4N8VG

Crystal structure of killer cell immunoglobulin-like receptor kir2ds2 in complex with hla-a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
194
structure length
190
Chain Sequence
KPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Killer cell immunoglobulin-like receptor 2DS2
total genus 38
structure length 190
sequence length 194
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8vG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n8vG01
1ZTXL 3UTQB 3IVKB 1A7RH 3JWNC 3CVHL 4H88L 3QCUH 3HB3D 1MCIA 3NFNA 1XIWD 2AV1B 2YPLA 2J5LC 4L9LB 1X9QA 3LB6D 1MHHB 3SCMC 3WE6B 3MJ8A 4POZD 3RQ3A 2NNAA 4RMVA 1HQ4A 3VXUD 5HHPB 5D5MB 1AO7E 2VXVL 3Q3GB 4MXVE 2CJUH 4AEIL 4F2MB 3TEUA 4ZAKB 4K8RD 1EAPB 1VGKB 4LLAA 2BY3A 1Z5LB 3FT2B 3UTZA 4JFFA 4C59B 4R90H 5LJYH 2X4SB 5FYLL 3QQ4B 5I30L 5GS0H 3U7WH 1N5YH 5L8LB 1XCQB 4OCYL 3MNWB 4Q0XH 3S36L 5EUOF 5JW4Q 3G08B 1FV1A 1NANH 2Y6SC 5HHNA 1HKLL 4MA7H 4YHYC 1FL3A 3FMGL 2X7LA 4LDEB 2VLKE 3DYPA 2QHRL 5GQBA 2ITCB 5C0BA 1NBYB 1AGCA 5B4MD 1FNSH 1AD0A 1VFOA 4P59H 5J7CC 4PRDA 1QRNE 2VTFA 3TIEA 3W2DL 3WNNA 1QSEA 1L6XA 3IAQA 1A3QA 3ILPA 1XGTB 5DQ9A 4HKXB 2H6PA 3M1BA 5EIIB 1BVKB 4Y4KD 3LN5B 4K3JL 1D9KD 5C0NC 3BPCA 2VXQL 1F3RB 2OI9C 1YJDL 3ILQD 2PW2A 1PZ5B 5C0IB 3P30L 4PJ5A 1IILE 5IQ7H 3HS0A 1Y18B 4NQDB 5CKGA 3QO1B 4AK1A 5GSVB 1BM3L 1IGTB 1EK3A 5K59E 1CFBA 5DJ8B 4MA8H 4JN2B 2V7HA 4JM2B 1EO8L 3BDYH 5GJSL 3WBDA 5D1ZB 4LSPL 3T09A 4KMTL 1U8QA 5AZEL 1J0IA 5C0CA 1FAIH 5GGTA 3KPRA 4PRAB 4Z5RA 3PWLA 1W0WA 3QDGD 3T3MF 3VRJB 2YWYA 4KC3B 4PP2A 3RU8H 4NQVA 5HD8D 1S9YA 4G7VL 4Z7VA 2P5ED 4HS3A 3FRUB 5CEXA 1KBGH 3D2UD 3IFOB 5GSRA 2HJLA 2JCCF 5SWZE 2YEZB 4X4XB 4D8PB 5IB1B 2W9LA 5B8CC 3PHOB 1ED3A 1LP9B 3INUL 3EZJB 4XP9L 2VXTH 4P2RB 3FZUC 2EO1A 3IJSB 4FG6D 1T66D 3MMEB 4PRPB 2HFTA 2R29L 1DQQB 2EDWA 2DJSA 3SGJA 2UY6A 2VLJA 5GPRA 1AGBA 4WCYL 3T1FA 1F58L 1K5NA 1U9KA 2ZPKL 4KI5E 4JDVA 2DI9A 1VFBB 1WZMA 3GSUA 1KLGA 1CDCA 2HTKD 4M48H 4CDGC 5TFSH 1CLOL 4YHZL 5B8CA 4LVHC 5FKAB 4F9PA 2HT2C 5TE6H 3NACL 2NTFB 4Z7VE 5C09B 4OV6F 3IDMB 5FUOL 1RD6A 1MI5D 3VXNB 1U91A 3WHXB 4PJCE 5EBLB 4YHOH 4ZYKA 2J8UA 1P4IH 5HYJE 3KLHD 5ITBH 2R2EA 1H0DB 1D9KB 4LMQE 3SDYH 3VG9B 3VWKC 4K94H 3UZEA 1QRNB 4BSVA 1KG0B 2AJZB 3QXAB 1EO7A 5IB2B 3VH8G 2B7DT 3L3IA 1G6RL 1BBDH 4O2EB 4XCCH 5I8CA 4KDTA 4D9RD 4PRNA 3QEQD 4K23L 4UMGA 2BVUA 3HNTH 3QULA 1JPST 1I8LC 1QLEL 3ARPA 5T1LB 4RAHA 5F7WC 1MRCL 3V52H 3VG9C 2EE2A 3QDMB 5CEYB 3BFOA 3LS5H 2Q76A 1YNLL 1PX3A 5F7DA 1IC5H 1HNFA 4G9FD 5DJAA 4JFHD 5INCB 1SMOA 3LV3A 4F3FB 3UBXA 5D8JL 1T1XA 4LSQH 5HGHB 5F9WB 1U8NA 3SE4C 2Y5TA 4XNXL 4BELD 3FAXA 5ESAB 4OLXH 2J8UE 4ZAKD 3MJ9A 3SGKC 2B5IB 1XGRA 5KSVB 1U8JA 1RUQH 2W0PA 4HS8H 4LSRL 5B4MC 5F3HA 5GGRY 1A6WH 5HHVH 1IEBB 1OF2B 5C0BE 3GJFB 4MS8C 4YUEH 2CDEB 2DQDH 4EI5A 5KVEH 3OJMB 3U1SH 1OM3L 1MHCB 3EYOA 3SJVD 1IM9A 1G7PB 3E3QE 1NFIA 4PLKD 1EJOH 4K3EH 5HHQA 3O4LB 5KG9B 3DRTB 3HZMB 2DRUA 1PX4A 3QI9A 3FQRB 1HXMA 1G0XA 2BVEA 4P2YA 4M5ZL 1F02I 4C55A 3UAJD 4XH2A 1S78C 3DRQA 2RR3A 3VGGA 1S5HA 1AE6L 4M6ML 2BCKB 4LPWA 3NPSC 1MQKL 4I0PC 1J0JA 3D85B 4JJ5B 5MEQB 2NR6D 1DLFH 5IV2B 3L7EA 3PXJA 1FQ9C 4NZRL 1IC7L 3O3BB 4X7DC 2D7OA 1XEDA 1NMBL 5FF6A 5DR5L 2A9NL 3PWNB 3V6OC 3UMTA 1NCWH 2B2XH 1NAML 4M03A 4WRLA 1MFDL 1ZVSA 4U1MA 4EI5D 4OLYH 4HIEB 1TTGA 1HKFA 4QRRE 3CFCL 1T03L 1T0PB 4MJ2A 1MRFH 4RISL 3V0VA 5F96L 2F53A 5C0GB 1FL6B 3SGDI 2AV1A 3DETD 1HCVA 3RTQD 4LSTH 4JZNB 3WO4C 1S5IL 3U0TB 3ARWA 5C0JB 4NO2B 4I18A 2NNAB 1R3HB 3G5VB 3NAAL 2APTA 2BVOA 5FB8B 3O4OB 1ZT4A 2BNQA 3MYJB 4G6JH 3V6OA 4WO4C 4Y5XB 1JPSL 5ABDE 3QUYC 4FQXA 4OF0A 4ZOCA 1BFOB 1O7VA 2DDQL 4UINH 3UJIL 5C8JB 1CZ8H 4KKAD 5C08D 3CFBB 2DQHL 2R8SL 1AQKH 2ATPB 1A4JB 3AC0A 2ICWB 1G6VK 1QO3B 5HHMB 3NMEA 2BSRA 4F37K 1WZLA 2FEEL 3QDJD 4TNWK 4JFXA 4QRRA 1RIUH 5IW3A 1I9EA 1FZOB 4U6XA 2OZ4H 3VFOB 4QY8A 4J3OC 3MODL 5H2BB 5GJTH 5E1AB 2DM7A 5B39G 4N0CD 2GCYB 3QDHA 2R0KH 3KVQA 4PRDB 4LQFH 1AO7D 3KG5A 3FOLB 2DWDB 2ADIA 2HH0H 5J1AA 2H6PB 1CXLA 3MBXH 3BJLA 3DUUA 3DUSA 3E6HA 2XWTB 5GGTL 4ORZC 4XPAH 4OZHA 4H0HB 1A3LH 4BH7A 2F19L 2FJGA 1MI5E 4HGWB 4JO4L 4R7DB 2IJ0C 1H5BB 4PJ5B 4DN3L 3T0DA 1I1FB 1BECA 2FSEA 4NQEB 3ARDA 4PGBA 1ORSA 3L5XL 4X6EB 5ALCL 2V9TA 2JELH 4JN2A 4WUUE 3CUPB 2GAZB 5L88L 1AGDB 5BZWA 3SDDB 1DP0A 2V9RA 2H3NB 5KN5B 3FQTB 1Q38A 5HYJD 5I1GL 5ANME 3UX9B 4Q9RL 2I27N 2JB6B 3CK0L 4NUJA 5SWSE 4TSAL 4Z7VB 5C09E 3GIZL 4IOIA 4L8DA 1Z9LA 4UOW1 4X7SL 5EZLA 1HEZB 1CYGA 1T20B 3DVNA 1SJXA 4Z7NE 4EXKA 5IHZB 1MI5A 1A4KB 3VFGH 1J86A 4C56E 5I1AA 2ORBH 4UNVA 4D0CA 1XF5B 2VLKB 1VCAA 2HVKB 2A9ML 4YHNB 5DK3A 1J0ZA 2VRAA 4P2RA 4P49A 2VDRL 2VR4A 3KPSB 4AEHH 5BCAA 5HGBA 4QXGH 1KB9K 4IS6A 5DA4A 4NM8L 5DSCB 5F1IB 1KPVB 3SPVB 5EORL 4YPGB 5HHXL 2HRLA 3U48A 2G2RB 4QT5B 3ARDD 5IB4A 4JDVB 1CT8A 3V9FA 3S6CA 1I85C 4B0MM 4KZEH 3U30B 4Q74A 4M7KL 4PIRF 3GSUB 4OCXH 5IOPB 3FQXA 4I3SL 1N6QL 4HCRL 1NBVL 2QSCL 2KL6A 4HIXL 3RNQA 1EO5A 1V5JA 3MREA 2NX5A 3VGHA 2ESVE 3V6BR 4PJ9A 1JYWA 5ICZB 1NBQA 3PV6A 1DUZB 4CVZA 4NZTL 3ZYJA 3U30C 5JA9A 4MJ5A 2J8UB 2XG5A 3ARFB 1H0DA 2PN5A 