3HZVA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.8)kdo(2.4)kdo
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
218
structure length
218
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKSIAVKWKIDGSERQNGVLNSWTDQDKKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
total genus 48
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvA01
5D2NB 4HKBA 5D7SH 5A40E 3EOTH 2VZVA 3STZA 4XT1C 4YWGH 4NO2B 5A16A 3VFNA 4CN6A 3G6DL 2WWKT 4RDQF 2R29H 2Z92B 3Q5OA 4YGVA 3BIKA 1FC1A 4C57C 3TBVB 4MA7H 5DD6A 1RK0B 4OCRL 5I71C 2VAAA 2W38A 3T0EE 1F5WA 4PB9L 6CGTA 5L2JB 4L3AA 3QDGB 4YIQB 4ZOCA 1FZJA 1MFEL 4HUXA 3VG9C 3HPJB 3JUZA 5L2KB 1TCMA 4OD2B 4K2UL 5L9DH 5TPWL 1YN6A 1HXMA 5I76A 3RX8A 4P57A 2NNAB 2HT2C 5GQBA 4HUWA 3TC9A 1T03L 2F53D 4PY7A 1OTTD 2W0KA 4WCYH 2EIBA 1HILB 2IAMA 5DD3L 5EU3A 5J8OA 3QWQB 1F4XH 2Y1VA 4FQJH 4YBQC 3OKDA 1CGSH 2UY6A 3MV9D 3EYUL 5IBLD 3GSWA 4L8SC 5D2LA 1HYRC 4LPTA 3O2WH 1TTFA 4F58H 4HUKB 3PWPB 1N5YH 1QPXA 2H6PA 3KLAA 4LVEA 2H8PA 3RVUD 1MH5B 1UENA 1HSBB 4MZ3A 3BQUC 5BRZD 3UAJD 4H25A 1J8KA 2VZ3A 2BSED 4PLJD 4X8JB 2HVKA 1NC4A 1QYGH 3WN5C 2X4RA 2YD3A 3SKMB 4PBWD 1INEL 2E3VA 4J2XA 2ZSVA 3NZHH 3W0WB 2RBLA 1I7RA 2JJTC 5DEFA 3BRDA 3DURB 3VRLE 5DLMH 2W9EH 2Z93B 1T5WB 4NC2B 2CKBH 2FJFB 4WU5B 2FECI 3DV6B 1JN6A 2CUHA 2EDKA 4MNQD 4QTIH 5DQJA 2FB4H 2NW3A 1Z5LB 3GSOB 3STLB 5HGHA 2B5IB 3G6JE 4A6YH 1GCFA 3TJEL 5C0FB 2HWZL 3IXTB 2DRUA 25C8H 5DUPL 2XTJE 3DUSB 1P6AB 5TE6L 5I16B 1UG9A 2XZAH 2Y6SD 3D85B 2B4CH 3U79A 4O58L 4NQUA 3RL1A 2YKLH 4RRPA 1AGFB 3L3GA 2LVCA 4ONGL 5CILL 2GJ6D 4P0DA 2PXYD 1QKZH 5F70A 2XQYG 3K4ZA 3RWFB 5BCAA 3MACH 3F58L 4XCEA 1VCAA 2Q8BH 2Y25A 3O45A 2W65A 4N9GB 3DO7A 4K8RC 5FDWB 1GJIA 2OJZH 3U0PA 5HGDB 3VXUE 4MVBD 3GMQB 1XF2A 1MF2H 4YE4L 4LLYB 2GKIA 2ZSWA 4PJIE 2OI9B 1IQWL 4ZXBA 5F96H 4G7YL 2N4IA 4G8EB 3AXLB 3X14B 5KSAA 4P9HC 1X5FA 2EC9U 3O6FC 4OLXH 2GI7A 4MAYD 3UC0L 5IJVA 2VLLA 1FZKB 1SEBB 1NJ9B 1U93B 4PS4L 5J7CC 3OAZK 1XF4A 4PJCA 1M71A 4YX2H 1MPAL 5EN2A 4DOHB 5F9WB 5F7UA 3KPLB 4OBSA 1IBGL 1QG3A 1T1XB 5JA9A 4LCWA 4S1SH 4U3CA 4Y4KD 4UAOB 4QHUB 4Q9CA 3R1GL 4EKXA 1NMCC 5MHSE 5HDQH 5CLTA 3QT2A 4NZJA 3DLQR 3LQMA 5CKGA 4DAGH 3S37H 2P24A 1I1AB 4C83A 5C3LD 1TZHA 4CMHC 4HUNB 5E8OB 3IDIB 4AJ0A 3CLFH 1VGEH 5IVZB 4RGNE 5I1JH 2ZJSL 2OL3L 1OW0C 4MSWB 1F3DJ 4NQCE 1BZQK 2OTWB 3SDAB 2IFGA 5FEBA 3NA9L 4P2YA 1DFBL 1EUUA 5IGXH 5ALCL 3ARED 1CLOL 3MCKB 4MJIE 4BM7A 4JFEB 2NY6C 5IHLB 5DK0B 1KPRB 3T2NL 3T65B 1M7XA 3S98A 1S7WA 3EJZC 1EV2E 2OQJA 2FO4A 4NYLB 4U1LB 2NXZB 3SE9H 1U8IA 4N90D 5D4QA 5ECJE 3LKOB 2YD2A 1TJHL 3ARBA 4PRIA 4IJ3C 3A6CH 2ARJB 2FWOB 4JFOB 2VDOH 4M1DH 4CVXB 5ITBH 1JJUA 2FIRT 4XCNB 4HZLB 4MCZA 1WBXA 3WKML 2NZ9D 2EYTB 3H0TA 3QI9C 4GW1B 3TPUA 5IFJA 3O2VH 3GHBL 3MRJA 5I73B 1TFHA 2V7HA 3O8XD 4OLYH 5HHQB 1VB9A 3QHZL 4ELKB 4JG1H 3MV8D 3QFJB 2HFFB 3VXOA 1A0QL 1AP2B 2VLJE 3VI4E 1ZT7A 1F6AB 1MREH 3U7WH 1TQBC 1FL5A 3MFGB 4Y8DC 1KCRH 3KLHC 2X4SA 3RVTD 1FG2A 2BXZA 5TH2A 1QEWB 2QQLL 2IMNA 5B22A 2R0LH 4JO1L 1INDL 4H88L 5EWIL 2P48B 4OUUA 5F7HA 2PTTB 3QIUA 4YUEH 2AERT 5T3ZE 4P5TC 3ARBC 4I8DA 4XNMB 1S7VB 2HVJB 3ARDD 3BP4A 4HHAA 2G5BB 4OLVH 3O81A 2EC8A 3MBEB 1EAPA 2IPKB 1G7IB 5IF0B 2Q7YB 2VXTL 3RHWF 1UQSA 4KY1L 3TO2B 4HKXB 2OTUA 1YEIL 1OL0A 5ERWA 2FBJH 5HYFA 3PABB 5DT1L 3RVVC 3V8OA 2PYFA 2WV3A 5D1ZD 3UJIL 2IADA 1MQKH 4XMKL 2YPLB 3HG1D 2VWEE 4KVCL 2VJXA 5GGVL 5TQ2L 9CGTA 1QUNA 4JRYB 4O00A 5JHLH 4TVSa 4XNUH 4OZFB 3DTXB 3LKSB 4Z77A 2PF6A 5AYUL 1UFUA 3MNWA 1BFOA 3RDTD 1P7KB 3V7AE 1H3XA 5HHOA 4OCSH 1KLUB 3QG6A 2AKRA 4CVUA 4TUKL 5JQ6L 3KR3L 3VFGH 4JZOB 4URTB 4FOMA 1I8KB 2D0HA 3C8HA 4TNWF 4Z7NF 4NKIH 4WVRA 1RJLA 1YYMH 5IEHA 3FB6A 3HNSL 5FYLL 3TIEA 1C5BL 4ELMA 4HW6A 5I8OL 1B3JA 1CFTA 2YD6A 3VDBA 4Y4FA 3LS4H 5I15L 1DUYB 5FYKU 1MIEL 3SHSA 3UZEA 4PJBF 3GSVB 3P9LA 4YDJB 5FFLA 1P9MA 3OX8A 4RAUB 2HFGH 4U6XB 3QZWA 4QNPE 4LGSB 2DQTH 1JWSB 5TDPB 2ICEB 2XZCH 4JLRB 2PYEA 2X9YA 2XNAB 4LHUD 4RX4A 4QRQB 2X70B 5E1AA 4NZTL 2ERJB 4QOKB 3UTOA 3PJSA 3LQAC 2J88H 3QXTA 2DWDA 2JB5H 3R06B 1CWVA 1V05A 2DQHL 3EFFA 3O3BB 1JPSH 3WUWG 4WV1A 1JPGB 3RI5F 3ZL4H 3MA7A 1IM3B 1JHKL 3QRFM 1ZLVK 1H15A 5D2LF 5EU5A 3A0OA 4N0CD 5I2IA 3DSFL 1IEBB 1U58B 4CUCA 4DGYL 5T33L 3OXSB 4HFUH 4Y4FC 3PG2A 2VN4A 1EH9A 4M43L 3EYQC 2YC1A 3PWJB 3S96A 2D31A 3TO4A 4QRUB 2BERA 3ILQD 4W4NA 3KPSD 5BQ7A 1E4KC 4WWKA 2HMIC 4NN6C 2VR5A 1FZOA 1RZIB 4X4MA 4P4KB 1KCUL 1RFDH 3AS0A 3KPNB 2YA0A 5EUOA 3MJ7B 3EYFA 4XP1L 2ZZUT 5CJQH 3Q48A 4FQIL 5T1MB 3RTQC 1CGXA 4WUKH 3IU3A 2FO1A 1GVIA 1AD0B 1K3ZA 3CMOH 1Z9OA 3RKDC 4WFFE 3ULVE 3VFTA 1ZA3A 3V52H 1NANI 1P53A 3B5HA 1AGBB 4J4PD 2XZQH 4GXUN 4LBEB 2XACC 3MRHB 1BOGB 2NTFB 5BV7L 4NJAL 4WY7L 3GMLA 1U8JA 4AEFA 5T3ZH 2LV4A 1MRFH 1HWHB 3GSRA 1AR1C 3TO4C 1G7HB 3SPVB 1DBAL 4XCFL 1BF8A 1QR4A 1N5AA 4X7SL 3VXMD 2FIKB 3ZKNC 4OAWA 5IFHL 3MV8A 1AE6L 4XHJC 5IVXA 4GG6E 5EOQH 4HWNA 3BKJH 4LU5L 3L6FA 3MCLH 4QY8A 4XCYB 5DZOA 1I1FA 4HUVB 2XY1A 4IIQA 4LLDB 2FX7L 4XGZB 4GRLA 4LEXH 5GRVL 4GRMB 3W39B 5F6HI 1S5IH 1EFXD 3AY4A 5D7JB 4E0RB 1F3JA 3WNMA 1DVFB 1SJEA 3KHOA 4EXKA 