1FO0B

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSADRVGNTLYFGEGSRLIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (ALLOGENEIC H-2KB MHC CLASS I MOLECULE)
publication title Crystal structure of a T cell receptor bound to an allogeneic MHC molecule.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2000-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fo0B00
3RWFA 4LHUD 3WKNA 5C7XL 2FYYA 4H26B 2P5ED 4BSJA 4S1QL 4DN3H 4JFHE 1DR9A 1B88A 4QRUB 3IDIA 3P40A 3S5LB 2KQMA 4ODVH 5D96B 2V17L 4RGNB 2PYEE 4G9FA 5KG9A 5CKAA 1IQWL 2LU3A 2BY3A 1U0QA 1A3RL 5AD0B 3T0EA 3GMNA 5L0QC 3AMLA 4LARH 4NFDA 1JNHA 3VGAB 4GRWE 1FIGL 1BREA 3RWEA 1EXUA 4OT1H 4JM2F 4XPTL 1A8JH 1RUQL 4WFHD 4ODXA 5E8NA 4OUOA 1QRNE 3P4OA 5H37G 5ICZB 3U0WL 4M1DL 4P59L 5I2IB 3VI4E 1BIHA 2C3GA 1MJ8L 4Z78A 2CLRA 2JJSC 4XX1G 3ES6A 4W6YB 3D69A 5ESVA 1OAZH 4L4VD 5CUSH 1LILA 4I1NB 3SE4A 4DZBB 4KDTA 4MQ7A 3DHMA 1G7IA 4HFUH 3ARBC 1KPRA 4UI2A 1HK6A 1NCWH 4F7MA 2Z8SA 5FUCC 3P4NA 4ZS7L 1XR9A 3ORJA 3F7QA 3TP4A 3HE7A 3LPGA 4Y4KD 3MO1B 4GG6E 4EDWH 4PUBL 2PCPA 5CBAB 3UJJL 4KY1H 4KRMB 1OARH 3ZHLA 1KCSL 1S9VB 5TFSL 1X7QA 3MTRA 3TPUA 3W0WA 4LGPB 4X6DA 4HFWA 1QEWB 1ETZB 3OB0K 5KSAB 1GSMA 2Y23A 2CIIA 3MQIA 2FZ3B 4LIQL 2NCMA 3QNXB 5A3IC 4QTIH 4I3SL 1XGYH 3ARYA 4KK9C 1XCTA 2A1WL 5DZNA 3BN9D 2ORBL 4BYHA 3RNQB 2Y07H 3PP3K 4NNYA 3ARTA 3SKJH 3N85H 5HHOA 4ZPTB 1A47A 3C60D 1JGLL 1ZT7A 2OSLB 4NN5B 4LLWB 4CNIA 4DAGL 1WF5A 1AGEB 4HKJB 4GO6B 1CBVH 5IB5B 1AXIB 2VC2L 5IBUB 2EDWA 3JV6B 1BJ1J 2C7UB 3LKSB 3L3GA 5E94B 1CXLA 1C1EH 2NXYD 5JORB 3VFRA 4FTVE 1K2DB 2A6DB 2ZCLL 4JFDD 1RHHA 4GAJH 4ZNCD 3HNVL 4KVCL 1OAUH 4KV5F 1NFIB 3DMMD 4JJHA 4AEFA 4G6JL 3S34L 1JFQH 2XA8H 3MOBH 1S9XA 1H15A 3H6JA 4CVZB 4XNQA 2JIXD 2N56A 5D7IA 3QIWD 2ID5A 1IGTB 2D31A 2QR0A 3TBWA 2R56H 1IAIM 3O6FC 1KEML 4X5XA 1UWGH 4NM4L 1JRHL 1L6XA 4MD5B 1F45A 5D1QA 2Q7YB 4G6KH 1F58H 2JCCA 3MSPA 3WO4B 5GGVH 2OTUB 3LSOA 1W0VA 2BZDA 4KQ3L 5ADOL 4U49A 3RX5A 3IF1A 4RGMB 1MNUH 3BP6A 3GJFK 5CP7B 1IAOA 1D9KB 1PG7L 4O51B 1F02I 4TNWK 1U58A 5C6TH 2FEDD 1CXFA 3BD5A 5DFVD 3T8XB 4EQ3A 2MQCA 2EH8H 4K9EL 4JFZL 4APQC 4P5KB 2J6EL 2YR3A 4QRRD 1HKLL 2LV4A 2PR4L 3JXAA 5I1IL 3BZ4A 1U42A 5MERB 1U6AL 2D7TH 4WUUE 4N1HB 3CZFB 1XIWC 3MBEC 5E56A 3VG0H 3KPQB 4PY8I 3VRLF 4HQQH 4MAYA 5CGYC 1RULH 4R26H 5DK2B 3RRQA 3WD5L 1BVKA 2EIZB 4QOKB 4OQ1A 5IVZB 5ITBH 4YPJA 2H32A 4GOSA 2QADB 1KIRA 5FHBH 1KTLB 1KCVH 4OIIL 2GAZA 2CLVB 5J57B 5I1DA 1KJ2L 3GHBH 3OBAA 2VLLB 4RBPH 4RISL 3OKMB 5H94B 3LN5A 2GI7A 1YEHH 2GK0B 4B5EA 4CGTA 5HHPB 3UJIH 2CLZA 1S9YA 4LVNB 1D5XB 3QUMB 1GGBL 1ORQA 3MV8E 1HIMH 4U6VL 2AGJH 4ZTOH 4WW2F 4MXVE 2YRZA 4W4NA 3LOWA 3QNYB 3CFEA 4PLJD 1R3HA 4F57L 4LQFH 3VW3L 2OR9L 3GNMH 4CJ1A 3OHXB 5T1MA 5TF0A 2W1NA 2A0LD 4IRJB 5IVXB 3OAUL 1T83C 3PWLA 4D2NA 3QDMD 1A14H 1G6RH 4MMXC 1MREL 4ZTPL 1LE5A 2P42B 4UV7L 4ONFL 4C56D 5A3ID 1U2CA 1TJIL 4XMLL 4K55A 5CLWA 4LKCB 4R4NC 4HC1A 1QNZH 5J4MA 2CDEA 4RGOL 5IWLC 2VKXA 1WTGT 4BFGA 1OTSC 3ULSB 1EJ6A 2RCSH 3V4UH 5CMAB 3NFSL 1CIDA 1G7JA 5TE4H 4LSTL 2AJUH 1V8HA 2DL9A 3UP1A 2BDNH 2E7BA 4I5BB 1SEQH 5F6IB 3MRDB 3HN3A 4I48B 4P3DA 2FCBA 5I6XB 3G6JF 3QFJD 3ZE0E 1SY6H 4WV1C 3MLUH 1MQKL 2VLRB 4FQ2H 3S37H 5K9JL 1VEOA 1JRHI 3GRWL 4JHBA 4HUVA 1MRFL 1T7VA 3EO0A 4FNLL 2KUTA 3FO9B 2C4FU 4U1HB 3SDCB 4GXVH 2Z35B 3CMGA 3HZKB 1T80A 2DBJA 3O6FD 1L0QA 2EC9U 3QUXA 1LO2L 4HIIB 2FIKB 4X4ZA 1DZBA 1KOAA 1QLEH 5DEFB 3MO1A 1BQLL 1GXEA 5IR1B 1E4XL 5CBAA 3C8HA 2BVOB 2ERJB 3OR7B 3VXSD 2Y5TB 4OCRH 1CR9L 6FABH 1S9VA 4LCWA 1RZGB 5AEAA 1MAML 1CD1A 3MLWL 3WN5C 1RJLB 1LO5B 1P2CB 3JWDH 4NT6A 5DD5H 4Q9CA 4OLEA 3WYRA 1S78C 2FZ3A 3QIBB 3QNXA 4P2CG 1FP5A 2NY3C 5DD6B 2FHBA 2EYSB 1MHPL 1C8PA 4KAQH 5HPOA 3F7RA 4APQD 5DUPH 3M17B 4X6CB 4NJAL 3UJTL 1Y6KR 5GSRA 1CGYA 3OGCB 3L3KB 4LLMA 4DVRL 1HE7A 4Z7WB 1SBSL 4L3EB 4IOIB 2Z8VC 1QR4A 3Q6FB 4Q6IC 3V52L 3MFGB 3FMGL 3MRPB 3MRNB 2HFGL 4RZCA 4YX2H 2DS4A 5DQ9B 3ROLA 3TO2B 2YN3A 1O5DT 4PRHE 3NIDE 2ADIA 2V2WB 4U1MB 5JW4N 3TIEB 1J1XL 1K2DA 1J0JA 1I3RA 2A6DA 3D87B 4MX7B 4UT6H 1H0DB 3D3VD 1LK3H 12E8H 1HCFX 1UWEH 4KMTL 3TYFA 4LBEA 1NFIA 3QXAA 1A7PH 5ID0B 3WUWB 4HWZA 4Z7VF 3BKJH 5CEYB 3TH3T 4RMQA 1IGTA 2H41A 5E0QA 5FXCH 3F8UB 3V0WL 2VXQH 4FQLH 1OTTD 2WBJB 4U6YB 5ITFB 4AQOA 3UZQA 1CN4A 1M4KA 2H2PC 4KZDL 5JOPE 5JXEC 1Q0YH 4ZFGH 1TZHB 1LP9F 4MD5A 2Q7YA 1FNGA 4UAOB 4KVNL 2OTUA 2R9HC 1JP5A 2E7CA 5L2KD 3LPWA 4M00A 3DX6B 4R4ND 1NBZA 1YEKL 4KI5F 3R4DA 4DCQB 3H9SB 1A7BA 5KVDL 3K81A 2P5WB 4HWBH 5A16B 4RX4A 1OTSD 3M8OH 1HINL 2X9XA 1IKNA 2Z8RA 1HXMB 3QZWG 4U1GC 4LSUH 1A5FH 3BH8A 4KROB 3MROA 3L5XH 2GTWB 5IROC 2IPTL 2HVJB 4LEOA 1N0LA 1OTUC 5JPMB 1WZLA 1S5IL 3ARFC 1ODAA 5IW3A 5IV2B 5EC2B 4P57A 1T2QH 4X9HA 4G7VH 2EIZA 5HYSB 4MNGA 4D3CL 4ZUVB 3TYGL 4TSBH 3P3YA 3U9UB 2DLFL 1X4YA 4YDIH 5IVZA 4FFWC 1CWVA 1TVHA 2PETA 5AZEL 1E4XI 32C2B 3GBML 5FO7A 5JOFA 3IDUA 5GRVK 4ZFFB 3OKMA 1H3WM 5H94A 2XTJC 1RMFL 2NZ9C 3PWNB 1HZHL 5HHPA 4NKDB 4JM2B 1KCRL 2FR4A 4D9QD 2VZVA 3QCTH 1SVZA 3G04A 5C07E 3S5LG 3KYMB 3CFJA 4PJAE 4G42B 4F7TB 1MFCL 2VNCA 3T65A 3E3QE 1WC7B 3MYZA 