2K9FB

Structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTNPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGSAEAGVCYPPVDTEFDIFGNGTYHPQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
total genus 19
structure length 128
sequence length 128
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 2k9fB00
1JZDC 2K9FB 1Z5YD 2K0RA 3PFUA 1VRSA 1JPEA 1L6PA
chains in the Genus database with same CATH superfamily
4J3OF 3WNIA 3D69B 3ZT7A 5DS8B 1X9UA 2KZ1B 1CURA 4HEMA 4IK6A 1OGTB 4FFWD 4NM8H 1F90L 2VLMD 3QJUB 4I8DA 2BP8B 1XMEB 4GKSA 4F58H 4JRXB 2G4EA 4TLTA 1ZV5A 1QEWB 3SGKA 3NCEB 4EZJA 4XT1C 1PLCA 2P5WA 3K2UL 1KXTA 2ZX5A 3ENEA 4P2YA 4X2UA 2EVJA 1RIVL 1IBGL 3OKKA 3G6JB 1YYLH 4FQ1H 2DKUA 4F5CE 2DQDL 3BE1H 3HVNA 2CKNA 3S4SA 2PXYD 5LN8A 2AAAA 3BD3A 1BQRA 4LLMB 4J3SA 1QTYT 2ZD0A 3L3OC 5IFJA 1R3KB 5FUCC 3U46B 2GSIA 5B38G 3F5WB 5IVXF 3MREB 3MLVH 5DZNA 1NIDA 1ED3B 2N56A 1RZIB 5I1LB 5AW2B 4PD4K 2WNXA 3JV6B 3UTTE 3ZKXB 4JO2H 5ICXA 1A8ZA 5I71B 5DJ2A 1ZJAA 4YDVA 2QSCH 1E3FA 2WXNA 3D0LA 4CUCA 5DT1H 4F57L 1DJGA 1RZGB 4ZUWA 3L6FB 1NIAA 2QQLL 4W70A 2CIIB 4OJEH 5IEKB 1GTFA 3KCPA 3V95A 4LLWB 1GVIA 3IFLL 1Z9MA 1GPOH 4Y89A 2KH2B 4NGHH 5CJXC 3V4LA 5E08L 1KLFA 4UIMB 3T0EE 5DK2A 4IOFC 2DWXA 4NC1E 5E4EB 5DFTA 5DQJB 3HTLX 4EI5C 5BZXA 1PEZA 5J5EA 3O4LB 3C12A 3QS3A 4W9FC 2UYLA 1RUKH 1DANT 2A9NL 1QOKA 5MENE 2P42B 3NIDB 2VDLL 1CE1L 2HRPH 2OK0L 4S11A 1NCWL 4W9JC 4CBZA 2A6KA 1A14H 5IB3B 3RUGF 3O3DA 1XQ4A 2D7OA 5DCCA 2ID5A 2XETA 4B3EA 1GJUA 1N10A 2HRHA 5FYKD 4NENB 3UO8B 5KSAA 1T7WA 5JOPD 4UQIM 1OCOB 5FGCE 5GISH 4XCFL 6PCYA 1EQWA 3O45B 4L9LA 1HQ4B 2B59B 1DVXA 3EDEA 3WIHL 2K78A 2X4TB 3D2UB 4M02A 3CMOH 4NQUA 3VXSD 4X8GA 4OJCA 1JCKA 5IFHL 1BZEA 1EEZB 4ZXBA 3HE7D 4JE0A 5DEGA 3ZX1A 4JREC 4PRDA 1R3HA 1M4KA 5F1IB 1QTPA 1IT9H 5CR8A 2VSCA 3ISYA 3FW6A 3QFDA 5IHZB 15C8H 2A6DB 1PYWB 2WXQA 3QI9B 1GC1H 3U0WL 1DQLH 3VFVB 1QATA 5C0FA 2FB4H 4OW6A 3REWB 4JG0H 5SX5H 4PRHA 4X9GA 1K72A 4EQ2A 2KI6A 3MRLB 1TOXA 2LLGA 2BVTA 1U8IB 2ZUXA 5C2BH 4YUEL 3B9KA 2FO8A 2W9DL 4MD0B 4FEMA 3OF6D 1JF1A 4CILA 2EKJA 4HEME 4JZJC 1I8KB 2CNZA 5CIPB 2EYSB 2GCYB 3C8KA 3QA3B 5D1ZB 4B6ZA 2WXHA 2C3XA 3JV0A 2D7TL 4KUZL 1X5GA 3BP7A 2NCEA 2JJWA 1RU9L 3EYOA 4BD4A 3G04B 3KPMB 4OLZH 1A7BA 2P5WE 4OZ4A 4XOAA 3DOSB 1C5CL 3FT2A 1BVZA 5I15L 1J9RA 4R0LA 4FULA 4K3DH 3FB7B 2VAAA 1XGUB 4LF3B 4RAUB 2WMPB 3FH5A 3DBSA 1CDCA 4E5XB 5AVTB 5J1AA 4XVTH 3GMOB 2H0PA 4KO7A 4L3ED 1D5IL 4QPEA 5D7IF 3LZLA 4EZKA 4GSDL 3SOBH 3FULA 2BP3A 3VFRA 4KITB 3HG2A 3LNEA 3DLQR 1EA9C 4D7PA 3AABA 2D0FA 4TUKL 5FDWA 4XBMA 1DSFH 3EZ8A 1JDDA 3L54A 3ZGHA 4YHNB 1ZHLA 4HX1A 3EJJX 4M29A 3PAUA 2CAKA 5KYXB 1Q0YH 4JM4H 3H4FA 4NN7B 3ZN6A 3QISA 5D7JB 1HYSD 2B14A 1F18A 2NY2D 4TSCL 1W91A 2Z8SA 2LGNA 1N64L 3EYSH 3T3MB 3TP4A 4J28A 2J1XA 1OAZH 5AW3B 4NUQA 3EGDB 1TLMA 2GBAA 3VXOA 4AMXA 4PW3A 4MD4A 4PEEA 2Q8AH 1DBJH 4JFPB 4R96B 2O6PA 1QFWL 4HPYL 4JFYA 3CFDB 4XVJH 5AAMC 2I25N 3VFSA 3LIUA 4PJXF 4MBRA 4JFOA 4EI6B 4UQBA 3BGMB 4BWUA 2ZOKB 3G6JF 3FO1B 3MVSA 4XVOA 3TLRA 4NRXB 2BJML 5HPMB 4NNYB 2X88A 3P69A 5TK2A 4N0CD 1BZDA 4LRNL 3HG5A 3BP5A 4H2AA 5F97E 3EH4B 3LRSB 3MPCA 2CUAA 2UX6A 4X9FA 3LD8C 4MB4A 1HWGB 2EXYD 3L8QA 1HKLH 3K0WA 2VO8A 2NY5H 1NIFA 3L3IB 2ICEC 3U4EA 2RCSH 3QIWA 3MI6A 3N2JA 3IMSA 2E6QA 3O8XD 3OLDA 4GI9A 4HV8A 4LESA 4JAMA 3PPEA 3GD1C 1CCZA 5B22A 3WFCH 1JXDA 4ODSL 4XPAH 3DX8A 4OZGB 1U9KA 2AERT 4XVUC 3V9FA 3T8VA 1A4JB 1KPUA 5MERA 2O6DA 3PUCA 2R69A 4FLSA 4IGBA 4HVBA 2CLVB 4PRHE 4UYQA 4IIZA 5DWUL 1KC5H 2OSXA 2NOYA 5EUOF 1CFVL 1T2QH 1GZPB 2VDPB 1JFQH 2COVD 4IIQB 4XGZB 3S96A 1E7VA 3KPQB 4LLAA 4QRUB 3KPNA 1CN4A 2W80C 3NIDF 4KJPC 3RFRA 2PPDA 4LZKA 1JPST 2QPUA 4JO4H 1NMCB 1JD9A 4PGDB 1F45A 3QWRD 5HI5D 2F5BL 4X7FC 3U7WH 2Z1PA 2ZSWA 1MRFH 2VN5A 3QUYD 4ZX3A 2VDMH 4W6YB 2BNRD 4P5TA 3O9WB 1SFDA 4FHKA 2MTPA 3QPXH 4RCAA 4TRPH 3P0GB 2DQCL 1QLEL 3BH4A 4H13C 5DUMH 1S7SB 1EERB 3ARFB 4A7SA 4GB9A 4JFQA 3FQRA 3IETA 1OTUC 3I9PA 4NQCB 1NEZB 3VTMA 3VW3H 3N04A 3WE6A 2HVJA 4F2FA 1KFAL 3SKUD 2IGLA 3T1FB 2BIHA 4OZFH 3BDXA 4UQ2B 1G7MB 4N2HA 4DZ8B 4OTXL 5GS1A 4GP5B 1JGVL 3M17B 4PRAB 4W9EC 2QGCA 4ZTEA 3GHBH 5DRWB 4AIZA 1YLBB 4M3KB 1ZIAA 2A73B 4U6XB 3K8KA 3WJJA 4DIXA 1M6OA 2WIIB 4AMWA 3OZLA 1QFWM 2Z34A 1IAKB 1W0YT 5C0DB 1PNDA 2VQUA 5T3ZD 2QVKA 2VQ4A 2ZXEB 1Z5LA 5C0AB 3U6XA 3RWGA 3K71A 4KKPA 4JVPA 4UDTA 5TE6L 1LK3L 2Q10A 5CHNB 3RX5A 4Z0BL 5IK3B 5BS0B 3RWDA 1M7XA 4ENZA 4U6YA 4Z7OE 3U9WA 3WS6A 2L7EA 3SJVB 3ASWA 3U82B 4KZCA 1LQSR 2HTKD 1LO0L 4ANKA 2DLTA 1MAMH 3VXUD 4HUXB 3WO4C 4KAQL 2PYFA 4A6YA 4G1MB 1Y18A 4MBOA 5F6HJ 5FHAL 5CEZD 1OE1A 1I3RB 2C9PA 1QQDB 3EH5B 1AD9B 2NQDA 3U1SH 3MLWL 2W1NA 2ADJB 3AREA 1WZLA 4Z95L 4M1CC 4KDTA 2JKNA 3F6IA 4KQ4H 4HAGA 4FXKB 4S0HA 2QR0A 2XZZA 1AIFA 4HCRL 4P05A 3OKLA 3K72B 1XB8A 2D9CA 3O6LL 1C1EL 5CEXB 2H45A 4ACPA 1A7OL 3MYJA 4ABQA 1FN4A 2WZPD 3BEVB 2W9LA 5ACMA 3CJJA 5LGKA 1KGUA 1TJIH 1G43A 1DBKL 4QY8A 5E1AA 5GRUH 3KEDA 1T1ZB 4WFEE 4UT9A 5GGTA 4GT0A 5D93B 2ATPA 3ESOA 4H25A 4PREA 3VX1A 1QPPA 5EZLA 2F74B 4WO4D 3OAUL 1HQRB 4JB9H 2K9FB 2GVYA 3QCUH 