2K9FB

Structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
b'MALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTNPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGSAEAGVCYPPVDTEFDIFGNGTYHPQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Oxidoreductase
total genus 19
structure length 128
sequence length 128
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 2k9fB00
1VRSA 2K9FB 1JPEA 3PFUA 1JZDC 1Z5YD 2K0RA 1L6PA
chains in the Genus database with same CATH superfamily
2P1YA 4X50A 4ADIA 1Z66A 4FI8A 5DRXB 5BQDA 4Z7VF 2NZIA 3U7AA 5GS1B 4J39A 4LCWA 1G7QB 1NKRA 4TUKL 4RFOL 3V9CA 4J3BA 5FO7A 4FXKB 2XFXB 4YHIB 4L37A 4ANUA 4FA6A 3IMWA 2IJ0C 4L5FH 1IVLA 1QHQA 3AS3A 5I74C 4CILA 3TBSA 2RALA 4IOFD 5IWLA 2N1KA 1ASPA 5I16B 4P57B 4AXWA 2PWDA 2J88H 3V0EA 3S36H 4OLWL 3BDYL 5K69A 3Q7JA 5HVGB 3ZL4H 4XCYA 1NIFA 3KJ6L 1IV8A 2O93L 1W72H 5AZEH 1HINL 1BBDH 3M8OH 4LCYA 4Y2DC 4HKBA 2YRBA 3ILQC 3NCWA 1BOGA 3S3CB 4B97A 2RGSA 5K9OA 1BP3B 3U2SB 2AQPA 3WNKA 1NBYB 3U46A 3DYOA 2OK0L 3BYTA 2HFEB 4HHAB 4CNIB 1I9IH 3FB7B 5EZPA 4H0IA 3B9EA 3FQWB 5HGBA 5GGQL 1BWMA 2V5RA 2XICA 1WZ1L 3MGOA 4E41B 1NC2D 3WTVA 2E74C 3GSNL 4PJAE 5DQDH 5ECJE 3B2VH 4WU7B 1E4HA 3AQXA 3CUPA 2MCMA 1VADB 3DX6B 3GRWL 4OJYA 4Y4FD 1HILB 3VQ2C 1TLMA 2GT9A 3EJRA 4O5LL 1T4KB 3JTSA 4V2BA 3HI1B 2ISDA 4JW3A 3VQ1C 3D18A 2D7NA 4OZ4B 3G04A 3LDBC 1BEYH 4EMZA 1JGUH 4PBVC 1K6QL 2FZ3B 2NY1C 5ITFB 2BP5M 4YDNA 3VYPA 5J06A 3PXJA 4Z7UA 4HAFA 4X42A 1EXUB 5CR1A 1FL6B 5H94A 3JSSA 1OGSA 1DBKH 1LK3L 3CV5A 3FNKA 5AVYB 3UZVA 3X3FL 3FT4B 1K72A 3FFCD 5FGBA 3BIKB 1BW8A 4OCSL 4JG9A 3DUSA 3CVHA 3QNZB 4KKNA 1AIFB 1U3HC 3RWEA 5EBMA 4N87A 5JW3L 2AQ3A 5DZPA 1MCSA 4XNXL 4HFUH 3UTTB 4G5ZL 3BH8A 4NM4L 5GSVA 4FYTA 3BEWA 2JK5B 1J1OL 5FO9B 5HHQA 2A0LC 1ZK5A 5L4JA 3EG9B 4MS6A 1ZAGA 3TIDA 4F24A 3ENEA 4Y19D 4LSDA 5JZ7C 4ESKA 3C08L 4L8CA 2FH6A 2P44B 4JY5L 2VXQL 4QRUB 1R1CA 4WEBH 5FKPA 1LO5A 3L5JA 2YWYA 3D8MA 4Q9CA 3KPRB 4G1MA 3QUMH 1FO0A 5DHVA 5JHMA 3IGUA 2EXYD 2DYSB 1E4KC 1IM9B 1FNLA 3OC5A 1T1ZB 3ARBB 4E68A 5I8CB 1D3CA 2AXGB 2NY0D 2JKNA 4JFVA 2DWEA 4HIIA 2DI8A 4GIOA 3RPIB 1QBBA 1SGKA 2K7QA 2YC1B 3NZHH 4PG2A 4XN4A 4EBQL 1FZKB 4M8UA 3C09C 4U2ZA 1KTLB 4OB5L 3W1ZA 2X4SB 2BIIA 3R4RA 3PV6B 4XPHH 1N64L 2JKTM 1NGPH 3H8NA 3VQMA 4NUMA 3D33A 4ZO7A 4PGCA 3AY2A 2AQNA 4NN7C 2GTWB 3IB4A 1KB3A 3W39B 2YPVL 1I85C 4QYOA 1A4AA 3NDZE 1Z3RA 2CPCA 1FNSH 2XTJB 1ZVHA 4NP9A 4OGXH 5EIIB 4OJFH 3G3LA 5D1XA 2BNRD 4B0MB 4IBZA 2OMZA 4WU5B 4AYEC 4BSJA 2XZQH 5CINL 3PPEA 2P8PB 2R0LL 2WPGA 4GXVH 3KM2A 1UKQA 4Y4HA 4XAWL 4M6OH 4F9LC 2F74B 2GUOA 4LLDB 2F0CA 1JN6B 1GGYA 4APQD 3GUTA 4ZDHB 4Y0GA 1CBJA 3KXFB 4LARL 3WTTA 1F4WH 2EECA 5ICUA 1JWSB 4ZW3A 4ZW6A 5MENB 3I6GB 5D7LE 4XTRD 1HNGA 1HS6A 3IETA 1PZ5B 4LSUH 2GQHA 1M4KA 4JVPA 3DX8B 5SV4A 2ADIA 1RZKL 1GS6X 2UZPA 2HJKA 2CA3A 3WXWH 2CBQA 4W4OA 3QDJB 3SDXE 1PFOA 4JHWL 5LVEA 3QDJE 1Q38A 4HFWA 3UGEA 2NDGA 1MRCH 4TQEH 3WJJA 2BW4A 1AS8A 1JZ6A 3ARFC 3PXLA 3DGCR 5KN5B 3MREB 2P5WE 2WSKA 1SJEA 3BFWA 4NQCE 2NXYC 3ARPA 4LU5L 4B27A 4HOMA 4B7IA 4LBAA 3MXVL 1WZAA 2IH3A 4P5TB 3HAEA 4GUQA 4R4BA 5KVFE 4HLZG 3G5ZB 1TT6A 5E03A 1QR4A 3KBHE 2OA9A 2WLMA 4AOFA 3BQUA 5AL8A 5E2TH 3I6SA 4LOUD 5FUCE 5C6TH 2OTPA 3T4YA 5DLMH 4JGUA 2ZX5A 2I5YL 1IGFL 3WS3A 2FLRT 2W60A 4XO9A 2CK2A 4X9FA 4ACPA 3QG7H 1WICA 1XF1A 4U6HA 1EFXB 5EEUA 5F96L 2WTRA 4I9WD 4YXHH 3MNZB 4LESA 1J9TA 2DLTA 3ZW3A 1D9KD 1JWMB 3O0RH 3VSVA 1PLBA 3KPNA 4B95C 4BDVB 5AKVA 2O6EA 4NIYE 2WVUA 1AGBB 2F5BL 3FZUD 1GGTA 2W1NA 1CU4L 3TO4D 3KVPA 1K4CB 3PQYD 1EGJL 5D7IB 2R51A 2YBRB 3V7MA 4P46C 5DVNA 2A1WL 1WBZA 3DSFH 2NY5L 3GK8L 3IWUA 1BFOB 4LCCB 3C8HA 4MHHG 5TJWK 2VERA 1P7KB 3VU2A 4M43H 4ENEC 1G6VK 3VXMA 4AUYA 4X4ZA 1J7VR 3K91A 2DBLL 3CFUA 5SWZE 4MMZC 3B37A 1ZA6B 1N26A 4QLWA 2J1XA 1XIWC 1ZCRA 3GO1L 2WWMD 2ZG1A 4QHUB 3C5JB 2A6JB 4TTDC 4A7VA 2BSTA 2OSLB 2NY2B 5C08D 1N6UA 2BNUA 1QA9A 5DD5L 4B9PA 3LSOA 2WTOA 1MWAB 3LPGA 3O6FA 3V8CA 2VR6A 2XN1A 4BA8A 4GH7B 5HHPA 1RPUA 1EUTA 2XWCA 3KWUA 4P9HL 3P9WB 1MFMA 1MEXH 2NDFA 2J6EL 1JXKA 1NANI 1TKWB 2NX5E 4KRMB 4F58H 4Y4KB 2YPKA 4ZMNA 2GBVA 3KGRA 1T7XA 4ODWB 3L13A 4IGBB 4YWGH 4D7BA 1IGJB 1KGXA 5AZ2L 4P04A 1MRDL 5KYUA 1G9ML 3VNZA 2DJMA 5IV2A 5C07D 2UY7B 1F3RB 4HW6A 4FQCL 3BUPA 4ODUB 2MWCA 4ZX4A 4NQDB 4YBQC 1MDAA 2JELL 1QSEB 4KI1A 5EZOH 5KYWA 3T04D 5IB2A 4JRYA 2PABA 1ZHBA 3UYOD 3EW3B 4IHBA 1PTZA 3G6DL 3MV01 1NCDH 3UAFA 4LQFL 4PJEB 4B6ZA 4BUGA 3H9SA 5L2KE 3RB5A 1MVUA 4QTIL 1ZSDB 1OB0A 4NNPL 1AO7E 4F15B 4TNWF 1XL6A 1NCAH 1S9XA 2H4EA 1Q94A 4KKZA 1DJHA 1AZBA 3TN0B 4AQ1A 4I4WA 2FIKA 2P45B 3L9BA 5T1JA 3LN5A 4O9HL 1SYSB 4Y16C 3HR6A 5BV7H 5C0DA 4FHJA 3W56A 1ZEAL 2EDDA 5TE7H 5KJ7E 1MRFL 1C7TA 1KIQA 1HI6A 5DJDB 4HUVA 1P84K 1OVZA 3MOBL 4JBSA 2XG5B 3WDIA 3QJHB 4M5TA 1QACA 4JFTA 4BFJA 4XH2B 4XNMA 5FLUA 5IJCC 1A7PL 2AEPL 3U9PH 4UM9B 1QRND 1HQ4A 1COBA 1HIML 2J8UE 1I9JL 4P2AA 3UO8B 5L8LB 1OGAD 1AY1L 3OQRA 3SYPA 5HPMA 5CP7B 3SGJC 1UB6A 3SE4A 1JCKA 1X44A 1PDKB 3TNMB 3Q6GH 3ZTCC 1F6AA 3ULVE 1T21A 5T5FL 3WV0A 4Z76B 2CR3A 1BAGA 4IU3A 4X6DF 1VKXB 1SXCA 3D0VA 