3CVCA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvcA00
7PAZA 1GY2A 2FQFA 2UXVA 3WI9A 3TASA 2IH9A 7PCYA 2YAPA 2VMJA 3ABGA 3FPYA 3UADA 3WNIA 1JVOA 2PPAA 1NTDA 1ID2A 1BQKA 4BXSV 1PCSA 4YVNA 4BWTA 5B1KA 3T6XA 1JZJA 4BWWA 4E9WA 2A3TA 4CSPA 2UX7A 3CDZB 3H4HA 2B08A 5PCYA 5I6PA 2QDVA 3EHBB 4YSQA 5I5IA 5I6OA 2UXFA 3D12B 1PAZA 1KYAA 2DWSA 2DY2A 1ET7A 1TKWA 8PAZA 1A4BA 2H3XC 4F2EA 3AG2B 1ADWA 3FU7B 5I6KA 4AX3A 1E5ZA 4KNTA 5EHFA 1SF5A 5B3SB 1SJMA 3FSZA 4KO6A 2J56A 2E86A 2FQDA 4P5SA 4GXFA 5B7FA 1AS7A 5B7EA 1ZDSA 4G70B 1UATA 2HX7A 3WG7B 2J55A 2Q5BA 3NSCA 4E9TA 2I85A 2BP0B 1GSKA 2DYRB 1AZUA 2IAAC 3JT2A 4NAJA 3DIVA 3NSDA 1F56A 5IY5B 1QLEB 5AZUA 1SDDA 4KO9A 1X9UA 4AI7A 1HAWA 2XXGA 3OMAB 3QJRB 1PZBA 4G7SB 3V9CA 2VM3A 2P80A 9PCYA 4YSPA 3X1FA 1L9QA 2P80D 4YSOA 5I5JA 3C75A 4YSSA 4HCFA 1EZLA 1DYZA 1WS7A 3N55A 4DP8X 3OM3B 4A67A 4AZUA 1T5KA 1OCZB 3MBWB 4WKXA 3UAAA 6PCYA 2XU9A 1GYCA 2YAQA 2DYSB 1QNIA 3NJKA 5AKRA 3ZX1A 1KDIA 2IDFA 1MZYA 3EH4B 1OV8A 1NIFA 1PLAA 2VW4A 1NIBA 3IN2A 4HAKA 1ZDQA 2FJSA 3EH3B 5LDUA 4K9JA 1BXVA 3IEAA 3AG4B 3FS9A 6PAZA 1AZNA 4A66A 2ZXWB 2PCFA 3FQ2A 2Q9OA 1JZHA 4HIPA 3IBOA 2HX8A 3QQXA 4BDVA 2OJ1A 2UXGA 1M9WA 1SF3A 4YSRA 4UAHA 3KW8A 1JZFA 1WA2X 2HLEB 2HRGA 3GYRA 1AACA 1JZGA 2BWDA 1JVLA 3HEIB 1AG6A 2QDWA 1GS6X 3NJIA 4GYBA 4YL4A 4DP5X 1FA4A 2JXMA 2XX1A 2JKWA 2CAKA 2YAEA 2VW6A 3DTUB 4PCYA 4WTQA 3UAEA 1A8ZA 3NJNA 4YSCA 3WKPA 5B7MA 1MG3C 2W88A 1RZQA 1AAJA 1EHKB 1M56B 3PAUA 4GP4B 2OV0A 3WKQA 3NJFA 4JKNA 1BYPA 1JOIA 3FU8A 1YLBB 2FTAA 4YSDA 2PP8A 2OCCB 2VM4A 3X1BA 1BQ5A 3CVCA 1CYXA 4A2DA 1NINA 2XYBA 1ET8A 5F7AA 5TK2A 3S3DB 1OCRB 1V55B 3FYEB 5B1BB 1BXUA 1PZCA 2EINB 2YARA 1OF0A 1J5CA 2ZONA 2H5UA 2PPCA 2QPEB 2PP7A 2R7EA 2Y1AA 1SFDA 2VW7A 1ILSA 2H47C 2J57A 2PP9A 1AZCA 1I53A 1AZBA 4DP9X 1GR7A 2CUAA 2GSMB 4DP6X 2I7SA 3GXUB 1AS8A 3N2JA 5F7BA 2VSKB 4A2EA 1MDAA 3SBRA 1WA0X 1BXAA 1R1CA 3WNJA 1JERA 3JTBA 1E5YA 2GC4C 4KNUA 3FSAA 2EILB 2Y69B 1AIZA 1HFUA 2FT7A 2FT8A 2GI0A 2YXWA 1GS8A 1CC3A 2WSDA 3AW5A 3ZBMA 3ZIYA 3IN0A 4HCGA 2BHFA 4QKTA 4F7KA 3FPXA 1XB3A 1JXDA 2CALA 3BVDB 1FWXA 3TBCA 3T6WA 2X87A 2IDTA 3TA4D 3AG3B 5I6NA 4HHWA 4ZK8A 2IDUA 1OCCB 4Q89A 3EF4A 2IWKA 3X1NA 4E9QA 4DP7X 2BZ7A 2I7OA 4FA7B 1AS6A 2CJ3A 4YSUA 3H56A 2FQEA 3AY2A 4KO7A 3FQYA 3X1GA 1J9TA 1N70A 1CYWA 2FWLB 1L9PA 3SBQA 2TSAA 1PLBA 1AOZA 3SBPA 1KGYE 1ETJA 1PF3A 1J9RA 1E65A 2X88A 2XLLA 2YAFA 3CDZA 2AZUA 3NSFA 1MG2C 3UACA 1QHQA 3S3BB 4HHGA 5I5MA 4EF3A 3T6ZA 4UF7C 1W8EA 4FAAB 3AZUA 1ASQA 5I6MA 3NP3A 1SHXA 1KCWA 2BW5A 1W6WA 3ZDWA 3FU7A 3NJLA 1B3IA 3FYIB 4HALA 5ANHA 2J5WA 3QJTB 3OMNB 2ZWNA 1BQRA 4UANA 1V10A 4A2GA 1OOWA 4M3HA 2UXTA 4P5RA 1GY1A 2IWEA 3AG1B 4DP2X 3PLYA 3S8GB 3X2QB 3OMIB 1A65A 3OD3A 2N0MA 3X1EA 1NIEA 1XMEB 1GW0A 2GIMA 2HZHA 4NERA 2PPFA 1IBZA 3ASOB 3T9WA 2B3IA 2XV2A 1ILUA 1NWOA 3V9EA 2XWZA 4AKPA 2BP8A 1JZEA 2PPEA 5D4JA 5TK4A 3FSVA 1XB8A 3S8FB 2HRHA 1V54B 4GY4A 1PMYA 2QPDB 1DZ0A 1J9QA 1VLXA 4AKOA 2XVBA 4QLWA 4Q8BA 1X9RA 1ZV2A 2JFCA 4G7QB 3ABKB 3NJJA 2W8CA 1SDDB 2AFNA 1JXFA 3ERXA 2WO3B 3ABLB 1AQ8A 2AVFA 2YAMA 1KBVA 2XX0A 1L9RA 5AFAA 1FFTB 2GHZA 1TU2A 3PAVA 4DPBX 2UX6A 3QPKA 2XV0A 2MTAA 4E9YA 4YSAA 4BWUA 1KV7A 4N4YB 4N8UA 1TEGA 2XV3A 3PXLA 1HAUA 1NICA 4M4RB 4X4KA 2WO2B 4DPAX 1ASOA 2BO0A 1A4CA 1NIDA 2AANA 2FQGA 1ASPA 1NWPA 3FSWA 3QJSB 4PAZA 4A2HA 3MX0B 5A7EA 2IDSA 1XB6A 5FC9A 1PNDA 4KOCA 1AR1B 1BEXA 4A68A 1SFHA 3CVBA 2CBPA 2DWTA 4TXVB 1OE1A 4YSTA 4F2FA 3TBBA 1NPNA 2PCYA 3TU6A 4BXVA 4KO5A 3T6VA 1RZPA 1AANA 3G5WA 3NP4A 3EH5B 4W1TA 5E9NA 3GDCA 1KDJA 3PPSA 4ENZA 1ET5A 2NRDA 3QJUB 2IWFA 2IDQA 5D4HA 4BDVB 2AZAA 1NDTA 2YAOA 5B1JA 3S3CB 3FU9A 3OQRA 4KNSA 3RYMA 1PNCA 2YXVA 4RH4A 1WA1X 3FT0A 1L9SA 2GBAA 3U25A 2XXFA 3PCYA 1ZIBA 2CCWA 1E30A 3CG8A 4MFHA 2VSMB 3UABA 4HZ1A 4L0PB 1JZIA 1J9SA 4A2FA 3NJMA 3PAZA 1BAWA 1KBWA 4KOBA 1ZIAA 1PLCA 2ZOOA 2YQBA 1URIA 4E9SA 2HX9A 3NSYA 5B1JC 1OE3A 4DP4X 1A3ZA 3HB3B 3SQRA 2BP8B 3T71A 4G72B 1IKOP 1RCYA 2VN3A 1CURA 4GP8B 2YAHA 4HCIA 3ABMB 2QT6A 3IE9A 2EIMB 1PZAA 2EIJB 1L9TA 4E9XA 1M57B 1W6LA 2PLTA 1NPJA 2FT6A 3FQ1A 4BK5C 2GC7C 1GS7A 2IH8A 2BP0A 5I6LA 2BWIA 2DV6A 2MRYA 2R7EB 4YSEA 1PY0A 5D4IA 4CSZA 1IBYA 1JXGA 4G71B 2XUWA 4YVUA 4DP0X 1SNRA 2LLNA 2BW4A 1SHWA 5I26A 1A4AA 1OCOB 3NT0A 4DPCX 1IC0A 4E9RA 2EIKB 4G7RB 4DP1X 1TEFA 3H4FA 3QJQB 4E9VA 2BZCA 2GB2A 3ASNB 1RKRA 1WS8A 3L45A 4JHVA 3UGEA 1N68A 1NZRA 4NB7A 3NJHA 1WAEA 3WIAA 3CZUB 2HXAA 5PAZA 4GP5B 1NIAA 2RACA 2TSBA 4AKQA 1J5DA 1BYOA 5I28A 1KCBA 1E67A 3BQVA 1OE2A 2FNWA 1ZPUA 3CVDA 1AG0A 4W9ZA 3NJGA 1AZRA 2PPDA 1IUZA 1MZZA 1CUOA 3NYKA 1L9OA 4JHUA 3QJVB 3KW7A 5B1AB 3DKHA
chains in the Genus database with same CATH superfamily