3N55A 1FO0L 1INDH 2ZXWB 1HSAB 3ZKMC 5C0RH 3B3IA 1X5FA 4C55A 2C3VB 2KPWA 3TN0B 4F2MB 2E0PA 5A3ID 3SY6A 3Q3GA 3VWKA 1ZA6A 5DJCB 4KMTH 2P80A 1JS4A 3MKKA 1ET8A 1G9MH 1PGRB 4TULL 4AYGA 2PKDA 4Y2LA 3SDCD 4F7MB 1KULA 2LV4A 1UXLA 3X3GH 4KKQA 4PUBL 5FM8A 1PDKA 3RTQB 2APFA 5LB1A 5IB5B 2QV4A 1Y0LB 3IXTB 1QYGL 1N59A 4FCAA 5D1XC 4HG4J 5AW9B 3U9UB 5AG8A 3PHSA 5DI8A 3K91A 4I9WD 5CS7A 1O75A 1VGEH 5HHVH 1TVBA 2ICES 5F7BA 5CLWA 5IJVA 4G9FD 4Y19B 4UCFA 4Z5RA 1UOLA 4PWHA 4BQCA 1IARB 2ZAIA 2XQBH 2Y1YA 4F37K 5ADPH 3TONA 2XU9A 3MNZA 2RACA 4MGXA 2JKWA 2FEJA 3ARBD 5KVDE 3MLSL 3DIDA 4IRZL 4WJ5B 5CWSB 5IKCB 1JWMA 1BFVH 5E1QA 4WUUD 3B8SA 5DRXA 3AT0A 3IBOA 2DI7A 3KLAB 2EC9U 2D03L 5F9OL 4Q2ZB 5BVJB 1S7RA 4NZUH 4R97B 3S4SG 7PCYA 1BX2A 35C8L 1QBMH 4DKDC 3DHPA 5C97A 3QORC 5TQ2H 5E94A 3AW5A 4L8CA 1ZEAH 2ZCHL 4K8RD 1K4DA 4RDBA 1HJBC 4CGUB 4P3WA 1Z9LA 1YUHA 4MB1A 5JDSB 1OCWH 3V5KA 2JVUA 2AV7A 3LEYH 4WVRA 3LZQA 2Q9OA 1UYWL 3TVMD 5KVGE 4HWBA 4WK0B 5IQOA 5J3HD 4G8IA 1QFOA 1UWEH 4LVNB 2YMXH 4GPVA 5F72S 1NFDB 2Y24A 1H0DA 1BD2A 3TBYB 5IMMB 4H1LH 5IQMA 3O6FC 1A6AA 2X9XA 1T5XA 3ZDXB 1SLVA 5KZCD 3PL6B 5GZOD 2B7DT 1TTCA 1VZGA 2ARJA 4GUOA 1K4CA 1G6RA 4J3XA 1NOAA 4RQQB 2C26A 3NIFE 3KPRD 3TO4C 5D2LA 3PNWA 1U6AL 1U58B 1Q9WB 3HNSL 5EZIH 4JFEB 2KMWA 4S1QH 3ULSB 3QDGD 5GGUA 1KJMB 2PWGA 1IC7H 4I9WE 3ZDYE 1HJCA 4N87A 3ZK0A 4JJ5A 1FZMA 1X3DA 4U2ZA 3JWNC 4K3GA 4XXWA 3T2OA 2ENJA 4GRWE 1UCBH 4XBEH 1H15B 3HZVB 5J1TC 4BZ2H 3S8GB 3WTWA 5K9OB 4X5PA 3ZL4H 43C9B 1U3ZA 5K59E 4OKVA 4QRQA 1TKWA 5I66A 1HOCB 3P0VH 4L4VB 3UCQA 5ACZA 3OSVA 5M94B 4WUUE 4KGJA 3ZSSA 3DUUA 5TH2B 2YUWA 3FXIC 2P49B 4TTDC 1FI8C 4H8VA 5IV2B 4K07A 1NIBA 2PTUA 1TZ8A 3QG7H 3D3VB 1JK8B 3DA0A 3PGCA 3MSPA 3GS0A 4RFEA 3KXFB 2JI3A 1YY9C 1U36A 4MAYA 5DSCB 4FNQA 3FQXB 4OR1A 5EUKB 3G5ZA 4UILL 1UKSA 3EYQC 2EC8A 2E8YA 5SWZA 4I0CC 3HNTL 2I7SA 3GI9L 3N1FC 2FJGB 4JKNA 1OF2A 1ZVSA 3AQYA 4ODUA 4GFTB 2GI7A 4R7LA 2R0WL 5L88H 2B16A 3UAAA 2EDLA 4GRWH 1WSST 4ELMB 3QQDA 3T2LA 3ZE1F 2CO3A 4NHUA 4J1UB 3L3DA 4IU2B 3CAFA 4LARL 5GGTH 5LBSL 4QLRA 2YO3A 2ZWYA 1JDAA 4F7EA 3MUGB 5DC0A 3BYYA 3BZDA 2WJ5A 4BJLA 4NZRL 2EIEA 3WU1A 2D7MA 4LOEA 2PPAA 4ZNCD 1A4BA 2J3SA 4CGTA 4QIRA 5I5RA 5D6DA 3KPRE 3L5HA 2K6YA 2XN2A 1IBYA 5EN2B 1JZEA 3N85L 4U33A 1T1XB 2WVSA 1DJWA 4P46C 4YGVB 5GRVK 4KTDH 5T33H 1JV5A 3OMIB 4A39A 4CNIA 1X4ZA 4C56B 4O2FB 1MCFA 1AFVH 1WEJL 1MVYA 2OX5B 1HL9A 3CDGA 4GW1A 3SD2A 1PF3A 2BNQA 3FONB 5HYJD 5E0FA 2K4WA 4Y1AD 4ZW8A 2QHLA 1E5BA 1KCVL 4AQAA 1E9QB 3FQNB 5J1SC 1FNSL 4ZT1A 4Y4HC 1AACA 4ZTPL 4X4YB 1PKOA 3QIBC 3QAQA 2NR6C 3NA9H 1TJGL 1WBYA 2R27A 4Z77B 4F92B 1F97A 3FTZA 4MKMA 2L04A 2OTUA 2GTZB 4PJAA 3GSOA 3SSGA 1BD2E 4KVCL 3B5HA 1FG9C 3QZBA 4YHPA 4F33B 3AU1A 4JFDA 3SO5A 1VENA 1BF2A 4ELKB 1A02N 4HZLB 1IAII 1TQTA 4Y2DD 3UEZA 2BSEA 1H6FA 3ZMNA 2XN9B 3N6YA 3SE3A 1I7TB 4K73A 4P23C 2BVOA 1JXJA 4JZOA 2AFNA 2H2PD 2QSQA 1QKZH 5D2LE 2CHZA 2FSEB 3DXAB 5KSBB 5J89A 5FO2A 4Z8FH 5LQBL 2IH3B 5T3XL 4IRJC 2N7BA 1GW6A 1AI1H 3NSCA 1K5NA 3MLYH 3HKZA 4JRYB 3ABZA 1AAJA 2CA4A 3FCGA 4LEXH 4JFVA 4NXSA 1S7WB 2ATKA 3L17A 1DVUA 3B7SA 3LY6A 4NKDB 3FU6A 4I18B 4L5FE 3NJVA 2WOYA 3FU9A 4JFXB 2LT9A 2PCPA 3D0VB 2X89D 5F1OB 1TCMA 3IGLA 3Q0HA 2FQGA 3IJHA 5EPMA 3L3HB 3FNKA 1IGFL 4MD5B 3RVTC 3E8UH 4P4KA 1HH6A 3II3A 2YSSA 4MQXC 4N2AA 4A2EA 3BKML 2NTSP 2CBPA 1J10A 1G5AA 3JYCA 3N43B 4ZW5A 2YD1A 4J23A 3NEOA 2RA1A 3H9SB 3PP4H 3Q2WA 4H44C 3NCWA 1MHCA 3NACL 1IM9D 4GSUA 5LCVA 4AXWB 4PGBA 5CJQL 3BRFA 2OMYA 1AS6A 1FZOA 1X5KA 4KX7A 5B1KA 3V9CA 3OXRA 1G6RH 4IJ3B 2NY4D 3JXAA 5SWZE 2H3KA 1BYPA 3BHBA 1N67A 2J8OA 1EV2E 3BPOB 4AEHH 1TT6A 5BUPA 4L8SA 3GIZH 3RVUC 3PXLA 3DIFA 4M1DL 3A47A 3HN8A 4QTFA 3AVEA 1MDAA 2DIJA 2UY6B 3EO1A 1P53A 2DM2A 3HS8A 4GLRI 1DVFC 1GYWA 4U1IB 4Y0GA 2QGDA 4P3CL 3GIVB 4FYRA 1I8MA 3CHPA 1A6TA 1B4TA 1MLCA 2H8PB 3AXLA 3E7JA 3FFCB 4O58L 1RJLB 2R7EA 5DUBB 5E9DB 1SQMA 3HFMH 5DEFA 2SODB 5F7DB 4P4KD 2C9QA 2NNAA 2ZQKA 4XPHH 2JCCA 1ECZA 3DETC 2GJ6B 3FJTA 3MROA 4GUPB 5AB0A 5CZXC 1Q9LA 4KMQA 1A1OA 5LNGA 1J0JA 1LGVA 1N26A 5IVOA 4E41B 1OGAD 1PD0A 3TZVB 3EKCA 5FA4B 4J8RA 3LKPB 1UJ3A 4XWGL 1YNKL 5FOBB 4PJEE 4QHKI 2WZAA 4JNXA 2BNQE 2R9HD 4NO0B 4KPHH 4LL4A 1X44A 1FBIL 4MDJA 3VFMA 4EMZA 5C0GB 2QBWA 1S5HA 3SBPA 5JXAH 4K3EH 4AZUA 3AQZA 1RP8A 4JY6A 4LVOB 4X0NA 4PWFA 4TQEL 3KWTA 1NGPL 2DWTA 1NWPA 1RURL 1A7QL 3NFSL 1IC0A 3FQWA 3DOHA 1VFAB 4PJAE 1B4RA 4HIHA 2XG4A 1S7UB 4OGAD 2VR6A 4UQAA 5TE7L 1RI8A 4GG6A 4KMLB 4JFDE 3HHSB 3ZE2F 3DO3A 3DDGA 3VFNB 4GBXA 1LHZA 3QEGL 4N3TA 1ORQB 4ENED 4A04A 2J73A 1DO6A 3NJLA 4YOKA 1RZKH 2P52A 1JOIA 5SWSD 5JOFA 4N25A 2VDQH 4BZ1L 3LB6D 3NBNA 5D5MA 2AANA 3IPBA 3C6SA 3QQ4B 4XOBA 5K33A 2WQXA 2UX7A 3DSNB 3IPEA 1MWOA 4UINH 2FECL 3S37H 4P2RB 2E27L 5EZOL 2AK4B 3LEVH 5DGRA 3I2CL 5D8JH 5AZEL 1IGIL 3MRHA 4TNVK 2WXMA 4OF8A 5TF0A 3DVNB 4WI0A 2QQKL 3A4DA 3LAFA 2B1AL 5E5LA 3F84A 2ZWSA 4KK6C 5LNDA 2H32A 5I0DA 3IJSB 1AO7B 4R4FL 3LOWA 4U0QB 2AJXH 1RZ8A 5C09B 2Q7YB 4AYDC 2R1XB 4G42A 2IQ9H 2WXKA 3DHJA 4NDMB 4WI5A 2E9BA 4MZRA 1Q72L 1Y6MR 1ZGLA 5KBNC 4G6FD 5DK0A 4XMLL 3DBXA 