4ACTA 5DT1L 4B9YA 3NP4A 1LL1A 4JFEE 1I8UA 1QPKA 2YARA 4LRIA 1TMQA 4N90E 2JCCA 4JQVC 2ZSVB 4NKMB 1YUHB 4JPKH 1NC4A 4U3SB 5K5YA 2H9GB 1MH5B 4IOFC 15C8H 1SMOA 4NKIL 5CLXA 4FKEA 3BX7C 1F58L 5D2LB 3VCLB 4J3UA 3NZUA 1U8HB 2VDOH 3T3PF 4PW9A 1SHSA 2WGNB 3MCLH 3WJLC 4XX5A 2H5UA 5ADOH 2V2TB 1QWUA 1OD9A 4LLQA 1CT8A 3TJHD 4CU6A 3KLLA 1JDCA 3S37X 1G5GA 2MPVA 4X4YA 3HE6D 4OZHB 4DN3L 3D0LB 1OB1B 1PZDA 5L6YH 4G7VL 3HTLX 3SDAB 1AGCB 4PG9B 4BZYA 1R3IL 2X7LA 4OCLC 4U6VL 4X6CF 4QNPE 1MQKL 4QUOA 4Z7WA 5F7AA 1YN6A 2P49B 3V4VH 2HG0A 1JERA 2GBTA 2GY5A 3V5DA 5LDUA 3G6JE 3QJXA 2X4NA 4Y4FC 1ZT1B 2ESVB 3K0WA 4WSGA 5F9OH 5I75C 4S2SA 4Q7DA 1BQSA 4UYPA 4XOCA 4HZAA 3GSUB 4XCEA 1J5OL 1QLEH 1CYXA 4YHZL 4FNQA 4HWEL 1D5MB 1CF8H 3SKJL 3ROOA 1CURA 2ZOKA 1Z3GL 1HHGA 5EC2A 3NTCH 1P4UA 3LHPL 2BFVL 1GMIA 5AYQA 1RZJL 3GMRA 4LHQB 4BFFA 3VGAC 3R1GL 4XXDA 2YQBA 2FWOB 5DRXA 4HKZB 5GS1A 3GLDA 2EINB 4B9IA 2CO4A 4U49A 4YHNB 2BOCB 1G7QA 2Y5TB 4PJXB 4AV5A 2F5AH 4K3DL 4XNQB 3VG9C 2DM4A 1PIFA 1A4BA 5JW4Q 1PCSA 4FXKA 4YHIA 2B59B 3FTXA 4JZNA 3M7FB 2ALWA 3FHEA 5D7EA 2QT6A 1TVHB 3ECVA 1USZA 1AFVL 4FFYH 5I16A 4ODVL 4P57A 1JYNA 3LX9A 2QV2A 3VGGA 1DLHB 4EF3A 5I30L 3H3BC 2JB5L 1KXQE 3SGKA 3ETSA 3PL6C 5E99H 3W82A 1NMBL 1C9SA 3U2SA 5E6UB 3ULAB 5AW0B 2D3LA 2EXYC 3CXDH 2GSGB 3NJFA 3FH5A 1NBYA 4ZPVB 5B38B 2FWLB 4YUEL 2EDMA 2HFEA 4M62L 4CNIA 1AXTL 5EU7E 3SE8L 3FB7A 4MJID 2NY0C 1W0YT 4OZGE 3BPCA 1DDTA 2VMDA 3D07A 4HH8A 1A3RL 1GZHC 2AQTA 4HGMA 4E41A 5D6DC 1FGVH 1CLYL 5CJ5A 2FEEL 4WU7A 1JF1B 2LOEA 3QW9A 2R1YB 2Y7SA 3FRPB 3N1QC 2MCPL 1VADA 3DX6A 2LFGA 3IE4A 1HILA 1AHWC 4JPWL 1TYJA 2ZP0T 4ONGL 1FZJB 1KENH 3DWTA 3HHSB 4Q9BA 4G6KL 1UACH 5I74B 5HD8C 3NEOA 2DLFH 3Q2CA 2JQZA 3OMNB 3CZEA 4HS3B 5CUSL 5IQ7L 2OCJA 2F08A 4MDRA 2B39A 4L48A 4OZ4A 5F1OB 1EV2E 4DETA 1S9KC 2QSCH 1LP9F 3EO1B 2XKNA 1MFCL 3IDIB 1D2PA 2FZ3A 3QQDB 5IVXE 5CCGE 1G1OA 1OAZH 2V17H 5ITFA 2XI9A 1GYAA 2IVFC 1EXUA 4A2EA 1FL6A 4K15A 1YMMA 4Y2DB 1UWXK 4JM4H 4G8AC 1ACCA 4LDEB 3FT4A 4KKCD 5F70A 2OP4H 4TQHA 5IKCB 4WUUE 4JFYB 1XBDA 2VDQL 3LH9A 4LIQE 3BIKA 3IDJB 5DO8A 3TIEB 1P9MA 5E9DB 3HCVB 1KB5H 2XNAA 4XTRC 3TT1L 1KCSL 4UIKH 1AIFA 2NRDA 2AAVA 2R0WL 3NACL 3QZNA 2C9XA 3APDA 1WBYB 3UTTA 2IIJA 4FG0A 2R1XB 1V10A 4DPCX 2JK5A 1FGNH 5FO9A 4KGJA 3ZE2F 4LPXA 3EG9A 5F6IC 1C1EH 3VYNA 4U0QB 3L3OA 3CPLB 4LKCA 1L0YA 1CJYA 5JOEA 2E8ZA 3WS6A 3GHBL 3KPRA 4MBRA 4U31A 1R24B 4DW2L 1RK7A 3V4LA 3LDBB 2JLPA 5FUZL 4FFTA 1IM9A 3MA9H 2NY1B 1T1ZA 2VWEE 3KE0A 2AXGA 5LWYL 3TEWA 1RLWA 3AT9A 5MERB 2YC1A 3BZDA 1FZKA 1A7OL 4UMSA 2YRLA 2X4SA 2WUCL 3IRZA 4Y9GA 4W6WB 3FTVA 1MAMH 2DQCH 3PV6A 4J2QA 4YDJA 2A9CA 4AH2A 5DJZB 1QR1A 2YJQA 1U3HB 2GTWA 5J8OA 2MOQA 3W39A 1CE1L 4MAUL 3VXTA 1D9KC 4H25B 4FNRA 4NKOA 2G9KA 3QUXD 2PKDA 2PW2A 3OLEA 5EIIA 1ODAA 1NAMB 3FZUC 4WU5A 3M1OA 4XX1E 4Q6IC 3OZLA 3GPSA 5KSAD 3S5ZA 2P8PA 1KPVB 6PCYA 2X6VA 5HYFA 2FQGA 2VDLB 1DVQA 2YR3A 5T8IA 5LBSH 1JN6A 3IMSA 2ODIA 4ZDHA 3AVEA 2WWKT 3WFHB 5IJDC 1OSPL 2CGZA 3KXFA 1O9ZA 3TV3H 3DTDA 3EO0B 4LLMB 5TQ0L 1JWSA 1F4YH 5C09E 2WWMC 5MENA 3I6GA 3GFUA 5BVJB 5ITBL 4K7PY 3FYEB 3A23A 2EC8A 3SZKC 2ICCA 5I1GL 1PZ5A 2CQVA 1U3ZA 4W9EC 1RSYA 3BN9D 3C09B 3DETD 3DJTA 3AW5A 2H26B 1HHIB 1V3JA 2HX7A 1CFNA 3KPQB 3Q01A 3EYQD 4LL1A 1C12B 4PR5B 3SBRA 3V6FA 1JPFB 5JIKA 1U8PB 2B0SH 3LH2H 4NN7B 4Q9QL 4X5QA 1N67A 1QABA 4JG1H 4K3JL 1T1XB 3NJNA 2PCPB 5KUMA 1KN2H 3W0WA 2VAAA 2V8MA 2UZXB 3IYLW 1F90L 1Q0EA 2TSAA 5LG1A 3APMA 4LNVA 4ZSOB 3S3BB 3MREA 4ZSOE 5K9JH 3CXHK 3DTUB 4NAMA 5K93A 1CVSC 1D5ZB 5AENA 1XT5A 4ZNEA 3G5XB 4TSCL 1KIPB 5CILH 2JV6A 1Q9OB 1VCAA 3Q1SH 3RIAF 4F7CB 4BQCA 1IKNC 5DRWB 4LAQH 3UTPE 2ICEC 3GRGA 4J23A 4TVUA 4IMKC 2EYTB 4AKPA 5D7SL 1G0YR 2NYZA 1A47A 3DOHA 2B5IC 1EFXA 5FOJA 5HJBA 3BAWA 1SXAA 5ALCH 3MNZA 1FO0L 1JWMA 4L0YA 3GBEA 1TETH 5I9QC 5HHNA 5GRZA 1PNDA 5BW7C 5AEAA 2IV9A 4BDVA 3UDWC 1T2XA 4JFUA 3WEBA 2F1BA 4TLSA 3OWEA 1K4CA 3IJHB 5D7IA 2YBRA 1JJUA 3QFJD 3APCA 1K9TA 1BFOA 4LCCA 4P3WA 2EQDA 2WUBL 4ELMB 4AITA 2UZYB 3CMOL 3IXTA 3CZUB 2Y6SD 2NXYB 4ZMLA 4ZJ9A 1JHKH 1J1PH 3CQPA 3L7EB 4M1CD 4Z9KB 5FO2A 1ZA6A 1CGXA 5IQNA 1ULVA 4P3DB 1EJFA 3F7PC 2VXSL 5B21A 3RKPA 4QHUA 3C5JA 2A6JA 1PEWA 4MA8L 3DLQR 3AWEA 5D71L 2OSLA 2EEAA 3A6CL 2EKSB 3V5KB 1RJLB 1NEPA 5TH2A 1A3LH 4K9JA 5DK2A 1ASOA 2LT9A 5KVGE 3VFOA 4CVWA 3MJ7A 4Y5XB 1RIUH 1GXEA 4JFHE 1X3DA 5IMLA 2FSEB 1D6VH 2B9BA 1EDYA 4Y4KA 1UQSB 1G5AA 1RCYA 4Q9RH 3GMPB 3OZ9H 5EOCL 3DNKA 1BM3H 4PI2A 4IGBA 3BP6B 2ZCKL 5CJXA 2PR9A 3DECA 1EO5A 2Y23A 2RCSL 4NFCA 4Z6AT 1ET5A 4P46B 2UY7A 4FYQA 4ODUA 1YNLH 2V0AA 4UMGA 4NQDA 3AC0A 5AFAA 5CO1A 1H3VA 1QSEA 1EMTH 4PJAF 3WU1A 2OMTB 4JDTH 4UTAH 1BVNP 5I66A 2P5PA 5F89B 5SX5H 2Z7UA 1EHAA 1JZJA 2O26U 1A4KB 3C60D 5IJVB 4PJEA 3TJHC 1XIWB 4LSVL 4JJ5B 3V4PL 1FVCA 4FNSA 3S37L 2AHIA 1ZSDA 2NNRA 1HL8A 3HE6C 4JRLA 4WHYG 4W9KC 5ESAB 1X5GA 3SE9L 4PRDB 3ZGIA 3LIZL 2OYLA 4QRAA 2NR6A 1A6TB 2VIRB 5ANHA 3TN0A 1OWWA 2YD7A 1I8IB 4JK0D 1GOHA 2CRZA 4NP4L 2VC2B 2R2BB 1L9OA 1SYSA 2H47C 4P2CG 2HX8A 4K5PA 3MJ9L 3OAWA 3D25B 4R90H 3KLDA 1MCHA 3HC2A 5GZND 4DKEH 4NT6B 3BH4A 4R9HA 3LKRB 