3E0GA 4YBHA 1BAFH 2FZ3A 1H5BB 3T77A 1F3RB 3BZFB 4ZO6A 3P73B 4K7PL 1B9ZA 3MA9H 3VXNA 4QHMB 4D0CA 4KK5C 3N0PB 4PLOB 2FLBT 1UM4L 4LCIH 1NL0L 2ICWI 1WIUA 5FF6A 2YRLA 1ZLWK 4FG6D 1V7NL 3HZVA 2OK0L 1ZANH 4WDIB 3MO1B 2P5EE 4G3YH 4R3SB 4PJ9B 4JM2B 3BE1H 2YEZA 2VUYA 2G9HB 3T2OA 3ARGB 2N7BA 5CJ5A 2GEEA 2JB6A 3UEZA 2ADFL 4HK3J 3HZYA 1KTDA 3I85A 4Y19E 2Y06H 4G6JH 5CZKA 3REWB 1C1EH 3T0AA 1CD9B 5DK3A 3HN3A 1KCKA 3WDIA 4OM1H 1CFQA 2GK2A 5GZND 3OJDA 5B38G 1A7NH 2C26A 1MI5E 3V4VL 1R3IH 4HPYH 5FGSA 1A6ZA 5A16B 3BN9D 2EIZA 4LKXA 3QIWB 3MUZ1 3FQRA 4G6KL 2NLJA 4GAGL 3VRIA 4ODSH 1E4JA 5HHPB 2AW2A 4MXQD 4YGVB 3BIKB 1T04A 2IJ0C 4L9LA 4AK1A 5DD6B 1NCWH 3PL6D 5E8EB 3BYYA 2VAAB 1ACYL 2DTSA 4JFXB 4PJBB 3RWGB 3U6RB 2VTFA 2J8HA 2OL3A 4S1DC 1YN6B 5I76B 2AJ3A 2QEJA 1RULL 2JCCE 1UWXH 4P57B 1LD9A 1DEEA 3HUJE 1DL7H 2YA2A 3AM8C 1T66D 1G6RH 4R9HA 4Y5VC 5C0AA 1EMTL 3TA3D 4AEHL 4PY7B 2WWMD 1DLFL 2IAMB 4CN4A 5TDNA 1YA5A 1ZTXL 5AG8A 3U0TB 4I4WA 2QV2A 3GSWB 5D2LB 4YPGB 3QCVL 1G9EA 3B3IB 2H6PB 5DYOA 2H8PB 1I9RH 5GHWH 5J3HC 1WT5C 3P4LA 4B5EA 5GGRA 1QLEL 2D7MA 1SQ2N 2HJFA 4H25B 1IKNC 1T83A 3QEGL 4NIKB 2HVKB 1NC4B 3DXAD 2X4RB 2HT4D 1S78D 5HHVH 2W59A 1JNNL 3WFBH 2ZSVB 2MPAL 3SDXA 4O5LL 4O2CA 3V6BR 5L8KB 1NMAH 3VD3A 1I7RB 1RIHL 4PJHF 1R3HA 5FUOH 2Y36H 3WKNA 4F9LC 4PLKD 4XCCH 4PGCA 1JN6B 4JKWA 1YEEL 3QDJA 1KGCD 2EDHA 5DEZA 2IANA 4HPOH 4TYUA 5DQJB 1CICA 4JPKH 2NW3B 3ULUC 4HUMB 5HGHB 4JG0H 1MCOL 2HFEB 5I1EH 2E5EA 4HEME 3BKMH 1A7PH 3H6JA 1INQA 4GQ9H 1NDGA 3IDYC 4X7TA 3RX5A 5IROA 1AXSA 4E41A 2VISA 3FO2A 4PRNA 1MCPL 2Y9RT 3RL1B 2C1OA 4S11A 3L3GB 4FQLL 2ITCA 4HH9B 1IC1A 3VGDA 1U3HC 4K3EH 4ELMF 2GCYA 2ADJA 3M07A 3U4BL 3RIFK 2VH5H 1EFXA 2HAZA 3T0WA 4GMTL 2P7TB 1W72L 4XCEB 4QRSA 1U41A 3O45B 2W65B 3MROA 3U0PB 1S8DA 3I6LD 1YPZE 1IGFL 2D7QA 5F7EL 1XF2B 5BVJB 3UPRA 1IGML 1F8TL 3WO4C 3MXWH 3E8UH 5E95B 4PYGA 4ZXBB 5E70A 5KSAB 2ARJQ 4LLUB 4WJ5A 5FYJL 1P7QB 2P8MA 1AQKL 4RSVA 5EIVA 2VLLB 1U36A 3VXRD 1XF4B 5IT2H 1M71B 1NCAH 3C9NA 3MQIA 5F7DB 1FL3A 3MRFA 1UKSA 3TCXA 2X09A 4MZ2A 4NN5B 3QULA 5J1AB 4BFIB 3QEQE 4LCWB 1JNJA 4LSVL 1YYLL 4KRPB 1S3KL 5D7IE 4F33A 5IIEA 2IEPA 2P5WD 4Z0XA 2J3SA 1FYTA 4Y16D 1CL7I 5EIQA 3U9PL 4KKAC 5TE4H 1F00I 4C83B 1TZHB 3X3GL 3LRSB 5ICYA 5DRWA 5HI5D 3ARQA 5HD8D 4D0BB 2CR6A 5EUOF 4HBQA 3L5WA 1GPOL 1LO4L 4PB0L 3VU2A 4ORGB 2R0WH 3K81A 3FMGL 3LV3B 1ONQA 2OSLA 2WWKO 4OD3L 3SGEI 1F58L 1Z3GH 1P84J 2BNQD 1Z0NA 2HRPL 1S7WB 3IKKA 4EI6A 5I1KL 2OQJB 2FO4B 1I3VA 1U8IB 4NZUH 5SWZE 3C08L 4HX1A 1A6UH 2F53B 3SBWC 5C9KA 1RZJH 1X7QA 4N0YH 4PRIB 1EHLH 4I0PD 3D2UD 4HKJA 4OFIA 3W9DA 2XV6B 4HJ0D 4I18C 3BPLC 1DCLA 3SGJC 3UX9B 2FGZA 5KVEH 4KQ4H 3NPZB 4D9RD 2AJSH 5BS0D 4ISVB 4KXZH 4HGMA 1M7IA 3H0TB 4JFDD 3TPUB 1QVOA 5IFJB 3MRJB 3FFCE 2V7HB 4G9FE 4H0IA 1CXHA 3HI6H 4X5XA 2IQAB 5BRZB 1ZT7B 4MJ5A 2V2TA 2H32B 3ULVC 4RCAA 1FG2B 5TH2B 2D0GA 5C0CE 4X6CA 1FQ9C 2XQBH 3MBXH 4MLIA 4NFBA 4OUUB 4RMQA 3U4EB 4Z0BL 4XBGA 4FFWD 4RIRB 4LNVA 3QIUB 4O9HL 1BPVA 3OMZA 1YEKH 2QSQA 2UZIL 4QTHB 1ZEAH 5IR1A 3UROR 4HHAB 3CU1A 3MR9A 2J8UA 1KBGH 4P59H 1EAPB 3DECA 4UT7L 3D39E 1UQSB 4PJHB 1I9JL 4KK6D 4Q6IC 4W81A 3UO1L 2OTUB 5ERWB 1A1MA 1TMCB 5I1GH 2PYFB 1YNTB 2VXSH 3CDGA 2IADB 4HDIA 2IBBA 4N8PA 3V6OE 1XZ0A 4WTZG 1WAAE 3R0MA 4ZG1A 4NQSA 1T1ZA 4IMLA 5I8KH 2ZWLT 4TUJB 4EZMA 3D1MC 3HC4H 4JO4H 5T1KD 4HLJA 4I0CC 2FH8A 5L6YH 1L0YA 1KT2B 4RBPH 1J1PH 3MLZL 2ED9A 3L5HA 1L4IA 4GKOA 3MNWB 1BFOB 2DL2A 2C5DC 2PO6D 1U8QB 5HHOB 5GRUL 2W0FA 3T3PE 2AKRB 2OR7A 2GJ6B 2PXYB 4NRZA 4LHJB 5EUKA 3QUKA 4TSBH 2AI0H 1NAKH 5ESQA 4M3KB 2V7NA 4UNUA 4Q97A 1RJLB 2VUOA 4NKDA 5GZOD 2HT2D 5FCUH 3FB6B 4Y4HA 4J3UA 3H9YA 3TIEB 3LY6A 2R8SL 4OIBA 4ELMB 4PJ5E 2APVA 2EDTA 4YC2B 3ZYOA 4P3CH 2NW2B 4MA3A 4LPUA 4NKOA 2CD0A 4YBQD 1KV3A 3NFSH 3PP3H 3V5HA 3P9LB 1NBQA 4G8IB 1NGQH 4OLZH 5D7SL 3OX8B 3EOTL 1VESA 1AGCB 5IFAH 2ICWB 4YWGL 2R29L 5F9JA 3GMNA 1UZ6E 3BQUD 3TVMC 1KLFA 2GTWB 3IAPA 4MA7L 3DNKA 4WENB 4F37F 1T6VN 2FH6A 2DWDB 2OX5A 2X89D 1EO7A 1Q9KA 2X4UA 4UIKH 4WHYH 1X5YA 2K3TA 2N1KA 3EFFB 4XC3H 3OKOA 1DTUA 3MA7B 4Y4KB 1H15B 4C56E 1KEGH 4CN1A 1F13A 5EU5B 3L3OA 5L9DL 4P23A 5I2IB 4QT5A 4LASH 5I74C 2Q7NA 2AJYH 4NQXA 2ESVA 4LAQH 2NY4C 5IMKB 3NCFB 5EU6E 1V7MH 4WCYL 1ZK9A 1N59A 2YC1B 3CX2A 4NCDA 1F4XL 4FQJL 1NSNH 1CGSL 4PJEE 2Q1EA 4YDLC 3KPOB 3NIGE 1A1NA 4WWKB 3E1F1 2CLVA 1FZOB 1ZVSB 1DUZA 3O2WL 4F58L 5IKCA 4ZUVB 1N5YL 4M7LT 1BF2A 5EUOB 5E2JA 3CDFA 2CIIA 2XXCB 3IU3B 5FK9B 4XP9L 2OR9H 5D72H 1CGUA 2GTZA 3HZMA 4BFBD 2E7MA 1ZA3B 1QYGL 4WHCA 1S7SA 1OT1A 3NZHL 2G60H 4LVNC 2KL6A 5DC9B 2I5YH 5T3XE 3SQOH 1FVDA 3GMLB 3HNVH 43CAB 3C60C 2XFXA 5ENWA 4Z7UF 5BS0A 2CKBL 2UZXB 3GSRB 3D0VA 4JFDA 4XVSH 5C07E 4QTIL 3UDWC 4JDVA 2FB4L 5HYSA 2B0SH 4U1KA 3MV8B 4PJDE 4PJ8A 1PKQE 4A6YL 3O6FD 1MAMH 4U6TA 2VL5A 3U36A 25C8L 3LIZH 4KH2A 5SWQA 4LDEB 1IGYA 3V5DB 5EZLA 4IIQB 2I24N 2VNCA 4GRLB 1X6NA 1WITA 3WS6C 2XZAL 2B4CL 4M93B 2E9BA 2YKLL 1F3JB 1QRNE 4PRHD 1X5JA 1SJEB 2IH1A 4RGOH 1QKZL 2VLME 4HMCA 4LPXA 2BOCA 4EXPX 3MACL 5KN5B 4WI8A 4YZFE 5H8DA 1MCLA 1OGAD 2NXYB 1W72A 2Q8BL 4Y5XC 4D0CB 5EO9B 