5JOEA 3HR5A 5KYUB 3SDAD 2FWOB 3FCBA 4OCWL 2DYPD 4NQDB 3LQAH 4U1HA 3AUVA 1OM9A 1E28B 1IEBB 2WVVB 2Y5TA 3B2VL 3MRGB 3ARGC 4R90H 1J11A 1R5IA 3FRPA 1CG9A 5DJAA 3RNKA 1A9VA 3QJVB 2XSKA 1A3RL 3RWFB 2EP6A 1SLUA 1IGJA 3BGFB 2QGEA 2WLLA 1QFHA 3G5XA 2G3MA 3EDFA 1QW9A 3KLDA 5I9QB 3S7GA 5BW7C 4L48A 4AUYA 4DPAX 3M88A 3ZDZE 2YUVA 2DJUA 4C8XA 3SZ6A 3QUZB 5JLZB 2VUKA 1HIML 1N4XH 3BWAA 5I30L 5I0XA 4JRWA 2P7TA 2C3WA 1WAEA 4HZ1A 2VE6A 3DX7B 2HLFD 1T83A 4OLUL 4B9GA 2ZNWA 2JCCE 4MQ7B 3ZTNH 2O5XL 2FYYA 4MQTB 4HBCH 5CP3H 2IANB 5AKTA 3ZZSA 3BLPX 3IS1X 2D4FA 2A4CA 2YAOA 5E8PB 1FZKA 2FL5B 2X44D 1P2CA 2WGNB 1I1AB 3ROLA 1TUPA 2VXUH 3N43F 4R4ND 4KXZH 4M8QA 5GJTH 3WHXA 2W9EL 4WI4A 3PV7A 1M2VA 5E9NA 5EBWA 1L9PA 2HJKA 3QFJD 2WINA 4HHGA 4M4RA 1IAIL 2X7LA 5E2UH 1PZ5B 1XF1A 1A3LH 2ITDB 4NT6A 4TVPD 1A8JH 4ZSOA 5GS0C 1QRND 5C71A 4BCXA 1SJMA 5F9JB 4Z1PA 3V4VH 4DEPB 1BLNB 3HS0A 2KC0A 4TTGA 1BZ9B 4GG6E 1QZNA 3SGJC 3PIQB 1CDYA 6TAAA 2P8PA 4L05A 2XTLA 4RAVB 3RL2B 1CIUA 3ZHNA 5DO2D 3AY4C 1E4KC 3WTYA 1CXKA 1JCVA 1IC5H 1J87A 2PPFA 2R2EA 2YRLA 1JNLH 1SJEB 2L0DA 1KYAA 2AXFA 3NP4A 5D5ME 3IDXH 1LEGB 4XPFH 2XKNB 3JYBA 4QHUB 4K5LA 1U8OA 2WWKO 2V8LA 4WWKC 3GHEL 1B6UA 3BUIA 4MAZA 1I8IA 5JW4M 5E1IA 3OLIA 2VOTA 2JQMA 1ZPLA 4UT7L 2J12B 4KY1H 2CM6A 2WNWA 4MMZB 4R83A 5EOTA 1SBSH 4DN4H 1WF5A 3E2HC 1WTGT 3GTTA 3L4TA 4XO8A 1YPZB 4X8JA 4UZGA 4MNQA 2XXFA 4R4BA 5T1MA 3S34H 4FG0A 3VRLF 2YFOA 4Z3EA 2BZ7A 2G3NA 5IESL 2AQTA 4Y5YC 2PP8A 5HVFB 5I8OH 4FHJA 5K1JA 3OR7B 2IQAB 2BZDA 5HHQB 4ETQA 1KBBA 2HN7A 2IF7A 2R8SL 5B38B 4GQ9H 4WSKA 3QDMB 4JO5A 4FRWA 1A6ZB 2BNUB 4JFFD 5EZPA 2YBGA 2A74A 3LV3B 4R2GD 1QO3B 4W4OA 1PY4A 5HGDB 2W88A 1UA7A 1S3KH 3LIZL 4KNTA 5FKPB 5C0JA 3MOAL 3V52L 5C6TL 3E3QC 3I84A 1I7RA 3GKWL 5FX3A 1NDMA 4FG6C 4F15C 2FWSA 4TVPE 3W38A 1MCPL 1ZAGA 3A3YB 4R7DB 5IBTH 3WD5L 1U8CA 4PJFF 2UVFA 1JUFB 2XYCA 4I1NB 3TPUB 1F4WH 1ZLEA 2WYZA 4EDXB 2VB5A 4KKCD 4JE4B 5CM1A 3ATBA 3ILDA 5DHYA 2BCKA 4Z7VF 4NCDA 1IGMH 3BD5A 3LZNA 5IROD 4ZTOH 4P2OB 2XFGB 4Z6AT 4MAUL 1F1AA 3ARVA 1JV2A 4FYSA 1SEQH 1IKNA 1MQKL 5E9AA 4M6OH 1KTDA 4HLJA 2XJKA 1NDGA 3EFOA 1QVOB 1CT8B 2AXGA 3HE6B 5IREA 1BWMA 3MA7B 1QSFA 3OKOB 1HCYA 3L9EA 3BJLA 4XNMA 1Q38A 4LNRB 1KLGA 2Q76B 4PSRA 1IAIM 2OPCA 3VXMD 1DJIA 3BUDA 4ZS6D 2BSRA 2C1OA 1C08A 1G7QB 3EJZC 3CH8A 5HJBA 5TD4A 1A7NL 4UM8B 3T4AA 3PDOA 4NQVB 1HILB 4LASL 3IFPA 4BH8B 1OSZB 1YSOA 4G5ZH 2VXQA 5I0WA 1Q1JL 4RWYH 4ANVA 4DP4X 5LXGL 1J0ZA 3CCHA 5FIEA 4MRCA 3ZQ9A 2O6FA 4W68A 2CR0A 4GLRH 3EUUA 1Y6NR 4G8EB 3JSSA 1NGZA 2NXYD 5GS0L 2BMKB 2HG5A 1I4FB 1XH3B 4E42B 4JPIA 2ZJSL 1UHVA 4ZMYA 4FG2A 1MCKA 3PP3H 4JHWH 3Q01A 2E5EA 5E5UB 4KKBD 3IFOB 3BUTA 4JANB 1RZPA 1E3ZA 1M9SA 1ZT7B 1DFBH 2DIAA 3KYNA 2VDRB 4N2BA 2X70B 4J4PD 5HD8D 4KJWD 5TQ0L 1ZLVK 2V2WA 4FCHA 2K7PA 2HKHL 1JVOA 3GMNA 2D3NA 4MNQE 3WXVH 4HPHA 3RIKA 2WWMD 3CH1B 4WY7H 4ICXA 2VQ1B 1NBYA 4XC1H 4ZW6A 1RSFA 3UL4A 1FG2B 2YN5A 3LZPA 5F93C 4YAQA 4TL5A 3BP6B 4EKJA 5I1HL 1KB5A 3O3BB 4JRFA 1CFSA 3CTTA 2Q87A 5FYLD 3ULUL 4IBTA 5AVUB 3V7MA 2ZP0T 3JV5A 1JE6A 1S9XA 1NAMH 3LNFA 1Q8MA 3WEXA 4LSRH 1KIUA 1T04B 4Y16A 1KN4L 1VF5C 1JGEA 3BWSA 3SEPA 4DVBA 2OW7A 3MODH 3NFNA 4OJAA 2C7FA 3V4PB 2IALB 3JTBA 3EJYD 4U6HA 3ARUA 4LCCB 1N8ZA 3H0TA 5K39B 4APXB 3TJEH 4NUPA 1GOGA 2GG1A 3CUPA 3WJMB 5H2BB 3OGOE 5CO1A 1CC3A 3QO1A 3WJLC 5DA4A 4HUVB 3IMWA 5FM4A 3SE9H 1TZIB 1ZHBA 3EG9B 1X9LA 1W72H 2WO3B 1WQVT 3APCA 4MB3A 4QRSB 2R29L 2N0MA 4F3FB 4FFYL 1U2HA 4MFHA 4DNLA 4L37B 2NX5B 3MHZA 1AS8A 1QHOA 1YPZF 2Y07H 3NT0A 1NC4A 1M1XA 3GZPA 1KMGA 3R06B 5EU6D 2DLGA 4KX9A 1NLBL 4APQB 5A2CA 5AG9A 1E4XI 4PGZA 1AHWB 1UB6A 4I0PD 4M93B 3FOLB 4PRIA 2ESVB 2IPTL 1QSFE 4OCXL 1VB9A 4EN3D 3UDWA 1CR9H 3P4OA 3TV3L 4OD1H 3NJKA 3ZHLA 2BOCA 4JDZB 1DQIA 2AEQL 5F1SA 3PWNA 1LO2H 3CFKA 1RHHA 1XTMA 5FYJU 4WW2C 2NSXA 5L8JB 2FQDA 3M7FB 3BJ91 4AX3A 2V2TA 3SDYH 2W92A 1ES0B 4G43B 3VWJA 1OT4A 4LHUD 3C5ZA 4HDIA 1NGXA 2BM3A 4YHOL 1E5ZA 1KTLB 2AQRA 4HH9A 4LE8A 2GT9B 2OI9C 4NQED 4OM0H 5C0CA 3ZTJG 4BRJA 2VYRE 3ZLQC 4WNQB 5F0JB 4A38A 1EJOL 1KBVA 1YNLH 2IAMB 3NP3A 1ET5A 1LWJA 4NUGH 1PJ9A 1WA2X 1YQ2A 3A4AA 1R5WA 2EUZA 1W0VA 5CN3A 5INDA 4RGNE 2E7HA 1IUZA 2KYIA 4HWEL 5DJ6A 1DZ0A 4FFZH 1FRGL 3Q1SL 3K4DA 3D7PA 1C5DA 2VLKA 5I16B 1MI5A 1CU4L 5GSRB 1HHJB 3K5RA 1TG8A 4GS7B 1FL6B 4IRSC 4DSYA 4L4TB 3WIHA 1O7DC 1MNUH 3T3PB 3E9TA 3ZR6A 5K9QI 2WTRB 3H9HA 4XP1H 3BKYL 4HJGA 3E1F1 4XCCL 5ERWB 1B2WL 1E43A 1I82A 3CIAA 3EXJA 2V7HB 4HH8A 5AUMA 3ZU8A 4EIBA 2B3IA 2AF2A 2PO6B 2WCSA 3C6LA 2VL5B 3F12B 1JGDA 1XSKA 1MCQA 3K2KA 2WXJA 2EVIA 5H94B 2YGOA 2VM3A 5A16B 5GRXG 1COBA 2O1AA 3OLEA 1MJJA 3MACH 3FC8A 5E6ID 3ARDD 1DJHA 3BIKB 2EINB 5F9WC 2YJLA 3EADA 4UZUA 4G82A 1TEGA 2X4PB 2I9TB 3RURA 4Y2OB 3DTXB 2ZP8A 4BZYA 1GGCH 5IQ9A 2PYED 3QDHA 3WS3A 4OF6A 4LOUD 1BVLB 4XC3H 3G5YA 3UJTL 2QKIA 4YMPA 1FAIH 1URIA 3EYVB 4L2YA 3BQUC 4U1LA 4F2EA 3ZHDA 1AR1C 2Z93B 1H8LA 2AABL 3WNJA 4XNZC 2YAMA 4XRCB 3P11H 3HIZA 3W39A 1I7ZA 3RKDC 4KNUA 1XF4A 3QUML 4OY9A 3MN8A 4NI6A 3KLHD 4IMLB 3V5DA 4JQIL 3FRPG 3ML8A 4M7KH 4NNPL 5DRNA 5KW9L 1QR4A 2XDHA 3UTTB 1H8OA 