4FS0A 2XFXA 3QUZD 3QUYD 1RIVH 4L4TD 3O6ML 5D7KD 3ARDB 2DQJH 4YQXL 4YDLC 1T6WA 3LN4A 3JV0A 1S78D 1CFVL 5JW4M 4KTDH 5AYQA 3MRIB 35C8L 3C6LA 4XB8A 4KRPB 2HN7B 4UDTB 2X4PB 3TZVC 3WEXB 1RZKL 4LKCA 1GHFH 1S8DB 2K7QA 1LEIA 5DJZB 2GITB 3CH1B 2B5IB 1OB1A 2YA2A 3O3UN 4Y4FD 4JRXE 3RZCC 3NACH 1BLNB 2PTTA 4G9DB 4J3SA 4HLZH 4HZLB 5CMAA 2YA1A 4HJJL 4P9ML 3T3ME 4XCYB 4I8DA 3ZDYE 1DQMH 5HVGB 3DX7B 5F3HB 4MNHA 2XZAL 5LGHH 1BQSA 1ZGLB 2AKRA 4JG0L 1RUPL 3MRDA 4QNPF 2FEEL 5EB9A 3U7YL 2B2XH 4LNVA 3QIUC 3WSQL 4I48A 2BMKA 4FOMA 4P4KA 5E08H 2VLRA 1BQHA 3REVB 5I8OH 4PJXA 1I4FB 4LEXL 3OAYH 3HG1A 2P43B 3D85D 3SDCA 3ARGB 1SJEA 4QHKI 5EZLB 1RUMH 2J5LC 1WT5A 2YBRB 1NAMB 4HIIA 4KHXH 1QO3A 2H2PD 3LS5H 5IHZA 2EKJA 5ALBL 3MMEB 2EDYA 5DEFA 4WEUD 1KCUH 3VDAA 1IM9B 1ORSA 1EGJL 3IAQA 4NCDA 2R9HD 5IJKC 2EEBA 2H2SD 2Y5TA 3L9RA 4KGLA 2IG2L 2DQHL 1IC4H 2VDLH 1M05B 3FQUA 3ZE2E 3HRPA 4Y5XC 2UUDH 4ELMA 3RIAK 5AUMB 5E7FA 3SKMB 5CJOH 3HI1A 1ZHNB 1RJLA 5KVFL 3AUVA 5IEHB 5DFTA 1P2CA 5F3BB 4U1NB 5I75B 4FRWA 2ENSA 2WM0A 2VLMD 3UC0L 3O11B 2EDQA 4UT9H 1SJHB 3CDGB 3MV7B 1ZS8A 4YDJB 4PRAB 5IBUG 1J1PL 4DTGH 4IJ3C 3M17A 4L8CB 1X5YA 4PREB 2R1YB 1CLYH 2I5YL 4R0LA 1O7VA 2IGFL 2VJXA 2DLIA 4YHNB 2XKUA 2R4RH 4L3EA 1JYWA 3SDDC 5AAWA 3KPSB 4IOIA 1FV1A 3QPXL 4NO2B 5INCA 3MRFB 2ESVE 2R0KL 4WW1A 5GXBB 2PTUA 4Z7QE 5DQ9A 5D1ZD 3V4PH 3GMPB 1CI5A 1JHKH 5B4MC 4U1MA 4PJ8C 4MX7A 1TJGH 3QNZA 1HYSD 5F21B 5IBLC 5DMKB 5F1IB 3VRIA 4JCMA 1UJ3C 5IJVB 2NZ9D 2XG5A 3F12A 1U95B 3D0LB 3OJVC 2UVFA 5L9DH 2OI9B 3VE0B 5ID0A 3GIVA 2DB8A 3QDJD 3WUWA 1KJ3H 5B38A 3ARSA 1WAAE 2AJYL 4O5LL 5HI4D 2A6KB 1JPGB 2WBJA 4Y2DB 5FCUH 2ZZUT 1JE6A 2APTA 4RMUA 3E6FA 3ZYJA 1AQDA 1K8IA 2HJKB 5DVMA 5LJYH 1G7HA 4MA1B 3VFUB 1TZHA 4GKOA 1DEEA 3O4LB 5EZIL 4HW6A 4ZOAA 4LVEA 4ZPVB 2AJXL 2X4OB 2Y25A 3L3OB 4JPWL 4MHHG 4HMEA 4PJ9A 2P4AB 3TZVD 3VG9B 5M7QA 4WRLA 4NUJA 1QSFA 1NEZA 4CN1A 4J1UA 1BJ1H 3U4BH 2XKNB 3H9SA 3U36B 1A6TB 5GGRB 5A16A 2X6MA 3O45B 2FEEI 2VXTL 4ETQA 3MRCA 5TPWL 4NZRH 3UAJC 3H42L 1ZV5A 4NQCB 5GRWA 1DBKL 1I9RH 3DUHA 4KRLB 1S7XA 1U8IA 4C4KT 2GTWA 4OFVA 4WW2B 1RZJH 4ZD3L 2X1WL 2HVJA 1JNNL 5IB1B 1Q72H 4NRYA 5GSVA 5JZ7D 1NKRA 4J3VA 5C0DA 2BVYA 1QG3A 3QIUD 5J11B 2ZUYA 1BOYA 2F19H 4KUCF 5JIPA 5DA4A 3W39B 3IS1X 1CXHA 2BNRE 5HYSA 1KELH 4ZUVA 5B3NA 4XCCH 1BF2A 3U9UA 4WDIA 4XXDB 3QDGE 3RL2A 1KC5H 1U8NB 1CZ8L 3EYSL 1ZMYA 32C2A 2NX5E 2X70A 5DS8B 3L5IA 1UM5H 3FQTB 4PJGB 2E27H 4UU9B 1MI5E 5HYJD 4GS7C 4R96B 4K8RD 3LQZB 1JNLH 4JM2A 4JFQB 2NR6D 4J2XA 1IT9H 3DECA 4PR5B 2F74A 4P2YA 5EUKA 1JF5A 5D9SB 5ILTL 3PF2A 3QHFH 4NQDB 3G5YB 4JPIB 1B0GA 4QRQB 3NN8B 5C3TA 2BNQE 3SGKA 5EIQA 3SKNA 5JQHC 3G6JB 2OS7A 1BOGA 2JJTC 4JQIL 3UTQB 4PJIB 2Y06L 2NY2B 3GSWA 5ECJE 3SJVE 5D6CA 2DIAA 5LQBH 4LLYB 5DJZA 4ZFZA 5I19L 1L7TL 3CH1A 1IGYB 5C0BB 1OM3L 2QKIB 1EZVY 1LK2B 2D2OA 4L8SA 3UTSB 4X80L 3AREB 5A2JH 2LQRA 4AZ8A 4JFFD 1F4AA 2GTZB 3S36X 3VWJC 3MLVH 4DW2H 1CK0L 1MOEA 3D9AH 3GI9L 4PJBF 5C92A 2VWEC 5FYLD 5C7XH 3K1KC 4S1QH 3L3DB 1BP3B 2H1PH 3KNBA 2V17H 8FABA 3REVA 5BZWA 1IQWH 2CKBH 3HPLB 3T77A 1KBGL 4KHTL 5IFHL 1I4FA 4MD0B 4P2RD 1FIGH 3UTTD 1JIBA 1FFQA 4K8RL 3ARGA 1MIEL 4TRPL 1KN2L 4M03A 2F5BL 2GUOA 4GW4B 2IWGA 4XPTH 4J6RH 1RUQH 1NAMA 1NMCC 2ENYA 3DRQB 1GGYA 3U0WH 1IGIL 1S7WA 4L5FH 1RZFL 2P8PA 3UEZA 1ZA6A 1P9MC 4ZMAT 1MJ8H 1KG0A 1A7QH 2J8OA 1OCWL 4PGZA 1KN4L 3NCYS 2VZTA 1WBXA 4G6AC 1FNSH 5T3ZD 1IGCL 4NHCL 4Z8FH 2BK8A 4YWGL 4NKOB 2BFVH 2RJMA 1I85A 3BVNB 2E7LC 3MA7B 3NCFB 5HYFA 3GSOB 3MUJA 4JFHD 2XQBH 3O11A 5LG1A 3UAJD 1YN6A 4MDIA 4DOHE 1SJHA 2PYED 1CDUA 3C09B 2VN7A 3VXTA 4P5TC 2JK5B 2GY5A 3C8DA 4YDJA 5DLML 1JZ6A 4Z7VB 2ZJSL 1NC4A 3FONB 3KR3H 1FFPA 5GGQL 1UGNA 3HS0B 4DQOL 4XWGL 4U7MA 3BEWB 2VXVL 1LP9B 1QRND 1CF8L 4PUBH 3UJJH 2JKXA 5FYLL 1KTKE 3KPSA 4OSUL 3P77A 1K4CA 4M93B 1KCSH 3FAXA 4LPTA 4ODWA 5TQ0L 4MNQB 3WUWG 1KIQB 1G7PA 3GMPA 1WZKA 4PB0L 1XCQB 3LD8C 1HHGB 4P5MA 1VDGA 3U9PL 3PABA 5DMKA 1JHLH 5F1IA 1GZPB 4LIQH 5DJ6A 5KVEL 1TNNA 5IJVA 3D0LA 1G7MB 4HCRA 1FZMA 4Y4HA 5JHDB 3I3BA 2A6KA 5D5ME 1MCPH 1JGLH 4LAJH 4DKAA 5DRWB 4WUKH 5F96L 5JDSA 5LGJB 1Y18B 3OZ9L 5J9PB 4DAGH 1CLCA 5FYKU 1GAFH 3RZWA 2VC2H 1L9NA 5D6DC 2IJ0C 2X4OA 5T3ZL 3WDJA 4D0BA 4ZQKA 1I7TB 1K85A 1R6VA 5CSZA 3WNNA 3L95B 3SHSA 4I9WE 3BPOB 3NMEA 1CFNB 3TVMB 5TE6L 1WFOA 3HNTL 1MCKA 2V7HA 1A6TA 1AJ7L 3EO1A 5MENB 3OJ2C 4G6JH 5BCAA 1Q9OA 1D7FA 3DROB 5DRNB 1KXTB 2G60H 5KJRL 1IEBB 4NQCA 1G6RB 3UYOD 1I1AB 5HTSA 4PJHB 5HYSG 3SPVB 3OMZA 3DPBA 3FFCA 1J0ZA 2AABL 4WW2A 4RQQB 4HK0B 4YBLB 1QA9A 1KEMH 1F5WA 3RQ3A 4NQEB 3T0DA 1AHWC 4GG6F 4OLWL 1UXSB 2B7DT 1PAMA 2EDLA 2V9TA 3T1FB 4IOFD 5FGCE 2YD4A 3W39A 3PIQB 1A6WL 4NZUH 2RB8A 4CVXB 3IVKA 1Q1JH 5SV4A 4NQSA 5ADOH 4XXDA 1MHCB 4G7YH 4D9RD 1BFSA 1IZJA 3QHTC 3ARBA 1FZJB 1N5YL 3RX8A 3WHXA 2NY0B 1JPTL 4NC1E 3MGTB 1T4KB 1PG7H 2IFFH 1I9JL 1EERB 4EBQL 1A4KA 3L3IA 3Q3GB 4XWOC 4HPOL 4UU9A 2YC1A 3FN9A 4Z77B 4R96A 4X5WB 4AMKL 2ZOLB 4K9EH 4JFZH 4B41A 4ZOCA 2J6EH 1PGRB 1QLRA 2PR4H 3QG6A 4XB7A 4QEGA 5FDWA 4PYGA 3HC3H 1MQ8A 3AGVA 4GAYB 4KJPD 4G6AD 1YEDB 1P6FA 1CXEA 1NC2B 3WD5H 3NN8A 4XNZC 