4J4PD 3C87A 3FFCA 5DS8B 1AJ7L 2AJZA 2BHZA 1A2YB 3VFUB 1UACL 1G9EA 2GJJA 1YY8B 2VZVA 4JPVH 4CVXA 4GBXC 3D25A 1XFPA 4P2RD 3THMH 2FBJH 5DUML 1D5BB 3CGTA 4P46D 2IEPA 5C0DA 4LVOC 2HAZA 1FZKA 5HI4D 3QHFH 5KVEL 5EIQA 3QDMA 4E5XA 5HHXH 2VISA 1UG9A 2LU7A 5C70A 4D3CL 3FT4A 5DJZA 2PNDA 1WIOA 4FMFA 1UXWB 3LV3B 1YN7B 4JANA 4YEEA 3BH8B 5E5MA 4LNRA 1ZT1B 4XWGH 5TDOB 1U8NB 3NZHH 4HWBA 2Y5TB 2RFXA 2BOBA 2Z4QB 3PG2A 4YXKL 3QDGB 4JFQA 1QRND 3OL2A 4P2OA 5SWQB 2J3SA 2ZOLB 1K9TA 4CBPA 4HIXH 5BS0D 1PGRB 3IKCB 3DYMA 1NUDA 4P2QE 1XGRB 4M7JH 3H9SB 3O0RH 1I9IH 2R15A 2V17H 4D0DB 1WGOA 1MLCB 3I02B 2PYEB 1HSAB 2DYPB 3RGVA 3U4AA 1OF2A 4QRPB 1E28B 2M8XA 3U9PH 2WBJD 1TJGL 3QWQB 3QIWD 4JPIA 4C56D 3EYOB 5HSFA 5DFVD 3DPBA 2FO4B 2CUHA 3W11C 1DBML 1ADQL 4NN5C 1NFIB 4FQHB 3ELAT 5KG9A 5JA8B 2BNUB 3IGAB 2QKIB 4OZHE 4UT6L 5C7XL 3MNVB 3HI6L 3UCRA 4DAGH 5LCVH 4GG6F 3CPLB 2PCPB 1JYVA 5ESVA 3QCVH 1MPAL 1ZMYA 4DKEL 1CF8H 2Y07L 2NXZD 2VJXA 3TYFA 3OF6A 4XH2B 2O26U 4XWGL 3SY0A 1ZKAA 3QXVA 1QA9B 4ZTPL 1BQSA 2HG5A 1NBZA 3LN9A 2H26B 5CCKH 4OQTL 3HRPA 2ZOKB 5EPMA 2Y5EA 4Z0XB 4Y2OA 3UTTD 3WNMA 3OZ9H 4JO2H 3FCTB 4DVBA 3TBYA 1LMKA 3PQYD 3RJQB 1TZIA 4NPYB 1ZGLP 1SQ2N 4LLQA 2OMBA 2IPUG 3PWNA 2E9JA 4XCYB 5IB5B 4Y4KC 5F3BA 3RWDA 1CL7I 1IAKA 4QHKJ 1F3DH 3ARRA 4LFHG 5DRWB 5JZ7D 4I48B 5JR1H 3BIKB 1YEJL 1GGCH 4X5LA 1DVFD 1OWWA 4HMDA 5IVZA 5EG6C 2F53B 5L0QC 3MXWL 4TSCL 4JZNA 5D70H 4PLOB 2YPVL 4AYFA 4GRMA 1PLGH 5C0JA 5MENE 2WK2A 4U1SA 4CNIB 3WSQH 2BVOB 5EC2B 1XT5A 4OLYL 2I07A 5CS7A 4JFDB 1CBVH 5IBUG 4WI4A 2ARJA 2BVPA 1P2CA 3CDCA 4GLRI 1WBXA 4MWFA 2DKUA 4HWNA 4P2QD 2B4CC 3GHBH 4JPKH 2WUCL 2DOCA 3LIZH 4OZFB 4JO1L 3K7UA 3RI5K 1IZJA 4K71B 2M26A 1KN2L 1RUKL 1IZKA 1I1YB 3M8OH 4M4RA 4Z0BH 4S1QL 1MCHA 2X4QA 3VRLF 1OAUH 2GKIA 1TITA 3HE7B 5HI3C 4JGMA 2EO9A 1M05B 4TUJB 4YIQA 3GRWL 1YEIL 2X70B 5ADPL 3KPOB 1JWUB 3L95A 4AEIH 4K71C 3QHTC 4J8RA 2YD8A 5J1AB 1I7RA 4KI1A 1QFWH 3DUUB 1FP5A 3QFDB 3WUWA 1HHJA 1MEXL 4NYLA 1U8HA 2Y9RT 2NW3A 1T1ZB 2FJGB 1M4KA 4HGWA 2HTKC 3E8UL 2H45A 3RI5F 4RMQA 3M45A 4WY7L 4X4MA 4KRMB 4RFNC 4W4OA 2GJ6B 3BXNB 4P9HH 5E6IA 4LVNC 4X8JA 2FH6A 3ARDB 1YC7A 5C6PB 1OVZA 1S3KL 3KJ4B 3T2NL 5C0BD 4X6EA 1G6RB 4GAGH 4PRIB 2XOTA 4UBDC 2MSPA 1JGVH 2A74B 3EHBD 4P9HC 4IHOB 2QTEA 4HFWA 5BZWB 4M62H 3FQTA 2XKUA 3QH3A 4MNQB 3T3PF 4XNZB 4G6MH 4OTXH 4BSWA 4DN4L 1F4AA 4YJZL 1R5VA 3D69B 1UM4L 3RIFF 5I75C 4ZXBC 2W65A 5GRXG 4PTTB 1IKNC 1ZTXH 2EYRA 3HRZB 5E6IC 2KH2B 5EZLB 3D0LA 5BVPL 5IHZA 4O5LH 2Z31C 1N0LA 4UV4L 1XF5A 1AHWA 2QSVA 3EYQC 5E4IA 5IHUH 4PS4L 3O9WD 2W9DH 2FR4A 3D3VD 1FNEA 1I9JL 2FJHB 3PGFL 4Q9QL 1KCUL 2XWBB 4U2ZA 1F3DJ 3DWTA 1KJ2A 1XR9B 1RIVL 3DOSA 5E9DB 4Y5YC 3KXFD 1C16A 3MRCA 4XRCA 2FECI 5TF0A 5DD6B 3VFGL 2HT3D 3Q5YA 4UIMB 3W39A 1ACZA 1J5OL 2X1PA 1YPZB 4Z8FH 5IOPA 2UWEE 5IBLC 5CMAA 2FGWL 4L3EB 5I8OH 1KBGL 3HC3L 4P4RB 3ZL4L 1MCOL 3OR7A 2P1YA 2VDKH 1KB5B 1AP2A 1R3JA 4U1LA 3MV7B 3R4DA 5E8DL 4HPYH 3RNQB 5GZNC 3VDAA 2EH7L 3QO0B 5EZOH 4UUJB 4PJ9B 4UTAL 1CLYL 3BKML 4U6HB 2OL3H 2JB5H 2ZJSH 2VLJE 1IQDA 3FQWA 5FK9B 1NCBL 4UQ3B 4KKCD 5DA0B 3PQYB 1Z3GH 5E7BA 3T0EA 5DS8A 2IAMD 2Y4SA 1T3FA 1T7VA 1PSKH 3TFKC 3MNZB 5DVOA 3C6LD 4WW1B 4CVXB 3D25B 2EIZA 3VFMA 4HWEH 15C8H 2APVA 3CLFL 3ZZ1A 4TULL 1UH2A 5I73C 4QKXB 5SX5H 5FYJD 1DBJH 2UWEA 5JORA 4GXUN 2QR0B 1FJ1A 1UXSA 1YN7A 4QTIL 1GHFL 1IGFH 1CCZA 1IFHL 5E4EB 1QR1B 1T0MB 4IRSB 2E6PA 2YA0A 2XA8L 1ADQA 1YNTB 4FFZL 2VDKL 1KPRA 3DTXB 2VABB 5ESQA 3BKCH 2YSSB 4P4KA 4ZUWB 2W91A 3B43A 4LCCC 5C0ND 2YD5A 4MD4B 5E94B 5ICXA 1F2QA 5C0AB 3MV8A 2PETA 3S88L 3RZCC 1SHMA 4JHAL 2OR8A 3WJJA 3RGHA 1FC1A 4W70A 4R0LA 3N9GH 2DTSA 2Y6SD 3T0AA 2XTJD 4KMQA 3UTTB 1C12B 3JUZA 4YXLL 3CLFH 1Q9KA 5CJOL 4YDLB 2C9AA 2JCCE 5FXCH 1G9MH 4BQ6A 5IEKB 4Z6AT 1FVEA 5SWZB 3EKCA 1A7NL 1W0VA 2VUYA 3WD5L 2UVFA 1AR2A 4PYHA 1LEKA 4DVRH 2VIRB 3P2TA 4E0RA 1DVFA 4YQXL 1K4DB 4KKLD 4QYOA 3M17B 1NAKH 2VLME 4MXWL 4ZD3H 4HS6A 2DM2A 2HG5B 3WJJC 4FFZH 1A0QH 2VZ3A 5DMKB 2B4CL 2VITA 1JTOA 2HLAB 1EIBA 2C1PB 3LHPL 1TVHB 1RU9L 2Z9TA 4F8QA 3ARED 5GS0L 4KZDL 3PWVA 3P9MB 2AW2A 5T3ZE 4LEXH 4FTVB 4OD2A 4FZEL 4LLDA 1FFNB 4IM8A 4LQ1A 2UZIH 3GMNB 1CQYA 4ZO8A 1RY7B 3QEUA 1YYMH 4MB3A 1U93B 5D7IF 4DGYL 1QP1A 1IAKB 2YHGA 1PY4A 3DV4B 3EUUA 2W60B 3P0GB 5HYEA 5SWSD 1QVOB 2F8VA 2J4WH 3O6FA 3ALXA 4B53A 4DQOL 5D7SH 2M2DA 4OF8A 1E4WH 1NGYA 5EDXA 2FX9H 3FB8B 3NVQA 4LIQH 4OKDA 1YJDH 2BMKA 5DEFB 2HKFL 1RIHL 1YEIH 4EQ3A 2PR4L 3VFPB 3QFJD 4JFDA 3PQYE 4QLRA 2NY5C 4OLUH 3ZT7A 5BOPA 3MLWL 4OFPA 5I1LB 1OW0C 4RZCB 4ZTOH 3GFUA 1YYLH 4MB5A 4JRWA 1UZ6F 1FFQA 4ONGH 3HC4L 3U4EA 2YPVH 3FFDA 3CFCH 5CD3B 1LK3L 3O6FC 2NLJB 4WY7H 1RUQL 2J5LB 3WLBB 1RK1B 4DKDC 4ISVA 2JTDA 2JJWA 2ADJB 4LHJB 3IDXH 3LKNB 1R3KB 3RTQA 4NCDA 3KYNA 4MD5B 4Y1AE 3VXRA 3DO3A 4WV1A 4G6AD 3ARFD 5ID1A 1VFMA 1GSMA 1YY9D 3G04A 4I3GA 1MHPL 4NBYB 5IF0A 1AD9A 5DVNA 3OSKA 3JVGA 3SDDD 5KSBE 2PO6A 1JN6A 1JGEB 1NMCB 5SWSA 3KPOA 2J4WL 1I7RB 1KF9B 1V7NH 3WNKA 4RQQB 3VXSB 4F57L 3BOVA 3UJTH 3VA6A 1U8HB 1A6ZB 3V0WL 2EYSB 3LQMA 4K7FA 2BX5A 4PV8A 4YHYB 4HT1L 2HTLD 3B8YA 3MLWH 4NHCL 2W0LA 4R96A 3BQUA 