5TE7H 2OJZL 4H1LB 1G7PA 4EIGB 4U1HA 5HHMD 1EEYB 3S5LA 5KVFH 2PUQT 3H7LA 3HG1B 3HZVB 4DGIL 2F19H 5EDXA 1MF2L 2FX8H 3MC0A 4D9QE 5J6HA 5IM7A 1CU4H 5F96L 4RZCA 4J7RA 1TPXC 2JB6B 3E2HB 2WLZA 3HZYB 4OCMC 2AXHA 3RWIA 3EZ8A 2VLKE 2WANA 3WE6A 2LTQB 1BD2A 5CLWA 4MB4A 3EJZD 1Q0YL 4YX2L 5SV3A 5EH1A 1CFQB 5CD5C 3BO8B 5I1DA 3OJDB 2V5RA 4LDOB 2X4OB 3UP1A 3VFRA 4S1SL 5K9QI 1A6ZB 4J3VA 4JZJC 2EIZB 3IRZA 4LKXB 1RK1A 4TVPH 3FQRB 5TJWK 1JVKA 4DWHA 5HDQL 2ED8A 1ZAGA 3AU1A 4TPRH 1A6TA 1NGWA 4DAGL 1PG7H 3G08A 5BZWB 3S37L 5T1DH 2NZIA 3QI9D 1UH4A 5C0DA 3LKNA 1M1SA 5IQ9A 3CLFL 1VGEL 4GKNB 5GGTH 1ZWIB 5I1JL 5CJXA 4MJ6A 1QSEE 2KDGA 4LHUB 4UTAL 2OL3B 1T7WA 1L9NA 1WFTA 1ZSDA 3LN5A 4KTEH 4FXKA 5D9SB 3VH8A 3KLHD 1FLTX 2X89A 5IGXL 5F6IB 3IVKA 4PFEA 4XZUB 1J1XH 2MOVA 1E6JL 4G6AC 4P5TD 1AGEB 4TNVF 3SE9L 3U2SA 4DFHA 3BWUC 4I4WB 1ND0A 4J6RH 5SWSA 2BNRA 4XNZC 4X99B 1RU9H 3A6CL 1IKFH 4NWTH 2VDOL 5CINH 3ELAT 4M1DL 5ITBL 4HLZH 4L8DB 4QRTA 2A6IA 4QWWC 4K71C 4X6CF 3KPSB 4FRWA 4H0GA 4HMEA 2A9MH 2MFNA 2E8ZA 2UYLA 2FLRT 2WNGA 3FTGB 3PE9A 3O2VL 5E9DA 5EIIA 4OLYL 5IMMA 3WMSA 4KKCC 4NQDD 2J8UF 3PQYE 1MREL 1MVFA 3U7WL 4O2CB 5IB1A 4MMXC 5LGJB 1KCRL 4YQXH 1WBYA 4JKMA 4NJ9H 1BFSA 2J12B 4LPCA 1R3HB 3L5JA 2R0LL 1OSZA 4OF5A 4L4VA 4RMVA 4PGCB 4HS3B 2WM0A 4RAVA 4UT6H 5ANMB 2YD1A 2ARWA 2IANB 2AK4E 3GBLA 4YUEL 4K7PX 4YHPA 3KPQA 3IKCA 4OLVL 4ONHA 3U7AA 5HYJE 1IGIH 5ICZA 3ROLB 4BH8A 1TJIH 4NUGH 2FEDC 4P2RD 3VXMB 1NDGB 4X7TB 3MXVH 1AXSB 4E41B 2FBJL 2VISB 4Z7UB 4PP2A 1KNOA 4DFIA 1MCDA 5F1NA 1E27B 1OTUC 1YC8A 2FJHB 3LN4A 4MQXC 1W2KT 5J6GA 1YN7B 1MQKL 1PW3A 2C1OB 1VDGA 4BQCA 1AIFA 1XGUA 3U82B 2ITCB 3CX5K 1NAMB 1PFCA 2AJZB 5LGHH 5JHLL 1ZVYA 2GCYB 2ADJB 4XNUL 4U1NA 4OCNC 4OFVA 3FT4B 1EFXB 1YZZA 3BI9X 5L88H 1H8OA 4U6YA 4QRPE 2PN5A 3K8KA 5FO9A 3U9UB 3OWEA 4U6VH 3MROB 3VFGL 3V6OC 4XB7A 1LE5A 4NKIL 3UPRB 1YYML 3NA4A 5EZJA 3GJFA 4UNTA 2EDJA 4C58B 2QQNH 4XAWH 2UUDK 3NIDE 1FNAA 2PW2A 2EDQA 4WJ5B 2P8MB 2VDMH 3LS4L 2GITA 3QWRD 1O7VA 1AC6A 1U95A 5DZLA 3TT1H 1QTYT 5ID0B 2HFGL 2EDEA 3C9NB 3O3DA 1FL3B 3WJJA 2DQTL 1RJZA 1LILA 4ZOAA 3QULB 2XZCL 3RTQD 1DR9A 5BZDA 3W82A 1PQZA 4X7FC 5EO0A 2B7DT 3RKDD 4Z0XB 2J88L 2JB5L 4NQED 4FXGA 3B6SA 1CDIA 4PV9A 1IC5H 5E6IA 1JPSL 3O3EB 4OZFH 3O9WC 3ZL4L 5CIPA 5ICYB 1CD1A 1B6DA 3I3BA 2BOBA 4Z6AT 4PJ7E 4KKLC 1YQVH 4RDQG 4MHHG 3EOAB 3L5WB 3WFHA 4HFUL 4CW1A 3MJ8B 4F57H 5B39B 1U8NA 4L4TE 3I3DA 4X5LA 2X5PA 4AY0A 5I6XB 2OSLB 1UM5H 1FO0B 3I6KA 3HE6A 5JO5A 2H9GA 3FB7A 4XHJD 2DOCA 2XOTA 3GSXA 1F11B 1EZVY 5AUMA 4EI6B 5B3JF 2Z31D 1RFDL 2PKDA 2CGRH 4JE4B 4HX1B 1QO3B 5CJQL 3O6KH 3CVIH 4WUKL 4Y1AA 5IG7A 4G6FD 2EO9A 1VGKA 2CDGA 1MAJA 3DPBA 1KN2H 4IHOA 3CMOL 3LQZB 4HKJB 5E00A 1XFPA 3W9DB 5MENE 2VC2H 1KG0A 3V52L 3O4LA 4ZSOE 1KPVA 1QVOB 1BVLA 1QOKA 2XZQL 2BCKA 2XTJD 4UDTA 1TXKA 5AEAA 2D7NA 3RJDA 1KIQA 2D4DA 4KK5D 5T3ZL 4X5XB 5BV7B 3HRPA 3VXTA 1MRFL 4MCYB 4NNXA 4MJ5B 2V2TB 2CKBA 1AHWC 3DXAB 5I1CH 4X9GA 4RFNC 4X6CB 4LSUH 2NY5H 3D69B 2YD9A 3QEUA 2VR4A 3NPSB 4XBGB 1HN1A 2O93L 4PRPE 2HTKC 5EOQL 5T5FH 4BYHA 4A6YA 1NUDA 1YY9D 5IR1B 3BKJL 3MR9B 3VXUD 2J8UB 3MCLL 4X6DA 3IFOA 3SDDC 4AQ1B 3L3JA 4LEXL 3PV6A 3SKOB 3DUHA 3VCLA 5D1QC 5ICXB 1S5IL 3MJ6A 3L1OH 5FB8A 5F9OH 3VA2C 1A1MB 4JFPA 3VMNA 5ISZD 5DVNA 4I5BA 4KK8D 4P5MA 1BAFL 3CDGB 4HDIB 5GIRA 3IDJB 1XZ0B 5D1XC 4PGBA 1WICA 2H3NA 4NQSB 3FONA 4GRWE 1T1ZB 3MA9L 4LLVB 2P49B 4C4KT 1KJ3H 4LCIL 4LARH 3RUGA 1ZANL 2KZWA 4WI4A 2EDNA 4G3YL 1DQQB 1BX2A 5MHSD 4S1DD 3BE1L 3IGAA 4NRZB 5EUKB 5ESQB 4U2ZA 3ZDXE 4NKDB 5FM5O 3OXRA 2Y06L 4G6JL 1CDJA 4YDKH 1C1EL 4GMSH 4RGND 4LF3A 4MA3B 2X9WA 4OM1L 4NKOB 5HYQB 4NQCD 3QQ3A 5E8NA 3V5HB 3RJQB 4K3HA 3ISWA 1KIRB 1A7NL 5JXEC 3T0EA 1R3IL 4HPYL 5DJAB 3LHPH 2A2QT 3QNZA 1ZHNA 4ODSL 5J3HD 5F9JB 1MJJA 4WTWA 4S0TD 5JOEA 2V5YA 3RPIA 1ZA6B 5GS1A 1NCWL 3AVEA 1WUNT 1Q9KB 2X4UB 3OZ9H 3R8BB 1JP5A 4JFFE 3GKZA 3TBSB 2VXQH 1NGYA 2DLTA 4HAFA 4P2QA 4YFEA 4F7EA 3BGFB 3ECBA 3IJSB 3MV7E 1FSKB 3HCVA 3L3OB 4P23B 5JR1H 1ZGLA 4QT5B 4Y16B 4FQQB 5DXWA 3V7MA 3K0WA 1DL7L 2HLFC 3KGRA 1G6RL 2PETA 4NQXB 2ESVB 1LO5A 1H3WM 3I50H 4LMQE 5K9OA 3ULUD 1FFQA 1L7TH 2VLJD 4ZD3H 3D9AH 1J8HE 4PGEB 1O0VA 2HJKA 2IH3A 2XZZA 5IWLA 1P4LA 2EC9T 3ETBF 4CL7A 2LVEA 5GS1C 1E4WH 1I9RL 5I1IH 2A6JA 4NZRH 5GHWL 4QHNA 2CIIB 4K94H 1P6FA 5T3ZD 2DQDH 1HWGB 3VWKA 1S5HB 2GTZB 3HZMB 3G5YA 2J6EH 1XF5A 5C09A 1U3HD 1S7SB 1JZ7A 4U31A 5HHVL 4I9WE 1D7FA 3FCTA 3WFBL 4I0PB 3WNPA 4TUOA 4IMKA 1NMAL 1TENA 3G6JA 1FVDB 3OF6D 2G2RA 2XFXB 5FUOL 1ZV5A 4JPIA 2Y36L 5BS0B 4XCCL 2ENSA 1JGDB 3D0VB 1B0GA 4JFDB 4FXLA 2JELH 1B4RA 4LSQH 1NEZA 1K6QH 2EXWC 3GRWH 1HHGA 3QYCA 4HPOL 4JDVB 4N0FA 4JPKL 3VXSD 4U1KB 2K1MA 4JG0L 2C7UA 3MZGB 5I1EL 1GC1C 1NKRA 1P84K 1KXQE 1A7PL 5C7XH 5T5NG 2VL5B 2MKWA 4V1DE 4GQ9L 5SWQB 5GS2H 2VDQH 5JHDD 1MFDH 2X1QA 1C5DA 4U1JA 1R3KA 3DBXA 1KULA 3EDEA 4P9MH 4FTVA 3REVA 5GISH 4H20H 2JJSA 3VXUA 2IH1B 4QYOA 2Q76A 1JGEA 4K3EL 2HA1A 4TRPH 2B1HL 3QO1A 4LQFH 4PJAA 4PJIA 1RUAH 2VH5L 1FH5H 1F42A 4KKAD 5BOPA 3RWCA 3MYZA 4CKVX 5FUCC 1W72B 1EEZA 2ICCA 3IF1A 1G7PB 2DKMA 2W0LA 3S5LB 4IDJH 5DO2C 