2K9FB

Structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTNPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGSAEAGVCYPPVDTEFDIFGNGTYHPQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Oxidoreductase
total genus 19
structure length 128
sequence length 128
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11412 DsbC Disulphide bond corrector protein DsbC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1250 Mainly Beta Sandwich Immunoglobulin-like Thiol:disulfide interchange protein DsbD, N-terminal domain 2k9fB00
1Z5YD 2K0RA 3PFUA 1JPEA 1L6PA 2K9FB 1JZDC 1VRSA
chains in the Genus database with same CATH superfamily
2H3NA 4TM9A 4UQCA 3ZVVA 2NY1B 4Z76A 2B2XL 3D0VB 2APVA 5HHPB 4M8QB 4ODXA 5ISZB 1MNNA 3DMMC 2OMYA 1EFQA 4W9JC 3QUGA 3ZHFA 1F5WA 1CXFA 5KJRL 1S5IL 3MGOA 4P5TD 4JPIA 1WFTA 3KNBB 3NSYA 2PTTB 2PYED 5BS0A 3IPEA 3FRPB 3PXHA 4M1CD 4N20A 3UZVB 4MXVF 5CEYB 4F33A 3LH8A 4Q9RH 4JFZH 3WEBA 2YD2A 4MDIB 4J3SA 1A66A 4GMSL 1AIFB 3D87B 4F9LA 5A2BA 2ARWA 2F0CA 3DXAB 3KLHC 2WAQA 4A39A 2EO1A 4U7KA 4EZLA 3GSNL 3AQYA 5C97A 4G59C 3KWUA 1A7OH 5DLML 3BD4A 1ZLDA 3P02A 1Z3RA 1WLHA 4NZUL 2RCSH 3U30B 3HN5A 3TYFA 4Y89A 2GAZA 1KLGB 4QRUA 1HIML 4LEBA 3T6QC 3RL2B 3LV3B 5CLZA 4FL4B 2JI3A 2IG2L 2JCCF 2AJYL 3DX7B 2W81C 4NN5B 1UACH 2IO5A 4Y2OB 5JUEL 2FVNA 3HLKA 4HIIB 3VWJB 3BKML 2DB8A 1WD8A 3SKNB 1U58A 3TV3L 4F7CB 1NIBA 4KTEH 4LGSB 2JXMA 3FT2A 4TUOA 4DIXA 5A2AA 2O5YH 4F92B 1JRHH 5TH2A 1IGJB 4N9GA 4NUQA 1ZLVK 3G5ZA 1IM9B 3I2CH 3NN8B 1CFTB 1RZJL 4HOMA 1DQLL 3CFDA 3R8QA 4K7PY 1AH1A 2MNUA 5PAZA 5HPOA 2Y6SD 3ECBA 1EPFA 5D7JB 3P9MA 1E8YA 1UOKA 2EIJB 1HHIA 1WD9A 4PGBA 5K9JH 3SOBL 4LRNH 3K6SB 5T5FA 3AG1B 2YN5A 3BAWA 4PVLA 3A6BL 3D0VA 3E8UL 4X2UA 5H94B 4PLKC 2HLFC 1BFTA 4A55A 2Y4SA 3H4HA 3S4SA 3MR9B 1NIAA 2Z7ZA 3KNBA 5DMIL 1XGUB 1N6VA 1SJMA 2QGBA 3N42B 3FRPA 5IFAH 3WFBL 1H8LA 4AYGA 4MS6A 2V7NA 3O9WB 4HUNB 3IWVA 5IF0A 4HJEA 2L0DA 1X5YA 2K7PA 2C1PB 2QADB 3DXAA 4OCLC 3O2DL 3GSQB 1Y1DA 3KGUA 4ICWA 4JM0A 5FM4A 3EG9B 1P2CB 4NXSA 3WFEH 1ND0A 5EU6D 2DBLH 3IFLH 4XOCA 4DERA 1FYTA 2PPAA 4OCYL 4WU5A 1IL1B 1BLNA 1PTZA 4KHTH 1JGDB 1KLGA 2PCXA 4MD0A 1OHQA 3FN3A 5B8CA 4E9RA 1ET7A 2MOQA 4KJYA 3LV3A 1AXTL 1F86A 4LFHD 1Z0MA 4RMSA 2ENSA 1MH5A 3IMVA 3VWJA 1H3VA 4HIIA 5DS2A 1P69B 4WV1B 3DIFB 4PW9A 5EF2A 4M93B 1AY1L 3OSKA 3GI9H 3CSYB 2OBGA 1QPXA 3T1WA 1NEZG 3C5XA 3L9BA 1X7QB 3EFOB 4R0LB 1V55B 5D1QB 1IGJA 1MRCL 1G4RA 1Z9PA 3ARTA 3DLQR 4QT5A 3US1A 3AG4B 3NN8A 3GUTB 3KH3A 4XZUA 4TNVK 1UWYA 3P11H 3QZWA 3LIUA 4LB8A 4KXCA 2V9UA 3K8MA 4FQJH 4TNVF 5KVDE 4IS6B 3WHXB 2DD8H 2WLNA 2XN0A 4LP5A 4Q6IB 5G4NA 3BJ91 2E6PA 5D7LE 5B7FA 1GYAA 1MJJA 1S9XB 5CM1A 3CLFH 4BYHA 5DCCA 5F7HA 4N2CA 1EUUA 3NQIA 1NCCH 3MR9A 2EDQA 3MJ6A 1RJCA 4E36A 1EZUA 3TBTB 4MD5A 3CVIL 3LB6C 3VX0A 2JJSA 4GW4B 3O9WA 3ZMEA 1JZ8A 4OLYH 3RUGE 4FEMA 4HQQL 4KV5F 4X5WB 4AL8L 3CN2A 1JWSB 3DUUB 3UXFA 3GSQA 2JI1A 2V3EA 1GZHA 2R56L 1YJDH 3N42F 4ZUUA 3GMMB 3ULVD 1I1RA 1EVTC 1KBWA 5D6DC 3DHPA 1DANU 1LDPH 2HZHA 2CHXA 4OY9A 3DKHA 4QRRA 1P7QA 2I69A 4WI4A 5ESVA 1N0XH 3OLDA 3VD3A 4QYAA 2XTJE 3KWWB 3QNXB 5DFVC 5ADPL 4U6VL 3LQZA 2PTUA 1WEJH 3T3ME 1W72H 1NC2D 4FG2A 3HMXA 5LO7A 4Y19E 5ABAA 1PW3A 3W9DA 1NCJA 4JFDA 1RSFA 3VD7A 2K4WA 4NUMA 3TH3T 2BDNH 4DW2L 3HG1A 4XNXL 1T1XB 1VACA 5IHWA 5B7EA 5E8PB 1KB5H 4MA3B 4M5TA 1X7QA 3EFOA 1C12A 1D9KC 1JP5A 4ATWA 4UM9A 2AS5M 1EJOH 2KS0A 1OT1A 3GHBH 1I9IH 4N0CD 1KPVB 3WUZA 3TESA 4AYSA 5AENA 1ZJBA 1LEKB 3VU1A 1IGTB 4IW4C 4FI6A 1K85A 3CHOA 3WTUA 1ZIBA 4KI5F 3PNWA 2LT9A 2VDOH 1YCSA 2G0KA 2CBTA 2IANE 4L3AA 2VM4A 3BP6A 1JFHA 2LW3A 4NRYA 3V5HB 3WHXA 4JR9H 1CE1L 4FJZA 4W9ZA 4B53A 2B08A 3QUZA 3C2AL 1DUZA 1QUNA 3PL6A 3TZVD 3V52H 3L3GA 1KIQA 5E5RB 1RUPL 3UBFA 3ZW3A 2A9DA 3OM3B 1ZSHA 4PH8A 4GAYB 4CVXB 1B3JA 1NANI 1K4DB 3TEZA 4B9FA 3DVIA 2R1XB 3I9IA 3ZDYE 4MCNA 3QDAA 4FG0A 2CIIB 1UZ6E 3TBTA 3RVXC 4H7VA 4MXWL 4GW4A 4RIRB 2EDYA 3OZLA 3QIBB 4AT6B 4ACTA 3KVDD 1YJDC 4JY5H 3U1SH 1AFVH 3VDCA 3WEMA 4WW2B 3F5WA 1AGBB 1Z9SA 4X5WA 1NCTA 4CMMA 2NW2A 4XC1L 1HWGB 4X7TA 4GG6B 1MFBH 3RFZA 3FCTA 3VXUE 3BRFA 2J5WA 3GMMA 1JRHL 3E2HC 3NPSB 2VJXA 2EVGA 3L1GA 4XPTH 1T2QH 2EDFA 5CBEB 2VQ1A 5I1IL 4A37A 4TQHA 3LNHA 4P5TC 3DJZA 2UXGA 1OAUH 1V7NH 3VXRD 3VYOA 2VLKE 3KDPB 1ZA6B 4M1CC 2WAHA 1CFNB 3UAAA 1IZKA 2UZYB 2FEEL 4YHNA 5FK9A 1J5OH 2EDXA 4OD1H 4V33A 4HUUA 1R3IH 3KR3H 5DJXA 4HJSA 3UL4A 1EEZA 2JTYA 3W82A 2NW3B 3O0RL 5KS9E 1J18A 2PCFB 2YARA 4JDEA 4JM4L 1J8HE 3D3VA 3FCBA 1TQSA 4CUCA 4U1JB 4RZCA 5IFAL 1KMGA 4XCYB 1D6EB 5DF0A 5HDRA 5I16A 1WHOA 5C08D 2AEQH 3BP7A 3KPSB 5FECB 1CXEA 3MGTB 3U82B 4ODVL 3T2QA 5HHNB 3H3BC 3CVBA 1RUKL 1CTMA 2XWBA 1HOCB 3IE9A 3IDGB 5CKGA 1QNZH 2YBRA 1GVIA 1JNNL 3KYOA 5D7HA 1E6OL 2YD0A 2OQJA 4PYHA 3MAWA 2XQYG 2PLTA 4JJ5B 4U6HB 4M8UA 5BMFH 4CVXA 4KHTL 3Q5TA 2BC4B 5DJ2B 1HZHL 1N10A 1P53A 4DAGL 4Z7QE 2FO4B 2P5EE 3MROB 4PWEA 2IXQB 1AO7D 5DO8A 1RJZB 1UKQA 2DLGA 4U1HB 4UQ3A 5EO9B 4RIRA 4RGND 1JPEA 4AT6A 2BCKA 2Q76A 4WWKA 2Y6SC 4CC4A 2EP6A 2ITFA 1AGBA 3FSAA 3TBYA 3CBRA 4GG6A 2IAMD 3GPSA 3T8XA 1CXLA 1PZ5A 3GI9L 5FYJD 5JW4M 