2HN7B 4HIXH 3QJHA 4XMLL 3Q8AA 4KRNA 2A6IB 4XH2A 2C4XA 5ILTL 5I17B 1JOIA 4NZRL 2Q20A 4X9HA 4UM9A 4V2CB 1AYRA 4HETA 5I1CL 5ADPL 3P0YH 4HHWA 3HPJA 1F4XH 4NBYB 1K2DB 3D2UD 3QNYB 3ZIMA 1V7ML 4BH7B 4E9TA 2B4CH 2ZKHH 5CP7A 1U3JA 1SDDB 4Y2NA 4NAJA 3X3GL 5DHDA 1A0QH 1PDKA 1T5XB 4WO4D 2QDWA 3TNMA 3BAEH 1HKLH 4Z76A 2YD0A 4XZ4A 2FUQA 2YD9A 5HDQH 2DQGH 4H13C 5TTRA 4F9PC 1A25A 2LV4A 2PPEA 4MJ4A 4X0KB 2ENSA 3SPJA 1KYOK 3DGDA 4NKMA 2ZSVA 4U3SA 1YUHA 2F58H 4DGWC 3TTSA 2H9GA 3UP6A 3QAZC 1MH5A 4HJ1A 1RQ5A 2JIXD 4NFBA 3VCLA 1KMGA 5D2LA 3GBLA 4KC3B 4LLAA 4PJGE 3SYOA 1U8HA 2VLRA 4PFEA 5FM5M 4N3UA 3H42L 4OAWB 3WE1A 1XH3B 3QNXB 1KY7A 2V2TA 2OZNA 1CR9L 4HV8A 2X89A 3UAJD 1IQWL 2EXWD 1MF2L 1NAKH 4N8VB 4XPAL 1SY6L 2CJSA 3G7TA 4M56A 4PJ5B 3TM6A 4OZHA 5LGHH 2HT2C 3D0LA 4IJ3C 3MXWL 4U1KA 1INDL 2IO5A 1OB1A 1MFVA 4RH4A 5JUEL 2WV3A 4OCWL 2VW7A 3SDAA 2KLTA 1AGCA 3SPGA 4UF7C 3H3KA 4M6NL 4A04A 2XQ0A 3W5MA 4PD4K 1QHOA 3F01A 3HG2A 2P80A 3FTUA 1MHPL 4N2OA 4DEPC 1HXKA 2ESVA 1ZT1A 3TJPA 4BM7A 1CGWA 1S5HB 4RWHA 1A7QL 3GSUA 4FP8L 1DQJB 2XXCB 1OO2A 3SBWC 4PVLA 1D5MA 2BSSB 2BNQD 2X2UA 1QBMH 4KMTH 2YRZA 5KYXB 1RP9A 5BS0E 3H3PL 3WEMA 3PXHA 3D4CA 3KPSE 1NM4A 5CGMA 3SDXF 2Q10A 3N91A 1MG2C 4KKCC 5F0LB 3BE1H 3L3KB 2FWOA 4HKZA 5FB8A 1NBVH 3P3SA 1U8LB 5I8KL 4YHNA 4M3HA 2BOCA 1SPDA 2Y5TA 4PJXA 3Q5OA 4XNQA 3V0WH 3V79C 2K7PA 4JRXE 1GGIL 1KJ2H 3F7LA 2XV3A 1G9NC 2B59A 2QKIC 5I1EL 5HGGS 5I1KH 1TVHA 3ETBJ 3MODH 4M7JH 2R0ZL 1NC2B 2Z6FA 4AG4L 4AJYV 5I73C 2F54D 2ZTBA 2YD1A 1VB9A 3QEQA 4N0FB 5HJDA 4Y4FB 3UO1H 5HYEA 1M9SA 5I75B 3WCYA 2G3MA 3L1GA 1YEWA 5J6GB 5I0WA 4MZ2A 4OLZL 4YVUA 1JGLL 2YMXL 4AV4A 4OCRH 2GSGA 4ZPVA 1PLGL 3LEYL 4IOSA 1QBAA 4TNVK 4XPFL 1Q0XH 3DRQA 4QEGA 4Q4IA 1Y7VA 4P2RD 4RMBA 2UX7A 5CEZH 4PJ9A 2CGYA 3VGAB 3GEFA 3TYGL 1T80A 2IPUK 3D9AH 3FFCB 4KK5D 4OF6A 3QPQC 3R0NA 4LT7A 4BUQA 2R2CA 2D7PA 3VG9B 2F15A 2R1YA 4G7RB 5HDBE 3Q06A 1C5CL 1P5VB 3ZZSA 2IPKB 2F9BT 1FZJA 3HHSA 2LLGA 2EDYA 4M6MH 3QUXC 5G5DB 2X6MA 4ZFZB 4HS3A 3RNKB 3QULB 1B0GB 1IL1A 3EO1A 3RZWA 5KSAC 1I9RL 2HT3C 3IDIA 3IWVA 1XH2A 1QW9A 3FTSA 4Y19E 4Y19B 3QQDA 1R5IA 4JO5A 3SE6A 4CSPA 1FFRA 4Y2DA 1A6UH 3PL6B 2FWUA 1IBZA 2A6DB 1OHZA 4YHYC 5E2VL 1XZ0B 2BY0A 1SJHB 2MIZA 4J2XA 4JFYA 3VXME 1ZDSA 3THMH 3WUWB 1MIEL 1WJ3A 4H1LH 4NPKA 3TIEA 2NY6D 3MLRL 4ETYA 2NY0B 4MRBA 2BVPB 2ZUYA 4KFMA 4IBWA 2HRGA 1CFBA 2NXZD 3ABLB 3BN9C 4KZ0A 3DETC 2VH5L 3QB7C 4A6YB 1WBYA 4PJCE 1N6QL 1JRHI 4GYBA 3EYQC 3FT2B 2R1XA 3BQVA 1PX4A 4EIGB 1ZT7B 1BZOA 3LS5L 5D6CB 3I2CH 3CPLA 1AHWB 2E3VA 2GJRA 3E8VA 3VACA 4Z23A 2PLTA 4YFDB 1PQZB 4QIRA 3PIQB 3TONA 3IPEA 5C0BD 5EDSA 2BNRE 1MY7A 1V8HA 2B3RA 2FD6H 3QXVA 5EU6B 4MD0B 2NYKA 3KW8A 1J9SA 2W9EH 3JTTB 1FIGL 1N0LB 3MBED 4PYGA 3IU3B 5F0JB 3IDGA 3TXAA 43C9A 5MERA 3I02B 3HMXA 4Z7QB 2JXMA 2UXGA 3Q6FB 1SN2A 4GKLA 2L04A 3M86A 4HIHB 1E8ZA 1ITCA 3N43F 4Y7MA 1HKFA 5HHOD 3U4BL 3NG5A 1XCQB 5J0BA 1A02N 1D7DA 1AAJA 1U3HA 2BHYA 1IE5A 1QATA 4JFFD 2IBGA 2CIIA 4I0PB 4Q4EA 1ONQB 5TK2A 5JHAA 1NAMA 4R8WH 4MB4A 3OKDA 2IOIA 4V33A 3TH2T 2J1ZA 4NNYB 5E23A 1KPVA 4L5FE 4NRXB 2LLLA 3ULVF 5FYLE 4POZD 4K8RH 1RZIB 2XZZA 4YZWA 2Q86A 3CSGA 1CGUA 3QWOB 4AW4A 3MLVL 3L5WB 2Y6SC 3P2BA 5BUAA 1WSST 4WNJA 2WZ0A 2ZWLT 3RI5K 4M1CC 1W72B 1ZPUA 3EO0A 3N9GL 4IIQC 4LLMA 3IKKA 2UUDH 3Q2NA 3Q8FA 3EJYD 4GMTH 3VVWA 2EZ0D 2OBGA 1YVLA 2FQFA 1CLVA 1Q0YH 2W0KA 3SB3A 4MA3B 3T65B 3FQNB 1HHIA 3H9ZA 4DK6A 3M7OA 5IJBC 1C12A 1NCUA 3OMZA 1PKQB 1JPFA 1YEGH 1U8PA 1CBVH 4GINA 3RY4A 1T1XA 3FCTB 1I85A 2VM4A 1D9KB 4EN3D 2PCPA 4GAGH 4OLYL 4GG8A 3LKOA 2UZXA 5HGAA 5DMIH 1E4XH 4BH8A 4N2HA 2VN6A 5A2CA 2WQWA 3TWCH 5CKGA 4YBHA 1D5ZA 1DBAL 1X7TA 4Q6IB 3N41B 3PQYB 2R83A 4NQUA 3BESR 3EIFA 5L8KB 3G5XA 1J0JA 4F8QA 5DRNB 3AMLA 3VD2A 1FSKB 1Q9OA 3DX9B 3MNDA 4F7CA 4F9LA 3PREA 5DRWA 5IHZB 2X4UB 3QA3B 3GKZA 3QR2A 1NCTA 1OARH 4K7PL 2EYTA 1W9XA 1YYLH 2W9DL 4I13B 5DVMA 5KYNA 1I9EA 1KUMA 1WBXB 3C60C 3G6JF 4OFYD 4WTWA 1IC7H 1P69B 3SN6N 4A7SA 1SHMA 3QQNA 5CEZD 2AZAA 1TVBB 4EAEA 1AC0A 1RIHL 2FQDA 4J8QA 3HVNA 4JCWA 5C08B 2CMRH 3F6IA 1AJ7L 2JJSC 1OQXA 3RQ3A 2H6OA 3SHSA 5C0GB 1I7TB 3B6SB 5F3FA 4OI9A 5CXPA 4TUJB 1YQVL 4Z3TA 4OIIH 2CUAA 4G43B 3RUGB 4FC3E 1RMFH 3V0VB 3CQFA 3IJHA 3EBAA 3KPPB 3JWOH 3PAVA 1UWFA 2J6WA 2XQYK 4LSRH 5I0VA 2D9QB 1PZUB 3SBPA 1DJIA 1QWHA 5LNGA 4JR9H 1U6AH 4ELMA 4BFIA 2BK8A 2DQTL 2UZYA 3ARED 5T3XE 2VXUH 4NQXB 2ADGA 2AJVL 5JPMC 3L7EA 7PAZA 5C07E 4F8PA 1BJ1H 5EHFA 4P3DA 4FXLA 5I0YA 4YSTA 1CDBA 4UTAL 3QUMB 2GI0A 2ICEB 3N44B 4OV6F 4WK4B 4JB9H 4UB0L 3KYOB 2ZKYA 4KI5C 3V5KA 2EKSA 1RJLA 3QXDB 4MNGB 3UAAA 3N40F 4WFHE 4MNGE 4WO4C 3WLWD 3S3SA 4P59L 1E4WL 1EJOL 4Y5XA 2RIKA 2XPGB 2WY3B 3QC6X 4DZBB 5I9QB 4NZFA 1UQSA 1K8IB 1E9PB 4XP1H 5BRZE 3OVUB 1E5ZA 5LO7A 3GMPA 1M6OB 3MAWA 5AD0B 1QNZH 3BP5B 4K2UL 3ME0A 4KJYB 4OZGF 1OOAA 4P46A 1FDLL 5KG9B 2ZWKA 5LJYH 1J12A 2IGFH 4XCFL 2OMTA 2M26A 1EZVY 2NNFA 1OM3H 5F89A 2NT1A 2YA1A 3UAJC 1A4KA 5IJVA 3LXAA 5IB3B 1XIWA 1KGYE 4JJ5A 4HLZH 1QRNB 3O8XA 3IS1X 2QPFA 1OGAE 5ANMB 1JHLH 5ESAA 3VXQB 5B3SB 2X6BA 3MRIB 4G6FD 4PRDA 2VDPB 5KSBB 3DXAD 3E38A 3I3EA 2VIRA 