QB 5B4MD 4KWUA 2J8UA 4N9GA 5SX5K 3QHTC 3IETA 3MNVA 4KK8C 3SOBH 3HCVA 3P4MA 1QA9A 5LQBL 1UJTA 3BRFA 4KV5F 3BISA 1T2JA 5DJ6B 2JJWA 4GAYB 1JPSL 4OZHF 3VXNB 1SYVB 3ULUF 3GI8H 5GSVB 3VXRD 5BS0E 1WCBA 4YBLC 2BFVL 4HKJB 3WNLA 5E2UH 4JM2A 1N2RB 2BX5A 5MERA 4PRDA 3BRDA 5CWSB 3OGCB 3U7WH 1UZ8B 3ZHKA 1T21B 3LEVH 4X0KA 1PJ9A 1AR1C 1W72A 4PJ7A 5JOPD 1ORQB 3U0TA 4W81A 4F3FB 4P2OB 4MLIA 1UM4L 4OZ4A 1R3KB 4KTYA 1MRCH 3C87A 3JTTA 3TF7C 3BD5A 1QPPA 2BVOA 1TQCB 4MCZA 4MB5A 4F2MA 1JN6A 1BBJB 2E9IA 4P48A 3WHE1 1MJJA 1ZT4B 1ZGLP 2EIZA 4DGYL 3OAUH 1MLBB 5F7WC 2F54D 3EZJB 3K2UL 1DUYB 3GJEA 4LVOB 4YHNA 1BFTA 4Q9QH 4KZEH 4WW1A 5D71H 1K9TA 3P77B 4X6CE 4KUCF 4M6AA 5ID1A 1T2XA 2WP3T 3IB4A 1KCLA 3EYFB 4LOUD 5EA0H 5F1OB 1T66D 1U8IA 2WLYA 1IC1A 2R8SH 2JB5H 5ALCL 2PF6A 4HKXA 1PW3A 2H2PD 4XHJC 5LGJB 1TXKA 1PD6A 4XCFH 5I76A 3CK0H 2EH8H 4G6AD 5C2BL 3K0WA 1N5AB 4BH7A 1X9QA 4JHAH 3O3EB 2A9MH 1QRKA 3QHFH 3QI9C 3HRPA 4FRWA 4IRJC 2LV4A 4FQIH 3HI6H 3O11A 3AS2A 1EFQA 1EVTC 3W0WB 1E28A 1KXVC 1F58H 5DQ9A 1SJEB 4LU5H 5MEPA 4UU9A 4FXLA 5FOBA 4M6MH 4DGIL 5CSZB 3LIZL 1EAJA 4XNQB 4F80A 2UY6A 3C5ZB 3AY4C 1JCKA 3GB7A 1CGYA 4PJ5E 4WHYH 3LQAH 3MLPA 1NLDH 3C8KB 1CIDA 3PWUA 1A9BB 5T5FL 3GSQA 1I1AA 2WUCH 2RB8A 4DK3A 4XBPA 5F7EL 4JPWL 2R4SL 2KQMA 1J0IA 4QRPB 1WQVT 3U9PH 3V5DA 4MJ5B 1OSPL 1CXIA 4L4TD 4HJGA 1CICA 2W60B 5ILTL 1KCRH 1IAMA 2Q86A 4Q58C 3W82A 4P4KB 4KJWD 2YD4A 1FVDB 5IEKB 4NO0D 4ZTPL 4JJHA 4QYOB 4LPXA 2VDLH 4HBQA 3HHRB 3E3QC 4MA3A 4JFEB 4QRSA 3QFDA 5LXGL 3O6FD 5D7JA 3DBXA 3LH2H 4KAQL 3GBML 5F88B 3T65A 5I1EL 5AAWA 4LPYA 1EEYA 4MNGE 5FYJU 3IFOA 4Y4KA 5JW3L 5D5ME 3DX8A 3LEXB 2OZ4H 5MEOB 4ELKA 4R0LC 2W59A 5C07B 