4KMTL 4F5CE 2BMKB 3QDMD 2BNQE 4Y5XA 3QHFL 4TNGA 3QUYD 1CQYA 5LVEA 1QW8A 4PV9A 5TD4A 2C9SA 2WZ5A 2VW6A 4NO5B 4WW2F 1HWWA 1AXIB 3U9PL 4GG6F 4QRBA 4NCC2 1ZA6A 4IMLB 2PO6B 1OGAE 3FQWB 3MRIA 1ZS8A 2Z0BA 3Q05A 3CXFA 1WQVT 4WHYH 3GSXB 1ZHLB 2ZNXA 3HZKB 3MOAH 1G87A 3TEXA 4J8QA 4MAYD 3DI2B 2VR3A 4K5NA 5BO1L 4MCMA 4NKDA 5DZNA 3NJNA 3NP4A 1ULVA 2JKIS 1AHKA 4BH8A 4PSPA 1M7UA 5DEFB 4HAGA 3KPSA 4X42A 1CJYA 5DHYA 3DRQB 1HH9B 2XFGB 4QLRA 4OLYL 5HHNA 3ULVH 4ZT1A 2P80D 3MUGB 4FLQA 4JZJC 3F65A 3R1GL 2Q3XA 4B9JA 2BXYA 3IU3B 1PY0A 4HXBL 4CAGA 2I24N 4HPOL 3MUZ1 4FQXD 4JFFB 3LYRA 2X4PA 2D7TL 2A4EA 3HFMH 3W39A 4EI5B 1IUZA 3NA4A 1KJ2A 4X80H 4N8VB 3O3EA 3OMIB 4JJ5A 4U6HA 5D4HA 5IQOA 4FXKA 4UOW1 1KDJA 1HDMB 4KAQH 3HE7D 2FO4A 5FHAH 5D7LB 2IXQA 1YECH 5I1HL 4U1HA 1IGFL 4LQFH 1TJMA 4D2NA 3PWNB 2CK0H 5I8CB 4AITA 2VJ0A 5JTWA 4HIXH 1HXYB 2NZIA 3D18B 1C8PA 1KCRL 3D4GA 3GO1L 2OL3H 4PJIE 4NKOA 4YK4C 2WPGA 1NAML 2OMZB 1XHHA 2R51A 4YX2H 5F1NB 1RIVH 4TVSa 3C9NB 2HCZX 1M4KA 4L4TE 4OIAA 4X9FA 2F8XC 1M53A 4I85A 1SLXA 3SGKA 1OGTA 4NO5A 1NFKA 3MNZA 5DYOB 2ICES 4ZUSB 5IP4A 1E4JA 2VDOL 4JM2A 4NZJA 2BSED 4K23L 1J9SA 4PWHA 4FNTA 2VSCA 4LEOB 2OCJA 5MEQB 3OPZL 1C5BL 3ASOB 1EGJH 2IC2A 5DEJA 4KDTA 1CGWA 3ZQXA 3GSXA 2ZUUA 4LPCA 2NYZA 5I26A 5I15L 4QOKB 3UC0H 4TNWK 1DEDA 4E41B 3WNOA 1IBFA 1VRSA 2IDCA 1J87A 3E7JA 3P9WB 3ESOA 4U1SB 4TNWF 2IV8A 2UUDK 3TCLA 4ODSL 4IOIB 3ULVC 2AXFA 4CSPA 4HIPA 1FL5B 3ML9A 3NFNB 3RGBA 4HCRA 4NAJA 5DEFA 3SO3B 5C70A 3D25B 3U1SL 4BCZA 3FSVA 3GMPB 3MUGA 5LN4A 4DCQA 5HDQL 1QVOA 1J10A 5HJ3B 5TE7H 1O0VA 4B3EA 1MFBL 1JCKA 1GYCA 1JZDC 4DJMA 4BKLB 4JX0A 5E8DH 4EI5A 1CFSB 3KYMB 3MRPB 1BMGA 3FSWA 2GIXA 1DFXA 2DM2A 2XN9B 2BVEA 2WIIA 4X9YA 1MDAA 4GYBA 4QHMB 2HWZH 4G9FB 3NP3A 2YPLB 3MRMA 3JZYA 2F58L 4PG2A 5D7LA 4N0CC 5IHUL 3L4UA 3TA3D 3BPCB 2E8ZA 3PWNA 1KTBA 4GW5A 4IBWA 1Z32X 1HXYA 4G8FA 3KR3L 2CKNA 3QDJD 1BXAA 3BT0A 1W8EA 3OJDB 3AITA 4YZWA 3P0VH 3FFDA 2R8SH 2LTQB 3ULUD 1V3LA 3UADA 4JFYA 2EEBA 5F1NA 3RUGA 3BYTA 1LO0L 3DX4A 3TZVC 1CLYH 3UBXI 3CZFB 4UIMA 1CLVA 5F9DC 1Z2KA 3C12A 1W80A 2AEQL 4C58B 5EF0A 4WSJA 4BUHA 3CV5A 4X6EA 4ZUSA 5FYKH 2FT8A 4HIHA 2P52A 5E2JA 3JYCA 5GRUH 3FN0L 5E9DE 1I1CA 2XQYA 2F2HA 4LEOA 5LBSA 5GGSB 1ZLUK 3SODB 3V4UH 2X28A 3RUGF 5F7WC 4YHYB 3V4PH 2FYYA 5A6MA 4QJ4B 2C9AA 4Y9EA 1BBJA 4Y19A 4TSBL 2OMNA 1XZ0B 4U1SA 1MHPL 4XCNB 5BZZA 1MCDA 4XAWH 3IGKA 4AG4L 4JN2B 5F7MC 3NFNA 3K6OA 4M00A 2PYEE 5FYJH 3HHMA 5A43C 4RBPH 4GT0A 5AOLA 3T3MF 1TEGA 3FO1A 4DQAA 5IQ7H 3CZJA 5D7EA 2GIMA 1SVBA 5EC1A 3IJ7A 3T2LA 3CG8A 1D6VL 5CKAA 3VMPA 1RIUL 5ADOH 3BAEH 3KYMA 5E1AA 3UYRL 3I3DA 3W11D 4NPYB 1LEGB 2C8NA 2IANA 4QHMA 4I18B 5J12B 4G9FA 2Z8VC 1J5IA 2YPLA 2GI0A 3EH3B 5KAQF 1KYDA 2ZYIA 3ARWA 3RDTD 5DHVB 4N5UA 3H42L 5LNDA 4N87A 2IJ0C 2O4EA 4HBCH 1TETL 4DNLA 3CDCA 3GXIA 4UINH 4D9QD 3SJVD 1K3IA 1T4KA 3V5KB 2ESVB 2UWEB 2P8PA 3STZB 3MOAL 1ONQB 4JVWA 2RTTA 4U2YA 3QDGD 4XR8C 1S9KC 4IKKA 4ZO6A 3RURA 2EO9A 4QRTA 3CZFA 3RX9A 4PP2B 1Q9WA 4NT6A 4F8NA 3VXUA 1LP9E 1DVYA 1NWOA 5CU5A 2CLZA 3LKSB 5DGQA 3DMMA 2J4WH 5DJDA 1E27B 2FECL 4FC3E 3ABKB 1TTGA 4NB7A 3V6BR 5FUOH 1DQDL 4HP5A 5GGSA 1TQBB 1FNSH 1FORL 1U6AH 1OHZA 2ZXCA 3O3BA 1V3MA 1WJ3A 1JXDA 4LF3A 3ZQWA 1T7YA 2NZ1A 5IBUG 4S10A 4NRXB 2IAMC 1DO5A 1CGSH 4QUOA 1UD2A 5DSCB 1CYXA 2OMTA 3P3TA 3U4KA 4N2LA 3GXTA 2CCVA 1G1OA 3EF4A 5LKNA 4KKNA 1H0DB 3QB7C 3MV8B 5KS9A 4M56A 3V9CA 3HIZA 1MFAH 1P4BH 2D7PA 3MLYH 1J8HA 2AKRA 1JPSH 3S5LB 3FHQA 3WIIH 1JGIA 1MLBA 3KLAA 5EOCJ 3JTTA 5AYTA 1URIA 5HHMD 5GSVB 5E2VH 5T3ZL 2VDQL 1CO1A 5AVRB 2LQRA 1T21B 4GG8B 4L4VB 1N18A 5EU6E 1T20A 3PFQA 5SX4I 4KZCA 4MAYC 4P2OD 1MHEA 2B1OA 4I18A 2OK0L 2J8UB 2AJXL 2KZKA 3TT3H 4WK4B 5DHVA 3DJRA 1GIGH 1AGEB 1OE2A 1OPGH 4RETB 4MYPA 2LLNA 4NO3A 1G7MA 4TVPH 1RZIB 2PPEA 3TLRA 3V5KA 3FHEA 3PDGA 4NN7B 3CMOH 4AJYV 2CG9X 3STZA 4JFUA 1DE4A 3PYCA 4JANA 3DROA 1ONQA 3TWCH 1XB6A 5CP3H 2WQ8A 3MCKB 2PNDA 2GBTA 4FQXC 4BQ9A 1PZ3A 2ADYA 4NENA 4ZNCD 3EO0B 3SCMB 2N1TE 1YQVL 2AP2A 5AEAA 4QYOA 4QAWA 5EOQL 1WUNT 2R4SH 1DVQA 3VWKC 4PP2A 1MCIA 4Z7QF 3HE7C 2UWEF 3DARA 1J8RA 1CPUA 1E8XA 2P5WB 2BINA 2BNQA 4P3DB 2V6HA 1E27A 2X9YA 5D72H 5JIHA 3WEAA 4JRXD 2QFRA 3Q9PA 4ERSH 4AYBA 3W5NA 1OIOA 1TQUA 2TRHA 3GIVB 1SJVA 3O3AA 3ZE0B 5ACZB 1A65A 3EZ8A 4X4KA 4F8LA 3ZUNC 4JUSA 4NN6B 5FM5O 3VXTA 2KZBA 3MV8A 3HZYB 4POZD 2YEZB 4OLVH 1BPVA 4DH2A 3HHSA 2FX7H 2C3WA 4I7ZC 2BOLA 1AS7A 3KLDA 4U6XB 3S5LA 3VFPB 1NGPL 4NO0B 3DURA 5BZXA 1NBYB 3DJ9A 1T21A 1V3JA 2D3NA 3FQ2A 2XU9A 2MMXA 3ULVE 3C5SB 3WNNA 1X4ZA 2FR4B 2OP4H 2ZCLH 6PCYA 4TQIA 5DQDH 2D8KA 2GB2A 4YLBA 3WNPA 4QGYA 4OB5L 1F6AB 4NQSA 5FDYA 5FYKL 1JYXA 3B3IB 3PS6A 5GRUL 3CN3A 2XWJA 2ZF9A 2CO7B 3BKJH 5E6RB 3VXMD 3WN5B 1WSST 5FA3B 1TPXB 5D9SB 4HJ1A 3R4RA 4XO9A 1J5CA 4DZBB 1ZDQA 3DUHA 3HRZA 5EZLA 3SPVB 1CL7H 5LXGL 2CO6B 3PDOA 2G75A 1OLZA 2ZG2A 4AM0A 3MCKA 4HLZH 9PCYA 3GWJA 2EILB 3D2UA 4TNEA 1QFUL 1MXDA 1THCA 1S5HB 4R7NB 3CFJB 3TJPA 1AXSB 2J6WA 3D1MC 3P3RA 1UH4A 3U4AA 3U46B 1VZGA 3GMLA 3UBGA 5FO9B 2ZXWB 1GTFA 3TCTA 3LS5H 4DO4A 1SQMA 4UZSA 5IEKA 3MV11 4L4TA 3AWGA 2XKNB 4GEIA 1JZFA 1A4AA 4MNHA 