3IKKA

Crystal structure analysis of msp domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein-associated protein B/C
publication title Elimination of the native structure and solubility of the hVAPB MSP domain by the Pro56Ser mutation that causes amyotrophic lateral sclerosis.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00635 Motile_Sperm MSP (Major sperm protein) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ikkA00
2YEZB 3W2DH 2J88H 3KHOA 3I2CL 4S2SA 4HS6B 2OQJA 3GSWA 5E6ZA 3O2DH 4PUBL 2H26B 2IANA 3ILQD 3O11B 1FG2B 2V9TA 4YR6B 4P4KD 1HHKA 5F3BA 1I7TB 3VJ6A 4YWGL 2AK1L 3ARDC 5BRZE 3V6FB 4F3FA 1FL3A 5GGQH 5FO8B 3MUHL 5KG9A 4IRJD 5CCKL 4JM2B 2PXYC 2FB4H 4YLQT 2E7MA 1EMTH 4JZJB 5D2LF 3MRIA 4CDHA 3OV6A 5IEKA 2W0PA 4IDJH 3NPSC 3KLHD 4OLWL 4WI5A 1KLFA 4MCYB 1UM6H 4WHDA 4JQXC 1DQML 3EO0A 4TVPH 3L3IB 4HMEA 3U2SA 1TVDA 4IOFD 3SGKC 3BVNA 2NY4B 4XVJL 5SV4A 2DM4A 3OR6B 2YD3A 3MV8A 1J5OL 2IFFH 1AD0B 5F9OH 4JKPL 3B9KB 1ZANH 4Q7DA 3V4UL 1TZGL 2JB5L 2WUCH 4NPYA 4PJ5D 4PJEE 3HUJF 5HHVH 4PB0H 3HE6B 3U82B 1WSST 3O4LB 4H25A 3GBML 3PGDB 2F19L 3I6GB 5DT1L 2HT3C 3BESR 1IL1B 1UCTA 4M5ZL 4I2XB 3ZE2E 4KHTH 1JWMA 4ISVB 2X4PB 3GKZA 4MA1B 2VLRB 1JHTB 4I3GA 3H42L 4Z8FL 4KZDH 2CR6A 5CJOL 1WIUA 1XR8A 5GS2D 5SWSB 1KEMH 2EIBA 2NY2C 3KPMA 1MFDL 4Y4KB 5K9OB 4ZFGL 3T2NL 4NKDA 5EN2B 5D1XD 1SJHB 4P4KA 5KTEL 5ISZD 2Z8RA 2EYTA 1RMFL 4G80B 4XXDB 4EOWL 3L5WB 4XC1L 4E0RA 2J3SA 1V8HA 4GAYB 3FMGH 3LDBC 4YPGA 3WLBB 2VITA 4IRJA 3V7AE 1NCDH 2CLZA 2HT4D 2XXCB 3WNKA 1RJLB 4U0RC 4EXPX 4JFEB 3FRPA 1FYHB 2EDXA 1I8MA 4FZ8H 1GIGL 1JL8A 2A1WL 3KDMA 4QHMB 3BKJH 3TFKC 3V52H 5I1AB 1YMHB 3MRQA 4WTZG 5HGHA 5MERA 3ILPB 1JWSA 1YEHL 3WHXB 3CLEH 3ZKXC 4PRPB 1FO0B 1AKJD 5DD0H 3RX8A 1FNHA 5JHDD 1WJ3A 5F7HA 2IG2L 1LD9A 2YPKB 2PR4H 1S7TA 4JFOB 4FQQB 1GZPA 4D8PA 1EEYA 4PJ5A 3MPCA 4LRNH 4RQQA 1CFNA 1N6UA 3DX8A 3WSQH 4G8IA 4I4WA 3REWA 2WIIB 3MGTA 4LLMB 2A6IA 5D72L 4OZ4B 3FONA 1BJ1H 4QHNA 1DBAL 3VFGH 3T08A 2EYSB 4QKXB 3FCTA 3CX2A 2AXFB 4MXVE 3RKDD 3WNNA 1A21A 1GGTA 3D39E 3W0WB 3VXTB 2HLAB 2YUZA 2Q86B 5KW9L 3RWDB 4LSVL 4GG6A 1VPOH 1A6UL 5DI8B 2UWEF 3IDGB 3V0VA 5IWLA 2XA8L 4AMKL 2O61A 5ITFB 4ZOCA 4S1DD 1K6QL 1U6AH 4TVPD 3QEGH 4LAQH 5D1XA 3TYFA 5ISZA 4LVHC 4RGNB 4I3RH 4G8GB 2I07A 1PKQE 1ZSDB 1DFBH 3DTXB 2A9NH 2R56H 3G6DH 4NUGL 4HJ0C 1UXSB 5D71L 3L3DB 5I8OH 2AJYH 1F8TL 1TZHB 1TZIA 1U8JB 2HLFD 4G8FB 2AJ3A 2X9YA 4M7KL 1T1XA 1HSBA 3V0AC 4N9OB 3S97C 4O02H 2FD6L 3UTZB 4NO0B 5JQ6H 2ICWA 3OZ9L 1KN2L 4XP6H 4YX2H 3E6FA 1WGOA 4Z7WA 3NFPA 3NH7H 3O2WH 3IFNL 5D1QD 5JLZA 5F9WC 3DETC 3FQXA 1RUMH 4Y2DD 4PLKC 3V79C 5EO9A 4IRZL 3W9DA 1KLUB 1AKJA 2A0LC 1QLFA 2ITDB 1KELH 4PYHA 5ADOH 3KLSA 5JHDA 3STZB 2GUOB 4HF5H 1A7NL 4Q6IB 4M1GH 2CJUH 5F8RC 5KVDH 3EFDH 3O2DA 4NNYA 1T1ZA 1ED3A 4EQ3A 2GSIB 1NCBL 2A38A 3LKNB 4K3EL 3DV4B 5C0EB 5EOCJ 4J1UB 2F58H 3RP1A 2N7BA 5GGRY 3DX9B 2JELH 3MNVA 4PV8A 5A2FA 3AREB 4UQ2B 1IKNC 2XQBL 1M7DA 4MSWA 3R8QA 3ROOB 5EUOE 2QADB 3RZCD 4I77H 2DI8A 4YHNB 1QKZL 1TETL 2YWZA 1YNTA 3NIGF 2EXYC 4WFHE 1RQ5A 5ELIA 4C56D 2CRMA 3OQ3B 5ERWB 5JZ7C 2FYYA 4R90H 1RK1A 4F7PA 4P2RD 2BSED 1JZ3A 1T7ZA 1E4XH 2P8PA 3QQNA 1S7SB 4Z0XB 3O3EA 4OM0L 5C0AB 1FC2D 3FQRB 4S1RL 1EAPA 2VYRE 2KKQA 2XTJB 1AGFA 1I7RB 1MIEL 2ARJB 1QTYT 4OUUB 1G9NC 1KJVA 5GS0C 3LKOB 2DLFL 5GSRB 3DXAD 1PGRB 1NBQA 3QI9B 3CPLB 2EE9A 1U91A 2E9BA 2YBRA 1T2QL 3DRQA 5ETUA 4X6FA 5JIPA 3VXNA 4LIQE 5BXFB 4WI8A 3MV7B 4PD4K 3MQIA 1OGAE 5D1QA 2I24N 4KK9C 3H7BA 4Y2DA 3IU3A 4XCCH 2LV4A 1XF3B 3C09B 3V6OA 2VUYA 1V3LA 3LVEA 4R7NA 3VFOB 1CLZH 3IU4H 3RPIB 1BD2B 2BNUB 5A3IC 4F33B 4OCSH 3VFWA 3EYUH 1TTFA 1UWEL 4M7LL 4JREB 5E8OB 4LSSH 5DJCB 5KG9B 1FORH 3MRCA 3NZHH 4MQXC 2D7PA 1A1MA 1QBAA 2BERA 3DOSA 3FQUA 5E5MA 2FDBP 3WE6A 2CH8A 4YBLC 1N64H 3HZMB 4M93B 5EUKA 1U8LB 3LQZA 4UAOC 3H9SE 5HDQL 4L3CA 2OR9L 2VL5A 4HPYL 1ZVYA 4QRRE 5F6IB 5HGDB 3RZCA 2EDHA 4QRUA 3VRJB 5B3JF 5L2JB 5E6IC 3HI5L 3ZL4L 3KS0H 4W4OC 5EZJB 1YY9D 3GMNA 3OAZK 3FQWB 4C56A 3BSZH 2VDQL 3GRWH 3QNZB 5E2VH 5EH1A 3V4VL 4TULH 5BS0D 2A77H 1MOEA 4P2RA 2DQGH 1IC4L 5C09D 3L3GB 5HHPA 4FS0A 2GW5A 1N4XL 4JN2A 3MOAL 1KXVC 4HIEA 1AXIB 1IKFL 4OKDA 4RGOL 1KN4H 5E00A 3FT4B 1L0QA 2F74B 4UQ3B 2ESVB 3DXAA 3HPLA 4U1KB 1P2CB 4QYOB 1NMAL 2DYPB 4HIIB 3BIAX 5FDWB 5FYKL 5L8JB 1LO3H 1OM3L 1JUFA 2CLRB 4RRPA 3D1MC 4JFZH 4HUXB 3EOBB 1CK0L 3ZYOA 5LKNA 3BWUC 4NJAH 4G6ML 4PBXA 4K3DL 3TT1H 4NZRH 4WW2B 3MJ9L 3MCKA 3HC0B 4LSUH 1TIUA 4G8EB 5C7XH 4JKMA 3RWEB 3BAEH 1DZBA 3QHZH 3QWOA 3QBTB 1G9MC 5KAQF 2UUDK 2OS7A 4M5YL 5TE6L 4I0PB 4WWKC 2P43B 3V0WL 3MA7B 3VGAB 2RB8A 1JRHH 1SJXA 3IJHB 3UYOD 2IPTL 2J5LC 1HZHH 3IRPX 3UJTL 5J56B 3QQ3B 5FHBH 4ZUVA 3ROLA 4L3ED 3ELAT 3GIZH 1MCFA 2A6JA 2IQAB 4OD2B 3P4MA 4HZLB 5TGBB 5HYIA 5FIEA 3INUL 3RVVD 2N7AA 4WWID 5ECJE 3UTPE 4EBQL 1A7RL 4OZGF 5F8QC 1I9IH 5C0CB 1CG9B 5I1IL 1FFNA 3U9UA 2FJHB 4NQTA 2QV2A 1XF1A 5D7LE 3BKMH 4J3VA 5DJXA 3DJ9A 2NLJB 1WZLA 1NCUA 5C08B 1N59A 1S7QA 4FXKA 5I2IB 4RGMB 1J8HD 2W0LA 3IXAB 5BS0A 2FO1A 4G7YH 5C09A 1MFBH 2WBJC 4WHYH 5SWZD 1IC7H 1E4KA 4K8RH 3QCTH 4LBEB 1KCSL 