2DDQH 2P1YA 2J1KA 5EU4A 2YUVA 4O2EA 3DMMA 2BNUA 3MXWL 4KTDH 4GXVH 5J6HB 3E8UL 3PGCA 4RZCB 5DFVC 4K9EH 5JNYA 5J0BA 2PO6B 3GEWB 2Q8AH 3RWIB 1S7TA 2XYCA 1RZ8A 1IGTB 1PY4A 3FOLB 4DN4H 1NC2A 5IT2L 1V5JA 2X44D 2BVEA 1NCAL 3QH3A 2JJSC 2PNDA 5IV2A 2IC2A 2B2XH 4DQOH 3VFRB 3FO1A 3HB3C 4IRZH 1RK1B 2B39A 4JO2H 2JTDA 3TZVA 1I8IA 3AU1B 3P9MB 4H5SA 4POZD 5HGBB 2Y5TA 1G9NC 4MNQE 3G08B 5TE4L 2EKJA 4S2SA 3RWEA 3PGFH 1FYHB 3LKNB 4MJIA 3I9GH 1KUMA 4X6BA 3SEPA 5IQ9B 1NMBH 1FFPA 3LSOA 3DETD 4MJ6B 5BJTA 1Y6MR 3B8YA 1TQCB 5KW9H 3BQUB 2OP4H 4L8BA 1CYGA 1IZJA 1CTNA 1N8ZB 4HS6A 2R0WL 3ULVD 4FXKB 1XGYH 4LPYA 3MRNA 3WN5B 4R2GB 3IVKB 4XWOC 3U1SL 4IRSA 3OJVC 3DRTA 1Z3GL 4NHCH 5K33A 1R0AL 4F7PB 4IBLT 4HIHA 4E5XB 1AKJA 3FB5B 4RA3A 1CE6B 4E42A 3U2SB 4NZUL 1ND0B 2QHRH 1Q1JH 3TZVC 1A4KA 2BNRB 3V4UH 3VFVA 1A6UL 1RZJL 4N0YL 1EHLL 4LSPH 1CLZH 3O3UN 3BIBX 5DD1H 5C0JB 3MRIA 5KVEL 1QSFD 2BK8A 2UYLB 4KQ4L 2AJSL 2VQ1A 3GK8H 3L7EA 1R3JA 2HH0H 4KHTH 4ZNCD 5EIIB 4Y0GA 3UPCA 3DWTA 5JMRA 4FQHA 5CJ8A 3RKPA 4Z7OF 3OR6B 2AJXH 3HI6L 4X6DF 3GO1H 4KV5F 1ACZA 5E6YA 5IB1B 4IRSC 3EUUA 2DTMH 3ZKMD 1T6WA 3ARFA 1RURH 1OSZB 1PLGH 3MFFB 4L4VB 2XQBL 3MBXL 2DIAA 4RAVB 5CBEA 1RJCA 4DEPC 1YEKL 3B9KC 5I19H 4YHPB 1ZEAL 3OG4B 3KPQB 3IKCB 4M00A 1RZKC 5FHBH 2A6KA 5C71A 1KBGL 5ICZB 1G7QA 2P5ED 4P59L 4BH8B 1OP9A 2YHGA 3W81A 3PDDA 4HCRH 4DTGH 4RRPG 4XTRD 2DAVA 3PWUA 3ZDYF 4F9PA 2XRAH 1NFDE 4PP2B 1KNOB 3MRRA 5ILTH 1TVDA 5F1NB 5I1GL 1CT8B 1X5KA 2VXSL 3BJLA 3LN4B 1ZOXA 3ESVF 3JWDH 4WUUE 3BPOB 3TVMD 3VJ6A 1XGUB 1TTGA 3LB6D 3HFMH 5I8KL 4U1NB 2RCSH 4JO4L 3P3YA 3P0YH 1GRWA 4BQ9A 1MI5D 5L6YL 1UWEH 1J1PL 2VOTA 1I3RA 3KPMB 3QDMA 1K3IA 5FO9B 1MAKA 1EVTC 2AV1B 4X98A 2H32H 2R69H 4TSBL 2AI0L 4F3FA 1NAKL 5F8RC 1LE5B 5FCUL 1YECH 2NY4D 1XEDA 3S37X 1U8KA 4P3CL 4XI5D 5HHMB 2GITB 1Z9SA 3NFSL 3DX8A 1U95B 2JKXA 1X44A 2AS5M 3NIFF 1NGQL 1FJ1B 1S7XA 4OLZL 3WIIH 4M7ZB 4DJMA 3SOBH 1MCWM 5IFAL 2VDPH 3O3DB 3RP1A 1UT9A 4S0SD 1MHEB 4Y2OA 1RJZB 3CUPA 1HEZB 5E24E 1CG9A 5BZDB 4MB3A 4Q74A 4LCCA 1PQZB 3BP5B 3F65A 4Z7VE 5EO0B 3VGBA 3LD8C 5KVGH 4UIKL 1AGDA 3IU4H 4FXGB 3B6SB 5C8JB 4PV9B 4XC3L 5E6IB 2P44B 3CSGA 1JFQH 1KEGL 4KZEH 2AQ1A 1J7VR 1CTOA 3UTPE 2YSSA 1NDMB 5D7LE 4S1RH 4YK4B 3C60D 1N6VA 3WFHB 4LASL 4FFVC 4CW1B 2AJYL 4YGAB 5KSVA 3QI9B 4LAQL 5HGGS 1U8NB 1G6RA 3VRLF 1V7ML 4JGMA 4L3EE 5I0ZA 2YD5A 3I6KB 2QBWA 1TZIA 4N8CH 3SKNA 3HE6B 2WBKA 5JO5B 2BVPA 3IAQA 2H9GB 1NSNL 2B8OT 3FB7B 3GUTB 2H2SC 3GSXB 3RZCA 3BD3A 1CR9H 1FGVH 3RNQA 4PV8B 5AUMB 1L6XA 1BEYH 3G6JF 2WBJC 1WWBX 2CSPA 2X40A 5IK3A 3JV5A 5IG7B 2A83A 5IW6A 1VGKB 2CDGB 5FGCB 2OR9L 5D72L 2Z91A 2V2XA 2M2DA 2BMKA 2GT9A 4PGDA 4TOYL 5CHNA 3O4LB 1KPVB 1WJ3A 1BVLB 2G60L 5I1AA 2BCKB 4EEEA 2I5YL 3ESUF 3SQOL 4GG6A 1KIQB 3HNVL 1UB5A 1U8HB 4HF5H 4BZ2H 5A2KH 5E08H 3VXTB 4NNXB 3GJFK 2CKBB 4XVSL 4XPTH 1K8IA 3SJVA 5L8LB 2B0SL 1EHAA 4KJYA 5JXAH 5CEXA 3QEUB 1AO7D 3X12A 3PWNB 2CUMA 1HHJA 4PJAF 4EI5C 4PJIF 1MAML 3BJ91 3LIZL 3NGBC 4X6DB 4OGAC 1WLHA 3IFOB 1KLGA 3QP3A 3QAZC 3L3JB 3U0WH 3PV6B 4JN2A 3VCLB 3EO9H 3MRDA 3X17A 3P0VH 2J4WH 2F5AH 4JFPB 2C4FU 4JRXE 3PNWB 3L3HA 4I5BB 1SJHA 4RGOL 4P5MB 1UB6A 5GIRB 4ZOBA 3QPXH 3KYMA 4P2RB 1CBVH 4PGBB 2XG4A 4ZODA 2XQYK 1UA6H 2HRLA 3B8SA 5TE7L 3M1BB 3S97C 5J11B 4Y19A 4G9DA 3QEQD 5KVFL 5DJ6A 8FABA 3OKKA 3B9AA 2F19L 2RQ8A 2FX8L 1BX2B 2NY2C 1HSAB 1CCZA 1CU4L 3P4MA 1CXEA 2J5LC 2Y5EA 2DYPD 3BVNA 1SMAA 4JCLA 1S9VB 3OXRB 5IBUB 4KZDH 4YHYB 4XC1H 3KWWA 3JTTB 1GAFH 2J7LA 1H8SA 4YDIH 3QIBA 4Q9QH 2QADC 3QZWG 3PWLA 5K9KA 2XWBA 3QQ3B 4DUXA 1P5VA 3T0EB 3GI9H 4QGYA 3LEYH 4HZAA 4J3SA 4TVPL 2HLAA 2VLRD 5CMAA 3V8CA 3QNZB 5L0QC 1MJJB 4QWWD 4Z9KB 3RPIB 4TPRL 4R0LC 2R1XB 3JWOH 3SO3C 1PG7L 5T1DL 2ZG3A 1LP9E 5SWZD 4LGPB 2R2BA 4O4YH 5GGTL 4JAMA 3WDJA 2D7OA 1NGYB 5E8DH 3WEXA 2CRZA 4F7EB 3ECBB 5I66A 4H1LH 5T1LA 3HCVB 4R7DA 1HNFA 4OFYD 4W70A 4QHLA 1KTLA 1ZGLB 4KTEL 1ADQH 2XG5A 3LPFA 3VI4F 1RUPH 2AP2A 1J1XL 1LO5B 4KPHH 1T2QH 4G9FD 1HYSC 2DBJA 2G75A 5DJ2A 2E7LA 1GZQA 3H9SE 5MERB 1C7TA 5CZXC 2EEAA 1L9MA 4J6RL 2HTLD 3Q1SH 4JVPA 3BMVA 4RFEA 1DBJH 2VQUA 3CFIC 5J13B 2HJKB 2IH3B 1RU9L 1P4LB 2FEDD 5C0CD 4ZYKA 1IKFL 4NWTL 5CINL 4QHNB 5EBWA 4Y2DD 4QRRE 2A9ML 4RWHA 1OTUD 4MQXD 1K2DB 4MJ4A 1MUJB 3VWKB 2Z31B 3ZTJH 4RA0C 4Z7WA 3N85H 1XF5B 3UTSE 1MHCA 1BVZA 3LKPA 4I0KA 4JQXC 3NABH 1G84A 3VWJC 4PG2A 4YHLH 1JI1A 1FZMA 2AEWA 4GAYA 3G6JB 4YQXL 2G2RB 4P46D 3FQNA 4MLSA 5DJXA 1JHLH 1B0GB 2AABH 4UT6L 2XTJB 3GM8A 3UJJH 1NEZB 1HHGB 1RPQA 4N0FB 5EU7E 3LDBB 4NSKB 3QJHA 4N0UE 1RZJC 1NLBH 2C7UB 3TFKD 1CL7H 1IGIL 3PUCA 1J5OH 3FRUB 3T4YA 1TJIL 1UEYA 4NUGL 5F1OB 5GS0C 2ADGA 3MXVL 4IOSD 4PR5A 1V3MA 2MCPH 4OJFH 1C5DB 2D4FA 3G5XA 4G80B 4U1JB 3DBXB 1WF5A 2PR4H 4AEIH 4ZOEA 3WNLA 4KWUA 3TJHC 3REVB 1BGXH 4PJ5D 3X3FL 1JHTA 5K93A 2LU7A 1GOHA 4QNPF 5MP6H 3VXUB 4QYOB 5C6WH 4CJ1A 5LGHL 1JGEB 3SGEH 3QO1B 3HTLX 4PJAB 4PJIB 4FQXC 4Q0XH 3P40A 1A22B 5L88L 2DKUA 3RWCB 4N9OB 3O9WD 1K5NA 1I7UA 4FS0A 4U6VL 5KAQF 3JXAA 4M02A 2VXUH 5CEYA 5F3HA 1FNLA 3CFDB 4O2EB 3DMMB 2BNUB 4L4JA 5ESAA 1T0NA 3PGCB 3RU8H 2QQNL 3K1KC 2UWEE 4XAWL 3BKYH 