3G6JA 3O8XA 5C0CA 3MCKA 1YEGH 2N4IA 4OZ4B 2L7UA 4N0RA 5TGBA 1NGYB 5BJTB 1KJ2H 4RISH 3QFDA 1OGAB 2XTLA 4U6TA 2DLHA 3BH9B 1XGUB 4HHAB 1IGYA 4RRPA 2QSTA 1K4DB 2IALB 5BVPH 3UTSA 3IT8D 4U6VH 2GTZA 4PJEB 2AW2A 3PGCB 1KYOJ 3DXAB 3IU3B 4WUUD 1QSEA 4GKNA 3O2DA 4XP1L 4F57H 3VW3H 2E3VA 1BJMA 1XEDA 4JAMB 4HSQA 4KU1A 1KXQE 3C9NB 3E8UL 3R0MA 2GSGB 2CUIA 1JWUA 3L5JA 3OAUH 2FD6L 5ID1B 1MREH 2WK2A 2APBA 4ONFH 2H26B 1TJIH 3HI5L 4JVPA 3BO8B 4RGOH 2X1QA 3RDTD 3S96A 2NY7L 5FM8A 1N0XL 5GRYA 3FT4B 3RPKA 3MRKB 4JPKL 4UNTA 3NFSH 3WIHL 4OLYL 3DRQA 2MFNA 4ZFOB 1U8QB 3PQYA 1NDMA 5D2LF 3MV8D 2VR5A 3BEVB 2L7JA 3DBXB 3IFLL 4FQXD 2WW8A 1JZ5A 1E27A 5KOMC 3QSKB 3ZL4L 1RJYB 4JN1H 5E6IB 1HSAB 3H7LA 4LGRB 1FVCB 4QTHA 3BVNA 2XWTB 3WFBL 2NY4C 5K9JH 1FQ9C 3MA7A 1KLUB 3GRWH 4YFLF 5HY9B 1IVLA 4Y16C 2DIBA 1ZLSL 2FJHA 1XF2A 1MRFH 1E4JA 1IAKA 1XIWA 2JK5A 3MBEA 3CX5J 4NN7B 4WENB 5I74C 4JKWA 5F7DB 5HD8D 4AL8L 4Z7VA 4V1DE 3BP5B 1C08A 4JGMA 1L0XA 4YPGB 2BOBA 5EO9B 1VEPA 4JVUA 3C5JB 1SJVA 3CUPB 5D7JC 5A1AA 1BQLH 3VCLB 2V6HA 4ZNEA 4IRSC 1LP9A 4HGMA 1E4XH 3VXQA 1RZIB 1CR9H 5EBMB 1MAMH 4JQXC 5CEXB 3FN3A 1KIQA 3FRUA 1V7NH 1S5HA 1C12A 3UX9B 4U31A 5I0ZA 3KGRA 3X11A 3CLFL 4G9FE 1BMGA 1GZPA 2YPKB 4P2QA 3PG2A 4EN3B 4DKEH 4XWOD 3OKLB 2H6PA 1I7RB 3CFBA 3T0EE 4Z7NF 5LBSL 1MHPH 1CTNA 1XGRB 3DIFB 1Y0LB 4PRPB 5JIKA 4H8WL 2FGWL 2IPUG 3ARVA 3CFDB 4NJAH 3UJTH 5JHDA 5D7LB 1XFPA 3WFZA 1E6OL 4U3CA 5E4EB 3TA3D 1MJ7L 5DRWA 2IADA 1SBSH 5FHAL 1RSFA 4CMMB 5JR1L 1LO4L 4PRBB 2NW3A 5K9OA 3GIZH 4LVOB 3VXUA 1N3NB 5DFWH 3CFCL 4X8JA 1TCRA 3NCEB 2IFGA 3K7UA 4U1IB 2HFGH 4N90E 4NO3B 3BQUC 3TIDB 1J1XH 1IEAA 4QRSA 4NN6C 5DJ0B 1H3TA 3OV6A 1ZHKA 4FQ1L 3TVMA 4KMTH 3SQOH 2ZCHL 2EEDA 4M4RA 3CGTA 3DROA 5JXAL 1A22B 3LQAC 4QRPA 4IIQB 3QWRD 4N0YL 3STLB 4U1SB 1TTGA 4C4KO 1WLHA 4GFTB 5GGUB 5SWQA 3V0WH 5T33L 5SX5H 1I7ZB 3B5TA 4I0PC 5ALCH 1H9VA 2HKFH 4NQEA 1QRKA 2LVEA 5DVNA 5I8CA 4FXKB 4KZDH 1UXSA 2VABB 2EDOA 4FG6C 3LAFA 4PB9L 4XMKL 3PIQA 4I3GA 4KVNH 4N8VA 2FBJL 3W0WE 4X6DE 3B9KC 4LPXA 4MA8L 3KLAB 4JO4L 1KB5L 3CSPA 4PTTA 4BZ1L 4PRHD 1YEKH 3MACL 1U8LB 4OJFL 4XP9L 1MVUA 1QTYT 3TN0B 3KYOA 3I85A 1BEYH 3FT3B 4YIQA 3AB0B 1HINH 4AH2A 3P9WB 4BH7B 3I9GH 2WQRA 5HHOE 4Y5YC 4X5WA 2IBGA 1MCCA 4YGAB 2R69H 1ZLUH 5FM4A 2IPTH 3QWQB 2HTLC 1KT2B 2ED8A 2A2QT 4O00A 5GS1B 1XGPB 4FQQB 1IEHA 3TNMB 4YAQB 2PXYB 5JOPD 1J8HB 3FB6A 4D3CH 3T09A 1WGOA 5E00B 1AO7B 2A6IB 2DLFH 1C7TA 1J9CT 1NANI 3JWOH 1EUTA 4ODTH 4XP4L 3VD4A 5AZEH 3GBMH 1NGYA 1OGAA 1H8SA 2FL5B 3BZDA 3D39B 3L3JA 1ONQB 1XGUA 2EIEA 5D7IE 2D9QB 1HZHH 4NM8L 2O5ZL 1K4DA 5AAMA 3FT2B 4JKPL 5IG7B 1RUAH 4Q6IA 5FYJH 2JB6B 43CAA 2IALA 2VQTA 1IJ9A 1A9EB 1T5WB 5HGAB 2XXCB 4ZO9A 5DRXB 2UYLB 3VFOB 5L88L 3DXAA 2MTPA 1JTTA 1MFCH 2AJ3B 3CCHB 4QHNB 4OFYD 3C87A 2JCCE 5BO1L 5CCKL 4JAMA 3C9NA 5SWSB 4K7PL 1JPFA 3ZZ1A 3CC5A 5CFHA 4ZODA 3SO3C 1YYLL 1V7MH 2F9BT 3DX9B 35C8H 5F1OB 3IFNL 1W72L 1YJDC 1YNKL 2H26A 3SGEH 1SMOA 3X17A 4M8VA 1RZKH 2FHCA 3IJYA 5T5FH 1D6VL 1P84K 5E2WH 5I1EL 1L7IL 1MCOL 1OSPL 1CDIA 4I2XB 4PJ5A 5JXEA 1CDJA 4H1LG 4HJJH 4P9MH 4Z7UB 1MCFA 1BAFH 2NNAB 5C07D 3DBXA 4YBHA 3X14B 2VDML 5KSBF 5EIVA 1RJYA 2Z93A 5E6IA 3VWKB 3U7YH 2D0HA 5EOCL 3JWNC 3WSQH 4PFEA 2MNUA 3MRRB 1QBBA 2XWTA 4PP2B 5HY9A 1X5JA 1ZHBB 3FQXB 1DUYB 2D7MA 4MXWH 1KTRL 4LEXH 2YUZA 4BELD 4DKFL 2W0PA 3ARFA 4PGCB 4WJ5A 3BP5A 1FIEA 4YHZL 4JRXD 4BK4A 1PDKA 4YPGA 4KMQA 2O61A 5EO9A 4HWBA 5ALBH 5SX4H 2IMNA 3B8YA 3CUPA 3GKWL 4YEFA 3VGBA 4PRNB 3V6ZB 4MB4A 4LFHD 2ZUSA 3ARPA 3J7HA 5F9JA 5BS0B 3K74B 2IG2H 2DQHH 4EDXB 1NGZB 5C08B 4P2OB 5EBMA 2W9LA 2PW2B 2HYMA 4POZC 2RR3A 4ZUSB 5MEOB 5I1GH 3LN9A 3SDXB 3AXLB 4RGNE 2CIKA 2YPKA 5DVLA 4EN3A 3MCG1 5EZOL 1V5JA 3AVEA 1XGRA 3DIFA 4KTEL 3VXOA 3OKYA 3D18A 1J1PH 1N4XL 3CFDA 2GHWB 3SCMB 3VI3E 5D7LA 3GSVB 3G5VB 5I1CH 2IGFH 2NW2B 2WINB 3LKRA 1XR8A 4GRMB 4CMMA 2CJUL 3W9EB 4PRBA 5FDYA 1M6OB 1N3NA 5HI5C 1HDMB 1LEGA 2VDRH 3QPXH 4KJWC 4EI6B 2R0KH 3NIGF 4EIGB 4MAUH 1PZ5B 3TIDA 2XV6B 1FE8L 3RZCA 4V2BA 1IGFH 3LEXA 2YZ8A 2KDGA 4XHJC 4G8GB 3ZO0A 5DT1L 3LPFA 3W5NA 3QA3B 5BRZB 3LZFL 3SGDH 1F6AB 4JHAL 4IIQA 5LVEA 1E4WH 1YC7A 4U1SA 1GOHA 4RFNC 3FL7A 2IAMB 4TUJB 5GGUA 2OK0L 3QEGL 2XIDA 2PYFB 4B50A 3PWPB 1N6UA 4QRTA 3TLRA 2D0GA 3LMJH 2GT9B 5EZIH 4LCWE 4XP5L 4YHLL 3L1OH 2AJXH 1HQRB 3MV9D 4JPWH 2ESVD 1BWMA 2VLJB 3DYMA 3MBXH 3X13A 1FJ1B 3EOBB 2P7TA 3IKCB 4ZDHA 3T3PE 1FYTB 3FT3A 4WWID 1ZT1B 5TPWH 3HMXH 4XPFL 5FIEA 1KNOB 3H42H 1J8KA 5JLZA 2BERA 1DBKH 5IJKA 4W4OC 5CJ8A 1F4HA 2IH1B 3MZGB 3TCLB 2CKBB 3EOTH 4ZD3H 2IPKB 1JNNH 2X4UB 3T2OA 1KT2A 4F9LC 3TFKD 4PJBA 1CE6B 2PO6C 3VXMA 4M7LL 4TULL 1XGPA 3BAEL 4FQQA 4JEGB 3NPSB 3BD3A 3PWVB 1L6ZA 4YAQA 3LKQB 4AM0B 1AO7A 1DLHB 1AD9B 3BWUC 1QUNA 3NIFE 4K3DL 2G9HA 1X5AA 5C09D 1CZ8H 2XG4A 3EYSH 4PJCF 2IBZX 3OF6D 3OKDB 4P3CH 5AYUL 3JBG7 3ZDXF 3P0GB 4HF5L 1TZIA 1MAKA 4JGUA 4C58B 1RAMA 2AK4B 4JN2A 5FFLA 1UVQA 2EYRB 4YC2C 4DZ8A 3D48R 1QLFB 3SDDA 5KZCB 4S10A 3FT2A 5CBEB 1OP3H 5E9DA 1RUKH 1T5WA 5D2LB 1WISA 1UZ8A 1YPZF 2UYLA 3QDAA 4PJ8A 1NPUA 3ESVF 1VADB 4EI5B 2Q76B 4KKAC 5EU4B 4LCYA 3KPRB 3R8QA 