4PB0H 4PGCA 5D7JC 3TA3C 1M56B 3T8MA 2DWDB 1A5FH 3DX3A 4ZW7A 4PJXB 3HC0B 3P3SA 1I8IB 5T1LD 4XN2A 3ILEA 1BEXA 3CHQA 3CX5J 1E67A 5ACZA 1CVSC 5EEUA 1CDCA 3ZZLA 3ULUC 4D0BA 2X9XA 1CD9B 2DJUA 1CDUA 4HF5H 5EIQA 4E42A 1EANA 3HZYA 3K6NA 5AVUB 5D6DA 4PG9A 4UINL 3EKCA 3ETBJ 1MAKA 1RJYB 2AK1L 1OOWA 3U6XA 3ZE0F 4BQ6A 4XVTH 5IVNA 4POUB 4NC0B 4WHTB 4LLDA 1TCRB 1O6VA 4E2OA 2ZAHA 5GS0D 3EXLA 3KCPA 2DQGH 3MRLA 2ZE0A 4AGPA 3BGFB 1L9RA 2CWRA 3MRDA 1PD1A 4UQBA 3B1UA 1QAWA 3K6DA 2VDLH 1T6BX 4AUYA 1AKPA 2BSTB 3HPJA 3HS0B 5F9OH 1F6AA 3ABMB 5T8IA 4F93B 2BVYA 2DYRB 2WGXA 1N9PA 4M1DL 3L16A 3WN5A 3L3DA 5D9SA 2VDKH 3VXRE 1U6AL 2BW5A 4DZBA 3WXWH 3AU1A 2A9NL 4HJGB 2B4CH 2A4CA 4N2FA 4OW6A 5FXCH 5IJDC 1VDGA 4LHUD 2JE8A 5ICZB 4LASL 4WHYG 1S5HA 3D08A 3CFJA 5T5FL 5TE4H 1BF8A 5D1QC 4R0LC 3V6FB 3W11C 3S8GB 1UXMA 4XBPA 5I1CH 5GGVH 3IVKA 3SO5A 1ADQH 1EAOA 5EMYA 4M7ZB 1Y0LA 2QT6A 1NDGA 2DMCA 3D6GA 4NWUL 1B0RA 3UBHA 3N85H 1CR9H 1JPSL 5C08E 3RDTC 3TT1H 4YSEA 1AS6A 5BRZB 2BIHA 4FEIA 4JFSA 2BH0A 2X88A 1P6FA 2NYKA 4PUBH 4G2AA 4RMBA 5IMKA 3VJ6A 2G2PA 1MLCA 3MJ8B 4XNAA 3HC0A 1C5CH 1HCFX 3BLPX 3P40A 1UWXH 1I8IA 1MFUA 4NLHA 5E9DA 3N6YA 4PWKA 4XHQA 2M1KA 4PHZA 4W4NA 1Q1PA 3CXHK 4BA0A 3L4YA 2WBJD 5C0DB 1WIOA 5JXAL 5K59E 1AG0A 4GBXD 1GW0A 2OR9H 3BFWA 3UTSB 3L95B 5CR1A 2XZCL 1A4JB 1A6PA 1S7XA 3H56A 4N2NA 1AO7E 2O6EA 4PJXF 5E5UB 3VYPA 4ABWA 4XE0A 5CUSH 1EXHA 4MX7B 1RJYA 4RGNE 5EORL 1LMIA 3CMOL 4H0GA 3ROLB 3T0ED 4KQ0A 3BQUB 5F7KC 4YGAB 5FYJE 2JELH 4G42B 4YFLF 3QDME 1RIHH 2HX9A 1KB5A 5MENB 1AQMA 2BSTA 3BEVB 1P5UB 4U1MA 4G3YH 2F7RA 2B4CC 4H8WH 4QLWA 1IQDA 5FYLH 3LZLA 2WVTA 2PYFB 2Y7NA 1NICA 3V4LA 4B3VA 4E5XA 3VA2C 1G84A 3WFHA 1NAKL 3GIZH 3U4BH 2VIRB 1L7IL 2HFGH 2DJSA 5J3HD 1ZT7A 3W2DL 5SV4A 3QUHA 1FO0H 4MJHA 4FCAA 1ZEAH 2AI0H 2IQ9L 1LK3L 3C87A 4L48A 4F8QA 3EJJX 3PHOA 4GRLB 3V6FA 1J48A 3OR6B 4P2OC 1QLFA 4JL1A 1WUZA 4HKXA 2AV1B 2FX7L 2YXVA 5B1BB 2UY6B 4YAQB 2R1WB 5BRZA 1CD0A 2N4IA 5MEPB 2MEJB 1NGQH 1SOXA 5EU4B 5TF1H 4PTTB 3FF7A 1B4JH 3VMOA 3QR1A 4D3CH 1LP9A 2EUXA 4XVUD 5D96C 1B9ZA 3N1PC 5KJ7E 1H9VA 2MNWA 3SDXE 2OP4L 4OBSA 2ZCLL 5DQDL 4X8CA 3UZEA 3LQAL 1KCKA 1MVUA 5C0DA 5IB2A 5ICXB 4GSDH 3S3BB 2XFXB 3UTSA 3TVMB 4I3SH 1A4JA 1OCRB 3I6KB 4ZS7L 1LP9F 2ZXBA 3WJJC 3OLGA 4XPHL 4FXTA 2HJFA 1G9ML 3FU0A 4N2HA 3DOHA 3VTAA 1EBAA 2VDRB 4HW6A 1ZGLA 4K2UL 4BFNA 3GM0A 1IGML 5KEZA 4H8WC 3OXSA 4PJBB 1TTBA 1ACYH 3C75A 4JQIH 2BVUA 3OQRA 3U9WA 4X5PA 2OMUA 2Z35B 3HZMA 1P5UA 1F1DA 3M7FB 4XNZB 1H6EA 1J9QA 1PCSA 1WGOA 3KAAA 4POZC 5CILH 5EU6A 4RAUA 4U0RC 4MWFB 4WU7A 1QHQA 2R39A 3ZKND 4A6YB 5SWSB 4UZGA 3ASNB 1GYUA 3BZFA 3GHEL 4XPFL 4TUUA 2VIRA 3ARQA 4GLRI 3P2DA 3L3JA 5KBDA 4QRSB 2J12B 3EYVB 4UIKH 2WBKA 2Y07H 3K2KA 1NMCC 1G4MA 4D8PB 4P07A 4OLUL 1SJHA 3OR6A 1TT6A 4LEXH 5GS0H 1NCWH 3EIFA 3ZR5A 3U83A 1BM3H 3D50A 3CFKB 3NK4A 5AOKA 1P7HL 5FF6B 2VQTA 5ALBL 5LN8A 4ZZFA 5MEPA 1KN4H 3B1TA 5BVJB 3ZTCC 4ODWB 1RZQA 5EU4A 4F9PA 2DQGL 4Q6KA 1T2XA 3F7VB 1NGXB 3NCFB 5K33A 5KSBB 3K3QA 5T1KD 1KPRB 3W3BA 5FR3A 3S8FB 3FH8A 5I5RA 4I1NB 1ETZA 5AVYB 5I30L 2DQTL 3NESA 5DTFB 2H2PD 1ECYA 3NABH 1RP9A 2NY3B 4LBEA 1Q72L 7PAZA 1BWMA 3IYLW 5ICXA 1NIEA 1U3HB 3CH1B 3US9A 4ZMNA 2K0RA 4I4WA 3I6KA 5EBLB 5AAWC 1UWEH 2BZ7A 2FJUB 5CSZA 5CIPB 1UYWL 4MAUH 2WLJA 2V5SA 3WFCH 2MSPA 4E0RA 3MRBB 1TZOA 4P57B 3QDJE 3GRWA 2MTAA 4G9DA 3L9EA 4Q9QH 2BOBA 3ULUE 2R59A 4HJJL 3SDCC 5GGVL 3B43A 4P0DA 5D71H 2Y5EA 2WVVB 4YHZL 2Z35A 2W0PA 1CR9L 1K6QH 3GUFA 2BP5M 3P77B 4XVOA 3TT1L 4GAGL 4DVBA 4Q6YA 4P46D 2FATL 1PYWA 3KPQA 3SPJA 4MWFA 3RY6C 1XF2B 4Z77A 1JZ6A 3FTYA 2MKLC 2KUTA 4PJBF 3WMQA 2J72A 2GFBB 4OQ1A 5GS0C 3LQMA 1NC2A 4UILH 4QRSA 5CJXC 4OLXL 1SLWA 4WJ5B 2CLRA 2DDQL 4LP4A 4F7MB 1BJ1H 1RZKC 2QQKH 3QQDA 2Q86A 3APFA 3QQ9D 2B39A 4M3KB 4X6FA 4LCCC 1GY2A 3FUEA 1YEKH 1E4WL 3RJDA 5FF6A 4HK0A 3HG5A 4OQTA 2WBXA 2VDPB 5F96H 3REWB 1ZANL 3V4VB 4U2ZA 3RPIA 4E9LA 3FOMA 3EO9H 5KSBA 2OL3A 4G1MA 1KPRA 4MXQC 2YA2A 4DGUA 5I1EH 1SXZA 1VEPA 3IM1A 3NZHL 4XP4L 4BZ2H 2WSDA 3UTTB 4XN7A 1XAUA 2N7SA 4G3YL 1NOAA 5FYLL 1U3HA 3Q13A 2X12A 5ITBH 5IFHH 4GXFA 4HGWB 4X8GA 5KSBF 2JNZA 3GC3A 4XMXA 4Y4HD 1NSNH 4D9QE 4NZRH 3SJVE 4UNVA 2DLIA 3ARUA 3GBML 1PSKH 1P5VB 3QVAA 1PAZA 5I8OH 2J88H 1ZEAL 1KTRL 1PD0A 1UCBH 2J2ZB 1OT4A 3MJWA 1E8WA 1DVUA 2HT4C 4RGNB 1OE3A 3HG2A 3QDGE 4U33A 6CGTA 2H0PA 2FHBA 1I3RA 3CSFA 1CK0L 4N6RB 4BFEA 4DPAX 1WK0A 2CO4A 2WBJC 1DFBL 2NYYD 4GBXC 2X38A 3KPPA 5L9DL 4YXLH 2NY2B 3D39D 3SIKA 4UB0H 3FUDA 1KULA 3QO0B 1XF2A 1NGQL 1LEIA 2VM9A 5MEOB 3VG0H 1X5HA 4AEHL 2VMEA 2CAKA 3T0EC 4QHUB 1HAUA 4Z7VE 3VXRA 5E23A 5EC2A 4OGXL 5C1MB 1XSOA 2QVTA 5FO8B 4GSDL 5DXWA 3L5HA 5IBLC 3F7PC 3I9AA 1J9RA 3FOLA 3CHRA 1ID2A 4OLZL 1QBLL 3J2PA 4U1GC 5K9KB 1HHKA 2J57A 3PWPD 3QH3B 1YYLH 5E9NA 1JNLL 3QEQB 4WSKA 1A22B 2F53D 3C5ZB 2AJSH 2DWSA 4HJUA 4J3VA 5C08A 1LO3H 3JSSA 1YLBB 5GGQH 3FUIA 1BYOA 5J3HC 3QWNA 4EN2A 2J7LA 1QEWA 2AMGA 4RQQB 3PUUA 1KOAA 3UTTA 1AYOA 5DURB 4DPRA 4EN3D 4U7MA 3BPNB 4GQPH 4W9DC 5HGDA 4K3HA 5HDWA 4BCXA 1AKJD 1CI3M 1S2EA 3PP3H 1FG2B 1H3XA 1QRNB 1NWPA 3QQXA 1MCWW 4JFPB 4JJHA 4LPXA 1P5VA 3P2BA 4M43L 4KH2A 4JRYB 