3BJLA 1TJIL 3CH1A 1CFNB 4A6YH 1ZA6B 4CVZB 4UOJA 3BFOA 5EIVA 4DW2H 1EGJL 4PJDE 3RNKB 2VIRB 4ZFZA 4JHBA 2PKDA 4R7DB 3GSVB 4FA8A 4YNYA 1U8NA 2CKBL 1AC6A 3FCTB 2Q7YA 3QO1A 3CVIL 4QCIB 4JG0H 1FZOA 4M1CD 1R3IL 1S5IL 2P5WD 1RZ7H 4R96A 4ODWA 4TSCL 2YHGA 3TBTB 4AIXA 4KJPD 3SQBA 3MRMB 2Y5TB 3FT3B 3AS2A 1X5ZA 2P5EB 4XT1C 4RWYL 2O61B 4XC3L 1BZ7B 3EYOA 1CLYL 1FH5H 1NDMA 5IIEA 3CDCA 3RBGA 2C4FU 3AAZB 4YHLL 4BH7B 4HX1B 3D9AL 4N90D 1Y18A 4OFPA 1CCZA 3MRJB 1T6WA 4JFXA 3FFCD 3VMNA 4Z7VE 4L3EA 2P42B 2OI9B 5E24E 5J3HC 4B50A 1FGNL 2D31B 4LASL 1U92B 1HEZB 5D7JC 2X70A 5E70A 3BP6B 4NT6A 3OAYH 3GSOA 2AJXL 2C3GA 4YHOH 1IGCL 3BWAA 4WHTA 5CGYC 4LPYA 1K85A 1XF2B 3TIEB 2R1YB 2DD8L 2XN9D 1J8HA 2RHEA 5EOQL 1T22A 5EZOL 3B8SA 4LPCA 5SWZA 4AIOA 5DMGC 1UM5L 4U3CA 3JWNC 3F58H 4QTHA 3SGDI 4FQ2H 4DGYH 4QOKE 3FO9B 3MBEC 1KENH 4MQ7B 5TH2B 2VWEE 1LO5A 3M17A 4JY5L 3C6LB 1ERNA 4K9EL 3VGHA 3SDCC 3SDDD 5HDLA 2EH8H 3CD4A 5L88L 1T1WA 1A5FH 5F7LB 1HHGB 4PR5A 2Y06H 2DTSA 2R0ZH 2ZUUA 2P5WA 2V7HA 5EU6E 3RWHA 3HI6H 1RVFL 3K1DA 5EU3B 1OPGH 3A0OA 2RCSH 3C2SA 4XWOD 5DZOA 5DSCB 3ALWA 3TBWA 1I1FB 1MH5A 2VDRL 4HPOL 3KYNA 1HILA 3BT2H 4UU9A 1CDGA 3GRWA 3BKYL 4EI5B 1CYGA 2NY6C 1HQRB 1YYMH 2DQHH 4HBCH 5EIIA 4U05A 2BVEA 3Q6FA 1VGKA 2J8OA 3F7QA 4N0CC 2AP2A 3FFCA 4XMPH 1YEIL 4BZ2H 1KJVB 2QBWA 4W6WB 5HVHC 1DEEA 1QA9B 3T3MF 3AUVA 4M61B 4WU5B 1PEZA 3OAZH 4Y19D 3HS0A 2DQUH 2FCBA 4PRHD 1KT2B 4E41D 1ETZB 4MNQE 1P7KB 3FRPG 4X98B 1JPFA 4K71B 3TH4T 2NW2B 4FQJH 2DTML 2KBGA 4H8WL 3IDJA 3O6FD 3TZVC 3C5JA 3EGSB 5J7CC 2JJVA 5D5ME 1A6PA 1MJ7L 3KXFD 1GL4B 2XN9A 1S3KL 1V7MH 5EFIA 3VA6A 1I1AD 1IGFH 1YJDL 3GKWL 5ICZB 4X4MA 4O5LH 5GJSH 3I6LE 4TSAL 4ZYKA 5GQBA 1X5HA 1Q9LA 3B5HA 1CGYA 1K4CA 1BQHA 4AIZB 2HTLD 2Z35A 1PG7L 2P24A 2DQCL 3HHRB 4GKZA 4NC1E 2EIZA 3HB3D 3TO4C 4XH2A 1M7XA 1LK3L 2HWZH 4Z78B 4MCZA 3WEXA 3ARBD 4XRCB 2VLLB 3WFZA 5DRZA 1C1EL 1NEUA 1REIA 4YE4L 5FGBA 3WFEH 1FZKB 2JKXA 1AHWA 4JZNA 4NN6C 3DECA 4OJFH 4L4TE 3ULUE 2UUDH 4X7DC 4XNQB 3CMGA 2B1HH 4LARL 5EG6C 4NQED 4UB0L 4UUJB 5HPMB 4GW5B 1OAQL 3S34H 4ZMAT 3LMJH 4U1GC 1DBKH 4O51A 3GI9H 1R3KB 2XRAL 4M1DH 5L8KB 2DQIH 3MTRA 4C55A 2IQ9H 4N8PA 3EHBD 1CT8B 3ZE0E 5BVPH 4X6EB 2QJDA 5JNYA 4P2RB 1FVCB 4XNZC 3WKML 1VFAA 4PRAB 3VGDA 3D3VB 5GZOC 3MFFA 1YEFH 4WCYH 3QRGH 4U6VH 4HMCA 3GMOB 4K07A 4UOW0 3CLFL 3GEWB 3PP3K 2ATPA 2EDLA 3I3BA 3LKSB 1F4XH 3BEWA 4HH9B 1T83A 2ZCKH 4Y19A 1NJ9A 3W5MA 2J8UE 4PRHA 5D2NC 1VFBA 4UMGA 3S36X 4E41A 1DLHA 5I8KL 2R23A 4NHCL 1PY9A 3TVMB 4BUHA 3MXWH 3BDBA 1B0RB 4JRXE 1GGIH 1JUFB 5D2LA 5D7IA 5IMLB 5DO2C 5GGRB 4JANB 3HKFA 2GY7B 5KANG 4P4RA 3MLVH 1QYGH 4M9OA 2Y1VA 2AERT 4JGMA 4ZUWB 3RGVB 3ES6A 2X4OA 4OV5A 5DS8B 3OF6D 1MCNA 3KXFA 5DJ0A 1OD7A 1I1AA 4NQCD 4P2OD 5E7BA 3B5TA 5SWQB 4NRYA 2JJWA 3ABZA 1ZWIB 4PJ9B 2EH7L 1Z3GH 3PDOA 3C9NA 1Z0MA 1SYVB 3DX7B 5I8CA 2APTA 4NHUB 5J8OA 4G7VL 3RGHA 4EDWH 1IT9L 3ARBA 3GMLA 1RD6A 5GRJH 3STBA 4TUJB 2W60B 2X1WL 2BC4A 3DUSA 3HUJA 2VZTA 2A6JB 4IJ3C 3C60C 1CLCA 5B8CC 3O3BA 5I6XC 3TC9A 4MB5A 4NQEA 1CZ8H 2NTFB 4NM8L 4GW4B 1A3RL 1B88A 1IGJB 2EO9A 4POUB 5FAAA 1QSEE 4PJBB 4U4BA 3OKDA 4KH2A 4A2LA 4CVWA 1NC4B 5DUML 3MV8E 5E2TH 1I1YA 2AVGA 4NQDE 1CD0A 2XT1B 5I18L 1W2KT 2JJUA 1T3FB 2Z92B 5C0RH 4JFQA 1KULA 5F9JB 1RHFA 4UTBH 1OAZL 4XB8A 2VKXA 1HKLH 3OPZL 3KPLA 3QP3A 1I3GL 4WFGE 3VE0B 3T2OA 4NRXA 4IIQB 4M8VA 2RIKA 2KPNA 3QXVA 2RFXA 3BO8A 3CDYA 4F7EB 3QO1B 5HYJD 5GRUL 5C9KA 4JFFD 1Y6MR 2XA3A 3ARFB 2VR9A 4GFTB 4YK4C 3KPSB 3IYLW 4YDVB 5DHVB 2XWTA 5HHMD 4HIXH 4Z7NF 5HHQB 1NBVL 2NYYD 3P4OA 5C0DB 2FEEI 5J11B 4JRYE 1T0PB 3BHBA 5C9JB 3OF6A 5DD1H 1M05B 4H20L 4NQCA 3QO0B 4PREB 4FNLH 3OKMA 5C2BL 3CFBA 3CMOH 2VDOL 3X17A 4ZQKB 1A4KB 5D9SB 3KPOB 3ZKQD 4N0UA 4K7PY 3ZO0A 1FO0L 3N1GC 2ADJA 1A7QH 4IEFB 2VN4A 1N7MH 1NSNH 3L7EB 2EE3A 3D48R 3FL7A 3PWUA 4ORZC 2BJMH 1N5YL 4JO1L 3HZVB 4HGMA 4XCFL 3EDDA 3FB5A 4IM8A 4QLRA 1RIVL 3WD5L 4K23L 4DOHE 1MCRA 2R1XB 4X5WA 3FB7B 5CUSH 3O0RL 3UZVB 4FXGA 4JQIH 5HYSA 3BWAB 3IFPA 1BP3B 5I1GL 4IMLB 4NC0B 3G6JA 1HXMB 2WINB 1W0WA 2YPVL 5A16A 4HSQA 3J7HA 4J4PC 1H15B 4AQ1B 4WUUD 1Q72H 2UZIH 3BN9D 3QEHB 3ARYA 1ZLUK 2F53D 4PJ5E 3OAUH 3NFNA 4YHKH 1MCPH 1M6OA 2B20A 4TNWF 5I30L 3A67L 5LAXA 4MNGA 1AD9A 3MV9D 1UB5A 3Q5TA 2CXKA 2DQEH 3KHQA 1NAKH 5C0ND 3BXNB 1JK8A 1KEGL 4F7MB 1MI5D 3V5KB 1Q0XL 3BKCH 4FFWC 2ADFH 5HYJA 4L8BA 4JFFA 2XKNA 3VI3F 2YK1H 4YXHH 3BP7A 5BJTA 1BFOA 1IQDA 4JAMB 2CK2A 4RZCA 4I3SL 4DFIA 4QT5A 2W91A 1AIFA 4JCMA 4U1IB 4NUJA 1JFQH 3LZFL 4HV8B 5A40E 4N0YH 3E8UH 1AJ7H 5CILH 3T77B 4PS4L 1B9ZA 1FL5B 3PHOB 1L6ZA 1TJHL 4Z95L 2ZUSA 4RRPG 4X4YA 4PJCB 5JA8B 1XGUA 5KS9B 5ISZE 5BMFL 3D18A 1FE8L 1JGEA 4MB4A 4U1LB 3UTQA 4DFHA 3KNBB 4LEOB 4HWBH 3C6SA 5AWNH 2CRIA 3EJJX 2X4QB 4CNIB 2WBKA 4YAQB 2DOCA 1DQDH 5LGJA 4NP4H 1NGYA 1HHJB 2NXZD 1BZ9A 5EORL 3WFHA 4PGJA 5I1DB 3JTSA 3UPRA 1HIMH 4Z7WE 7FABL 2C3WA 1VGEH 2HJFA 4O9HL 2O26U 3T0EB 5CD5D 3C87A 1BMGA 2BHYA 4LCYA 3MRLA 4Z76B 3GUTB 3BH8B 3CFEA 4LCCA 3PP3H 1CQYA 5B21A 1T66D 4NQVA 3MMEA 4WUUA 5T3XH 5IFAH 2MPAH 3B4NA 3OXRB 5JMOC 2F53A 4QNPF 5BZWA 2D0HA 5BO1L 4WENB 3DX6A 2AJVH 