2CDGA 4PJXB 4Z7WE 1QBLL 1PVHA 1AQDA 2FB4L 2IBBA 3A6OA 3W9DB 4L8BA 4JRYE 2PO6C 1D5ZA 4PBWD 5TFSL 4AIZA 1FZMA 4R9HA 4PRIA 4CMMA 2MKWA 5GGUA 1YN6B 3NFSL 5T1KB 4Z7OF 1MJ8L 3DSNA 5A40E 1JHTB 2GITB 3CDGB 1JNLH 1OP5K 1FFRA 3FO2B 1SYVB 3IF1A 3PL6B 1V3KA 2Y1VA 2YA1A 5BZDB 4HPOL 5AWNH 3R1GH 1OARH 1PG7H 3D69A 4NOBA 5JOPD 2VL4A 1DQMH 1EEYB 1WICA 1OTSC 4Z78B 4OZFG 4LCWB 4Y16C 2AXGA 5LGKA 4S1SL 4K3JH 3HAEG 4NC2B 5DEGA 2JB5L 1F6LL 1WAAA 3S97C 4UT7H 1KELL 4XP1H 1D3CA 3C8DA 2E8YA 5JQHC 5KVGL 3ILQC 3P4LA 3RWFB 1YNLH 4Y16B 4WGWB 3PV7A 4DGVH 1QSZA 2ZUWA 4MA8L 5DMGD 4ODBD 1AHWC 1P4BL 1U3ZA 3QDME 4KMTH 2MCPL 3TNMA 1N8ZB 4HJ0C 3SOBH 3EO1B 4JR9H 5FM5O 5B38A 1OAKH 5EU6D 4ZQKA 1WWBX 4JQXC 2BNRD 3VMOA 5BRZE 3LPFA 4WU5A 2YD9A 3GMRB 2E7LA 3PWPB 3HMXA 5HY9B 5T1DH 1QNZL 4U6HA 1A7RL 3QG6B 2J88L 3ULUL 5F88B 1UJ3A 3RVUC 3FQWB 5F7YC 4GW1A 1MUJB 5CZXD 4FA8A 1HI6A 5T5NF 4MAUL 4JKLA 1P1ZA 3JV4B 3A0OA 1AGEB 5HGDB 3VXOB 4WW1A 1UC6A 2NXYC 1H3XA 4JQXA 1JBJA 2DKMA 2NX5E 4OZGA 2Z93A 5D2NB 1NCDL 1RZJL 3M07A 2AXJA 2DIJA 1NC2D 3LEVH 4RWYH 1XGUA 1H8OA 25C8L 3E2HC 3EYQD 4LSVH 2QR0A 1UXSB 3VWKB 32C2B 4L4VE 5E99L 4PJ9D 1FNHA 4JR9L 5ETUA 2AJXL 2OXGA 4JFHE 1T04B 5F6HJ 1Q9LB 4J4PA 2PTVA 3SGEI 4ALAL 3C2AL 2W9EL 1WCQA 2VABA 2ZUXA 2OS7A 3SHSA 4G6FD 2UVEA 3DGGB 3BZ4B 3RY6A 2AJYH 4FXKA 4DJMA 4WU7B 4EI6B 4LLMB 5IBLD 4XVJH 1GGUA 4YC2B 4XPGH 5E94A 5ICXB 3O3DB 3AM8A 3V8OA 5KJRH 4YXHL 5JO5B 1NAMH 4JO3L 3CXHJ 5E9DD 2OL3B 3HHRB 4RRPG 1KXQE 1G6RH 2OTUA 4I4WA 3DETC 3FL7A 1IQWH 1FVCA 5E2JA 1LK2B 4X98A 3TZVD 5F9WC 3MRNB 1H8SA 4LRNL 4R0LB 3D3VB 3DHMA 4MNGE 3WNOA 4FZ8H 5KS9B 1A7BA 3QYCA 4L8CB 4YC2C 2A6KB 3A6BH 1F97A 1WLHA 4PB9H 4LU5L 5CP7A 5L6YL 1HZHL 4NQCB 3HE6C 5DJCB 2VIRA 5TDNA 4I77H 5CIPH 2Q87A 1G7MA 7FABL 2NY5L 4QYOB 4TUKL 4R0LC 3EIFA 2A38A 1RUAH 3QIUB 1I4FA 5HYJA 3MUJA 2EDQA 4PY7B 3MGAA 1KIQA 3DX8B 3MR9A 3OXSA 2XIDA 2HLAA 2DLGA 3P9MA 4ONOA 4ZDHB 4F7CA 3F7VB 5IW1A 4FXLA 3RWIB 4LLDB 5GS1C 5KAQG 4I2XB 3OKLA 3C2SA 3QIUC 4MNGA 3RDTB 4W6WB 1U95A 1N0XH 4G8IA 1KACB 1MWAA 2BK8A 3BESR 3LN4A 1HCFX 2E27L 4D9QE 5C6WH 4JHWH 5MERB 3WN5C 4F37F 5LQBL 4IIQA 1JYNA 3O41A 2YD6A 2W60A 5ERWA 2AI0H 2E9IA 2LQRA 2FECL 1J11A 2CDFA 1MFAH 4HUUB 4XNMA 1L7TL 2WLYA 4NFDA 2BOCB 3RDTC 4JZOA 2CIKA 3BGFC 1EFXA 3WN5B 2FEEI 5D7JD 1ZK9A 3BEWB 5CILL 3MLXH 1S7RA 4K2UH 1ZLWH 4U7MA 4NWUL 3A67H 4JKPH 5TE6L 5EC1A 3S3JA 2VZOA 4L3CB 5I1LA 5FUOH 5EU6E 1T21B 4BFGA 1BREA 2XZCL 1ZLSL 2BNRB 1T7WA 4NWTH 4F7PB 3FQNA 1UKQA 2NLJA 3O8XC 4JQIL 2PTTB 3WFHB 5EA0L 1UWEH 4WUKL 5ILTH 3LKNA 4XP6L 5GGSY 2EXWC 2UYLA 4OFDA 3VXRB 4XHJC 2L0DA 3ZKND 4L4JA 5IMLB 2D0HA 1CR9L 4C4KT 1FIGL 5IUSA 4EXPX 1NGQL 4XPFH 4NJ9L 1BBJB 2EDKA 2VQ1B 1MJJB 4X0KA 1JGEA 2R4RL 1QSFD 3IFLL 5SWSB 1TQCC 3O8XB 1R24A 3RWEB 3SDAB 3UTSA 2R0KL 1MHHA 1PAMA 2VXSL 4U1JB 3WE6A 1CFQA 4X6DE 1EHLL 3RX7A 3UDWA 5BVJB 2Y06H 2PTUA 1UM5H 4R7NA 4QXGL 2W92A 3I3DA 4J1UA 4NQDD 4HK0B 4F2MA 1KUMA 3HCVA 3OPZL 4JPWL 3S4SG 5D1XA 5GRVK 1RULH 1F90H 5FYJL 2CGRH 2HFGH 2GI7A 5D7JC 1FORL 3RUGF 3AREB 1LDPL 5C2UB 4NP4H 1AQDB 5JIKA 4JQVC 3TO4B 3T2OA 3I6KA 4RX4D 4PJDA 4JO2L 4OQ1A 1ZEAH 4EVNA 3UDWC 2NY2B 2RIKA 4EOWL 2HFFA 2YXMA 1T2QH 1SYVA 4JLRA 3D1MC 3GB7A 3LRSB 5J1SC 5L2KB 3TIEB 4I3RH 4AM0B 5D1XC 3FZUD 1XGTA 4FHBD 1QEWB 5C9JB 4G5ZL 1S7WA 4XPAL 3KYOB 5DDHB 1OD7A 4LKXA 2J8OA 1MJ8H 4HKJA 4FQLL 2DYPD 3TVMB 4P46A 5D7IE 1I7ZB 1CD0A 3SDDC 2ICWJ 3GHEH 1S7XB 1RZJC 3OPZH 1Y18A 4NQDA 5IVNA 5GS3A 4KU1A 5CZKA 2IC2A 4WHCA 4Y16A 3VWJD 1ZOXA 4DTGH 2GYSA 3VXPB 3RPIB 3TBVA 3DLQR 3SKUD 4FQQA 4HIHB 5D1ZA 4OAWA 1BOYA 3GBNL 4U6YA 2PYEE 2VLRB 3RVWC 4KTDL 4P2OD 4HUKB 4PRAA 4GBXD 5EOTA 3PWLB 1TJHH 3Q6FB 3ECBB 2DI7A 1T83A 2R2BA 4NQVB 4Z7WB 5CD5D 2VE6B 1C08B 1FVDB 2I5YH 3P0VH 4PD4J 3U82B 2DAVA 5IWLC 3IFOA 2A6IB 5GSRB 4M9OA 2QADC 2WBJA 2ITDA 1MCSA 1JV5A 1KYOK 3KPPB 3U9PL 3QUKA 1ZHNB 2ICEA 4OF7A 5IB1A 1HI6B 4C83B 3F58L 2AJYL 4LP4A 3NABL 1KN4L 3TA3D 4ORGB 1ED3B 4WI2A 2DM4A 5DJ0A 1MEXH 2P8MA 3EFDL 5F89B 3BDBA 1VESA 1W8NA 3O11A 3V5HA 2P24B 5BV7L 3TBSB 4JZJB 2JE8A 4G8FA 4YHML 4BH8A 5D5MF 1DQQA 1RHHA 2AP2A 5C0FB 5J13C 2L4OA 1T22A 4XNQA 1AGBB 5D2NA 1AKJA 4OZIF 1S8DA 2EDTA 4LRNH 3Q5TA 5F70A 1VFBA 2QHLA 2XZZA 4JHBA 2EH7H 3K4AA 5ANMA 3NZ8A 5EZOL 5GGVY 3T2NH 1KIPB 3V6ZB 4BYHA 2ZSVB 3KHQA 3QI9D 2Z31D 1KNOA 5C08E 4BSJA 4XWOC 3L5WB 4ZUUB 2HKHH 2NTFA 4Y89A 5C09A 4LASL 1JPTL 4L8SA 1NCCH 3IDMA 1IMHC 1I8MB 5BV7B 2JJSC 3DGGA 3KLDA 4KDTC 4YO0A 5F9DC 4CUCA 4ZYKB 2ZP0T 3OKNA 3BZEA 1B6DA 4FQCH 3LS4L 3B83A 5DK0B 2EDRA 3H8NA 2OK0H 3MBXL 1GGIL 4UDUA 1ZS8B 5MEOA 5IB2A 1ZWIB 4JDTH 4OCSH 3PWJA 5J12C 3BAEH 4PJXF 4G3YH 3ZKMD 1L6ZA 4LLWA 4DZBB 1CDGA 1IKFL 2DM3A 4HH9B 5BV7H 2EIBA 4MHHI 4V1DE 4O4YL 4YHMH 4NN7B 4O9HL 4L8CA 4LIQE 1B0RB 5AZ2L 2MQ0A 2VDPL 5HI3D 1HQRA 4HC1H 5FO9B 4QCIB 5FYLD 2YKLL 4HBCH 5EWIH 1NH6A 1W72L 4APQD 1S7TA 4IRJC 1FDLH 2IG2H 2Z92A 4LEOB 4P23A 4MSWB 4K8RH 1U36A 1YUHA 4AH2A 2D7QA 1CGTA 1BVLA 2Y36L 4Y19A 5HYJB 1KJMA 5GRJH 4PGJA 2CD0A 1N2RB 4MQSB 3FOMB 1MREL 4L4TE 3MR9B 4FQXD 4X4ZA 1ZGLA 4XC3H 2QQNH 3H7LA 4M6AA 2XTLA 4ZOAA 5ACMA 2EDOA 4F7CB 1INQA 