5JNYB 2MQ0A 5D7KD 5DMIH 1JZ3A 2VDML 3C09B 4PUBH 5D7IA 3GMMA 1RZ8B 1Z9MA 4WI7A 5D6CB 3TT1L 3BEWB 4AH2A 3QUYD 3ARSA 1NC2B 1HCFX 1K4CA 4X0KB 4C4KO 3QH3B 4S1QH 2MNUA 5IV2B 1JPST 3OR7A 3SGKC 3G04A 2NY0D 2MHAA 4RGNB 2F9BT 1J87A 4NQCB 3RVXC 3BMWA 3ROOA 1I8IB 4H5SB 2Y5TB 1Q9LB 1NAMH 2CR3A 1IC5L 1KGCE 1Y18A 1ZHKA 4JFZH 3VFSB 5IESH 3RWEB 5J1SC 4XMLH 1CE1H 2CRIA 4MJIB 4X6BB 1T2JA 1CS6A 4MNGA 3ZMRA 1YQVL 4W6XB 5BJTB 3THMH 4L8BB 5FKAA 4F57L 5AAMA 3CDCA 3CSPA 4HC1H 4KVNH 1ZGLP 3EO1A 3DIFB 5BXFA 3GMOA 1UM5L 4KXZI 3DRTB 2HN7A 5HPOA 1HHHB 2QQKH 5T3XD 5GS3A 1AKJB 4OI8A 2HTKD 1BIIA 2XXMB 1CK0L 5HI3C 5JW5A 4MA8H 1B0RA 1A3LH 1G9MC 4E42B 2CGRL 4GG6F 3SDDD 1PEZA 3K80A 1LO2H 3O6KL 3FFCA 3CVIL 4M6NH 5C07D 2WQ8A 3CC5B 5D1QD 4EUPH 1IAOB 1KN2L 3BPNB 1T5XA 3MRCA 5C0NC 2VLJB 2X4TA 2VC2L 2VQ1B 1UJ3C 1R3JB 2LAAA 5MEQA 1MCWW 2I60H 1YEJH 5D1XD 1C8PA 3OL2A 1VENA 4A2MA 4BELD 4FQHB 3QDGA 4YIQA 1KJVA 2EECA 3HPJA 5L2KA 5F88A 3HPLB 4BSVB 2DQJH 1NEUA 3SGDI 3VXRE 5I1CL 4HWZA 1VEPA 3ARFB 3ALXA 4LSUL 3D39A 2NY5L 4OKDA 3V6FB 3VXPB 4MD4B 1B2WL 5D2NC 5T5FL 2DL9A 4P46A 4MWFB 2A6KB 1WAAA 1YJDC 1A7OH 1G7QB 5EBMB 3S8WA 1OTSC 1FVEA 1DBKH 1JBJA 5JXED 3L1OL 3LEVH 3PWUB 5F9OL 1NFKA 3PXJA 3MRRB 2EYRB 2XIDA 3MV01 5HHNA 5FAAA 2GFBA 3HAEH 5IMOA 3VJ6B 3C8KB 4EDWH 1YMME 3NCYS 3G6AA 1GSMA 3SKMA 1S9KC 1A64A 3VFWB 3EIFA 1J9CT 1KJ3L 4CJ0A 4ZNEE 4ONFH 4LARL 1LHZA 4HMDA 3W0WA 1EBAA 1I3RB 1J0IA 4ACPA 4YXKH 2JF1A 5E2TH 3T3ME 3DURA 2E27H 1EJOH 1P4BH 4XPBH 2AJVH 5IQ7H 2Z93A 4X98B 4WU5A 5FGBC 4F3FB 4NP4H 1HCVA 2VIRA 3ZE1E 5HVHB 2HLFD 1ZLVH 2Q86A 4I77H 2H2PD 1Z5LA 4M7JH 2JCCF 1FPTH 4YDKL 3FO9A 1QSED 3CFJA 5C0FA 3DX8B 4D9RE 1HQ4A 1WBZB 1S7XB 1H3VA 3BDYH 2FEEL 3S4SB 4P5KA 1ERNA 1VADA 2D3VA 3LHPL 2BRRH 4CDHA 4C56A 2FECL 3V2AR 5DMKB 5JW4N 4N8VB 4A2LA 3IFLH 4OD1H 4LCCB 3RPKA 3V79C 2D7TH 5HVGB 5CSGA 5KSBE 1CDYA 3OZ9L 3ARRA 1AGDB 5DJYB 2OS7A 5EU6A 2VXQL 5GGTA 4BFGA 2ATPA 4RMUA 1H9VA 1EO8L 4N9GA 2LQRA 1D5BA 4FFZH 4YHZH 5JR1L 2YSSB 1GOFA 1UH2A 4YXLH 2B5IC 3BXNB 3GMQA 1EK3A 1LO3H 3HZKA 5KSVB 5CZVH 1G6RB 4G8EA 2EXWD 3I50L 4UOW1 1TZIB 4Z7WF 4H0HB 2R2EB 1L7TL 1OWWA 3MLVH 5JUEH 5IVOA 3PQYD 4GLRH 4ZD3L 4BK4A 1FZKA 3D9AL 1G7MA 1JIBA 3RZCB 5EO1B 3RNQB 1JZ8A 3PHOA 2XKNA 1E4WL 5I1IL 4NZRL 3JVGA 3KPLA 1T1XA 4K94L 4KJQC 3M8OH 1UJTA 2AK4D 2A83B 1DDHA 5IW6B 2DQDL 3X13B 3SCMD 2Z91B 2C3HA 1UCTA 1ED3A 4PGDB 1OQXA 5HYJD 2J6EL 1I85C 1OP5H 3DI2B 2A38A 1IM9D 1I1AA 4FQCH 4JR9H 5E8OA 1PYWA 5I1AB 2IGFH 4Q6IB 3IDIA 2OI9C 5IVZA 12E8H 4GG6B 1C16A 3X11B 1UB5B 3C6LA 1B0WA 2OTWA 5IHUL 4J3WA 3WNNA 4Z7NE 2JELL 4NUJB 1K8IB 3SJVB 1FC2D 4LSQL 1K6QL 1BBJB 3GRWL 5DTFA 5FA4B 3EO0A 1B6UA 1D6EA 5CD3A 4KJYB 4JFEA 5DFVD 1WIOA 1ZLWH 3X12B 1DQLH 1QRNA 3JVGC 2C3GA 3H8NA 3T65A 5C7XL 1BFTA 3TNNB 1NBZB 4P2OD 3F7QA 4NYLA 2YN3A 1EEUA 2JIXA 2VDQL 4UAOC 1MFDL 4IOFD 5H94B 3KPPB 1N0LA 3LKOA 3FT3A 4OSUH 4JN2B 4JKLA 4P9ML 4R4ND 1IC4H 3MRDB 5EU7C 5GISL 3DX6A 4H20L 4JFOA 2P42B 2CIKB 1I1AC 4OF0A 4XCNA 4HWBH 4HZLA 3RY5A 3MJ9H 4LRIA 2P5EB 4TRPL 5JLZA 4H8WC 3MLWH 4LQFL 3RA7H 2EH8H 2EYTA 3QISA 1RUAL 4GW1A 1LDSA 1FH5L 3SDAC 1JWMB 5D7IF 5GRJH 3QXWA 1MRCH 3V6ZA 5HHQA 4ELKA 5EC1A 4Y88A 4Y19B 4G9DB 2HFFA 1B4JH 1F6AA 2VLKA 3WNOA 1NGPH 5DJ6B 4IDJL 3OKKB 2DDQL 1I3GH 1JV5B 2GY7B 3TVMB 1FE8H 2YBRA 2ZCLH 4J12A 4KTDL 4GXVL 2OM5A 1A7BA 3P4MB 5KG9B 4K9EL 2NXZC 1MI5B 5D5ME 3VW3H 3BVNB 2Q8AL 4WGWB 4YO0A 4XNMA 1S7VA 3KWWB 3G5VA 3VG0H 1XGQA 4DN4L 3QIBB 5K9KB 3U46A 3ZDZE 3EFDH 2FHFA 2XWBB 3Q2CA 2Q7YA 4LRIC 2NY4B 2B2XL 4UI2A 4DQOL 5JORB 2XN9D 4PP1C 4IRZL 5I73C 4JO2L 3PABA 2HLAB 5CMAB 5LAXA 4O2FA 5C0BA 1XH3A 4NT6B 1YMHB 1JTPA 4WO4A 2YPLA 5DJ8B 3LS5H 2R39A 2JCCB 1OAXH 5J9PA 5A2IH 4JRYA 3PGFL 1GL4B 4OZFA 3I9GL 3DTXA 4K07A 4PY8I 4AEEA 3BT2H 1NMBL 2EXYD 4FMFA 2IBGA 1PZ5A 3WEXB 5KW9L 1P7KA 1QD0A 2IQ9H 2OP4L 5I66B 5KZCB 5T1LB 4WEUD 4OI7A 4QHLB 1KTLB 3HE7A 5MEND 1XGYL 1HXYB 4W4OC 3NACH 5BW7C 5A3ID 2DF3A 3T0BA 3MBEC 4OZHE 2C1PB 4NHCL 2RFXA 4RGMC 1YY8A 5JW4R 3JV4A 1DEDA 4AT6B 3B9KD 1DUYA 3MYJA 5B3NA 4JN1H 2D03H 3GSVA 4I2XE 2QHRL 4YDJA 3B43A 5FECA 1Q1JL 4RFEB 3V4UL 1T21B 2ZPKH 2ZNXA 4UQ2A 1K8DA 4U6XA 3ARXA 4LSPL 1CLZL 4ZYKB 4B50A 3UTTA 5DD1L 1GGIH 5TDPA 4JLRA 2ILLA 5EBWB 3UZQA 3UZVB 4PRPD 2ZOKA 3PHSA 1MVUA 3GK8L 4QRQA 2X70A 2MJWA 4QOKA 5MI0B 2HH0L 1T89A 1XIWD 4KHTL 4Z7WB 1IE5A 3LKPB 3V5KB 2MCG1 2ZUSA 2AJXL 1AH1A 4KGJA 1QSVA 3ABZA 4OGZA 1JPGA 1WAAF 2AK4A 2BC4A 4PJCE 2NQCA 4O51A 3CK0H 4GAYB 3OJ2C 3SCMA 4WHTA 2DTML 4DKFH 4UQ3A 3KJ6H 1IEBA 4LP4A 1U58A 4BSWB 5HYJA 4LCWE 5LQBH 1RURL 2DD8H 3FQNB 3OXSA 5HYEA 1PLGL 5DJXB 4OLUH 1IM9A 3UXFA 2X9XA 4JO3H 4JVWA 1FG9C 4OV5A 3T3PF 1P5UA 5JA8B 5I19L 3PWJA 4Y5XB 5C2UB 1S7UA 3TN0A 3QJHB 4G8GA 3U7YH 2Y7QB 4KROB 3MMEA 5FHBL 2K7PA 4R7NA 3T4YB 1RZIA 1CZ8H 5D6DC 5B4MC 4HCRL 4DTGL 2ERJC 4PR5B 2CDFB 1JF1A 5I0DA 2XRAL 4M9OA 3G5XB 3ZO0A 5ILTL 4I1NB 4QRPA 2XI9A 1IMHC 1S7QB 3JWDL 3N06B 1JHTB 2J2ZA 3DVGA 1YPZB 3O6MH 3HFML 3D3VA 2RCSL 1UZ6F 1CDCA 3CMGA 3P0YL 2EDRA 3S5LG 1UWEL 5D93B 3D18A 2NTFA 3T04D 1XR8B 3ZE2E 5E0QA 1K5NB 1I7UB 4I13B 4OBRA 3C5JB 1FVCB 2R69L 