2UUDH 4MAUH 3NCYS 4LIQE 4X4YB 1ED3B 1L7TL 3OKOB 4EBQH 3OKDB 4BH8B 1ZTXL 4AQOA 4HWBA 5IMLB 5L2KA 3SDDB 1MVFA 4M7KL 4IDJL 1RSFA 2EDTA 1DN0B 1N3NB 3C5SA 5I1AB 4PRPE 2I60L 1MRDH 3HMXH 3K8KA 4HEME 1YN7B 2BVUA 3NH7L 1RUKH 1YEIH 2EDWA 1NGZA 3DVGA 4J3UA 4Y5VB 3REVA 2ADIA 2NY4C 2VRAA 3P9WB 4ONHA 3VWKB 4L9LC 3L6FB 3QZWG 4O5LH 3SDAD 1FC1A 2FEEL 2G75B 3VXSE 4NM8H 3MV7B 4FQPA 1MQKL 5T1KB 1ZHLB 2UVEA 3B4NA 1RZJL 3UJTH 2WW8A 3QG6B 3PGFL 3SCMA 2O5XH 1JNLL 2PYFB 1UEYA 4I3SL 3ROLA 5I71B 2EDDA 5L9DH 3VGFA 1HCFX 3NZ8A 3QRGH 4EIZC 1H0DB 2NNAA 5IFAH 3N85H 5C0BE 5TQ0H 4YE4H 1I8MB 3CMOH 3DROB 1BBDH 1VGKB 2DI7A 3HG1B 4KI5C 4XMPL 2EIBA 1T1XA 3KLSA 3RPIA 4ZOAA 3QXTA 1QRNE 3TBVA 3FB7B 2W91A 3N9GH 4KQ4H 5E9DE 1MVUA 1WEJH 1MIEL 3B2UC 2A73A 3MCKB 3U7AA 1L7IH 2XWBB 4G8GD 4OQTL 4X4MA 5C7XL 5T33H 3S9DB 1KTDB 1U8MA 2EE9A 4NCC1 1D5MB 4L4VA 2EDHA 1FPTH 2O5YH 3MRIB 5H35A 4DAGL 2BJML 5I1JH 2YUVA 1MJ8L 4PJEF 4HJJH 4YXKH 4PTUB 2R9HC 5IMMA 1M05B 4Y1AE 5DRXA 5E4IA 3O4LA 1J8HB 4BELD 3W5MA 1CXLA 2R39A 3ZE1E 5J06A 2HFGL 4I1NB 1S9WA 1CZ8H 1FZKB 2VE6B 4PGDA 1NBZA 2Y07L 1DBKH 1J9CT 4FQ2H 4HFWB 1SVZA 2IFGA 1IC5L 3QNYA 1IGJA 3B3IB 1U8OB 3MV8D 3H6JA 3L3GA 5SWZE 5C09A 1LD9A 4G9FA 4NNYA 4MJIE 5L7XH 1OLLA 4FTVE 5ITFA 4Y19A 4XVSL 3BT2H 1OP3K 2FR4B 1WICA 1MCJA 3LKQB 1NGWA 5GRVK 2JELL 2F53E 3L9RA 2XYCA 1RY7B 12E8L 2ICES 3AS1A 1WUNT 3RKPA 3V0VB 3H9HB 4MA1B 3CFCL 3D0LB 1HDMA 2XZAH 4GKZB 5I8EB 3SE4C 4CVXA 4DKFL 4BKLB 5F93C 1MWAB 1U3HC 4JHWH 5FYLE 1HOCB 3Q6FB 3K8MA 5DYOA 1QEWA 2FO1A 1ZGLA 2XNAB 4HULB 1AGEB 1OD7A 2VABB 5D2NC 4QRTA 2CUMA 1EEZB 2BSSB 4KKNA 5KVEL 1AGBB 2VDMH 1HSAA 4K2UL 3UPRA 5AAMA 1KCKA 3P0YL 1ZLUK 2H8PB 4TYUA 