1IGIH 5HJ3A 2P24B 3QUYB 3WS3A 2I5YL 3MV9A 2ZSWB 2DB8A 3QPQC 3D0LA 4PY7B 4HK0B 4KAQL 4RA0C 2GCYB 5KSVA 1PQZA 2WAHA 1DQQB 4JY6B 1MI5A 3RWJA 5HVGB 3KPNA 5DUPL 1BEYH 3SKJH 1FV1B 1QPXA 4LGRB 1FGVH 1LK2B 2X4UA 1S9YB 5GSVA 2Q8AL 1N6QL 5E9DB 3D6GA 4OF6A 1ZHNA 1Y0LA 1P6AB 5JOPE 1ZTXL 1OW0C 2WWKT 4TVPE 1Q9OB 4K2UL 4MS8C 3C5ZC 3UC0H 2X9XA 4HXAL 5IQ7L 3MLWL 2VXVH 3VRLE 3SQOH 2WP3T 4UIMA 4OI8A 2AJZB 1F42A 1F4AA 2H6PB 1ZE3C 1XGRA 4M6MH 1SEBB 4ZFOA 2IH1B 4QRQB 3ZSSA 5GS1A 3I9GL 3RI5F 5KOVC 2R2CA 4IRSD 4U6TA 4A6YB 2ENYA 1TENA 3OKKB 1R3JA 5A2KH 3ORJA 1RULL 3KVQA 3QAZB 4KDTC 3HE7C 3MRGB 4PP2B 5DFVD 1N8ZA 1CXKA 1NCWH 1Q9KB 1BX2A 1A9EA 2YSSA 3G5VA 4P2QD 3QPXL 4RISL 3V6OE 5ID1B 1J11A 3BPOC 4K7FA 1T4KB 5GISL 5DMJB 3FO0H 3PWPE 5EZLA 4R3SB 3CNKA 4PLOB 1P1ZB 2VXQL 2G75A 1YC8A 4N9GA 4EUPB 3QUXC 1QSFA 2IF7A 3LKPB 2YS4A 2Z91A 4CADA 1A6VH 1Q0YL 4M43H 4YDLC 3GJFK 3PWNB 3VFRB 4PGBB 4GUPA 1SBBA 3TO2B 5BVJB 1GHFL 3BIBX 1ITCA 3TH3T 4JB9H 3WUWB 3WMSA 4ODXB 2V2WB 5CSGA 3SGJA 1BIIB 4HAFA 5I16B 1V3KA 3FQTB 1GZQB 4HDIA 2PTTA 1DN0B 5EB9A 1UKTA 4PTTB 5GGTA 4F9PC 3QCVH 5I71C 1MFNA 3WL9A 3TPUA 1RIUL 5F7FA 1XF4A 5KZCD 4TNWK 5DJ6A 2FSEB 3O9WC 1CICD 5DVMA 3QJFA 1QD0A 4KROD 1JP5A 1WBYB 4C56E 5JQHC 2IADA 4TPRL 3MJ6A 3BI9X 4R8WL 1IGMH 2XZQL 1JN6A 3U9PL 5E8PB 1G1CA 3OJ2C 1WF5A 2R4RH 5F21B 1I85C 4ZAKB 2XPGA 4Z7UB 4JHAH 5GGUB 4UT7H 1E6JL 4NKIH 4IRSA 3O2VL 5D7KD 3HNVH 3DXAE 1BVKA 4MJID 5DQDH 2FL5A 4DUVA 4MXQD 2BOBB 1FPTL 3NCBB 2YXMA 4YQXH 4XCEA 2NX5D 1GC1L 2GJJA 2QR0A 5ICXB 3VG0L 4O4YL 2EDOA 4PJXA 4JE4B 2VLJB 4P2QA 3ZYZA 2VDLL 1D6VH 2EKSA 3QQ4A 3ZDXE 2KH2B 2BRRL 1RZGB 3P4OB 3UXFA 3P2TA 4K9EC 5HDBF 1WUNT 1EXUB 3QIBB 2ZKHL 2NCMA 1HQ4A 4MAYC 1BQLH 43CAA 4OZGA 4XAWL 4YHPA 1FRGH 3QDGD 1YECH 4PG9B 4M7JL 4D0CB 1FLRL 4TUKL 4D9RD 5GJTL 4YDIH 4JHWH 4XP1H 2EDYA 4Y0GA 4KHXL 4WW1B 2LVCA 5I1JL 1S9WA 3DMMA 2MWCA 3IT8D 3EYVB 2CUMA 4LDLB 35C8H 4M48H 4HWBA 1XZ0A 1S7RA 1BQHG 1A0QH 4KKLD 1HCFX 4KJQD 3VFPB 2YKLL 2UV3A 3RDTB 4D9LL 3CFCH 2Q6WB 1KFAL 3O8XD 5F88A 3UZQA 4KRPC 5L6YH 4HKZA 2HN7A 3L1OL 2CDFA 1X4ZA 5TE7L 5DXWA 3TEUA 3F7VA 4OAWB 5EC2B 1CR9L 2H32B 1U8IB 1CICA 1YY8A 5LQBH 1PBYA 4DZ8A 5KBNC 5HI3D 1C08B 5CEYA 3CJJA 4XXCA 4F57H 5DURB 2HFFB 3V5DB 4F7CA 5HPOA 5BS0E 4M6AA 3GSNH 1L0YA 1NGPL 1NBZA 1U8KB 1CDJA 4BZ1H 2UWEB 4HUWA 4N68A 3QIUB 4HHAA 5E2WL 1OQOA 3LS5H 4JM4H 1AXTH 4H8WC 3O45B 3B9DA 5IB5A 4MJIA 4I5BB 5J0BA 2BXYA 5CSBA 3IXTB 2C1PB 1A47A 1YJDC 1FIGL 4DTGH 1MCCA 5IMMB 2NX5A 2FEEL 2XZCL 5I0ZA 5IEHA 4LNRB 2ZCHL 4WFED 3SKOB 4JR9H 4X6DE 1NH6A 4ODVH 4RZCB 2R8SH 4RNRA 5FECB 5MEOB 5GGVL 1WC7A 2WBWB 4BKLA 4ODTH 2GTZB 1D5IL 4NN7C 2GSGA 5FYJU 3DVGA 1MIMH 4LLVA 3QDGA 4P48A 5DD5H 3HG1B 2NXYD 1UWGH 5TDPA 3O41A 3UTTE 3OX8B 1HWGB 5IBUB 4BA8A 1CFQB 3EO1B 2EEBA 4JCLA 2IH3B 3K2UL 2FJGA 4BQCA 4FFZL 1RIHH 5GS3A 4EIGB 1VDGA 5E94B 4OD1H 4LLDB 3C6SB 3UDWC 5C0BD 4X7TB 2CIKB 3QG6A 5FKPB 4PJEF 3S36H 1C8PA 3QDJD 5DVOA 3IAPA 1JPGA 2HA1A 1AXSA 1J1XH 5FUCC 1GGYA 4L3EE 3ZMRA 4GBXB 5E1HB 3O2DL 4M02A 2YOCA 4ZPTA 4JVWA 3O8XA 3ZE2F 1NCNA 2ZJSL 5I76A 3O3DB 4UDTA 5K9KB 2DRUA 4HIHB 4KJYB 1WIOA 5C6WH 4OGXH 3VXRD 2Q1EA 5TDOA 1J8HE 5HHXH 3FQNB 3WHE0 4XZUB 4OV6F 4CKVX 3QUZD 4XNMB 3U79A 4FQLH 1FNGA 4WTXA 4PJFE 4IDJL 2AKRB 4XNUH 4BK5A 3UZEA 1OB1B 4E5XA 2V5RA 3MLXH 2QQKL 5HJ3B 3RTQD 4N5UA 2BMKA 1T80A 1CBVH 4LVOB 1CE6B 1EEZA 4Y4HB 3LRSB 5T5NF 4DK6A 4Q97A 1EFXD 3KPNB 5LGHH 3HLAB 5DC4B 5F9OL 3U0TB 2X4UB 4IMKA 2NY4C 2OMNA 2WUCL 4X4XB 3HMWL 4DGIL 3S96B 5HHVL 4Z77A 4QRTA 4RAHA 3GJFH 1D5XA 4PGDA 5TJWK 2ZG1A 5DJYA 1NFIB 2H45A 1HKFA 4PJGA 1OWWA 3OMZA 4NKOA 2QSCH 4N90E 4OZFA 2FGZA 2HVKA 1BOYA 3BEVB 4KZDL 3WFBL 1IJ9A 5C0BA 4D9QD 4XP5H 4M3KB 4NZDA 4ZFOB 4P5TD 3NIDE 1KEML 1NLDL 2OTWA 3H3BC 3QDJA 4NQSA 1F4WH 3Q5YA 5TFSL 2X09A 5I1EH 2GJZA 4HQQL 2QQLH 4KXZH 4OCLC 4LHQB 4AG4L 5C0JB 3U4BL 4YBQD 1INDH 1FVDA 4GMTL 3GK8L 4R2GD 5C71A 4PGEA 2DBLH 4NYLA 2P7TA 2MHAB 3QEQD 3EAKA 4KKBD 4MXVF 4QWWC 1ZT7B 3BISA 3FMGL 5EOTB 5GRYA 3ARDB 4NWUH 4OCMC 6CGTA 1UJ3B 4KKCD 3VXRA 2RR3A 1NCDL 1DL7L 2XN9E 2ADGB 2PXYB 2X1PA 4GS7C 4UI2A 5IHLB 5T1DH 3QUZA 3VXMD 4Q9RH 5HYSG 1GAFL 3SOBH 1G84A 2OJEB 1AC0A 1QSFB 4FZ8L 5HYQA 2VXSH 4GAFB 4HS3A 2Y07L 3NPSB 5DQJA 3QUKB 5FM5O 1ZVSB 3SKNB 3V52L 2BDNH 4LSQH 1U8HB 1J05B 3CLEL 4U1NB 3QCUL 1OGTB 5DD0L 5HTSA 2ZUWA 2IAMD 2C3VA 3PHQA 2PR4L 1DQJB 5DR5H 2A9MH 1LP9A 4KI5E 4AH2A 1L7IH 4LRIA 4LRNL 5J1AB 3NMEA 3OKNB 3TJEH 1BBJB 1LHZA 1RAMA 2DLTA 4P23D 2HJKA 3VFGL 4CJ1A 3BPLB 4ETQA 5I17A 4LEXH 3B3IB 4UINH 4G6JH 4X7CC 5E08L 3UO1L 2I27N 2VWEC 5HHNA 1RUPH 3GSNA 4P57B 3KPQA 3K0WA 2P8LB 2X44D 4P5TA 1VPOL 3RWFB 1IEAB 4ODUA 2NY2B 3O6MH 1U6AL 4LDEB 4Y19E 5L9DH 4OQTH 1AP2B 4TTDC 2FL5B 3MJGX 4PRHE 4LAQL 1A6TB 1O7VA 3BIKB 5GHWH 1CFSB 4EDXB 3QEQA 3F6LA 3LRHA 5D7IE 3QULB 4JO2L 4NN5B 1ZHKB 5EUOF 2BOCB 1VENA 2V5SA 3KXFE 2D7OA 5I8OL 4NM4L 2AJYL 3T4AB 5FOJA 1S5HA 3RVXD 1GVIA 4U0RB 3VXMA 4OZGB 4IBLT 1IFHH 3QXAA 4O02L 2W65A 5JQ6L 4XP6L 4YX2L 1MHHB 2ENSA 1A1NA 1H8OA 3QG7H 3O2WL 3NH7L 1G6RB 4N5ED 5ID0B 5D93B 4UV7H 1VB9A 3DMMB 4GO6B 1OT2A 4MA7L 3BZFB 3MREA 3V6ZB 