3H9YA 3GM8A 3RWIA 3HMWL 3EYFB 3OKLB 1G7IB 4IRJA 1RZIA 3H9HA 3P4OA 5DD3H 4Y7MA 1P84K 4JFOB 2QSTA 3STZB 4AT6B 3LN4B 4U4BA 3BWUC 4N8CH 5HGGS 1IM9B 4IIQB 1B4JL 3X3GH 3SQOH 3K2MC 2EZ0C 1DL7H 4KHTL 3DRTA 3C8KB 3QWOB 1QLFA 1N7ML 5D96B 1A6AA 3JTTB 4ENED 5D7IA 4G6KL 5I16A 3V6FB 2VDLL 3HN3A 4PLJC 4M00A 2N1KA 3GUTB 1JK8A 5EN2A 3WEXA 2NZIA 5D72L 5FGBC 1GHFH 2J7LA 4ZFFB 1M6OB 5CLWA 5AYQA 5BMFL 1IGCH 5KVFL 3BUYA 3WNPA 2DTML 4BZ2H 3K8KA 4XNUH 1ZLVK 3CSBA 4ENEC 3NTCH 3LKRA 5L0QB 4HZAA 4XAWL 4H1LB 3P11L 1MJ7H 4K7PH 5A2LH 3V4UL 3QEHA 3TH2T 1XGQB 4NP4L 3HR5B 4OZIA 2VOTA 4NFCA 3IDNA 3NCFB 4JRXE 4NWUH 2UYLB 1HHKB 3MBEB 4I5BB 3MTRA 4UINL 1FFOA 2R2CA 3V5DB 3MUZ1 4QXTB 5CUSL 3F6LA 1W8OA 1GPOL 4HIJA 3ARBB 3TM6A 4U49A 2XZCH 4F7TB 1BBJA 2VQ1A 4LSDA 1T2QL 2VN7A 3TGXA 1EHNA 3O8XA 2X4PA 2AKRB 1TJIL 3V5KA 2ADGB 4KJWD 4WJ5B 4NO2A 4ZFGL 1NEZG 1S9WB 2HT2D 1D6EB 5D72H 4XPHH 4RNRA 4MA3B 4Q0XL 1P7QD 2ICWI 1U41A 4NJ9H 1FLRH 1NCWL 1B2WL 4Y2DC 3TCLB 3G5ZA 4DUVA 1J8HD 1QO3A 1IBGL 4WTZA 4PJDB 1HHHA 2Y06L 5ICYB 4XI5C 4W6XB 4QRRB 4EVNB 2NY6D 2CXGA 3IFPB 3O3UN 4TPRL 3TBTA 1PBYA 2HFFB 4K07A 4MA1C 3FHAA 4HLJA 4N0UE 2HA1A 3UYPA 1GPOH 3LD8C 1DTUA 4GS7B 4WWID 1FG2B 1KGCE 5IG7B 3S3SA 3QUML 2ADIB 4X7TA 2P7TA 1JJUA 2BSSA 4C4KO 4Y2DA 3ARDC 2O5ZH 2CLVB 5DDHA 2APFA 1X5KA 3IDIA 2A83A 3SE9L 5D9SB 4ZS6D 3O4LD 3N85H 4HKJB 3TVMA 3E6FA 1YMMD 3BRGC 2FEDD 1FFPB 5A2JH 1I1FA 5DJ6B 2YBRA 4X7SH 4YDKL 5EOQH 4RMWA 1LEIB 5I75B 2I25N 4FQ2L 1MFCL 3UXFA 1BQHG 4NRYA 4EEEA 3U7WL 5JMRA 2AEPH 3ZDZE 3WIIL 5FUCE 3KAAA 3GRWA 1K4CA 3CH1A 4Z95L 1A6UH 1CE1L 5D7LA 2H3NA 5KN5A 4CU7A 4ODUA 1CVRA 4PJGE 4NM8H 3E0GA 3KPSE 2FGWH 2R2BB 5I8OL 3QNZB 1UZ6E 2VC2H 5FYKD 5TDPA 1F4WL 3D5OF 1C08A 1FVDA 3MRRA 3U2SB 4KPHL 3GJFK 4U6TA 4XCNB 1C5CL 1A4KA 1RJZA 1NLDH 2BVQB 3UYOD 2BJML 3QFJB 2H9GA 3P73A 4ZUSA 1UFUA 5DEZA 4PJFF 1T6WA 3EJYC 5KSBF 3MV01 1U8OB 2IBZY 3RIAK 5KSBB 2EEBA 4J3VA 3BUTA 5F1IA 2VKWA 4X99A 4NQED 5L88H 4HUVA 4F15B 4CN4A 3T4AA 5DLMH 3IJYB 5I1IH 4HF5L 1TCMA 3GSVA 4NO0B 5DVLA 4RFEB 4NKDB 4QRTA 4N1CA 1DSFH 1KIPA 5GGQL 2UY7A 5ITBL 2ZSVA 4NT6B 1LP9F 4X9FA 4FNLH 3MRFA 3BH9A 3MCLH 1QFUL 1I8LA 1O5DT 1QTYT 2AQ2A 4PG9A 2LVEA 5EU5A 2GTZB 4FQ1H 2JJUA 1AY1H 5DK0A 4P9MH 4U1KA 4KAQH 4MMZC 1LO4H 1RAMA 4L29B 5A16B 4PRPD 1J1XL 1MJUH 3EFFB 1HYRC 5KSAB 2AVGA 3INUH 4TVPD 2DQGH 2YPLD 7CGTA 3WV0A 4X7CC 5T3ZL 5EU4A 4XTRC 1FZKB 4ZNEA 3HI5L 3DGCR 1HNGA 3S96B 3MRDB 3FT4B 5DJZB 3BT2L 2Y23A 5C0AD 3HUJF 2J8HA 3TJHD 5IR1B 3ROOA 4LNRB 5TDOA 1LD9A 4HWBH 4YEFA 1F4XL 1JHLH 3CVHA 5GHWH 1SJEA 1RI8A 2EDEA 2XTJB 3QPXH 3QDGA 3ULVD 1ZHLA 4L3ED 1OY3B 5DZOA 2X1OA 2V6HA 1QYGH 3JV0A 3NOIA 1MLCA 5F9JB 3OGCB 3LH2L 4B5EA 5K9KA 2Y07H 1BIIB 1FSKC 4QRPA 1E28A 3VXRD 4JM4L 2XKNA 3TPUA 4OUUB 2CKNA 5JHDA 3SE4A 1EVUA 3P11H 2A73B 3O9WB 5J4MA 3X3FL 1VA9A 2QQNL 2RB8A 4KKCC 1WBZA 4IRSD 5J6HA 3IGAA 1YEKH 2BHYA 1PQZB 1A6AB 3FO0L 2PCPA 2FJFB 2YD1A 3FO9A 2YD7A 3TFKD 1YECH 3UTSE 2YN3A 2IAMC 5I66A 2D31A 3MGTB 2FRGP 4PJEA 1HYSC 4W68A 4BZYA 3X13A 1DFBH 3JV6B 1YY9C 2MPAH 4ZPTB 2ZOKA 5L2JB 4GKNA 4OT1H 4PRID 4QRPE 4P3WA 1WFUA 4P99A 3MV7D 5D7LE 1X5AA 3FCTA 2BRRL 4DVBB 4I18C 3TBYB 5DRZB 4IDJH 1A6WL 3NN8A 1Z3GL 3BPLB 2X4NB 3JWOC 4TQEL 4U1IA 1ACYH 3ZTJH 1JL8A 2X9WA 3DNKA 5DJ2A 3RWDB 4OZIB 1MCWM 4LGRB 1OWRM 1MFEL 4N68A 1I3GL 4JG1L 4PRBA 3MJ9L 4DKEH 3IVKA 1B90A 3CNKA 4DEPB 4LSQL 1FNSL 4K3DL 1S7SB 5INDB 4L9LA 1SJVA 4TRPH 3CC5A 4ZMAT 2X4PB 4WJ5A 2ADFL 5HDBE 4CNIA 4S1RH 2C3GA 4O51B 2H41A 2FGZA 3L3DA 4ZAKA 3UAJC 3RGVD 1JZ7A 3WDHA 4N8PA 3TCLA 1JWSA 4R97B 2RGSA 1HKLH 4MA7L 3N1MC 1FYTA 2XRAL 1LO2L 2P8PA 3IDXL 1J7VR 1T7XA 1T1YA 5HI5D 2Q6WB 4LLYB 3ZDXE 5JHLL 2ITCA 5C0BB 4FFWC 2GJ6E 1P7HL 5FYJE 4KK6D 4MLSA 4ZAKC 5E08H 4CRPA 1QSEB 1UKTA 3ARGD 1FG9C 3HZYB 2VDQL 1T7YA 2AI0L 1A7NH 2ADFH 1HHJB 5ALBL 3DSFH 1A9BA 3OAYK 1S9VA 3Q5OA 5D9SA 1OT2A 1KIUA 4GG6B 3H7BB 5J9PA 1NAMA 4Z7UE 5D6CB 3MLZL 2A6JB 5IP4A 4YLQT 5EBMB 1JGUH 5C0IA 4ZD3L 1FFPA 4RX4A 3HS0B 4KK9D 1KB9J 2YBRB 4KKNA 3QEQE 5HTSA 3FQUB 5EBGA 4PY8J 4KK6C 3DURA 1ONQA 2F54D 1C7TA 4X8JB 4M4PA 3QO1A 4A6YB 1MQ8A 5GSVA 3UTOA 3BKJL 5IT2L 1LEIA 4JVWA 1MF2L 3F7RA 3FHQA 1QBML 4PRPE 1C5BL 1G6RA 4WCYH 3CMGA 1Z0MA 1Y6NR 1H15A 3CX5K 2QJDA 3RHWF 3BDXA 4X6CE 2VLRE 3N85L 4MXQC 3S37X 5FO7B 2GSGB 3MRGB 4V2BA 5HYFA 4Q9QH 5D7LB 4Y1AD 1YMHA 4L4VD 2WBKA 4GQ9H 4MNQA 1JNHA 3RU8L 2WNGA 5EZIL 1KJ3L 3IU4H 3MV9E 4S2SB 5DWUL 1A6TA 4M43H 1QFWM 1ES0A 4XVJL 4IMLB 1MIEL 3DJ9A 5IMKA 3WHE0 3HRZA 5KJRL 1C7SA 3MLYL 2R0WL 4KI5C 3WIHL 5IMOA 1X6NA 5JHDE 4WENB 4L4TD 2YEZA 4X4XA 1AHWB 2J88H 5CEZD 1DE4B 2AS5M 3L6FA 3PHOA 3TNNA 5J57B 1HDMB 1IGYB 5FM4A 5F7UA 3VD9A 3RHWK 3IJSA 1U8OA 3C6SA 4HSQA 1JNJA 4PRPA 2KUTA 5E8NA 4UQ2B 4YGVB 2VLJB 3OQ3B 3T1FB 1NCAH 3NA9H 3L5XH 4NO0A 1CD1B 2Z8RA 1JWMA 4UIMA 4NKDA 3S9DB 4TNWF 4MDJA 2MJWA 3U0PA 3BZDA 1BAFL 1OPGL 5B8CB 4P4RA 1CVSC 2C1OA 3HE7D 3BT2H 4QRSB 1AP2B 4Z76A 3EGSA 3C60B 3B9VA 1KC5L 2VDOL 3KPLA 5IFJA 2XTJE 3Q6GH 1HHGB 1G9NC 1IQDB 4G8GD 1P6AB 5C0RH 4HFUL 2EZ0D 5D93B 1WWCA 5EUKB 1R0AH 1U8LB 2HLFC 1NGPL 3CDYA 3IKKA 5I1DA 2YD2A 4Y5VB 3BMVA 4XXCC 