2E8YA 2ZSVB 1YEHH 3TH4T 1BQHG 1I75A 3B2XA 4PI2A 4IRJC 1MWAL 2FQFA 1KWGA 5DJ8B 2B3RA 3K2KA 2VLKE 5KVMC 4LKCA 2YPVH 1SEQH 5FKPA 1ES0B 2AQTA 2R83A 3BWUF 2MH4A 1CGYA 1FHGA 1ID2A 1QVOB 3CUPA 3OKEB 4PJEF 4P5MA 4YVNA 2XNAA 3CH1A 2FD6L 4FYRA 4UNVA 1G7LA 3PL6C 1TYEB 3D8MA 4IM8A 3FBKA 4WFHE 1JI2A 3EJPA 2EECA 2VXSL 2VLKB 5CIPB 3UO8B 3FQTB 2BS8A 2DWSA 5I9QC 1RUKH 2J1WA 2ARJA 2FECL 3JWOH 3N41F 5EV7A 1N3NA 1CDGA 4I4WB 3TZVD 4X8GA 5E4IA 3RU8L 4WCYL 1VSCA 4RESB 3B8YA 3FU7B 1JNLL 4XBPB 3E2HB 4Q9QL 3UTPD 1XIWB 3P30H 2F53A 4JFHD 2YQ2A 4U1LA 4QTIL 2O26U 1QFWH 3KE0A 3EO1B 3O9WB 4YHKH 2VJXA 3T04D 3X3GL 5ALBL 1NMCC 3DJTA 4E9TA 4QNPF 1BBJB 1MFUA 4NKQB 3QEHA 4V2BA 5EBLB 2QBWA 1VKXA 3E8UL 4ZOAA 1U2HA 2ZP0T 5KZCD 5C0FB 1YEGL 3H9YA 2EXYD 1F58L 4UTBL 4QGTA 2XG4B 5T1DL 5I1HH 4HZAA 2R56H 2XY1A 2X1XR 1N64L 1Q0XH 3BWUC 2NUPB 3W56A 5I76B 4WFGE 4F92B 1U8LB 3LZNA 4IBSA 3BJ91 3B2UD 5KVEL 3ULUD 4BGDA 3L08A 4TUOB 3MLTB 1TTRA 2VDQL 2P8PB 3KPQB 2C4FU 3MN8A 1UC6A 4KJWD 5EZJB 2F5AH 1F41A 1OCZB 1V05A 32C2A 3CSFA 1JK9A 3VA6A 5HYJD 4Y8DC 5C0GA 1YQVH 3PWPE 3TT3L 4AENA 3LN4B 4U4BA 4XP1H 3TYFA 1M05B 1M71B 3DX0A 2Z3FA 4TSBH 3EH4B 5EEZA 1NIFA 3ZO0A 2VISA 3F7LA 4ETQB 1IGIH 5AOLA 2F74A 1NIBA 3OGOE 5LDUA 3DJ9A 4XNUL 2CJUL 5GJSH 5D70L 2G5RA 4I0PB 4R7XA 5HD8C 1N19A 5FYKH 1QW8A 4G1EB 4Y19D 1CE1H 1IBBA 1MHEA 4YGVA 1EUUA 5FWRA 3FCTB 5I5RA 2EUVA 4LBEA 4I1NB 1U58B 2P26A 2Z91A 3PWPB 4U6HB 3CVHA 1TSRA 2F5BH 1XMWA 2QTVA 4QRPD 3II2A 1FORH 4NM8L 1D5IL 3ZE1E 4B3EA 3QWNA 2HLEB 2HRGA 3VWKD 1TO4A 2K9UA 1SUJA 3H0TB 4DERA 4QLRA 1YC8A 2Q6WA 4MD4B 3UAEA 2H2PD 4NZTH 3TEYA 4H8HA 4FI7A 4GQQA 3L48A 4HJ0C 3HE7B 3D39D 1CXFA 3K6DA 4XOAA 3ARBC 3PV6A 1IEAA 4O58L 1BM3L 2IC2A 4MRBA 1AFVL 5DD1H 2Y4SA 1SQMA 3G6DH 1BWWA 3R8BB 2PXYA 3ZE1B 3SDYL 3X1BA 3ARQA 3QR2A 5E5MB 3FTUA 2VXSH 4F8NA 4GG6E 2LLLA 2I25N 4R7NB 2B1HH 3I02B 4GRLD 1H3PH 3SOTA 4GQ9L 4OF7A 5E24E 1E4KC 5EN2A 5B1BB 1CVSC 3EO0A 3EYVA 3FQ4A 4CU8A 3RU8H 3ESMA 4WCYH 5KYXB 1FVDA 3PWUB 1FPTL 1PS3A 3HBZA 5ESQB 4Q9QH 1N6QL 3MRPB 5KJRH 4JQIA 1PG7H 3F65A 4QTIH 1MW0A 2I7SA 1TVHB 3MLWL 1I8MA 3GRWH 3KLLA 5HVFB 4LCIL 2X1QA 3JSSA 3WL9B 1DVQA 4OV5B 1UUSA 4GG6B 1PIFA 4YDVA 1KLFB 1A9BA 3O3BA 2X9ZA 3IJHB 2DIJA 4GXUN 4WUUD 3VI4A 1SJEB 1W0YT 3I74A 5LAPA 4MD5A 4N2FA 2VXQL 2CKBL 3V9FA 1HE8A 2W59A 4TUUA 1F58H 3C60C 1HZHL 1HJBC 1R3KA 3IN0A 5K9KB 4FMVA 1N64H 2NY2B 1B4TA 2X4NB 1FO0A 1XGPB 4HKXA 4RMUA 3S4SG 3MCG1 2NDFA 1X5AA 4G7YL 3AG3B 4MXVF 3L4WA 4RETB 5JHDA 2DWEB 5LBGA 4G11A 3EF4A 1CFNB 1HTYA 4QRRB 2BZ7A 1CICB 1PX3A 2W0PA 3CNKA 3DO7B 4BINA 2FX7H 2BNRE 2V3EA 5C0DB 3SDCA 1U42A 3ZDXE 3FFDA 2JI3A 4K7FA 4KKBC 4F8OA 3HHRB 5AG8A 3VYPA 5JYLA 4X5WA 2KPNA 1KGYE 3U79A 4L1HA 5HHOD 3WY4A 1ETJA 4MDIA 3G6JE 1HEHC 3BYYA 2YMOA 4LB8A 2IDCA 3O0RH 4BFOA 4XHJD 2CJUH 4L4TE 3S96A 4X6CF 5ESAA 2GBUA 4PJ5A 1EIBA 5L0QB 1GJWA 3LSOB 4FMFA 3HI1B 5DC4B 1W0WA 3APDA 4W4NA 3ZDXB 2MSPA 4DETA 4ODHL 1JAEA 4AGNA 3NJVA 3DX6B 4KMTL 2WQUA 3IDGA 1AY1L 1D5IH 1FNEA 1RUQL 1YEJL 5E2TL 3UFIA 5D93B 2JCWA 3OVUB 2GTQA 3G6JB 2UWEF 3TEXA 4ODTH 2YEZA 3Q8CA 3GFUA 4NFDA 1X5MA 3L3JA 2D3LA 2WXFA 15C8L 1D5MA 1UOKA 3M7OA 5JXEA 1GPOL 1QD0A 4XNMA 3EBGA 3HIZA 2C9QA 3QS3A 1BVLB 2WIIB 1FVCB 1I1FA 1T1WB 1LMIA 2EH8L 5CHNA 3RZCB 4DP2X 3KJ6H 1BM3H 2NXYC 3QZMA 1JGEB 1LILA 5HYQB 3WS3B 3C5ZD 3RIFF 3ZLQC 2E0PA 3T0WA 2Y7MA 2FH6A 4WFFD 1J87A 1SDYA 3QRGL 1O6SB 2JMRA 4RX4A 1D6EB 3I6LE 2NY3B 5FFGA 3SPVB 2Q3AA 2EQDA 3TPKA 2OXGB 2B3IA 4OZFA 1RUAL 5KVFL 3K2UH 3L1OL 5DYOB 2GTWA 4U0RB 4BFNA 3QO1A 1ZEAL 4NIYE 4XGZB 2HRPL 3L5JA 5ICZA 3C8HA 3OKDA 3C5JB 3EXLA 1UJ3A 3QDGE 1N6QH 1IARB 3Q5OA 3WO3B 4GO6B 1F6LL 2NPLX 3MOQA 4N5EC 4JO3L 3WHXA 4MCYB 4PBXA 3PQYA 1J9QA 2OYLA 1T04B 3TIEA 3X12A 3MREB 5FKAA 3C5XA 2VITA 2JFCA 4LSDA 2CO7A 3NJJA 5AVUB 2NY0C 2VXQH 2CKBH 1VEOA 3V7AE 5GHWL 3EJYC 4JDZB 1HZHH 2WO3B 2A9BA 1IE4A 3G04B 4PJGE 3QDGB 3ES6B 3BP6B 4UU9B 3TN0B 2UX6A 1NBVH 2EZ0C 2XV0A 5F97E 1J1XH 2AEIT 3HA0A 3QE5A 5F8RC 3L4YA 1UYWL 2HLAA 1FL6B 4XX5A 1I3VA 1GMEA 5BQ7A 3ZKMD 1L5GA 5DZOA 5BRQA 3QJSB 3E80A 5B39G 4F7CB 2CIKA 1IAII 5L7XH 3MRJB 1CMOA 4LEOB 4LOVA 2Q2EB 4OCSL 5BZXA 3VXRA 4KRPB 1JGLH 4PJGB 4UMGA 3UMTA 5D7LB 3VRIB 1ZE3C 3BVNA 5EUKB 3N42F 2DWTA 3V0HA 1K5WA 1NPNA 3TU6A 3BXNA 4Q14A 1OTUC 1CT8B 3NTCH 4LVHB 5EU7C 1QSEB 1Z9PA 1QSFB 2P9RA 3O8XB 5IK3A 2O72A 2YC1A 3AWGA 4YHYB 1DCLA 2H2SC 3CX5J 4BH8A 3QEQD 3LS4L 2IDQA 4E42B 2D0HA 4JHBA 5F1NA 1U8MB 4UM8A 3LKPB 1DQLL 3HS0A 4Y7MA 1UA6L 5DFTA 2AK1L 3OJMB 3DNKA 4Y4FA 2XC8A 4XXDB 4XNBA 2C8NA 1I7UB 4G6FB 4DGVL 4LLUB 2Y6SD 5HGBA 15C8H 1RZGA 3GB7A 3MO1B 5DJXB 1GPOH 5G2NA 4IU2A 2V17H 3E1F1 4AY0A 4PJ8C 4L3AA 5E7BA 1SBSL 3N6YA 1NCTA 3MLYL 1KXVA 3RWFB 4J1UA 4ZYKA 4KDTC 4P5KA 4N2DA 4APQB 2OR9H 1R5WA 2OMNA 3LD8B 4DGYH 5JHBA 5T1KB 4JY6A 5CZXD 1L9TA 1IZJA 1DL7L 3BRDA 1W6LA 2DLHA 3LPWA 4WKZB 4YHNA 3LXAA 5E2JA 5G55A 5IJKC 2AQ3A 2GC7C 3FTZA 1RUAH 1RIUL 3ARED 3VXSE 4MS8C 3W57A 4YSEA 2CM5A 2R7EB 5A2JH 2ZSWA 2ALWA 4M1CD 4XN5A 5H37H 3MCKB 4N8CL 4POYA 2A5UA 4G82A 3U6RB 4M6NL 1GAFL 2QFRA 3RVWD 2HFFA 1T7XA 2X1WL 2G2RA 3OJ2C 5FYKE 1OLLA 2ADGA 2EEFA 2EXSA 4L8BB 1BJMA 3NZ8B 2SEBA 2ZXBA 5BMFL 1TJMA 2J21A 3C08H 3V10A 4EZMA 2BOCA 4E9VA 5IW1A 3HNSL 5EOCJ 5F1OB 3OPUA 4JLRA 2AJXL 1RJZA 1Z1WA 2GIYA 4H1LH 3VXSB 1C5CH 1NZRA 5AW3B 3UCQA 5JW4M 1EX0A 4BFJA 5GHWH 2ZD0A 4YC2B 2X10A 1NIAA 1U8CB 2OMVB 2TSBA 3QJXA 4PVLA 5I66A 2OMXB 4JEGB 4RGMC 1SJHA 4Q56A 