1S7RB 3MRPA 2H1PH 1KELL 1F5WA 2IAMA 3LN4B 4HF5L 4XMKH 4M1GL 2CJUL 1GGCL 3EFFB 3QDMD 1FNEB 3L9RA 2ZOLA 2D7MA 4F7TA 1OAYH 5GRVL 4BFIA 2HFGL 3BD4A 4P23A 2F5AL 3TNNA 4UBDD 4KRMB 4YDJB 5CJXA 2W9DL 4L8SA 4U6YA 4KJWC 1KBGH 4UDUA 1LE5B 2VLKD 1AGBB 1D9KA 3OB0K 4NC1C 5I1LB 3KG5A 5MEQB 3EOYG 5F6HJ 1GCFA 2VLRE 2YRLA 4DJMA 4I77L 5JW5A 3TNMB 1LNUA 1DBML 1WZMA 5C0IB 1F6FB 5SWSE 4FFVD 1B6UA 4F37F 1EUUA 3K8KA 2J8HA 3MYZA 5C07B 3G9AB 1AGCB 5I8EB 5GXBB 3ULUC 3ZTJH 5F7MC 4ZUTB 6FABL 5IEHB 1ZEAH 3PWLA 4LVHB 1E4XL 4B0MM 2FR4A 1PLGH 3N0PB 1RZFH 3PE9A 2PW2B 1TCRA 3LEYH 4RNRB 5JOFB 1JZ4A 5IMOB 4OCWL 4BKLB 3R4DA 4NQCE 4OUOA 3SJVD 2GSGB 3GJFA 3K4AA 4GKNB 1XCQA 1YN7B 3IDIB 3QDHA 3TCLA 4NRZB 3QZWA 4N0UE 1P7QB 5C2UB 2C1OB 4JY4A 3HCVB 3CSPA 1DUYB 5F9WB 4XCCL 4PJ8D 4NO2B 2SEBB 1RZ8B 2Y6SC 1CLZL 1MEXL 4FOMA 1MLCB 3ZKSD 3MRRB 4KC3B 3QDMA 2H3NB 5E1AA 3DGGA 1GSMA 1MAJA 4OCSL 3EYUL 5CAYB 4R0LA 4HGWB 3G5ZA 1IAII 1IM9A 2CLVB 4LSSL 4ZUSB 2MKWA 1PYWA 4KVCL 3HZYB 1JPSL 1H3UA 1FORL 3NZHL 3G6JE 2JIXB 4XGZA 3WS6A 1IGTB 1OSPH 3EYQC 1U58A 1N64L 4JG1L 5F89B 2VLKA 4Y1AD 1LO4H 4K55A 5KOMC 3LPWA 1QFPA 1RZKC 4XTRD 1KJMB 3F62A 3UYRL 4MNGE 2XNAB 4WO4D 2CO7B 2KQNA 1K2DB 2VC2H 3VXPA 5IW1A 5E8NA 4JVPA 4ZOAA 3CFJB 1JVKA 3VFVB 1DJSA 1II4E 4LDOB 2Q76B 2YZ8A 3MLRH 2QSTA 3BSZL 3GRWL 4WGWB 5E2VL 4PP1D 5HYJE 1PSKL 3P9MA 3D85D 2A77L 4NBYB 2DQGL 4RGNE 1IMHC 2R0KL 3DUUA 4JDTL 1A2YA 2X4NA 1JF1B 1RUKL 3J8F7 3JV4B 5HHME 2Y7QB 1YA5A 3Q48A 1B4RA 1HSAA 1KN4L 3OGCA 4U1HA 3JTTB 3FB8A 4X7SH 3VWKD 3SJVA 1S9XA 2R1WA 3U36B 2GIYA 5INCB 3HPJA 4R4BB 1MRCH 4FFYH 4U31A 4KK5C 5IB3A 1XGTB 3LQAC 3ALPA 5E99L 3T0DA 4NO5B 3U7WH 4GLRI 4JFZL 4PJ8A 3TGXA 3BPNC 3QH3A 4NJAL 5EIQA 4G43B 1XCTA 2XY2A 4JGJA 3TT1L 4KK6D 3P3YA 4LSUL 2IPUG 4PJDF 5C7XL 4R97C 3SHSA 1HYSC 3BAEL 3RAJH 1UKQA 3QHZL 5EU5B 2H8PB 3BQUB 1B0GB 4PJ7A 3STLA 1A1OA 1J87A 1E27B 4NYLB 3ULVL 4Q9QL 2ADIA 4I48B 4PLNC 5KSAD 1VCAA 4WEBH 4WW2C 1MHCA 3A6BH 1ORQA 4PV9A 1JRHL 4JN1H 2R4SL 1A7OH 2DQJH 2EDBA 1Q94B 2AK4D 2ICCA 2Q7NA 3ILQC 3WLWD 1FZMB 1SBSL 1HZHL 2JCCA 3I75A 3IF1A 3JV5A 4P4KC 4PJHA 43C9A 1G9EA 4W6XB 3TV3H 3S3JA 2YPLB 3GIZL 3BRGC 3RWCB 4YBLB 1JWUA 3VFSA 4UAOB 1F4YH 4XVTH 3PWJB 5FYLD 4IRJC 3VFMB 1I3RB 4HS3B 1J8KA 1C5DB 2XI9A 5MENB 3MV9E 4WO4A 5C8JB 2GEEA 1AY1H 4HGKC 5E6IB 4JPVL 5DDHB 1YMMB 1MI5E 3KLHC 1JTPA 2VDMH 1KB5B 3GSUB 2CGRH 3G5YB 2AV7A 2DL9A 3D85A 2FRGP 4G7YL 2Q87A 1MFBL 4LSRL 1G7MA 4Z7VF 1UYWH 3C5SA 1IC7L 4IOFC 4YO0A 1UB6B 4K8RL 3LHPH 3QCTL 1HHHA 4AT6B 4A6YL 5JMRA 2XTJE 4QRPB 3LV3B 5ACZB 1ACZA 4F37K 5HSFA 1G7LA 2ZPKH 3VWKA 3N9GH 3HZKA 1ZS8A 1MCOH 1EZVY 2CRYA 3PWVA 3GSRB 4M62H 5H2BB 2ZP0T 3DYOA 5JDSB 1KIQA 2GT9A 2AXGA 1RZ7L 4GAJH 4J12A 32C2B 1LO0H 4M4RA 5E7FA 3T8XB 4P9HH 4DVRH 5IB1B 1RJYA 4HW6A 4RAVA 4P5KB 1XGYH 3CX5J 5H94B 2XWBB 5TF1H 5D6CA 1FH5L 3NZ8B 4QHLA 4R4FL 4F80A 5CBAA 1I3VA 1HOCA 1UCBH 1OSZB 2ATKB 1RHHA 3BW9B 1BD2E 3AVEA 5IWLC 5IJKA 3S37X 3NACL 5KSAA 1DUZB 2ZUYA 1P69B 3OR7B 1UKSA 2AK4A 4HCRA 4F2MB 1PZ5B 3CU7A 5D1XC 3B2UD 2J5LB 1ZT1B 3CVHH 3X12A 2D7QA 4XNXH 2YD6A 4AM0A 3KLDA 4PG2A 1F6AB 3V7MA 4HC1H 1KTLA 4I18A 1LDPH 1MVUA 4FRWA 1BVZA 2PTVA 3Q6GH 2PNDA 2WM0A 1A6AA 4YHOL 2BVOA 4N8VB 1QPPA 5AAWA 3VW3L 1F58H 1KIRA 1UACH 2AABH 1LVEA 3GBLA 4GG8B 4ODHH 5FYJD 2GKIA 4LQ1A 1QFOA 4JLRB 3SEPA 3DSNA 1CFTB 5BRZD 4FQ2L 4DGYL 1MQKH 3LEXB 5SX4H 1F3JB 1KENL 4MZ2A 4XCYA 5TPWH 3E0GA 5H35A 5HGGS 1A3QA 4M8QA 2E8YA 4KTEH 2HT2D 3E6HB 2NNAB 4BFGA 3LAFA 1OT1A 3T1FA 1W72H 1AGEA 2VABA 3QXWA 4OB5L 5JHLH 5D5MF 3G04A 5DRWA 3DROB 4OLUL 4XPHH 1D9KB 3NN8A 4WU7B 4N1HB 1QNZH 5AYQA 3HI6L 3LKRA 3UTSD 4OCXH 1C16B 3H8NA 2A6DA 1OPGL 1G1YA 1FNSL 4OZFG 2VLMD 4X99B 5FGCB 2C3XA 4XX1G 3RKDC 3KYMA 5DRNB 2Y4SA 1WBZA 4WJ5A 5ALCH 1XH3A 4LGPB 3BT2L 3RVWD 4QHKI 4PJXE 4XBGB 1UQSA 2AJUH 4S1DC 3SO3C 4MAUH 1MF2H 5CP7A 4LNVA 3MUZ1 1XGQB 4U6HA 5C0GA 3ULUF 1JNHB 1NUFA 4BZ2L 5FUOH 3GJFB 3KYOA 2RQ8A 1OP9A 3WO3B 5E8EB 4R9HA 3GNMH 3ZE0F 3GSQA 1ES0A 1XAUA 3FO2A 4GQ9H 2HLFC 4PRDA 4WDIB 4W81A 1P6FA 4WY7L 2JF1A 1T1YA 3BP4A 5B38A 2AXHA 3JV6A 1SEQL 1YEKH 3CSBA 2C7UB 4CU6A 1AO7D 1IGFL 5D1QC 3P9LB 4YHYC 3GHEH 4Y2DC 4NQXB 1TVHA 1D6EA 2NMSA 1UXWA 2W07A 3RIFK 4HUUA 5BRZA 2J8UF 2X4SA 3V6OC 5F7DB 1KCRH 1T5WB 3MYJA 1IM9B 4YUEH 4OGYL 1LE9B 3MJ7A 1U8QB 1YPZA 2XQYK 3DV6B 5IVZA 3NAAH 1JTTA 4ZNEA 4KK8C 5JDJA 4QF1A 1C12A 2DWDB 1CI5A 1Y6KR 3SDCB 4V1DB 3RFZC 2IBZX 3WFEL 1T03H 1IQWH 2Q8BH 4TN9A 2LE9A 4OJFL 2AEQL 3F5WA 2B1HL 4PGCA 1PW3A 4OCYL 5IUSA 1HH9B 3TN0D 1WCBA 5IW1B 2R2BB 4ENED 4MJIE 3LMJL 1D5ZB 4NO3B 1DBKL 3UJIH 2V9QA 4Y16D 1MJUH 4M1DL 2DQIL 2NX5E 2IQ9L 3RZCC 2P1YA 4PRIB 5LXGL 1DDHA 5F1IA 5BVPL 4PJEA 3QWRD 3SY0A 4EZMA 2IPKA 1CD1A 1T7VA 4MDIB 3QRGL 2NY6B 4U6VL 5C0FA 3FN0L 3VWJD 5KN5B 4G42A 2B4CL 5CSZB 1BVLB 4LIQH 1Z2KA 4LLWA 3MNWA 3MFGB 4DUXA 3WJLA 4LQFL 1F4XL 3UBXA 4DCQB 3QDGE 5HVHB 2ZCKL 1Z5LA 4X7EC 3HRZB 1J0IA 1I8KA 3MXWL 1FAIH 1FSKC 2YRZA 4H1LH 1U8PA 5JPMB 1F00I 3TT3H 1IAIL 3TVMC 3TZVB 3L5IA 1AO7A 3BP5A 5K93A 2BHUA 3KLAA 3CDFA 4ZTPH 2R0WL 1Z3GL 4P59H 3P11H 1CVSC 4OTXH 3RUGB 2NY0D 3EYFA 4X6BB 4NNPH 4RAUB 