4BJLA 5F3HB 1UWGH 2CJUH 4FFVD 3TH3T 3GSUA 2NTSP 5ESAB 1T0NB 3DJ9A 1YECL 3FQWB 2FIKA 4P4KC 1PG7X 4MXVF 2IF7A 3ARYA 3QEQB 4HUUA 1J10A 1KJ2H 1BREA 5D7IB 5LWYH 3GMMB 3WIIL 3VDCA 5JW3H 3SOBL 4HUVA 1EA9C 2VDPL 4LLDA 1A2YB 3O4OB 3M45A 4XGZA 4NQDE 2WBJD 4PJEF 3TYFA 4GRMA 3NIGF 1BZ7A 3OR7B 4OKVB 7FABH 3G04B 1HZHH 4P9HH 4PJ7A 1DVFA 3S35H 3QUZD 1M7DB 2Y23A 3ROOB 2Y07H 1J8HD 2A74A 3IU4L 5GRWA 1VPOH 4L4TA 1ZHKB 3ME0A 2H45A 1JFQL 4QHMA 4KZEL 3RIAF 4YXHH 3TBWA 4S1RL 2H26B 1EERB 4DK6A 2BZDA 4GT7A 5FKAB 4B7LA 3QRGH 1S9WB 4WDIA 5B8CB 2X4QA 1LK2A 3SDCA 2VZOA 4JM2A 4I3RH 2FR4A 1P7HL 5SWZB 2G9HA 3S3PA 3EO1B 2X2YA 5BXFB 3GMOB 1SBBA 4N8CL 3ARVA 3BSZH 4NRYB 1OSPH 1JGLH 2ZUQB 1KYOJ 3QB7C 4EI5D 5I30H 1BIIB 1CR9L 1FGVL 1V3LA 1N26A 5D7JC 4JHBA 1B0RB 1FN4A 1OAYH 4PJDF 1DVFC 1BEYL 2ZUTA 4OGAD 2EE6A 1I1YA 1QHOA 3HHRB 5A1AA 1H5BC 3FFCB 3U4AA 4LCUA 1A6PA 5HDLA 3QIWA 2VYRE 3C5ZA 1T5XB 3MRCB 2X4TB 3CFBA 5HHPA 1UC6A 1Q0XH 4I48A 2J6EA 5DUBB 4P4RA 4V1DD 2FX9H 5MEQB 5E4EB 5C0CB 5E8EA 1D5ZB 4PJ9C 3B5GA 1L6ZA 4JFXA 1CN4A 1J18A 3OKEA 4PJBA 3RWGA 1KJVB 4Y5YA 3U6RA 4EBQH 4Y2DB 3ZSTA 4HF5L 2NX5E 3ARGC 4BZ2L 5E08L 4WW1B 5F88B 3LKQB 3BH8B 4YDVA 4XP5L 4P3DA 4XPTL 4GUPA 3BGMB 2PYEE 1H0DA 1X6LA 4HWZB 3CSYA 4NFCA 3DX9A 3GRWA 3D39B 2CLZA 5JXAL 4PD4J 2I07B 1P4IH 2HJLA 3KNBB 3QEHA 3PP3K 3C8DA 2I9TB 1XF1A 4P46B 5F7YC 3QIWC 3U0TA 5DD5H 4P2CG 4NQEE 4JQVA 1FVEB 3U0WL 4YPGA 3EO9L 3B3IA 4IOIB 5K9JH 3P0VL 1WFNA 2J4WL 2F5AL 4X4XB 3RGVA 4M8QA 5AZEH 1Q72H 5CEZD 5HHNB 3MLPA 1BJMA 2GFBB 5F89B 3QPXL 1ZVHA 2FCBA 5IMOB 1R24B 1CBVL 4HD9A 3G6AB 3WUZA 4OFPA 3HI5H 5C0RH 1UA6L 43C9A 2UZYB 4X4ME 1MHHB 4TULH 3N1GC 3MLTA 2R2HB 2FEEI 5IB4A 5JIHA 2AEQH 2A9NH 1ES0B 2H41A 2IAMC 4WU7A 5FOJA 5IOPB 5DHYA 2VIRB 1JK8A 3GZKA 2AJUH 4YHKH 2Q86B 3WJLA 3O9WB 4KZDL 4XC1L 1D9KD 4OZ4B 1HYSD 1GAFL 2HFEA 4G8FA 4YDIL 3FO9B 4Q9QL 3RNKB 3CFJB 3KXFD 5CZXD 3QO0A 3DUUA 4F7CA 3WHE1 1HQ4B 3OGCA 4FFYH 3GI9L 3MUGB 3LEYL 4JFFA 3CH1A 4OUOA 4P5KB 3TH2T 1VADB 1M6OA 1QBLH 4UTBH 3DARA 2BVOA 4P3WA 1YEDB 3WLWC 3MV7A 4C56B 4PRAA 3JWOL 1FDLH 3QUYB 3U83A 3OAYK 5IVXE 2R9HC 4HH9A 4J8RA 3DOSA 4KUCD 3HRZA 4AQOA 4O4YL 5CGMA 4PJFE 4U1IA 5EU6B 5E8DL 2ATPB 2P7TA 1KC5H 2NY0B 3KJ4B 3VWJD 3EHBC 4CVWA 2MSPA 1D5BB 3FJTA 3QUZA 2MMXA 3WLBA 4PJEB 1H3TA 1ADQL 4XWGH 3AFLA 5BVJA 3HZKB 1RUPL 4ZUSB 1W0WB 3LQAH 5A2JH 2XWJA 4HIEB 4KPHL 1EX0A 2IBZY 1T2QL 1I8LA 5IB2A 1FLRH 1G0YR 5IB5B 4LLUA 1P7QA 3P77B 5ISZE 1Q9OA 1QFWH 1UEMA 1JNHB 1G7MB 1WC7B 3Q1SL 4XP6H 5FM4A 1DBJL 1U3ZA 2WUBH 3F5WA 4LVHB 3PHOB 3CFKA 1OB1A 5F7DA 1U3JA 2XKNB 3GIVA 2Y4SA 5GS0D 4HBCH 2LFGA 5J1AA 4BFIA 2BVUA 5DSCA 5JMOC 1DDHB 4KI1A 3NVQA 4BA8A 1U8LB 5I1LA 2EZ0C 2GK0A 4M6MH 1ED3B 4HS8H 3H9HB 3N85L 4B0MM 4XX1G 3AS2A 4APQD 5C07B 3NABL 1IAIM 3LRSA 4FQXD 1PYWB 4YHLL 5F6HJ 4PJDB 1C16B 4D0BA 1I8LC 3Q5TA 4ZXBC 3C6LB 5KSAC 3D87B 4JANB 4WUUD 3VGAB 4ORGA 1JHLL 1KCSH 5C0IA 2AABL 4D8PB 3UJJL 5I18H 5DTFB 3LV3A 3KPTA 4UNVA 3EO0B 1D6EB 5CD3B 4Z76B 2OCFD 1NLBL 1HKLH 1CL7L 1CFSA 4NN5C 1QRNB 3KPRE 1J5OL 5H37H 4FABL 1I8MB 1FBIH 1GGYA 2BSTA 2ICWJ 3NIDF 3IJHA 2NPLX 2JIXB 3H3PH 4KRPC 1T2XA 3MLSH 2MCPL 4HCRA 4OJFL 4AEIL 1EHXA 2F53A 2PR4L 3FT3B 3S6CA 1G1CA 1TNNA 1UM6H 1BGXL 3DX6B 3GBMH 4ZS7H 5HY9B 3GFUA 5C0AE 5MP6L 3MV9A 1EFQA 3T2QA 3RBSA 4F8QA 4YHMH 4XVUC 3MZTA 4GFTB 5FYJU 3RVXD 4ISVA 5JLZB 2DJ4A 4Q0XL 4UINH 3RY6A 3V6ZB 4PRDA 5I9QB 3ULUE 2IQAA 1A9EA 5BRZA 2VXUL 1WTGT 4M7LH 2VLKB 2H32A 5MEPB 4GBXD 2YBRB 5IBUG 2CLRB 3RU8L 5INDB 4PJ7F 5C08D 3MODH 3TCLA 3QUXD 3NAAH 5DMIL 3U4EA 4RIRA 1BQUA 1E28B 3ES6B 4PUBL 2FL5A 4YO0B 1DQTA 4TSAH 4UUJA 1OTTC 4QTHA 3SO5A 4XH2B 3G5VB 1XGQB 3UTPD 5D7LD 3SDXE 4U1MA 5HI3D 5DGRA 5C70A 4S1QL 3U46B 4LMQI 1A8JH 4MNQA 1OGTA 4PJHA 4PGZA 4IDLA 4AG4H 1EGJH 1D9KA 2CKNA 4L3ED 4JM2F 1EXUA 3QDJE 4GOSA 1IL1A 5LAXB 3RY6C 1IAKA 2VDKH 3RVUC 4O2FB 5C0BB 1DE4A 1YNTA 3OPZH 4EOWH 5C0ND 4ODBD 1XH3B 5CBAA 4WO4B 2YR3A 4JFQA 1NAML 3UAJC 4JFZL 3BISA 3QQNA 5J9PB 3P4NB 5IESL 3IT8D 1CE1L 4XMLL 4NM4H 4TUJA 3VXSE 3VGHA 1KT2A 4DVBA 1A14H 1PZ5B 2P47B 1I7TA 3THML 4U7SA 2GSGB 1CGWA 1FAIH 1U8QA 5F1KC 5TF0A 3TNMA 3F58H 2GJ6A 3QIUC 2PXYA 4GAJH 3HS0A 4HC1L 3HE7B 4KVNL 5FUZH 4LVOB 5JHDE 4J1UA 4OT1H 3ILPA 4HULB 5CKAA 2XA8H 3TIDA 1HDMA 4JGUA 2RFXB 1YY8B 2QQKL 3JV4B 4EJ1C 2NW2A 1GGUA 4MA8L 3MYJB 1A3LL 1R5WB 5FECB 3WBDA 4G8IA 3D0LB 4M7KH 1LO2L 4HGKC 1X4XA 4M6NL 1AGCA 1OTSD 2X1PA 1K8DB 2ICWA 3BW9A 4OF7A 4UQ2B 3UTTB 2HT3D 4XBPA 5C0GA 2V5MA 4RISH 4MAYA 3PQYB 2EDLA 2ZOKB 1QSZA 5FYLE 2GTWA 1MVUB 1IBGH 4EN3D 3MGTB 2O61A 4OZGE 2I60L 1YEJL 1E4XI 2PXYC 4R8WH 2QTEA 4X5WB 4DZBB 1VEMA 4M1CC 2AK4B 2BC4B 4Y4KA 4M3JA 3NCYP 4O51B 4JRXD 1Z6JT 4WHTB 5D71H 2DQJL 4UQ3B 3SCMB 2FSEA 1NEZG 5HYJB 2QLVB 3V4PH 5BVPH 1CIUA 3FOMA 5GGSY 3V0VB 2OTPA 2EE9A 4R26H 2NY1B 1IM9B 5IMKA 3RVWC 3OTTA 4Z78A 1FO0L 4OV5B 1FYTE 5JPMB 1NFDA 4QF1A 1P9MC 3CLEH 1S7UB 3TN0B 5GSRB 4G8GB 3PWPD 4WI9A 3MMEB 1AXTH 4PG9B 3KPOA 4R7NB 4ETQA 4NNYA 1A7OL 3DGCR 3CVHH 1ZVSA 2AV7A 1DBKL 3AREA 4ZUVA 1MQ8A 2UUDH 3GGWB 1MCSA 3LEVL 1RIUH 1JF1B 3FFDA 1CVRA 4B53A 4U0RB 3ULUH 4QRPB 3OV6A 