5J6GA 1FRGL 4L29B 1OTTD 3QDJB 1A1MB 2YSSA 1HHKA 5C6PB 3G6JF 3PGDB 3TN0C 2AKRB 4JFDA 3ZDZE 2ADGB 3SGEI 4KVCH 3WYRA 4WHCA 1EXUA 4DOHB 1MCPL 2CKNA 4GBXD 3TZVD 1CFVH 3N50A 1BAFL 1MCBA 4Z7WF 1AY1H 3RL2A 4X5XA 3HE6C 4N90D 1CGSL 4N8CL 4P2CG 3UTZA 1TZGL 3QUXB 5TE7L 2BOBB 3W2DH 2GITB 3AFLA 4I5BA 4N0UA 2ZCKH 1R24A 4TRPL 3WNPA 3ZE0E 2GSIB 3LPWA 3CVHA 2JE8A 3EFDL 5F9JA 1MCFA 5D8JH 1C12B 5H37H 3SDCA 4RRPA 4HKBA 3MRQA 4ZOBA 2FL5B 1EBAA 5DD6B 4UTAL 1L0QA 2GY7B 4PRBA 3S4SG 3U7YL 4RISL 1DVFA 2F19H 5DRNA 4M5YH 1Z0MA 2J4WL 5HYJD 1MFCH 3G6DL 3MJ8A 3LN5A 1E4XL 2ESVB 2H26B 1W0YT 3ECBB 3WXWH 4JFFE 5C0CD 3ARXA 4LGRB 3MROA 4XX1E 1SMAA 5EBWB 3SPVB 2CGRL 4TNWF 3DRTB 3ETBF 4P46B 3G04A 3D2UA 4DKEL 3BKMH 1CD1B 3QUYB 4DEPC 4NBZB 1FVCA 4J23A 2H6PB 3GSWA 4HUVA 4Z8FH 1UWEL 1YMHB 1MHPH 1Z9MA 3HC3L 2XZCH 4Y16B 3NABL 4OAWB 1L6ZA 1GGIL 1WZ1L 4FQJH 1JBJA 4NOFA 3MV9A 4FQ1H 2OJZL 1IM9A 2H32H 4F33A 3MLXL 2PO6C 3QXUA 3O8XC 2YPLA 2BSRA 2DWEA 2Q8AH 1XT5A 5LWYL 3E8UL 4X5LA 1K8IB 5IB3A 4JCMA 5EU5A 4PJAA 1SEQL 2WSKA 4BQCA 1VFBB 4NWTH 4RFOH 1P4BL 3TBSB 3QIBD 2X4NB 3QEQE 3QDMA 4QOKA 1Z9SA 4OD1H 1R5IB 3VFGL 4AENB 5CEZE 2DJUA 1FO0H 1P7QA 1JI1A 1G9MH 5C0BB 3T2OA 4KK9D 5I8KL 3MC0A 3U0PA 1QO3A 1GIGL 4KFZC 3MRJB 2ZUQC 2WWKT 4Z7UA 4JE4B 3RGVC 2NY0D 1OM3L 4S1SH 3DX9A 4U0QB 4Z7VF 3CZJA 3FONB 4QRUA 3IDIA 2VH5H 3L5XL 2BNQB 1VADA 5D96C 1OW0C 3PP4H 4ZNEE 1AD9A 3SE3A 3MFFA 5MP6H 2XQBL 5GGUB 3VWJD 4QHUB 2ICEA 4JZJC 5EU4A 1JGVL 5EBMA 4RCAA 3IGAB 4QF1B 4FQCH 4UUJB 4V2BA 1LO0H 2OK0L 2E27L 4ENEC 1ZLWH 1SJHB 1FNSL 3VH8G 4U3HA 5JR1L 3EIFA 1SEBA 5EOCJ 2V2TB 4NWUH 1NBVH 3SQOH 1W72L 3JSSA 3MODL 5DHYB 3NVQA 3PHQB 2M26A 3UDWA 1MFNA 