4UIKL 1UD6A 3ZUCA 5JHDB 2QSTA 1Z6JT 4XVUC 5IV2B 4PJ6A 4FNSA 4JY4A 3TFBA 2YGQA 3WIAA 5L4JA 1NCDH 4LSTH 5F7DB 3IGLA 2OSLA 1DVFD 1NCWL 4N6RA 4XOEA 4JKMA 5GRZA 4TUKL 2YKLH 3WEOA 4HLZG 4H5SB 5C09D 4K4KA 1YMHB 3QDMA 5I1KH 1KN4L 2APBA 3WTXA 4LLWA 4HCRL 1IFRA 3QUYA 3QQ3B 4JRXE 4HOXA 5MEOA 4M7LL 4UT7L 3OKMA 1JWMA 3RTQD 3MN8A 3V0HA 4QHUA 3PAYA 2Y7SA 4F3FB 1EERB 1N4XH 3PNRB 4Y9FA 4HUKB 4NPJA 2A4ZA 3BVVA 4X99A 4Q74A 2VH5H 2JJTC 3LH9A 4BQBA 3STLB 2EC9T 1F11A 2NTFB 3QIUB 2UVEA 1OQOA 2CRYA 1G9HA 1LD9B 4HFUL 4IRSD 5K9KA 4YDKL 4P3WA 2IFFH 5DHMC 1CGUA 3WFCL 1GSKA 2WQUA 4P59L 3ZKNC 3J07A 1ZHNB 3SGJC 5DUBA 4GSQA 4TPRL 1CG9B 1DBAH 2WINA 3EJPA 3N40P 4P5RA 1T80A 2YBGA 3UZQA 3OPUA 2P80A 4P23D 3DX6B 1Q9LB 3EBGA 4EIZC 2VXQH 4XPBL 4JCMA 4FQXA 1JPFB 1KXVC 1RK0B 2ARJA 2CO2A 3SDXA 1KIUB 1XTLA 2VXTH 5DRNA 3VXME 4E9QA 4CSZA 4NQUA 3ZKMD 4P9MH 2C3XA 3UG5A 5FX3A 1F58H 5E6ID 2VB5A 3F85A 3PQYB 3ARPA 3I6GB 1FRGL 1T5WB 1AOHA 4Z5RB 2YC1A 4J6IA 5JHDA 2VN7A 2X42A 4GP5B 4DKFH 1J86A 4XXCC 2ZTBA 2YKKA 3BAKA 5E1GA 3SDXF 3ZRSA 3F12B 3O8XB 1OP4A 1LO4L 2QQKL 3B2VL 3B6SB 1X3DA 3BVNB 3GLZA 1LO2H 2ZUQB 1EDQA 2LGNA 2MOVA 25C8H 2H2PC 5H2BA 1AD9A 4XBEL 5D5MB 3FU8A 1YEKL 3VTMA 1U2YA 3H9YA 2VXVL 5IB4A 3MFFB 4NQDD 1T5XA 4KUCF 3AAZA 5FIEA 5DRXA 2ZX5A 1EHAA 1UURA 1IBZA 1L7TH 1UT2A 1INEH 4A2FA 1R24B 3V9EA 1XIWB 2BSEA 4BZ2L 4HZAA 3QJFB 4HSAC 3CK0L 4OKVA 5J0BA 1NPNA 1IFHL 2CXKA 4H1LH 4EOWH 2HVKB 3QIUA 4M6NH 5BV7B 3D33A 3P4NB 4RRPA 3Q5YA 5CZVL 4JG9A 5I73C 3HNVH 3OLIA 2WLYA 4XBGA 1A6UL 4P46C 4LLQA 1FVDB 4NZRL 4EDWH 5MERB 3KLLA 5AVTB 5I8OL 2N1KA 1ZHNA 3KBEA 4OSUL 3RA7H 3L4XA 1CG9A 2AZAA 5LNGA 3B5TA 4TOYH 5E2UH 4I9XA 3IJYA 3B2DC 4DN3H 1HWHB 4NOFA 4XGZA 1INQB 4GO6B 3DX6A 1Q9LA 4G8AC 4LSQH 5AZEH 1P84K 4P5MB 1KJ3H 2XETA 4JS7A 1JPFA 5KVMC 2YQ2A 3GLDA 5A2FA 1KIUA 2DMBA 3QQ9C 1FQ9C 4M03A 1YNKH 1ZHBA 1MWOA 5CS7A 3GTTA 1IAIL 3UOAB 4WKXA 1OD9A 5IMMA 5BCAA 2BZCA 5L0QB 4QHLA 3OMNB 3SE4C 3TA3A 2VUOA 3M17A 3RG1C 1KN2H 5EO0B 2XXMB 3F12A 1L5GB 2UZPA 4NIKB 3QDJA 4JRLA 3HKZA 5IBTL 4R7XA 2WOBA 3FSOA 3FTGA 1BQRA 4A63A 2LHAA 2YK1L 3VFTA 4F91B 4OZ4A 4XMVA 3UGEA 2PP9A 4WWPA 1EBPA 4X4YA 3VG9C 4Y4HC 2WWKO 4FXGB 3GK8H 5HHOD 3L08A 35C8L 3LKRB 5HY9A 3Q6FA 1CZ8L 3AXLB 2HX7A 1A3RH 4FZEL 3BVXA 5JDSB 3MJGX 3ULUF 3CVDA 3SYCA 1IAMA 1HNFA 3JVFC 5C9JA 1QUPA 2EACA 1UM4L 4I0KA 2ALWA 1I4FB 3OQ3B 1U2CA 1AGCA 3WD5L 1DVXA 5JNYB 4JE0A 4J2XA 2NYYC 1WF5A 3TEWA 4Q8BA 4R4BA 1YEFH 3ARSA 4Y4FD 4MDJB 5MERA 1IX2A 3UO1H 1C7SA 3VX1A 3T0EE 1S78D 2CIKA 2P47B 4XHJD 2GHWB 4OI8A 4LSTL 4WEUD 5I8EB 5IB5B 1LWJA 4G8IB 2DIAA 3RY5A 2YKLL 4IJTA 3QJQB 3T9WA 1FC2D 2MQCA 1CU4L 3T3PB 3LKOB 3EGXA 4NQVB 4AEIL 5T1JA 1L6ZA 5I1KL 3NFSL 3NJMA 4PS7A 3H0TA 1A14H 4K8RL 5FUCC 2ICEC 4YLQT 1QEXA 3K2MC 4W9GC 4AIEA 4H25B 3WIHH 5I0VA 1WTLA 2YD3A 1IAKA 4X50A 2NZ9D 4S1QH 3RDTA 1Y6NR 3QT2A 3UPRA 1OQXA 1RUQL 5DS1A 2EIEA 4PM1A 1BECA 1I1FB 2VH5L 3CFIC 5E8EB 2WKGA 4I9WD 4YSQA 1NBVH 1S7TB 4I3RL 3X3FH 4J6RL 2IDUA 4MSWA 4EN3C 2IFFL 2FEJA 1GC1H 3C5JA 3IDYC 3KXFD 3QDGA 4GAAA 1W15A 2BFVL 4ZTPH 4J23A 5JHBA 3V0AC 3NAAH 4B60A 2JI2A 4FXGA 4MZ2A 4MD4B 3X12A 4F57L 5D7SL 2NCEA 3WY1A 4U1LA 3LKRA 1BZ9B 4N3TA 2VCOA 1FBIH 5CGMA 5ACLA 3QEGH 3GLEA 1A1MB 4X9HA 1HE7A 1KG0A 3RNQB 1UVQB 1DVFC 2OLDA 2DS4A 1JAEA 2BS71 2F8IA 2VXTL 3IXTB 3MRKB 4Z7VA 5JNYA 1Z5HA 3LHAA 3D06A 1PQZB 2VUYA 3EYOA 3Q1EA 2R2BA 3CFBA 5TQ0H 4MDJA 3FUFA 4RCAA 5DC9B 4YC2B 5BW7C 5BUPA 4QMEA 2YRBA 1MJ8H 4N8VG 4YSPA 3WMSA 5AAPA 2VR4A 1QMUA 4DKFL 2OMWB 3RTQC 2YQ3A 3A22A 3DHJA 4XODA 3D09A 5ERWB 1KEGH 2IPTH 1GGBL 1UATA 3BI9X 3S3DB 3MLVL 4WO4D 4G8IA 4HZLB 1BGXL 2YUXA 25C8L 5JLZB 4HPYH 5F7FA 3B7SA 3DIVA 5EOCH 3DSFH 3LKOA 2Z8SA 1GHFL 4NQVA 4MB1A 4NO2B 2VGLM 1QHPA 3NVQA 2DLEA 1M71B 3OKYA 5ID1B 4ZQKB 3UEQA 1DL7H 3BN3B 4P2OA 2GY7B 1INEL 2DQUL 1S9VB 3WOVA 3OMAB 4ZPVB 4WLCA 3BH9B 4N0FB 2VE6A 2MIZA 3LPPA 2BVTA 4AV0A 1GC1C 4EOWL 2G3NA 3MRCB 4EI6B 4UM8A 2R7EB 1PDKA 2WZPD 1FIEA 2DIJA 3HNVL 2NLJA 2BNRB 2DLTA 1KGYE 1AGDB 1S7SA 3ARVA 2MCMA 4PRBA 3ARFB 3GZPA 4ZSOE 2F54D 2H26A 3ZKMC 4IIQC 3RA7L 4MD4A 4MQXD 4YDIH 4YHLL 1DEEB 1T83C 5E6IC 3WJJA 5FGRA 3PJSB 2EZ0D 2KPNA 5FO2A 5IMLB 1JMZA 3H7BB 5D1ZI 4N24A 4KQ4L 1KJ3L 4KJWD 2WZAA 1XGYL 3WHE0 2VLJD 3QNYA 2OW6A 2XI9A 1MCPL 4FQCH 3EFDL 3MRKA 4W4OC 1MJUH 1PQZA 4N2GA 2DJ4A 4PJDB 4KHXH 3CNKA 3WEXA 3CQPA 5FHBL 2VL5A 3N1GC 4QKXB 4A7VA 5D4QA 4R90L 3E0GA 4OCXH 1T7VA 3GMNA 4KXDA 4KTGA 1XR8A 3VU2A 1I8LC 4Q0XH 2BY2A 2G3ZA 2A83A 1GJWA 4PVMA 1FO0A 2CNZA 1R3LB 3GINA 3WTSA 1WC7B 4XWGH 3PJLA 2D3JA 3U0PA 5CZKA 1N5YL 3MLRL 1D2PA 2FEEI 4MNQB 4KPHH 3B8YA 1SNRA 3MDJA 1BD2B 4Y1AB 4LGRB 3ZDZB 4AW4A 2P4AB 4ZQKA 4AQOA 1NBCA 2XACC 1E43A 2MHAB 3GK8L 1JG9A 1UA6H 4KY2A 3W5MA 1EZVY 3CJJA 1U8QB 1M7IB 3IU4H 4MMXC 4YBLB 4Y4KD 4F1SA 3FSZA 3DRTB 3VXMA 3PXLA 5E94B 3GDBA 4PR5A 4TRPH 1BVOA 3C08L 5LDUA 2AF2A 2GK2A 4G11A 3EYUL 5DUMH 4N1CA 2E47A 3TO4B 4EI6A 3QXAA 3NCYP 1NBZA 2R7EA 2EIZB 3BSZL 1YMMB 1SM3L 5FOBA 4R7LA 1WS7A 2BNRA 1D5BB 4MASA 3Q6GH 3UO1L 4OI9A 2X2UA 3ARFA 5DRWA 3WCYA 1XH3A 4QHNA 5FM5M 3MCG1 4UT6A 1VADB 3C6LB 1YN7A 2IH9A 2D2OA 3MA7A 4NGHH 5HJGA 