4OJCA 4YVNA 3VH8B 1DJWA 2YFOA 1I8IA 4XMTA 5IVXF 1DN2A 3QRFM 5KVFL 2R2BA 3Q9QA 1XF2B 4JO2H 3M17B 1T2JA 4KTEH 4ZMAT 1JYVA 1C5BL 4ANWA 2Z92B 3FN3A 3RGBA 4NT6A 4QHMB 3HPLB 1CXFA 3LKRA 2AJXL 1WE5A 1V5JA 1F4AA 3NZ8B 2CBOA 1IQDB 1P4BH 1JXDA 3QWQB 4Z7NE 5I17A 3CPUA 1YPZB 3M1BB 4K8RD 5H2BA 4ZUUB 4JMXA 2OXGA 4ZT1A 1U8MB 3RL1B 2FX7H 4U3HA 5AVZB 1K2DA 3QNYA 4BH7A 1N4XL 4G3YH 5D4JA 2MCG1 1ZRUA 4AEIL 3QDMD 2AAAA 3ZDYB 1SDDA 1T5XA 4PJ7A 1YMME 1DR9A 3S96B 1BQHG 5TPWH 5L0QC 2V2XB 1W15A 4OLVL 4K94H 2VN5A 3HE6B 2GJPA 5C3LD 4A2HA 5FKAB 2NQCA 2KYIA 1OLLA 3F64A 2YAHA 4RGND 1FPTL 1EAQA 3UFIA 2MH4A 1AD0A 1BECA 4X0KA 3UBFA 3FPXA 5A1AA 2IMMA 2HZHA 2BDNH 5B7EA 5LXGH 3L4CA 2BVTA 1YJDL 2OJ1A 3FQXA 2ICWI 1A6VL 2EO1A 4WW2B 2HG5B 1MWAL 1WFTA 5DD3H 4P5KB 1LGVA 4OAWA 4Q8BA 4MQSB 1XH3A 2LR4A 5ACZB 3NQIA 3EGDB 1MFEL 4MAZA 4JZJC 4N8VA 1PLCA 4LEEA 4PJ5A 1PG7W 3RJDA 4O51B 1UFUA 1Y6NR 2XACC 2X70A 1W6WA 2LU4A 3SGJA 2NYYD 1A14L 4D9LL 3CU7A 3EBHA 1T7VA 1W6LA 4KK5C 2Q7AA 3UTZB 1EO8H 2VDRH 4Z5RB 4QTHB 4XBEH 2E4TA 3S98A 2JQMA 3O45B 2A7BA 4JQVA 1S5HA 1YQ2A 4Z7OB 4MQXD 1S3RA 1ACYH 4EVNB 4AYMC 1M3IA 3QAZB 4WI8A 5BXFA 3CC5B 3BPLC 1S6NA 3CNKA 1DQJA 2YUWA 4FXGC 2OXHB 4KDVA 1CLZL 3OKOB 1N3NB 3VU1A 2FHBA 3UADA 1IU1A 4A7TA 1NDGA 1ROWA 3WJLA 1ECYA 5KYXA 2M8XA 1P4IL 2F18A 4ZMVA 1IFHL 1MHHB 3AROA 3V0JA 3DJZA 5FYKU 4E9WA 4ZMQA 1QFPA 2BZDA 2NCEA 1JYWA 5GJTH 3L3KA 4RGOL 4Y5YA 3AS2A 4PREB 2NTFA 3U6RB 1U8LA 3KWVA 1BFVL 1FRGH 1OCWH 3BWZA 4HCFA 4IJ3B 4PBWD 2NY6C 4MJIB 4I77L 4PIBA 3QZWB 1JNNL 1SQMA 4HVBA 2NXZC 4W9LC 3KWTA 3B1UA 3RLSA 3OAZH 2WCGA 3T3MB 4GG6E 2WQ8A 1NC2A 4Z0BL 1UA6L 4ZW5A 5EORH 4GAFB 4AL8L 4X4XA 4UT6H 1QVOB 3A47A 4N0FA 5A16B 1T7YA 1EZUA 4HK3J 4PMEA 4DEPB 1W80A 1AI1H 1WPCA 3ULVL 4OIAA 1T2QL 4EUPG 4A55A 4PB0H 4LMQI 4KHTH 1KYDA 3UC0H 3W0WE 4MAYD 5K1VA 1KBBA 3DC0A 4PCTA 1LDPL 3FB8A 3E8UL 2D73A 3KR3H 3INUL 3CZJA 4PRID 5IFJB 2I32A 1TJMA 1TJIH 2F19L 3VO0A 9CGTA 3PWVB 2XN9E 3I6KB 4NC1E 1PS3A 1TO4A 3FFCA 4C56A 5I0ZA 5JIPA 3JZ7A 4NWUH 3VI3B 4MYWB 2C9SA 3NEEA 3W57A 1N19A 3T5WA 4GJTB 1XX9C 2QKIB 1R33A 4PH8A 5CIPH 4I3RL 4OGZA 4GSDL 4G6AD 2IPKA 3ISWA 3T9WA 4HP5A 4C58B 3ETBF 4NJAH 2B1AH 5G5DA 4B96A 1BHGA 4ZFZA 1UADC 2IH1A 4GI6A 3RNKA 1MPAH 3QULA 4TNEA 3RGHA 2EEXA 5IEHB 1A7NL 3RAJH 2HLAB 3BKJL 2GJ6D 4JFDE 2VOTA 4H5SB 2Q3XA 4POZC 1TF4A 4KPHL 3PHQB 4HD5A 1FP5A 3D1MC 1HSAA 3PL6A 1HXYB 4LCUB 5E2WH 1U58B 3BFOA 2A6DA 2WNWA 4FFZH 4URTB 1XZ0A 4PLJC 3B56A 3UEQA 4BCXA 4IBSA 1SJHA 3MV7D 3WUWA 4ENZA 4CJ0A 3IGAB 4IBTA 2DQDH 3EJYC 1R34A 1AKPA 3WSQL 1KTKE 3ATBA 3HNVH 3DTXA 3GTVA 2NQ3A 2BZCA 8CGTA 3FF7A 4A6YA 1IO4C 4K3HA 3NFPB 4UYQA 3FT2A 4FADA 3ARYA 1ZT7A 5I0XA 4FE9A 1NMAH 1F42A 3HBZA 5D6CA 3ULSB 3SPIA 4PLKD 1AHWA 2V5MA 1PQZA 3QUXB 1E65A 3PIQA 1YEIL 4NRZB 4DWHA 4JRFA 5CWSB 4M1DL 5E7BA 5EU6A 5KSAB 3V10A 4BFKA 3V6BR 4BZ2H 3C6EA 4MD0A 2B2XL 1JV5B 4P4KD 4XWGH 4PGDB 4I1PA 4R7DB 2ICES 3QIWD 3JTTA 1S7XB 4HK0B 1N0LA 2ICWB 4G8FB 5DD0L 3IU3A 2Z7YA 1ACZA 5AAPA 2DM7A 4UNVA 1XH0A 3N0PB 3I02A 4HGWB 4WQOA 4WI0B 4YHYB 3Q6FA 2CBTA 4U2YA 4HIHA 4EI5C 2WBJA 3O2DA 3VM7A 4K0OA 1XCQA 2IPTH 2CJUL 3LXUX 1LO0L 2HFFA 3O4LE 3ZZLA 4PWIA 3IDMB 1GJUA 1Z9SA 2YRPA 2Z8SA 3QCTH 5DD6B 5ECGA 1KXTA 1YNKH 1PY9A 2QVKA 2WAHA 2O5XH 1XAUA 4I0PA 5D72L 4UZGA 4X98B 1GTNA 3RWCA 1CN4A 4ODSH 5AVSB 5I6LA 3ECUA 3SKOB 3ARVA 5T1DH 3MYJB 4X7TB 3BEVA 4ZUTB 5TQ2H 4OGAD 1B88A 1RZIA 2J12B 2Z31D 3W2DH 2ENQA 2Q3AA 3BUYB 1KLUA 3O3AB 2QQLL 3AREC 3QWOA 3L5WA 4KUCD 2VN7A 3TC9A 1W72A 4XNUL 2UY6B 3QR0A 3QHZL 5IW1A 5GS2H 2CUIA 4AI7A 1XCWA 3LN9A 4EJ1C 3EFDL 5EO9B 5EO0A 4PJGF 3KYMB 3PDGA 1BA9A 4RISH 1RURL 3Q8CA 4MA3A 3T65A 3FQNA 1CMOA 4OD1L 3TT3H 2BHUA 4OSUH 2VDKH 3OD3A 5T33H 3WLWC 1B9ZA 5EIVA 1IIIA 3QZLA 3WKML 1PKQA 3MV8D 3WKYA 4NQSB 5FM8A 4FXTA 3ZE0B 5LCVA 3FCTA 3PJSA 4PN6A 2Q76A 1I7ZB 2IAMD 1D9KA 1HH9B 5E0FA 2HWZH 2OCFD 1CI3M 3T0WA 1O5DT 2HVJB 3KVQA 4H8PA 5LXVA 2K0RA 2CHWA 1HH6B 4OQTA 1OP5H 3QFJB 3WNMA 1FFPA 4LZKA 5DRNA 2X2JA 4DTGL 3DX9A 4ZZKA 5JORB 3IPFA 2X4UA 3QA3A 4NLHA 5IHZA 2YOAA 3D4ZA 4R96B 3C2AL 2YGOA 2VLRE 3DIFB 4KY1L 3QXUA 1KOAA 2ZSWB 1WBXA 2J20A 2PTTB 4G5AA 3WLBB 5BZWB 4DVRL 4IIQB 4V1DE 5EOTB 1IJ9A 3NT0A 1MWOA 4LEXL 2DY2A 4BIKA 4M7LT 4UTBA 2YAQA 2V9RA 1A8JH 1N18A 4AYID 1UENA 5C08A 1RSFA 4LSPL 4HGKC 5CEXA 5H4YA 1OP5K 2OJEB 1U95B 4L2YA 1I7TA 2FX8L 4KXDA 3B6SA 1E3XA 2H8PB 4UIMB 1KB5B 5JQHC 2MQCA 1IGIH 4NZ8A 5I1LA 3KHOA 4LHUG 4G43A 2KQNA 3RUGA 3V0VA 1O7SA 4HEMA 2Y07H 4TNWK 3QUKB 3KPPA 1MAKA 4JQIL 4NQVB 4HQQL 5ES4B 4BWUA 4HAKA 1MXGA 4XWOC 4FQIH 4YFEA 1ZLUK 3SCMA 4LOEA 3S2CA 4NQXA 2LHAA 4NZTH 3W11D 3RL2B 3VAEA 2ZUSA 1XGTA 3P77B 1F97A 3BRDA 4ZTOH 2FE0A 4NHUB 2WLKA 4JKNA 5JA9A 1NWPA 1HFUA 2ICEA 3QUMA 4NZDA 4P3CH 4GO9A 1ODUA 1KJVB 4F92B 3BT0A 4IMKA 4RNRB 4XODA 3KYOA 2F68X 1H8NA 2DL2A 2XRAL 3C60B 3HG1B 3QXDA 1KBVA 4CDGC 1I4FB 2ITCB 3T4AC 4QHLA 2VDLL 5KVDE 4L1BA 1X5JA 2ZT9C 2XPGA 3JWNG 3RX9A 5JTWA 3L08A 4DZBA 4RGNC 4L9LB 4JREC 1OTUD 1K8IA 2Z4QA 5BW7A 3OXRA 4G9DB 3MRBB 3UDWA 1M6OA 5AD0A 3BP5A 1K3ZA 2QL1A 3RPBA 4F27A 5IT2H 2DB8A 4HBCH 4N9GB 3QP3A 4KJYA 4PUBH 