1MCJA 3FO2B 1VADA 3B7RL 5DJ0A 2F15A 4Q0XH 4PRIE 1KB5H 2GJZA 1SMDA 4ZQKA 1ET7A 1MRDH 5I8EA 3GFUA 3N5AA 4OIIH 2EDYA 3L3OA 2EZ0D 1BGXH 5DYOB 3L7FA 1IM3B 3LN4A 5FM5M 4LLDA 3WXWL 3ZYOA 5DD5L 5EIQA 4BSWB 4ZD3L 5C0BA 2ED8A 3K6NA 1QFUL 2YD3A 1CXLA 4E9SA 4OLVH 1I3GL 3T0EB 3QIUC 3CZFA 5C92A 5D1QC 4FMFA 5EBLB 3STBA 1LK2B 2YD7A 3MAWA 4PJ8B 3BSZH 1HDMB 4OLXH 3TURA 5C0CE 2NDFA 3FUHA 3C6EA 3Q9PA 3NPSC 2A6JA 2DAVA 3NN8B 5MENB 4HETA 2NMSA 1WZKA 4E9VA 3EOAA 4F1SA 3X14B 2DQDH 2ZCZA 5CJXA 1YN6A 3VRIB 3MRNA 3QRGH 5FK9A 4YVNA 4CMMB 5IHWA 2WBJB 4EI5A 1L7TL 2VQTA 4M8RA 1FF5A 5HYSA 5CF3A 32C2A 1FYHB 4GAYB 5FGCB 2VIRB 5E00A 1HZHL 1T20A 2ADYA 2IGTA 1SY6L 1VZHA 7PAZA 2VLKE 1KCUH 5EU4B 4KV5F 3HOGA 5KJRH 4P5SA 1E27A 4XAWL 4L3FA 4ZX5A 1KEGH 1DLFH 1Z6JT 5AYTA 3DHUA 3V5HB 2I7OA 2ZKHH 2QQLH 2ZAGA 1ESOA 3HMWL 1LD9A 4K7PH 3BW9A 4HIJB 4RDQG 5T5FL 1M05A 2KQNA 4X7EC 2ITCA 3QJZA 2NUPA 3O2VH 1G9NC 5E6UB 4PS7A 1OAJA 2A9ML 5A2FA 4LNVA 4M7JL 1H5BC 4HK3J 1M57B 5E2WH 3CLFL 3SCMD 5AB9A 3UYRH 5GRVL 1PX4A 4GEIA 4Y9EA 3MYZA 1OD7A 1GS7A 3JZYA 1BAFL 1MFMA 4ZOBA 3VCLA 4DTGL 4GKSB 1RVFL 2OK0H 3RA7L 2H6UA 1NMAL 3EFDL 3G6AA 4A37A 3O6MH 3R19A 4RFNC 2P5WB 1KXTB 1RULL 5CR1A 3OKKB 1PZAA 3U30B 2QHRL 1E4XL 3T2PA 2DOCA 3S4SB 4JZJA 2OBGA 2LTQB 3W11C 4FADA 4JFUA 4U1JA 4K7PY 5A2IH 1QBLH 3QUXC 4N8VA 4AC2A 1C12A 4TL4A 5GHWH 2PCXA 5IFJB 3DJSA 1BF5A 2GSIB 4UOZA 3FK3A 4KZEH 3D51A 3MLRL 3OD3A 4YSQA 3PWLA 1NUDA 1GAFH 3SE6A 4Z3JA 4G7YL 5HJ3A 4DUVA 1IQWL 1JNJA 3EZJB 3NDZE 1UACL 4FF9A 1TQWA 2DEXX 5ICXB 1O5DT 3SYPA 2JTYA 4YDVB 2E74C 1I9IL 5JW4Q 3D0LB 3SYQA 1BVOA 4ZUWB 3CFQA 5L2KA 5L7XL 5FUCE 2BIIA 3MV8D 1SEBA 2N7SA 2IH1A 1GRWA 3KCPB 3O2DL 4HK0A 1GJIA 1NAKL 5C0BE 2EUXA 2JCWA 3F83A 4IM8A 1KLFB 3SGDI 5GQBA 5DK2B 1QI5A 1UD5A 5KG9A 2VC2L 1BG1A 5LAXA 3VGBA 1DQJA 4OGXL 2F58H 1MEXL 5HDBF 4BXSV 2QTVA 3BDYH 2UYLB 3BD4A 5CN2A 1PIFA 3KM2A 4EBQH 3GQFA 4Z3TA 2EEAA 2O4EA 3RI5F 2ETWA 1UWXH 2A6KB 4BFBD 2P5ED 2R0LH 4LRIC 4JDTH 3O3DB 3SE4C 1UGKA 4AQ1A 3H9ZA 3G9VA 4U3HA 3EBIA 4DGIH 4FZ8L 1CBVL 5KSAB 1SNRA 4G80A 1CGTA 5AAMA 3TBWA 5TDOA 1NIEA 3GLEA 3MNVA 4L9LB 3ARPA 4FEIA 3IDIA 2V8MA 1PLGH 4D2NA 3QXTA 3D48R 4ZXBB 3RHWF 5DEGB 4PRDB 1R3HB 4D9QD 2AKRA 2BW5A 5PCYA 3QFDB 3T8XA 4E9TA 3RU8H 1XEUA 1MCDA 3SGEI 3SQBA 3UROR 5BVPH 3K2IA 3U6RA 3WBDA 2VERA 3ZKQD 5C0FB 4TSCH 2ZUUA 4O2CA 4KRLB 3T65A 4PRHB 5E99L 2ICEA 3FS9A 2I60L 2H0EA 4PW4A 3LH2L 4CSSA 4X80L 1F6LL 1RCYA 3SO3C 3B9KB 1MRCH 3MKGA 1JF1B 3LH9A 1FPTH 1T4KA 4I3SL 4MXWL 4XP6L 3RVVD 2J6WA 3C8KB 4X9HA 3WOVA 1G9NL 3NSYA 1C5BL 1FO0A 3H6JA 3BP7B 1A1NA 4X7TA 4HU8A 4ZMNA 3EYOB 2YBRA 1YQVH 2QVFB 3EYUL 3OVUB 3EO9L 1JMXA 1CLZH 1TTGA 1JIBA 4OZ4B 4NCC1 4OUOA 1RZFL 3FT2B 2P1YA 5A7EA 2YR3A 3GBLA 4R0LB 4ZJ9A 4QNPE 2VAAB 2VZVA 3ATEA 4B9FA 2GK2A 1I7UB 4UAOC 5J1AB 2D7PA 1S4IA 3WTSA 4HJJL 3Q9QA 1M7UA 2PWHA 3GXPA 4V2BA 4KWUA 4O5LH 3VFRB 3DMMC 3WN5C 2P26A 5CAYB 4G5AA 1OQXA 4IBYA 1RMFH 5FDWB 1D9KC 4ODSH 4KJYA 2QFPA 3QJFA 1SXBA 1CFTA 2EEDA 4I2XA 1ZHLB 2ZXCA 3FMGL 2B20A 4M7LL 4WUKH 1IFHL 4HX1B 3BVDB 4IRZA 4LLVA 5L2KE 4KKRA 3QZOA 1D2OA 4HGWA 5DWUH 3QDJA 3N44F 3P2DA 4KROD 3L3GA 4M48H 1MAJA 4QTHA 1JBJA 4YH6A 1K8DA 1JGUL 1FDLH 4KI5D 2PABA 3PWPA 2WJ7A 5FYJH 2ZKWA 2FQFA 1JZJA 2O72A 3DX9A 4D9LH 1AG6A 3NIGE 4HSCX 3SQOH 4QGYA 3TBCA 4G72B 5DUPL 3B9DA 4WW1A 3VXOB 2Z4QA 4MD4B 2XY2A 4G6KL 1DQDH 1TJHL 4NWUL 5EDXA 3UJIH 2ICCA 3WN6A 1PD6A 1BEYL 4JFYB 2VJ8A 5GZNC 3NSJA 3VFSB 4HEPA 3MUHL 4JFOB 4AW4A 2CD0A 2J5WA 3MZGB 1YN7A 4YO0A 1GZHC 5DF0A 4A2HA 4K9EC 2FHFA 3QO0A 3TT1L 4ZS7L 1MY7A 3DARA 4FP8H 3MA9H 2VERN 4YNYA 4AKOA 1PZ2A 3DYOA 4HCFA 4FQQA 3BP5B 4WCYL 3T2NH 3TH4T 3AS3A 3W9DA 4U3SA 3T71A 4LSQL 4OF3A 1CYXA 2XOTA 3KYAA 4HUMB 3D85A 5TFSH 4NHCH 5LBGA 3IEAA 4WEEA 1BZ7A 3UCRA 3U4EB 4ZMPA 4PR5A 4BGDA 3LNGA 1X5ZA 3QIWB 3HZ3A 3T0BA 4HV8B 2VR8A 3CK0L 4JAMB 4AGMA 4KO6A 1PQZA 3Q06A 1CO1A 5FHBH 3BPLB 3DX8B 5ISZD 1YDPA 4PMFA 1YJDC 3LZFH 4LGRB 3RJQB 4ZZFA 4OTXH 2R0KL 3GZOA 1KPUB 4MDIA 4PY8I 5MERB 3CFCH 1WIPA 4TUJA 1U91A 3K7UA 1UG9A 3KBFA 4IGBB 4MS8C 4PY7A 3BLKA 1J5CA 4GSRA 2NY1D 1JVKA 1H9VA 3CX2A 4BELD 1QI3A 3RNQA 3QGVA 1DBBL 2NY3B 2Z31D 1ETA1 3L1OL 1R0AL 2M1KA 5AYQA 3S96B 3KPNB 3U79A 4H26A 1DDHA 1ZT1A 1ACYH 1XD1A 5CGYC 2DD8H 3DKHA 3CQFA 1XBDA 3QP3A 3GM8A 1SDDA 4U6VH 5AOJA 5C7XL 1BQSA 4MA1C 3CLEH 4LL1A 2ZSWB 2CCWA 2APWA 4BFRA 5I73B 1C8PA 4WRLA 4UQEA 2AITA 4CSPA 1J9CT 3QCVH 1RJCA 4P5TB 4IOSD 2Q86A 4X5XA 5G5DA 4UV4H 5FUZL 3UAFA 4AV5A 4O2EA 1RZJC 4H2CA 1TQBB 4PJBF 5JW3L 4YXLH 5DA0B 2ZUVA 1YEFH 1JF6A 4L1HA 4JFQB 4AYMC 2E7LA 1SHMA 2LABA 3FQRB 3IETB 3UAJD 3SPJA 4ERSL 2EXWD 4OSUL 3S0PA 1MCOH 4BH7A 1MJ8L 5J12B 3TCXA 2HVJB 4AH2A 5DMGD 4HKBA 2G5BA 2A6IA 4JPKL 1U3HD 2ZXDA 4I2XE 4ECNA 2VISA 5KN5A 3FU3A 7FABH 3K74B 2W0PA 3F7RA 3MRCA 3QRBA 1TFHA 3RGVC 2FSDA 5DD3L 5KS9E 4LGPB 2W0FA 3QDJE 1KWGA 5LBSA 4YHLH 2B0SH 4FD0A 3RY5A 3IE9A 5GS1B 1GSMA 4RBPK 1OLLA 2P24A 5DWPA 2R56H 4XI5C 4AIZB 2IMMA 3SHSA 5BZDA 3PWPE 4LOFA 1PBYA 3B9EA 2F1EA 1M6OB 5JIIA 2CJUL 3IFNH 1FE8L 4F8PA 5F88A 3KGUA 4QGTA 4QCIA 5DRZA 4O02B 1Z5LB 3ZKMD 1A6UH 2H2SC 2BPBA 