1QQDB 3VD5A 5C0ND 4XC3H 1ZLSH 1J8KA 5DA0B 5IMLA 1OCWH 2WJ7A 3BLBA 1ORQB 4JQIA 1B9KA 2YAMA 4NWTH 5J7CC 3ZKXB 3OWEA 3F7RA 1NCBH 2QQLH 3L3IA 3L5WB 3QNFA 4ZAKB 5T1LA 1IVLA 2EE0A 4IGBB 1TCMA 1BVKB 5DMYA 4Y9GA 4RSYA 4W9KC 3BWUC 3JYBA 3PWJA 5AZ2L 1CFMA 4PJDA 3GI8H 4H20L 1OK8A 4MJ6A 3MMEB 4ZMWA 3ETSA 5GGTA 3OAZK 4XAKD 5CSBA 2K9UA 4KTDL 4MB3A 2VXSH 4UDTB 3VFNB 1OAYH 5SV3A 3CSPA 4OGYH 4NM8H 1X5IA 1PVHA 3KBHE 4AJVA 3DETD 3WTVA 4PJDF 1ZGLP 1L0PA 4N2AA 2KDYA 4OCWH 2NCMA 5CJXA 3FU7B 4Y1AA 3HUJE 3WBDA 4ZUWA 4C54A 4RAVA 5DZJA 4M3HA 1EO7A 3D39E 4IBQA 2XZAL 3LN5A 3QE5A 5E5LA 5FC9A 4AMXA 3IDIB 1L6PA 3BIAX 3NJXA 1AR1D 1SF5A 1ZE3H 2DICA 3EYQD 2JVUA 3QJOA 4Y4FC 4KGJA 1F3DJ 3LXCA 5TPWH 2W0FB 1U8OB 2EO7A 1S78C 2HRHA 1J11A 4IDLA 5JMRA 3QEGL 4BH7A 1H5BB 4KVNL 5JMOC 2FX8H 4FNLL 1YEIL 2ENYA 3ZDZF 1XWVA 3TO4A 4LCWD 1QTPA 2CMRH 4B5EA 4HBQA 3QZBA 3O4LD 2BHFA 2IADB 4XNUH 2EIZA 1BQHB 4Z78B 1YMMA 2UX6A 1G7JB 2BP8A 4LHUA 2V17H 4PRAB 5C0IA 1T0PB 3R06B 1NDMB 2EE2A 2GTZB 1X5JA 5FUCE 1MPAL 3PWPE 3B7RL 2LU7A 2CDFB 3EYFB 4HT1H 4EPSA 5EBWA 3QYNA 2F53E 2P43B 2SEBA 1QQDA 2CGZA 4MJJA 1JZHA 2NZ9C 32C2A 4OCMC 5HHQB 4N6QA 1LE5A 3R4DA 5IIEB 4FJ6A 1NCHA 5DRZB 2V2TB 4WUUB 3WDIA 5EEVA 1M9SA 1FLTX 2HVJB 2K1MA 1K4CB 3NJHA 4L9LB 5I17A 4KNSA 1JVOA 1YN6B 2MQ3A 4UV4H 2WBJA 1OWWA 2EXYD 4GBXA 1XR9B 2JIXD 3QCVL 3HS9A 4MKTA 3HB3D 4ZW5A 1QZNA 3FW6A 3WN6A 2HKFH 3VFNA 1DQML 1T0OA 3FONB 1T6WA 4NAQA 3ZX1A 4IKLA 4PRID 4LPUA 1OP5H 3WU1A 3FF8A 1ZE3C 3FU7A 5ICYB 2D03L 2AJVL 5KYYB 2V2WA 1BA9A 3L13A 2H6PA 5C09E 4AMKH 3MBWA 3VXPA 3IDIA 4X5RA 5FV2A 4FMFA 4CRPA 2K3TA 3M8OH 3U0WH 3VW3L 1U8PA 1U8OA 1KCUH 1ZT4B 2F9BT 5ECJE 3L9RB 1CXHA 1FZOB 3WS6C 1Z9NA 3RWEA 4YHPB 4WO4C 5G4OA 2Y7MA 3GTNA 4GXUM 3TYGH 5I19H 5KOVC 5I0ZA 2IADA 1VFBA 1MJUL 1BQHA 1FGVH 2Z1KA 1G7JA 1OK0A 4PRAA 3ZT6A 4KNQA 2IMNA 2QSCL 2ZYHA 1VIWA 3A6OA 4GKNB 2EAEA 4HMDA 4PB9L 2BOCB 2DQFB 3HC3L 4FLRA 4NP4H 4H1LG 2CDFA 2R23B 5ESAB 4IRJD 4L8SB 1T5KA 1K8DA 3QWOB 4GIAA 1R3HB 3WUWB 2AQRA 4XWGL 3W56A 2VDRL 4XWOD 5A16B 1A9EB 4GKSB 5HTSA 3ILDA 5EEZA 2ZKMX 1T04B 3TH4T 2DLFH 5KYUB 4F2FA 3KPRB 4QHKJ 4JZNA 2E7DA 3ATBA 4F1ZA 3TS8A 1K4CA 4ESKA 4H0IA 1FNEA 1CVRA 1UA6L 3BX7C 1NJ9B 1FJ1B 3WE6B 1EMTL 3ARED 3ZE2B 2BNUA 4GRWB 4A6YL 3LEVH 2B8OT 3NCXA 4TRPL 4MQXC 5AYUL 4WI0A 1NANH 3L5JA 1GKEA 2WY3B 4HV8B 5LWYL 3I84A 5T1DH 2EZ0C 4M7JH 1I8KB 4QXUH 3QZNA 1R34A 3U36A 3OMZA 2CALA 1MY7A 2A6JA 5IHZB 1YNLH 4R9HA 1C16B 3OKOB 3EH4B 3VGDA 2B9AA 4KJWC 5H4ZA 5HD8D 5ICYA 2NY2C 3MV7D 2XWXA 1JHKH 5CJOL 4I1PA 4NQDE 1CLOH 1HH6B 3CN0A 2O5ZL 5SX5H 5IJVA 1ASPA 1FL3B 3FULA 4S2SB 3CZUB 4OQTL 3Q8FA 4NQXA 3L9YA 1OCWL 2R69H 1IGIL 3SGJA 1B0GA 5E7BA 4J8RB 2GVYA 1UQSB 1ZMYA 2DRUA 4FYRA 5DJCB 4F58H 2E4FA 1DVZA 2D7MA 3J27A 2NUPA 3GI8L 4A2GA 1C1EH 5CWSB 4BK5C 4L8BA 1NLDL 3UCQA 1JGVH 5KZCB 4R97B 1MCLA 4Y5VC 3U2IA 1YDPB 4L3CB 3NJIA 3PLYA 4M9PA 4DUWA 4OGYL 1CIDA 2WUBH 3IGUA 4U3SB 3WUWA 3GBNL 1WCBA 4WJG3 3DTDA 3N43F 3PP3K 1KGXA 3MNMA 1DJYA 1MUJB 4Z7OB 5BVPL 3MYJA 1ZA3A 4TSAL 3PABA 3UAFA 5D7IE 4PHXA 2EEDA 3GSOA 5KYUA 3S88H 2CGRH 4G1EB 5T1KA 2X3BA 1SEBB 2R0KH 1I53A 2JKJA 4FG6D 5DWUH 3IJSB 4ABUA 5HGHB 2EDMA 1X4XA 4NZFA 2HKAA 4FQQA 4QO1B 4JFHD 4NQTA 3UPCA 5JA9A 3B9KB 2YFOA 4LOUD 3V2AR 2RFXB 3QAZB 4JY6A 1IC4L 5T1MB 3BN9D 1M05B 3FU3A 4LLMB 1MW1A 2CHNA 5C0NC 2FECI 3E80A 2VERA 2XIBA 5GGUA 5LXVA 2ZF8A 4PU2A 4XNUL 2HFFB 4DEPC 1G7QB 1OB1B 2EXSA 4J4PD 3MOBL 3ZE2F 1B6DA 4UTAH 4GRWF 1VGKA 1T1WA 5JPNB 4P5KB 4OCSH 1SBSH 2EKSB 2E7CA 4L3EB 4OD2B 2F74A 3Q8CA 1DQQA 2PTVA 3LJ3A 2Z31D 3CC1A 5HHOE 3W9EB 3G08B 4ISVB 4DKEL 1IEAB 5CCJA 2VDPL 3V4VL 4G8EB 4PWFA 4XE5B 4P46A 1CYGA 2XZQH 1L9QA 4XRCB 2BSRA 2PW2B 5HHVL 2BHYA 3GGWB 2IPUK 4HFWA 4M29A 4ZD3H 2VXQA 3DETC 3HNSH 1UQSA 5DYFA 1UH2A 4HZ1A 1XSIA 1CFVL 2DTMH 1E4HA 3KHQA 1WZMA 3SBPA 3QSKB 4UV4L 4JCWA 5JPMC 1M7DA 5HSFA 2XBDA 5BV7H 1YDPA 4L3CA 5I6LA 4NUPA 5ILTH 1AR1C 3EYQC 5I6OA 2YPKB 3ZMRA 4U3SA 1KIRB 1R4XA 2DPKA 4URKA 1DLFH 1F3JB 2WLLB 4N2BA 5D70H 3WKNA 4KXZI 3KJ4C 2XA8H 2EXTA 4I3GA 1WH0A 3F62A 4KK9D 3SE3A 3BE1H 1SEBA 1EAPA 1FNFA 3QUKB 1MELA 2HJLA 3IJSA 1X6NA 1HXMB 1KUMA 3SY0B 1RZGB 4B9IA 4V1DD 2EKJA 4NRZB 4DP8X 5DD0H 4MMZC 2RFXA 3A6CL 4L8DA 4FZ8L 4LMQI 1YAIA 3OAUL 3RILA 3U7WH 4APXB 3B8SA 3GMQB 4Y4HA 3VXOA 2W07B 1XQ4A 3CSBA 3E6HB 3FO2A 2H47C 2G2RA 2DKSA 3O8XC 3LCYA 5H37H 1R3JA 3LKNB 1BOGB 1IILE 2C4FU 4LP8A 5I19L 3G6JE 4I9WE 2HFFA 1X5ZA 1FGVL 1MRDL 4H1LA 1VCAA 4GSXA 3MBED 1SJEA 2FQEA 4C8XA 2AAVA 3KXFE 2E9BA 3L6FA 3QFJB 3PREA 4OD2A 4P05A 3KWVA 1JPGA 4PJ5D 1OM9A 3HUJA 1JFQH 2EXYC 5LNEA 1L0XA 1YG9A 4FQ1H 1DBKH 4EUPB 4ZTEA 3HR5B 3LNFA 1DLHB 1N2RA 1ED3A 1UADC 3PWUA 4NUJA 1EK3A 1U8MB 4O2CA 4X7CC 3LXAA 4MA8L 4AK2A 3T2OA 5BV7C 3OSVA 1TO5A 1BFOB 1XGZA 4MBRA 2X7LB 2LV4A 1Q9OB 5CGYD 4PJ9B 3RBSA 3QJHB 5FCSH 2X53A 5IGXL 3WTTA 2C1OA 3EW3B 4UAOB 4PY8I 4QNPE 3LH2L 2PCPA 2YPKA 1KDIA 1BX2A 3QW9A 2VDMH 1ZKAA 3R7RA 1YEHH 2YQGA 2ICEA 2WLLA 3QIWB 4HHGA 1DANT 3PWPA 1S7WB 4KZ0A 2HPTA 4G7YL 1DDTA 1JK9A 1YNLL 2CXGA 5DD6B 3D69B 3AADB 1D7BA 3QCUH 4HGMA 1D7DA 4R4FH 2WXPA 2WVSA 2V9RA 4IRZH 2HFTA 3V7AE 2JLLA 4JFVA 