4RMSA 5TDOB 1UG9A 4O2CB 1RULL 2BSED 4C55A 5KG9A 1DSFH 3OAUL 2QKSA 4GBXD 5JXED 3VXUE 2NNAB 2VUOA 1PSKH 4H2CA 2ZCLL 3MMEB 5AW9B 3QEQE 4PY8I 3VB9A 1YC8A 1XGYL 1SNRA 4PVMA 4TNGA 5HDBF 1RUQH 4KVNH 2WCSA 5DK0B 3RVUD 5D1QE 3V4UH 7PCYA 5JPMB 3SYCA 2QGBA 3V6OC 3SYQA 3CX2A 3I84A 4HWUA 5IB3A 5I1AB 2F7PA 2HJFB 3P1VA 4GAAA 1QRNA 4WENB 2F2HA 3DDGA 3STBA 3D2UB 5ANMA 4Q74A 4KNUA 5GGUA 1GAFL 3VXQA 1E2WA 5IHUH 5C0CD 3MRIA 5KSBA 5C0FB 3KYAA 3OF6D 2NYYC 3VH8A 1CLOH 4RGMC 3WIHL 1OSZB 1RUPH 2XY2A 3ASOB 3TA3D 1RZKC 3MPCA 3OKMB 3OWRA 3M17A 2EJ1A 4DQOL 1ZVNA 4Z7AA 5BOPA 1XF2A 4RMRA 4ABVA 4F8LA 2JKSA 4TF4A 2DWSA 2Z92A 4GKSB 1NLBH 2V3FA 4QHMA 2EXTA 1LEGB 2ZWYA 3EAKA 3HPLA 3IBOA 4IRZL 2YEVB 4H26B 4KNSA 4AEHH 3NZ8A 4MQXC 1TSHA 1IAKA 1IQDA 3VXPA 2JIXB 4PW4A 5AYUH 4G8IA 4Y2LA 3U36B 1C7SA 1U42A 2CKBA 4K5LA 4OR1A 4XCCH 1YPZA 4G6MH 4O58L 1HXMB 3NESA 3DGGA 4F33A 2O5NA 4ZUUA 1A1NB 3MLXL 1B90A 4N0UE 4WTZA 4PJCF 1BDYA 4UAHA 3RL1A 5LQBH 5DWUL 5ESQB 4HHGA 1RPQA 5A3ID 5IF0B 3UTSE 1WZLA 3SKUD 5CBAB 3S88H 2E6QA 4EZJA 5CM1A 1JNLL 2TSBA 3S96A 1MW3A 4N2GA 4LFHG 5I5RA 2V2XA 2SEBB 1F1GA 3HE6A 1SOQA 4AQOA 3L2LA 3EJPA 5FKAA 3ZGHA 3KLAB 2V5YA 3LTVA 1HDMB 5K59F 1AHMA 4FA7B 5EDXA 4AJ0A 1L6XA 4BEIA 2QLVB 43CAA 4JO1H 3MBXL 4PS8A 5C7XH 2CCWA 2QV4A 4Y1AE 2OSWA 2LU5A 2WLHA 1HNFA 1OSEA 2DQUL 3RVTD 5C2BL 2IMNA 2PR4H 4IEFB 1LEKA 4WW2A 4AGOA 2HG5A 3KYKH 3AUWB 4P5KA 3I50H 4FQXB 4FI6A 3CFKB 5KVGL 3VI4B 4XMPH 5DEGA 5ACZA 3RU8L 3S3PA 5E8PB 3EGDA 1NJ9B 1ZJBA 4NFDA 5DZ9A 4D0CB 4LCIL 4MAYC 1E28B 4FNPA 1FH2A 2BNQE 2W88A 4YHMH 2ATAA 1M57B 3QR1A 4QT5B 4O51A 1IGCH 3TU6A 2KT6A 1KFAH 5DC2A 1P7BA 4P2OD 2BX5A 4Z78B 2AXFB 3SE3C 2W0LA 4PWGA 2AQQA 1RUKL 2X9ZA 3WEXA 5HHVL 5EIQA 3FONB 4KXCA 5D5MB 3A5VA 4Z5RA 5L0QB 4WHYH 3WE6B 1CICD 4GKNB 3GPEA 1MJUL 2X9YA 2GVYA 4F9PA 4N2LA 3O45A 3MUUA 3K46A 1BOYA 4G6AC 3F2LA 4XMKH 3PP4H 4EVNA 3NCYP 1XSOA 3DV6B 4WWPA 4EN2A 2PYFA 1RZ7L 3A67L 2OR9L 2QBWA 4I2XE 4UWQB 2F54E 4S1DC 3OKOA 1N3NA 3UZEC 1KULA 4C83B 4MKTA 4F2MB 1P53A 1WK0A 3NAAL 1UEMA 3QCVH 3PLYA 1MHHA 2DMBA 4QXUL 4YHLH 3VXRE 1KYAA 1IZJA 3EYVB 4LSSH 1T3FB 4HS8H 2XX1A 5EU4B 2ZX6A 4PREA 3U6RA 1IGMH 2N7BA 2I60H 3ESOA 2WWNA 1BQRA 1QTSA 4MJIA 4UBDD 5I82A 1GCFA 3QZWA 4P2RB 2I27N 2EE0A 3ARDD 3JV6B 3T6QC 2WMPB 1PMYA 4A2LA 4K94C 4E9YA 3HLKA 2KC0A 2FAUA 2GEQA 5FUOH 4E9LA 3E80A 1LO2L 3OB0K 1DQDL 3RTQD 1NGQL 4BQ6A 1QVOA 3U1SH 5A16A 1S5IL 1TJHH 35C8L 3QCUL 4PLKC 1X9RA 3POHA 1F3DH 3X14B 6CGTA 3A6BL 2P52A 1IC0A 2VMFA 3C5ZA 1YY8B 5CLYA 4HJSA 1EHLL 4FXGB 1VF5C 1FORH 4WHCA 2OQJA 5E6RB 4GY4A 3BVXA 4KNQA 1TCMA 1ZLVH 3SBWA 3MSPA 3HI5H 1FWXA 1UJ3C 4G59C 2YLKA 4P4KC 5DI8B 2DI7A 3UPCA 3OZKA 3QIWC 4JM2D 4R97C 2VN4A 2GSIB 4AGLA 5IJKA 5IFJA 1Z5YD 3KDPB 5E4AA 3PWVA 1XF3B 2ZQKA 3I6KA 2BH0A 4FQLH 1FC2D 2DTMH 2JI2A 3MLYL 2C5DC 3LVEA 1ORQB 4QRTA 3SD2A 3NABH 4CC4A 3VI3A 3QDGE 1OZUA 2XWJB 3O3DB 4F5CA 4Q6YA 5L9DL 2UX6A 1MCKA 5DHEA 2BY1A 2NXZB 4M5YL 3GSOB 2YWZA 4XRCB 4BFGA 4FTDA 1KZQA 1RERA 1C5DB 1KBWA 1X5IA 2R69H 3N44F 5IEHA 2QTEA 2HLAA 5JXAH 3E3QC 3ZVVA 2ZKXA 1MKFA 2J21A 1E8XA 4H5SA 4OGAC 2Z31C 3LRSB 5C0BB 2ZYSA 3PHQA 1IB5A 4MWFB 1HXYA 3T09A 2Y69B 2R4RL 4DOHB 4CKQA 1KCWA 4IS6A 5HYJB 4X6EA 5EB9A 4J6RL 1DDHB 4ERSH 1GRWA 4NZUL 2EACA 3BIBX 3FSAA 3IGAA 2WZ6A 2VKWA 3S0PA 5I23A 5E08H 1YNTF 2QQKL 3NUKA 3QIBD 5D2NA 1PFCA 4TQPA 1GPOH 1NBCA 3HAEG 5E8DH 3QK0A 3NFPA 1SBBA 2KKQA 4PHZA 5HHOB 1WA2X 1HWGB 3CLEL 4U3XA 4FG2A 5C97A 1IKFH 1A5FH 1PAZA 1CK0H 2FL5B 4XN7A 3ULSA 3AABA 5A2JH 2IAMC 3DIDA 2Y72A 1NIAA 2BJMH 1FL5B 3I6LD 3QUXA 4JFFE 2VLJE 4PCYA 2JMRA 2AQRA 3P30L 2BIQA 4KXZI 2HYMA 3ELQA 1S7VB 3BUIA 4M1GL 4NRZA 5JHDA 4FKKA 5CWSA 5I5IA 3CLWA 5KSBF 5KSAA 2FCBA 1OOWA 1R47A 1JV5A 4OIBA 4OBRA 4PGDA 4R7DA 3UYRH 3H6JA 1S7XA 4HK0A 2GBAA 3IJ9A 3N1FC 1K8DB 2ICWA 3OLGA 4G8FA 4IHOB 1HYRC 3P3TA 4LVNB 3L3JB 5EUOB 5HGHB 2Q7YB 4HGWA 1BMGA 3ZQWA 1KEML 1U92B 2DEYX 5J9PB 2OL3L 1FFOB 2YQ2A 2VUKA 4FQ2H 3U2JA 1RZGB 5I26A 3RIAK 4MB5A 1F2QA 3IDMA 4HG4J 3HZYB 3K7UA 5DD6A 1LTXA 3Q2WA 3GIZH 4HDIB 4QRPE 2JJTC 3NSXA 4M5ZH 2PW1B 3RDTD 1QKZH 3RZCD 2YPLD 4RRPA 4X98A 1RJZB 3LS4H 1TPXC 4YDZA 3EDEA 5CCKL 1XH1A 4BK5C 2EVHA 1F1DA 3FW6A 1KCLA 1ED3A 2UVFA 3SKOA 3UTQB 1T03L 2D3NA 4DFIA 3MYJA 4X7TA 5KVEH 5IBUB 1XB8A 4ZUTA 4PHXA 2F1EA 4FFYA 2ZXBA 2E9BA 1NFIA 2R2HA 1NKOA 3GSWB 2VO8A 3BUYA 3HBGA 3IMRA 3T0ED 1XO8A 3O3AA 5FDYA 3HKFA 1JXGA 3W11C 4M48L 1TFHA 2UY6A 5GRJL 1O9VA 1A64A 1A6WL 3EXLA 2N59A 4FQQB 2DQEH 2DDQH 4S1RH 4AW7A 4HPOL 1TO5A 5FYKH 3NPZB 3ILEA 4NHCL 4WWKD 5F9DC 1DBML 1M2OA 4EI5B 4J4PC 4ZMXA 4FNUA 3K6OA 3BZEB 4HZLB 1N7MH 3FU3A 1NL0L 3IGLA 4UDUB 4PVBA 1MLBB 3NPSC 1RZFL 2XZAH 2QQQA 2NZ9D 4PJ7E 3E6FB 3V2AR 4HT1H 1TJGL 4PJHB 4UINL 1R75A 4MXQD 1BREA 1FG9C 4PRPD 1SJXA 1OTUC 4OTXL 3V0GA 2JJWA 3F8UB 5B4MD 3WO3B 3CSYB 4GI9A 2JKJA 2V4LA 4GAJH 4X80L 2HVJA 1GIGL 2YK1L 2I7OA 2QLYA 2WB1A 3LZRA 2EIBA 4G9FD 4OF0A 4F57L 1MCIA 4TVPE 1L7IH 2OMXB 2LVEA 3CSBA 3WFEH 3VD0A 4GBXC 3H2PA 4XCNB 1L0QA 4RQQB 4AJWA 5DUPH 5JXEC 2DMHA 4HUWB 1NCBL 5JORA 1QZ1A 5ISZD 5EEYA 1A66A 3AXIA 5D8JH 1R6VA 3HC0A 3AREB 4R96A 2BSRB 