3BP7B 4X7DC 2YFOA 2ZXGA 4Q0XH 5EG6C 3R4DA 4YNYA 2D2CC 4XPGH 4CAGA 5IIEB 1MZZA 4IU3B 3WNKA 3BN9C 3FHQA 4PWIA 1DANU 1DQMH 4BHUA 1XZWA 4DN3L 4L5FH 2EABA 4OLEA 1RU9L 3RL2B 1KBGL 2XZCH 2A99A 3KPSE 4AIZB 2QEJA 1TUPA 4N6RB 4FP8L 2VMJA 2XQBL 2D9QB 3P0GB 3T0EC 2AV7B 4OCSH 5JHLH 2E7LA 3EZJB 3CIAA 3ALXA 1F1DA 3FRPA 1WVZA 4N25A 3BUPA 4HWNA 3BWZA 3QORD 3D2UD 4JFZL 5CZKA 5AOZA 4I2XE 5AZ2H 4ZW7A 3ZHKA 1E42A 5EBWA 3NCEB 5I0ZA 1KGCE 5KYYA 2MNUA 1DBAL 2XN9A 3MROB 2ROXA 1K4CB 3ECWA 3UIYA 2V8LA 2QDVA 2DEWX 2X6MA 2UXFA 3KPSB 4P2AA 3IETA 5TF1H 2W1NA 3ZKSD 5MERA 3MJ9A 3QNXA 4O2CA 4XPFL 3BZ4B 5DK0B 4NPYA 3NFNA 5C07A 3DJSA 1WZ1H 4ZPTB 1L7TH 2IV8A 4MB1A 5DGQA 1BBDL 5IMOB 4C56D 1KC5L 4I2XB 3GZKA 4N3TA 3OQ3B 3RA7L 3UAJD 2BVOA 4KTYA 3JUYA 1R5IA 1KJMB 1ZDSA 2GUOB 4QHMA 4FJ6A 4AQ8A 1HSAA 1MXDA 4HK0A 4PJFB 1KNOA 2FB4H 1OSYA 1CF1A 4YBQC 3QUYA 1S2EA 3HFML 4QHNA 3GMLB 4MZ2A 2YA2A 1AKPA 3MLYH 3AXIA 2F61A 3DVGA 5AZUA 1G9MH 2JQMA 5C92A 1X9UA 2FJGA 1E28A 5ELIA 1E6JL 4P59L 5EU3A 4BKSC 1XAUA 2AXFA 5ENWA 1DL7H 4J28A 5EU5B 5KUKA 4Z7VB 2XTLA 5DHMC 5DRXA 1OPOA 1L9QA 3RUGA 1J88A 1OTTC 4F7MA 3RIFK 1OGAA 4ETYA 5HPMB 2K0RA 1T4WA 1WS7A 3GZQA 4ONOA 5DI8A 5HDBF 2NUTA 3ZKXC 5JO5B 4NENA 5C2UB 4OVUA 4M6NH 1GAFH 4ODXA 1MRDH 4TUJA 4HEPA 1CD8A 2ENQA 1KIQA 2WXJA 4GKLA 1K8IA 4BKTC 2NX5A 1BJ8A 4EZKA 2WOBA 3VSUA 4LLVA 1ZVYA 2XHNA 1X7QA 2VLRE 2N56A 4P2RD 2B59B 3CDGB 4PJBE 4C8XA 2QVKA 2JCCF 3SZ6A 3MUZ1 5F7HA 4J8QA 3FCGA 3P3RA 4MVBC 1QZNA 4ANKA 4GQZA 4UT9L 4HIJA 5EC1A 4ZFQA 2R4SL 3FS9A 6TAAA 5FA4A 3IMBA 3QUXB 4GW1B 1A4KB 4ANVA 3S35X 4EI5C 5I73C 1QQDA 3H7BB 2ZX9A 4NJAH 5GZNA 1I82A 5LO7A 5T1LD 2GJZB 1WD8A 3VXMA 4WNJA 43C9A 1RP9A 1JD9A 1G1KA 4F20A 3W0WE 3Q3GB 4G3YH 4PJBB 2KZBA 3ARVA 5DJAA 4A7GA 3BDYL 1WA2X 3VQ1C 1KBGH 1SBBA 3WFZA 5DJ2B 4P23A 1AG6A 3NJIA 1EFQA 1ML0A 1EFXB 3WELA 1TQVA 1WD9A 1A8ZA 1IIIA 1KPRB 4F58H 4OM0L 3F62A 4Z8FH 1MG3C 5JPMB 5KVGH 1AAJA 1M56B 4JFZH 3WKQA 1X44A 4YPGA 1IM3D 3L2LA 3VD4A 1CD9B 4KV5E 5I1IL 3W0WB 3D69A 5IR1B 4S1SL 3MVSA 4DO4A 4LBAA 5F9OH 2XG5B 2Y5TB 3HG2A 2VO8A 1WUNT 1DQVA 4JDTH 5G4MA 1JPEA 3AB0C 4DKDC 5B8CB 1YEDA 3TV8A 1DN2A 1GJUA 1YC7A 4ZAKD 1B6DA 5TK2A 2E6QA 2CUHA 4HC1H 4XPBL 1BXUA 3WNOA 5EIIA 3TBVB 4FYQA 5C3LD 2ZQKA 2VWEE 3FDWA 4L3EE 2Y1AA 3UYPB 4WSKA 5HXMA 2NYKA 1KC5H 1AZBA 4G5AA 4PRIE 4IOIA 5GISH 1S3KH 4FXLA 1KPVB 3PHQB 4PGDA 2E3VA 2OYMA 3GXUB 3RNKA 1AS8A 3KPRA 5E6ZA 1IM9B 3LXBA 1ZTXL 5LCVL 3T2LA 5JW3L 4CU7A 2BC4B 2ZOTA 2R0LL 3ATBA 3H42L 4KNUA 1GZPB 2CGRL 2FSEA 4I1RA 5IBUB 4X5QA 3ECUA 3AXLB 4ODUB 4D0DB 4JANA 4MWFB 4L3EB 4UBDC 2NR6C 2WSDA 2DM4A 3HAEA 3O6KL 5F7DA 2GJPA 3ZVVA 2CKBB 1U3NA 1IT9L 4F7KA 4PRIB 2CO1A 5E9DA 1JN6A 5DZAA 5C0IA 5IKCA 4AMWA 3OBAA 5B4MD 1QA9A 2B1AL 4X9BA 4WHTB 2DLIA 4XCEA 4FXGB 3TA4D 1H8OA 3BH9B 1RPKA 3POCA 1VDGA 4M6OH 1I8LA 25C8H 3F58L 1CDHA 1E4XH 1UGKA 4JN2B 5JIHA 2I7OA 3CLFL 3V55A 5FGCB 3U1SH 4NO5B 2HVKA 2E6JA 2H32H 4WDIA 3WS6C 3HE6C 2D7MA 2QQNL 4PJ9D 5AZEL 2KUTA 1P53A 5LBVA 3BX7C 1BG1A 1N70A 3EBIA 2J25A 3P2TA 3PXHA 4IOSA 5DFAA 4PWFA 3L2NA 4FQJL 3QR1A 1BVOA 3FH8A 5F2FA 3PNWA 1BMWA 2C5DC 2X4TB 4HIHA 5BO1L 3QNFA 1S7RB 4L1BA 5GGVY 4NT6B 3UPRB 2R4SH 2X88A 2E47A 5E6ID 2HT2D 4KVPA 3RHWF 4ATWA 4AL8H 4LU5H 5JPNA 1SYSA 4O2EA 1ZSDA 4AQ1B 4ZX6A 3RDTA 1QUNB 4KI5E 4LOUD 3KPOA 2Z4QA 4J3TA 3VXUD 1NGPL 4UT6L 5AL8A 2J43A 4MLIA 4D9QE 3WUWG 2BVQA 1F4WL 2DIAA 2FVNA 4R5VA 2BW5A 2HLFD 3T0AA 2OP4L 5KG9A 3WKML 3GMNA 3KR3L 4DZ8B 3NJLA 3BO8B 5F21B 3V8OA 1YNLL 3L3OA 4JK0D 4KGLA 1U41A 1UM6H 1X5GA 3AU0A 3OJDA 3QCUH 2LTQB 4QRQB 4R7DA 5EO0A 2W65B 4ZXBB 1G7IA 1KYOK 1WRFA 4OLWL 2ZWNA 1U3HC 3T3MF 3UC2A 1KIRA 2DJSA 4OM0H 2BY1A 3DOSA 4JRXE 4WY7H 4YZWA 1HHIA 5KVFE 1BP3B 3O9WD 2IWEA 4HIXL 3RWJB 4PBWD 2FBRA 5BV7H 4AE0A 3QCTH 1YAZA 3OMIB 4H8QA 1U8HB 1Y6KR 2OMWB 5LN4A 3FCSA 2R1XA 2HH0L 4ZUSB 1LO2H 1TZAA 1SXSA 2PPFA 3QI9D 3IU3B 2H1XA 3TTYA 2UYLB 5KSUB 4P49A 5E8EA 5CN3A 2V9UA 1TKWB 5IT2L 4AQAB 2ZP8A 5D9SB 3BT0A 1F02I 2Q2LA 1HILB 2VRKA 4JRXB 4TVSa 3UBXI 1OGPA 1FHNA 3FFCA 1T7YA 4OFQA 4JQXC 3UDWA 3VNZA 3W9DA 4CVXA 2WBJC 1U8IB 1BWMA 1DZ0A 2FDBP 3LNFA 2RJMA 2VC2L 1ZLSL 3VI3E 1YY8A 4MNQD 2R0LH 2ZPKL 3H42H 4YR6B 5GGQL 2FX9L 2CGRH 2GJ6E 2VZSA 4Z0XB 2AFNA 4RA3A 4ZFOL 5FLVA 3VYNA 1A7NL 2ZYSA 4L5FE 2ZAIA 4XOCA 4H1LB 3ETSA 4G9DA 2AVFA 1A4JB 3C8KB 1USZA 1REIA 3BKCH 4X7TB 1IT9H 3BLKA 4YZFE 2PWGA 3SJVE 3C5SB 3VDCA 2QJDA 3SGEI 1TDQA 3VI3B 1OCWH 2UZPA 4QYAA 3VUAA 1L0XA 3F58H 1PZ3A 3PWJB 4LHUB 5E2WL 2GJ6B 2AANA 3FSWA 4QF1A 1N26A 3CLFH 1XEDA 1JGUH 2FYYB 5D71H 1DJZA 2VUYA 4UT7H 1CWVA 3SGJC 1UM4L 1TQSA 2BVPB 2JB6B 4BE5A 5E08L 3W2DH 4OD1L 1M7DA 5HJ3A 4QTFA 1BF5A 1HCYA 4WJ5B 3SJVB 3W82A 1MCWW 2CCVA 3X14A 1IQWL 4FLHA 3GXTA 3I6KB 3T6VA 5BO1H 3U0PA 2R69L 4XI5D 1EDQA 5F6HI 5KVDH 1CDIA 1KENH 3TO4A 4HF5L 3V4PA 3EXJA 1FL3B 1F6FB 1MRFH 3FB8A 3PPSA 4G1MA 4NQEE 4ERSL 4B7IA 2NRDA 5HI3C 1DVUA 3R7QA 1ZRUA 3APNA 3B5HA 1OARL 3L7EB 2O30A 1HHHB 4WW1A 3WEXB 5DLMH 4JMXA 1QRKA 1H3WM 2OP4H 4G5ZH 4Z7OE 3WKMH 5CKGA 2LE9A 3MRFA 4H25A 1TTAA 5IB5A 3RWIA 1HQ4B 3RWGB 3ILEA 