3KW7A 3MFFA 3RWGB 3ABMB 1SQ2N 2WLKA 2XTJD 3T0WA 4WTWA 4UDTB 3K71B 4G6AD 4Q89A 3TM6A 4WWNA 4F1ZA 2DIEA 4XPGH 3RWDB 4U6YB 5CCKL 3Q8FA 1WICA 3WSQL 2OR7A 5F7NC 4AIEA 1SHWA 3QORA 2DL9A 5DMKA 4KKNA 1OCCB 5D1XD 1CGSL 2PYFB 4A6YB 4K23L 5I6LA 4WJG3 1IGYA 3EHBB 1DZBA 2O5NA 5EORL 3GINA 1TQVA 4K9EL 1LEIA 1NCGA 1PCXA 4FI8A 5JIMA 2OJZH 3GI8L 4GMSL 5BV7C 3AREB 1Z3GH 2QADC 3NIFB 2TSBA 3CVHL 4AKQA 3QXAA 2QR0B 1AIFB 3W0WA 3OKLB 5DJDA 5DS2A 1A6PA 1BVNP 4XAKE 5FPIA 2AGJL 4FQXC 3ZDYB 2PPEA 3SGDH 1XIWC 4R26H 5AOIA 3MYJB 3PABA 4X5WA 1FN4B 2DQEL 3O6FA 2XRAL 4GRWB 2OMVA 4UV7H 3POCA 4QY8B 5E1AB 4MYWB 4TM9A 5E4EC 2ZAHA 3TEXA 1I9JH 1SBBA 4N2KA 5D71L 1QEXA 2ATPB 4H25B 1QUPA 4PREB 3TO4A 3EDKA 5HYSG 5EZLB 1YJDL 2D73A 3C60D 4OCYH 4XB7A 5E95B 3QORD 2E9JA 2HT3C 4TPRH 5EWIL 4ZQTA 3D50A 2QMKA 2UV3A 3RDTC 3B3IB 5L9DH 3IGUA 3BWUF 5EN3A 3DUHA 3JV4B 3GSNL 3D4YA 4XMKH 3Q3GB 2WUCL 3VWKB 1ZA6B 1LO5A 1T1YA 1ADQL 3K1DA 4PTUA 5FF6A 1UYWH 4FERA 3VVWA 2HRGA 5T1LD 4QRRD 4JQXC 2HT4C 1EEYA 2R1WA 2UWEF 1H9DA 1CF8H 4NXKA 1PDKB 2FGZA 1ORSA 5HI3C 5KTEL 3VB9A 3ARTA 1N59B 4Q52A 1BSIA 1OTTD 3DGDA 1U8JA 4R8WH 5DI8B 4N9GA 2DPKA 3IN0A 4WAFA 3LPPA 4FFWC 1TVBB 2O93L 1QLRA 3LMJL 3MJ9H 4YSOA 2AXJA 5IJVB 2FR4A 2EYTA 2H7WA 4Z5RB 4Y1SA 2LU4A 3X1FA 2HTLC 3RAJL 3IJ7A 2CK0L 2H6OA 3MNZB 2JSFA 4OF7A 4PJ9D 3TO4D 2WLYA 5D1XE 4RA0C 1OGPA 4HXBL 4WU7A 4A7QA 1JMZA 1JWMB 1AQMA 3UTSA 1URLA 2PXYC 1KSRA 1E6JL 5DRXB 1XO8A 3NAAL 3P54A 1YCSA 2O5YH 3ALPA 5HTSA 1P7QA 3MXWH 1A0QH 3GJFK 1UZ6E 5FUOL 4LP8A 2EICA 1S7RB 1HEHC 2V7NA 2CKBH 1BX2B 3KL3A 3P73A 1SOKA 3KPOA 5E94B 1I8LC 3QH3A 4N8VG 4L8CB 2OL3A 4N8CH 5MHSD 4RRPM 1K4DB 2D0HA 3DPBA 2DLIA 5EC2A 3SBWC 4TXVB 4YS4A 4TTDD 3WYRA 1YUHB 4NQXA 4HS3A 1C16B 3WFEH 2NW2B 4ILDA 1AGDA 3V5KB 2AV7B 4HCGA 2H6PA 1XGRA 3CXDH 4KI5F 1IEHA 1C8QA 4L1LA 4TV3A 4KK5D 4L1DA 4GT7A 4P9ML 5J11C 3L1GA 4G8IB 2EIZA 4N2EA 4NUJA 1MWAH 3WIFA 1H0DB 1BD2B 1PZ3A 2Q3AA 4LLUA 2V3FA 2YKKA 3SDXF 5CZRA 3EYQD 2AI0L 1A6AB 4KI1A 1T5XB 4Q7DA 4HXAL 3ORJA 4DAGL 2ARJB 3GXMA 4Z7IA 5D96B 4JO1L 1K4CB 3QIBA 1G6RB 2NR6A 2C9AA 3MGTA 5D2LB 5I6XB 1FYTD 3PNWB 4JKWA 4BZ1A 3W0WE 3HC4L 3LXAA 2SEBA 1KJ3L 2VRKA 5GGUB 2MKWA 2EDTA 4JHAH 5MP6H 1M9WA 1ZXQA 3QHTC 4JJ5B 2NPLX 1AXTH 1FZMB 3NDYE 5BV7L 4DWHA 1PIGA 1DBAL 8FABA 5HYEA 5T3XE 2WN2A 1ZOXA 2VXSL 3R1GL 4AI7A 4P23A 1D7BA 4OKVB 2VDOH 1NCCL 4QRQB 2Y25A 1TKWB 2QDVA 4GO6B 2WXLA 2OJ1A 5I66B 5LBVA 3HE7C 4FXGC 5ACZB 4P46D 3WFBH 4ZZKA 4L18A 5AWNL 1CXFA 1KENL 4IRJA 1WEJH 1A6VH 3INUL 3DUUB 3JWNE 5ESAA 2YQ3A 4ZBJA 2ZWLT 4YDLC 5IQ7H 1FNGA 2BIQA 1FNSH 4HYTB 4MSWA 2Y2TA 2Z8WC 3FTSA 2J20A 3VQMA 4B97A 5E8NA 5HGBB 4N5ED 4GXVL 3N42F 4CA4A 1S9KC 2X6MA 1T03H 1P7HL 4Y4HD 3PGCB 3SDDD 2A1WH 4RFEB 4MAYB 4ANWA 1N6VA 4JPSA 3SKJL 1NLDL 3MV9A 3G5ZB 1UOVA 2Y23A 2BHYA 5F7YC 4JZNA 5DR5L 5SWZB 2X4OA 3NIFF 2XTSA 4OB5H 2QSTA 3BVNA 1OF2B 3T0VA 1ZVSB 5EO0A 4JM2D 4ABVA 3ABLB 3GXFA 2R2BA 1TTRA 1CXEA 2HLEB 4ODUB 2EVGA 5GPRA 1HESA 2WIMA 3QR2A 3KWVA 3K81A 3S35X 1OTSC 2PR4L 3L2LA 3O3EA 3QQDB 4BA8A 4GRWF 3GMRA 1HL8A 1AGBA 2J56A 2LQRA 3AGWA 4NHUB 1FFQA 2YLKA 2CGYA 3L3DB 4OJFH 2CCVA 1MCWM 3I6KA 4P5MA 2XI9A 1TVHA 5F3BA 5D9SA 1JNHA 1BM3L 4F7EB 2V33A 1IC4L 1AZRA 2H5UA 1JZ5A 4WI8A 1UH3A 3MOBL 4L1BA 1RJZA 1H3VA 5DUJA 2CGZA 3DECA 3P9MA 2N1KA 5EBMA 4G6JH 1DVFA 4HUWA 3JVFC 4PRPD 4YBQC 1O6VA 2YAPA 1JWSA 1KEMH 3L5WA 3KJ4B 1JV5B 5LDSA 1M42A 5AW8B 3VSTA 3GKZA 3LHAA 1ACCA 3EBAA 4CNIB 4GW1B 3CDGB 3JT2A 2BNQB 3LKOA 3WKNA 3HZKA 4AQAB 2AK1H 1VGKA 4YHZH 5C3LD 4N1HB 4YHIA 1GGTA 3FN0L 3H85A 1N5AA 4S0TD 4IBLT 5HI4D 2NY2C 2YOAA 1OKEA 4XXDA 4Z7NF 1WBYB 1MREH 4A2MA 1F1GA 2R0ZH 4LLYA 2OTUB 2GQHA 4PJAB 3GSOB 3O2WH 1E4WL 3RP1A 4K3HA 2OQJA 4MVBC 4YHPB 2C9RA 1ZCRA 2RQ8A 3AU1B 4JFDB 5FXCH 2NTFA 4HF5L 3EFFA 4AGPA 1PPIA 2OCCB 3VSQA 4Y4FD 4N0YL 3B7UX 2BVOB 4AM0A 4JZOB 2DWSA 3C9NA 3P3YA 3ARWA 1NPUA 4B27A 4XB8A 2MSPA 5E70A 4QJ3B 2LVEA 3CV5A 3EYFA 1HSBA 2YGQA 4HEPG 4N0CC 3MR9A 2ZUQB 3W81A 2QPSA 4DGVH 1K5NB 3VFGH 5ICUA 2VUYA 4UM9D 1IRAY 3SQRA 3LXUX 2ATKB 3UH8A 5CGTA 3KVPA 1MSPA 2OL3H 2XNAA 4G8GA 2EXYC 3GRGA 4V33A 1OLZA 1X4XA 5E4IA 2YPLD 5CZXD 8CGTA 1WCQA 1WV7T 2CIKA 2PCPB 5DMIL 5FYKL 4BFEA 3O8XC 1JPFA 3IJHB 5EPMB 2HFFA 3HN3A 4P0DA 4P4KB 1UT2A 4E2OA 3NA4A 1HH6B 3FQ2A 2YSSB 4K5OA 4BYHA 1W8NA 2BIMA 1MFEL 4CADA 4TQEH 4PRPE 5C07A 1MHCB 2CBOA 4FL4B 1U95A 1E7UA 1NUGA 2X05A 4Q6YA 5CIPH 4Z0XA 4PGBB 2OMYB 3P2TA 2PTVA 4CVWA 1JHKL 3MV9E 1FZOB 4D3CL 4DEUA 4MJID 3OXRB 2NYYC 2JJUA 5HSFA 2WWOA 2G5RA 5CJBA 4QXGL 3LIZA 3BHBB 3L5IA 5D2LF 1F3DH 4GRLD 4L8SB 3X11A 3ARGA 4H20L 5AQ0A 2F0CA 3DIFB 5HI5C 1ERNA 2F68X 4LDCA 2G2RA 3EO1B 4WTZA 2GI0A 3ZDZB 5EZOH 1Z2KA 5SX4H 1LO3L 4IKNA 1G1KA 3ULVD 2VLJA 1DP0A 3QUYC 1I8MB 1A6TB 1MLCB 3AXLB 3NTCL 2ZXAA 2R7EB 4PJCA 5CLXA 4PYGA 2B1AH 2CWRA 2VLRA 5DEFB 3BZ4A 4Y7MA 2J57A 4OLWH 2NNAB 3HN5A 5BW7A 2JCCB 2Y06L 3GM0A 2FBJH 2K45A 3MROB 3PAVA 4R4FH 5CFAA 1AD9A 1Q9LB 3GSRA 3T6XA 43CAA 5IHHA 2ADJA 4L3AA 2F8VA 1MFCH 3PF2A 3ZR5A 5T1KD 3AGVA 1FIEA 3FHQA 2JIXD 2LU3A 3IWVA 4JK0D 2F8OA 4J8RB 1UJ3B 2VDPL 1J0KA 4AQZA 2B15A 2O5ZL 1OM3H 