5J6HA 2FX8H 3BH9A 3IETB 1T5XB 4K7PL 1KPVA 3I02A 3TO4B 5IOPA 2EXWD 4EDWL 5KVEH 4HUNB 3EOAB 4Q9CA 5GRJL 4G9FB 3KPRD 1R5IA 2R2EB 1PAMA 2OZ4L 2CDEB 4PPTA 3S5LA 3VFSB 3VXSD 1B4JH 4NN6B 3QNYA 4L29A 1QRNB 2FWOA 5GGSY 1JGVH 1MY7A 3HNTH 3NA9H 4NOFA 1K4DB 3TN0A 4PBWD 3BGMB 5IVOA 1G7HA 4Y16A 1U95B 4U1GB 4NKMA 5GRZA 3HRPA 1ZVHA 3C2AH 3N1MC 1UG9A 2HT3D 3QWRA 4ZFOL 3GHBL 1YY9C 4HKJA 4XNZB 5IQ9A 4XVSH 4LMQI 3PNWA 3VWJA 4UTBL 1HKLL 3CFIC 2GFBB 3O6KH 5HGAB 3ARUA 1OVZA 3C8KA 1MRFL 4PJGE 4LKCB 3P4NB 4DAGH 1YN6A 2EDJA 5DWUH 1K8DB 3PWVB 3MRNB 1L4IA 5D2NB 5F96L 4XX1E 1KJ2B 5C0BE 4JKLA 4S0TD 2V2XA 3VXOB 1CGSH 3QDJE 1DQLH 3QXTA 4OBSA 4ZS6D 3RL1A 3VG9C 4AEHH 4K3GA 1YNLH 4LCUB 2O5YH 5JXAH 1PX3A 5D6CB 4OIIH 4FNLL 1KNOA 4MXWH 4Q2ZA 3IDYC 3CMOL 1N3NA 4R6UA 1WICA 1DLFL 1HK6A 1A7QL 1MREH 5D1ZD 3VXRE 1A6WH 1N7ML 2CD0A 3F12B 2WQ8A 5IF0B 3MLUH 3DO7B 5CJ8A 2V7NB 3I85A 3MRFB 2OSLB 2BJML 2PO6D 4NWTH 5GZND 3SGKA 4KGLA 5I9QC 1Z9OA 4PBVC 3LKQB 1MFEH 3VXSA 2ZWLT 5CWSB 5DK0A 1TXKA 1IAOA 5B8CB 2FECL 5CUSL 2Q20A 4YGVB 2OL3H 4JQIL 2VDKH 3G5XB 4XPGH 3RVVC 1XR9A 4QXTB 2A74B 4DVBB 5T3ZE 5DJ2A 3FT2A 5JA9A 1OP5K 1YUHB 1Q72L 2UZIL 1X5YA 1SYSA 2HFTA 1LP9E 2PYEB 3NBNA 5FCSH 2BCKA 3OAUL 3L3JB 1D3CA 5GPRA 4YHKL 1MCPL 4FQIH 4Z7WF 5FA3A 4C83B 2DDQH 4OZHA 3RVUD 1JGDA 3VGEA 1NFDA 4FTVB 3T2QA 3W82A 1T0MA 2DQEL 2HRPL 4JJ5B 4U1JB 1IGYB 1HXYB 1DSFL 1NAKL 1H3WM 3NFSH 4GRMB 5CMAB 1K5NA 4E42B 3P77A 2UVEA 3BKCL 1CDYA 2ADFL 3PIQA 5DRWB 1VA9A 1FNFA 2WNGA 2D0FA 4ZPVA 4DQOH 2YD8A 3KPTA 1DVFD 4YXHL 2EDRA 4Y4FD 3G6AA 3UROR 4D9QE 1VKXB 3L95A 4WNQA 3PUCA 5HGBA 4YK4B 2BVQA 2GTWA 4G5ZL 2EDKA 1JYXA 3ULSA 1JFQL 3E8UL 1AJ7L 5HHOB 5CILL 4PRBA 1YEDA 1CD9B 4M1CC 1FFOA 3IJYB 4HUVB 4HFWB 5DHXB 1G6RL 2DBJA 2K7PA 1U8OB 3IDMB 1RZJH 4KJPC 1SJEA 3QEQE 5F1NB 2UYLA 2NW3B 3MGOB 4F9LA 5D1ZA 1I7UB 5AWNL 4YFLI 3SDXA 4JDZB 1W8OA 3K8MA 1DQDL 4U3HA 4NP4L 2PO6A 3VXME 4PJIA 4XBPA 4ELMA 4JKWA 3FRUA 1N2RB 2A0LD 4CAGA 1IEBA 4X9FA 2X7LA 5IROA 2DWEA 3VRLF 5JORA 3GMRA 1YDPA 4HFUL 1FAKT 1T04B 3CX5K 5IB2A 1SMOA 1DN2A 1P4LA 2FATH 3OKEA 3WIHH 2BZDA 4PJBE 4OKVB 3PV6A 2FZ3A 4H1LA 4TRPH 4MWFA 2C3HA 5T3XL 2MPAL 1FG9C 4NDMB 5EU7E 1UXWB 2AJVL 3CZFB 3RL2B 1IGIL 2A73B 4Y5VA 3TYGH 4ZDHB 4KDVA 1NMBL 4NOBA 5CINH 1HI6A 4MQTB 4HWEH 3QXDA 3CDGA 1N5AA 4M4PA 3S98A 5FFLA 3TJHD 1AQKL 3FFDB 3SCMD 1BEYL 3QUYC 2EXYD 4LLYA 3SKJL 3TA3D 1EPFA 3ESUF 1FGVL 2AV1A 4OCNC 4Y5YA 1RK0B 4GKOA 1DVFA 2B5IC 2EDTA 4Y4FA 1KPRA 3H0TB 1TQCB 1G0YR 1PEWA 3HAEA 1UENA 2NY1D 4GKSA 2APXA 1AHWC 4MLSA 4IS6A 1BWMA 4MD0A 5FKAB 5EBMA 3VD4A 2ED9A 2VXVL 4KTYA 5BZDA 3BUYA 3DBXA 5EO0A 5GS0D 3KWWB 2AQ1A 2EE6A 3MRKB 4TUOB 2L4OA 1JHKL 3SY0B 1ZLWK 4XWOC 4M6ML 3PABB 4XP9H 1Q1JH 3GIVB 1BJ8A 1UVQA 3LPGA 4L8CB 1FVEA 4FQCH 3FAWA 1QLRB 4JFPA 4KK9D 3GGWB 1ACYH 3ZTJG 2OR8A 1VHPA 5DZNA 1U93A 1J0ZA 2AEWA 2RGSA 2X1XR 2ZNWA 1NL0L 5ADPH 3DVNB 3WUZA 1NCWL 1KG0A 1LGVA 2YXFA 3L6FB 4W6YB 1R5VB 4HMDA 1EAJA 3P30H 5KJRL 1PKOA 4D0BA 1LEGA 3FO0L 2Z4QA 2VISB 1BFVL 2VQ1A 2FEDD 1Z9MA 4HZAA 3IKCA 2E27H 4XBEH 3U7YL 3QDME 1C7SA 4H5SB 3RNQA 1IKNA 1OOAA 1I1AC 3PP4H 5HYEA 3WYRA 4DN3H 1NEZA 4HXBH 3ZDXF 5MEPA 1BOGB 3MRHA 3SCMA 1DEDA 2VLKE 5B39A 3TA3A 5DRXB 3HB3C 4XMLH 5T5FL 4U1MB 3CVHB 1M4KA 4UV4L 1HHIA 1I4FA 5AG9A 3IDUA 3ARBC 3QNYB 1INEH 3QFJD 5CLTA 1G9NL 5TE4H 1WBXA 1FZJA 4ONHB 3IGAA 4GRWB 1MUJB 3GJEB 3AY4A 4D94A 2ZSVB 3KYKH 4M7LT 5KS9E 1IGML 3SBWA 4GAGH 4BSVA 3SGEI 2R4RL 5FO7B 3Q3GB 1IM3A 4WV1A 5E2UH 4JHAL 3EHBC 2CR3A 4UT7L 4NKIL 2PCPB 1MAMH 3S9DB 3SJVE 3R1GH 2EE2A 4KPHH 5DQDL 2APBA 5CS7A 4ZAKC 5K9JH 4ORGB 4YQXL 3SDAD 5EU6D 4TVSa 1OP5H 3D39B 1W72B 1CQKA 5HVFB 2WK2A 3H9HB 4DGVH 3HE7B 3CH8A 3T0EE 3T65B 4CW1A 3MA9H 4WWKD 3I3EA 4ZO6A 3BPOB 1G7IA 1BQLL 3VFUB 1PKQB 5B38G 1RZKH 3OKLA 4PJ7E 5J9PB 3QUXB 1KJ3H 5IGXH 4XP1L 3UYPA 3QIBC 3VFTA 4XVUD 4WFFE 1WTGT 5AEAA 5KSUA 4YDLB 1JV5B 4X6DF 5T1MB 4PJHE 2JCCE 1D5BB 2B0SH 4M48L 4JPIB 4B7LA 4YXLH 3E3QE 3K46A 1S9VA 1P53A 5JR1H 3L5XL 3O3AA 4LF3B 1UC6A 5CIPB 4KMTH 3FTGA 4Y1AE 4KKNA 5L6YL 1BBDH 1DQMH 4BQ9A 1MFAL 4G9DB 5DK0B 2WBJD 3QNXB 3QFJA 5I74B 4OI7A 2XG4A 3TBYA 4YDKH 3H2WA 3PXHA 4LLQB 3X14A 5LQBL 3M8OH 3O9WB 4P5MA 4Z18A 2C26A 3IJSA 3MLTB 2YD9A 3I6LD 4F57L 4JKPH 1G7QA 3MROA 2BHZA 3IB4A 2DMCA 3GSNL 3FB6B 3P0VH 3WIHA 3GMPA 4X8JB 4BZ1L 1KIPA 1G7PB 3ZKMD 3KPPB 3BX7C 1J0YA 2FX9L 4IHOA 1TVBB 5TQ2L 2V2TB 3LS5L 4JM4L 1AXTL 3MRDB 2F19H 3MUGA 5F1SA 4DKDC 5F3HB 5AUMA 1G9ML 4UT6H 5IBTL 4CBPA 5D7SL 2GJ6D 5EU6A 3SDAA 3ZLQC 4HKBA 5EUOB 3PIQB 4L4TD 1I7ZA 1TJGL 3REVA 5DJ8A 4OLEA 3UBXG 5CJOH 3FOMB 4ODVL 2ITCA 3LY6A 4Z5RB 3FOLA 4QXGL 2R8SL 4WWKA 5HI4D 1EJOL 4JGUA 5D6DA 3RY6C 5ESAB 4APQD 1QG3A 2LAGB 4PTUA 3U46B 1KLGB 4GW1B 5GGSB 4I13B 4ZO8A 5KTEH 1MIML 4MAYB 1RMFH 5DD5L 1UWGL 2JLLA 5JIKA 1X44A 5K9QI 4XC1H 2AJSH 2NYYC 2E7CA 5HI5D 2OTUA 1R3LA 5B4MD 4ZFFB 2FJFA 5FK9A 2AK4E 1X4XA 2Z93A 1AQDB 2BVYA 5D7JD 1Q9WA 5GIRA 1VEOA 2JK5A 5KSBA 1K8IA 3O81A 4QTIH 1XMWA 2VERN 1OGAB 5FYLE 4QHUB 4KRPB 4KQ4H 2E8ZA 4J8RB 4O2CB 4LLAA 1QVOA 4JDVA 1S7UA 3WXWL 2H9GB 2VE6A 3S3PA 4QRSA 4HS8H 4FZEH 3V95A 3MBED 5IKCB 3K7UA 