3S37L 4MHHI 1PLCA 4U1JA 3QS2A 1PAMA 1KB5L 4LSTH 1AZZC 3CN4A 5FOBA 4WNSA 5DUPL 4NQEB 3Q2VA 2IWGA 3FTXA 1HH6A 1SXBA 3PL6B 2XY2A 5DRZA 2AI0L 2HJKA 4LSQL 2BINA 2L8AA 2QVTA 2EUWA 1KJVA 1H8SA 1CURA 5GSRA 4Y5XC 4D2NA 2WLLA 3CFIC 2HH0H 3I6GA 4Z7OB 2IGTA 3GSWA 3MODH 4TULL 1M57B 2XWDA 3UGUA 4E9XA 5JHMA 3H9ZA 4FXKA 3Q05A 3FQ1A 1TJGL 3Q2CA 3LV3B 5ID0A 3CFQA 4M62H 4XNDA 2IH8A 1WICA 2G60L 3DGDA 2K6YA 1J9CT 4X0NA 2IBZY 1S7SB 3BAWA 1U8QA 1IKNC 2V9QA 1ZVSB 4E41E 5F7KC 2BSDA 1JXGA 2KDYA 1L6PA 4PJEE 5DJZB 4HX1B 2XJKA 2XUWA 3GXMA 4XN8A 3K7UA 5GSVB 3ZGIA 4QRRD 1CICD 4FNTA 1NMCB 1U3ZA 1AR1C 2VC2H 1ZLSH 4E9RA 2EDNA 3RRQA 5EBMA 3PHOB 5LGYA 2ZPKH 2VR9A 4OBSA 4JX0A 4NC1C 2LABA 5C70A 4KK9D 3HKFA 2P48B 3GMRA 5CKAA 1A7NH 2I07B 3EOBB 3KLHD 4E41B 5FYJD 4HJJH 3UZQB 4D7PA 4BJLA 5I28A 3OLDA 4N0YL 1RIHH 4PJEB 2CLVB 2ZYIA 1HWHB 1WK0A 2ZE0A 2D7TH 5FXCH 3RGHA 5AG9A 4QHLA 2BRRL 3SPGA 4WF7A 1IC7L 4DAGH 4DH2A 1NDMB 3D9AH 2VZTA 4DVBB 2JK5A 5G4OA 3BMWA 3CGTA 5KVGE 3QDAA 3U9PH 4ODWB 1YEEL 3VGHA 4S2SA 4DKAA 4ZO7A 5EC2B 2H3KA 1ETZB 3QARA 5E2WH 2UXVA 2ZUUA 3CV5A 1OF2B 4QNPE 4OZGF 2CH8A 2PKDA 4ANXA 1FYTE 3GMQA 1HOCB 3PGDA 5MENB 3N41B 5LGHL 3N85L 3MR9B 2W60B 2WXRA 1KB9K 4N2MA 4NQCD 3RVUD 4HLEA 4ZZFA 4JFPB 1WZMA 4GXVH 1JZJA 1IQWH 3HHSB 4DEPC 4HYTB 4Y4HA 1ZKAA 3U4EB 2F7RA 3H4HA 3RB5A 2ZNXA 2WN3A 4LCCC 4F8PA 2WQXA 3NSXA 1BPLB 1FYTB 3M1BA 1OARH 4WEBL 2CDEA 3OAZK 3L3KA 2ZJSL 4L2LA 3RHWK 1JNNH 2ATPB 2VDLL 3E6FB 4M5YL 4PY7A 4P06A 4ZI8A 1F42A 1Q9LA 4EUPG 1VGEL 2ENSA 2X9WA 4IQHA 5BS0A 5C8JA 1ACZA 4QHKJ 4DUXA 2EADA 1D9KC 2AJYL 4KK5D 4RAUA 1EEYA 4Y8AA 3S37H 3OKOA 5B7FA 5ISZD 4ALAH 3OC8A 4F1ZA 4U1MA 1CFSB 4LMQE 3RWCB 2M8XA 1G7PA 4KROC 1ZHNA 5F7YC 2YD9A 3MNZB 2IALB 2AI0H 1JNHB 4X5XA 1SMDA 3EW3B 1JWSA 1SDDA 2XKSA 1NH6A 1FZMB 4EPSA 1AXSB 1NC2B 3MLRL 4UILL 4GAAA 4J23A 4ILDA 5KJ4A 4HDIB 2VM3A 4TULH 4Q9CA 5L2KA 1RY7B 2LOEA 4FQXB 3U0TB 1S3RA 3KPNA 3VDBA 2G60H 2FYVA 3FO1A 4GAJL 3TN0D 3QQ4B 3K71A 1MIEL 3S34H 3QQ3B 1OM3L 1S8DB 1XAKA 4YXHL 1GL4B 3LKOA 5CILL 4YXLL 4A6YL 3MC0A 4M5TA 4C47A 5HYJA 1FG9C 2P5WD 4XVSH 3KCPA 3T8XA 1OAZH 4XC1L 5BJTB 3WV0A 3IVKA 4Q7DA 1BFVH 1N4XL 1OIOA 3CE1A 4JQVA 4NUJA 1AQDA 5ACLA 2H32B 2WP3T 4JFXB 4W68A 3D50A 5JLZA 3GLDA 3FCBA 4XTRC 4MNGE 3QZNA 1HH9B 5D7LD 1NCHA 2EDOA 3MGOB 2ED9A 4XPTH 5KSAD 4JR9H 1AGFA 1CDYA 2CE6A 5E99H 4L8DA 1KZYA 5A6IA 4JPIA 3ETTA 4K7PH 4KXAA 5I16A 1TU2B 1BZ7B 4EXPX 1LO5A 4IS6A 1T3FA 4HBQA 2PCFA 4MA3A 1QSED 2VYRE 35C8L 3GGWB 5GRYA 4ZW8A 1QSFD 1JPFB 1RURH 3CN3A 2QQQA 3HZYB 5JORA 1LLAA 3MBXL 3QQXA 4DGIH 1WEJH 3WSQL 1YHPA 2K3TA 1RJYB 1RZ8B 3KW8A 4MNGB 5I1CH 5KSVB 5SWZE 5T1MA 3RTQB 3HN8A 3L7FA 1OSZA 1ITBB 5EOTB 5I1KH 1SUHA 4HAFA 3ARRA 4XNQA 4I13B 5GS0C 2Z35B 3N85H 4X7SL 3D39A 2HN7A 1U8PA 4KHTH 1JF1A 3NOIA 5GIRB 3RY6A 3HI6L 4B50A 1RZQA 3BEVB 3GNML 4G6FD 5J1SC 3TA3A 4LRIC 3QZWB 4F37K 4DKTA 2AXGA 4XB3A 4DKEL 5AOIA 3OAUH 4J3BA 1I1YA 2VERN 1MI5D 5F7MC 1HEJC 5BV7B 5L4IA 2OJEB 5SWZB 3RPKA 3ARFC 4MXVE 1SGKA 1RULH 1LDPL 4R5XA 4WTWA 5T1KD 3DPBB 2EC9T 5C9JB 1BZEA 3L9YA 1U8OB 1FN4A 2BNQA 4KY2A 4WEBH 2F1EA 2ZJSH 2VDLH 4MJ5A 1P4IL 4HIQA 1ZLWK 3V0VA 1SQ2N 2XWEA 4XMLH 4IOFC 3L9BA 3MPCA 2MCG1 1EEZB 5T5FA 2HKFH 1T0NA 4UUJA 3P54A 5IFAL 3JTTB 3K46A 4A2EA 3WOVA 4K15A 4Y5YA 5JOFA 1IFHL 3MLUL 3BP4A 3MMEA 1YYLL 1S7WB 4X6CE 2CSPA 5KS9F 4PRPE 3BAKA 1WTLA 2NXYB 2ZCKL 2NYZA 3EJZD 2BP5M 2GI0A 4NN7C 5LDSA 2ZYRA 3OWRA 5FOJA 2CU9A 2KYIA 5JIKA 4WSJA 2QADB 2VXUL 5DZVA 4RIRB 2ZCLH 2DYPA 4MTMA 4X5PA 3QK0A 3KWXA 2ICEA 1MH5B 1MW3A 3DRQA 2UWEE 3MSPA 4Y88A 5AD0A 5AENA 2YD0A 2JKIS 4FYTA 2PR4L 2R0ZL 3WY2A 1OM3H 4YXLH 4UWQB 5CILH 4PYHA 4X6CB 2LLGA 4PRPB 4KJQC 3WN5A 4PGBA 2XWBA 5KVDE 1QKZL 2MQGA 4W4OC 2Q86B 3H56A 4XC1H 3T2PA 3CVIL 1N4XH 3UMNA 3AY2A 5CP7B 4NP9A 2WJ5A 2OL3L 3B7SA 1JSYA 3NZHL 1CYWA 3SBQA 3ULVD 2TSAA 4KKAD 3D52A 3DSFL 1NL0H 3ZL1A 2X9YA 1SLVA 1WBYB 4WV1A 1ZT7A 2JI2A 4Q4IA 1K2DA 2UWEB 2YGQA 3Q1SL 2H1PH 2WBXA 1NBYA 4NRYA 3M17B 3NSFA 4DESA 3VD9A 4KK8D 2ISDA 4AYSA 4MZIA 4Z3TA 4IKIA 4FFVD 3FFOA 2OZ4L 3MBXH 3KWWA 5D5ME 2P5EE 1HU8A 3KPSD 2WVVA 5EU7E 5JW5B 2EJ1A 4TQ8A 2BFGA 4CNIB 1AXTH 1LDSA 4HHAA 4OLZL 5DDHB 1IGTA 3QXDB 4A7GF 4D0BB 4P9HC 4AUJA 3QIWC 3A4DA 1JBJA 1YY9D 4P5TC 3KGUA 4JRYD 4JFYA 1Q9OB 1NCWH 2Y2YA 1BG9A 4KKCD 4X7SH 4GFXA 2WZPD 4JO5A 4X8JB 4ELKA 4IKJA 3CQQA 3DHPA 4ZMXA 4MZ3A 3LIUA 4O2FB 3BGFC 2P5EB 2IBBA 4DKEH 4MXQC 2B8OT 2ZWSA 4IBLT 4PSRA 2R0WH 3FTGA 4K3DL 2CDGA 1MVFA 2F9BT 4LVOC 2HZHA 5GS1C 4YK4C 2DQGL 2K3HA 2ZICA 3EDKA 2HP4A 4NC0B 4WU7A 4EI6B 1DVFC 3MTRA 1PKOA 1LDPH 2EP6A 3WO4B 5IOPB 3WGVB 1SMOA 2ROYA 3APFA 4R2GD 3CAFA 4Q9BA 3B9KA 2NW2A 2P43B 4ZMLA 5C3IA 1TQCC 1U4EA 2M2DA 5ITFA 4L4JA 5C0CE 4H4NA 1FGNL 3LZLA 2IANA 2XDHA 4Z7QF 2MPVA 4GY4A 43CAA 1PMYA 1UENA 3BSZL 1J86A 3IDIB 2ZXQA 4RISL 5I8KL 1F11B 3D7PA 2JWYA 4PJ8B 4Z0BL 4E2OA 1OGTA 1YYLH 1N8ZB 3U7AA 2VC2B 5HGDB 2EDKA 1YCSA 3JWDC 3Q13A 2ZCKH 5IHUH 1FNLA 2WVTA 4LKXB 2ZX7A 3TO2B 3AM8A 3UO1H 4ZFOB 2CLRA 3DDGA 1G4MA 5C0CB 2EEXA 4M93C 4H8VA 3E1ZA 3N42B 3U4AA 2F0CA 4HV8B 4D0CA 2VXUH 