1VPOL 3H9ZA 3MCLL 5KSAA 2YUWA 4Y8DC 2I9LA 2R1YB 5TQ0H 4OM1H 4QRPD 4O58H 4PRNB 1TQBB 5DK2A 2VSDA 3W0WD 3T0VA 5EU4B 1L7IH 2EXWD 3HZKA 5GGRB 4AL8H 4Z8FL 2NY0C 2LE9A 3S5LB 4HKBB 1XCTA 2UWEB 1X5LA 4KJYA 3OJDB 3ULVL 3I6GB 2DQIL 3AMLA 4NO0D 4UB0L 3QCTH 4N0FA 3RVTC 3TV3H 1FAIL 1LD9B 3U0WL 2A0LC 3MJ7A 4XP5L 1YNTA 2OYPA 3F5WB 3NH7L 2BC4B 2NY0B 1RFDL 1RVFL 2V2XA 4GMSL 3MA7A 1E4XL 1TXKA 1GZQB 5D4QA 3TPKA 3MLVL 2CSPA 5DGQA 1VENA 5DMGC 3JWOL 3OGCA 2VZTA 1CGSH 4C57C 2IPTH 1V7MH 3L3OB 3IDJB 1XIWC 3ZDZF 5IJVA 5JZ7C 2FZ3B 1MSPA 1Z0NA 2PKDA 5CWSA 2HMID 1CXIA 1SEQL 4P3CH 1CR9H 4NBXB 3CFKB 3BP7A 3CZJA 2P45B 2OSLA 5JLZB 3VXQA 2FCBA 3IDYC 5IKCB 5DHVA 2WW8A 3HZMA 4IOFD 3OAZK 2B5IC 1W0VB 2VYRE 4ZSOA 1EEZA 4WEMB 2QSCH 3KDMB 5AG9A 4ELME 1EZVY 5D6DC 3LKQA 4O2FB 5HPMB 2YC1B 4M3JA 3LEXB 4M61B 4J12A 3M17A 4Y4KA 1S7VB 3U1SL 2QQKH 3D18B 3DRQB 4S0SD 4PJFE 3IDYB 4CL7A 3C5SA 3X13B 3JV6A 3QEGH 4YWGH 3ZKQD 3TT1L 1TCRB 2AEWA 1YNKL 2C1PA 3I9GH 5MEQA 5L2JA 4G80B 2CPCA 2PYED 5IVXA 4FTVA 3ARQA 1HWGB 1N4XH 4NZUH 4OD3H 4XZUA 3V8CA 2F8XC 5DRZA 1RJCA 2X4NA 2O5YH 3VXME 4LCYA 4U1IB 4XCFH 1U93A 2FX8H 3GGWB 4WDIA 2O93L 1SEQH 5K33A 3FN3A 1GAFH 1NLBL 3NPSB 4ONGL 4QO1A 4XXDA 5AAMA 2PXYA 3HZVA 3UJJH 1OCWL 1SBSL 5T5FL 3F8UB 2FATL 2EC8A 3G5VA 5FOBA 2XZQH 1TDQA 2X4RA 3E1F1 4H25A 4LGPB 1MHPH 2NW2B 3NA4A 2EDNA 4OI9A 1BFOA 3QNYA 3PGCB 5CJQH 2DLTA 1KENL 4R8WL 4U2YA 1G7QA 4OGXH 4GAJL 1EMTH 3MLZH 3T77B 5E2VH 2CGRL 2HFGL 2RBLA 1J05A 1EGJA 3UC0H 1BX2B 3HUJE 2BNRE 5BRZD 1WCBA 8FABB 5DRNB 4JFXB 3QUYA 5DD5H 2NX5D 4AJ0A 2J6EL 3B9EA 1R3KA 2EDDA 2LU4A 3P9LA 3CSYB 5IGXH 1FZOA 1Q0XH 5IVXF 5H2BA 4LLYA 5ID1B 1MCNA 4KFZC 2HRPL 1Y6MR 5JIIA 2FX9L 4Q9RH 2APBA 1CF8L 3U46B 5IF0B 3C09B 1X4XA 3QJHA 5CP3A 3IFLH 4PJ8D 4BFIA 3FOLA 3TO2B 1FNLA 2MQCA 3JSSA 3Q2CA 3AREC 1P7QA 5GS2H 3MRPA 2IAND 4JY6B 2XWTA 3MUGB 1CL7H 4PJIF 3U6RB 3PDOB 1S9VB 5J8OA 5ITFB 1MCPH 4GG6A 2VWEC 3H7BA 1A6ZA 1NAMB 4LPCA 2NY6B 4R7DA 2EE9A 5KAQF 3CSPA 4PV8B 3C09C 1H5BA 4TVSa 1TPXB 4LCUA 1DQML 1BZ9A 3QDAA 3FQUA 1QOKA 4R96B 4NRZA 3DURB 1ONQB 3VFTA 5EO1B 1EXUB 4PJXA 5EUOA 1VEPA 3ZLQC 3F7YB 5CINL 1UWXK 2Z31A 4RGOL 3WLWD 4Z7QE 3ARXA 3QXDA 3OAUL 3ULVF 5FO7A 2GSGA 3MRGA 4WFFD 5I1KH 3FO2A 5AYUL 2Q7YA 1D5MB 3ESUF 4L5FL 4RCAA 5EFIB 3GBNH 4S2SA 1J0HA 3X11B 2ZCHL 1G9NL 4Q9CA 1KXTB 4MAYA 2MCPH 2H1PL 3DBXB 1HEZA 4UOW0 1WAAF 4XNYH 2V7NB 4J23A 4JFEE 4U1HA 1WK0A 4RFOL 3KPRD 2FIKA 2PF6A 4UIKL 4XHJD 2VLKA 1U92A 3B5GA 5CAYB 3L6FB 4KKBC 2HVKA 1EUUA 4YHNA 3VFWB 1A7QL 3GSQA 1REIA 5HJ3B 3PNWB 1UACH 2E7MA 1QSEE 1KXVC 3U36A 5HGBB 3H0TA 1DBAH 3RWFA 4UOJA 4YDJB 2XXCB 5DMJB 3SPVA 3ULVC 1IGJA 5E8NB 3ZT6A 4JFZL 4CU8A 2E7LC 4ZXBA 2V5RA 2G2RA 1RUPL 3CIQA 3QHZH 3QHFL 5KVDH 1VGEL 4NKOB 4M8QA 5FDWB 3TNMB 5BJTA 3K4ZA 5D1QC 4CADA 1AO7B 3FQXB 2AK1L 4UDTB 3QUMB 3CSGA 4F9LC 4PGDB 4QRSA 1OL0A 1KTDB 2WM0A 4WU5B 5DT1L 3GMRA 3AU1A 3CDFA 4U33A 4PJ7B 5F93C 3PV6B 1KTRL 1HHGA 1AJ7H 4QNPE 2X4OB 4JRXD 1KIRA 1H3PH 5C86A 1H3VA 1I1AB 4TULH 4KJQC 4XNXH 4N90D 4F8TA 2ZKHL 3GMOA 1A2YA 1CG9B 3JTSB 1U8IA 3HFMH 3ARTA 4MGXA 5I74C 2AXHA 3KYKL 2AJVL 3SKNA 1S9KC 1JE6A 2Z93B 2Q3ZA 4E5XB 1ZT7B 1SMAA 3CFIC 3AXLA 2L7JA 1XCTB 1RZGA 5HYSB 1XGUB 3I6GA 3SJVB 3AB0B 3MC0A 1P9MC 5F7LB 1AXSA 2AXFB 4N0FB 4G42B 5TE4L 3BH8A 5E5MB 2C5DC 5ETUB 5L8KB 5I9QC 1NUFA 5F1OB 1K3ZA 2BNQD 1IEAA 5J12B 2BC4A 5SV3A 4PS4H 3BZ4A 3NIGF 4LARL 3IKCA 4LDLB 1F4WH 4TTDC 4EN3D 3I02A 1SM3H 2ZCKL 3QEGL 4K23H 4YWGL 2JJTC 3KPMA 3L3OA 3GMLB 4DZ8B 4G9FB 2EH8H 3D85D 3REWB 3K2UL 4NNYA 2YA2A 3B2VL 1XH3B 4AY0A 1LK2A 4X98B 5D2NE 2VDRH 4PJCA 2R39A 2FO4A 4QHLB 1YMMA 4YHPB 5JLZA 2O5YL 4FQHA 5IKCA 4J3TA 2BNUA 2XQYK 3WS6A 4HGKC 1O0VA 1MCOH 3RGVC 2BERA 1W72H 3EDFA 4LCCA 5CGTA 2NTSP 1VB9A 2AJ3B 1QSFA 3UTSD 1TTUA 3PP3K 4PGZA 2E27H 3LEXA 3WKML 2IQ9H 3SY0B 1NUNB 4XHQA 1F4YL 4DKFL 3V4PL 5EUOE 1Q72H 4Y4HC 2H26A 2VLMD 1KIQB 3OXSB 1TCRA 3O81A 4NO3B 4JY4B 2Q86B 2HT4D 5IVXB 4NQSB 3F7VA 1AI1L 1G7JA 3BMWA 3QA3B 4HLZG 3OHXB 1J1PL 4NIKB 2MCG1 1SM3L 2ZCKH 2ESVD 4JDZA 1L0YA 1J8HE 2XN9B 1KN4H 1RUKH 3L3KA 4YBQC 4EBQL 3PJSA 3GGWA 1KCVL 4ZG1A 5K9QI 3H3PL 1MCQA 1W72A 3EDDA 3O41B 4NKQB 4I48A 5L2KD 2R0ZL 4Y4HA 3MGOB 2BXZA 4TYUA 2RAMA 2ED7A 3MPCA 4P2CG 1PDKA 5FM5M 3ZTNL 4E42A 4HUUA 3GRWH 5DUBA 4OIIL 2CUIA 3SE9H 3GMMA 3SKJL 5DFVC 5CJ8A 3RA7L 1NJ9A 3QIWC 2AJSH 4HK3J 1YEGL 3BEWA 1WFOA 2WP3T 4K9EC 2X4RB 4OM0L 5ELIA 5CEZE 3MBEC 3QNYB 2BVPB 2DQEH 4KKLC 1T21A 3N1FC 3S88H 4FQJL 3T3ME 4D9QD 1WBXB 4MWFB 4UNTA 3RUGB 2D4FA 2KBGA 4HX1A 4PJEF 1CICC 35C8L 3FQNB 2W0FB 4OZFA 2XNAA 1LE9A 1G9ML 2BDNH 3FB6A 3LMJH 1LVEA 3P9LB 4XTRD 4EDXA 5CUSH 2X4QB 4H8WL 4JG0H 3F65A 2DL2A 1F90L 1XZ0B 1HK6A 3GZKA 3KNBA 3STLA 2EDJA 3MFGB 1M05A 1N59A 4G6JL 4TUJA 5A2FA 4ELMA 2G60H 1AFVL 1OQXA 3SDAA 3UTSB 4KVNL 3L95B 1E4JA 5HDQH 4J7RA 4BK5A 1CFTB 2E7CA 3P4NA 5BVJA 2YKLH 4HBCL 1U8PA 5EWIL 4NYLB 3TN0C 1DQLL 1FYTE 3MACL 3BW9B 4LVEA 4P0DA 1T1ZA 5DHXB 1P7KA 5HYIA 2D7TL 4I0KA 1JZ3A 4X9GA 4XVSH 2IADB 3HCVB 2EDXA 3OWEA 3EOTH 4NQEE 4WV1C 3HE7C 3F7QA 4X7EC 3H3KA 4FABL 4RMRA 3P30H 4BQBA 4R90L 2ID5A 3BEVB 3AREA 1P5VA 5EA0H 