5ILTH 3CCHA 4POZD 4QHNA 2Q7NA 4JO1L 4M1CC 2CGRL 4YHML 1RK0B 3GM0A 5SWSA 1YJDL 5KS9F 3VXRB 4JQIH 1FZKB 5GRZA 4P0DA 3HUJB 4OGAD 2UV3A 5GGSB 3A6BL 1PZUB 1M7DB 3HC4H 1NGWA 3FQNA 1BD2D 1EHLL 2VH5L 4LHUB 4Z0BL 2DYPA 4BFIA 2VDOL 1EK3A 2BRRH 2NX5D 1L7TH 4XVJL 1WWWX 4E0RB 5DJ8B 5DTFA 3L7FA 1YA5A 2C3VA 1OM3H 5DI8B 1VKXB 3KS0J 1TVDA 3PHQA 3S35H 1F13A 3IJHB 5HI5D 2VSCA 1UCBL 4KJWD 5D1XC 2CMRL 2XQYK 3BIKA 2ZG1A 5IBTL 3GI9H 3X12A 4FHBD 5ICYA 1NKOA 2GJ6A 1J05A 3CFKA 4KK6D 1OW0C 2NQCA 4JDTL 4MNGE 1P69B 4NO0A 3NOIA 1N6QL 4O58L 4OV5A 2Z92B 5J1AB 2BNQD 2BSRB 2F8OA 5D7SL 5EWIH 1TZGL 1CLOL 4PP2A 3REWB 4M6MH 2R1XB 4HJ0C 3BPCB 1KBGH 1TVBA 1DUYA 1MJJA 5IFHH 5IFAL 1MCWM 2DJSA 4K8RH 5ADPH 1MIEH 3BMVA 4TRPH 4CN6A 2NY5C 1KN2H 4L4VB 2F5BH 3OXSB 4FQJL 4W81A 3MLPA 1CG9B 4JZOB 4L29A 1JZ2A 1U91B 4KKCC 4X7SL 3NAAH 1IGIH 3BHBB 3HE6C 1Q9WB 5EU7E 4NBZB 1EEZB 4PRNA 2PW1B 4WI5A 1OCWH 4LAQL 3HPJB 3MREA 4NRZA 4P2OA 1SEBA 1NGXB 1IGCH 4OTXH 2MKLC 2PW2A 5IB3A 3ARQA 1EX0A 1GVIA 1KXVC 4JDVB 4ZS6C 4Y4KB 3UBXA 3VFTB 3AXLA 2NY6C 4WCYL 3WFCL 1INQB 4HS3A 3P73B 1KEGL 4OV6F 3I6GB 2B0SL 2RBLA 1YECL 4NSKA 3WFEL 5DLMH 2ZJSH 4YHKL 4LGSB 4MA7L 3B3IA 3L7EB 4KTYA 5GGQH 5HYEA 1JWMB 2OXGA 3GMMB 3GSVA 4DQOH 3G5VA 4NC1C 2CKNA 4Y5VB 4XWGH 2BJML 4MJIA 2LAAA 3NCCB 2KKQA 3CSGA 4GG6A 2JJTA 1HHHA 2X1PA 4PGEB 5J3HD 1S9KC 5HDQL 3C6SA 1M6OA 1CF8H 2NY1C 1DBJL 1HDMA 5FYLH 4HXBL 5IOPA 1RD6A 3RTQC 4OSUH 2FJFB 1XZ0A 2FLRT 2P8LA 4PB0H 1VHPA 4UDUB 5TDPB 2VLRE 3U6RB 5J56B 4PJXE 1MCHA 1Z3GH 4O2CA 4OB5L 4UBDD 4G8GA 3ZKNC 5E8PB 3QA3A 5BRZA 1T6VN 2NXYB 4LSSL 3HG1E 2OYPA 3Q5YA 4EIZC 3NCMA 4HLZG 1H5BC 2NLJB 5DHVA 2IAMA 3DURB 2FJGB 2ZUQC 4KKAD 5E7BA 3CSBA 1KJ2B 3DMMB 1M7XA 1X5LA 2RQ8A 4JPVH 5KN5B 4HIXL 3V0VB 1DE4B 2JIXB 2GT9A 4A2LA 5EOQH 3RWGB 4ELME 1QSVA 2OCFD 2CDFA 4X6BB 4WWKB 4XVSH 1UJTA 4M02A 5EFIB 3EOBA 3IKCA 5F9OL 5TE6H 1IFHL 3P2TA 3HNTH 5GIRA 3SDAB 1AJ7H 4Y0GA 4JHZA 1YNTB 3WMSA 2VQ1B 1ZT1A 1A1MA 2NYYD 5KJRH 4OF3A 4YDVB 1AGBA 3HRZB 3HKFA 5DVKA 4GRWH 2OJEB 4JG1L 5L0QB 2MMXA 1UXWB 3VH8B 1XGTA 2AABH 3IDJB 5EU5B 2CKBA 4LSVH 2IPKA 3MUY1 4OIAA 2DQGL 2I9LB 3I50L 4L3EE 3V5HA 4OLWH 2E7LA 3SOBL 2Z31D 1A6WH 1PKQB 1MCSA 5DJ2B 5E5UB 4P5TA 1DLFL 4H5SA 1AD9A 2DICA 1MPAH 4YK4C 5K9QI 2QBWA 3GMLB 4PBWD 2N7BA 4LCCC 4I9WD 4H20H 1P4IL 2KH2B 3DO3A 1I9JH 4EBQH 2J12B 1LMKA 4IM8A 3ALPA 4LNRB 4ZUWB 2BCKB 3LRSB 3BZEB 4AMKH 5IB4B 4ZO6A 3HE6D 4HS6B 4IDLA 4NQVB 1DBMH 3L5HA 5F89B 1G0XA 1VADA 4EI5A 5EC1B 3NCJH 3MOAL 4B0MM 3V7AG 4Y1AA 5DQDL 4ZS6D 1OSZB 1N7ML 2NY6D 5DK0B 1G9NL 1S7SB 5C2BH 2GCYA 1QSFE 1FL6B 4JB9L 3FRPA 5TH2B 2RIKA 1HEZA 3MLRH 3H9SE 1M7DA 4O2EB 4YXLH 3UTPE 4S11A 2AERT 2Q8AL 1EA9C 4YJZL 2FGZA 4JO2L 1F3RB 4QHLB 4M48L 5DI8A 4R4BB 4C56B 1VKXA 1MCEA 4LRNL 1B9ZA 4D0CB 2NY1D 3IJHA 3NFPB 1IQDB 4QLRA 5L8LB 4F37F 1AGCB 2BY2A 4G6FB 1N26A 3U7WL 3KPPA 4MLIA 4XP1H 2XPGB 5CAYB 1FG9C 3GMOA 4U0RC 3E8UH 3HAEA 3CD4A 3RWCB 1GC1C 3CVIL 4PPTA 2FD6H 2Z92A 3GKZA 4LHJB 1N2RB 5MI0B 4PD4K 5GS0D 2VYRE 3AC0A 2R1XA 3KJ6H 3BPCA 4Q58C 2ZKHL 1R3LA 4OLVL 1U41A 2NY5L 4M7JL 4G6MH 1AHWA 1I3GH 4TQEH 5CZXC 5GRVL 5HYQB 4OCNC 1AR1C 2NY7H 3GSXA 2C5DC 2R0ZH 2JLLA 4JPKH 5HGBB 1A0QL 3CU1A 3OXSA 5IQ7H 4RWYL 1T1WA 2F5AL 1II4E 4BQCA 3RVVD 5F7HA 1Q9WA 1PFCA 3STBA 2V5YA 4YFDB 4ZSOA 1OP9A 4R3SB 4PRDB 1KULA 1TQCB 3MUGB 4UTBL 3IFLH 3UPRA 3ZL4H 2AV1A 2AQ2A 4FABL 3EYVB 3HPJA 3N1GC 4YR6A 2DM3A 2O5YL 1T7WA 5FKAB 4Y4KA 5IMOB 2YPVL 3VFTA 3WFBH 4ZXBB 5CJXC 1INQA 3P73A 4JO3H 1RIUL 5L2JB 3I6GA 1ZLSH 4NFBA 4IBLT 1A6ZB 3IDNB 4J4PC 2R0WL 3EUUA 4OCWL 1JGVL 5I9QC 4XNUL 1T66D 1P4LB 2MOVA 5HHNB 4ALAL 4V2CB 1RZ7L 2EH7L 4PGEA 2KZ1B 2QQLL 1RV6X 3PNWB 5IESH 4X6EA 1B6UA 3JV4B 2HFFB 1YYML 2DAVA 1OVZA 2D0FA 5HDBF 4Z7OF 1BBJB 4GKZB 3LRHA 5T3XH 3DTXB 5HGGS 4CJ0A 3CLFH 2D7QA 5GS0L 3IDMB 1IGMH 3DARA 3B83A 4WFEE 4MVBC 5GQBA 5BV7C 3MNZA 1IAIL 1LQSR 1SQ2N 4H8WH 4S1RL 4EZMA 5HHQB 3DRTB 4X9IA 5FGRA 1T2JA 4V1DD 3IGAB 1IILE 4L1HA 2B1AL 1E6OH 1AGFA 3MJ9L 3VGEA 5IGXL 5JR1H 1LO4H 5CGMA 3H7BA 4FZEH 4R9HA 1DE4A 3WIIL 3DI3B 3OKNB 4F80A 3RWGA 3D0VB 2FECL 2FB4L 1B3JA 4XAWH 2H8PB 4WWKA 3ILPA 2NTFB 4PJCB 2CDGB 3QQ3A 5D1QC 4RMVA 4KV5E 1MFNA 2OP4H 3S3PA 3ZE1E 3SDAA 4G9FD 1JJUA 3AMKA 5F97E 4DGYL 5F1KC 5JXAH 5L2KB 3OXRA 4IHOA 4OFDA 3T0ED 3LB6D 5J89A 1MLBB 5CWSB 2EXYD 3MLTA 2OJEA 4PRIA 1YPZB 4OGZA 5T33H 5E5MB 1HH9B 2I9LA 3KPSE 4PV8A 4OFKA 2MWCA 5KSUA 4PB9H 4R2GC 1EDQA 5ISZA 5KS9B 2UY7A 4W6XB 3QJFA 4ISVA 3VRJA 1DBAH 4JO4H 4N90D 3EOAA 1LO3H 4NJ9L 4GQPH 1KB5H 5HVFB 4BZ1H 2ATKB 5IMKA 3P4LA 3I3DA 3RWDA 3I02B 4G43B 4IEFB 1CICB 1FC2D 5D7JA 3BGAA 3PHOA 4LNRA 4ZUWA 4IRSA 3ILQD 3LRSA 5IB2B 1ZK9A 1G7QB 4NQVA 1T5XA 1AP2B 1U8KA 2KL6A 1IBGL 4JQXA 3V6OA 5EZJA 1T1ZB 3KPMB 3VRLE 4DFIA 3U82B 4UIKL 5T1LA 1YY9C 1RURL 3OPZL 4L3CB 3EO9L 1FORL 3HE7D 4QXUL 2Q6WB 4PJFF 5KSBA 5E8DL 4LHUG 1ADQA 1MWAL 3KWWB 3PL6B 5FYKE 4O2FA 2X1OA 4U6HA 1OSZA 5CHNB 5DK0A 4YO0B 5J6GB 4YHYC 1EO8H 1AKJA 3W0WD 3WLBB 4XP4H 2X7LA 3QUZB 3QUYB 4L4TB 5C2UB 1NCCH 4Q7DA 1A4JB 3MRBB 5AG8A 4ERSH 4HKZB 4NQCE 4XPGL 5D96C 3VJ6A 4RGNC 3LDBB 1BZ9B 4NM8H 2IH3A 2HFTA 3K3QA 