4HUVA 1WIUA 3GIZL 3MRRA 3OR7B 1RPUA 1E0OB 3OAZH 4JO2L 3OWEA 3CZEA 2Y0SA 4ZW5A 4HXBH 2NCMA 1NM9A 3D4YA 4MMYB 5C0RH 4HH9A 2FQGA 3D0VA 5A2AA 4GOSA 3SKNB 4R0LA 4H44C 4WZ9A 4LPTA 2X4PB 3Q8AA 2HUEA 3IXTA 2IBGA 1ZHBA 2EE2A 2IAMD 4F8QA 1R3HA 4KKPA 1I9JL 3ZN6A 1EFXD 3CN0A 1S5IH 3VXOA 1MW2A 3EYFA 1HEZA 1WIOA 3T0EE 1QPXA 3BVUA 2Y7OA 3FT3B 3LEYH 1VZIA 3QEQA 4M61A 5DQDH 4QAMB 1MPAH 1QAWA 4Q74A 4RGMB 3SQBB 1TQBC 1JZ4A 3O45B 3KXFD 4R5TA 5DU7A 3SY0B 4BZYA 5IGXL 4BDVB 4HWZB 2AZAA 2VM9A 2ENJA 2OZ4H 5SWQB 2E7HA 3BPLB 4I18A 1BA9A 4HFUL 5IB3A 5DUBB 1WA1X 2H41A 4B60A 3QXVA 3VMPA 1YYML 3LIZL 4OLZH 1G5AA 1QFWI 5GZOA 1RZJH 2BIHA 2YMXL 1H8LA 3T0EB 1ERNA 1YUHA 3LQMA 2XQYG 4XVJH 5FAAA 4DK3A 4WI2A 2JQAA 4YH6A 4MBOA 3D87B 1YAIA 2FR4A 3RLSA 1W8OA 4NI6A 1KB5B 4PN6A 4JFDE 1HXMA 1ZMYA 3BUIA 1OTSC 4CADA 5I19L 5IHHA 1JVKA 1XH0A 2JE8A 3L4TA 4G72B 1AO7A 4RMRA 4N0UA 5KYNA 5J9PB 4LSRL 4NAMA 3OL2A 3ABMB 5MEPB 4BCXA 4BZ2L 2J4WH 1RZFH 2DQGH 2MCPH 2WTOA 1NBCA 5B38B 2BM3A 4IDLA 3STLA 1TG8A 2WWMC 4PRID 2BLFA 1JFQL 3AXHA 2VZVA 3QWOB 4AWJC 1FO0H 4JFDB 2WAHA 1F4XH 3D48R 5CN2A 4OUUA 1IIKA 3IT8D 1OSEA 4OQ1A 1ADQH 1AGCB 1HL8A 4X4XA 4HULB 5I23A 5D1QC 4JY4B 2E7CA 5D1XC 3PU7A 1LK2B 4XMTA 4R97C 4NO3A 5I26A 4DPCX 3HUJA 1XH3A 2R4RH 1MJUH 4JHZA 3VA2C 4DP1X 5I75B 5I8KH 2BJML 3ME0A 4XRCA 4Z0BH 2Z31D 4BFRA 4XNXH 2E4FA 3T4AC 4N2OA 4N2NA 1ORSB 1GZQB 5M95B 4JPKH 1I8IA 3QG6B 2GCYA 2CA4A 2XA8L 1DQDH 4CMMA 2V5RA 5JQIB 4JFEA 2FLMA 1J5DA 3AU1A 3GM0A 4XC3L 4PTTB 2BXYA 2MWCA 1L9NA 4HCRL 4F3FB 1VFBB 4XCYA 2I9TB 4YDJA 1MFBL 4J3OD 5GGTA 5CGYD 5C7XL 3ZKXB 1L6ZA 3BD5A 1JRHL 1JWMA 1T4KB 3C6LC 2DMHA 1ZLWH 1UA3A 3OXRA 1GY2A 2CUIA 3BW9B 4L4VA 4RDBA 3WFDL 4ELDA 4QXTB 3QUZD 3UTZB 1OB0A 1AMXA 3T65B 1J8HE 1H19A 4OIBA 4XNYL 3DX8A 1PD1A 1MLBB 1WQVT 4OCRL 3RFZC 3QORA 3ZKND 5CD3B 4OGXL 5JQ6L 2BSCA 4BA0A 1ZS2A 3VD2A 3O6MH 5AW2B 3KGTA 1BIIA 1JCVA 3SE9L 4P4RA 1ECYA 3IAGC 2WM0A 4KI5D 5EPMA 1NKRA 1ZHLA 1RK0A 4EI5B 4L9LC 4U1GB 3UG3A 4D9QD 2A9ML 5D72H 5DD5L 5ECJE 5HDBE 1HYSC 2Y7NA 1ET7A 5IGXH 2ADYA 1J8HB 1YPZA 2R8SH 3AG2B 4P4KA 1J8KA 2FBOJ 3JWNG 1CL7L 3VFTB 4A38A 5GS0L 4ZO6A 1Q9KA 1YYMH 3GHEH 5DSCB 1KPUA 2VDLB 4WI9A 2Z93B 2GSGB 2FO1A 3NA9H 4XP5L 1M53A 2JCCE 3DI3B 4QCIA 3WG7B 3QULA 3IJ7A 4ORZC 4P46B 5J5EA 4JFFA 2NY4D 3DUHA 4H26A 4YBHA 1FFNA 2KT6A 1I7RA 3UBXA 4U6VL 5HDBB 2XTJC 3UGXA 4CVZA 2YN3A 3GT6A 4MJHA 1WBZA 2QGBA 3EADA 1IAIM 1Q94A 1LD9B 4AC4A 1UACH 1WYJA 5CINL 2XYCA 5A2BA 3N44F 1HAWA 4M02A 2OTUB 4HS6B 1D7CA 5C0EA 4BFBD 2O61A 1QPKA 3D0LB 4J8RA 4W9GC 5J13C 4KWUA 1TR7A 1L7IH 4YSOA 2YPKA 2JCCB 2NTSP 4NNXA 2XWJB 4WHYG 2MCAA 3B6SA 4XNZC 5DO2D 1CLZH 1HHKB 2VZUA 3HJEA 2Y7LA 4XWOD 1TJHH 3AT8A 3IRZA 3MLXL 1Q4NX 1T66D 1OT1A 3A4EA 4K94C 4HWBL 2YSSA 1U6AL 1QNIA 2Z8SA 1YMMD 5DC0A 2B14A 3BSGA 1DJWA 1GTNA 2OFQA 3U30B 1FI8C 2ITCA 4Y2OA 1ZA3B 3GSOB 3EH3B 4N0CC 5J11B 1X4ZA 3DK2A 3IEAA 3WXVL 4X98A 2XA8H 4N9GA 4B9CA 4XP4L 5T1LA 4O51B 4IDJL 4PHZA 4NQVB 1Q72H 4MMZC 4O02A 4CW1B 5FF6A 4R7LA 3TM6A 5IFHL 3E6HB 4KUCF 5F1IB 1G7LB 1LO4H 1CD1A 3JYCA 4H5SB 2J6WA 1AYRA 1QHOA 1XTLA 1XGUA 2VIRB 3QXAB 3TH2T 4MRCA 1KYOJ 1JZFA 3FUKA 3WFDH 4ZS6C 3VFGL 5IW3A 3HE6B 3ZY7A 4N8VB 2WV3A 2QDWA 5TDPA 3QHFL 3HPJB 4O5LL 4XNYH 3QRFM 4CN4A 4L8SB 4OCRH 4IRSD 4YSCA 5TQ0H 3WKPA 5B7MA 1XF4B 1A3RL 4LNRA 5ERWA 3SN6N 1UCBH 4GG8B 4NQED 1JOIA 3QZPA 1SEBB 1MHCA 2R23A 3SE9H 3VFOB 1U8JB 4TSAL 4PS4H 4U1LB 5K9JH 5EU4A 3O4LE 1BQ5A 3ZMEA 4FEMA 3EIFA 1NBZB 3CZLA 3G08B 2A9MH 3MUGA 5IP4A 3AS0A 4NDMB 2YEQA 4YHOL 4FQ1H 1S9WB 4AYFA 5E4EB 3EAKA 4P9HL 3FT2B 5CNHA 5FDYA 3ZL4H 4PG2A 2VW7A 4MJ4A 5DJ0A 3RBGA 2BS71 1J8RA 1DQJA 4Y9GA 2Z7WA 2GSMB 2HAZA 4PB9L 4DP6X 4XN7A 1LXMA 2BSSA 3WE6B 5I8CB 2QZQA 1TQWA 4N90E 5DJYA 3O4LB 4OF8A 5FECA 5ABAA 1MEXL 3UIZA 4U6VH 5EIQA 5BQDA 3WKNA 3FU0A 3S35L 1TETL 4LSUH 4AEHH 2IGFH 4Y2LA 4CN1A 4A63A 1T1YA 2FT7A 2FWOB 3FB6B 5CINH 2FUTA 4DN4L 3BZFB 1C12B 3B5TA 3S88L 3GKWL 3P4MA 2D4FA 1MVUB 3TYFB 1GGBH 3FPXA 4F7PB 1RAMA 4MJ6A 3BVDB 4QRFA 4E41D 5CJQH 4U6XA 4U3XA 2YK1H 5BUAA 1FSKC 3LKQB 3ARGD 2BSRA 3P3SA 3BQUB 4CSTA 4Q6KA 1DUZB 2F74B 4OTXL 3RB7A 2NQ3A 4KZCA 1JTPA 4M48H 4ZQKA 5I2IB 4JREC 3W9EB 5C0NC 4DP7X 3T3ME 2CRMA 2ZSVA 3QIBC 4EE2A 2WBJB 3KJ4C 5EZIL 5LWYL 5HHQB 5AQ0A 5E51A 1CB4A 3P3YA 3CFJB 3JWDL 4MDJB 2MMXA 2LV4A 4HWBH 4M9OA 4IGBC 4JGUA 4JHWH 1QVOA 4AQOA 3OKEA 3V6FB 5MEND 1J1PH 4GSDH 1P7KA 1PTZA 5D7KD 2OTPA 1QR1B 4U49A 3F7RA 2R15A 3ARUA 4KBPA 1MG2C 3P69A 2DJ4A 3LEXB 3T3MB 3GBLA 2J7LA 1P7QB 4OLYH 2OCFD 5CLYA 4JG9A 2WTPA 2VLKA 5CIPA 4BQCA 3FQTA 1U93B 1TLKA 3FB5B 5IFHH 4OF0A 3MV9D 1I1AD 3AZUA 3STZB 2GBVA 2R27A 2Z8RA 1FYTD 3FU7A 4MXWH 4XBPA 2G9HB 1XIWA 2RCSL 1HI6A 3JBG7 1XGQB 4HJEA 4HALA 2J5WA 2VLJD 4O5LH 4OCWH 2EE9A 2IH1B 5HTSA 5DHEA 5EN2B 1H5BA 3EO0B 1T7WA 4OCLC 1A3RH 3P1VA 4IMLB 1BBJA 3O3DA 4R84A 5EBLA 2AXHA 1TENA 3IGUA 3AG1B 5AOMA 3CCHA 3QWRD 3QG7L 5C0FA 4HWUA 4O4YH 3VRLE 2XG4A 1N10A 1DUYB 2HG5B 2X38A 3CHQA 1KEML 3T9WA 5J57B 1K9TA 1NC2D 2NUPA 4YHOH 1H3UA 4KXBA 5I76A 5IUSA 4LP4A 1U8LA 4TLSA 3O3BB 2XV2A 3F2LA 3I50L 4KKLC 