5FK9A 4MA1B 3TBYA 2F8VA 4UV7H 4HK3N 1NGXB 4M6AA 4OFKA 4P2OB 4WV1C 5M95B 5GSVA 5C0EA 4Y4KC 3DVGB 4EDWL 3NMEA 5M7QA 3D3VB 4DCQA 1D6VH 4ONFL 3DVFA 3D18B 4RWYH 2GUOA 5KANI 4QXTA 4YXKL 43CAA 2E27L 1EJOL 1P4BL 4XPBL 4F2MA 2AJVL 5IQ7L 2BVQA 3MJGX 4G7VH 4HG4K 4NP4L 3B9VA 3MNVB 3GSUB 3O8XA 4WWKC 4I77L 3WXWH 4M7JL 5J4MA 3IJYA 1FPTL 4NO5A 4HUUB 4AIOA 3CD4A 1QSFE 1UKTA 4MAUH 1OLZA 4YFLI 4Z7VA 3OAUH 5F21B 3D85D 3IDGA 3BDYL 4F7MB 3V5DA 3BUTA 3EKCA 3SDYH 3TYFB 1BZ7B 2BRRL 4R4FH 2WINB 1I9EA 4GW5B 4HKZA 4KJQD 3ARDA 3IFLL 1DP0A 4PJ7B 5E8PA 3H9SD 2D7TL 3P4OB 3CU7A 2A74B 3CSBA 1G7JA 2C4FT 4L4TB 4WFEE 2J8UE 5KN5A 4D9LH 4ZAKD 4Z95H 5EO9A 4H1LA 4FFZL 4CBPA 5D1ZA 4YHZL 3TBWB 1EEYA 4QRRD 4YXLL 4UIMA 3HG1A 1ADQA 1LO3L 2X4QB 1LK2B 3SDCB 1MELA 4ESKA 5CZVL 2FR4B 4N5UA 5SV4A 4ZO9A 3UTSD 5JQ6H 1P1ZA 1IJ9A 4XMPH 1F4YH 1FHGA 4IIQC 3MLVL 5JUEL 3RDTA 1CDUA 1BQHA 4GRLC 1DLHB 5K59E 3IS0X 5MENB 3HNSH 3AY4C 5DHVH 3QBTB 1IRAY 3STBA 3QFDB 4FP8H 1FN4B 3BO8A 4ZSOB 1I1YB 2X4OA 1OVZA 5DC4B 1NQBA 4LCUB 3M8OL 4H26A 5DJCA 4X83A 4DEPB 3B9KB 3C5ZB 1KCLA 1NLDL 3TT3H 4GS7B 2NXYC 3CFBB 1SY6H 1QLRA 4I48B 4KKNA 3KYAA 5BZWA 3BOVA 4P4RB 1R5IA 1QP1A 4FQCL 4JR9L 1OLLA 2IGFL 3ZE0E 3SDAD 1C08A 4GKNA 1ZWIA 3OKEB 12E8L 4Y5YB 4PRPB 4LLMA 4LHUA 4XXDA 5DFTA 3E2HC 3UYPA 4R97B 4EN3A 4YDVB 4NBZB 4P3DB 4GUPB 5D9SA 1XIWB 3T1WA 1H0DB 3HMXH 2LTQC 3CSYB 3DX9B 1RI8A 2CLZB 2EO1A 4NO3B 4XZUA 5CSZA 2HJLB 1DQLL 1MCIA 1AD9A 3SE4A 2BP3A 1VSCA 3QEHB 2X4PB 3F62A 4M43H 2Q87A 1AGEA 5GRXG 1HHIB 3ULVH 5BOZG 4OSUL 4X99A 3F7RA 3OKNB 3V7AG 1IC4L 1XAUA 4L9LC 4RMSA 1IAMA 5CS7A 3Q5YA 1G6VK 1PEWA 4L8DA 3DO3A 4HWBL 1MFNA 3W5NA 1X5ZA 3KPSA 3MJ9L 3RGVB 1A3QA 3GSQB 4M8QB 3ORJA 5HDOA 3MLWL 3RA7L 3FTGA 2EH8L 4K23H 3QFJD 4WTXA 2P8PA 5GRJL 5I75B 1MRCL 3ZYZA 43C9B 3E6FA 5F6IC 3RHWK 1RZGB 2YZ1A 1B4JL 4MJ2A 1CDGA 3MLTB 1NGPL 2OR8A 4PGJA 1UCBH 3NN8A 5LGJA 1I3GL 1FE8L 1HOCA 5IB4B 2ZCLL 4JHWH 4WU7B 4HK0B 4HS3A 4WI2A 5DHYB 4J4PA 1JK8B 5ANMA 2EDWA 2VKXA 3I6GB 3VW3L 3MBED 1KOAA 2UY7A 1U6AH 1BFVH 3VG0L 3BZEA 5CP7B 4G8FB 4JREB 1HHKB 3S4SG 1MEXH 3EFDL 3ROLA 4YFLF 3QO0B 3DUUB 4F7CB 4LAJH 4ZFZA 4NCC1 3S34H 5F9AC 3VXMA 3OGCB 1UADC 3BEVA 5H35A 3BP6A 4JFFB 1T83C 4Z7UA 4BUGA 5SX4I 3CH1B 4TNWK 4KUCF 1M6OB 4M6OH 1E27A 3FN3A 2FJHA 2BVOB 1YN7A 3MV7B 4PRAB 1X4YA 2DQGH 3LS5L 5F93C 1XMWA 1TETH 1I3UA 1OAXL 1NAMA 4J8RB 2AJZA 3GHEH 2ZKHH 3HRZB 4LRNH 4G42A 4GG8A 2Q6WB 3DHMA 5EORH 1VFUA 3HI1A 3BT2L 3FT4A 3SE3A 1AO7E 4U1IB 2W07A 4TQEH 2IQ9L 4LFHG 4OB5H 2EYSB 3U9UA 1J11A 3QUZB 3WLBB 1CICC 5CJOH 2XICA 3B2VH 3W2DH 1J8HB 4HC1A 3NACL 1SM3H 5C6PB 1UM4H 3OBAA 4L29A 4ZAKA 3GIZH 1QFOA 2XWJB 5IB2B 1T80A 4LLAA 4UDUB 5IROC 2ZCHH 1Q9OB 3RI5K 4JN1L 2D03L 3S36H 3VGEA 1EVUA 1MCKA 2YPVH 4RFOH 1LGVA 4LSDA 3I02B 5ID0A 3F5WB 3CFKB 1OB1B 3UTSA 4IRJD 3QCUH 3VRJB 4M5ZH 3GIVB 1GGIL 4QHKI 4EUPA 1FNHA 3GI8H 5FM5M 5DSCB 3SKUD 2DS4A 4NM8H 1YUHB 4KJWD 1BJ1H 1CGYA 1UYWH 3HLAA 5F9DC 5I1LB 2GK0B 1NFDF 5FYJE 1MCJA 1F2QA 4EDXB 1BD2E 3DSNA 3FQXA 3O3EA 3ET9F 4N1CA 5GGRY 4JJ5A 1OD9A 1IGCH 4DKFL 4N0UA 3KJ6L 5LQBL 3EOAA 2DD8L 4NWUH 4OLUL 3MJ8A 1KF9B 1SYVB 3EGSB 4FG6C 3NCJH 4ZPTA 3OKMB 5C0IB 1YMMD 3FZUC 3PL6A 5B39A 4L1DA 4JO3L 1I75A 1U8MA 2W0PA 1FO0A 2APXA 5LJYH 4NOBA 2VLRE 4NC1E 3O0RH 3U7YL 5TQ0H 2M8XA 3QUMH 1CFSB 2R4SH 5ADOH 5AYQA 2AXGA 1F11A 2BSTB 5ID1A 1CZ8L 2DM2A 3IJHB 1KXVC 4UMGA 3TA3A 3IS1X 1QO3A 2ZG1A 5EFIA 3UBXI 2ICES 3LQZA 1QZ1A 3MV9B 3HAEA 3V95A 2V17H 3KS0H 4KUZH 3O6ML 2AEIT 1W0YT 2QSVA 1JZ4A 3AB0B 2UWEA 5DDHA 1VKXA 15C8H 1TNMA 5SWSE 4Z7VF 4PRDB 5D96B 1A9EB 5I6XC 4MCYA 3WHXB 3HC0A 3ZKSD 3TESA 1CD0A 5HVWA 5JW4Q 1IT9L 1UWGL 2CJUL 5KTEH 4GQPH 3DXAA 5JOPE 1HIMH 2PTUA 3RZWA 3TCLB 3D69A 4Z8FH 3TEUA 3IDXH 8CGTA 4Z7QE 1KJ2L 1T66C 4HGWA 5E9DE 1OM3H 3RAJH 4POYA 2HYMA 2FL5B 1KSRA 4UUJB 5LWYL 4XPHH 2RHEA 5FYKE 2WWMC 5DF0A 5JW3L 4J3OC 4U1MB 5D7JD 2RJMA 5LCVH 1F6FB 4MNQB 1OGTB 1BWWA 4UV4H 2QL1A 5LBSH 3SKOA 1CDHA 5ICXA 7FABL 3TGXA 4GW4A 1D9KB 5GGUA 1HZHL 4P9HL 1XCTA 4PTTB 3SGDH 1EXUB 3S35L 2EDXA 2JJUA 4CU7A 1IL1B 3BDBA 1MHPH 1IAKB 4XPAL 1DE4B 4CMMA 3IDJA 5CBAB 1ZT4B 2Y07L 3BP7B 5BV7C 2ENYA 4JFQB 1HH9A 5E56A 2UVEA 4QO1A 3ZHDA 4NPYA 4LLVA 4PJ9D 4YXHL 1WCBA 4DVBB 1I7TB 3ARGD 3QRGL 4KK9C 2VDNH 3DX7A 2EEDA 3TNMB 1DQQA 4I3RL 1OCWH 1WEJH 2NYYC 3HS0B 2AAVA 2R23B 5EC2B 1R3LB 4J1UB 1DN0B 3ILPB 2NMSA 5E5RB 4PLKC 1N4XH 3TIDB 4GKZA 3BSZL 1HDMB 1OSPL 1JGLL 3BD4A 4U4BA 4XRCA 3VWJB 1NCNA 1NCTA 5I17A 2RGSA 5I30L 4HAGA 2Z9TA 1KELH 5HYQA 1OAYL 2A1WH 1AQKH 1V8HA 1KIRA 5EC1B 1N6QH 3DVIA 3BW9B 2BDNH 2BY1A 2IPUK 1ZMYA 3AC0A 5DJAA 2DIJA 4ZFOL 4XBPB 5C0GB 4MAYB 3CFEA 1Q0XL 1VFBA 1ZA6A 3VXRA 2O61B 1C5CH 1IFHH 1QFWM 2FNBA 2FX9L 4C59B 1TCRA 1LEKB 2M1KA 3TBSA 5D7KE 3OB0K 4EBQL 2R0ZH 2BY3A 5KJRH 5B21A 3MGAA 3IJSA 1NCDH 2P5WA 4Y4HC 2FSEB 4ZTPH 4Y16A 4FQQA 1A47A 3FOMB 2IAMD 4LOUC 3JV0A 4APQB 4OZIE 5D8JH 1JRHI 1QPPA 1P4IL 4Z78B 5JPNB 1NFDB 4QF1B 4WW2A 1HK6A 5IJKA 5ADPH 4CU8A 1TTUA 4XVJH 5DD5L 2I25N 4WUUB 4ETQB 4NNYB 4U1GB 4HFWA 1DQDH 1PSKH 4PGEA 1T4KA 4JFYB 2AV7B 4LSTH 5LVEA 2CQVA 3AREB 1H3GA 3CFCH 1KB5H 5K9JL 