4MQ7A 4N0UE 1HXMA 1VKXA 2DQDL 1JN6A 1JZ2A 1PZ2A 2QSQA 5B21A 4DO5A 1LJMA 3AM8A 5TDOA 3ZKQD 1A7RH 4AQ1B 1AE6L 2X2YA 4EN3A 4IRJC 3O3UN 1U95A 5F1IB 4QY8A 3FU6A 1AKJA 2W07A 3MLTB 5EZIH 1T0NA 5GRXG 3VQLA 2APWA 4OJCA 5F88B 3T2PA 2VW4A 1D7CA 2Z91B 3EH2A 5IWLA 4KK6D 3CN1A 1JGVL 3GJEB 1ZOXA 1OP3H 4M6OL 4PJAE 1XMWA 1DVFA 3LRGA 2H32B 4ELME 2CKBH 2F54E 4YPGA 3LVEA 4Z3HA 3AREC 1ORSA 1BDYA 4AXWA 4XOAA 2WXIA 3SHSA 5C09A 1EXUA 1U8HB 4EXPX 3AACA 4NP9A 5SWZB 4XTRD 5BW7A 4OAWB 2DWEB 3FN9A 1U8MA 4TTGA 4CVZB 3RTQA 1R5VB 2VLJE 3CGTA 1RUMH 5HD8C 2YWYA 5EWIH 4Z7UB 2GABA 1X5FA 4PJ9A 2N01B 2ZUXA 2J5LC 1XO8A 2EXWD 2FEDD 3UAJD 5FM8A 3RZCD 2F08A 4GUPB 1NGZB 3HTLX 4LVEA 4P4RB 2XNAB 3DGGB 1J05B 4IRSA 4J3TA 4GKZB 4I1RA 2Q0ZX 2E27H 4ZDHB 5LCVH 2X4TA 5DHDA 1F1GA 1M2OA 1U3NA 5K39B 4UTAL 3RVVD 2OX5A 3K72B 4L2LA 1SBSL 2ADFH 2NY0D 5E4AA 4OZFB 4L8CA 1T22A 1K5NA 1DJWA 1NEUA 4P23A 2F6AA 3AB0C 5F71A 5I28A 4YEFA 1S3KH 3V6OC 1YUHA 1JGLL 2AJUH 4GS7C 4AQ1A 1FZKB 3GDCA 3MLPA 2QFPA 1YA5A 3L5IA 3MUJA 3G04B 2XZQL 1N70A 5EN3A 5F1IA 4YHOL 1CICB 1I3UA 4IIQA 1T83A 5HI3D 5E6IA 4NZTL 5C9KA 1S8DB 5LGKA 1RSYA 3E9UA 3L7FB 4OBRA 4OZGB 4AX3A 4F7EB 4QJ5B 5JO5B 4FG6C 4RFNB 2WWMD 3LRLA 3L17A 4R26L 4GUOA 3T4YB 2BY1A 4HCFA 2H32A 3T4AB 1TXKA 2ADJB 4HHAA 1QACA 4YHKH 4BZ1A 4PCTA 4LOUC 1U8HA 4NBXB 5HP5A 2A74C 3BN9C 5C07B 5GS1B 5T5NG 2DWEA 3BE1L 5LAXA 3GXFA 5FLVA 1YNTA 4OF8A 3POHA 1I8LA 4HUVB 2ADIB 2FJSA 1F56A 3ZN6A 3U2SB 4MLIA 2A9AA 3O6LL 4JFEB 4LSDA 4OZHE 4J4PC 4K7FB 4G6ML 2BIPA 5CAYB 4B41A 1TJIL 2FBJH 1IU1A 2YUVA 2L7JA 3IJEB 4X7DC 4XAKE 1IRAY 2G3MA 1NGZA 4Z7IA 3NJGA 1CLZH 2W88A 1U36A 2Z31C 5I2IA 3ZTNL 4FADA 5I1DB 3WELA 3KBFA 2E9IA 3B4NA 3ISWA 3QRGH 3RNKA 2Y36L 3M7OA 3BJLA 3TIDB 2XIDA 3K72A 5E2TH 3OB0K 4OZFA 2I60L 5DJAB 1XT5A 5D7IA 1MIML 2Z92B 5CCKH 2ALAA 2HAZA 2NDGA 5SX4H 3WKYA 1SEQH 4N3UA 4YNYB 2A6DB 1W0VB 2B1AL 3VH8B 3V0VB 1K3ZA 2YD5A 1XGTA 3EJUA 3WY4A 1FSKC 3BAJA 4LCWE 4YR6A 4KVCH 4KK9C 1OSPH 2F61A 2PPCA 3O4LE 5DA4A 1X9QA 4LO9A 5JO5A 4OM0L 1U8KB 1MHHB 3ZLQC 5I6XC 5IZ7A 3BMVA 4EIUA 1EFXB 1W8NA 1KBGH 4A7QA 2YPVA 4PGJA 4NFBA 3G3LA 2IIJA 4LNVA 3JT0A 2G3XA 4X8XA 1DVTA 3ARZA 3ZHDA 4C55A 4LNRB 1YEHL 2OZ4A 2WLHA 5TQ2L 3S48A 4TN9A 1QASA 1BIIA 1NC4D 4MJID 4ZFOB 1O9ZA 3T5WA 4A38A 3RI5K 4H2AA 2NXZB 1FVEB 5D8JL 5HHOA 5L2JA 4HWUA 2D31A 4P9HL 3RI5F 3JWNH 3CUPB 4YSUA 4X9GA 3Q1SL 2QVKA 3OGOE 3WFDH 1JGUH 3MBEC 1TZ8A 3MI6A 4S1SH 1IJ9A 9CGTA 1AQ8A 1MQKL 3A4FA 3DGCR 3IJEA 2NUTB 4RMVA 2AVGA 1IAIM 4X98A 2X70B 5DEGB 4RFOL 4QRQA 4ENZA 2CSPA 5H35B 3QQ4B 4F8PA 5I1DA 2HA1A 3IFNH 1U91A 2L4OA 1I7ZB 1RU9H 3GMRB 4C4BA 1EDYA 4Y4FA 3BH8B 1AOZA 4PRIE 2A6KB 1Y1UA 1MDTA 3TIDA 4G6JH 4XNBA 5KYXA 3C60B 1C7TA 4EAEA 3T09A 3ELQA 4IKNA 4YFEA 1YY8A 4TQEH 5DJAA 2WSPA 5CGYC 4KZEH 2Y22A 3FFOA 1G43A 1EXGA 1SHMA 4M61A 4NHCH 3TPKA 1HYSC 5C0CB 2PKDA 4IBTA 1VF5C 2Z6FA 5I9QB 3T77B 3QG7H 4IDJL 5IVZB 4CBZA 3HLAA 3U4EB 1UOLA 5HYSB 1XV8A 2A6DA 5IK3B 3JUZA 4M02A 1OTUD 1K72A 2DAVA 4JFXA 4KI1A 3FQ1A 5DUPH 1DSFH 1HL8A 4ZI8A 5DMJB 4N8PA 2O6FA 4PRHD 1TQCC 3BP5B 5KSVA 3IFOB 1TU2B 4N85A 4ZPTA 1FZMB 5FEBA 1S7UB 5F70A 1VFUA 2WTPA 1BFVH 1JPTL 3C8KB 1EFXA 4G5ZL 5G4MA 1PG7H 4X9BA 3L3HB 5SWQA 3SDAD 5JOPD 5GXBB 5MI0C 4LNRA 5BOZG 3H9SB 3EJZD 2AGJH 1RZ7H 1E9QB 3MRRB 3CHXA 3KXFA 3CX5K 1B2WL 2XN1A 5LCVL 2R4RL 3OG4B 4M7LT 1JI1A 1T66D 3MKGA 5ABZA 1A6ZA 1Y6MR 2YAFA 2GJZB 3JWDL 4GINA 2GCYB 3ZKXC 3KW8A 1U3JA 4BWUA 3CUPA 3FRUA 5D93C 3UJJL 2DIBA 3JV4B 2VDNH 2XX0A 5JOEA 1OAXL 5GGRA 1AQDA 2AJ3A 2ZSVB 4KK6C 1S3KL 1QLEH 3DPDA 5T3XD 1BEYL 4OD3L 5BUGA 3ARYA 4WI2A 5DD5H 5EIIA 4W9CC 4JPVH 1EAQA 4LKXB 3ETBF 4Q2ZB 2IV9A 3P0YH 2RH0A 3MTRA 3QS2A 5GRVK 4PREB 5H35A 3GQFA 3HZ3A 3LPGA 1Z5LA 1I7ZA 1EHKB 4WRLA 4XTRC 3RWJA 4O4YH 1A9VA 3KJ6L 4JB9H 3IS0X 5F3BA 1X9RA 3AABA 1QA9A 2ITCB 3VB9A 4XVSH 2OR7A 3OJVC 3TH2T 3NJFA 5EA0L 3MV7E 3WS6A 1QPKA 4Z0XA 1OV8A 5IJBC 5DK0A 1E5UI 2MTPA 2KLSA 2W38A 3H7LA 4Z3JA 4Z7NE 5CMAA 4NSKB 5C0CA 4YHKL 2MCAA 2EXWC 5IVZA 2FEDC 4NQCD 4IK7A 3RZCC 3UAJC 5F9JB 1NCAL 4N0UA 3C09C 5IK3A 4ZO7A 2Y1AA 2JWYA 2PXYD 3S0PA 2XRAH 3G6DH 4P2QB 4CADA 2EDDA 2GC4C 3R19A 4K9EH 4NDMB 5A6LA 3QI9B 4Y4KB 4RISH 5CJQL 1FZMA 3RVVC 1HSBB 5EU5B 3BZEB 1TVHA 2GC7C 2L04A 2NY0C 1AZCA 3B3BA 4MA7H 3MC0A 4ZTOL 1ETB1 3SKMA 3V6OE 2VRKA 1DYZA 5D2NB 1A7QH 4K7PL 2WZPA 4L23A 3SZKC 3UDWA 5BRPA 1JZJA 1URLA 4PJFB 5GGTL 3H9SA 1WS8A 3MRRA 1E9QA 3VDBA 2GJ6B 4J27A 4PJAA 3QRGL 3UGUA 3V6ZA 2KI6A 3VVWA 2A1WL 2F8OA 2Y7QA 2F54A 1OT2A 2AQ2A 5HI3C 5JR1H 4KQ3H 1PKQB 4X6CE 2VZUA 2Z8RA 2WP3O 2YRZA 3MV9D 1L3WA 2Z64C 4X4MA 1WWBX 4W9LC 3I3EA 2WWMC 4FTVD 4PJAF 3C2SA 2VLJA 2FK9A 4JFHE 1U93B 3LRKA 3SBWA 1F2XK 1QI4A 5E2WH 4ZUVA 2CUIA 1A6VH 2WIMA 3BXNB 4PREA 4QDGA 5JQ6L 5DZLA 2D7NA 3LXUX 1JXJA 2FJHB 3AFLA 4LLUB 4QR7A 3QPKA 1EZSA 4JPWL 4PJ7E 3MA9H 1II4E 2WM0A 4NX0A 2VZ3A 4FULA 5C6TH 1OPOA 4F2MB 3UIYA 3S34H 1ESOA 5KVGH 5AUMB 5FW8A 5H37G 3MRHB 1NGYB 4G7VH 4X5XB 1I9EA 4I8DA 5BUAA 1H8NA 3HI6H 4NSKA 2VLRD 2X4RB 4K9EC 3RU8H 5CEZH 4O02A 1T03H 4LZKA 1SY6A 4BK5A 1IM3B 4WHDA 1T1ZB 2W94A 5G5DA 3H3PH 4PGDB 3JT2A 4JFOA 4Y5VA 4P2QA 1LYQA 3EJYD 4LKCB 