1WHPA 3UZEC 3BEVA 4MDJB 4OVUA 3VFMB 3MRPA 1FGNL 3TBSA 1S5HB 3MJ7A 1A5FL 3FT0A 4ZO9A 4Z78A 2FCBA 4JY6B 5E8OA 4B7IA 4EXKA 2A9CA 3FQWB 4MJ5A 2Y0SA 3MLZH 4ZUSA 1HQRA 1V05A 4HIHB 2XG4B 3NABL 4GG6B 1NEUA 1A6WH 1EMTL 5ECGA 2J5LB 4N0RA 1HXYA 3WENA 1U8NA 4ONFH 4A7GF 4GBXB 4AVKA 4M6AA 1P7KA 2D7NA 3AT9A 1T22A 5JOFB 5MI0C 4HJEA 5D5MB 3S88H 3C6SB 2E6PA 1G7JA 2VDNB 2BC4A 3P4LA 4RGMB 4YDKL 2HTKC 1SGKA 2G9HA 4MJIE 1BMGA 3SGJA 1BIIA 2YD8A 1S7XA 4R7XA 2NY0D 4Z7WE 2Y7NA 1RUPH 4FKHA 2OR9L 3AY4A 1E4KA 3MRHB 4H8QA 4WI0B 4G9DA 3STZA 4JGMA 4G8GE 1H3GA 1VCAA 4X9BA 4E9QA 5CJ5A 1FSKB 2H32B 2B08A 3DPDA 4G3YH 3N9GH 2FLRT 4WWKA 1ZLSH 1RZ8B 4PGCA 4W9IC 1XTLA 4PD4J 3CVIL 4G42B 5GGVL 4N5UA 1ZGLB 2XVLA 5IVZA 5DK0B 4PS4L 3DBXB 3HR5B 2J4WL 3D2TA 4XMPL 5DD0L 4TNFA 4PJ5A 4U1HB 4OKDA 4FOMA 3LYRA 2Y5TB 1WPCA 5C07E 3FSWA 4RMWA 1R5IB 3FRPB 3IDGA 1CG9B 1MZYA 2Z8VC 5DJAB 3RNKB 2J25A 4Y5YA 1GCFA 2I27N 2I5YL 3HG0A 1BFOA 5B3JF 1D5MA 1UD8A 4LSPL 1AOZA 3PL6C 4B0MB 3EH2A 1IGJB 4OZIF 2WLLB 3G5XB 4GI8A 2FGWH 5A3IC 2BY0A 1DVTA 3Q8AA 2DIBA 3BT0A 1KV3A 4GXUM 4NPJA 4TYUA 3SDCC 1UD6A 3HC3H 3JWNG 1V7ML 1VKXA 1J0IA 2C9UA 2VLJE 1RIUL 3S6CA 4L0YA 2NUTA 1AE6H 4N8UA 5DZJA 3RBGA 5HYQA 4UT7H 3BWAB 2F19H 4PJCE 2R29A 3ZY7A 2P7TB 4FFYA 2VLRE 3MBXL 2VE6B 3OLGA 1WD9A 4DKEL 4YE4L 4HGKC 2PUQT 4PVBA 3DV4A 4W81A 4XPTH 3GK8L 2FYYB 3ZIMA 3AWGA 1KB3A 1UVQA 3IAPA 3RY6C 5LUMA 3RY4A 1LQBC 4GAFB 4WWPA 3ULUD 2AEOA 1FZKB 1K6QH 1MFDL 4AIXA 1P2CB 2BP5M 2PMZA 3ARBC 3F8UB 2KDYA 4PVLA 5EOQH 2CNYA 2X2HA 3E38A 1SJVA 2X4RB 3QS2A 1TSHA 4KXDA 3ROLB 1HINH 2Z92A 3QAZB 4M8QB 2JKXA 3RX9A 2R8SH 3WHXB 5JMRA 3IMRA 2WB7A 1M2VB 1BOGA 4NKOA 5EBWB 2HJKB 2ZWZA 1KWKA 1KELL 2WINB 4M4RB 2X7LB 2YMOA 2WZ0A 4NT6B 3ZHFA 1R46A 2W07A 4ZSOB 3MLXH 1ZHKA 5BRZA 1NSNH 3GBML 5EF2A 5F7HA 3LIZH 2VXTH 1EIBA 3APMA 3MOAH 2QMJA 4QYOA 5C6TH 2WYTA 1HOCA 5JQHC 3HS0B 2FX9L 1A3QA 4UTAH 3RGHA 4K8RC 2NRDA 1MCHA 1G9EA 2P8PB 4N3UA 3R4DA 1SF3A 4MXVE 4P07A 1F4YL 2QPEB 1EGJL 4HPOL 1WZ1L 2LR4A 3D9AL 4RX4A 2VDKL 2R2EB 3QG6A 1AC0A 2AXFB 4DW2L 1IGCH 2JKLA 2AJSL 1U8OB 2X6BA 2B4CH 3PWVA 3TVMC 2J1YA 5LGHL 2BIPA 1I8IB 5J3HC 2LE9A 4HOZA 2P5PA 3TBTA 1MXDA 4HC1L 2IC2A 5EOTB 3V4UH 2BWQA 4FQPA 3DTDA 2GBVA 3KYKL 1H3WM 1H3XA 4FQCL 4UTBH 4X8JB 3PRZA 1ETZA 4MNQB 4FXLA 4R4BB 5CJOH 5T1MB 5E2VL 1QUNA 8PAZA 5I19L 1BAGA 2BWIA 3TJHC 1OP5H 1J8HA 4GRMA 3BMWA 4HQQL 4LQFH 4JG1L 4Q9RH 2E3VA 1P6AB 4KRNA 5CEZL 1DANU 1N18A 4UOW0 1EO5A 2F5AL 3I50L 4ETQB 1WJ3A 2JB5L 2M8XA 2HN7B 4PJ5E 4FTVD 3U4BH 1O7VA 1U3JA 2V3DA 2X41A 5IWLC 5TE4L 1B3JA 4ODHH 1WITA 5A1AA 2F6AA 2A74B 4JX0A 2XZAL 2W0KA 3CZUB 1CICC 5C70A 3FUKA 3ISRA 5T1DH 3U0PA 3A6BL 2YWZA 2B2XL 5C0JB 4HBQA 1A7RH 3S5LA 1CGVA 4YWGH 3RI5K 2J88H 1I7RB 2EABA 4RISH 5E2TH 1H3TA 1NDMB 2ZP9A 4BQ6A 1FIGH 4AQEA 5L8KB 1G94A 2X3AA 5JUEL 3GO1L 2X9WA 3DRQA 5DS1A 3BKCL 1U8CB 3MJ8A 5EU3A 4ODTH 1BIHA 5LHDA 4UQDA 2LFEA 2FBOJ 5DHYB 2BCKB 4YC2B 5GGQL 5JW5A 3E3QE 4WTXA 5CILH 2KERA 2ZKYA 2CRYA 4E0RA 4I18C 5IGXH 2XUWA 4WENB 1J1OH 1WP6A 3QUMA 2RGSA 2YPKA 1JV2B 3K6IA 2FEDC 1WD8A 3CQPA 3QJOA 4NZTH 3AZUA 3WJLA 1KTDB 1WUZA 4YR6A 3VTTA 4JQIA 3EFOB 2AXGB 2CO6A 1CPUA 1QSFB 5E23A 2D3LA 1EFXD 1FV1A 1HN1A 3M1OA 4XNMB 1YO4A 1BREA 2LAGB 1NCAH 1KLGB 3U6XS 3T6QC 1S7VA 4FQ2L 1B0WA 1JERA 4UAHA 5CSBA 4EDWH 2BSRB 3AXIA 2C1OB 1C08B 3AWFA 3OZKA 4GQZA 4WFGE 2YGNA 3MGOA 3T4AB 1CD1A 3U2IA 3PDOB 3K4ZA 1F3JA 3IFPB 5I1EL 5BRZE 2ADFL 2G60L 2EIBA 4Z7QF 4DGYH 4LT7A 3CCHB 2MCG1 5SV4A 2MOGA 3J07A 4GIPD 4XNYL 1NGZB 4WW2A 3VXRD 2HG5B 4WI2A 2WUBH 1GYAA 5DQDH 3T0DA 1R4XA 4JPIB 3HI6H 1ADWA 4LSSL 4JFWA 1KLUA 4RGNB 1KB9J 4C47A 5ANHA 4HFUH 4F91B 2GIXA 4WJKB 3Q2LA 3LDBC 4Z7UA 2MCMA 4K8RL 1RQ5A 3ZKND 3FTUA 4S1SL 5TGBA 3JTSA 3NZHL 2Q8BL 3DIVA 3KYNB 5CCJA 1OOAA 1UM4H 4AJYV 5EG6C 1Q94B 5L6YL 3B9VA 3DX1A 1TTBA 3MNDA 3P02A 1JG9A 4MJ4A 1BJ8A 1SY6A 2V2WB 2KKQA 4BUGA 4X4MA 4KUCF 2E46A 1UA6L 2IPTH 4JKPH 1L0YA 3GMNB 4Y2DC 1USQA 1CZ8L 2EE2A 2Z0BA 2IV9A 3RG1C 5J7CC 3RIFF 4C4UA 1J8HE 1JYVA 5AB2A 1LE9A 5GRJH 5FKAA 2VMCA 4YPJA 2QTEA 1NBYB 5EO1A 4Q4EA 1X5JA 3KGSA 1SYVA 2HVKA 4YAQB 4GINA 1IE5A 1KB5B 2RTTA 4FNLL 4IRSA 5DD1H 1CFSB 2DV6A 3S35L 5T5FA 2IG2H 2WKGA 5GGSA 3K80A 3TNNA 5D7LA 5IB2A 1S9XB 1AZVA 1XGYH 1M7IA 4UT6A 3GRWL 3RWJA 3WEXB 1KIUB 1IKOP 4NP9A 4Y16B 4DVBB 1JGEB 2OZ4L 5IT2L 3NFNB 1UH2A 3IJ9A 5C6PB 3CFIC 4U6HB 2VJXA 1R75A 1LL1A 3B7TA 1RAMA 1WFOA 1KBGL 2GY5A 5ANMA 1N8ZB 1XH0A 3H0TB 4QHMA 5HHXH 2CLZA 3GSUA 4WHTA 3CUPB 4IEFA 4C4BA 3ZTDC 4M5YL 2DWEA 3BESR 5CBEA 1GS8A 3QO1B 1ZV2A 3ZOAA 2I24N 4QRPA 1ZHBB 4KFZC 3VGAC 3QZWA 5A6MA 3VUAA 2IXQA 3KZ8A 3W2DL 3GBNL 2MPAH 4P2AA 3FU8A 4N2GA 3QXUA 4OFYD 2J6EH 1NGYA 1NC4B 1M1XB 3OBAA 1NWOA 2NY4C 2WLMA 3BQUA 3H2QA 3R8BB 4D0CA 1UB6B 1L9QA 4PRIB 2YC1A 4AENA 2GK0A 1I9RL 3WFDH 3HMXH 3FU5A 2FIRT 2DRUA 3P4OB 4J6IA 3T6ZA 1FUNA 2OCJA 1UZGA 5BCAA 3D39A 2BOCB 1I1RA 2YRPA 2X53A 4OT1H 3PWNB 4J6RH 3CFKB 1RHHB 1SMOA 1YEEH 1KGYE 2AXWA 4I87A 4WTZG 2OYKA 3E0GA 2IFFL 3O2DA 4K5MA 2V2TB 1TPXC 3PGDA 2NT0A 4K55A 3VWJB 4Q9QH 3C5ZB 2BDNH 3NRFA 1R47A 4HDIB 4XP5H 4MA8H 3H54A 3ECVA 1ROWA 3PAZA 