2WUBL 1BQHA 3F7YA 1Q1JH 4YBLB 3TO4A 3TN0B 4MCYB 2YR3A 4XB7A 3RIAF 3O2DL 3WFDH 3VRIA 4HFWB 5F97E 1S9XA 3ZYZA 2IALB 3D48R 1EAJA 3RWCB 1NGZB 4QHUB 1LO5B 2NXZC 3QRFM 1GGCL 5I8EA 5JQ6L 1R5WB 4MZ2A 4KUZL 1HIMH 1T2JA 4YHKL 1QQDA 2VSCA 3S3PA 1NSNL 2FWOA 3OKDA 2VXUL 4H5SA 4EUPH 4KQ3L 4U1HB 3SDCB 1NCBH 2FL5A 3QNXA 4LKXB 3OR6A 2DIBA 2LTQC 2NY7L 1U92B 4UV7L 4Q6IC 5T1MB 5KW9L 3VW3L 3PNWA 4XNZC 4HT1H 3VD3A 4JCLA 4PRHE 4DW2H 1H3WM 2OJZL 2FEDC 5EU3B 1T83C 4DK3A 2KDGA 4ZXBB 3TESA 3BHBB 4NKOA 2LTQB 5IWLA 1MRDL 3KPSD 1YPZA 2R69H 2KZ1B 3IT8D 1AO7A 3PGDA 5JW3H 1QLRB 5DUPL 3RVXC 4L3EA 3S4SB 1LO2H 3V7MA 1A9EB 2EEDA 3TYGL 5IHLB 1BBDL 3FN9A 5MENA 1CLOH 1R3JB 5JPMB 3OBAA 5TE4H 4GFTB 2VE6A 1TTFA 1TZHA 3ZSSA 4DOHB 3AU1B 2GY5A 4UUJA 4JN1L 4PJ7A 4Y19D 3B2UD 4CU6A 2A6IA 4UTBH 4G8GE 1XF2B 3KYMA 3QUXC 4YHOL 1E4XI 1MCWW 3C5ZB 3WL9A 1D6VL 3UPCA 2OP4L 1T3FB 3NCBB 4GLRH 5DJ0B 5CJ5A 5D8JH 5E6ZA 1NFDA 3MNZA 3ZE2E 4NJAH 2EIZB 2X4UB 1RHHB 3BISA 5C0FA 1T22B 4XNQB 1AKJB 4JFEB 1FC2D 1KTLB 2BVYA 3T0EC 4Q2ZA 1RZGB 3WDIA 1WC7A 1DEEB 2B1AL 2V9QA 1UJ3C 3PIQA 4Z7UF 3NZ8B 3Q48A 4JY5H 3QUXA 1AXSB 1E0OB 4OFIA 1M7DB 5JW3L 4ACPA 3FTGB 4F7EA 4ZUUA 2MPAL 1UM6H 1FLTX 3MRIA 1TETL 3SE3A 4L8SB 3DX7A 1KPRB 3P40A 2AJVH 3VG0L 1UT9A 3DHJA 3DXAA 1ZLWK 1JFQL 4P4KB 3G6JE 43CAB 2DMCA 5I73B 3T0XA 2VDNH 2W38A 3K1KC 4NUGH 3J8F7 4X4ME 1KLUA 3BWAA 2JIXB 1ZS8A 4PB9L 4GRLD 1LE5B 5EOCJ 3PWJB 4OD1L 3MRMB 2ZG2A 2ESVA 1J1PH 4HXBL 4UZGA 4O00A 4C54A 2CKBA 4P5TB 1Y6KR 4GKZA 2GK0A 4LLVB 1CGXA 3NACH 4R6UA 2NY1B 2OBGA 2UUDK 3H3PH 1NDGA 5AEAA 2OJEB 1CGUA 3OKYA 4YAQB 1DVFB 5IFHH 1ZANH 3F62A 1LQSR 4WNQA 5FFLA 1AXIB 1FSKB 2IH3A 3HC3H 1YUHB 4B7IA 5H35A 1LWRA 1RURL 4OZFH 3VGAC 2PR4H 1BVLB 2C7UB 3FFCD 4HS6B 2W9EH 3EYVB 5DMKA 1NC4A 2NY1C 4HDIA 3W5NA 3AUVA 4MNHB 4NO3A 4YFLI 1KFAL 1YEGH 5JW4M 4OB5H 2FHBA 2Q86A 3GBLA 3LQZB 4YHLL 4RIRA 4PTUB 3KLSA 3D0VA 1WFNA 1OAQL 1DLHA 1ZLUH 3GMNA 1MFAL 3MZTA 4P5TD 1NCDH 1TIUA 5K93A 4JFOA 4LCWD 1IGIL 4M6NL 4MD0A 2L7UA 4K94C 5FGBA 3NCEB 3QDJE 2DLHA 3C8KA 1EPFA 5F21B 1AXTH 2EC9T 1AI1H 5K59F 4MCZB 4WHTA 1I9RL 5IBUB 2E3VA 1T0NA 4M5ZH 4U3HA 3U7YH 2W0KA 1FNAA 2DI8A 2Y7QA 5IW6A 1U3YA 5KANI 5GIRA 3TBWA 3GJEA 4R26L 4ZFFA 4OGZA 4WFGE 4PG2C 3DX6A 3NAAH 2F54A 3HAEH 3HG1B 2EKJA 3DMMC 1S78D 2FX7H 4ERSL 3BUYB 5IHBA 4GJTB 3ZKMC 1DLFL 1WIPA 5E1HB 3QRGL 3ZTNH 3VXSD 1RZ7L 1M7IA 4ODWA 1P69B 3WFBL 3LKRB 1J8KA 2Z91B 2QEJA 5CD3A 1NLBH 4PJAA 2XNAB 5EO9A 1JI2A 3IXAB 1M71B 1OHQA 3DVGB 3WXVL 5EZIH 4C56B 3DMMB 2X10A 3CCHB 3QQ3B 3RTQB 3HPLB 4KY1H 3MSPA 3GNMH 4CVWA 1I75A 4PG2A 1S3KH 1BLNA 1RK0A 3NCYS 3STLB 2FATH 4HIJB 1S7QB 2G5BB 3C5ZD 3EYUL 3H9SE 4APQA 5F8QC 1N59B 2Q7NA 4UAOC 1CIDA 1W0YT 3NFNB 1OARL 4WI5A 3V5KB 2ADGA 2ED9A 4R97C 3SKMA 2WZPD 3RTQC 3CFEA 5HHPA 2VAAA 1S9WA 5HGAA 3OKEB 3NBNA 4Z7VF 5D2LA 3MLXL 5JXEA 3KJ6L 3CU7A 1C1EH 4OCNC 4UAOB 1WWWX 5I18L 4FMKA 2YWZA 2GJZA 1VGKA 4PJCF 3TWCH 1Z5LA 3FT2A 4QHMA 4OCWH 3G5ZB 4CW1A 3WIFA 4HKZA 5KW9H 3W9EB 1NMCC 1H9VA 3IDGA 4MCYA 4OKVA 4CMMB 3SCMB 1YN6A 4D9LL 1ZGLM 4LF3A 5IM7A 2BY0A 5CIPA 3IFPA 4QHNA 1C5BH 1S9XB 1XF3B 2X7LB 5FYKH 4WWKD 3IF1B 1OM3H 4YDKH 3QCUL 3KYAA 1EX0A 1P4LB 2ZNXA 4NRXA 1BIHA 3A6CH 4KRPC 3PP3H 4NSKB 5D7KE 3FONB 5F9OL 2I26N 1BMGA 4Z78A 4X7TB 2OXHA 3A67L 5TF1H 2CLVA 3QR2A 2YRPA 4PJBF 4TVPE 4IRZL 1ZV5A 4WTXA 3LN5A 4S10A 1QHPA 3OR6B 2JK5A 3HNSH 1FE8L 1YEEH 3BVNB 4ZNEE 3QISA 4XB8A 1ZLSH 3KPTA 3W0WA 2Q8AL 2DIAA 5T1MA 3HMXL 1ZHKA 3P0YL 2AEQL 5JQ6H 5I18H 1B88A 1U0QA 2P8LA 2A9MH 1BOGB 1F11B 4RGNC 4U7SA 4YHKH 3HC0A 1NLDL 5DJ8A 1DQJB 3SOBL 1HXYA 4QWWC 3IS1X 4JM2A 3SGDH 1D5IH 2GT9A 5C0CB 1K4CB 3CH1B 3RZCD 2R9HD 5E99H 3S4SA 2OI9B 3B5HA 4ODUB 2CXKA 4NQTA 3VJ6A 4GMSH 1OB1B 3BRDA 4WFHD 5T1DL 3QUXD 4RGNB 1U6AL 5JPMA 3CXDH 5HY9A 1JPFB 1IL1B 2HMIC 3FRUA 3QG6A 1IFHH 1UM5L 5F6HI 5I1EH 2HJLB 1XF2A 5EH1A 1FO0B 1U8KA 4JPWH 3TC9A 1CDUA 4O2CB 4G5ZH 4OZHF 2CMRL 2H9GB 5D1ZC 2N4IA 3RVWD 2GK2A 3WFEL 1TFHA 1SVZA 1X5FA 1ZLVH 1AGEA 5HGDA 1PYWB 3D39B 4HGMA 1ZEAL 5FA3A 2X4UA 1HH6B 5ISZA 1T6VN 1CZ8L 4OZGB 3C60C 4QF1A 5C07E 1LO4L 5J56B 4TSBL 2I60L 2VERN 3PIQB 4RGOH 4NT6A 3WYRA 1ODAA 2R4SL 4NQCE 3ULVH 2DQIH 3MRFB 3TJEH 4XP4L 1MFBL 1K85A 1IC4L 3VXTB 2V5YA 1MRCH 3V52L 2V5TA 5AWNL 3DX7B 3VXNA 1JZ8A 1MQKH 3K3QA 5LG1A 1RHFA 4JKMA 2DMBA 5MHSE 4PGEB 5EBLA 4M5YL 4WU7A 1FAKT 4LLMA 4FQPA 5D2NC 5C3TA 3MOBL 5HVGB 4ETYA 1JGDA 3MCKA 3UP1A 3BWAB 5I17B 5DR5H 5A16A 4K94L 1SVCP 4OB5L 3L3IB 2KQMA 2OTUB 1ZA6B 4P5KB 4NDMB 2R29H 4GAYA 3UBXG 1IGFL 2HJFA 4P5TA 3GO1L 1JFQH 1YQ2A 5CEYA 4D3CH 5IEHB 1RZKL 3S96A 1O7SA 3MRDA 4LSUL 4NNXB 5F7DB 1CICD 4NQCA 4LSTL 1KCSL 1NDGB 3GMPA 4JM4H 5CHNB 4KGLA 3ROOB 3VGBA 1KSRA 4JVPA 4PJDF 4M1DL 1XIWB 3CVHH 4H88H 5JUEH 2R4SH 2GSIA 4IDLA 3X3FH 1KENH 3T0ED 3R0MA 2MHAA 1NC4B 3VRLE 4CMHB 3WDJA 4JHAH 4N8CL 2C3WA 4M7ZB 5DJYA 3ISWA 4NKIL 4K3HA 1X4ZA 1UVQB 5BW7C 3GSOA 4PJHE 5IFHL 3CFJA 2OK0L 1XF4B 2D03L 4I2XA 4IJ3B 3C6LB 3O2VH 1FGNL 4EI5B 3TPUB 5LQBH 1CDBA 2IBZX 4OUUA 1U95B 4G8IB 5EBWB 5E8PB 4CMHC 3BKCL 4EIZC 2ERJB 4QOKA 3WHE1 5MERA 1UZ8B 4MQXD 4QNPF 1N5YL 4ZFOL 4WIQA 4M7ZC 1A22B 