4P9HH 1A9VA 2G5BB 4FQXD 4TUOA 2UZIL 4MD5B 3GSVB 4RFEB 1FGVH 2P8PA 3KPQA 3KLKA 5IVXE 5CJ5A 3Q6GH 1R3KB 4E36A 5EZJA 3G5YB 1G7MB 1BCIA 1U92A 1FO0B 5DZNA 4CSSA 4NKIL 3C12A 2VZ3A 3HMWL 5GJTL 3A6CH 4G7QB 4JCMA 1ROCA 3S35H 4I5BB 3QHZL 4ETQA 2TRHA 3TEUA 4GSUA 1RUPH 2OI9C 1BVNP 2RHEA 3R0NA 4I0PA 1KWKA 1E3ZA 3NAAH 2GHZA 4G1EA 3CHSA 3J07A 4NQUA 1G94A 4TL4A 3FCTA 3ZOAA 4NC1E 3MNVB 2CWRA 4CN6A 3PWPA 3VGAB 4KQ4L 4U6HA 3P4NB 3O0LA 4X5WB 1AJ7L 4N8UA 4AJ0A 1T5WB 4LCWE 4M4RB 4OTXH 4UTAH 1LNUB 2OW7A 5DFVC 3S96B 4MNHA 4DUVA 4BELD 3LDBC 4YX2L 5IEHB 1KB9J 3SCMC 3FU3A 3QUKB 5LWYH 3H0TA 1AR1B 1BEXA 4X4ZA 1RK1B 3RTQD 4MD4A 4FFYL 4OCNC 4CBZA 2VL5B 4KRMB 1S6NA 2I27N 3IDGB 2CR0A 2HMID 3HE7A 3CXHJ 3D07A 3VX0A 3VWJD 3NP4A 3BKMH 1MQKL 4N0FB 1FVEB 1IILE 2YEZB 2AJSL 2ZOKB 1CZ8L 2ZKYA 2VXTL 3UEZA 1NLDL 1WWWX 5E5MA 4POUB 4G6AC 4ISVB 2UUDH 4R7NA 1NCBH 4XNMB 4TLTA 3I02A 3B9DA 3M86A 5SWZD 1HWGB 4HETA 4S1QL 5B1JA 2EVHA 5T3XH 1EERB 1UWEL 2HJFB 3L4UA 3O3EB 2EYRB 5KYXA 1SN0A 3PCYA 3UPAA 4KJPD 3PWUA 3M46A 4XCNB 4PCKA 2P24B 3MRPA 1HK6A 4IHOB 4JKKA 2ZOOA 5MI0C 4OY9A 1TVHA 1M7UA 4WAFA 1EGJL 1FFPB 4Y4KD 3GSUB 3GXFA 5E2UL 3ZQWA 5KUMA 1JPTL 4OV5A 4GG6A 1CE6B 1KLFA 4DEPB 5DT1L 3IJHA 1ID5I 3D3VD 1S9VB 3MQIA 3I75A 3OKDB 1CR9H 4ZBJA 1SJEA 3QG7H 5LG1A 5LBSL 2ADFH 4LCCB 4MX7B 4OB5L 5DD0H 5SWSD 3L5WB 1R34A 2WB7A 4M6ML 1HNGA 2MIZA 5K9KA 2X4NA 1LO0H 1XGPA 2APTA 4HUWB 4GS7C 4OCYH 2VITB 3RE0A 2A4CA 3LRKA 1HJCA 1TF4A 2QADD 1XBRA 4OZGE 3NFSL 7TAAA 5K39B 1GYAA 5IROD 5HGGS 1RZ7H 2K8MA 2VMFA 4UYQA 4FFZA 1OP5K 2DWEA 1CFNA 1CICA 3DO7A 2CLZB 5K69A 5CGBA 4YVUA 5C0DA 5F96L 3T1WA 1ZK9A 3OB8A 3K6SB 2GFBB 1RHHB 4KROB 2HLAB 2QPFA 4EIGB 4NKIH 1NLBH 3UTOA 3MDJA 1A66A 1QFUH 3IU4L 4HBCH 2ZAGA 1VZGA 3QHZH 2LU7A 4OZGB 3SKJH 2CBOA 3BWSA 2E59A 4PJXF 3K80A 4WWOA 4AW4A 1KCBA 4MJJA 1WLHA 5FCUL 1DCEA 3NESA 3LSOA 3CVDA 3HI1A 3ZDZF 4GUQA 2BNRA 5CM1A 4JKLA 4KQ4H 4DKFL 3TF7C 1AJ7H 1F4YL 3WIHL 1E8YA 1EJ8A 4GBXD 3DX6A 2ZG3A 2R2HA 1RJCA 4J7RA 4BYHA 4Z3IA 2R9HC 3ENEA 2XTSA 4ABQA 4BQ9A 2G2PA 2Y24A 3TASA 2YC1B 4R26L 3G6JA 3HLAB 3ABZA 4BH8B 1QABA 4L4TA 4JN1L 2IPUG 5J0BA 1BQKA 4CVWA 1MFDL 4HK3J 4GEJA 5AB1A 4KDWA 1QSVA 3HS0B 3PJNA 4X42A 4QT5B 4W6YB 2WIIA 1NGZB 5JMOC 1FNHA 1FVCA 1T1WA 5AEAA 3BAYA 1IEBB 2PMZA 3RZCA 1E4WL 5HYQA 1JGEA 3CIQA 1XFPA 2AJSH 3L4VA 2B08A 1DEDA 3WS3A 1IAOB 3HI5L 1LVEA 3GEWB 3P11L 1VIWA 2QQLH 1NLDH 2X41A 3D12B 3MAWA 4HUUB 5HGBB 1O6SA 3GB7B 3SPVA 4M00A 2P7TB 3TOPA 2OXGA 3QDHA 4G9FE 4RAVA 2YGVA 1XSIA 1UWEH 4ZYKB 4LSSL 3OKMB 4PG9B 1QWNA 1R5WB 5EHFA 4AZ8B 2C3VB 1IC5H 3L9RA 2RTTA 4JY6B 2BSEA 3LNEA 3OHXC 2J56A 3V0JA 3DECA 2WKLA 2XVGA 1AS7A 3K2MC 2YA1A 5A3IC 1M6OB 3LZOA 5L8LB 1GZHA 2H8PB 4I0KA 1P7BA 3NSCA 1T04A 5E2UH 1XGYH 3FQXB 5E2VL 3SDAC 3MREA 3JT2A 4KUZH 4PRDB 5DT1H 2EYSB 1LE9B 4P3WA 5EF3A 3PG2A 4R83A 4N22A 1E9OB 5DZPA 3VFVB 3VCLA 1J05B 4MKMA 4JDZA 4LMQI 4OB5H 4IW4C 3V9CA 1XSOA 2HG0A 3QDGA 3ES6A 4EIBA 3BH4A 3BP6A 4UU9A 3TN0A 2P80D 4WI4A 3Q2WA 5C0CD 1RJLA 3CFDB 1XCQB 3NFSH 4KZEH 1E4XI 3U7WL 3N06B 3GTNA 1FL6A 2DM7A 2WY3B 4XODA 3VFUB 4DVRH 4DUWA 1JZ8A 1YEFH 4ZMNA 1N7ML 3ZQ9A 2ZUXA 3MRNB 4F7CA 2DL9A 1SJHB 4A7SA 1S7XB 1JHLL 4MAYD 4XB8A 3NK3A 5AKRA 3WJMB 2CXKA 4PJGA 1Z66A 4K5LA 2JTDA 3VRIA 5EUKA 1ZLEA 2YPVA 4OI9A 4S1DD 1QATA 3FQRB 4NZUH 4PW4A 5IZ7A 1ND0B 1MCDA 1YA5A 3L3GA 4Z18A 3RX9A 3DO3A 1E7VA 4JE0A 2VLMD 4QXUL 5MEOB 5EFIA 1CT8A 2J73A 1JCKA 3DMMC 5I24A 1DBJH 4DEWA 3O8XA 4XX1G 4A66A 1PG7W 5FCUH 1JZHA 3QIUC 3IKCB 2YRZA 4E42A 2QVIA 2AEQL 3MBEC 3FAXA 5AVYB 1U8MA 3LKPA 4OLUL 3FTSA 4J6RH 4J3UA 4K94H 4UNUA 2EYTB 2J5LC 5D55A 2C4XA 1XR8B 5I6XB 1RP8A 2DTSA 2ESVE 2WLZA 2VDPH 4HQQL 4LESA 3QJFB 3IETB 5KS9E 3LQZB 4XXDA 4K71C 4O2CB 2VW6A 4JN1H 3TVMC 1I7UA 4LLUA 1MFCH 3MO1A 1NKOA 2JJTC 1NBQA 4GUPB 2ADIB 2X05A 2CA3A 2X42A 3RWFA 1IC4L 2Q3ZA 3FU8A 1E4WH 4JO8A 1IV8A 3RFRA 4APQA 2PP8A 5TH2A 1E5BA 3W38A 2XI9A 3JZYA 5T1KA 3HI5H 2BMKB 4G42B 2ESVB 2QPSA 1J10A 5GGVH 3Q5TA 4HPYL 5KS9B 2YD3A 3QUYB 1YPZF 1KBBA 2HT4C 3DETC 4BZ1L 2B5IC 1A1MB 3DVGB 2D3VA 2ZONA 4BQBA 5D8JL 4KXZH 2R7EA 3IJ9A 3MCKA 2GHWB 2PXYC 2PP9A 4W81A 3U6RA 4NUQA 5CU5A 3INUH 2X2HA 4P5TB 4NO2B 4JFDD 2BSTB 4L8BA 5EN3A 3NZ8A 4PR5B 5B21A 1MDAA 3SE3C 1AQHA 2HT3D 5IREA 5E2VH 4JB9H 4PEEA 3BGFB 3D0AA 4UOW0 3VXQB 2XIIA 1N0LB 1TYRA 3VXSA 2QLYA 4LVOB 5GS1B 4RWYH 3AADB 4YK4B 2YQGA 1J1OH 3U7YH 4F9LA 2NX5B 1U8CA 4QKTA 1V7NL 2OMXA 1CGWA 4PGZA 4K0OA 4NKMB 4ADGA 1JGIA 4NUGL 1CGXA 1K4DB 1EO8L 2X87A 2ZWZA 3BP7A 4NWTH 1KT2A 3VG0H 1AR2A 1FAIH 1W9XA 5IIEA 1OCCB 5J3HC 4OM1H 3SDDD 4E9QA 4OH2A 2WYIA 5FA4B 4JPWL 4GKNB 3GD1C 3RL2A 3VG9B 1QMUA 5JIPA 4MDRA 1GGCL 4XO5A 2K6WA 3MXWL 3ZRCC 4AIZA 1QI5A 1MKFA 4H0IA 2W07B 3BPOC 4EQ3A 4MZRA 2AV7A 1OK8A 1VFAB 4OJFL 3RVVD 2OCJA 1ANUA 2G0LA 2AABH 1FC1A 3RAJL 3A21A 3INOA 5T3XE 2A6IB 3BIKB 3M1OA 3HG5A 3MLSL 1GIGL 4OV6F 3RGVD 3CFCL 4XAKD 3ZE0F 2HWZL 3QEGL 5IQNA 3K72B 4ODSL 4QXUH 4OFPA 2WNGA 4FZ8L 3MX0A 3UACA 3MROA 4N20A 1K4CA 1UZ6F 3KPLB 2ZZUT 1H9VA 3KPSA 4HIIB 1W8EA 3BZ4A 2AEQH 3MRKB 3H9SE 1TFHA 4YJZL 4Z7QE 