3UBXA 1B9KA 4KTEH 5C0CB 2WD0A 3T08A 2FYVA 3SPGA 1T5WA 3NRQA 4HHAA 3QCTH 4N6QA 1R34A 4DP8X 2VDLB 3L95A 1R5WB 2FWOA 1W0VB 2R9HC 3G6DH 3QIUA 4JPVL 5INDB 1KCRL 5D1QA 3CSTA 4Z7UE 3QXDA 4HISA 2BRQA 3DJ9A 4WFFE 7TAAA 2XT1B 3ECUA 4U1GB 5DJ6B 1J9QA 3HB3B 1V27A 4X4KA 1I8AA 4OI7A 1C5DB 2MOQA 2VLKB 1PY0A 1MI5B 2VRAA 5I8KH 4LSTH 1QW8A 4OGAC 2JJTC 4H8WC 4TQHA 4MRBA 3Q43A 1QASA 3MV7D 4X4ME 5LWYH 4DP5X 4ENEC 2WLNA 1QD0A 3H9HB 4HJGB 3OJMB 1ZSDA 3DVFA 3LB6C 3E6HA 5AUMB 3WXWH 5KWYC 4LSUH 4JKKA 3C6LB 2EDHA 5C3TA 1JGDB 2HCZX 1FORH 2DQJH 5JHDA 3MCLH 3ME0A 4RSVA 1O7DE 2NZIA 1MJJB 3RZCD 5GRYA 3TA4D 3L5XH 4ZMZA 5D7LE 3HG1A 4Z3GA 5AZ2L 2MPVA 4JCWA 3UTPD 5C08A 2BLFA 3RFZC 3Q7JA 3RX7A 1HYRC 2O30A 2VKWA 2CR3A 4M1GH 2YKLL 5DZLA 1AH1A 1NBZA 3GUTA 1INQA 4XMVA 3KCWA 1YUKB 5IQ9B 3MV11 3FQ1A 3WS3B 5DVLA 3LPOA 4PJIF 3G5YB 3MRIB 1DQML 2XYBA 5ANME 2QKIB 5TDPA 4AG4L 4KHXH 3QEQA 1H5BA 3QJSB 5BRQA 1ZVYA 3SDAC 1REIA 3C75A 4LK4A 1ITCA 4U1LB 4CAGA 4M56A 1CTNA 5I17A 2GSGA 2G30A 3IDYC 5J56B 4QRPE 1EO8H 5EV7A 3ASOB 4YDZA 3UJJH 3W39B 1I7ZB 2EAEA 2V4LA 4CJ0A 4HW6A 3IU4L 4M43L 1XF4B 1CD9B 3LS5L 4N0FA 5DURD 1RHFA 3P3RA 1WYJA 3VGGA 2NZ1A 1UWGL 2C4FU 2XWEA 3V5DB 1MFAL 2DJMA 4OM1H 1J1XH 3S36X 5BQDA 5FYJD 3HNVH 5DRNB 4JO3H 4N4YB 5I1KH 5L2JA 3TWCH 1KCSH 3DURA 1VADB 5DJ0B 3QHFL 2WM0A 1RFDH 4YX2L 3V0VA 4JY4A 2GJZB 4QXUH 4IKJA 1ZS2A 4ZQKB 3QUXA 5I8EB 1GGIL 1N8OE 3L3OB 2Y2YA 3KPPA 3L7FB 2DQTH 3D39E 1UURA 1P1ZA 3LN4B 3L1FA 2WQRA 4LLDB 4M7JH 4UT6H 1KPVA 2VH5L 3WUZA 4FNTA 3B2UD 5C0BB 4POYA 4ABUA 2HLFC 4M6NL 4MWFA 1F0LA 4Y7OC 3CZFB 3DX0A 5B39A 5FWRA 1DHKA 1VACA 5D2NC 4YSUA 4X6DF 4LAQL 4MZIA 1YMMA 5E8DH 2CGRH 3BAEH 3SYOA 1OAKH 2A6JB 3HPLA 4J2QA 3EOAB 5DVKA 2V9TA 5F44A 5BPPA 2QHRH 1YN6B 2YK1L 3MRNB 3GMQA 2FD6H 1N7MH 1P4IH 2OULB 5FK9B 4RMVA 5D1QE 4EI5B 1MF2L 2GFBA 1M2OA 2DQUH 1LO4L 5HYSB 32C2B 3FKUS 1QHQA 2ZUWA 3LCYA 4BA0A 3QR0A 3CZJA 3QUXD 5E00B 1T20B 1BAWA 3PYCA 1KTJA 12E8L 3OSKA 1XCXA 3Q13A 4KRPD 4X6CA 2IPKA 4DQOH 4F20A 1SM3L 1E27B 1UACH 3IAGC 4Q9CA 1LWHA 4LRIA 2K6ZA 3HE6C 4YQXH 5DO2C 2R23A 1ANUA 1XZ0A 4DVRH 1Q1PA 4ODVL 2GEEA 3P30L 3AQDA 4G8FA 4GKNA 4XO5A 1LD9B 4H8WL 5IMKA 3LKQA 3BW9B 3GLZA 3MNWA 2NY6D 5D7HA 1M05B 2ITCB 2NUPB 2JB6B 2JNZA 2ZICA 3U2SA 4DF9A 4AC4A 3G5VB 4JDVA 2K1MA 5EF0A 4JREB 2X6VA 3TYGH 2P28B 3HG1E 2DTSA 2EDRA 4NKIL 2FX7H 5F7LB 4MASA 5E4AA 1CT8A 3BC9A 5DZPA 2EH8L 3VCLB 4FZEL 3HG4A 3QDAA 2Q3XA 3ISWA 4O4YL 3FUDA 3N41B 1GOFA 3G6AB 4IDJL 1XBRA 4Y4KD 3BUPA 5D7EA 3QEQE 3U7AA 1SVBA 2DS4A 2VMJA 4NM4H 5HHOA 3W82A 5JQIB 1OHQA 1QWUA 4JZJB 4A68A 1GGBL 1ECYA 2UY7A 4U1JB 3APNA 3OKMA 4JBSA 3TF4A 4N8VB 3PDDA 1C12B 4GNKB 3PREA 3ZE0E 1ZTXH 1GOHA 2J72A 1UXSA 4XCYA 3ZO9A 4G7VL 2X0UA 3MBED 3PWLB 2EIMB 3H1ZA 3C08L 5HJ3B 1KCLA 1FA4A 3EDDA 1OK0A 3PJSA 3QXWA 1G0XA 2A77L 4PI2A 2XPGA 3O0LA 2BFVH 3IXAA 3S5LG 1MJ7L 2F9BT 1AMXA 2DLFL 3MRBA 3GXIA 5L2KB 3AG2B 4JS7A 3DMMA 1SEBB 3PQYD 3WN5A 4UU9A 5JHLH 2IH1B 4V1DA 5IVXA 2ZT9C 2AMGA 4HK0B 5CNHA 5IROC 4J5VA 1D9KA 2CO2A 3PU7A 2IGFL 1NC2D 4P9HH 4TNWF 3NIGB 4ZAKD 5LAPA 1KG0A 4IOIA 5KG9B 5KAQG 5LAXB 1PEWA 3FH8A 1DQJB 4J3OD 1C5BH 4X7CC 2G5UA 4QOKA 2HX8A 1YEHH 3VDBA 3F7QA 3EW3B 2QSVA 4QJ4B 2OYMA 2W81C 2BHZA 4U49A 3ABKB 4RRPA 3GTVA 1CGYA 1RH8A 4ZS6C 3VH8A 1KBPA 4AQ1B 4PN6A 2BOBA 1DVSA 2FWLB 3FTYA 4G80B 1ZD6A 3GSVA 5GZNA 3TBWB 5TDOB 4XNQA 4XPBH 3MNVB 3KLKA 1HZKA 3NGBC 2AJVL 1FLRL 1GZHA 3IDIB 3QC5X 1HHIA 3QEUA 4X6CE 3JVGC 2WWKT 2EXTA 4OLEA 2GYSA 4DP0X 2NXYC 2VW7A 3KH3A 3EOTL 3FMGH 4M7LH 3RUGA 1IFHH 2K9UA 3H3BC 2AKRB 3T8XB 2ICWI 4RFOL 3CVHA 3SQBB 3ZZQA 4KKBC 2J21A 3LD8B 3U6RB 1Q90A 5KYWA 4UB0L 5IHUL 3EO0A 5DMJB 4O2CB 1BJMA 3T65B 1SOQA 2ICEB 1E3XA 1KY6A 5HD8C 2ODHA 4KJWC 4K15A 3L4WA 1S8DA 2PW2A 1KYUA 2YPVH 1JHLL 1KOAA 4F24A 2IJ0C 1T4KB 1IEAA 1WTLA 2JKTM 5C0ND 4OGYH 1FO0B 2EVFA 2BHFA 3ATDA 1A1NB 4X7TB 2AEWA 5LG6A 2E59A 2YBRB 3P9LA 4QAMB 5D4HA 4HA1A 4L3CA 5DQ9A 4AVIA 3VXQB 1YYMH 1ADQA 1TZGL 4OQTL 1OAUH 4X9YA 5HHOE 4JDEA 3B2DC 1RUML 4P2QD 1WDAA 4YFLF 1YMHA 1ZXKA 4AE1A 1CI3M 2ALWA 2KPNA 4MDRA 3UTOA 1U8LA 1KTRL 4P57A 3D34A 1JL8A 3E80A 4ZMOA 1OAQL 4HOMA 2XA3A 3FHEA 4WKZA 5CZVL 1A7PL 1EH9A 2NYKA 4KJYB 2IAAC 1E4HA 4K7FA 1NCDH 4QR7A 3QJFB 3FFOA 4MB5A 4JGUA 5IBUG 1CFTB 1K3IA 3O0RL 4I2XB 3GMMA 5DZVA 4G7QB 4B3VA 3NCFB 1V7NH 4LLVB 1J5HA 5ESQA 4HGWB 1JPSH 1UWYA 3QDJB 5ALBL 5IFAH 4ZMXA 1NCJA 3L3GB 4V1DE 3T0XA 5IVXE 4QTHB 1K8DB 4P8QA 4TQ8A 3PWPB 2FHBA 1RK0A 1S78D 3DX9B 4P06A 3QZWG 1THCA 4WZ9A 4XN1A 1J7VR 4WW1B 2Z4QB 4FN0A 1WIUA 3WAKA 3DRTA 4I0PC 4B41A 4L2LA 3N41F 4X7DC 2WZ6A 3RGVA 5CD5D 1CD8A 1W8OA 5C7XH 4QOKE 4EN3C 3KPSA 4H0LC 4HKXA 1VESA 2Y1VA 3FL7A 1YN7B 4X5RA 4YO0B 2Z3FA 3BKJH 1OO2A 2MCPL 4L9DA 2WQ8A 3QO0B 1DL7H 2HFGH 3VM7A 1IIIA 3P0YL 3WE1A 4WGVB 4P4RA 4YBHA 4TLSA 1GYCA 1CS6A 1N19A 4YNYB 4AZ8A 4BM7A 4FQQB 3W9DB 2W65A 2B39A 1YEIH 4XE0A 1Q0EA 1ACXA 4NAJA 3II2A 4U3SB 5A6IA 1F02I 2XXMB 3T4YA 4P49A 4PJXA 5D7SL 5BO1L 4OSUH 5E6RB 3QYNA 1QNZH 2YQGA 3D85B 5KVFH 4NCC2 2J1WA 1X4YA 4S2SA 3GTNA 1BZ7B 5GGRA 3I3EA 4PR5B 5IW3A 4M5ZH 1SHSA 2CMRH 4GMTH 2F53A 1QLFA 1AKJD 