4QHLA 4WI8A 5F6HI 4R4BA 4JKPH 2ADFL 3CPLA 5HGDB 3FFCE 1P6AB 1KJVA 2JJUA 3VGAC 4D0CA 1UKSA 5HHOD 5EOTB 3GJEA 3NFPA 3BQUA 3QG7L 5I1AA 4K7FB 4RMSA 5ENWB 4Y4FB 3RIFF 1IAII 5JPNA 2XPGA 5BO1H 5CCKH 3MODL 4P4RB 2Q3AA 5I16B 4K7PH 1HNFA 5EU6A 5C0EB 1YYLH 4Y2OA 3P0VL 3DYPA 4UB0L 1N2RA 2I27N 1YNKH 1ND0B 4MVBD 5FA4A 2QHRL 1X4XA 3EDDA 1QBLL 5J6HB 1ITBB 4LRIA 1YEFL 5I1EH 1SHMA 1MCOH 3VDBA 4NZTL 5C0GB 4L4JA 3VD3A 5HGBA 5IKCB 3B9KA 4U1JA 3S7GA 2I07A 1U3JA 4R3SA 3S9DB 1QFOA 4PRDA 3V6BR 1JHTA 3GSQA 1D5IH 2VDMH 3QUXC 1LEKB 3EYVA 4OQTH 1DVFB 5FO8B 2J3SA 3RKDC 5EOCH 3G6JE 4NHUB 4GG8B 5D1QD 3EOYG 5FKAA 5C0CE 4FP8H 5IMOA 2VDNL 4X7TA 5GS3A 4ZXBA 2DKMA 3CMOL 4YXHL 2PTVA 1U8JB 4BQBA 5L2JA 1MIML 5KSAC 4JY6A 5DYOB 3MYJA 3IDNA 1TCMA 2AV7B 4YHZH 3UTSE 1XF3B 1DL7L 4X9GA 2G5BA 2W92A 5HHNA 1LDPL 4WEBL 1GOFA 1RFDH 5LXGL 3GKWH 3VFVA 1QSEE 3B2VL 3FQWB 1ZLWH 1QVOB 1IM3B 4WHYH 4NUGH 2HWZH 4XVUC 2X2YA 4MAYD 1FPTL 4BK5A 4NN5C 4PGJA 4ONHA 2ITDB 3V9FA 1JK8B 3UYPA 1NCDL 1OF2A 3TC9A 3UYRL 4MQTB 5BV7L 3GSNA 5IW1A 4OI7A 5EZOH 5C70A 1I3UA 5E6ZA 1YUHA 2YWZA 2MPAH 4K94L 5BZDB 5D1ZB 1G9MC 3Q1SH 4P23B 1D5ZA 2BOCB 5GZNC 3DRTA 1NMBL 3ECBA 4UINL 3MJ8B 1A1NB 3IGAA 3EBAA 4PP1C 1X4ZA 4EVNA 3DO7A 1A3QA 2C1PA 1NFKA 3PQYE 5DD0L 4MJ2A 4HUKB 5FYJU 2MCPH 3QDJB 3UDWC 4AYFA 3D0VA 3KG5A 3W9DA 2Y4SA 1GGCL 4G8EA 4HKBA 3AFLA 2H8PA 1MFDH 4E5XB 3HZMB 5HHME 1N8ZB 1CD0A 1NQBA 3O3BA 4PJCA 3VH8G 4NNPL 3WO4C 1JGEB 4GMSH 3V6FB 4EXKA 4RGND 5DT1H 1KTDB 1ROWA 1D5MB 4I4WB 1K3ZA 4RGMC 4Z7VE 5B3JF 3FO1B 5IIEA 5CWSA 3MX0A 1KCLA 1D9KC 3NZ8A 4LHQB 5MP6L 1YPZA 5E5MA 3T2PA 3QEGH 1W8NA 1IKNC 4U3XA 2MHAA 4ZNEE 1LP9E 1JZ8A 1LNUA 5JMOC 3TESA 2XWJB 1R5WA 4XP5H 4YHLH 4X9FA 3RJDA 5IHLB 5KS9A 1J0YA 4M8QB 2EKSB 4KI5E 4WHTA 3GMRB 3ULUH 5DDHB 4XNYL 1MRCL 4W70A 3DV6A 5F1SA 3HR5A 3OB0H 1CICA 2AK1L 4UUJB 2HT2C 2QADC 1JYNA 5JHDE 3EYFB 5IB2A 1G7QA 4JKMA 1P1ZB 3PP3H 2RGSA 4QWWC 4O9HH 4F9PC 1AP2A 3LKPA 5ACZB 3HMWL 1F4WL 1ZAGA 3KPMA 3QUXD 1WFNA 2VIRA 1ACZA 3VXUE 4GKSB 4M7LH 4LVNC 2HT3D 4OZHF 2Q6WA 5B22A 3VGDA 5HYJB 3Q6GH 4H25A 4WI3A 3LEVH 2X4RA 2BNRA 3PL6A 3F7YB 1DQJB 4LCWD 4XNMB 3QDGA 5J6GA 1FGNH 4KUZL 4XMPL 1V3LA 3WLBA 5AWNL 1NGQL 2FWOB 1G1CA 2LTQC 4Y5XB 4ZAKB 3QUZA 4IS6B 4HF5H 4IRJC 4Z76A 4LCUB 4PJDB 3FCTA 4HC1L 1FNHA 5D72L 3ULVH 4HKZA 4ZYKB 1MCDA 4XH2A 5DQJB 5HGDA 3ZYIA 1OPGL 3WKMH 3MRLB 5EOTA 2JF1A 3TCXA 4NQEE 4LCIL 5FO9B 4K7FA 4XVUD 3MRQB 4ZUTB 2W0FA 4TUOB 4JO1H 4EJ1C 5KW9H 1S7TB 4JZJB 2EZ0C 1NCNA 1YJDH 4WI6A 1FNEB 1MHHB 2NTSP 5F6IC 3SJVA 1YEJL 3A6BH 1YEIH 2J88L 4ELKB 5H35A 3VMOA 1EHLH 1QFHA 2VH5H 4X5LA 5I6XC 2VDOH 4KK5D 4P4KC 3GJFH 3IETB 1SBBA 4P3WA 1WBYB 1INEL 1NMAH 3VXNB 1OP5K 2NXZD 1A6VH 5IKCA 4OI9A 5IQ9A 2B4CC 3G9AB 1UCBH 2CMRH 2R2CA 3SDCC 4PJ7F 4OZGB 5IBTH 4AEIL 5FA3A 3UTTB 4QNPE 4YHPA 2YD3A 5B21A 1WT5C 1MH5B 4OCMC 2H3NA 4PV9B 4Q2ZB 1DVFA 3STZB 1N6QH 4M6OL 1NEUA 4O58H 1I1YB 5D7SH 1J1OL 2ERJC 2YD1A 4FMFA 1UM4H 1TZGH 4NRXB 4E41A 1OGAE 2Q1EA 2EIDA 1A2YB 5FB8B 5IFAH 4RX4D 2PO6A 1KIPB 4WFGE 1DTUA 3BUTA 2A74B 2HH0L 4OF7A 1PQZA 1INDL 2AEWA 3T0XA 4C57C 4FQJH 1OAQH 1XF3A 4BZ2L 4LKXB 4Q0XL 2VXSH 4X7SH 1DQQB 4JVWA 4HIEB 1T21B 4LMQE 3DXAE 3HMXA 2EECA 3VFPB 2VITB 4HGWB 2G75B 1QVOA 1IM3A 5IHUL 3D25B 4GRWB 5A40E 1VGKA 4PIRF 5E8OA 1JK8A 3CXDL 3T0AA 4DGVL 1AR2A 1T2XA 1H3UA 1QRNB 4WCYH 3WFCH 2DWDA 1NBVL 1KEGH 2YSSA 4M9PA 1YECH 1WICA 1VFMA 3BE1L 4LSQH 5BZDA 1FLTX 3WFEH 4PJ5E 4KPHH 4YHKH 4F58L 4P23A 1J11A 4MA7H 4PGBA 4U1LB 5SWZA 1X44A 2KPNA 2ICWJ 1CFQA 2HRPL 3MJ8A 1FG2B 3OKEB 1A1NA 2AXGB 2BJMH 4DN4L 1UKQA 4S1DD 2P49B 5HDQH 5HHVL 1Z5LA 2VZUA 1Q0XL 1DBJH 3QDJA 4HXBH 2A83A 1EAPB 3VA2C 5AZ2H 2WBJC 2Y7QB 5IEKB 1MUJA 1CFTB 3HZMA 2FO1A 1EBAA 4UAOC 2EDRA 4J8RA 3PWJB 3INUL 4RMRA 4XPBH 3C6LD 1DN2A 5DMYA 4HBCL 4OB5H 3V6FA 4MQXC 3P11L 5FUZL 4E42B 3RVWD 4JHWL 3G6DH 5D1XA 3FOMB 4LSSH 4I4WA 3CK0L 4B7IA 3FO1A 4N0CD 5D71L 3ULUF 3BESR 2EDBA 4ORGB 3GEWB 5EIIB 5T1KA 5HJ3A 2B1HL 1I7UB 1S7RA 1A6AB 1IC1A 5GZOD 1K6QH 5JQ6L 2JE8A 2R2EB 4KROC 4R7NB 4RIRA 3CVHH 1I1CA 4HG4J 1N59A 1KLGA 1URLA 5IVXF 5J12B 5ESQA 3O2WL 1AD0B 2ITCB 5C0NC 4P4KD 5F9OH 1VFAB 1AI1L 1M71A 1IFHH 2HJFB 2VRAA 3TJHC 2VLRD 3UCRA 2E7MA 5DD1H 4UILL 1P7KB 3PE9A 5C0AB 4PRPE 1W0WA 5HGHB 4ODUA 1UT9A 3EGSB 3EYFA 4NWTH 5EO1A 3A0OA 5D7LE 4LDLB 3OAZK 1T89C 3HG1D 5C9JA 1B2WL 4JG1H 2W60A 3SDCD 3QAZC 5A2FA 3QEHB 2W65A 1GIGL 3TNNA 3IU4L 5DJXA 4GKSA 4JM2C 1WBZA 2WIIA 3IFOB 4UOW0 1R5VB 2VR4A 3SOBH 1NLDL 5FKPB 3ULVF 1B4RA 2RHEA 3PJSA 3F7YA 1DFBL 1AFVL 2SEBB 1DLFH 1X5KA 1A6UL 5MEQA 3S8WA 3L6FB 3L3HA 1BBDL 3DUSB 1NCBL 2FWOA 5DXWA 4HWNA 3ARDC 4WNQA 3SGKC 4ZAKA 1BIIB 4IS6A 2I24N 1EO7A 1GCFA 4LCUA 2LAGB 3LIZL 1AIFA 2CRYA 3QI9B 3IXAB 4P9HL 4ZYKA 2GJZB 5DQJA 4M62H 4XRCA 3CXHK 1F6LL 2B5IC 5JNYA 1UENA 5BXFA 2AXJA 2VDKL 4JFEB 5DQDH 4L3ED 5MEPB 4JZJA 1X3DA 4RNRA 1N7MH 3C8KB 1MHHA 5GRJL 1G9NH 3G5XB 4OLUL 4JB9H 4LLUA 5HYIA 2MJWA 2VZSA 4JGJA 1H5BA 4ELKA 4AIZB 3WS6C 1KACB 1FVEB 1FAIL 2Q8AH 2YWYA 3IETA 3NH7H 4JO2H 4J3XA 5BVJA 4M48H 4X6CF 3BUYA 2B4CL 3OR6A 1LVEA 3VXNA 3C5SB 1VFBA 3G5ZB 2ARJQ 1PEWA 4MA3B 5IUSA 3W2DH 