1ODAA 2F8IA 4ZPTA 4D94A 1HT6A 4XH2B 4OLUH 2Y36L 5IMOA 3KS0J 4HKJB 2NNXA 3C2AL 4CDGC 4ZW3A 2V7NB 4I2XA 4WO4C 3HOGA 5EA0L 1PQZB 5GRJL 1T0MB 4JJOA 2GUOA 1V10A 1DVZA 2UXTA 5JUEL 5CCGE 4JMNA 1MWOA 2V5YA 4HT1L 4LSPL 2GSIB 1LGVA 3GRWA 4HAGA 3IJ8A 1CK0L 3QAZC 4P46D 1EA9C 3GMLA 3MRGB 1E8WA 3H9SB 3P0VH 1IJNA 1IC4H 1E9QB 2N0MA 4Z7QB 2GIMA 5C1MB 2FWSA 2VQ4A 5SX5K 4KITB 1IBZA 3PP3K 4GMSL 1XQ4A 4K3JH 2OM5A 2RFXB 2A9DA 3HMXL 2OR7A 4F5CE 4HPYH 4UTBA 2RALA 5K1VA 3ZR6A 3V9EA 3MUHL 2XWZA 1JPST 3JYBA 3HJ0A 5HPMA 2JJVA 2BP8A 3UZVB 3EGSB 2G9KA 4AXWB 5JO5A 3WFCL 4UQ3B 5FV1L 2UZYB 4ZMWA 5IMMB 5E9DB 1JN6B 4QOKE 2NY5H 4L23A 2QKSA 1VLXA 4P9MH 1EDHA 4G8IB 1KFAL 1BECA 2B59A 2YRPA 3CDGA 2QGDA 5KTEL 3QAQA 5JHAA 5D1QE 5D1XE 2WANA 2P8LB 2YO3A 3LVEA 1GVIA 4I77L 4XVUD 1E9PB 2A2QT 1L9RA 2IPTL 3QUXA 4GW1A 1A4KA 1IAIH 3EOYG 2CNYA 4NUGH 1AGBB 3U48A 3H7BA 4QOKB 4MASA 5MP6L 1QBLL 2IOOA 3J27A 1U8NB 1F8TL 4HZLB 4P04A 2VLRA 4L8CB 3Q3GA 4PJBA 5SX4I 2E27H 5ALCH 4JPWH 2XA3A 5TDOB 4Q52A 5D1QB 4O2EB 3MXWH 1PNDA 2HCZX 4FQPA 5DJ2A 4R97B 1SFHA 1FFRA 2EEAA 1EFXA 4CUCA 4M7LL 4FHJA 1KPRA 5LGKA 5DMKB 5FFOA 5ID1A 3PHAA 5JPMA 1JF6A 3WDIA 2KERA 3FT4B 3MLSH 1GIGH 1RZPA 2QKIC 3GMNB 3IMUA 2DEXX 1T7VA 2HWZH 1D7DA 4UQAA 4LQFL 3W0WA 4FZ8H 3SE4A 3GBML 1ZA6B 3LPOA 5IR1A 1CGSH 3FQNA 3QBTB 2F53D 4M43L 4JRWA 2XG5A 1OAUH 2Y5TA 4HVBA 2YHGA 4GAGL 5B8CA 4PFEA 3NCWA 2GW5A 2YAOA 3NZSA 4UV4H 4GW4B 3C6LB 4JM4H 3SDXF 3TBVA 3FT0A 2J6EL 1HL9A 2Y36H 3NVQA 3UYPA 5L9DL 3OR6B 5DJ6B 5EU6E 2HKHL 1JZIA 1IAKB 1KPVA 5J1AB 4FABL 1CIDA 3RIAK 3RFZB 2CG9X 5B39B 5TE4L 1IM9A 2D03H 3K81A 3TEWA 5DF0A 2D7PA 2BC4A 2EH7H 3SKUD 3HB3B 4HT1H 1BJ1J 3VNYA 4M5SA 1GZPA 3FFCB 4Y4FC 1KYDA 2HFGH 1MF2L 3IS1X 3RWEB 3AXLA 1F18A 4MQSB 4ODUA 4ZD3L 4D0DA 4L9LB 1PZAA 4CA4A 4CVXB 4DTGH 4NBYB 3FTVA 5D7EA 4L3EA 4XMVA 4LLQA 5EU6B 1QW9A 2PO6C 2CKBA 1X7TA 2VXQA 1A8JH 3VTTA 4AV4A 1KG0B 1KCLA 4PRIA 4BK5C 1M7XA 2E56A 3VXTA 2VT0A 2ZOWA 1FJ1B 5C0BE 5I6LA 1JHTA 4WHTA 1D6VL 5D7IE 1A6UL 2XN0A 4FXGA 1SYVA 5DXWA 5DURB 5KBNC 3V5DB 3BH9A 2A0LD 1IBYA 3DYOA 4N90D 3BQUD 1D5RA 4NP4L 2A6JA 2EDHA 1JXKA 3CSGA 3FH7A 4NO5A 1BEYL 4AGLA 2BOLA 3BZEB 2LFEA 2P46B 1XGZA 3OF6D 3FO0L 3QJQB 3BT2L 1CFVL 1P6AB 1ODUA 3FUNA 4ZG1A 5BZDB 3BESR 4JPVL 4P48A 5KTEH 5C0BB 1COBA 5D7IB 5F89B 2X4TA 3BJLA 3QDJE 1KJ2L 5IJBC 1S7RA 3FUEA 2QSCL 4NT6A 5FHAL 3S36X 3UPRA 1A7BA 1WT5C 5ESVB 3BIBX 1R0AL 5D6DC 3LCYA 4PREB 4AQ1A 3GPSA 1MCPH 3S5LG 1QUNA 1VFMA 4XNZB 1YNTF 1K8DB 1FZOB 1P7QD 1QBLH 3WMSA 4U4IA 1ZT4A 4NZ8A 4XO3A 5JR1L 4M1DL 5CLZA 2QFPA 4UQIM 5D4QA 3EJCA 3TO4B 4Z5RB 4MYPA 4DZ8A 3IMSA 3H7LA 3D85A 2C1PB 3QDJB 1JVOA 3FO9B 4NHUB 4QRQA 2VDPB 1KTRL 2W65A 3ZMRA 4ZXBA 5IVOA 4BWTA 3ARXA 2DDQL 1CU4H 1PEWA 3QQ9D 1ETA1 2IMMA 3MKGA 3OZKA 2AEPH 2C3GA 2R0KH 2DIEA 4Y89A 3ZTEA 4AV0A 1VADB 1U8HA 3NDYE 2OMWA 4J3XA 3RKDD 4YSQA 2E7LC 3ZE1F 4MMZB 4M43H 5FOBB 1SZNA 2YD1A 2CMRH 2ICWB 3IU3A 4HPHA 2D7OA 2UYLA 4B9IA 3TBSB 2Q8BL 4LIQH 2BERA 3OPZL 4ZUVB 1JZ6A 1TKWA 1WWCA 5CAYB 4XO8A 4AQAA 3FTYA 4ZMVA 4YS4A 5D9SA 3MFFB 4EOWL 3N44B 1URLA 1HILA 2J6EH 2JB5H 3AMLA 4JRXA 5DVLA 1SJMA 1HNFA 2K9FB 1ZK5A 2E9IA 2HKHH 1A7PL 3RX5A 1K6QH 3V0GA 2VTFA 5GS2D 4OSUL 3V4UL 4G70B 1U8IA 1WZKA 1C8PA 2X89D 2X2YA 3AFLA 1QLEL 3NCMA 4U3SB 2ED6A 4ZFFB 1T89C 2IAAC 1U8QB 3N1MC 5HI4D 5A2FA 1C8QA 1F56A 3DC0A 3QFGA 5FGSA 1A3QA 4Z0XA 3QPXL 4KO9A 5DZLA 4ZD3H 4M8UA 5JHDD 3KYNB 4UI2A 5F0JB 5J4MA 4H1LA 3JVGA 2AGJL 2JKTM 9PCYA 4FXTA 4AQ8C 1A4JA 9CGTA 4JRLA 3C8KA 4G6JL 4X7TA 3O2VL 4NC2B 3SDCD 2IVFC 2B39A 1D5XB 3C5SA 3O2WL 3NABL 1D6VH 2MTPA 1UZ8B 2X44D 4IYKA 4XN9A 5E6SB 5I0YA 4G8GE 3S2CA 3VI3A 4TNVF 3IFLH 4BFKA 1VACA 4EQ2A 5IJVA 3CDCA 3KBEA 4AZUA 1T5KA 4PWEA 3UL4A 1KJ3H 1OPGH 4LHUA 2E74C 2GJ6A 3UTTE 3BLBA 1CCZA 4OGYH 2NYYD 2WLHA 4M7KH 3NGBC 1WWBX 5K59E 4IHBA 4PJ5D 3ZX1A 2FEDC 3EBHA 4W9IC 1QYGH 3GSRA 3WY3A 4WJ5A 2DW5A 3SJVA 5IMKB 2I24N 3CFKB 2G0KA 4WWKC 4AITA 3I6KA 4Z78B 1VFOA 3ARDC 4MJIE 3VAEA 1GYUA 6PAZA 5FHAH 2GI7A 4JG5A 2BS9A 2F19L 5GRWA 3PGDB 1WISA 3PP3H 3QQNA 1FL3A 1MHPH 1R0AH 5K93A 3TT1H 1FSKB 1AHMA 1DBML 4AVIA 2UXGA 1MREL 4PMEA 3L7EA 5ILTL 2D3JA 5JXED 5JZ7D 4YHIA 1HHHA 1XF5B 2GJRA 3TNNB 1FRGL 3QIBB 3WEXA 3GYRA 4IRJA 1IAMA 3KJ4B 2BWDA 4PRAB 1JG9A 2JTYA 4U0QB 4MJIB 1FA4A 2FIKB 3KWVA 4YL4A 1HQ4A 3R0MA 3B2MA 4NSKB 4CL7A 2I60L 1KTKE 2EDTA 2X6BA 2YXFA 5ICYB 2CDEB 1MELA 4RX4D 3FB7B 1GYVA 2DDQH 2W88A 4NQEA 4V11A 4ZSOE 4BD4A 1G1CA 3PFQA 3VX1A 3PL6A 4ESKA 1O5DT 1HN1A 3IRCA 4TVUA 4P23C 3RQ3A 2COVD 2VM4A 4XMKL 2D4DA 1XBDA 3OKOB 5KANI 1CYXA 4UM9B 1CTOA 4JL1A 2VXVL 2OAAA 3S3DB 3LV3A 5IG7B 3PQYD 4PJHF 1EVTC 1SLUA 5CCKL 1E5CA 2BH0A 2PP7A 3EG9A 1S7SA 4EOWH 2JF1A 1ZVSA 1GC1C 3IGLA 4E5XA 3K6FA 3QFJE 2CUAA 2EDQA 3DTXB 4BK8A 3FMGL 2LFGA 3JWNC 5DJZA 3N2JA 4HX1A 5DRNB 3SBRA 4KQ0A 1QLEH 1R1CA 4F9PC 3WNJA 3JTBA 3QHTC 3PHOA 3TFKD 5DS1A 5BRPA 3GS7A 3QPXH 5LAXA 4ELMF 3CMOL 1I8KB 4F57H 4JG0H 3IVKB 2I07A 3EOBA 4JVPA 4E41A 1F90L 1H9DA 2AGJH 4ZT1A 3T2NH 4G6JH 1KXHA 3O2VH 5KBDA 4PJEA 5KAQG 3VXRD 3P4LA 2OXHB 3O2WH 2OYKA 2FATL 3NABH 