2GCYB 2YA1A 3WO4B 5HYSA 5D9SA 1U92B 3CFJB 3D3VB 4PJHB 5E2TL 1PSKH 4DKDC 1XF5A 1OGAA 2VZ3A 5J6HA 3QP3A 4S1RH 3TC9A 5ACZB 1I9IL 2I25N 3LAFA 3PJSB 2F53B 3FHQA 4IS6B 4NQTA 4JY4B 2Z8VC 1RUML 2YEZA 1EO7A 2ZCHL 5DJZB 4Y5YA 3QDGB 5BS0D 4A6YH 2G2RB 2OBGA 3PL6C 1GGTA 1RIVL 4PLJC 4CNIB 3RWHB 5KZCB 1CDJA 2AEQH 3Q3GB 3ALXA 1CFNA 2APWA 4I48A 4OZGA 3CZFB 4UV7H 1SBBA 5FGBC 1ES0A 3TNMB 1QD0A 1OB1A 2JJTC 3VXUB 3QO1B 5GQBA 4L5FH 4U1LA 1GZQA 3T3PF 1UJ3C 2VXSH 2I26N 4R4NC 1ZA3A 3QFJA 5DK2A 1YZZA 1JVKA 4Z77B 2DAVA 2R1WA 4UOW0 4D0DB 3L7FB 2OP4H 3SKOB 3BYTA 2OR8A 4PGCA 5EB9A 5KVMC 3AREA 1OTUC 5GGVY 4UTBH 2E9JA 2P48B 5JNYB 5GS1B 3MACL 2JB6B 4HG4J 2PNDA 4G9DB 3CLFH 4OLEA 3ELAT 5IWLC 2CSPA 4PJFB 5D1ZB 3I50H 4MA8L 4PUBH 4W6XB 3I02B 4APQC 1T6WA 3ISWA 5AYUL 3GM8A 3SKJH 4XB7A 5CILL 2ZCLL 4EEEA 1FLRL 4OI8A 2X4OB 3K4DA 5CGYD 3O6ML 1K6QL 1MF2H 3ZZ1A 3GMPB 4PP2A 1EH9A 3D9AL 1S7UB 4FZ8L 2GJ6A 4Q9RH 1MAML 3E6FA 1S7QA 3GM0A 4HPYL 4HIIB 4LSTH 4LAQL 2IALA 3NAAH 5EPMA 3PE9A 4LLVA 2B4CC 4PJDE 2X5PA 2X4RB 3Q0HA 1P9MA 4GSDH 4ALAH 1N64H 3OXRA 3VRJA 1T5WA 3HLAA 3JWDL 4CW1B 1FC2D 3HTLX 1IVLA 4PPTA 4LPVA 2QSCL 1LO2L 2ZSWA 5DF0A 3PXJA 4XVTH 1KN2H 4HWBL 3EO9H 1GSMA 2DLTA 4WUUA 2GFBB 2RJMA 4HWZB 1NLBL 3PDDA 3NGBB 3FFCE 4RGOL 4F15B 4O2EB 5DJXA 3KJ4C 4U0RC 4QHMB 3CVIH 2KDGA 2F15A 3QIUD 3B9KC 2WMPA 3CC5B 3BGFB 1IZKA 1NC2A 2CKBH 3DX7A 4JFZH 1ZVYA 2VLKA 4O2CB 1EO8H 3NA4A 5FGSA 1F2XK 5I1HL 3LKOB 2IPKB 1DDHB 4XBGB 5HHXL 4OLZH 2J1KA 4QHLA 3CMGA 5CZKA 1RIUH 1BFVL 3AU1B 3U6RB 4Q9BA 4F7PA 3KPLA 4U1SA 1RULL 3SGDI 5JMOC 2FB4L 5FV1L 1EZVY 1NCTA 3WNKA 1ZXQA 2D03L 3VXMB 1AO7E 1E4JA 5EWIL 2I9LA 4MQ7B 1RHFA 2YXMA 2UWEA 2BOCB 1YN6B 