2IBZY 3BZFA 3EHBC 4Z7WF 1NBYB 4PJBE 3ARGC 3MLSL 3VXME 2WBJD 3RDTB 1MH5A 3KPNB 1J8HE 1FL5A 1EEYB 4MHHI 3STZA 1I8LC 1MFAL 1AO7E 3DHJA 4DVBA 3CVIH 2QEJA 3MV8B 1MJUL 4PJ9D 3V5KB 1XF4A 1QSFD 4FQXB 4NRXA 1A9BB 4KJQC 1WQVT 2ZKHH 3AY4A 3IJSA 4RAUB 4OLVH 2IANB 3H9SD 3TO4B 3ROOB 3UTPD 4M7JH 5I75C 2ZOKB 2A74A 1ZSDB 3BP7B 5E9DE 1FFOB 5DJYA 1UG9A 1QQDA 2F5AH 1DQQA 3QQ4B 1Y6MR 3SN6N 2HLFC 5DC9B 3FB5A 4XTRC 1U8HB 1L0YA 4GXUM 5C8JA 4IRZH 4M5YL 1OT1A 1RZ8A 5SWSE 2DOCA 1ZWIB 2O5YH 4YLQT 4HWEL 1I8KB 1S7QB 2AJZB 5E8EA 2YPVH 3P9LB 3TBTA 2AQ1A 4QF1B 3OKOB 1U2HA 3RPIB 4PS4L 2IQ9H 3RL1B 2YPLA 1CDHA 3V7AE 1RIUH 4HIHA 4NYLB 4QCIA 4GLRI 3SE8L 5DUBB 4I2XE 2E9JA 2R0WH 4U1LA 4OCWH 1JGVH 2ZCKL 2UZIH 2H9GB 1KB5B 1FG2A 3OKEA 1SYVB 2DWEA 2Z91A 4JFPA 4XNUH 4LL9A 4XZUB 3MJGX 2OI9C 2WNGA 4MB5A 3VDCA 2P8MB 1RZ7H 2EH7H 3UZEA 1HHIA 1IL1B 2GJ6E 3MR9A 2X4TB 4L8BB 1EAPA 4N0FB 2Y7QA 4Y2DC 2HFEB 1YYMH 4PG9B 1ZVSB 1IARB 4OUUB 3TA3B 2WWKO 2WUBL 4MA1C 5IVNA 3RJQB 4LP4A 5GS0H 1WIUA 3NA4A 5C3LD 3IS0X 3VG9C 1MHEA 1FO0A 1IAIH 3DETD 3WJLC 1DQLL 1A6PA 3LS4L 4S1RH 4CADB 1FGVL 3V0AC 1OL0A 5HVWA 4HUNB 2B1AH 3O6KH 2YUWA 2A9ML 1I7UA 3MJ9H 1T0MB 1A6AA 3CU7A 5IGXH 4OZHB 4PJFA 2ADJB 5IHBA 2R2EA 4WW2C 2YD6A 1ERNA 4M5ZL 2FB4H 3WNPA 1NUGA 4FN0A 2E6QA 2FRGP 5J11C 2AVGA 2Q87A 1AD0A 1E28B 2ITCA 4DUXA 3CJJA 5ERWA 1VFAA 4HT1L 2HJFA 5ETUB 3M45A 1ED3B 5D93B 1JI1A 1A64A 2P48B 4RMWA 3WS3B 3PWUB 5DVOA 5C0AA 3SE9L 1T1XB 5L7XL 2DQDL 5HGHA 4WFED 3UO1H 5F44A 4PRHB 1KPUB 5ANMB 3ARGD 4UQ3B 4MJIE 3O41B 5GJSL 3TBVB 5L8KB 1JYXA 4HKXB 4AEEA 2V9RA 3ZKSD 1ZHLB 5FF6A 1BVZA 3AAZA 3L5WB 5CJXA 1EFXA 1T0NB 5FKPA 4F33B 1U3HA 3DUUB 1RK1B 2SEBA 1MCWW 1F11A 2MSPA 1TENA 4S0TD 5INDB 5I66B 4J4PA 3DUSA 1BZ7B 4UNUA 3QXDB 3K4DA 4PGDA 1IKFL 3V5DB 1A3LL 4M7LT 4G8GE 1BIIA 4FFYL 1P53A 2F54A 3O8XC 5BRZE 2ZNXA 3QI9A 3IXAA 2K1MA 2NY2C 2GJZA 1UKTA 2VWEE 1CIUA 1JUFA 3P30L 1NC4D 3H9YA 1IBGH 4UIMB 2QQQA 4PJ7B 2ZSVB 2R2HB 5CD3B 2BVTA 5I8KL 2F53A 4Q9QL 4JLRB 1RURH 3K1DA 4LSPH 3OPZH 4HDIB 3EO9H 1FORH 4JFEA 5E8DH 3AREC 3BSZL 1U8MB 3WXVL 5BMFL 3SE3C 3KPSD 1T20A 2E5EA 2R2BA 4QY8B 2VDQL 5FAAA 1ES0B 1BX2A 3VXPB 1I8IB 1TDQA 5FGSA 3ZE1F 4UOW1 1CLZH 3DX8B 1FVEA 5JHLH 2VDPL 3B8SA 5ESAA 5EORH 1MY5A 2ZSWA 2AJSL 1R24A 3BW9A 3HHRB 2FH8A 1PYWA 2GW5A 4Y4HD 4H1LH 4J3TA 3LH2L 3QG7H 4JJ5B 1NAML 2GFBA 4QKXB 5F9WB 4UNVA 4KKLC 3ZKXB 2D7NA 1P7QA 4OBSA 1EEYA 1XF5B 4WVRA 3U30B 3WFHB 5FYKD 3P0VH 3BD4A 3R1GL 5DHYB 5C07B 1NUNB 1HILB 3QHZL 1QBLH 4PJAB 3T0VA 2XZZA 4Z9KB 4RAUA 1YEFH 2IANA 2VL5B 4FXGB 3TO4A 2AK4E 1TQBB 1GH7A 1G7LA 4F15C 2AEPL 3FAWA 1F8TH 4NZTH 5F7EL 3X3GL 3KDMA 1ZSDA 3BP7A 4NQCD 3C09C 5D2LE 4FQHA 4X4XA 4J3OC 3FFCD 2KQNA 3T4YB 1I1FB 4BM7A 3EFDH 1K8DB 4NOFA 3KPRE 1U8HA 4Y1AE 3QZWA 4X8XA 1VEMA 3LV3B 3KPOA 3P9MB 3PGFL 4JRXB 4QHMA 3H3PL 5HI3C 3R06A 1QZ1A 3DVNB 3AS3A 1I8KA 3QISA 1S7QA 4L9LA 3HUJE 2AJZA 1EVTC 4RFEB 2VDNH 1CFSA 3MRGB 4YGVA 3RGVA 4OD2B 1X6LA 4M93C 1O7SA 3G6AB 3RPIA 5CINL 5DZLA 1XGQA 3ARBD 4FQIH 4NYLA 1ACYL 4GW1A 1AQKH 3MRHB 4KI5C 1MIMH 4S2SA 4HCRL 4K3JL 2WZPD 1UACL 2BSSA 1EJOL 1DL7H 1VENA 1SYVA 2FBOJ 3GB7B 3QH3A 4XZUA 3FZUC 4WEBH 2YRLA 1CTOA 4GMTL 2WLYA 1B4JL 5GJTL 5A43C 3B2VH 1IL1A 4MDJB 4QXWA 4H26A 4WFHE 1FPTH 1V3MA 1ZVSA 4HX1B 1RJZB 5FYKL 2FO4B 4QRUA 2DM4A 3S5LA 1CU4L 1NCDH 4X7EC 4KK9D 4DEPC 3HNSH 3ZDZF 3O8XD 5C0CD 5AD0A 4Z7NE 2DI7A 1HHJB 1FCCA 3IDGB 4K94H 4PJGF 2MQ0A 2XZQH 4OBRA 3BPOC 4DKDC 3TVMC 1KFAL 4U4BA 1BGXH 2BVQB 4OM0L 3C08H 4DN3L 5ICZA 4WU5B 5DURD 1T0MA 3M07A 3UTSD 4YZFF 5DD0H 1UZ6F 5I2IA 4ZSOE 4HH9B 2CK0L 2ADJA 4LARL 2YA0A 4QYOB 1FFRA 3N50A 4YBLC 1QSED 3VFNB 3IRPX 3RNKB 4EOWL 3ZT7A 4PY8J 5CS7A 1GGCH 1X6NA 4CVUA 2Y72A 5I1JL 1MCRA 4XC1H 1EHNA 4PJIF 4NNPH 5ETUA 4DZBA 1TJHL 2BVEA 2FHFA 3WS3A 3S98A 3PWUA 1T1XA 3MV9B 3NFNB 4XCFL 8CGTA 2ESVB 4LLVB 1GRWA 1JN6B 3PDDA 2NY0C 5IF0B 3B6SB 5ANMA 5MP6H 3RUGB 4UQ3A 2KBGA 2YKLL 3CLEH 3TBVA 3GJFB 3CIQA 1F42A 1QFWL 3PQYD 5JOEA 3O3AB 4RAVB 5F71A 2ARJB 2EIBA 1RK1A 1QEWA 1ETZA 2QLVB 3UTZB 5KSAA 2OL3H 5INDA 2IEPA 1DBBH 1K5NB 1BZ7A 4XNYH 4CAGA 3O81A 2H32H 1QOKA 5HHMD 4TTDC 2DQCH 5TF1L 2VOTA 4NKMB 4OQTA 3BWAB 3RNQA 1OARL 2AK1H 5DA0B 3VA6A 4ZPTA 1XIWD 3MBED 5TJWK 3GM8A 3I6LE 1R3JB 5C09B 1ZTXL 2K9UA 2OSLA 4LLDB 5CGYD 4UIMA 4M9OA 2EYTB 4PJ7A 1CL7I 4LLWA 2R2HA 3QCVH 2Q3ZA 4S1SL 1AGEA 4HKJA 4A6YL 5IB5A 3JWDC 4HDIA 4ODBD 3RBSA 3JV6A 3GGWB 2C7UA 3RY5A 4QO1A 3K8LA 3LKSA 5E94A 3O2DL 5JORA 5E03A 3SKJL 4DGIL 2DLEA 4KUZH 1EHXA 5HPMB 5AWNH 1NGQH 3HCVB 3QEQB 4XI5C 4KI5D 1YEEL 3WIFB 1DANT 4OCSL 4P2QD 4CVZA 5F1NB 4HC1H 4MCYB 1KJMB 1XAUA 1C1EL 1IC7L 3IXTB 4PRIE 3O3DB 2FATL 3UDWA 3O2VH 2AAVA 1BD2B 2W9EH 3NABH 2XKSA 1OOAA 3KYKL 4LCIH 2NX5B 1OAUL 3SKUD 4U7SA 1WV7T 3NPZB 3PGDB 3QB7C 1DEDA 1JFQL 2XA8L 1OP3K 3VXUD 2WWMC 5ISZE 2GIYA 2I9TB 3A6CH 4GSDL 1BFVH 2ARWA 7CGTA 1D3CA 5EBLB 2R56L 5DHYA 1HILA 1YEJH 5E6IC 5CP7A 1UWGL 1D9KA 3WNMA 1Q94B 4O51A 3DLQR 2CQVA 4NKIL 4YDKL 3TVMD 4ZOEA 3H9ZA 2VL5A 4JFOB 4G6KL 3T8XA 1HQ4B 2BNQB 5GGVL 4P5KA 2HMIC 1CGSH 3VFWB 4QRPD 4HXAL 5MERA 3V6OE 4XXCC 3CZFA 1PX3A 1MNUL 3KPQA 4RCAA 