3LZPA 4OFIA 5DWUL 1NDMA 1AGFB 5EB9A 4DVBA 1RIVH 4J27A 3FH5A 4ODWA 4TPRL 5EC2A 4EUPH 4FA7B 4JM2F 1ETZA 1P5VB 5GGTH 1OF2A 2DMKA 2EEDA 1DJSA 3CPLB 5DUMH 4ZMQA 3ZTJG 1PL3A 1HOCA 5T33L 1I3UA 1L3WA 1SJVA 3B8SA 3OGCB 1PX4A 4PP1C 4KDVA 2PUQT 2P49B 1WBXB 3H1ZA 4YDZA 4YN3A 5LNDA 4JFPA 1XH1A 3UYOD 4NKDB 5DD3L 2OI9B 1GHFL 3WFEH 1E65A 3EDJA 3L7FB 3H53A 3TTSA 3T0BA 4GNKB 3U4EA 4XNQB 2DQDL 4XHQA 2CHNA 4G59C 4NQDE 1MFMA 1IGFH 2XBZA 3ZTNH 2F15A 4ZFZA 4UOW1 2P8MB 2Y06L 1FYTA 2AERT 5ILTH 3LH9A 4P2OC 5ANME 1VF5C 1QBBA 1N5AB 1BYNA 5KOVC 2ATPA 2WWKO 1FRGH 3SCMB 1SM3H 1A6ZB 2AQQA 2YEVB 1YUKB 4RRPG 4FQLL 3RDTC 1R4XA 5AVRB 1F1GA 2I60H 1BQRA 3A4FA 1CFSA 3CSTA 2WGXA 4KTEL 2VSCA 3RWCA 3TH3T 4NQDB 4V33A 2YPLE 4MJ5B 1VFUA 1HE7A 3MNZA 3HPLB 4YL9A 4AK2A 1JNHA 3IJSA 4KZDL 1R5VB 3E3QC 4JM2C 1MOEA 4PV9B 5ANMB 3LHAA 2FGWH 1FZMA 1AXSA 1NC2A 2GY7B 1CBVL 4HDIA 4A2MA 4AYBA 1Z2KA 3UJTH 3H3PH 2C7FA 5F9JA 4UZGA 5JOFB 4TN9A 2W9DH 4N6QA 3TNMB 3U0TA 2Q1EA 3V0EA 3QQ4A 1AE6L 3R18A 3JTSA 1S8DA 3LEVL 3L3HB 5D4JA 4ADIA 4PY8J 1DVSA 3MLVH 4BFIA 3W11C 1PCXA 3WUWB 3CJJA 4FF9A 4NWUL 3CZNA 1BQLL 1T2QL 3QW9A 4K23L 5EO9B 1QI3A 2QPDB 3I9GL 2OK0L 5D2LF 4HJGB 3KL0A 1KYUA 2H32A 1BSIA 4R3SB 4JFXA 1Q9WB 4QLWA 1E4JA 2YMTA 2Y9RT 1IU1A 5JIIA 1HH9A 4XP6L 4I3GA 1Y1UA 3WN5B 4PGBB 3MGOA 3ERXA 4IEFB 3CMOH 4I9WD 1PGRB 4FNQA 1MW1A 1F90H 4U3HA 4YE4H 3WHE0 1TU2A 1BZ7A 2CIIA 4RSVA 4AJVA 1F3JB 4GS7B 1JZ5A 2V2XA 3GGWA 2EIZB 4YSAA 1JPFA 2PYEE 4N4YB 7FABH 1P1ZB 1TEGA 2FATH 2XPGB 5I30H 1Z0NA 4I89A 4AQEA 4WV1B 1MNNA 2VH5L 5DWUH 4EN3C 1O7SA 2AJUL 1RZ8A 3HTLX 4N26A 4MNGA 4TPRH 1ASPA 4XNAA 3TV3L 3VW3L 4LL1A 5A1AA 1TOXA 3NQIA 3RTQA 5CBAB 1VERA 1T7ZA 4KOCA 2HTLC 2XN9D 4OD3L 5EOTA 1G1YA 1MCRA 3CVBA 3KWWB 4LXFA 3SOBH 4Z7AA 2CBPA 2Z35A 4X9FA 1OE1A 2V0AA 4HUXB 4LT7A 2VDKL 5KSBF 5GIRA 1YNKL 5INDB 3BEVA 2PYEB 4NLAA 4WTZA 2AK4E 5AVWB 4BXVA 3QFDB 4HHAB 3QZWA 2Y1YA 2CRYA 1GHFH 4F93B 2QZ5A 5E9NA 4M7LT 4PB0L 3GXPA 2DQDH 2IJ0C 2MQ3A 2OJEA 5SWZA 5IMLB 1ONQB 5I15L 4ELKB 5A16A 2J8OA 1EAPB 5C9JA 1CIUA 3IWVA 1U8OA 3RBSA 3QUYD 2W5PA 2PWEA 1GOGA 2CDGB 3M1CA 1SXAA 1H6EA 3IWUA 3NJMA 4WU7B 1KBWA 5BUPA 1EEZA 2Z1PA 3PABB 1OAXL 5BW7C 5C6PB 1MCOH 1KLUB 3U2JA 2HX9A 5FYLL 4NN5C 3JTTA 1TCMA 4PJXE 5EORH 1DVYA 4PUBL 2V6HA 4UIMB 3B9KB 1S7WA 1Z5YD 3T71A 4B9FA 1IKOP 2EDMA 1OGAD 4KZDH 5ICXB 1WFNA 2VDNL 1HL4A 1EANA 4HCIA 4ONHB 4FTDA 4FFWD 3TJEL 3ZDZE 2EE3A 3VFNB 1JGVL 2ZXCA 4UINL 2B0SL 1AHKA 5IROA 2NX5D 1O6VA 2Q7AA 5DK2B 3V6OC 4AUUA 4EDWH 2BWIA 3Q7JA 4EIZC 1PY0A 4PJXB 5BO0D 1AE6H 1F13A 1NMAL 2IV9A 3MJ9L 3OHXB 4X6CA 1HKLH 4PRPA 3U46B 2WGNB 4OGQC 1BQLH 4DP0X 3ZDZB 1ECZA 4M7ZB 4JO4H 3K6OA 5CP7A 2EIKB 1WFTA 4YHLL 2HPOA 3H4FA 2CD0A 3SDAB 3BUQA 1C9SA 5AW4B 4JHVA 5GZND 3SYCA 3V7AG 2ZOUA 3VU1A 4NB7A 1PKQE 2DQUH 4RMBA 4XP6H 3VXMD 4HH9B 1WAEA 1WBYA 1TLMA 2UWEA 2XPZA 4NNPH 4AMKL 1MCSA 2QLVB 5T5NG 3M17A 2ITFA 2DQCH 3U9UB 1KJ2B 4AIEA 3U6XA 1R3HB 2OX5B 2WJ7A 2NY7L 1F2XK 4PLKC 1NA8A 2YUVA 2A73B 3VXOB 3DXAE 3LRLA 1HEZB 2VH5H 4J3WA 3ECQA 1WDAA 5JW5A 3O3AA 1TNMA 3B2VL 4JG1H 3WI9A 5TE6L 1AD9B 1PKQB 4K9EH 1N0XH 2FL5B 3QXDA 4M61B 4UT6A 5DDHA 4D0BA 1T20B 4WEMB 4DPRA 3GPEA 1EZSA 3F04A 3LS5L 5F0MB 1Q9OA 4HFWA 2FBJL 2J2ZB 2VDKH 4X8JA 1CQYA 1A0QH 1YNKH 3EO9L 4G8FB 5FUOL 3O6FB 4DEUA 4CC4C 2UX7A 3D05A 4O2FA 1EAOA 5D5MA 2P5EA 3DXAB 4AYGA 3DMMB 4ZFGL 1ZANL 3EHBB 1VZHA 3ULUF 3QIUB 3ULSB 4EI6A 2DY2A 2WNXA 5L2JA 3BH8B 3FN0L 3B83A 3BC9A 1PBYA 3AJ7A 4BSWB 3KPRD 4Y9CA 4WHCA 5IOPA 2DQEL 1QPPA 1A4BA 1H0DA 3ZE2F 4H7VA 4W93A 4U6YA 4BUQA 3A5VA 1BREA 3CHXA 1NC4B 4X6FB 4Y1AE 4LEXL 1A6VH 1JDCA 3LH8A 3B37A 4X5LA 3KG5A 4N2IA 1OAXH 3TZVC 3TVMB 1UWGL 4KV5F 1KCRL 1BD2E 2Q5BA 1J18A 1PLGL 4XN4A 3IDIA 4YDIL 5E9DD 4CDHA 1DJXA 2X9XA 4PJCF 1QRNE 4OBRA 2WXGA 4PJ8A 4PUBH 5C6TL 1N8ZA 2J88H 2JIXB 1QLEB 5HGDA 1INEL 4KDTA 5D7JB 1YECL 3TJEH 3GXIA 4LKXA 1OW0C 4R8WH 2P80A 4OJCA 3LKSB 4DJMA 2PCXA 3X3FH 4ZFOA 4HH8A 5C0CA 1LEIB 1LWJA 4LSVL 2B0SH 4FG2A 4HV8A 5F88B 5I5JA 4NQQA 2YFNA 4BBWA 3C75A 1GC1L 2EXYC 4IRZL 4YSSA 3F05A 4IOSD 1AMYA 3EJUA 1V7ML 2Z7YA 4A67A 4QOKD 5I74B 1O7DC 4MMYA 4WKXA 5BRZE 4JFEB 3P3TA 5AVQB 4X0KA 5T3ZL 3B2UC 3PWLA 2DPKA 1NFDF 3SKNA 3ULUC 3STBA 1Y1DA 4EUPB 2X4PA 1GGIL 2DYSB 2R2CA 4XCYB 3CBKB 1OAKL 1PZSA 1UD8A 4JVWA 1JWMB 4WGVB 4KQ3L 3OXRB 2D31B 2FJSA 1UD4A 5ITBL 1EPFA 4JQVC 3FT3A 3K0YA 2XACC 4HWEL 5BRZB 3SQBA 2R69A 3QCVH 2OTWB 3PWNB 3O45A 4G6MH 4MB4A 1JYXA 1JZ3A 3SY0A 5CJXC 2VJ8A 4BDVA 3JV6B 1BVNT 3Q01A 4HWZA 3RGBA 1B2WL 1HYRC 5DVNA 5SWQA 3PV7A 3WN6A 4XPHL 3BIAX 4PJAF 1Z9MA 2DLFL 5DUBA 5I1LB 3FU5A 3N1PC 1HHJB 5TE6H 1CXIA 4JZNB 3UCRA 3VGFA 3BCFA 2BIPA 3T0EA 4LCUB 1FZKB 3UJJH 4K5PA 4PCYA 2YAEA 1R6VA 1EWHA 5F7FA 3EBAA 1YPZB 4TVPL 4TRPH 2X4QB 4JZJC 4NAQA 2GAZB 2DKMA 4I3RH 1MDTA 4JDEB 3VWKC 3IDXH 1KB5A 3NJFA 1BYPA 1MRCH 2WUBL 3FOMB 1KPUB 5KBPA 1CDUA 3HB3D 2A1WL 3ZMNA 4F2ME 2H2PC 5CD5D 5J9PA 2DQTL 2OCCB 3FFCD 3HG1E 1ZANH 4JFSA 3ZRSA 5MEPA 1WFOA 3DHUA 1YO4A 4KMQA 4JFFB 4RZCA 2YD8A 4E0RB 1FFNB 3RY6C 2JKNA 5B38A 5EU6D 4L48A 1Q94B 2VMEA 2D8KA 5D7SH 5CEZD