3X13A 2DQIH 3AXLA 4LDLB 4OGAD 2VSCA 3X12B 1JHKL 4LHUA 5SV3A 4EN3C 1C5BH 4HUKB 4PRPD 4KVNL 3KR3H 3RTQB 2UZIL 5FUZH 4PJIF 3H9SB 2XZZA 1CGTA 5GRWA 2DQJL 3RUGB 3AUVA 4TULL 3BH9A 3O45A 5BV7B 3OJDA 4Z9KB 2HMIC 2FJGB 1MIMH 2DL9A 3WSQL 2P7TB 5KG9B 4LLMB 4FQXD 1FJ1A 4ODHL 3TEUA 2WINB 2NXZD 5F1KC 4H5SB 2FATL 1I7ZB 3PHSA 4M93C 4ODTL 4AL8L 2IC2A 2IANA 3DRQB 4D9LL 2A74A 4DN4H 5E1HB 1T3FB 2YUZA 5CZXC 3R1GH 5FA4A 1A6UL 4TUOB 3TFKD 4UQ2A 2AV1A 3RQ3A 1A5FH 1GGCL 2J2ZA 4NUGL 5DJYA 5B8CC 5HYIA 2YKLL 1F4YL 2ZG2A 4Z0XA 2RHEA 4JPKH 3QULB 3T3ME 1QRND 1BJ1J 4UV4H 2OZ4A 5E9DD 1AQKL 2EYSA 1B88A 2DTML 2LFGA 3CFKB 3MA9L 4PV8B 4OZFB 4KRPD 3D48R 1KFAL 3BW9A 5SWSA 4L8DA 2DIJA 4FFZL 5DJ8B 5I19L 3EKCA 3I3BA 1D6VL 1ETZA 3SY0A 1KIPB 2EXWD 4NZRH 1S7RB 4LGSB 5CBAB 1ZGLM 1TZIB 1W2KT 1IAIM 3QQ9D 2ZUWA 3GIVB 1TIUA 2PTTB 3ARSA 4LKCB 1FVEB 1IAIL 1I75A 1J5OH 3BN9D 5ACLA 3VXRA 4OCSH 1NC4A 5K9QI 3I3EA 1XH3A 4YH6A 2VYRE 2D7QA 5C0DA 3PNWA 3VG9B 2NYYD 2P5EB 3SGEH 1OAUL 1QYGH 5IMOA 5F9AC 2YN3A 3IKCA 5SWZD 4LASH 2ORBH 4MJID 2NY6D 4P3CH 4FTVD 3DYOA 1KULA 4WTZG 3R0MA 5IVXF 3VXPA 3VH8B 3GMNA 1Q9WB 4XI5C 4GAGL 3BGMA 2VZOA 1F02I 3RDTB 4P9HL 4AK1A 3CVHL 1WLHA 5INDA 4FXKA 5FUOL 3VMOA 3UTSE 5DJ2A 2ED7A 3U0WH 2ENYA 1OL0A 4JDTH 1GAFH 5FYLD 1XGTB 3ARPA 2A0LD 1F3JB 2EDKA 5LCVH 3HPLA 3WFDH 4CADB 3KYMA 1YNTA 2CK0H 1A6TA 2F54A 4NRZA 2C9AA 3BSZL 1QLRA 2K1MA 2VN4A 4GRWH 5BZWA 2XKSA 1S7VB 2GTWB 2B0SL 1A1NB 3B8SA 4G8EB 1I1AC 4JKLA 1YY9C 4G7VH 1EMTL 2Z35A 5AZEH 1J05A 1MLCA 4RGNB 1CE1H 2FIKB 2QEJA 4D0BA 1KJVA 1MPAL 3MOAL 3F7YB 1CICC 1AE6H 2QADD 2YD2A 4TUJA 1U93A 2HVJB 4I3RH 4QWWC 4N8VG 3O6KH 1FNGB 3KDMA 2R0LL 4X6FA 3GSNH 5E99L 3V4PH