4ETYA 4EVNB 3NIDF 5HHXL 4KV5E 3GSXA 5IVXB 2IG2H 1ODAA 4U7MA 1FN4B 2WMPA 4FQLL 2Z9TA 4MMXC 5L2KD 3PGCB 3U0PB 4XNUL 5ESQA 1M7IB 5MHSD 1V7NL 1GGUA 3W39B 3MLXL 2PW1B 1WT5A 5DQ9B 4Z7UE 5L8LB 4LCCC 2X4TB 4ZXBD 5A2JH 2I25N 3BN9C 4H26A 3H9SB 5IR1B 4ERSL 2P8MA 4JFDD 2GJ6A 1OTTD 3V5HB 3MJ8A 3B8YA 4L4TA 4QRRB 2XZAH 3QHFH 3SE4A 4LHUD 2DQTH 4ZD3H 4KUZL 5C0NC 1KPRB 4NNXA 2D2OA 2XA8H 2NZ9D 4AMKH 1Z9LA 1QSED 2G60H 4APQA 4NQDD 3QIWD 5T1KB 4NN7B 1T20B 2DQFA 2W9LA 5I75C 1DE4A 2QSCL 5DHYA 1T21B 1HDMA 5KVMC 4JKKA 1HH6A 5D71H 4DKEH 4KI5F 4XP5L 2A83A 4RMUA 5DMYA 5D7JA 1UT9A 1F8TH 4X5XA 1F4WL 2W0FA 2R2HA 3FJTA 3HR5A 4HKXB 4BSWB 5I1EL 3VRIB 2CDGB 3OZ9H 1KN2H 1RY7B 4LSPH 3ZDZE 4U33A 3WIFA 3L3KB 3M45A 5GS1C 2DBLL 4GJTB 4C59B 4U3XA 1P4IL 5ENWB 3MBXH 3MNZA 3PL6D 4JRYD 1URLA 2NXZC 3EZJB 4W4NA 3ZSTA 4IRZH 5AD0A 1PVHA 5FCUH 2QKIA 3CC5B 3RWGA 2BSTB 2ZOKB 1CGXA 3IFOB 5FYJE 5T1DL 3TIDB 2V17H 5L2KA 3OWEA 2BNQB 1UJ3C 1KV3A 2VXSL 1BFSA 3RNQB 5DEGA 1WITA 4MJ6B 5DYOA 3H3PH 1YPZE 4L8DA 4Q74A 5D7IF 3LQMA 4L4VD 4ZXBA 4ZNEE 2GITB 4ELKB 3T4YB 1RFDH 4D0DA 2DQDH 4JFDA 4YHIA 2R9HD 4KY1H 1OP3K 1X7QA 5J13C 4ZSOA 1R24A 4LHUA 5DR5L 2A9ML 4HLZG 1I4FB 1HYRC 3ARVA 1L7IL 1F11A 4OI9A 1JMXA 3UTSE 3D0VB 3SGJC 3TJEL 2HP4A 1QSEA 1EX0A 2VLME 5D7LB 2XFXA 5GZOD 4NQDA 1ZHLA 2G2RA 4P2CG 4BJLA 3QIWA 5JW4M 2BSRB 2OL3B 2EEAA 5IMKA 4LEXL 1X5FA 5IV2A 1FYTB 4UINL 5GGVY 4G6JL 5EBWB 2BSSA 1CDBA 4CMMA 3BPLC 4PJDB 4NZTH 4EI6B 2H2SC 1U3HD 5ICYA 1BF2A 5FF6B 5FEBA 5DEFB 5H8DA 4OGAC 4Y5XA 2JB6B 3D5OF 3M1BA 4IOSD 3X11A 3S4SA 1T2QH 3EDJA 5L9DL 4OQTL 2FO4B 5IB4A 1ZLSH 1QQDA 1INQB 5CEZL 3MV11 5GHWL 4IRSC 3G9VA 1JMZA 3PL6A 3OJVC 4JRYA 4BUGA 4PRNB 5JW4R 3TPKA 4LAJH 1OCWH 3B6SA 5I66A 1CF8L 1JE6A 4HWNA 5IK3A 3WJJA 1NGWA 4YIQB 1D5MA 3FKUS 1JGUH 4LLUA 1AO7E 4IOIA 4P46D 1N26A 1X5LA 4GS7B 4JZOA 1IFHL 4NN5C 4HJJL 4M7LH 5C1MB 3LSOA 5DFWH 1NC2B 3K81A 4H1LG 1SVZA 1K9TA 1MLBA 3VGBA 3C60D 4UV7L 3TBVB 5LJYH 4L4VA 3GB7B 1OAKH 4Z7VB 4WI2A 2H1PL 1ZGLB 5D93C 1LQSR 3HR6A 2E9IA 3DMMC 5IFJB 4HPYH 1U41A 1NGZA 1L7TH 3N85L 3OHXB 4LCWD 3U4EB 3MRBA 4J3SA 3HI5H 2FIKB 4JQVA 3AMLA 5FOBB 5SX5K 3I6KB 1OAYL 3QEUB 4RA3A 3X14B 4O58H 2VDQH 4WRLA 1FFPA 1OF2B 1KPUA 4RFNB 3HAEG 1IC4H 1KJ2L 1O0VA 3VH8A 1KBGL 3D25B 1XGPB 2NY3D 5FA4A 4QOKB 1CICC 2G9HA 3L3OB 4KROC 2G5BA 4XXCC 5FB8A 3RVTD 1U3HA 4PGZA 1WFTA 1NQBA 3N1QC 3TESA 3UAJC 1A7PH 4RIRB 5CD3B 1NMAH 3F7YA 5FYKH 1JZ2A 3G6JF 1A7BA 2IGFL 4OIBA 1ZEAL 2Z31D 1DCLA 3OKOA 4FQXD 5F7KC 5IJVB 4GRLD 5JOPD 1RZFL 4G6AD 1CK0H 1A6ZA 2IALB 3DSFL 4XCNA 3CFDB 1EO8H 4MXQC 3LEYL 1NAMH 3F7RA 1QACA 4DKFL 12E8L 4G6FB 4MD5A 5DJDB 4JFYA 4P46A 2AXJA 3I50H 4S1QH 5EU4B 5EC1B 5LWYL 3CFKA 4M5YH 2L7JA 3WIIH 2VQUA 5E5UB 4HULB 3C08H 1FJ1B 1H0DB 5F70A 1RJZA 3WN5A 2W59A 3CSYA 2BVPA 3MLSH 4EN3D 2VAAB 1AGDB 3JWDC 1BLNB 3HI1B 3KPRE 3KR3L 1WFNA 1M71B 4ZUUB 2BNRD 2GK0A 1OY3B 3INUH 4AEIL 4MNQB 3SKMA 4LCWA 4MA3A 3EDKA 3VXSE 1NUNB 5CEXA 1NEZG 1A7RH 1XIWB 3IVKB 3B43A 2IMMA 2X4RA 4U0QB 1QFUH 4KKLC 4KJQC 5I1IH 4FG6D 5B39G 5JIHA 5JPNB 5D5MB 1DQTA 2I9LB 1ZT4A 3O8XC 3PWPD 5IG7A 2HFEB 5DJAA 1AI1H 2P46B 4LKXA 1OSPL 3L5JA 5ESVA 3HC3L 2D03H 3DIFA 1MY5A 3MR9A 1A8JH 1QEWB 1TJIH 5DJZB 4HJGB 1LO4L 3FO1A 2F54D 5HI3C 5ESQB 4FFWD 5E0QA 4OZHE 1PX4A 1NFDE 1EGJH 2VC2L 3Q5OA 4OSUH 3JWOH 3VXQB 5I1HL 2YD1A 3MLRL 1J86A 1TPXC 2IBBA 1R3IH 3HA0A 1D7FA 3UPAA 2Z31A 4FQXA 1ND0A 3L3HA 4GRLA 2VKWA 1NBYA 3ARGD 4BH8B 4MA8L 2ZG3A 3QA3B 4XHQA 4JPWL 5DK2A 4X7SL 3OXSB 3WCYA 3DRTB 3MCG1 3X3GL 1VACA 5IHBA 4IMKC 3IDNA 4PJAA 2XIDA 1HWHB 5L0QC 1MRCL 4FFYL 4LU5L 1OP3H 3AU1B 4EN3A 4NFCA 2JJSA 2E7HA 5DD6B 3U7WL 5BQ7B 1LEIA 2XQYG 3R06A 3SDXE 1GGBH 1I8IA 2NXYC 1QR1A 4X5LA 2HG5A 1MHEA 3P73A 4PJIE 3ECBB 2J8UB 4X0KA 2BNRA 4ELME 5BOPA 1NANH 3AMKA 3DI3B 2Z8WC 3RAJL 1QRKA 4DEPC 4JRXB 2VO5A 5FYKD 4ZTOL 5IM7A 1A9BA 4WEBL 5FM5M 4JN1L 1A7OL 4S2SB 1GOFA 2OQJB 3GSWB 3PWPA 2DD8H 3BQUC 2IANB 2XKUA 1FDLH 1UADC 2ZCLH 5EZOH 5I1CL 1HHKB 2BY2A 2FBOJ 3QXUA 5F3BB 3TV3L 2OP4L 2YZ1A 1UM5H 4PLJD 3VJ6B 2Z0BA 3GM0A 1F4YL 4XVTL 3VXUD 2F54A 4F3FB 1FL3B 2VZ3A 5DYOB 4JY5H 3QUZC 1AY1L 1I3UA 2OTPA 4BM7A 3MRIB 3DUHA 5I15H 2A6KA 4HIJA 5IEKB 5DUBA 2VDML 5L88H 1FL6A 3LEVH 2CGRL 3C5ZD 4RFEA 5INDA 3G08A 1UYWL 1U9KA 3EO0B 5JW4N 1ORSA 3LHPL 3U2SB 3ARGA 4JO3H 5JUEH 1DANU 3BVNB 1ITBB 4WUKH 3RIAF 4DZBA 3MV8B 4X9GA 5DFTA 1U8MA 5JW3H 3N9GL 4LRIC 4NPYB 4M62L 2NPLX 3QUMH 4RMTA 4XP4L 2IC2A 3V4PL 5E56A 4H25B 3EUUA 1QO3A 4UIKL 4GAJL 1LO0L 1AFVH 4QXUH 2ICEA 4P3DA 4DVRL 1IAKA 3BPNB 4NCC1 5FO9A 1XGYL 1AR1D 1TNMA 2ZUTA 1JWMB 5TF1L 4HD9A 3OJDA 2GK2A 2HAZA 1UCBL 2FLBT 4R97B 2VDNL 4N8VG 4P5TC 1F13A 2GAZA 1XR8B 3BMVA 1CL7H 2FNBA 3KPMB 2KDGA 4YBQC 4DUWA 4HG4K 2IBGA 4R2GC 5IK3B 5I66B 1MJ7H 4NKDB 3SKUD 3NCEB 1R5WA 1JNJA 3GKWH 2PETA 4P4KB 1VESA 3CVHL 1NAMA 2EYTB 4FMKA 4KKBC 3UTTD 1A4JA 4XNXL 3WNPA 5C6TH 4YHZH 3LN5A 4E0RB 3VXUA 4HC1L 4KKCC 3RX5A 1OARH 4YPGB 4RFOH 2VITB 3PQYD 4IRJB 3PGFH 4WGVB 3Q6GL 2CLZB 4OCRH 1MJ8L 1LK3H 3BUTA 4KTDH 4P0DA 4PJXF 5TF0A 3O6LH 4AQOA 2IFGA 2VTFA 5FM4A 4MNHA 3OG4B 1F58L 3DLQR 4QY8A 1I8MB 4CRPA 4CN4A 2AABL 