2X5PA 3VFVB 4OFYA 4IJ3C 4MCZA 3C6LC 4K55A 3GMQA 3N50A 2VQTA 4WHTB 2A77L 4XNMB 4ZXBD 1HXMB 3FQRA 2BOCA 5DC0A 1T0NB 3I6LE 4HXAH 1K8IA 2XZAL 4NCC1 4RAVB 5IW6B 2ERJC 1JHKH 2IANB 2D31B 3MGTA 5GIRB 4U0RC 3TBWB 4PJEB 1HHIB 5E2TH 3VWJA 3VFSA 1S7RB 4S1QH 2F54B 3CX5J 4LRIA 1MAJA 3BSZL 3MV8D 2F5AL 3LKPB 4KJQD 4TRPL 1KCLA 4LSRH 3FAWA 2K7QA 3L7EB 2JF1A 4RGMB 3BGMB 1M7IB 4ODWB 1FNFA 3EDJA 3O3BA 4OGXL 2DQFA 1N64H 4WUUD 5FF6B 1EV2E 1QHOA 4N1EA 3IXAA 3GHBL 3C08L 3RWGB 5C07B 2GEEA 5L7XL 4C56A 1YEKL 3UTTE 1DCLA 2BFVH 3CCHA 3NIGE 3QQ3A 3LEYL 2EDFA 1RMFL 2QQLL 2Z0BA 4Z0BL 4RGMC 1S7QA 5DI8A 1NL0L 4APQB 3UZQA 1TZGH 3CJJA 5HHOE 1RZ7H 2CRYA 4WI9A 1J12A 4ZS6C 1PFCA 1MJJA 1OAYL 4X0KB 3CC5B 4U1JA 2VLLB 1PD6A 1QFPA 3QB7C 1R3HA 2XQBH 5DZLA 5ECJE 1YYML 3SO5A 4M1GL 3CFEB 4GRWH 1RZFL 1JHKL 5FGCE 2NMSA 1QFWL 1BJ1H 1TVDA 1BFTA 4J1UB 4PREA 4HWZB 5JW5A 3PABB 2OM5A 1HWHB 1C8PA 4R4FH 5C6TL 1II4E 1E4WL 3W9EA 2DLFL 2BSRB 3WO4B 5CZXC 3SCMA 4X6FB 2VN4A 5CZVH 3M8OL 2UZYB 5IM7B 2RCSL 1GC1C 1J1OL 5D70L 1JIBA 3L5HA 2YK1L 1AIFB 1L9NA 4Y5XC 2R1XB 4EBQH 3VGDA 5GRZA 4JB9H 5IMMA 3V0AC 4IEFB 1DUYA 3CVIL 3FONA 2V2TA 1H3PL 3MV7E 1I1CA 1RUMH 2IH1A 2ZCHH 5I8KH 1JMXA 3KWWB 2ZUQB 1PW3A 4TOYH 1KB5L 4KVCL 5C9JA 1A9BB 2GFBB 2BRQA 4BH7B 2FYYB 4Z18A 2JK5B 4HZLA 2WUBH 3MUY1 4P5MA 3MRLA 5FYKE 5EBMA 3REVA 4QWWD 1ZHKB 3EFDH 4XPTH 2FSEB 1B0GA 4NM4L 5E95B 5J3HD 5GRYA 5KSAD 4BQCA 2MQ3A 5DHYA 4A6YA 5JNYA 4PGBB 4WHYH 3DO7B 2DN7A 4FQJH 4H20H 1HXYB 4K8RC 1IAII 1MY5A 5KVDL 5CZVL 1TJHL 1TVBB 3SDDA 5E7FA 4U6YB 2EEAA 4JFYA 4LPXA 1RJLA 4FFYL 4ODXA 1BD2A 5EOTB 3TVMC 1BFSA 1ULVA 2DMKA 3VJ6B 5D71H 3ECBA 2JB6A 5DJXA 2AK1H 3LEVL 3SGJC 4Z7WA 1ES0B 1QBLH 12E8H 1UGNA 4DTGL 4CN1A 2CJUL 3DVNB 4GG6E 4MX7A 1RQ5A 4JM2F 2WBJB 4K9EH 2I9TA 4UILL 1JV5B 3EZ8A 5F1NA 2ICEB 1CFNB 2Q20A 3MRQB 4OGAD 4X5WA 5D2LE 1N5AA 1DE4A 3S35L 2OR7A 2GTWA 1BQUA 4BM7A 1BQLH 1NMAL 3C5JA 3HI1A 5F89A 3O11B 4PJGA 1PYWA 3D39A 3KPSA 2AK4E 4NC1E 3C6SB 3RWJB 5IQ9A 4UT9L 5BO1L 1OP9A 4HMEA 4DUXA 1A6VH 4S0TD 5C7XH 4HWEL 5IB4B 1CT8B 4QXWA 5AD0B 3JWDL 3WKNA 2GHWB 5ANMB 4FQ1L 2MOVA 4D0BB 1FNGB 4DKFH 5F44A 3IXTB 3THML 4LSUH 3QXUA 1X5HA 3C9NA 2EECA 1CGVA 2HN7B 1FPTH 4Z76B 1ZA3B 3EGSB 1JGLH 3EYSL 2SEBB 4HCRH 1R3LA 5ICZA 4PGEA 4RDQF 2DLIA 2NY3B 3ORJA 1OTUD 4XBPA 4NO5A 5J06A 1T5XB 3ALPA 2WINB 4KGJA 3UO1H 5I1DB 3RKDD 5C0EA 3AB0C 2VZUA 3FFCE 1T5WB 5MEOB 1ZWIA 1ORQB 1YY8A 2R1YA 1ZA6A 1NDMB 4NZRH 4YFEA 4LLWB 4DZBA 5ACZA 4HH9A 15C8L 5GJSH 5DK2B 5C0DB 4BZ1L 1NFKA 3VXUB 2B1HH 4M7JL 2NY3C 2XI9A 1ZAGA 4GXVL 4LOUD 5D7KD 5DUMH 4HKBA 3F12A 1UM6L 2EE6A 1MHEB 1HQRB 5B22A 4QCIA 1AC0A 1UXWA 4JANB 3WFCL 4DFIA 1N6UA 2VC2L 1S7TB 4N5ED 4Y4FC 2NQCA 3MFFB 2Z92B 4LEOA 4P23B 4OCMC 2RFXB 2Z4QA 4ZPVB 3F5WA 1WISA 3P77A 3QZWA 5SWQA 1KJMB 2MHAB 3KLAA 3K80A 3ZE0E 4DWHA 5I15L 4NZTH 2NY3D 2A2QT 3QI9C 3RVXD 3BP4B 3QIUD 1UVQA 3QQNA 3IDJA 2IAMA 3BPNC 3RGVB 4GW5A 2ICES 3NIDF 1XF4A 2YUVA 2AV7B 3ROLA 2LAGB 3OG4B 4Y4FA 1G7IA 4IRJB 1RZIB 3H9HB 4J3SA 5L6YH 3PWPE 3STZA 4AT6A 1UEMA 4R2GB 1CWVA 1DN2A 3DIFB 4QOKB 3VFRA 3ESVF 5CJXA 3VXQB 3LPGA 4YXLH 1SY6A 2B1HL 5L7XH 1A64A 4NZUL 5J6GB 3WFZA 1QLFB 3MNVA 1UH3A 4LBEA 5LGHH 3TIDA 5B39B 2FIRT 3NCJL 2C4FU 3LKQB 4LKCA 2O5XH 3V6FA 4DCQB 4OCRH 3BGAA 1K8IB 4M61A 3MRHB 3TYFB 2X1XR 5EN2B 1S7VA 3D18A 2IANA 3AVEA 1JTPA 2R2HA 3VFSB 1JPTH 3C5SB 1YZZA 5GRUL 1Z2KA 4BJLA 2ICCA 2YUXA 4BUGA 4NQUA 3WXWH 2PYFA 1MY7A 1VEMA 2DD8H 4JHZA 4P2RE 3ES6A 4YK4C 3U7AA 4GH7B 3SKOB 1GGTA 4FZEH 4X9HA 1B2WH 2E6JA 3MJ9H 4NQXB 1IRAY 1Q9WB 4XZUB 1BD2E 2BVTA 3UPAA 1GC1L 1BWWA 4H1LA 4LLQB 1OGAB 5LVEA 3RWGA 3QEHB 5FYJH 3TT3L 3ARGC 4WDIB 4OBRA 3PE9A 5IJKC 1OTTD 4S1RL 3ETBF 3AFLA 3LZFL 4KJPC 4NBZB 3G6JF 4YK4B 1IT9H 4FOMA 1NAKL 2XACC 1JPSH 3ARBA 1JCKA 2DQTH 4HWBL 4F7TA 3LIZL 1I1AD 2XY1A 1YEJH 5GS2D 5CEZH 3BPOC 1JVKA 4ZUTB 2VLLA 2FX7L 1CK0H 1YJDC 3DI3B 4GRMB 2DQHH 5IBTL 2UWEF 3IAGC 1R5IA 3Q3GA 4RMSA 5JIHA 1IAOA 4MA3A 4WW2B 3V4VL 3ZT5A 1VKXA 1YQVL 3FKUS 1G7QB 2X1WL 2GQHA 3N1QC 1UWEL 1G1CA 2OX5A 4JFFB 2OR9L 4QRUA 4I2XE 3T77A 3QQ4A 4WHDA 1A7PH 1BX2A 2CIIB 1HHHB 5ICYA 5DRNA 3D87B 3MNWA 3E3QC 4MVBD 3TP4A 5MEND 3TBTB 3VD7A 5GGTH 4KK8C 1AIFA 4PJIB 1NBYA 4KROB 1EFXD 2GY7B 3H2WA 2HWZL 1DUYB 4BFIB 1QR4A 1VEOA 3ILPB 3TO2A 1W2KT 1DDHA 5D71L 3KWWA 4KJPD 4HKXA 4OQTA 3OAUH 2X40A 4UU9B 1BVKA 1T2XA 3IDIB 2A83B 4IMKC 2FYYA 3MRLB 2IQ9L 3TJHC 4LCUB 5DJ6A 2X2YA 5DQDL 1NFDF 2GJ6A 2COQA 3BXNA 3VFTB 4GS7C 4EZMA 5E6YA 4XCEA 2V7HB 3P9WB 3KPRE 3QXDB 1U8QB 4MQTB 1D5XA 1CE6A 1JNLL 4JCMA 3B9KD 4IMKA 1XR8B 1MELA 3QH3B 2Q7YB 1D5MA 1BD2B 4M7LL 1W0WB 4G7YL 5EFIA 2CO6B 1RIVH 1LDSA 5EU6B 4BA8A 5DJXB 2IPKA 1HE7A 2R0LL 3I2CH 1R5VB 5I2IB 1UWGL 1UA6L 4PJ8B 1P84J 5E08L 4X4YB 4LVNB 2ZWLT 1A3RH 3I6LD 4XCNA 4UNUA 5KVMC 2NY4D 2BVQA 3OMZA 3ZDYE 4Z77A 5CGMA 1CFNA 3MRQA 4D8PA 4X5WB 1N5AB 3UTPD 2GUOA 3C5JB 3HI1B 4PJGB 5K9JH 1NCUA 2AQ1A 3TA3C 3BKYH 5KSBA 4OLUL 1K6QH 4X99B 4YDJA 1KJVB 3RWJA 1QSFE 5KS9F 5I1JL 5BS0E 2OQJB 3FB5A 3GSVB 5DD6A 1S7UA 1MRDH 3L5JA 3I3EA 1FGVL 4QRTB 2X42A 1Y0LB 1KOAA 4CADB 3QJFB 4LCIL 4GXVH 3WCYA 4AMKH 3MUHL 4D0BA 