4D8PB 5IP4A 3T4YA 3J8F7 4AEIH 3D1MC 3KJ4B 5DK2A 4HIJB 4NQED 5DR5L 5KSBE 2ZUTA 3P9MA 4BUHA 2XRAH 5C6TL 4QOKA 4LSDA 1YY8B 2VMFA 3DVNA 3RWHB 4HMCA 1J1OH 2XT1B 2G2RB 1KTLA 3MRGA 1QFWI 2D7TL 2DN7A 2CLVA 3G6AA 3VG0L 5HHXL 2VLLA 4G8FB 4OGYL 3CVHB 4F9PA 2GK0A 2DM2A 2NY0D 3MRHA 3B43A 2X05A 2YN5A 3I6KB 1E0OB 4EN3C 4YBQC 1D5XA 1INDH 3QUMA 1NFDF 4PJHF 4F37K 5ITBL 1JPSL 3GB7A 4NO5B 1KB9J 3KYNB 4ENEC 5FHBL 3QNYA 3QRFM 2WBKA 3ZTNL 1CDYA 1E6JH 2XXMB 3RGHA 5IHUH 1YEHL 5E4EC 3OHXA 4IRJA 5IVXA 2FX9H 5EU6E 1FRGL 4HX1A 4LVOC 1RJZA 2NY3D 2FO4A 4TTDD 4F7CB 5D8JL 3U7AA 4DGVH 2AGJL 4ZTOL 1NBVH 1QKZL 5F72S 4NOBA 3I2CL 1OY3B 4JFXB 2FX8L 3F65A 3BE1H 2BC4B 3ULSA 4F58H 1OGAD 2ED7A 2VERN 2X4SB 4JM4H 3GNML 2HRPH 1NCUA 4DK6A 4WFGD 1A14L 2LU4A 4DN4H 4WU5A 3MPCA 3B2UC 2D03H 4IIQC 5HHVH 1J5OH 4I5BA 2CRZA 1T1YB 3NIGE 4GW5B 3DXAD 3RY4A 1J18A 4QYOA 3VFNA 4I18B 5I71B 1HNGA 2E7HA 3CX5K 3KLDA 4XI5D 4AIOA 5HBBA 2Z8WC 4TSCL 3FFDB 2RCSL 1OQOA 5EULV 5TE4L 3INUH 1LD9B 1BVLB 1VGEL 5GGTA 5JW3L 5FUZH 3U1SL 2XNAB 5AG9A 4JHWH 4IMLB 3FO9A 4U1HA 3CK0H 3IRZA 3NFNA 2Z35A 3HZKA 4JREB 4LLVA 1DSFL 3ETBF 4YUEL 5E2JA 3T4AB 2BVPB 1J86A 3TN0C 4PJ5D 3B6SA 2FIKA 4X4YB 4MJ6B 5JXED 3AB0C 1BFTA 2B1HH 4PJEF 5IR1A 4KJYB 1QBAA 2I25N 5H2BB 1NSNL 2BVOA 2WWMD 2FX7L 3K8MA 3OR7A 5JQ6H 1RZGA 1JZ7A 3QO1B 4GXVL 4KDVA 3DV4B 3MRJB 4JQVC 3RA7H 5E6ID 1LO5A 3TT3L 3MV11 5GS1C 1K5NA 2ATPB 3QIBA 2YD5A 3HLAB 2PXYC 2Z31B 5DD6A 2EYSA 3U79A 2V2XB 4UILH 2HMID 2R15A 4OCRL 6FABL 4X6CA 5ICXB 5LWYH 1M7IB 5FM5O 1OTUD 2R0LH 3ARFD 5JO5B 1B2WH 1NJ9B 3OGCA 3L3KA 4HUXB 2QJDA 4Z7WA 4LLDA 5DD5L 1GIGH 2EYTA 1TMCB 4GJTB 3IU4H 3ZYZA 4BZYA 4R4FL 5JW4Q 2WV3A 2XA3A 3Q6FA 3K2MC 2HVKB 1NLDH 4WHYG 1Y6NR 3GGWA 3MRNA 3MRPA 3V7MA 4FFWD 4GRLB 5TDOB 5DUPL 5F7YC 5FYJE 3TO2A 4GLRH 4HV8B 2CO6B 2V2WA 4KKBC 3TIEA 3TH4T 5TDNB 2BHZA 1A6UH 1H0DA 5IM7B 1BBDH 4PJCE 1T3FB 1NCBH 2XTJD 3QEQA 3ZDXE 5KANI 1F2XK 4K3EL 2HKHL 4TPRL 1T03H 2V5RA 4ZO7A 1JMZA 3LIZH 3K4AA 2C3XA 4P9HH 5CEYA 1TFHA 3RWIB 1UQSB 3IXTA 1CE1L 4GH7B 1YNLL 1YPZE 3DI2B 1F4XL 1CD9B 1BD2A 2J4WH 3ARWA 4U6YA 1LK3L 12E8L 5D7LD 5ITFA 1ZLVH 2CK2A 4RA0C 4BA8A 1S7VB 1PG7W 4QHKJ 3FQRB 1U3YA 4JRYB 3G08B 1A7PL 4X0KB 4KUCD 4MLSA 4P46B 5KS9E 1HI6B 3NVQA 1A7NH 3DX6A 1CT8B 2NY1B 5GRJH 1TPXB 1CVSC 4OLUH 2K3TA 4DCQA 4KK8C 4FQLL 1A7OH 3RZCD 1C5BH 2P5WA 3VWKC 3LKNB 1Q94A 1FAIH 5LKNA 1Q0YL 4JFOA 2BSED 1HXMA 1MAJA 3EFFB 3DSFL 3VFWA 2XYCA 4WHCA 1VFUA 1C5DB 2OXHA 5JPMA 2F58L 2WIMA 3MLSH 5IV2A 4HWBL 4FFZL 1T04B 5EC2A 4AT6B 4M61B 5I1LB 2VUYA 4LASL 4F8TA 3T04D 1U92B 5HDLA 3OKKB 2HT4C 4I77L 4IDJL 4OLXL 1MFAH 1FC1A 2CR6A 4LSUL 5CJ5A 1A5FL 3GSRB 2W38A 3LRGA 1MJUH 1P5VA 1UWXK 3FTGB 2FSEB 1T89A 4P2OC 5C0FB 4ZFFA 3TT1L 1RZJC 3CVHA 5CEZE 2XWBB 1T2QL 3PWNA 3F58H 2Z0BA 5KOVC 4G7VL 4NKDA 5DO2C 4YHIB 2UZYB 4ZOBA 3EYOB 1Q9KB 3F7VB 4YDIL 4Z18A 3KYMA 3RIFK 4G42A 4F7TA 3KHQA 3EIFA 1AC6A 1WC7A 3BDYL 3ARDA 3VXMD 2MKWA 4F7EB 1FNAA 4M5YH 3T1WA 4NPYB 2ZUVA 3BGFB 4LPWA 1DQTA 4MS8C 3MRIA 4HWEH 2HN7A 4UDTA 2X4PA 4U3HA 1AO7D 3WEXA 4PS4H 1MFBL 1S8DA 4KMLB 4LMQI 4WTZG 2GITA 1WSST 4Z0XB 2BXYA 1FSKB 1BLNA 3RKPA 2VB5A 4G9DA 2APVA 2X4SA 2ZCKH 4HZLA 4OM1H 5F7FA 4XCYA 3SDDD 3DX7A 1VACB 5F3HA 2QSVA 5E9DD 1F4YL 1ZEAH 2OZ4A 5DMGC 1ZGLA 1TITA 1QSZA 3PUCA 5B4MD 2D9CA 4PJ8D 4GW5A 4CU8A 2IAMC 5IBLD 4I18A 3WS6A 4V1DB 1HN1A 4QXGL 4MD4B 1GJIA 1C5CL 1MCLA 2WUBH 4TVPE 4NKQB 3JTTB 5SWSD 4XBEL 4M6AA 4B53A 2W9DL 3K4ZA 1ZVHA 4DUWA 1A3RH 1LD9A 1FZOB 4E41E 1CYGA 4NBYB 2XNAA 2DYPD 2FYYB 3LS4H 5EZLA 3MC0A 1FGVH 2B2XL 3T4AA 2YBRA 4X4YA 1G84A 2VLME 3O9WB 4IMKC 5E08L 3MMEA 3IDIB 4DWHA 4M1DH 1IM9A 4P59H 1I8LA 4G9FB 5KG9B 5H2BA 5CP3A 3BISA 5JTWA 3T0EB 2M26A 2LFGA 1M05A 1Z9LA 3RWEB 2GJ6D 4H1LB 5AUMA 3SKMA 4KK8D 1ULVA 4M5ZH 1ZHNA 5L8JB 2VO5A 5IEHA 4OZFH 3T0BA 5F3BA 4NO0D 4U1NA 3AS2A 4ODXB 2ATPA 4OD3L 3NPSC 5E8NB 3P4OB 4OFPA 4AEHL 5J0BA 3CDGA 3MV7A 2RAMA 4PRAA 2Q8BL 4Z78B 2CR3A 3SE9H 5I18L 2DQDH 1QR1B 5SWZE 4L8CA 5ICXA 1M7IA 2DQIL 4FZ8L 4PREA 5ABDE 3D69B 2R1YA 2X40A 5ESVB 5CJOL 4ZS7H 5EUOF 4YHNA 5K33A 4OF5A 4Z7UF 3TWCL 1RQ5A 5GJSH 4Q74A 1P5UA 4NO2A 3QDJE 4L8DB 5TFSH 2DQTL 2EO1A 3MRFA 4MQ7B 4AK1A 5E70A 4GRLA 3GHEL 1KPRB 3WNKA 1FNLA 4EI5C 4F7MB 4P2OD 1CLYL 3BDXA 4ONGL 5IM7A 1Q9LB 2ZUWA 1T3FA 3HE7B 3QQ9C 1U95A 1IKFH 1A3LH 4I3SH 5T5NG 1FNFA 4AY0A 1N5AB 2A1WH 3OTTA 5DO2D 2DBLL 2ORBH 3VE0A 5JUEL 2X9YA 1H8NA 4PYHA 1LO0L 5F7LB 1X7QB 3IDYB 3TPUB 3FB7B 3W0WB 5F7MC 3RWIA 4X6DB 1JPGA 3P30H 1UFUA 4HEPG 4HFWB 4I13B 4MJ5B 4Y2DA 2HJKA 1OAYL 1S7VA 4UV4L 4MJID 3VFUA 2OTPA 3O4LA 1XCTB 4NC2B 3BX7C 3LHPL 4ZPVA 4JRYA 3G08A 4MS8D 4NNYB 3GI8L 3L3OA 4P46A 1KJ3L 3MUZ1 1HI6A 2ZCLH 3A6OA 3WJLA 4N68A 1ZT7B 2VDQH 3HNVH 3SDXF 2VLKB 2XKNA 4KVCH 3AROA 3U36A 3WUZA 5FCUL 2X89A 5GGRA 3Q0HA 3O45A 3LKNA 3S34H 4XX1E 1OD7A 3BKYL 2VDPH 4NP4L 4OLZL 4G8GD 5CJQL 1NFDB 4OKVB 3VWJD 5BRZD 4CBPA 2ICES 3L3GB 2R1WB 1EHAA 4X6FB 3VFRB 1C5DA 5IB1A 1J0KA 4NM4H 1AC0A 2IAMD 4HUWB 5GGVY 1JRHH 3H3BC 3BPNB 3AM8A 2BP3A 3UROR 1H15B 4NZRL 4XNQB 4KQ3H 3WL9B 5DJDB 1I9RL 1KIUA 2QR0B 3TBWB 1U8NA 3N1MC 1RZJL 4FTVD 2C4FT 3RHWF 