1UM5L 4JPKH 3RUGE 5G4OA 3WO4B 1QAWA 1M71A 1PQZB 3KNBA 3UBXG 4DO5A 2P48B 1ZY9A 5IIEA 2VDRH 1QSEA 1YDPB 2JF1A 5I0VA 4WGWB 3A67H 3C8HA 4MDIB 5DLLA 4ALAL 4TUJB 1T6VN 1U91B 2X2YA 1YEGH 1GC1C 3FAXA 4PY7B 4W6XB 3KPSD 2ZUYA 1YECH 3G08A 3TA3D 3RNQB 5I28A 2ZPKH 4L0PB 6FABL 1JZ6A 4I3RH 4J2XA 3VRJA 1RUQH 4YFDB 3DSFL 4YHKL 3U48A 4FQXA 3VI4F 4H26B 4NNXA 1XIWA 1DDHB 2D3JA 1IB5A 1AY1H 3A6CH 4IU3A 1KCBA 2AQ3A 4JRXD 1M53A 3F04A 3OPZL 3JWOH 1BXXA 3BFWA 1SDDB 3TT3L 3DHMA 2QGBA 2BZCA 5TF1L 3MRJA 5EUOA 1CE6A 1G9HA 3KDPB 1AGCA 1G4RA 3CBJB 5AL8A 5E6IC 1B3IA 2VR4A 3ARDC 4NM8L 3NEXA 5INCA 3RDTA 4X5XB 5G5DB 2Q86B 3V4PH 3EJRA 4YHMH 5B3SB 3IJYA 2OSWA 3ZL1A 2PLTA 4F58L 1CUOA 2A5UA 4PG9A 3UTZA 5HJGA 2YAHA 2D31A 4I4WA 5FECA 2OMTA 3QBTB 3A22A 4JQXA 1MIMH 3VMPA 4FQ1L 1YYLL 2ZTBA 5BUAA 4BH7B 3BE1L 4R6UA 3WFZA 4P2CG 2CBQA 5B7EA 3BDBA 5AAWC 1SXZA 3L3JA 4LPCA 3EOYG 4HKBB 2G5BB 4AH2B 2A6IB 3VGHA 2VISB 3E6FA 4Z3IA 5KN5B 2PWDA 4DFHA 2ROXA 3MRCB 4H0GA 1AQHA 3V0HA 4OCNC 3WLWD 3TESA 2ZOUA 2W0FB 3B2MA 5K9JL 5F6HI 3MLVL 1CFNA 4NRYA 1T7XA 1TTUA 1F3RB 2P24B 5BZDB 5CUSL 1CGUA 1D6EA 2HH0H 1VHPA 3PNRB 4F8TA 2IWFA 2Q1EA 1AZBA 3BX7C 3KLHC 3VVVA 4JO2L 1JWUA 1T80A 5FGSA 5I5IA 4U2YA 3D08A 2BVEA 1XGPA 1E9OA 2QSCL 3H8NA 3O4LD 5F88B 5DT1L 1B6DA 2PXYA 4QCIB 5DRZB 4H88H 3QQ9D 3MFFB 1BV8A 1DSWA 1XSOA 3VG0L 3HRZC 2YQBA 4WGKA 2VUOA 3KPSE 2N01B 5F7KC 4LOVA 4R3SA 3TJPA 2EZ0C 4LCUA 2JH2A 4HIJA 1GPOL 3X3FH 4NGHL 5DZAA 4I7ZC 1UTDA 5KTEH 4PI0A 1PFOA 5EOCL 3MX0A 2LTQC 3QORB 5I1JH 1I8LA 3NCBB 4BK4A 2W94A 5I74C 2XZQH 3HBGA 4OCLC 4RMBA 5HI3D 5DMKB 1Z9OA 1I1YA 4JG9A 1G7PA 4UIKH 2XV0A 1JNNH 3L7EA 3KM1A 3ZKSD 3H55A 1AZUA 1RUKL 2PPCA 3D5OF 4KVPA 5KOMC 1IGYB 3SBWA 3D2UD 4NN6C 2Y7QA 4IBQA 1D6VL 4PJXE 1LEIB 2HRPL 5CSZA 3RL1A 1YEJH 2W91A 4LHQB 2BOLA 4ZO8A 4ZMLA 2ITEA 3T77A 1Z9PA 1YY8A 3I6LE 1FFRA 4OD2A 1RZJH 1A14L 2RD0A 3KPLA 2HTLD 3PDGA 5B39G 2F8XC 2F53E 2NY5C 3QXAB 1WK0A 3W0WB 1EANA 3QI9D 5DJDB 4TOYH 3MRMA 3TO2A 1LP9A 1QSEE 2XWBA 3OJVC 5GISL 4URKA 3MC0A 4J7RA 5TPWH 3PABB 4X5WB 3O6FB 4BINA 3BN3B 3CMOL 2OMVB 3VI3A 5AVZB 3EUDA 2RALA 2XWRA 1TZOA 4XMXA 2ZYRA 3TO4B 1ILSA 1C9SA 1IT9L 2OTWA 4QD2E 2OR8A 4MMYA 1A3ZA 15C8L 2A9DA 3HA0A 5AYUH 4YSEA 1GIGH 2XA8H 1SXNA 3MXVH 1GC1L 4ZPVA 4PBVC 1DQLL 4S1DD 3S36L 5F7EH 3WEBA 2FB4L 3GPSA 4GI6A 4Q9BA 4JG0L 3FRUA 3X13A 4PJHF 5FF6B 1G1OA 1LO5B 1T1YB 1MN4A 5C2BL 4PTUB 4AOFA 1WAAF 2A9AA 2AVGA 2KLTA 3KHOA 5DVMA 1RZQA 2WQSA 1EO7A 3VXSA 3IE4A 1EEYB 2R1WB 2Y7MA 5EUOE 1VFOA 1ZLUH 3US0A 1EXHA 3HE7A 4FXGA 2MCAA 2P43B 1ORSB 1TITA 4NB7A 3RJDA 4X6EA 4NP4H 3SCMC 4IBVA 1P6WA 1U8JB 2AI0H 3LPWA 4JMNA 4N9GB 2DBLH 2J8UF 1QLRB 1BFTA 2EECA 2C5DC 4W9LC 3ZMRA 3F7PC 4YSDA 3N1GC 2FR4B 2EYTB 4HD9A 4JPWH 4M3HA 3FO9A 1QMUA 3OC5A 3UEQA 2X4NA 4K3DL 3R0MA 3ULAB 1X5HA 3OF6A 2JK5A 5F6IC 5BV7H 4Q8BA 3GZQA 4WU7B 4XVTL 5AVRB 1P9MC 1WBZA 3UTSB 1NEPA 2V0AA 2Z6FA 2VLME 5D7JD 3SOBL 1DUYA 1P7QB 1G87A 2MTAA 4XMTA 1UXWA 2X3CA 4CN1A 1DSFL 2V7NB 1BHGA 1M56B 1O5PA 2XC8A 1OB1A 2X2UA 3P73B 4HT1H 4XMZA 4HJ0D 1IBFA 1KPRA 1XGTA 3KPOB 3LNHA 4X42A 1NGQH 2KT6A 3QH3B 2EEXA 4NOBA 2OL3B 4PP2A 1PLBA 3QC6X 3RWHA 1Q0YL 5J6HA 3DPBB 4LP4A 4BQBA 4JM4L 5JNYA 5EC2B 1F11A 5F1KC 2OXGA 1R24A 4L3EA 4TMPA 4TQPA 4P3DA 4NQXB 4WDIA 3WFHA 4HS3B 3COOA 3QPQD 5FC9A 1AGDB 5E56A 5D4JA 4D7BA 4F7CA 4KO9A 2H6PB 1XGRB 3EYSL 4JFZH 2V9UA 2NYZA 4L0ZA 1TTFA 3VQLA 1SDAB 1OAZL 2WANA 4BV1A 2C1PA 1A22B 1DBJL 2EIZB 3F62A 2I32A 5FGBC 4XVJL 4NUJB 4TUOA 1KT2A 3WIFB 4LLUB 4LBEA 4E36A 1ZANH 4Z18A 2VJ0A 2K70A 1D5ZB 5ILTH 2APVA 4FFVD 3RPKA 2PR4H 3QIBB 3SIKA 5DEZA 3MGTB 4PY8J 3WIAA 4KQ3H 1TTAA 4PBXA 1OTSD 3PE9A 3VYPA 2SEBB 4KXCA 1LP9E 1NCHA 2WTOA 1UZ6F 2ZUTA 2ALAA 4JY5H 4QRBA 8FABB 1I7UA 4RRPG 5AVVB 2NXZB 2PP7A 2NY5L 3VI3E 2ZUSA 3VH8G 3VJ6A 4EIGB 4P23B 2RCSL 2G75A 4WNSA 2WTPA 4A2FA 1NZRA 4DCQA 3OAYH 1ZKAA 1RIHH 3WFCL 4XPAL 4YBQD 3U9PH 2ZKMX 3AU0A 1BZOA 4CMHC 4IRJB 2YAFA 5FYKE 1UD3A 5JPNC 3CLWA 5ESAB 1P4LA 5JOPE 2C8NA 4NZDA 3BWUC 5DEJA 2J8HA 1FNGB 3FN0H 4MSWB 1KC5L 4PP1C 2IDUA 3VXSE 3BO8A 5E8NB 2Y5QA 1T2QL 1Z66A 1EAQA 1UH4A 3MCYA 1G9MC 2IO5A 2VITA 3O9WD 1PL3A 3O8XA 3ILPA 4M7LT 4CJ1A 3NSFA 5EBGA 5C7ZA 3ARFD 1EEQA 3MV9B 3FT4A 4JO4L 4PFEA 3VM5A 1NBVH 4MVBD 4AVJA 4JZNB 3RVVC 1MJUH 2X4OB 4JR9H 3KWWA 1XF2A 4NQCD 4ZPTA 3S37X 3U7WL 3BVNB 4KDWA 1DE4A 5EO0B 2R2BB 2J71A 1SUJA 1DEEA 1B4JH 3AROA 4FJ6A 4KO5A 5MEOA 2PETA 2VDML 5J9PA 3O3EB 4TRPL 3QPXL 4J3WA 4FMVA 3GMRB 1AGBB 3LRHA 1MFBH 5DUML 1NDTA 3I6KB 4P5MB 3GDCA 1TVHB 2ZG3A 5ID0A 5F3BB 5D9SB 2XBZA 1JNHB 2GHWB 2WQUA 4MMXA 4CSZA 4JJOA 1RJZB 3QWRA 4X8CA 2DL2A 4MJ2A 2VRQA 3P9MB 3VW3L 5EBMB 2NLJA 1DVFB 4LQ1A 5HHNA 4HUWB 4FNPA 5B1JC 5C0AD 3EJQA 1JWSB 1U33A 3L5WB 3FYIB 2F7QA 1AP2A 3QUYA 5EF1A 2BNRA 4K5PA 3NCXA 1U8PA 5BS0D 4BFFA 3L2MA 4DETA 4L3EE 1DLHA 2ZCKH 1HXMA 3ZHKA 3SJVD 3LKOB 2HVBA 2WXIA 4TN9A 1JPTH 2WP3T 1UJTA 3GHBL 3HZKB 4J3VA 5FAAA 3ROOA 3ZYIA 2E75C 1VGKB 1N9PA 1NJ9A 1XAKA 4KROC 4YHIB 4RETB 1N5AB 1HC1A 4KI5C 2EDOA 1AHMA 4XXDB 2NNRA 3IPFA 3QHZH 3UTQA 4LLYB 3NMEA 3FBQA 5I1IH 1T6WA 3L9RA 1BP3B 2OQJB 3Q5TA 2NYYD 5HDR