1FNGA 4XAKE 4FP8L 3MZGB 2M1KA 3FMGH 3TA3B 3JUYA 4PGDA 4UT6H 2IMNA 2HP4A 4DN4H 3OR7B 5TGBB 3SO3C 4FQIL 3AS3A 1XAUA 3QDMD 5HPOA 3MV7A 5D1QD 2SEBA 3D2UA 5DLML 4KK5D 4KZEL 1SBBA 5EU5B 2YRZA 5FAAA 2R2EB 1T5XA 3S37L 3T0EB 1KCKA 5I15H 4BSVB 1KG0A 3QXAA 3SO3B 3HAEA 1T5WA 4I77L 4PLNC 1CG9A 1MNUL 4XPGL 2X4TB 1B9ZA 3PP4L 2E9WA 4GKSA 3VI3F 3ULUF 1QLEH 3ZHLA 4LARH 4XVSL 5I8CB 3VFMB 2H2SC 5JXED 3QULB 3VXUA 3HUJB 2EDYA 4YXKH 1IC5L 4PJ9C 2DF3A 2HKHL 3V7AE 2APXA 4HG4J 1FYHB 1MHEA 5K9OB 3BE1L 3MO1B 3GBMH 1BVZA 1GIGH 5F7EH 5DJAB 2NYYD 3EJZD 5INCA 1CD8A 2R1WA 2IBGA 1A6UL 4E41D 1T0MA 1UEYA 5HGHA 2ZNWA 2PW1A 2APWA 3CVHB 4XXCA 1Q9OA 1IEAB 4ZPVA 5FHAH 1MOEA 1T89A 1GOGA 5HI5C 2C4FT 4P3CL 2XXMB 2NY2D 1KC5H 2VLKD 3K4DA 4ZUWA 1CGWA 1YYLL 5F9JA 4WFED 4FFWD 4OT1L 3HC4H 1KJ2L 1QPXA 3WJLA 4XVUD 1WZ1H 4MXWH 5FECB 1UJTA 2AV7A 3UTPE 4X6DF 1DVFC 3Q0HA 1KEML 2DTMH 4RGNE 4BZ2L 5FDYA 3QCVL 5JHDB 4PJCB 4QHLA 2WP3O 2ZUSA 3UTTA 3DV6A 2YD3A 1G7PA 3HE6D 1Q9KB 1JF5A 3N9GL 3R06A 1LO3L 3TT3H 2ZCLL 5SWZA 2RQ8A 1F5WA 3O3AA 3CZFA 5LWYH 4LCCB 3RUGE 4E0RB 3FO9B 3RAJL 4UB0H 1QSFB 5TE7H 4NWTL 3SDAD 1AXTL 1X5GA 3WJLC 1S5IH 4JM2D 4HH8A 3RBSA 5CEZL 8CGTA 5EOCL 3EW3B 3L3GB 3T1WA 4WTWA 2P42B 2VITB 3G5XB 5AZ2H 4JJ5A 2JLLA 2EYTA 2PYFB 4OFVA 5J11C 3IJHA 4U6VH 4KMLB 4O02L 5IB3A 4F80A 1NGQH 4XPFL 3V4VH 4L4VA 5IROC 5GGVL 4LSPH 2O5XL 3DX9A 4KKBD 3NN8B 3O4OC 2AGJH 5CCKL 3WUWG 1IGIH 4OFYD 1ZVSB 4S1DD 5DJ2B 3NFPA 4QTHB 3DV4A 5T3ZH 4XMLL 4XP6H 3MGOA 4LHQB 1JYXA 1FL6A 1OW0A 1S7SA 2VNCA 5SWZD 5DUBB 1FIGH 1T4KB 2PO6D 1EFQA 5I76A 3RAJH 4JRYB 2R4RH 4YBHA 4F58L 3BPLC 2D9QB 5CILH 5GRWA 1E4KC 3MYJA 1R5IB 4UT7L 4M93B 4N9GB 1IAOB 4Q97A 1MFDH 1MJ7L 2A6DB 4K7PL 4H0GA 4QGYA 1VKXB 5IGXL 4JFED 4JKKA 2XKSA 5I1HH 3HKFA 4BQ9A 4FFVD 3X12A 4F7MB 1MFNA 2ATPA 4HX1B 2F74A 3B6SA 4PJDE 1JWSB 1DQLH 4NUGL 3AS1A 3WLBA 3PF2A 1EDQA 3OGOE 5KSUA 4QGTA 4WO4A 1LE9B 1FYTB 3RL1A 2P8PB 4FQXC 3FB6B 5E8OA 3S36H 1T1YB 3RKPA 1H5BC 1FBIH 4LSSL 5E6ID 2Q6WA 4LQFL 4PJIA 4G8GA 5E1AA 2HFEB 4W4OC 4J3WA 3IU4L 5DWUH 2VDQH 1AD9B 3MA9L 3K8LA 3W2DH 2ARJQ 4E9LA 3O6MH 3HZYA 3U4BL 4Z95H 5F6IB 1D7FA 5K9QG 3BQUC 2IWGA 2Q3AA 4UU9A 3TT1H 2VXVH 3DUSB 4OZIE 3NIDE 4JFPA 4OZHB 5ID0A 3RIFK 1FCGA 3SGEH 1P7KB 1QPPA 1A3RL 3H3BC 1L0QA 2EYSA 2IGFL 4K7FB 4OF5A 4TUKH 5D6CA 1FL5A 3OV6A 6FABH 5IESH 1JNNL 1BGXL 5ENWB 5IQ7L 3PL6D 4MAYC 5DYOB 3BQUB 4MLIA 3ZE1F 2X44D 4PB0H 3R8QA 4L8BB 1CLCA 2A1WL 5AUMB 5C07D 2WIMA 2AJUL 5ALBH 5GGUB 4UV7H 3F6IA 1ND0A 5LGJA 5SX4I 4W6YB 3DVFA 1D5XB 4TQEH 1CE6B 2GITA 3CDGA 1M1SA 3FO1B 1XR8A 2E7BA 3O3EB 4KTEH 1LO5A 5EU6A 1PLGL 5A2IH 3CMOL 1DQTA 4NUJB 1GOFA 5LBSL 1EEYA 2R69L 3OKDB 1VACB 2X1QA 5D1QA 1BWMA 3UJTL 5H37H 5FUZL 1MIML 4CVUA 4JRXB 4XWOD 3OAYH 5DEGB 4KHXL 1FIEA 3LY6A 3TNNB 1N26A 5DFWH 5BQ7A 3GO1H 1Q1JL 3LB6C 1I7UA 2H32B 5FCUH 4YNYB 1EA9C 5MI0B 4BQ8A 2IMMA 4OZ4A 5F9AC 4K3GA 3FB5B 4ZO9A 4RAUB 1CD1A 1QG3A 2VR5A 2P4AB 4EJ1C 1Y0LA 3G6JB 1JP5A 5B38G 1HILA 1N6QH 4WEBH 1ETZB 4MDJB 1JUFB 1RIUL 4LHUA 4Y88A 3LSOA 2C1OB 4Y2DD 5TGBA 4G7VH 3S7GA 2QV2A 1OSPH 1BEYL 1EHXA 5KZCD 1MVUA 2AK4A 4MB4A 5C0RL 5JPNB 5I1JH 5IFJB 1JF6A 4RWYL 2NY7H 1DUZA 1I85A 4CVZB 1E4XH 5F88A 3HLAA 4GW1B 3FFCB 2VXTL 4LFHD 4YDVB 5KBNC 5DQJB 5I19L 4ODSH 4H26B 2IPTL 4YHIB 4Y5VA 2F53D 3SE8L 5F72S 1NFDB 4HUWA 4DN3H 3VD5A 2X9XA 3MCG1 3GSNL 4GRWE 5TH2B 4OLZL 2NY1D 2WWKT 4R3SB 4XMPL 4JFZH 4RBPH 2VISB 3TCXA 3RY6C 1LDPH 2NXYD 4KJYB 1DEEA 1MCKA 5JW4N 3GSRA 5D93C 1BHGA 1FO0L 3VI4F 1H8NA 3KR3L 2Q1EA 1ZT1A 4HXBH 4GBXA 25C8H 3NCMA 1FCCA 3FTGA 5IFAL 3MJ7B 1INEL 1KJ3H 4NQDE 4Y5VC 2ZUTA 1Q9OB 1OTTC 2J1KA 3BP6B 4JFQB 2DDQH 1Z6JT 2YPKA 1BZ7B 4M5YH 1M7XA 1LILA 4OSUH 4EI6A 2VZ1A 3GIZH 3I84A 3QWRA 4WUUA 4LGSB 4MJIE 3QDJB 3ZKXB 3GSXB 5FYLE 2QLVB 1GRWA 3WIHH 3O3DA 5HVHC 3CH8A 3IRPX 4WEUD 2OL3A 3ULUC 5I19H 5IK3A 2P46B 4WI3A 3QBTB 4YX2H 3SE8H 1WWAX 1FVCB 2ESVB 2R56L 1NL0H 3BP7B 1IGML 2VDML 3I50H 1IJ9A 1AKJD 1JHLL 2XA3A 1L4IA 2XFXA 4HBQA 1U3JA 5HVHB 1PZUB 3I85A 1BP3B 3IFNH 3ZYOA 5C9KA 4XMPH 5CP7B 5E00B 4L1HA 2B2XL 2Z35B 1EEZB 3O3AB 3CZFB 5DJCA 3KDMA 4XMLH 1I9IL 4XT1C 4O2FA 5HPMA 1Q94A 2YC1A 1WITA 1BAFH 1OPGH 3PWUA 4XBGA 5FCSH 1QA9A 1IAMA 3QIUA 3L3GA 3FN0L 3EBAA 1V7NL 4KI5F 4HDIB 5HI4C 3LS5L 3O45A 5BXFB 1I9RH 3CXDL 4MJID 3JZ7A 2DLFH 3IJHB 5IB3B 5IW1B 1XGYL 2WV3A 4DFHA 3D0VB 2E8ZA 4YE4L 3CFDA 1DBBH 3HE6B 3DX9B 3QIWA 3EO9L 4M6OL 4DQOH 3OKKA 4MNGB 3RDTA 1MWAB 1DBJL 4X6BA 1B4RA 1CXEA 4QTHA 5DRWA 3BIKA 2FD6L 2JJVA 5KTEH 1NGWB 1WBYA 5DVKA 5IVZB 5HHVL 2CDFB 4ZS7L 1QFOA 1I8IA 1PEZA 1T4KA 1TZGL 4JGJA 1NEZA 1C5DA 4K7PX 4JRYA 2WQRA 1INDL 2Y7QB 5DC4B 4U1SB 4XCFL 5FOBB 2Q8BL 4YDIL 3VDCA 3GJEB 3OXRA 4M7LT 4PLJD 3EYUH 3I75A 1GC1H 1A5FL 2E6QA 3HG1A 1Q0YH 3GSWA 4M8VA 4N9GA 3IB4A 3FN0H 2X89D 3PGCA 5KANG 1NCCL 2PXYC 1PY9A 5I1CL 3OB0K 5E2VL 2DBLH 4P59L 4MZ3A 3X12B 4APQC 2C3HA 4HUXA 4N8VA 1GZPA 4P9HL 1OAZH 5C09D 4X6DB 3OJVC 2F74B 3B6SB 2Z91A 1P5UA 4GRWB 1I3GH 1BJMA 1JGUL 1E4KA 8FABA 1WCBB 4K3DH 3DVGA 2J8UF 4WI6A 3BGFB 1FZJA 3HB3C 1CU4H 3TWCL 5FYLH 5I30H 3HE7A 4X83A 3N0PB 4G9FE 4RFNB 4ZOEA 1NGXA 2G5BA 3ZHDA 1CBVL