1D5XA 1ZLSH 5I1KH 1RUMH 3FFDB 4OTXH 4DW2H 1NC4D 2BNQA 4AIXA 4HWBA 5AZEL 3K74B 1Q72L 1GGBH 3MJ9A 3TBYB 3WLWD 1PY9A 1S5HA 3LH2H 5GSVB 1ZXQA 2NR6C 5C0EB 3UJTH 1FSKC 2R9HD 3WL9B 4P23C 5EZOH 3HI5L 5C0RL 1JNLH 1ZHBB 4DCQB 4Y16C 5GRZA 4TULL 3RWJA 4I0PA 3KYKH 4KRLB 5ITFB 3D2UA 2GIYA 4NHUA 1WFUA 2GUOB 4QXTB 2OZ4H 1R5VA 4NN7B 1U92B 2AEQL 4K8RD 2F54E 2W9EL 2A9NL 5DLML 5FYKH 4F2MB 4Y1AE 2BVQB 5C6TH 1JGDA 5IJKC 4YAQA 1Y6KR 3PDOB 3O8XB 2AJUL 2Z0BA 4M4RA 4KJPC 4X7EC 4YHKL 3MLXH 3IJYB 3Q6FA 4NO5B 1CI5A 4LLQA 3AGVA 1UXSA 4XX1E 4GBXB 4X8XA 4Z7VB 5KSBA 3IDGB 4FFYL 3NH7H 3KLSA 1MCNA 3KVQA 2UZIH 3QUXB 4X7CC 1QBLL 2DQCH 2ZUUA 4UTBL 3GSNH 3FN0H 5F7NC 4HKZB 3ARDB 1FDLL 5HJ3A 4WHYG 5D7LB 5E8PB 2YXFA 1AY1H 1OWRM 3P11H 2EZ0D 3GDBA 4GLRI 3F7YB 1G7JB 2GSIA 1KC5L 2B20A 4W6YB 4ODWB 5GJSH 2YN5A 5CWSA 1FCGA 5D1ZB 2V2WB 4UIMB 5KSAD 4PJ8C 4X9BA 3MLZH 2VDRH 4DVRH 3LQAL 5TGBB 1MWAH 2P43B 5T1KA 1P1ZB 3PIQB 1SJVA 1MJ7H 4OLXL 2NY6D 2PO6A 3RDTB 4L3CA 1Z2KA 1QFWL 3GJFH 1BQHB 5J12B 1IGTA 4XP6L 3FOLA 4NKMB 2WUBL 4LCWD 1RJYB 4NZDA 1J0JA 4CVZA 1O7SA 1QLFA 3RUGE 1XCQB 2XKUA 1MFCH 4HBCL 3QXDB 3HR5A 5CP3H 3EDKA 4H26B 5DJCB 2BVYA 4KK6C 2BY2A 4M6ML 4HS8L 3P9MA 5FO7B 3EDDA 5HGBA 2WIIA 1QLRB 3MLUH 4L8SA 4XVUD 5E7FA 1SEQH 3DGGA 3PXHA 1JGUH 5DRXB 2Z8RA 1R5IB 4HIIA 5JDSA 1IVLA 1C08B 1FNGA 3BESR 1LNUB 4LLMB 3JBG7 3BQUA 4XXDB 1X5XA 1N8ZA 4EN3B 5CIPH 5ACZA 1KCSL 2PO6C 1IARB 4ORZC 5I18L 1T7YA 3FHAA 3WN5A 3QXUA 4P48A 1MCHA 2ZUXA 2EDDA 5CSZB 1NBVH 1I7ZB 1HKLL 4F7PA 5GZOC 4E5XA 1AD9B 4JRXB 2JJTA 1FBIL 2UWEF 3ARBD 4PRID 3NIFE 4P2QE 1N0XH 3FB5A 1CE6A 5DI8B 1X5IA 3H3PL 3MLSL 2XWTB 2MKLC 5E7BA 1UM6L 3GBML 4ZS7L 4NC1C 1QFHA 5C0JA 5T3XH 3PDGA 4Q7DA 4O02H 5ACMA 3RVVD 4YHML 3MRBA 5HHXH 1U8PB 4QXGH 2BHYA 5CJXC 1TQCC 4U2YA 1QHPA 5GJTH 2EKSB 3LOWA 4XP9H 2P8PB 4UINL 1TJGH 1HE7A 4JDTH 1WCQA 5D5MA 1CGTA 3OR6A 4JG1L 5FO8A 3O6LH 3E6FB 4R2GC 4M7LL 2AEPH 3KDMB 3NN8B 1TITA 1HOCB 3WO3B 3QIUD 3UBXB 3MFFA 3MODL 3WV0A 4KDTA 3NAAL 3QQ4A 1N3NA 5DK2B 5KOMC 4M5YH 5DJZB 5EA0H 1KJ2A 4TSAL 5C09E 3BZEB 4N1EA 1DBMH 3MRPA 4LCYA 2APWA 4ENEC 4HXAH 4WFGE 4X4YB 3BHBA 4Z5RA 3VI3E 2CMRH 4ZFZB 1LP9B 2YXMA 3WFDH 2CO7B 3BEVB 5H35B 4AG4L 4KKBC 1EGJL 3BP6B 4DZ8A 5F1IB 1KN4H 5FUCE 1WWCA 2AXJA 3CGTA 2VDKL 1CT8A 3O6FA 4EOWL 3OPZL 1PX3A 4OV6F 3VD7A 3WCYA 3CZJA 1G7LA 5DC0A 4G42B 3IDUA 4GG8B 4ERSH 4NM4L 5HHOD 4BQBA 4OZHA 3HI1B 5DQ9A 3WYRA 1BMGA 1A14L 2FD6H 3NFPB 3KPMA 4M1CD 4PRHA 2CK2A 4KDTC 3BZ4B 1SVCP 1FAIL 5CJBA 1KB9J 3H9SB 4OCSL 1GIGH 2AV1A 3TYGH 4GAJL 4FTVE 4I2XA 5FUZL 3VFPA 3MRQB 4OT1L 1N7MH 2AK1H 4L29B 4ZAKB 2XA8L 4GAFB 4Y4FD 4F37K 4DGIH 1OGAA 4AL8H 4AM0A 3BRGC 3RVWD 3ZKXB 3EYQD 4PJAE 1XGRA 2HFTA 2NX5D 4QRRB 1OW0A 3IYLW 1Z0MA 5HGAA 1FJ1A 4M7KL 2JK5B 3G9AB 5C1MB 2HMID 2PYED 1XGTB 4HLZG 3BPOC 2Q20A 3INUH 3UTSB 3IRPX 5A2FA 3H3BC 3GNMH 3EOBB 4RX4D 2CXKA 4WI3A 4D94A 4EUPB 1MHEA 1Q0YH 2C3XA 4GH7B 4RISL 1GGTA 1HEZA 4ZFOA 2FRGP 3QDAA 4YHIB 4DGVH 3G5ZA 1BVKB 1P69B 1U2CA 4KMLB 3HLAB 3BP5A 4PBXA 4HJJH 3TV3H 4WW2F 4OQTH 1JE6A 4R8WL 4DKDC 4U7KA 5C8JA 1EBPA 4MNHA 3FQXB 4JJ5B 3KYNB 1T7VA 1CXLA 2OYPA 5D71L 1J86A 5HI4C 4N0UB 3T4AA 1NDMA 3V4PL 4AENA 1Q38A 5BVPL 1OAUH 4ODVH 1AR1D 4R26L 4ZPTB 3TO4D 3QI9A 2DQFA 3PL6B 4UTAH 2JE8A 3T3MF 2Z35A 1U8MB 4Z18A 4KQ3H 4WWKD 2XN9E 3CLEL 4M7ZC 5DRNA 4LSSH 3ZKND 3EBAA 3WJJC 3D48R 3GUTA 1NUNB 1AXTL 4L9DA 3ZE1F 4ZUWA 2AXGB 3CVHL 1DSFH 4PV8A 5ID1B 1A7QH 5KS9E 1T0PB 1VACB 4ZTOH 1E6JH 3TA3B 1RIUL 4K7FB 1F4AA 3AAZA 2GAZA 2KBGA 5EFIB 3ULUL 1CVSC 1C12B 1H3PH 5E6IC 4UV7L 2XPGB 1A3RH 4P5TA 1HQRA 2QR0A 1GC1H 2IG2H 3HAEB 5H2BB 4YK4C 4QXWA 3RWHA 2EE3A 5JDJA 5EOTA 1D6VL 2UWEB 5DDHB 4X6FA 4WFHE 1VKXB 4RWYL 5IW1B 3QNYB 5KSBF 1U8HA 3WSQH 5GGSA 5IHBA 3HC0B 3P30H 1T1WA 1V3KA 3HE6C 4G7VL 3TWCH 4B41A 5CFHA 5T5NF 3WXWL 3K7UA 4NQDA 1JI2A 4XHQA 1I1RA 5HDBE 3PWNA 4LEOA 4JKKA 4HGWB 4HQQH 4JGJA 4MAUL 1BLNB 1B88A 4GRLD 4BZ1H 2R15A 3JWNC 3OAUL 3MNZB 5HTSA 4JPVH 4TSCH 1J88A 3SDYL 3BH9B 3ARTA 1LE9B 4Y89A 5EOCH 4R4FL 4RGMB 1A6WH 1AJ7H 4GW4B 3QJFB 4K3DH 5GGUB 1XCTB 3PNWA 4FQ1H 5E99H 1J05A 3MPCA 4CMMB 4OZFG 2NXYD 1YQ2A 4GKSB 3VFOB 3CH8A 4P2RA 1GOGA 1HH9B 1D5MA 3ZT7A 4D9LL 4NPYB 5LG1A 1F4WH 4Z95L 1IGJB 4YBLB 3S9DB 4UILH 3M1BA 4DN3H 4F15C 1WCBB 4KMTH 3CIQA 1RV6X 4MD5A 3DX7B 2SEBA 2NY3C 4PJGE 5AD0A 3NCMA 4XB8A 1HSAA 1G9NH 1ORQA 1OT2A 3D25B 4XMPL 1F4YL 4GKZB 1S9VA 3FAWA 4XRCB 4Q6YA 2DLFH 3JTTA 5I17B 3MRLA 4WRLA 1RY7B 2B4CC 4FP8L 3P9WB 3QDME 4JPWH 3BD5A 5DZNA 3FQUA 4F7TA 1A6AB 2D0FA 2IBZX 1XF3A 3RIFF 1CD8A 1YEHH 3O3AA 2NX5A 3QWRA 3TT3L 2YUXA 3CFEB 1SY6L 5J11C 3K8LA 3KPRD 2R1XA 1E4KA 1VFBB 1MY7A 3VXRB 1LEIB 4IRJB 4TNVK 1TCRB 1QFPA 2CO6B 3RTQA 2IALA 2YUWA 5C0AD 4MB5A 2P5WB 4L5FH 4U05A 4YHYC 1WVZA 3HMXL 1U91A 3NCCB 4NQEA 2WSKA 3T09A 4HIXH 3VXQA 2F74A 5BMFH 4BSJA 3KLDA 4WW2B 3T0EC 3H42H 4JY5H 5MERA 3ZT5A 5D5MF 3ULVL 1GH7A 4HFWB 1YMMB 3OQ3B 1T4KB 5GRVK 3CCHB 1D5XB 2V9TA 3ZDZF 1KIUA 2BNQB 1Y0LA 1PAMA 1K2DA 1X5AA 1MUJA 4K23L 2Z31A 1RZKH 4ZQKA 5JIKA 4OGXH 2DIBA 3N50A 4KFZC 3ZLQC 1FRGH 3CX5J 3RWJB 3NCBB 1DN2A 4BKLA 1EUTA 3D2UB 4NHUB 1PZUB