4NDMA 1TMQA 1KBVA 4HKZB 1FFTB 2QJDA 5INCB 3D85D 3R0NA 3GSVA 4RFEB 2DM3A 3CZLA 4Y4KA 3VTTA 3GSUB 3EADA 8FABB 2VISA 5E5MB 3BZEA 2P44B 4BFFA 1A21A 4S1SL 5JW5B 2EC9U 1BQLL 2VC2H 3K2UH 2ZX7A 1SPDA 4PJGE 3CDYA 1TZGL 2AQTA 2AZUA 4M4RB 4M5YH 4J2QA 2WQWA 5D2NA 3IRPX 2CBOA 2EQDA 4ELKB 3MRFB 2BS9A 4FNRA 4UOJA 4MJ5B 1XF3A 3CN4A 1BVNP 3O3DA 1XVSA 3GMOA 3VQ1C 4NUGH 1PJ9A 3LD8B 5C0EB 2YAEA 2K9FB 3FO0L 4AKOA 3BO8A 1WIUA 1MI5D 5HDBB 2X2HA 3SDDD 4WUKL 1RZ8B 2WWKT 4PBXA 1MCQA 5LQBH 3JTSA 1KCSH 2YUZA 3ZK0A 4KZEL 4JBSA 4PJFF 4NHCL 4UU9B 3MLXH 4PJ8D 4PN6A 1D7FA 1JBJA 4V1DE 2CGYA 4D9RD 3N1FC 1X5GA 4XB7A 4OZHA 4BWTA 3KPNA 5ANME 2R69A 1ZWIB 3ULSA 1NMBH 3ZQ9A 1I1AB 4LLUA 4YDJA 3RVUD 1MAML 5EZJB 4M5ZH 4PI2A 1NUNB 4F2MA 1A47A 4AQZA 5FGCB 2ZCKH 3P4LA 5TDPA 4ZNEE 4MCYA 2NXYD 4XP9L 5JW4R 4LARH 5J6SA 4BFIA 1M2VB 2R1YB 4OZHF 3MRHA 1MF2L 3FQYA 3OKLB 3VRIA 1JSYA 4NJ9H 1G7IA 3RIAK 1F8TH 3T6WA 4PJ5E 3SGEI 2AGJL 1R0AH 1VFMA 4UUJA 3RIAF 2F5BL 5C92A 5FKPB 3PP4L 5EO1A 4FQHA 3MLUL 4QEGA 1LE9A 2B0SH 4XCCH 4LKCA 4XP6L 4F8OA 2ZOLB 3EGSA 2MH4A 3TBCA 3TNNA 4RFEA 1G6VK 1RURL 4MZRA 3QPXH 5E5MA 5FV1L 4JLRB 4GLRH 1MCNA 2ZSWB 3FHAA 1X5LA 4HUWA 5DZ9A 4LCWA 1JTOA 2TRYA 5EUKA 5E4EC 3G5VB 3O4LA 4NI6A 1RUAH 2QLVB 3MRFA 3VD2A 3D12B 3MRQB 4MJ5A 2C9QA 2B59B 1TKWA 3TBSB 1DQJA 4X0NA 5AOMA 5C0EA 4O4YL 8CGTA 1LWHA 1P4UA 4PBVC 4ZFZB 5KBMA 4FD0A 4ZFFA 1XCWA 2BO0A 2WUCL 5CBAB 2G60L 1PLGL 2HFEB 1Q0YL 1ITCA 2P8LA 3HPLB 3BGMB 1SDDA 2G2NA 2FBRA 2IEPA 5ESQA 2V5YA 3PXJA 3MACL 2EVHA 2LAGB 3TIEB 1P4LB 3BIKB 2D73A 4ONGH 2G5RA 4GRMB 5HDBF 3SDAC 4DPCX 2QR0B 4BDVB 3TBVB 4ZMAT 3EJZC 1T7WA 2V33A 1ZV5A 3RL1B 5DVOA 1R75A 1T66C 3LSOB 3G6AA 5K5YA 2JIXA 3VRJB 1FFOB 3BFOA 2FSEB 5I1JH 1Q94A 4XP5L 4CW1B 4LOEA 2QQNH 2R1YA 4MFHA 3KPTA 4AGNA 3RAJH 2KH2B 4KC3B 4PRIA 5CD3A 3F2LA 3X14A 2HKHL 4Y7MA 3NIFE 4R96A 4WO0A 5AW4B 5ID0A 3VGAB 1RVFH 2X4NB 3LZRA 3P30L 5KVEH 5FKPA 3RYMA 3QNZB 5JQIB 4OJYA 1H19A 4JW3A 4KQ3L 3E38A 1BJ8A 2ZOLA 4NKQB 1BF5A 1UM5H 1JXFA 4EUPH 1O5PA 2AEIT 3JXAA 4JG5A 5F9WC 5BZWB 1A6WH 2Y1YA 4N0YH 3PWLA 5D2LB 1AMYA 5C0FB 3QQNA 4LCVA 5AB2A 5F93C 3HC2A 1MCKA 1G6RB 4AUJA 1N26A 1OF0A 1UKSA 4IU3A 5K9OA 4AYID 4BA8A 2ZQKA 3PV7A 3PAUA 4LVHB 1KELH 1SFHA 3F00A 3KYKL 2HVBA 3KDMB 4RAHA 3MZTA 2PXYC 3PF2A 4RWYL 4K3JL 1IAII 2ORBH 1M7XA 1TTAA 1TQWA 1FAKT 2EDBA 4IRJA 2UZIL 5KVGL 5CBAA 1K8IA 1IEHA 4X6BB 4QAMB 1WBYB 4S1RL 4F80A 1E3XA 2X40A 1LTXA 3ROOB 1NTDA 2HLAB 3HPLA 2EE3A 3BGMA 4OUOA 7CGTA 3GS4A 3FB5A 2FGWH 1IKOP 1MFNA 1WA1X 2NT0A 4ZS6D 2RIKA 4HSQA 2D7OA 5FKAB 1T03L 5F6IC 1GGCH 1FAIL 2XZZA 1JOIA 4HMEA 4F24A 1IGCH 4GRMA 1BZEA 3H3PL 5A2LH 2QR0A 4PJEB 1CFQA 2DM7A 4OF6A 4UV7L 3O6ML 3RE0A 3TBVA 3FCSB 3MTXA 4HUCA 3CSGA 3S37L 2VMCA 3ZZSA 3OHXC 3AREA 2R2EB 3LSOA 2CJSA 2DMKA 4XMPH 1A7PL 4DZ8A 1FIGH 3I02A 3INUL 4NM4L 2FSEA 4BK4A 3VUAA 4K5PA 4IU2A 4YOKA 1IB5A 4JQXA 3SSGA 4OF7A 2ZWLT 4MZIA 3WNMA 4FQPA 4OLWL 1SOQA 1JF1B 3LDBB 5LBGA 4FYSA 2P24A 3V5DA 2OSXA 3L3OB 1KEML 2V3DA 5DQJB 3MV7A 3BVTA 2X4NA 1YYCA 4UBDD 5GS3A 2K45A 1DDHA 2WYZA 5LGHH 2GKIA 3KVPA 4GW1B 4GQ9H 1CE6A 4FNQA 5C0AD 4K3DH 2BIQA 2ZAGA 3HJ0A 1MW3A 2HX8A 5BZWA 1Z7JA 4LSUH 3LKPB 2VQ4A 4BV1A 3MLXL 4KO5A 4EBQH 3H54A 3BPLC 1CTOA 1HKLL 5IESH 2IGLA 3FB7B 4JO3H 5C0FA 3WL9B 2WCSA 1FPTH 2Y0SA 3DTUB 1G6RA 3JWNG 2R0WH 4NQEB 4J3XA 2C3VB 1KYUA 2YO3A 4Z7NF 4BRJA 5I71B 2YD8A 1WVZA 1G9NH 5IREA 4PIBA 1R1CA 5EZOL 1XF4B 4JO4H 3V6OA 5C2BH 1HFUA 4FCHA 5D2LF 1E2WA 1TQVA 4IKIA 1DN0A 3DECA 2K6ZA 1N67A 4HWEH 4Z23A 5JHLA 2XN2A 5IQ9B 4LARL 4P5SA 4N90D 1A9BA 3KEHA 2Z1PA 3HE6D 3PHAA 5IHBA 3L5XH 1TZIB 4TSCL 1F8TL 2AMUA 3VXSB 1MREL 4N8CL 1PLCA 4ODUB 4X6CA 1CXKA 3TO2B 2BSSB 1BZDA 3ZL2A 3UBXA 3FCSA 4FQ2L 1LK2B 5DJYA 4DP9X 1I85A 1B3IA 3ELAT 4Z7WB 3QPXL 3MCLL 3GKZA 3UJIH 3KBPA 3H53A 3SDDC 2A74A 1OCCB 2R15A 4N8UA 5J06A 3SPHA 5DJ6B 1R6VA 4PJ7A 4PJEF 1UD3A 5ICUA 3UJTH 1QSEB 4QRPB 4PJ8C 1V3KA 5M94B 3HMWL 4J4PA 1AACA 3HZVB 1ES0B 4LIQE 2DYPB 5DQJA 4BZYA 4ADIA 4F15C 4JRFA 1GYWA 4HAFA 3FFCD 4HIJB 3LRSA 3AY2A 4MJIE 4B95C 2YAHA 1M6OA 3I9GL 4GW1A 4S1DD 1TVBA 5CP7B 3ARBB 3QZOA 2Z31A 4PJ7F 4Y7OC 4I48A 1KLFA 3RVUC 3VI3E 1TJXA 4LU5H 4PTUB 1BREA 4NBYB 1WBXA 5HYFA 1CD1A 2NXYC 1G9NC 2PCYA 2WBWB 3FB7A 2Q3ZA 4ZMOA 3KWTA 3WNJA 3RBGA 4FMKA 1A64A 1IQWH 5AD0B 4ODTL 1DUYB 2C3VA 3EYSH 1BZQK 3K0WA 2H9GA 3LKQB 3QS3A 3N50A 2BZDA 4L29A 2DZEA 5KTEH 2FL5B 1NFDE 4PJGA 4NFDA 3IDMA 3VI4E 1UC6A 2GSGA 2XWEA 3KPLA 5TDNA 3FK3A 5I1JL 2FHFA 2OXHA 3NCWA 4Y88A 4LVOB 5GISL 2BJMH 4UWQB 2QQNL 1XGRB 3BWZA 1TLKA 4WCYH 1O9WA 2XBTA 3D9AH 1B88A 3PWVB 4I2XB 3FNKA 2OMXA 2FD6H 1QG3A 1TZIA 3RY4A 2WOYA 1ET5A 4IJ3B 3GJFB 4PRPD 2WQAA 3PAZA 1BF2A 4DN4L 3TF7C 5DI8B 3KLHD 2KZWA 1IV8A 1GGIL 4KNTA 4YPJA 2MCPL 3W0WB 4NZDA 4A68A 3W1ZA 1E4XL 2Q2LA 2VLLA 4ZZKA 4ZW3A 1CICC 5ACMA 3IPFA 3MJ9H 5DR5H 3CD4A 4V1DA 1N3NB 4Z7WA 2VW7A 4PRHE 4FA6A 5AKRA 2EDLA 2EIMB 4HIEB 4ATTA 5ANMA 4FYQA 4TS6A 4K7PX 2HH0H 5D6CB 3NIDE 1JZ5A 2WZ0A 4G8GD 1AZBA 2QKSA 1XB3A 5EIVA 3WGVB 1OSZA 2MWCA 4QRPA 4GAJH 5I82A 1BAFH 5JOPE 5FPIA 4XCFL 5HYJD 2EICA 3MRNB 3K71B 1ES0A 1SRDA 1FE8H 4Z7WF 2YSTA 3MBEA 2A99A 3CVHB 