2ICWB 4X5XB 5DS8A 2FSEA 3ZHKA 3FQTA 4PJGA 4PLNC 4Y4KC 2F19L 4PG2C 2AEPH 3LQZA 2XICA 4JFQA 4YHIA 3X3GH 4M4PA 1HKLH 4HBQA 1Q9KA 4XCCL 5I1IH 5CSBA 2AXFB 1U6AH 4PR5A 3IF1B 3EJJX 1KC5L 2J8UF 5DRZB 5D9SA 2AEIT 3FKUS 1IAOB 4NQDA 3EKCA 5DF0A 3G5YA 4JPIA 4QRQA 1U3ZA 4Y5VC 1U58B 1GGIL 3PGFH 3H3PH 4NPYA 2WBWB 1H8OA 3UTQA 3S3SA 2NPLX 4PJIA 4C83B 3BZ4B 4P5TD 4OIIH 1IT9L 3KXFB 1MY7A 4K9EC 5CINH 5FYLE 2V9QA 4OCLC 4LLYA 1ACYH 4CMHB 3BT2L 4MAYB 2EDDA 4YH6A 3V79C 2J8HA 2O93L 5C0BA 2A38A 5CILL 4HLJA 2QKIA 2OL3B 1OLZA 1LK2A 2X4NB 1GGBH 2CO7B 3AREA 1UACH 4Z5RB 2H32B 3SE3A 5KZCD 2NXYC 1KIRB 15C8L 3KAAA 4GMTH 2GAZB 5GJTH 3S4SB 3UTTE 5MHSE 3LN5B 2OR9H 4EI5D 3OQ3B 5HDBE 4XBGB 3DMMC 4Z7OE 4Y1AD 2CLZB 1J87A 1S9YB 4ZTPH 4UV7H 5FYKH 3L3DA 1ORQB 1CU4H 5D2NB 3BI9X 1ZGLM 4XMLH 3HPLA 1LDSA 3D9AL 4YE4L 3CFEB 1BJ8A 4MD0A 4WWKC 3TPKA 1BFOB 5B8CB 1RVFL 4UOJA 1KFAH 3LKOB 4GW4A 4LSRL 5T1MB 3BOVA 4OM0H 3PWLB 3SDAC 4QHUB 2AEQL 3O9WA 1LE5B 4LSTH 2H1PL 3OB8A 3NCBB 2YXFA 2CKBL 4ESKA 1UYWL 2CK0H 2CDEB 3BGMB 3GFUA 3VFGL 4H1LA 4EOWH 4NKOA 1XF1A 1MQKH 5I1JH 3BIBX 3QCUL 2FEDC 5DFVC 3HUJF 4J6RL 3GSOA 1G7JB 1EIBA 2YPLE 4Q9BA 5JIIA 4L5FL 3P4MB 4TOYL 2B39A 1TJHH 4FNLH 3C5ZB 3FONA 4X7CC 1FLRL 1A7QL 4XCFH 1QR1A 3HS0A 3OSKA 1PSKL 1FNSL 4P3DB 1BM3L 1LO2H 4Z8FL 4C55A 2BFVL 3BEWA 3UBXI 4JKLA 2YKLH 1MCNA 2Y36L 3E6HB 2XQBL 1QFWH 4HUVB 2WMPA 4L8DA 3E2HB 3EO0B 3V6OC 1WTLA 3UPCA 1IC5L 4KI1A 4MNQA 4NFCA 3MLWH 3ET9F 3KR3L 1XCQA 2COQA 1HHGA 4JANB 2CPCA 3ZSTA 5GS2D 3QUXB 1FN4B 1Q9LA 1BECA 1G7MA 2DLTA 5TF1H 1N5AA 3VFMB 4R90L 4LCWB 4PLJC 3FB7A 1CD1B 1WCQA 1ZTXH 4DVRH 4MJ5A 4NT6B 5JA9A 5FK9B 2HA1A 1JHLL 1Y18A 2A0LC 3MA9L 4H0HB 2Y6SC 4O02L 5J9PA 5LGJA 4S1SH 2WANA 4PJFE 4A6YH 5I73B 3V52H 3FMGH 2X41A 3B9AA 4ODSL 3HC0B 3O2DH 5J8OA 1I7TA 4POUB 4DGIH 3L95A 2DTSA 5GSRB 5HXMA 1DP0A 3EJYC 1MCPL 1CFNA 2VLKA 4LLMB 1REIA 4WUKL 1YEEH 4OCSH 5MENA 3KPLB 3PV6B 4RA3A 4KWUA 1GAFL 5DRNA 5C0AE 1IEBA 1G6RA 1I1AA 4RZCB 5MI0C 3EYUL 1NFDA 4D9RE 4PJHA 4OKVA 5DWUL 3ROLB 3SPVA 5I1HL 1QHOA 1IC7H 2R1WA 2ADIB 5T1DL 4X6FA 2FATH 2YD8A 3HR6A 4LRIC 1I3RB 4HK0A 4RQQA 1ZANL 2EC8A 3I6LD 3KYKH 4HUWA 3TYFB 4LBEB 3QXAB 4BUGA 2W59A 2EDEA 1UH2A 4U2ZA 3T1FA 2G60L 4HWZB 2NXZB 3WL9A 5DJDA 4CVXA 1RU9L 2C1OB 3EDKA 1FCGA 3N9GL 1MHCA 4Y7MA 1TQCC 4GSDH 1FZJA 2ICWA 5IMLB 5KVDH 3ZLQC 4WWKD 3F5WB 1WWAX 3MGTA 4NQUA 1T4KA 2F54E 3DVFA 4NKIH 4YDKH 1WVZA 3Q3GA 1FNGB 4NCC2 3SDAD 4QT5B 4Z77A 1SY6A 4ZXBC 2ZOLA 4NZUL 4OZIF 1H3XA 1Q1JL 4HXAH 2AXFA 1L4IA 4G7YL 1KGCE 3GBNL 1NBZB 1S5IH 4PRID 4TUKL 2F53E 4GAYA 2ZG3A 2QQNL 5DRZA 3LVEA 1YEDA 5DR5H 4JFEE 2IFFL 1NC2A 4PTUB 3S35X 2NY4D 3TYGH 5F8RC 2ZNWA 1WFUA 3BH8B 4Y16D 5BOPA 3MROB 5ISZD 4C83A 4OZ4A 4LEOB 3HC3L 3KXFA 3MLXL 5BJTA 4PLOB 5HHXH 4MCZB 1HOCB 3GUTB 4OGYH 2CUHA 4KDWA 3BH9A 4LQ1A 1RMFH 1YMMB 5A2IH 4P57B 4HHAA 1PLGL 1KCRH 4MNGB 5D7JD 2OL3A 2X4NA 5T3XE 3ZT5A 1GZQB 4IRSD 1JPSH 4Z5RA 1TVHB 4PJEA 1YEGL 3PGCA 4YFLI 3IU3A 2NZIA 3ZTNH 4GBXB 5FO7B 5JOFB 3JWOC 3S4SA 2HP4A 1SMAA 4LOUC 3O6MH 5T1LD 3WCYA 4YQXH 2GSGA 2FH6A 4XBGA 3D2UB 1CFVH 1R5IB 1FRGH 5ID1A 5B39B 1EH9A 2FR4B 5BVPL 5D8JH 5DZOA 5D2NA 3U2SB 3G04B 1QKZH 1AKJD 3CFJB 3BO8A 3T65B 3I2CH 1OTTC 2IANE 2FX8H 2XFXB 1BFOA 5B8CA 2LTQB 3FT4A 3MRKA 3U48A 3LKOA 3LN4B 3RVTC 1D6EB 5EUOB 2Y6SD 2BSTB 4QHUA 5J1TC 3C6LB 4ZFOA 1U8QA 3TV3L 2XZAH 5EA0L 2X5PA 5J13B 3BEVA 2QSQA 4KRNA 4ONOA 1LEIB 4JG0H 1FVDB 1RUPH 3BQUD 3C2SA 3BGMA 1EVUA 1OWWA 1OB1B 3MFFB 4G6FD 2APFA 1RZKC 1HSAA 3EJYD 1OT2A 1I75A 2PTTB 1FVCA 5IK3B 4TSCH 4U05A 1TETL 3MJ6A 5EU6D 1KLUA 5FOBB 4MNHB 3P4MA 4Y88A 1VGEH 4XXCA 3KVQA 5JW3H 3U1SH 4OD1L 1JBJA 2AKRB 5B3JE 3C5ZA 5F7DA 1MEXL 4JN1L 1DSFH 4I0PD 4WO4B 4YUEH 2WQ8A 3BYTA 4GQ9L 2BMKB 4P4KB 1CICC 3C5JA 1BQHB 4FG6D 2Q20A 1EGJH 3VCLA 3E6HA 4PJXB 1NSNH 1RZIA 2FX7H 3B9KD 2YEZB 3S36L 1KUMA 3HG1B 5CEXA 1ADQL 1KCKA 2YRPA 1SJEB 5KVFH 3O3EB 4XCNB 4JANA 3TT3H 1FN4A 4DUVA 1QO3B 4FFVC 5IHZB 3QT2A 2CXGA 3PL6C 3UC0H 3OKLA 5DC4B 1I7RA 1ORSB 1NCAL 4ZXBD 5DHXB 1FHGA 1Y0LA 4PRPA 3VFMA 3L9RB 3OJMB 3FQUB 2HTLD 4ELMB 3QUZC 2I5YH 3B9VA 5C0IB 1V7NL 3QUYC 3HI1B 2XN9B 1QPXA 5FK9A 3CDFA 3WXWL 1MRDL 3LDBC 4H0IA 2WAHA 3LQMA 4OZHE 4R4FH 4DKEL 1Z9OA 2VKWA 4U1IA 3ARRA 1ZS8B 4NO3A 3HC0A 2EXWC 4Y4FC 2ADGB 1EUUA 4CKVX 4R0LB 5DJ0A 3KLSA 2QQKL 5A2KH 4F7PB 3LQAL 4CW1B 1SYSB 4K3EH 2HKHH 4TPRH 3KPLA 3GIZL 3UXFA 3PV6A 4MQSB 3ZKQD 1FV1B 4LVHB 5INCB 3BJ91 3G9VA 2VAAB 4WW1B 1BPVA 2AJYH 4O5LH 3STLA 1OLLA 1EPFA 1CE1H 1NH6A 3MGAA 5ANME 1YNLH 1I7ZA 3QNZB 1F4XH 2P24B 2J8UB 3VRIB 4LOUD 4FXKA 3SQOL 3F12B 3VFSB 2VABA 5E99L 3GIVB 3V95A 5DD3L 2C1OA 3KLAA 5B38B 1F97A 5FYJD 3ISWA 1U8LA 3ARZA 3HTLX 5ALCL 5IMLA 3TN0A 1DVFC 2HKFL 3F5WA 5C0JB 3E6FB 2VXTH 1Z0NA 3CZJA 1AQDB 1K8IB 1G7HB 3RVTD 4Y19B 1DEEB 3X3FL 4BH7A 2P44B 4OIBA 4QT5A 2EE2A 4I0CC 3CXHJ 3DSFH 2Z9TA 2H2SC 4PJ9B 4NUJB 1QSFB 1NEZB 2QSCL 2AXHA 2DMBA 4PJ7E 5JW4R 2I60L 4J1UB 5C71A 4JQVA 2F58H 2W0LA 1F3DJ 4FFZH 5GS1A 1BEYL 3TNMA 4ETQB 3MRCB 2PXYA 5ACLA 1J8HA 4PTUA 4LASH 4WGVB 3I9GL 5E00A 2A6IA 4I77H 3MV01 4IDJH 4OLXH 1S7XB 1F90L 3SY0B 3WDHA 2R69L 1VSCA 2E6PA