3ATEA 3RVUC 3DIFA 1FG2B 3GM0A 2ZSWA 2PTTA 2L8AA 5LGJB 3VGDA 2Y7QA 3WLBA 1PVHA 5BZWA 4IIQA 2OR7A 5EOTA 4LP5A 5G4NA 4DN4H 1AGDB 2AABH 1XGZA 2ATPB 2DQIL 4DCQB 4XMUA 4ONFL 3WIIL 1YYML 4MLIA 5CSGA 2K9FB 1KCRH 1U3NA 2Q8BL 2BP8B 3HC4L 4HBQA 4XPBL 1DL7L 1I82A 3BISA 2OJEA 1U95A 4ZYKB 4AUUA 4H1LB 2H8PA 3QJFB 1KB5A 3GHPA 3V6ZB 2D7OA 3TA3C 3BOVA 3NEXA 1PX8A 3B9DA 5DFWH 1VGEL 3CDGA 2QGCA 5DO2D 2AMGA 2LGNA 4ZOAA 1TZAA 3QUKA 5JMRA 1AE6H 1BLIA 4NQVA 4UILH 1MOEA 4M7ZC 3KMDA 4LDOB 3W9DB 1UD6A 1ZTXE 4Q6KA 5CMAB 1QMUA 4HX1B 3WBDA 1A4CA 4PMFA 3RL2A 3F00A 3P77A 4HSQA 3FQ1A 2BIOA 4Z95H 3R8QA 5LNEA 1INEH 1KTCA 1S7TB 2KMWA 2CLVB 2BVOA 4U1NB 3SQRA 1KJVA 4QR7A 3IXAB 3VFNB 4RNRA 2DM3A 3OMIB 1RXLA 3T0AA 2W9LA 3HG1A 4UT9A 1EANA 2ITCA 4L5FL 4P9MH 2AK4D 5IIEB 2CO3A 1DJSA 2WLLB 1ADQH 3HS8A 2VDNH 4DT2A 1S7RA 2J88L 4QY8B 3S36L 2Z1KA 1SLXA 1UA7A 4G6FB 4GW1B 4YX2H 5AVVB 4L9LA 3DXAE 3QQXA 3ZL4L 1THCA 1KZYA 1TXKA 1W72L 2M1KA 4G9DA 3SDDD 3MRBA 1TCRB 5AZEL 3BT2H 1OAUH 1BBDL 3M8OL 3GINA 3P9LB 5E6ID 3O11B 5JDJA 4PD4J 4N9GA 4YDMA 5AOIA 1NTDA 5EEZA 5TDOA 3RVTC 1Q90A 2ZOUA 3NYKA 2NNAA 1P4LB 3WKNA 5D9SB 1FV1B 4HJJH 1I9IL 4CGUB 5LAPA 2JFCA 1BVKB 2WVTA 1BVNT 3JXAA 5JPMA 3MRHB 4F8TA 3LQZB 5BZDB 1NEUA 1WQVT 3PNWA 2HJFA 3WY1A 5DQDL 4ZQTA 3B2VL 3D2UA 4P2OC 5C0FA 3HUJB 3ARQA 5ERWB 2PP9A 1CQKA 3QDMB 1BXXA 2GYSA 1OSZA 1HL4A 3T4AB 4Z3GA 4P23D 4WY7H 2WCPA 2DLHA 1ZLDA 2VZUA 3OKMA 6FABH 1CICC 3NFSH 1RFDH 1BEYL 4GKSA 4RGNB 1JGUL 2R29H 3BKCH 1QAWA 4KZEH 5JIMA 3OHMB 4H26A 3NJHA 2CDEB 1JK9B 3FO9B 4UTBL 1DBKL 5GGVY 2FIRT 1DYZA 2JIXA 3UH8A 3QUHA 3U36A 2OW7A 5I1JH 1HXMA 3CFTA 5J5EA 5ID1B 1V54B 3UG3A 3N6YA 2BVQB 5ESQA 5D7JD 3S2AA 3VFRB 5IF0A 3FMGH 3LNGA 4X4MA 2WKLA 1OALA 5FHAH 1TZ8A 3DVFA 5DCCA 4HFUL 1BZQK 1JZ7A 1CG9B 1JVKA 2SEBA 5JLZB 4BFRA 2ZXEB 5FYKD 4BCYA 4UBDC 4AGMA 3KLAA 1HDMA 3N0AA 3VWJB 3ZDWA 2ED8A 3ARDC 4RGMB 5IW6B 2WXQA 3GSNH 1D7CA 4WEBL 3CDFA 4Y5VC 1ASQA 4FNTA 4L3EE 5LBVA 4OV5B 3QUML 2MNWA 5D96C 2WZPA 4MNQD 2Y7LA 2P48B 3RTQC 3UMTA 1UVQB 4IEFA 3PAZA 1XGUB 1IFRA 4FQXA 1FZOB 1YRKA 3SO3C 2P47B 2APWA 3VI4A 4LP8A 5I8OH 2A6KB 2ZXCA 5ICXA 1DJZA 1EIBA 3LKQB 3AB0C 5E8PA 3NZHL 3OC8A 4D0CA 4FJ6A 3OR7B 1MCWW 3V9FA 4AC2A 4XPHL 1NGPL 4QT5A 1J1XH 2FEDD 5L88H 4AMKH 4JM2C 1A9VA 4CMHC 2AXFA 2JKIS 1S46A 4IK7A 5GGTA 4KHXH 1AMYA 4PP2B 3QJZA 2X5PA 2O5YH 3NA9H 1FNSL 2A4EA 3KCPA 4KX7A 4OGXL 5D5MA 4B41A 4OJFL 3S97C 2ZWZA 1XGQB 5AYTA 1QSVA 4GKNA 3MJGX 5F1IB 3V0AC 2XZQL 4GXVL 3IMBA 2R4SH 2J5LC 3SDYH 2QHRH 2C3WA 4M6OL 1ZS8B 4PCKA 1MSPA 5ALBH 4D7PA 3J27A 4GKOA 3B2DC 3DV6A 3HFMH 4K7FB 4N24A 1IAIH 3VFTB 3HNTH 3AG4B 2JTYA 3M45A 1WEJH 3S5LB 3ET9F 1DJYA 5JQ6H 2VDPL 3IM1A 1F4WL 4C83A 2E75C 4F2MA 2QZQA 2HVKB 2RTTA 2Q8AH 1IEBB 2ZG2A 4ODXA 2RD0A 2DD8H 2HH0H 4BHUI 4KROB 4PWFA 4HWBH 4F7MB 2Q3ZA 2I9LB 4FJZA 5KJRH 4LSUL 5EEXA 5BUGA 1KYFA 3VXSE 3EYVA 4MAYB 1T3FA 3G9VA 4U1LB 5EU4A 1G7IA 1UXLA 4F8OA 2ZNWA 3NJMA 3WXWL 2F8IA 1QX1A 2QVTA 5FGRA 2DH2A 1MREH 4P2RA 2WXOA 4PRIB 2C9UA 4MGXA 3QIBC 5MP6H 3JV6A 5KTEH 1ADWA 1MRCL 4TQEL 1VSCA 4NXKA 2WMPA 3L3GB 1EX0A 4P06A 1UC6A 5K1NA 4KRLB 4R2GC 2A4ZA 3JWDH 4LKXB 1Z9PA 1OP3H 3VWKA 5HVFB 4AWJC 1XGPB 3X14A 1NCJA 1VESA 3MFGB 1UWEH 1YY8A 5AVUB 2R1WA 4FXGA 5E2TL 1QSFE 1WDAA 5C6TL 3T0VA 5DLML 4AE0A 1BZEA 3NSFA 1E5CA 3MV9E 2GJ6B 5KBMA 5DI8A 1E9QA 2FT6A 1HC1A 5EIIG 3DBXB 1KTDB 3QG7L 2N0KA 1HL5A 2GSIA 3L4UA 1OP3K 3QXAA 4YXHL 2ERJC 5ETUB 2ZAGA 4MCYB 1KGJA 4TSAL 3O0RL 4WV1C 1NFKA 1JTPA 1XF3A 3EYFB 3IMUA 4E42B 3MV7B 4Z7VB 1ORQA 1ORSB 4JCLA 1G84A 1QD0A 3CN2A 1A2YB 1B4TA 4ZS7H 3ILDA 4OCYH 3VB8A 4E9QA 1LE9B 2XWJA 3WMPA 3BP7A 3DSFL 3SQOH 1JFQH 2VABA 3GSOA 3HZ3A 4KGLA 5DC9B 3RDTC 3CBRA 4XRCA 3RZCC 4M43L 5LGYA 5B1AB 3P4OB 5D7LD 3VTMA 1C5DA 3G5WA 3KJ4B 2X28A 2PXYD 4XVTH 4H8WH 2YN3A 3ZXAC 2ZXWB 4FX5A 3EBGA 3JV0A 2WXNA 1E42A 3EDFA 5JQIB 1E9OB 1NUFA 4CDHA 5F7NC 2V3EA 3L5HA 1JVOA 4DKFH 1S7QA 3T0EC 5D1ZI 1FL3B 3WFDH 4KH2A 1JS4A 2E27H 1WAAE 4UCFA 2OZ4A 5HYJA 1BG1A 1DDHA 1UJ3B 4HOWA 5IEKB 1CL7H 4P4KB 2FNBA 3EYSH 3QIWB 2VR4A 4R97B 4ANKA 2O4EA 5B8CC 2GBUA 1MEXL 3S4SB 4B60A 4CU8A 3LYRA 4F58L 2X1XR 4U1IA 3UERA 3KLSA 4WWKC 1IC1A 3VD1A 5HHOA 4UU9B 4YWGL 3GKWH 4KITB 1DQMH 4WJKB 1UYWH 3IRCA 2NZ9C 2FL5A 3VDAA 5JPNC 2VERN 2IDSA 4LEBA 4MXQC 4FABH 4XP4H 1FL5A 2RJMA 4K3GA 3LXBA 5EZOL 4HC1H 5FXCH 1OWRM 2JF1A 4H8VA 1S7VA 5JO5B 3FB6B 1IM3A 5IK3B 2R23B 4Q52A 1BZ9A 1NCDL 2D03H 5K9QI 4JFQB 2D7TH 3E3QE 3F5WB 4RMTA 3TESA 3DUUB 5E1GA 3OJMB 2WLJA 3O6KH 2Z31B 1GL4B 3HA0A 3MC0A 1CWVA 4JKLA 4ATWA 4YL9A 4EUPH 1NCAL 5AW5B 3L3JA 5HGHA 5EN3A 3HHRB 2Q7YA 5AWNH 3CLFH 3JVGA 3O3BB 1U92A 1KGIA 4JJHA 5J9PA 1KXVC 2UWEB 4X5XB 4XO8A 1FFOA 1G6RB 3UACA 3NFNA 3B43A 5BV7L 2OI9B 3B3IB 1N6VA 3BHBB 5TE7L 5IOPB 3HZYA 5SWZD 3BLBA 4HDIA 4M8RA 2PW1A 2B8OT 1YEHH 2UVEA 4Z3FA 1UZ6E 4PQXA 1TTFA 2ITDB 1RJZA 2ENJA 3CCHB 3IFPB 3IGFA 4J6IA 3C5XA 3MV8B 3WAKA 2L7UA 2WINB 5DO2C 5EBLB 3MQIA 4OJEH 2EUXA 1QLFB 1XTLA 3U9PL 3UTQA 2IAMB 1BJ1J 2IWKA 4PJBB 2XIDA 3GSWA 4EIZC 5IHBA 3AT8A 4OZFB 3ZBMA 1G9MH 3KLQA 2W65B 4L0PB 2CNZA 4FQCH 3MLTB 1UT1A 3K2UH 3PU7A 1E7UA 1I3UA 