3RQ3A 1HQ4A 2NX5D 4HIJA 4TMPA 3QORD 4KKBD 4AM0Q 1UD4A 5CP7A 2ZWNA 2B2XH 3MLWL 2XYBA 5AFAA 1KZQA 4EF3A 2WXOA 4L4JA 4C4KO 1FI8C 4PTUA 3HG0A 3N91A 1S5IH 1RJLB 2FGWL 4EZKA 4O2FB 2MRYA 4ES9A 5T3XE 2C7FA 3E1ZA 1KJVA 1SYSB 1UH3A 1W6WA 1IC5H 3T04D 3TN0D 5I5IA 5AD0A 1IGCL 1DUYA 2JKXA 3D30A 1I7RB 2Y3AA 3LKQA 1YY9D 3IGFA 4J3OD 1T4WA 2VN3A 2VRQA 1ERNA 3P9LB 3VXQB 5F7BA 5GS2D 4PLKD 4XMPL 5F1OB 1QD0A 3GSNH 2AEPL 5IEHA 5DLMH 3FMGL 5IOPA 1XX9C 1UJ3B 1U8NB 4NZUH 5B3JF 1E0OB 5HGBA 4LSSH 4F7PB 2KYIA 3TEUA 2JQMA 1TJGH 2WXFA 3EHBB 1HIMH 2BRRL 2KQNA 2XPGA 4ZXBD 2WLMA 3NIGB 3GB7A 5DI8A 2IG2H 2PWFA 4NQCE 3WNKA 2WXHA 5C8JA 5JUEH 3TBWB 1OF2B 3G5YA 4PCSA 4W9IC 3BKMH 4K3DL 1AGFA 4P2YA 4YFLI 3TV3H 5JIIA 4HYTB 4LSUL 2XVLA 4HIEA 5D1ZD 2FWOB 2VMFA 4RGMC 3U7YH 4EBQL 5ALCL 2D4FA 6PAZA 5L2KB 1Z1WA 1RZJH 2R0LL 5I8KL 1DQLH 3RKDD 5I66B 4UYQA 3ABZA 4EO5A 2NY4D 1HCVA 4ZS6C 4HXAL 4Y2DD 1HHGA 3MRNA 4MGXA 3RWFA 1FUNA 2IALA 5F0LB 3CVHA 2CUAA 5INDB 3QULB 3IDJA 3SOBH 3CSTA 5F89B 2NY6B 2H0FA 3A6BH 3E8UH 5AALA 2CLVB 2Z7YA 3D0LB 5HVFB 1O7DC 2EECA 1P6WA 1S7VB 3KPMB 3OC8A 3MV9E 3UTPD 1CGVA 3FQXB 5KVEE 1KFAL 1CUOA 3WFBH 5AW1B 1R9FA 4FTVE 1GH7A 3DOIA 1IEBB 4F7KA 4FHJA 2WLIA 2O30A 1CD8A 4O9HL 4HH9A 2AW2A 1KGCD 2GUYA 3O2DH 4UBDC 5IFJA 1DCEA 1R17A 2UYLA 2ZWYA 4P2RD 4B9KC 3UAJA 2O61B 3K46A 1QFPA 3CFEB 3RZCA 2VZSA 4LSRL 5KYNA 1A25A 1AZVA 3AQZA 4QXWA 1E28A 3DOSB 1FNAA 4RDQF 2FZ3A 3M1CA 2YZ1A 3B9EA 4APQD 1FZJB 1PIFA 3VM7A 4QCIB 2D7QA 1EEYB 3HAEH 4Y5YB 2DMHA 3QCTL 3CVCA 3IEAA 4NQQA 4U1NB 2V7HB 2VLRE 3S35L 5KBNC 2IBZX 5I1LB 3I6SA 2YPVL 1S9YB 2H3NB 4ONFL 1OLLA 1HKFA 3AW5A 2OZ4L 4JG1L 4Z76B 4Y1SA 1CBVL 1KXQE 1CFBA 1RZJC 4ODXB 1AY1H 1I7TA 2OMYB 2FWOA 3MGOB 2C9RA 3NIGF 4JPIB 3NH7L 1G7PB 1ECZA 3EFFB 2F7IA 4ODHH 4F33B 5ENWA 3O4OC 5I66A 3BZ5A 3HE6C 1JK8A 2ZUYA 3O45A 3L81A 2FNBA 3OV6A 3G7TA 4Y2NA 4DK3A 3GSWA 5TK2A 3GTVA 4KX9A 4L5FL 1DCLA 2VERN 1D9KD 1MI5E 1OAQH 4YN3A 3K5RA 3TYFB 1B0WA 3AZUA 4Z3FA 2GAZB 4QRUB 5LBVA 1AP2B 1SGKA 2VUKA 3FQXA 1ZLWH 3CVIH 3VD1A 3OWRA 3NBNA 1ZTXL 2XTLA 4D9RE 5AWNL 2YGVA 5BO0D 3NRPA 4HQQH 5GZOD 3IXAA 2YSSA 4X0KA 1YAZA 3ESMA 3IFPB 4NEHB 4XMWA 1YPZE 2C9UA 4TUOB 3CFEA 1LM8V 2B16A 2R56H 4S1DC 3PGCA 5TH2B 1G5AA 4N9GB 1GS8A 2VR6A 2LU4A 3DDGA 12E8L 1FH2A 5DVNA 1C08A 1ROWA 3FUHA 3CFDB 3VD0A 3REVA 3I85A 5ADPH 4NOBA 1BZOA 1EEYA 4GAJL 4PS8A 1BAFL 4U6VH 4Y5YA 3ZXAC 3ECBB 4FFZA 1RHHB 4MA1B 3P9MB 2LFEA 3QJTB 1HHIB 4PGBB 3MUY1 1AIZA 3MNWA 1RLWA 1S9YA 4HS8H 2O5NA 1Q0XL 4HS6A 4LCUA 4Q14A 1UXWB 4DW2H 2M8XA 4XNXH 2V9TA 4ZFOL 1HINL 3NSFA 3S4SB 5MHSD 4J3OH 1HQRA 2H5UA 1G7PA 2JKWA 4OFVA 4V2CB 3IMUA 5GS2H 3EFFA 2KHAA 1IC5L 4KO7A 4EUPG 5TJWK 2V7NB 2Y2YA 5IF0B 1JV2A 4JPSA 3AGVA 1AHWC 1M6UA 4JKNA 5KSUB 2WANA 2Q7AA 2APXA 1PJWA 1CE1H 1ND0B 2YOCA 43CAA 3OAYH 2MOGA 3QXTA 3C2AH 2NR6D 4LSSL 1RUPH 3NJJA 1FYTB 1HX0A 4AGMA 2PUQT 4WU5B 1BLNB 1KPUA 2VM3A 1TJGL 4MD0B 1AP2A 1NC4A 1EHNA 3CU1A 5B8CB 4ZG1A 4KJYB 4HH8A 1UWGH 4AL8C 1FL6A 4MXWH 3VI3A 3S37X 4HEPG 1X5MA 2GTQA 1MH5B 4H88L 2Q8BH 1YO4A 3FH7A 4XMUA 2DI7A 2R2HA 3C8HA 4XC1H 3IFPA 2EUZA 3MQIA 3QORC 4KKBC 3WXVL 1SXAA 3U7YL 5KANI 4QT5B 3S97C 3ZE1E 2YD1A 3VI3F 1NFDA 3OJMB 2CM6A 2DTSA 5I1IH 5EBGA 1QBML 4DGIL 4XZUB 3VI4A 4DGVL 2LOEA 1U0QA 3MRGA 3QZWB 5J1AA 1RHHA 4HK3N 2XY1A 2GJRA 4Z1PA 2ENPA 2GJPA 1KXTA 3TN0C 2J56A 2YA1A 3K1DA 3QUXB 1W91A 2CJUH 2JKRM 4B9ZA 1YY9C 4J3OC 4XVJL 5JOFB 4G5AA 1WBZA 1UXWA 1MJJB 5J13B 1Q1JH 1U8CA 4IBUA 1E9PA 2DW5A 3O0RH 4JM4H 3ZJAA 2XSKA 4MMYA 5I74C 2A9CA 5I6MA 3BPOB 2BERA 1KTKE 4J3UA 3WO4B 1JHTA 4MD5B 1DBBH 5IROD 1A7NL 5DJ8B 4PRHA 4Q7DA 2AHIA 2OA9A 4MQTB 4ZXBC 1A1NA 4ODVH 2JH2A 2ZOTA 1SMDA 3FTZA 4HOZA 1RUKH 2O5XL 2VNCA 5KSUA 2Q8AL 1MFMA 4HWBL 4KKCD 2VSDA 3R0MA 4FLOA 1LL1A 4CA4A 3M6DA 1JNNH 1EJ8A 1E6OH 3K74B 4ZUUB 3NG5A 2GQHA 4OFIA 4QF1B 4QRRB 1P7QB 3NA9L 5FDWB 5ESVB 5KG9A 4OZIE 1DJSA 2DWXA 1KWKA 5D1ZC 4Q97A 4NC2B 4I87A 1HZHH 2YRPA 4P4KD 1C5DA 4DAGH 3NIDF 3LQZB 1KNOA 4G6AD 5E1IA 4DWHA 1N6QL 3RKDC 1HL9A 4CVUA 1KACB 4YSDA 3CLEL 5CJBA 2OJEA 3W9DB 4JFDB 1YEWA 4FABL 2NY4C 4Y2DC 4ZO9A 1QW9A 3HG1B 1SY6L 3F84A 1VACB 1P4IL 3UX9B 2J6EH 4KDVA 4KMTH 1JERA 5J8OA 3DA0A 3Q01A 1C12B 3QHFH 4UM9B 1JDCA 1O7DE 4FRWA 4ODHL 3DO4A 1G0DA 5D1XD 5F3HA 2WYTA 1MIEL 4O51A 1LDSA 1VFOA 3AS2A 3U9PH 1OALA 3PNWB 3WGUB 1Q38A 2ATKA 4G6KL 4NRYB 2J21A 3BP6B 3EJTA 3FXIC 1MFCL 1ZY9A 2V5MA 3QUXA 1HJBC 5C0BD 2DN7A 4LVNC 3QUZB 5GHWL 5JOFA 2IWFA 1DUZB 1N68A 1QUNB 1T89A 3PL6B 1J12A 1OAQL 3L3GB 1KIQB 3ARDD 5DQ9B 4Y16D 4H0HB 5C0AE 4NQCA 5BO1H 2XICA 2PXYA 1A3QA 3ZDXB 1LQSR 3BIBX 1AJ7H 2A77H 3K80A 4Q4EA 4APQC 4CKVX 1OEZW 5DJ8A 1ACCA 1QSFD 4JDTH 3N06B 4DFHA 4QTIL 5ES4B 3F5WB 3LNGA 3R1GH 1Z9SB 3UTOA 4CMMB 2ENQA 2NW2B 4HXBH 4X7TB 2E8YA 3EH5B 3BVDB 3GNML 3VE0B 4C56B 4HPOH 3WE1A 3ZYOA 3FCTB 1WP6A 2E3VA 4ABVA 3RFZB 4HC1L 2D7TH 3II3A 3N44B 3S6CA 4QF1A 4XNYH 1FFNA 1E7VA 4IM8A 5FDWA 3RGVD 2VQ1B 1TTRA 2DY2A 4MCZA 3RB5A 4D0DA 4N90E 5JYMA 1FGNL 2WXRA 5AWNH 3OHXA 5CU9A 3QA3A 3QUMB 2KL6A 3UTQA 2LU3A 2C26A 5I1HH 4G82A 3QAQA 1BJ1J 1FHGA 1IGFH 2F5AL 1BQSA 5FK9B 2WTRB 5DMKB 4YHNB 3O6FD 2B5IB 4HS8L 1VESA