3DVIA 4MVBD 4CL7A 4FHBD 3C5ZA 3KDMB 3H9ZA 4LARH 4UB0H 3MRQB 2VDPH 5HGHB 5MERB 3D2UD 1JWSB 4MDJA 5TPWL 2IAMC 4KTEL 1JJUA 1Z0NA 5ILTH 5TDNA 1W72L 1LD9B 5C6PB 5J6GA 1S7TB 1ZHBA 1GZPB 1S8DA 4D8PB 1EEYB 3R0MA 1T2JA 4PJ5B 3WKMH 4FP8H 4RQQB 5D4QA 3EO9H 3DX8B 4XPHL 3P4LA 4G8IB 1AE6H 4I4WB 1JF6A 4HT1H 4P23C 3REWB 1QNZL 1PJ9A 3MGTB 2A6IB 4AZ8A 4QHNB 3FONB 3CLFH 3ZZ1A 2R39A 4OCXL 1F90H 4FABL 3VD9A 3AS0A 1FBIH 1BJ1J 5C86A 1D9KC 2QSQA 5T1LD 1EGJA 1TFHA 3K4ZA 2YA1A 3QJHA 4NHCH 4X6DA 5ALCL 4MX7A 2CKBA 1S9KC 3IAGC 4GG6B 2AEPH 2AJUL 5LBSH 3RWIA 4OZIA 1MELA 2HMIC 3V0VB 1MF2L 2CIIA 5K33A 4MD5B 5D1XB 3TYFB 2V5YA 5ISZB 1FCCA 3UTTA 1E4JA 4LP4A 2I07B 1ZA3A 1J18A 5FUOL 2YPLE 2ARWA 4AJ0A 1IBGH 2WP3O 3GNML 3LN9A 3PQYA 4GQ9L 4OLYL 2FLRT 4RMQA 5MENE 1TZIB 3L5HA 2AJ3B 4XPTH 1T1XB 1HSBB 1NGXA 2PYFA 2QLVB 1YMME 2ICWB 3E6FB 1BM3H 4Z7WB 3NFPB 3EJZD 4XWGL 1V5JA 5JLZB 3FQXB 5EPMA 1I75A 5FM8A 5EO9B 3QFJE 2GI7A 3D2UA 4WIQA 1H3VA 4YUEL 3TBSA 3W9DB 1A3RH 1AKJB 1QLFB 4QRPE 2IMNA 4LHUG 4HEME 5JHDB 1MJJA 3NAAL 2DL2A 5DVKA 1KTDA 3U0WH 3RY5A 5AYUL 4OLZH 4NSKA 4PJFA 4ODSH 4U6XA 1KXTB 1AR2A 4NNYB 1T03L 1T1ZB 5LVEA 1ED3B 1G7JA 3V6BR 2Q8BL 4LMQE 1GPOH 3WFCL 4P9MH 2C4FT 4UBDC 1E28A 2OM5A 3W9EA 3WS6C 3RIAK 3GMMA 5DGQA 3W81A 1W0VA 3AXLA 1S7XA 2XV6B 1T0NA 3MNVB 4WVRA 2XWJA 5CBEA 5T1LA 4PV8B 3VCLA 5D96B 1H5BA 1MJUL 4TOYH 1M7DB 4MSWB 4KI5D 5FUZL 4F8TA 4CVXA 5K59E 1R3HA 1ND0B 3PJSA 3S4SG 3WXVH 1YNTB 3IS1X 3SO3B 3SE8H 1FIEA 1S7WA 3W11D 4LIQL 5DK2B 2FYYB 3X3FH 1RK1B 4L9LA 4F7PB 2P8PB 5CJ5A 4GQPH 5HY9A 2O5ZH 3O3EB 2VZOA 3CCHA 3X13A 3D69A 1EAPB 4P2YA 2VRAA 1AGFB 1FAIL 1FO0H 3TH2T 2YC1A 2W38A 3QUMA 2R0LH 2DICA 3EJYD 4X7FC 5KSBE 1N5YH 1U91B 2WLZA 8FABA 4JO1H 2YBRB 3DRQB 2X05A 3TT3L 1B90A 4XCFH 5ETUB 3GMQA 4X6FB 3VXNB 3VDCA 1UFUA 2B2XH 5D1QB 1CFBA 3F6IA 4K3HA 4PJ8C 4PJGF 4ZTPL 4P59L 3TLRA 3P11L 3H7BB 4Y2DB 3ZT7A 4YHYB 3IU3B 4X6CA 4NNPL 4JM2D 4TQEH 4ZO9A 4E9LA 4R7NB 5KVEL 1E0OB 1LEKA 4H88H 3HMXH 3DURA 1NDGA 3VFWB 1P9MA 4KRNA 1W0YT 5IW6A 2ZNXA 5IHZA 1KCKA 5F44A 1B4JL 3A67H 4UILL 1RURH 3MRCB 3BZ4A 3E3QC 3JUYA 3MO1A 3VH8G 1A1MB 3FQUB 1K3IA 3HNTL 3NA9L 4PFEA 5E5MB 3SDDA 3WE6B 2NY4D 2UZYB 4XI5D 5CHNA 2IPUK 4OLXL 5EUKB 3LQZB 5FGCE 2AEIT 4L3CB 1A3LL 4XTRC 2XXMB 3VFNA 4AENA 1J10A 2GJ6E 5EBLA 3C2AL 2VL5B 3B9KD 5CFHA 4WO4C 3RZCB 4QRUB 1RUQL 1MRDL 3DVFA 4PB9L 4BSJA 3SO5A 3HE6D 3O4LD 3LZFH 4O2EA 3GMNB 4N1CA 1P84J 2YA2A 3KS0J 1TJHH 3H6JA 4C56B 4PP1C 1KCVH 3O6KL 1KIUA 1RZIA 2FH8A 4OF8A 1XF5A 3O4OC 1QFWI 3CUPA 5HHPB 5BMFH 1CXFA 3ET9F 4EXKA 4DAGL 4JN2B 5JO5A 1WWCA 5DWUL 4HIEB 2VLRD 1MFCH 1PFCA 4U1SA 7CGTA 5E00B 3L7FA 1LP9F 5SWSD 1QO3B 1FSKB 2YEZA 1CGSL 1VSCA 3DXAB 3HPLB 5ACLA 1DQLL 3W5NA 4Y4KD 4HS6A 4AEHL 1YNLL 2H26A 5EORH 3QFDA 2O5YL 1ZXQA 2LU7A 5JXAL 3O11A 1FG2A 1IILE 4YR6A 4OIIL 2EC9U 4MXWL 1I7TA 2V6HA 5EDXA 1X3DA 3O6FA 4KK6C 5IHUH 1MSPA 5FO8A 3KJ6L 4JM2A 1T89A 1MREL 3BDYH 4OFVA 1IZKA 3SGDH 3MCKB 4JZJA 4JFED 4UZGA 1TNNA 3MLUL 1OAXH 3SE9H 5IJKC 3QWOB 1MCLA 1NAMB 4NWTL 5KSAC 2I26N 2HKHL 5L2KE 1GH7A 4MCYA 2EYRA 1MFEL 5MHSE 3WLWC 2I5YH 3L3IA 3BPCA 4J6RL 2OJZL 1EH9A 1S7VA 3U7AA 4NC2B 2WANA 2H2PD 3NTCH 2OL3L 4ZUVB 3ROLB 4PRPD 2VDKL 3OR6A 4PG2C 1I9RH 4XPGL 3IKKA 4JFDE 3P4MB 1AD0A 4QY8B 1KCUH 5DUPH 1JF5A 4I18C 3WO4C 1JPTH 3B9KA 4PRIE 4ZSOE 4KI1A 2BFVL 5BV7H 2WWMD 1MCIA 3HE6A 2UZXB 1FFNB 1N0LA 1WISA 1ZTXH 3O4LA 4FQIL 5TQ0L 3U9UB 3VI4E 1J9CT 1BQUA 3E2HC 2DDQL 3PGDA 5DJXB 3I6GA 2EC9T 2DM3A 1N59B 4HXAH 5IQ7H 1S7QB 1PD6A 4FXKB 5FGSA 1IL1A 5BS0B 4I2XA 5C09B 1X5AA 1QLEL 3NFSL 3I84A 4ISVA 3NIFE 2X4PA 3K74B 4PJBF 2E6QA 3CH1B 1J1OL 1JHTA 2VLRA 4DQOL 2VXTH 3VDBA 3W0WD 3RHWF 5SWSA 3I9GH 4GXVH 5K9QG 1PG7W 4PIRF 1YQ2A 4ZFZB 2J6EH 4Y4KA 5K9OA 4Y88A 1MVFA 3LH2H 4YNYB 1U8NB 3VG9B 5EN2A 2Q7YB 1SJHA 1FZOB 4RGND 2E9JA 4G8GD 5EA0L 2BY3A 1I1RA 4G80A 4R96B 4XXDA 3L5WA 4ODWB 2VSCA 3IDYB 4G3YH 3B83A 4GAYA 3RUGE 3WLBA 3BN3B 5E4IA 3D87B 3T0VA 4P2OA 1W8NA 3EYOB 1RJLA 1CLOH 5CEZE 1NDMB 4JFEA 5IIEB 1YZZA 1MCWW 4NO0D 1CTNA 1MCKA 1ZA3B 1Y18B 5I9QB 2ICWI 4LL9A 1P5UA 1Q0YH 4QHMA 1OL0A 3B2UC 4EKXA 5I1AA 4UTAL 1YMHA 4L4VE 2E7LA 3FN9A 4JFXB 3ILPA 3SDYH 1ZKAA 5GGTH 3WHXA 2D7NA 4PRPA 1FO0A 4L3EB 2BVTA 4H0HB 4XNYL 5FDYA 3RQ3A 5LGKA 1S78D 2YPKA 3LB6D 4BELD 4JFOA 4FQQA 4L5FH 2X70B 2RAMA 1O5DT 4NT6B 2EDQA 4YZFE 3GSOB 4F58L 2DLIA 1IAMA 3HFMH 4WHTB 3D2UB 2WIIA 3TYGL 4LLMA 5KVFH 3BGFC 4OZ4A 1DR9A 1QHOA 4X4ZA 5CINL 1J8HB 2D4FA 4HWEL 1T22B 2EYSA 1RPQA 1H8NA 3AS1A 5SWZB 2MMXA 2XZQH 2OR7A 2AXFA 3U9PH 4QTHB 2I60L 4S10A 3ARED 4Z6AT 5CZVH 1G7JB 3HMXA 3U1SH 3W0WA 3VXTA 3OGOE 5D2NE 1I8LA 2HLAA 2QADD 2Q86A 1J0HA 2HT2C 3RWDA 1LO5B 5DI8A 3M17B 3IDGA 1E6JH 3BRFA 3IDXL 3O2VH 4Z7OE 3EKCA 1T1WB 1RI8A 2HKFL 4PR5B 1TQCC 4G8GA 5HVWA 2EDFA 2P5WB 2V7HB 5I19H 1ZSDA 3RWHB 1V05A 3DTXA 5C0AD 3V2AR 4XP9L 1UXSA 2XTJD 3TP4A 1F97A 1Q1JL 2OLDA 3L3DA 3DHMA 1TZHA 4G8FA 1U8JA 3TBWB 3RVWC 1MH5B 3QI9D 3KYNB 4XAWH 1HILB 2HJLA 1ACYL 3UTZA 4L9LB 4NO0A 3GI8L 4Q58C 4PYGA 4UU9B 4KVNH 5GJTH 1AH1A 3MV7D 2Y6SD 5EIIB 3PHSA 5KS9F 3T2PA 1H9VA 4Z7QE 3WJLC 3Q6FB 1VGKB 1L6XA 3WDIA 3FFCB 