4FYSA 4QLRA 3ZE1E 3N55A 5EEWA 3Q6GL 1Q1JH 1U3YA 3MOAH 1SLVA 3SBQA 3ZDXE 1E3ZA 5GIRB 1GS8A 3MCKB 3UEZA 4ALAH 1UB5A 4FQQA 4G8GD 2QPUA 3LB6D 4EIBA 3W81A 3FUNA 5IMOB 1A4JA 3IN2A 4OFYA 3TBTB 3NMEA 2A83B 4PJDA 4FQJH 4WO0A 4S0HA 3BZEA 1L9QA 4EI5A 4JPKL 4HZLA 4J3OG 15C8L 4HIQA 4UDUA 1MLBA 2MOGA 5M95B 3MUY1 3BGAA 2VDOL 4PJHA 4IRJA 2CUHA 3MCLL 4GRMB 5F8QC 3NN8B 3T6ZA 1MHEB 3G5VB 2ROYA 1ID5I 3SDDC 5IMMB 3CSYA 5ADOL 2C9RA 4QOKB 1AO7D 1TPXB 5E6IC 5CIPB 3EF4A 3M88A 5TF1H 1ZA3B 2OMXA 2F1AA 3PNRB 4CW1B 1ZLWH 3LZLA 2MJWA 4RQQA 4XCNA 1UUSA 4HUWA 2Z91B 3R19A 3AREA 5L6YL 2BSRA 4MSWB 1FG2A 4CRPA 1CI5A 5LGJA 2YMOA 2ZONA 5IB1B 5FFOA 2YAOA 2ZXGA 5I5JA 4MA1C 4QO1B 5DA0B 4HWNA 2ATPA 3NIDE 2XPYA 3S7GA 5GSRB 4AZUA 4BRVA 2BP8A 5FECB 1B3JA 5HDLA 4ZYKA 3HEIB 1SUJA 5F9OL 3CVCA 4YMPA 3QI9D 3QJFA 3V6ZA 4P23C 3SOTA 5C6WH 5C9JB 4LIQH 4QWWD 3NPSB 1QLEL 3GSXB 3TPKA 3GMNA 3AY4C 4P05A 4UV4H 4XE5B 1CF8L 4NUGH 5D4QA 5AW7B 4M61B 4JVUA 3NTCL 3W9DA 1R46A 2FQEA 3VRIB 4I89A 3RWJA 3FRUB 1F58H 3PWPB 1ZANL 5CMAA 3WN5A 2M83A 5BO0D 1AOHA 4KTDH 4HOXA 2Y7NA 1NGZB 3ABMB 4S10A 5DGRA 4GBXB 1DVTA 4X5PA 3HG4A 4N90D 3NSJA 5D7JC 3LD8C 2F5AL 2AVFA 2VDMH 5AW1B 4FN0A 4U1NA 3C6SB 4I9XA 3VFNA 3IXAA 2BVUA 1E27B 1J5IA 5T1KB 2J44A 3TYFB 1JK8B 3KWWB 1T7WA 1XR8B 2C3XA 5IVOA 4DN3H 2WLLA 1FIEA 1Z9NA 4FFYL 2DOCA 3TP4A 3BCFA 4XN5A 5FGCB 4KJQD 5C0CB 5JHLH 2APFA 2RH0A 4YDKH 1AP2B 1E5AA 1WF5A 4K73A 3N2JA 1TCRA 1X5YA 3FO2B 4AGNA 3BWSA 2PCXA 5DVOA 3GWJA 4G72B 1KGWA 4K55A 4XO5A 5E99L 3TBWB 1DVSA 2ZCHL 4R4ND 3CXDL 4N5UA 3JBG7 1P4LA 4M7ZB 5D9SA 3UXFA 1FV1A 2VXQA 3OLIA 3QXTA 5F72S 2Z35B 4H0GA 4C4KO 3LQAH 1BVKA 3F7YA 2G0KA 2XWDA 3IEAA 1PY0A 2CA4A 3VSTA 1PY4A 3GB7B 5E5MA 2F53E 1NSNH 4EDXB 1BVOA 1IAOA 4KZDH 1FGVL 1NBZB 4ECNA 2FEDC 3DROB 3F3HA 1RL1A 2PYED 3R1GH 4LNRB 4A63A 1KJMB 1NEZB 3HUJA 3QDMA 5ERWA 1A3ZA 1FYTD 2BO0A 3MNVA 1KENL 1E7VA 3T4AA 1A7RH 2IALB 1UACL 4JFOB 3WMSA 2DLFL 4YO0B 3MN8A 1ZLEA 3ORJA 4L8SA 2QSCL 4N2EA 3P4LA 2Y4SA 2VDKB 1G9HA 5A2KH 1AFVH 1OAZL 2V17L 5AVWB 1YEEH 2CDEA 4ZZFA 1JK9A 2F7RA 1I8MA 3FO9A 1WFUA 3ES6B 4JM4L 2YEZB 1DN0A 4KQ0A 1U41A 3V0DA 4XP9H 2O5ZH 1G94A 1S4IA 2OP4L 1K5NA 3FYIB 5ID1A 5DZJA 1F02I 2PPAA 4X9GA 2BVQA 1KB5L 2HCZX 4UIKL 1GGCH 2FO4A 1C16B 1HEJC 2YSTA 2Y3AA 3V6OA 4HU2A 2IBBA 3LIUA 4EDWH 2C9VA 7FABH 3KYNB 1L9TA 4DP5X 2FT8A 5IG7B 5JLZA 1FGNL 1SN0A 2NOYA 3M46A 4XOEA 4HMEA 4P2OB 1KFGA 2XQYA 5PCYA 1R4XA 1A3RH 2DEXX 1C1EL 5KAQG 4IOIB 3VWJA 5GS0H 5IW6A 2D2OA 2WNXA 3U1PA 2XA8H 2ED6A 2VW4A 2VT0A 3NCCB 3L7FB 1IAMA 1CICB 5D2NE 1B4RA 4OV5A 3JWNH 2ILLA 5EUOF 1UVQA 3K4ZA 2A2QT 3MA9L 1OAJA 3U0WH 1FZOA 2BIMA 1BAWA 2EVIA 5IBTH 2A6KA 3F62A 5I0DA 3LKQA 2AEQH 4XVSH 1W0VB 4O4YH 4X5LA 4ABWA 3PP3K 4X8GA 2B9AA 4WRLA 3LKPB 3RX8A 1MAML 2DQCL 4HIJB 3V55A 3BP4B 5JYMA 3OHXC 4OZIB 1ET8A 4PS3A 1GKOA 3FUIA 4PP2A 5C0AE 4ZW7A 3QXWA 2C1PA 4PJIE 1XEDA 3RP1A 4HIEB 4M3KB 3TT1H 4QHKJ 1S9YB 3DX1A 3L4XA 4KKQA 5LAXB 1XGQA 3FH8A 4X6DB 5MEOA 1IBGH 4XOAA 5C0RH 2EEDA 3ARDB 1I3GH 1HVXA 4WUUD 1ZS8A 4Y5VB 1S3KH 5LBSL 4K7FA 1JMXA 1RV6X 3K2MC 3QEUB 3VFTA 1OAQH 5D96B 1EGJA 3RTQB 1AZVA 1MCCA 2PXYC 3S5LA 5F0MB 4LPYA 3TV3L 3VM5A 3ATFA 4PJ8D 3T3PB 5TE6H 1F4YL 2HVKA 3SO3B 4UOW1 2CCLA 2CD0A 4RMUA 4DO4A 2XV2A 1FN4B 2I9LA 3AB0B 4DPBX 1I1AC 1ERNA 5IROC 1X6NA 3L2NA 4HUCA 2JE8A 4MAYA 4Y1TA 1YLBB 3RIKA 3VFUB 4U1LA 2BRQA 3C8DA 4K5OA 3BZ4A 1TENA 5FA4A 3WY2A 4JM2B 1SRDA 2AP2A 2B0SL 3LH2L 4CMHB 3SE3A 2K6WA 4JG1L 4QGYA 4EIUA 4X7EC 3AG3B 3JQOB 4S0SD 3T2PA 2A3TA 1KN2L 1U93B 3L3GA 3MJWA 1MNUH 1QI4A 2WHVA 4X6CB 2YD8A 4YH6A 3K1KC 4I1NB 5K9JL 1NDMA 4XGZB 3I9GH 5DJ8A 5FAAA 2DKSA 4LKXA 4HU8A 1GC1H 4AQEB 2J6EA 2PTUA 2QQNH 4BV1A 5F8RC 5CILL 1LWJA 3Q1SL 1MFNA 1V55B 4LAQL 4IKIA 5GISL 2AITA 4ISVB 1P7QB 4OCMC 4LSQH 4UNUA 3DVGB 1HZHH 2WK2A 4PM1A 3E7JA 4HIPA 3UZEA 1V7NH 3EHBD 1M1XB 5LG6A 4NPYB 1EJ6A 1Y1DA 3AITA 4HISA 2FATH 1CGVA 1DANT 5ALCL 3QRBA 3N1GC 5ETUA 3T2NH 4PSPA 2MEJB 2VL4A 4GFXA 1TETL 1JWUB 3QO0B 4DEWA 3EYFA 4GIPD 1SQ2N 1EFQA 3E2HC 3MV7A 3V4PB 4Z7VA 1ORSA 2GJZB 3L3IB 1Y0LB 4PTTB 4R83A 4BELD 1A2YA 1KPUA 2CAKA 3QJUB 5DUBB 3TO2B 4UNTA 1LE9A 3KG5A 2WXFA 2DIAA 3HLAB 4UUJA 2OMYB 3QIBB 4LASH 2APTA 2MMXA 3GXFA 4D8OA 3VXOB 4C59B 4Z7IA 1V27A 4R2GB 1WHPA 5C92A 1JHKL 1J1PL 3CHQA 5AOJA 4OFQA 2DRUA 2CHZA 5KSVB 3B5HA 3A0OA 1JP5A 3ZMRA 3GXDA 4QRRE 1KEGH 1GOGA 3HS0C 4QRSA 1E9OA 1S9WB 4N4YB 3CVHH 4UZSA 1F56A 5F21B 5ICYB 2UZIH 1FL3A 3VFGH 4ELKB 2PP8A 2IANE 3CHPA 3A21A 4LLYB 1A3LL 1UJ3A 3GXPA 5IEKA 4H8UA 3AZUA 5E6ZA 1RIUL 3PDDA 2ERJB 5IM7B 3LB6C 2XVLA 3O9WD 2HUEA 1D6VL 2VLKB 3GRBA 4WV1B 5CJOH 3S4SA 3QZOA 3TL5A 4ES8A 4NENB 2YGPA 3ILPA 5T1LD 2H1PH 4Q9RL 4PP1D 1OPGH 3OZ9L 5T5FA 4XHJD 3R06B 4UU9A 1BM3L 3EJTA 1OL0A 4CL7A 3UTPD 4LPUA 3MRCB 1YEFH 3GJEB 1XB3A 3L17A 5T3ZH 5DHVH 5GS0D 1YNLL 4A2FA 1J0IA 4P2QE 4XOBA 1DO5A 3RDTB 2IDTA 1EMTL 2WB7A 1N0XH 2YPLB 4QAWA 2YPLE 4JDTL 1J8HD 5EWIH 4YXLL 1AZNA 3CU1A 3GBDA 3ZZQA 4D94A 5JO5A 3ZMEA 3EJSA 3FB6A 5IK3A 2R23A 4L4VB 3IT8D 4G71B 2XV6B 4JFQA 1LP9B 4TUOB 1WV7T 4WDIB 3F5WA 5HYQB 5L4FA 3DUUA 3SEPA 2DQHH 2Z31A 3STZA 3ATDA 1J0HA 3T0EB 1B2YA 1I1FB 4KQ4H 3SJVE 1QASA 2H32B 4R5VA 3SYAA 1AG6A 4FYRA 4K3EH 1BD2A 5FR3A 1E6OH 3FQYA 1G6RA 3FT1A 1C08B 5F1NB 3BH9B 1NOAA 2R56H 2XBZA 2JJVA 3FU9A 3BHBA 4JGJA 4R90L 5B8CB 5IOPA 4NKQB 4DKEL 2GFBB 2QHLA 1DVFC 4KAQH 4ZODA 4IBUA 4HIXL 4WWKB 3F7RA 1MQ8A 1M05B 2X2YA 3QI9C 4ZO6A 2XXGA 3VD3A 1L5GA 3CCHA 3GHEH 4AK1A 2GKIA 4NOFA 4UQAA 3ZLQC 2WINA 4QWWC 5EBLA 4AL8C 1XSJA 1QLFA 2M2DA 1XDTT 2IAMA 1UD4A 1AZRA 4NYLB 4PRPB 3P0YL 4PJBA 1ZV2A 1F4XL 1QFWH 4FQPA 3Q8EA 3LPFA 4OZFA 2B4CL 4QHNB 2PCFB 1VZHA 2COQA 3MRDB 4M9OA 1BWWA 2W65A 2ZKHL 4G9FB 3MLTA 4MYPA 4G8EA 1A0QL 5FYJU 3ZX1A 3GBMH 4UOW0 1F4HA 1X5KA 3BAEL 1HKLL 5JIQA 5JR1H 2BXYA 3BC9A 3FUMA 2OPCA 2BOBA 5DUMH 3TZVA 5A6IA 5ISZB 4IDLA 5GIRA 1MI5B 3MCKA 1UTDA 4BA0A 4HCIA 5HDQL 2DQGL 3KW7A 1VDGA 1J18A 4E5XB 2WQRA 5IMOA 3RKDD 5BCAA 2A83A 3IKCB 1D5IH 3JT2A 4X4ME 2F58L 3BSZH 4OCXH 4LPWA 5KYYB 3WNNA 3MVSA 4KJQC 3AWFA 4PIRF 4TSBH 3UJTH 2EIKB 3VYOA 4LFHD 2AEWA 5L4IA 3D12B 3HAEH 5IB5B 1MHEA 5AW4B 5IMMA 2VJ8A 2YD2A 3WTSA 2LU7A 4QOKA 2L7EA 5E56A 5EUKB 4BK5A 4YSCA 5J6SA 1UD5A 1ROCA 1ZA3A 4WFEE 1NAKL 4QMEA 3FCBA 3GI8H 2VQ1B 2VYRE 4R4NC 4Y88A 4KX8A 4CW1A 3UJJH 3WN6A 2Z91A 1BG9A 5LGHL 3GMLB 3P2DA 2VB5A 4L4TE 2J55A 4MSWA 3P11H 2APVA 1BQ5A 2BWIA 5IB1A 1WVZA 5JMOC 2N7AA 4DGUA 5DHYB 4NI3A 4QO1A 5EZLB 4ZXBD 2XZCH 1UOWA 5GSRA 5FECA 2WXMA 1MCLA 2E9JA 4XNAA 5ID0B 2BCKB 4J4PA 2AK4B 3ZRFC 3RWGB 4RA0C 2FB4H 1X9UA 2X6CA 5C9JA 5I19H 3GSXA 4WW1B 4GRWH 3DX3A 2ZPKH 1QBML 4X8XA 4KMTL 4PS7A 4M61A 2D0FA 3CFDB 5INDB 4QDGA 5K39B 3SDDB 4I0CC 3VRIA 3FRUA 3FQUB 1B6DA 3PWPA 5E6IB 5GRXG 1XF5B 4D0DB 3M1CA 4OBSA 1NCCH 3BE1L 4F37F 3H42H 1NIEA 2GTZB 2KQMA 2WVSA 5JXEA 3K6SB 1NBVL 1R3JA 1DJXA 4N2FA 1IZKA 3C5SB 2X53A 3V0WL 3W9EB 3C6SA 3LEXB 3GNMH 4BZ2A 2D31B 5T1KA 3TYFA 1JK8A 1SXBA 5I1KL 1T66D 1TTRA 4FEIA 3KWWA 3UG5A 4PRHA 3QJQB 4MA1B 3MODL 3N40P 4W68A 2K70A 1RJYB 2CE6A 2G60H 2P8LA 2OS7A 5AVTB 4ALAC 4H0HB 4AEEA 5I6XC 1UH2A 1W8OA 5C0CA 2CIKA 2NLJA 4IMLB 1AP2A 3LZFH 3T2LA 2IV8A 4JJOA 3STLB 3UO1L 1MFDH 4N8VG 1OK8A 5SWSE 4PEEA 3T1FB 3M07A 4P23B 5HHXH 3L5XH 3FO2A 1U8OB 5T3ZD 4JKWA 5EU7C 4X0NA 2V2WB 4ZAKD 1KBPA 4BE6A 1GJIA 3AQZA 3BAKA 5DVKA 2B14A 4OCRL 1REIA 1AGFB 3ZTJG 1UXSA 3ABKB 5BPPA 2Z35A 1Q0XL 1SOSA 4A7GF 5CEZL 4QKTA 4LPTA 1J8KA 5KVEE 1X9LA 4P07A 3ESUF 3GB7A 5A2IH 3D9AL 2HLEB 4EDXA 2VE6B 3U48A 1NBZA 4W70A 3LD8B 4WGWB 5D7JB 5FYLH 3DROA 1UASA 3B7SA 1Z32X 2FECL 3NGBC 4LNRA 1LDSA 1KJMA 1NEZA 2AS5M 4XPGH 1LQSR 5MEQB 5ABDE 3RWFB 4M6ML 1VGKB 3EOBB 2IALA 5B7MA 3PGFH 1RP8A 2V5SA 4JFOA 3D06A 2QSTA 1DVUA 1X7QA 4YO0A 5BS0D 2W59A 2R15A 5I71C 3CIQA 3KPSD 5FYKE 5EFIA 1T20B 4Y4HD 1WAAF 3L4VA 4TPRH 2UYLB 3IMTA 5DMKA 1ZDQA 4OGQC 1I7RB 2JKXA 5DA4A 3ES6A 1OPOA 1A6UL 4UT7H 2YEZA 4JRXD 4BFOA 4MNQE 1LVEA 3HN5A 1YEKH 1QLRB 4FG6D 3PE9A 1JI1A 4PJ8C 3THML 2DWXA 2MCAA 4PJAB 3B2XA 1DBBH 2C3GA 3QSKB 1C16A 4N25A 1YO4A 2WQVA 1PL3A 1XXDC 4I3SH 1N5AB 1QEXA 3DYPA 2DF3A 2EP6A 1XTMA 4AGPA 3JUYA 3KYNA 4TLKA 3ZY7A 2X6AA 3C6LD 3CDYA 5IG7A 1J8SA 3P0VH 1J9CT 4M7KH 3E1F1 5IHLB 1JFHA 4NBXB 1TNNA 3FTGB 5B39A 1J8RA 4IOIA 3TV8A 5AW2B 1JZGA 4LLWB 4N0YH 1F3DJ 2VWEC 2HA1A 5GRUH 1CICA 1HWWA 2XA3A 4MRCA 2FD6L 3EJZD 4LDCA 4LEOA 5I28A 4X9IA 3UYPB 2VLME 4KUCF 3CK0H 3LZOA 5F7WC 2UWEF 2W9EL 3BQUD 3MRJB 4KTGA 4LVEA 2AJZB 3H6AA 2FO1A 4PGEB 3MUJA 4Y8AA 1IBFA 1E8WA 3BYYA 1W0VA 2X2HA 2LVCA 3EHBC 4OLEA 5DQ9B 4Y7OC 4N2AA 4HIJA 3NJIA 1UZ6F 3FB5B 4FLQA 3V5HB 4D0BB 2R0KH 2Y36H 4OZIA 5T3XH 3OSKA 1ES0B 1AZZC 2NW3A 3VFWB 5DJYB 5EOQH 2IOMA 4PJBF 1S9YA 1SOKA 5LAXA 4R8WL 4TV3A 2XWEA 3I9IA 4X6DA 2Y06H 4JPVH 3LEVH 4B9FA 1JPTH 4UV7H 5IZ7A 3ZE1F 3ARDA 2ZXQA 5KS9E 3VXMD 1MFUA 1QOKA 4K8RL 1EH9A 2VDNB 4N1HB 4Y9BA 3WUWG 3MRRB 3MTXA 4HUXA 2DI9A 1XF4B 4KU1A 3TBVA 1LQBC 3ZDXF 5EULV 4EEEA 3GSVB 1DCLA 2NW2B 4BSVB 4DEUA 5JA8B 4XXWC 3T08A 3QYMA 4GMTL 3MRNB 4N6QA 1FN4A 3CZGA 5E6SB 3HZVA 1OQOA 4P4RB 5GRVL 1Q0YL 3TCXA 3TA4D 1IUZA 4H0LC 3VFUA 3PWJB 4XI5D 4LLVB 4A2MA 1WITA 5CZKA 1YEGL 4KX9A 4X9YA 1CBVL 3E0GA 3OHXB 4NCC1 4NQEE 3UGXA 1GYCA 3O9WC 4JDEA 4DUWA 2Q7NA 3VD7A 3RFZC 4GAGL 1U93A 1XSIA 4PP1C 1E4XL 4X6CA 5DMIL 4XHJC 5FO8A 3TWCL 4XGZA 5F0PB 4BZ1H 3EJCA 5DJ0B 4PJDE 3FCSB 3FS9A 4AQEA 5F88B 1JZ3A 4UANA 3BPOC 5GS0C 2H7WA 2H1LM 2EIDA 3CHSA 2ZYIA 3BJLA 4UQEA 4JO8A 2HTKD 4JRYD 1FZMB 5E8OB 4EQ3A 4EZMA 3QH3B 3H7LA 4U7KA 5D7LB 1WG3A 4EKJA 4ISVA 1P7QA 2L4OA 5F1SA 3DVGA 1YYLL 2OFQA 3K8LA 5LNDA 4PS4L 2RA1A 2ZCZA 1QFHA 4U1JB 1IC7L 1XCTB 2DKUA 1M1XA 4NPYA 1P7HL 1H6TA 1S8DB 3X13B 3DO3A 2G75A 2XWXA 4Z0XB 3MLVH 4X7SH 1U33A 4FA8A 5C71A 4XVJH 5HGDB 1I1AB 2ZJSH 3N9GH 1FCGA 1AMXA 3LZQA 3SDXB 1JWUA 2QSQA 3V4PA 4RESB 5FYLD 3EF7A 2GJZA 3L3IA 4PTTA 4OIIL 5DUBA 3TO2A 7CGTA 1RMFL 2P5WB 1JIBA 3JWOL 4KK9D 2J57A 4NQCB 4LSRL 3LIZA 5DMGD 2OMYA 1R5WB 3QIBA 1SM3L 5BS0B 5DU7A 2DIBA 3OR6B 2EDQA 1U6AL 4JR9L 4WEEA 2G4GA 3VXOA 2CRMA 2KERA 3QQ9D 4CN6A 1YDPB 1FA4A 3EGXB 4DH2A 3WELA 2VXUL 2RR3A 3OKLA 3MJ9A 2EABA 3WMQA 2CLZA 1AXSB 2C3VA 3B2UD 2R2EB 1DVZA 3VFPA 4ZNCD 1QO3B 2G2NA 3LRGA 3PS6A 4JB9L 4OD3H 4ELKA 4WWNA 3HMWH 3ZDZE 1OCRB 1OF2A 4YXKH 1AS6A</