1KLUA 1DEEB 2Y36H 4MZ3A 1CTOA 3P30L 3HS0B 3EYSH 3STZA 2GUOA 4L9DA 4D9LH 4Q6IA 1BD2D 1KFAH 4OQ1A 4LCWE 3L1OH 4HBQA 5J57B 2MSPA 1JPFB 3BD3A 3RY4A 2GSIA 3IDJB 5DK3A 5EOCH 5EO1A 4N0RA 3C5JB 4P9HC 3LKNA 5JXED 3DV4A 5C0EA 2XN9B 4FTVE 5EFIB 4DN3L 4J1UA 5IBLD 3T1WA 3DX9A 3ULUL 4ZYKB 1VEMA 4YXKH 1SM3L 4YPJA 1Q9LB 3AREA 1K4CB 4UQ2A 1BQHB 1HCVA 2Z35B 4XMLL 3ROOA 1YEEH 4GKZB 2EIZB 5E2WH 4XH2B 4YHNA 4PJ7F 2B5IB 3BD5A 4MCZB 3NGBC 3WEXB 3SDDB 5TE4L 5DMIL 5DRZB 1ULVA 2EDWA 3B2VH 5ERWA 4PJHF 2JCCF 2F15A 1AHWB 3BE1H 4OFYD 4JZNB 3GBNL 2ERJC 1S7SA 4Z0XA 2R29L 5ABDE 3TN0C 4GAGL 5C0AA 1P4BH 3FQRA 4ENEC 3MUJA 1JPST 3RHWK 4Y16C 1I7RA 4JPKL 3JWDH 4O51B 5E2UL 2ARJA 4OUUA 2QL1A 3UJJH 3LKOA 1D5IH 5GSRA 2ESVD 3QI9A 1MAML 3CPLA 1PZUB 3R1GL 4PJAE 1RZIB 3PDGA 2DYPD 2F8VA 4KMQA 5JNYB 4WI6A 2MFNA 1VFAB 1ZLVK 5BXFA 3MV7A 2UY7A 3VWJC 3RX7A 3MFFB 1BREA 1SHMA 1Z6JT 2KL6A 1TLKA 5GRVK 1HYSD 1UA6L 4DGVL 5BW7C 1XF3A 4MQSB 4LFHD 3WNLA 2ATPB 3MCLH 2DKMA 3MA9L 1V3JA 3OBAA 1UEYA 3BEWB 1YEJL 4Y19B 1NJ9B 3VFOA 2YRPA 4PRHB 2BNRE 1VFBB 2JE8A 5HDOA 3BMWA 2J6EA 3QFDB 3RPIA 1BD2A 1DLHB 2R23B 4E41B 2BNUA 4QEGA 4F33A 5T33L 3QSKB 1CFVL 1RZKL 2VR4A 4I0PD 2ZJSH 5D2LB 5D7IB 1JNLH 5E8OA 1KJ3L 4P4RB 5IGXL 2XOTA 3T09A 3O6FB 3ES6B 2X4OB 2MNUA 5DJCA 4OV5B 3KXFB 5JXEA 5DJ0B 5IESH 1I1AB 2B0SL 4ONGL 4NRYB 3HZMA 4YXLL 2GYSA 4PY8I 3S3SA 5DA4A 2ED8A 1U8LA 4LSTH 5JR1L 3PDOB 1UM4H 1NLBL 2NY0C 3C9NB 2ED7A 4KMTL 1WWWX 5I8CB 5HGDA 2F54E 5J4MA 3VRJA 2EYRB 2EXWC 1BBDL 2QQKH 5L2JA 3NPZB 3BPCB 5C0CD 3ARBB 3GMLB 5EZJA 1NGQH 1S7VB 2BC4B 4YDKL 3DUSB 3FQWA 1FC1A 3HUJB 5C08D 3M8OL 1JNNL 3QNZA 4RBPK 4OFYA 3EOTH 4RMVA 3MLZH 3L3GA 5I74C 3O3BB 3F65A 3P0VL 3LQAL 4OT1L 4NQEB 3HMWH 4DGIH 1QFWL 1LILA 3FT4A 3OKDB 2F74A 4UQ3A 1I1YB 4OZFH 3B9EA 2ESVA 4U1KA 2D9QB 1P2CA 4FQPA 4QYOA 4CMHB 2DYPA 4HIIA 5FDWA 2WUBH 3U4AA 4UT6L 1NCCL 4KV5F 4JFQB 3ARWA 5D70H 4P3CL 2CLRA 3WFBH 4HUXA 3EOBA 3KPLB 4NZUH 1NLDH 4NRXB 2P5ED 2CMRH 4ONOA 5TFSH 1C5BH 4WW2A 4HQQH 3HC0A 4Z7UF 2RFXB 3BO8B 2XTLA 4G8EA 2EECA 4KQ3H 3RWEA 4AG4H 3U4BH 9CGTA 4GMTH 3GK8H 3ZHLA 3BRDA 1ZLUH 4I0PA 5FYKE 2J4WL 2AJSL 4ZS6C 2XWTB 3P0GB 3MA7A 1P84K 1WIPA 3QB7C 1CS6A 3IJHA 3BHBB 1X6NA 1E4XI 4DKAA 4NQCB 4P2OB 1DL7H 1WWBX 3QQ3A 3OKMB 2IQAA 3N50A 3CFBB 4OD2A 1GAFH 2DIBA 4HZLA 5TGBA 4QTIL 4N0UB 4F9LC 3VXUE 5D1ZC 2MCPH 2Y07H 1J88A 2ADJB 4KQ4L 4RDQG 2E9WA 5T3ZH 1CXIA 5C0CA 1CG9A 2BP3A 1OLLA 2FJHA 2PO6C 5GZNC 1NANI 3PWUB 4HS8L 4FZEL 2NLJA 5C08A 3QCUH 3ZKND 2X40A 4GRWE 5I2IA 3FB5B 1MCEA 3IXAA 2ORBH 1IE5A 5IROC 3C8HA 4CU7A 4Q6YA 4AEEA 4X5WB 4LBEA 5AZ2H 3ZDZF 4FXGB 2IWGA 1ZA6A 2Y23A 5HYSB 4CVZA 4KKAC 3IFPB 5EWIH 2X6MA 3G6JB 3RNKA 1A02N 2VIRA 1W0WB 2MCG1 3C6LD 4NJ9L 5CP3H 4R7DA 5A16B 5JIIA 3GSVA 2DM2A 5IT2H 4QCIA 3K1KC 5E08H 4Y5VC 3NFNB 4LCIH 3UO1H 3RVUC 4C57C 1M6OB 4KDWA 2XZAL 3QHFL 5LAXB 4MNGB 1AD9B 2DQTL 1UB5B 3TBTA 4ZD3L 4LGSB 2VN7A 3MC0A 3MRMA 2Y5TA 3FT3A 5IP4A 2P5EA 4NFDA 4D3CH 1BZ7A 1JK8B 2G60L 1YPZF 4Y5YC 3AAZA 1DVFC 5B22A 5HYJB 4L8BB 4JFFB 4BH7A 4Y4FC 2XKNB 4HX1A 3BP7B 5BJTB 1BFOB 1IQDB 2DMKA 2WLYA 3RKPA 1KC5H 2WZPD 5HHMB 4QT5B 4EI5D 3BDXA 1AIFB 4JO2H 4MD4A 4OZIE 3MRJA 4NUJB 2RJMA 4J3TA 4DKEL 3NCJL 3NCYS 4NM4H 4X4YB 2YD7A 1XGUB 4OF3A 2CK0L 4K7PX 3D18B 1P5VA 2HJLB 1JGEB 3GM8A 3HTLX 3UTQB 4LSPL 2D31A 1U92A 4AEFA 3TCXA 1HEZA 3BP6A 3EW3B 3PQYE 3F7PC 3W2DL 3MBXL 2J88L 4LPWA 1L9NA 1XF2A 5LGJB 3TIEA 4MA7H 4YC2C 1NGYB 2R1YA 5FCUL 1WAAA 1EV2E 1BZ9B 2EEDA 2W9EH 3WFHB 3JTSB 3UPRB 2F5BH 4UNUA 3ZE1E 1CL7I 2HJFB 4KK8D 1BECA 2ILLA 1GGCH 5ANME 2V17L 2YUWA 1ZLVH 3FO9A 1QSZA 4MQ7A 2NY5H 5GGQL 5TH2A 3NCCB 4Q0XH 4LCYB 3EDEA 3MRLB 5EO1B 2FB4L 3H3PL 2HFGH 25C8H 1EMTL 3C6LA 2F5AH 3CFEB 4LCCB 4NQVB 1RFDL 1UH3A 3MMEB 4WUUB 2W9DH 1JRHI 2DQDL 1TQBB 2F53B 1VADA 5DHVH 5BZWB 1F02I 4Z9KB 3DX6B 1HHGA 4KY1L 2W1NA 1UM6L 4TVPL 3WS3B 3MV9B 5AZEH 1OTUD 3JVGC 5J89A 3OJMB 3D0LB 3BJ91 5EU3A 1DBMH 3TJHC 5KSVB 2ZUVA 1PQZB 3SCMC 1MI5B 3H7LA 3RWJB 3MOBH 3TA3C 5DSCA 2IFFL 5T3ZD 1XEDA 3ZDYE 1I1FA 4RWHA 1NMCC 4M00A 1HINH 3FHAA 1ZANL 3RJDA 6FABH 5GSVB 3MACH 4EI5A 5I75B 3OAYK 4PB0L 2NY1C 1HQRA 1ZHNB 3D3VD 4RMRA 1CGUA 1Y0LB 1T7WA 2MTPA 3AY4C 1HNGA 4OCWH 2OCFD 4ESKA 4KFZC 1JYNA 5BV7B 4QHKJ 4NZTL 1KCLA 5ITBH 1QA9A 3SBWC 4M61A 4WU5A 4KHTL 4XPFH 3DGCR 4UIMB 1KT2A 4RBPH 1XGRB 1EBPA 1ZLSL 1ETZA 4WV1C 1P7KA 3TVMD 2Q3ZA 2QSVA 4X98A 5GS1B 2NW2A 3FZUC 2FHBA 1OCWL 3EGSA 3RGVD 1KGCE 1ROWA 2NXZB 4I9WE 2R69H 1R3JB 5ICZA 1MEXH 1JGUL 2FBJH 2WQRA 5HD8C 5IVXE 3EIFA 4PJ9D 1KTRL 1N8ZB 2FX7H 4AIZA 1BX2B 5F7WC 1A9EB 2YSSB 4X6CE 3G5VB 1N0XH 4KVCH 4K7FB 4Z78A 1JPSH 2FEDC 4XRCA 2VLLA 2NR6C 1JHLH 4JFHD 5EZLB 1OAKL 4JG1H 2G75B 1FZKA 4N9GB 5DMKA 4CADB 2Z91B 1RZJC 3RTQA 1L7TL 4XNQA 3BKJL 5J13B 3UYRH 1LO2H 2Q3AA 4GUPB 3UEZA 4UUJA 5HPMA 4GW5A 1QBLH 1QR4A 4X80H 1R3KA 1EFXA 1NC4D 1JYWA 4O58L 4HDIB 2PTTB 4I1NB 1OTSC 1CT8A 4X6EA 1PSKH 5JW4Q 1FVCA 1MWAH 2R0KH 4FXLA 4JDTH 3WL9B 4PRAA 3TPUB 5I73C 3WSQL 1XF4B 1RUKH 3D3VA 5DJ6B 4ONFH 3QJFB 3GMOA 2P4AB 4QGTA 4RFNC 1FNLA 1BJMA 2IADB 3LKSA 2J7LA 2I9TA 1A7PL 1OAUH 4HH9A 2ID5A 4K94H 1CE1H 1JN6B 2JTD