3CVCA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvcA00
5PAZA 2P80A 4K9JA 1KV7A 4GXFA 4KOBA 1E67A 1AS8A 1HFUA 3QJSB 3RYMA 4YSPA 2PCYA 3CVDA 4P5SA 1TKWA 3NSDA 6PCYA 2YAEA 2FWLB 3QPKA 2FT8A 5B1JC 2BP8A 4DP2X 1NTDA 3T71A 1CUOA 5AKRA 3ZBMA 1IC0A 1SDDB 1X9RA 3PAUA 1AOZA 2CBPA 1HAWA 2P80D 4HHGA 1AACA 4RH4A 2UXFA 4A68A 4DP8X 1AANA 1JXFA 4NB7A 3AW5A 5I6MA 4A66A 1ILUA 1NIDA 2IWFA 4GP4B 5I6KA 1AZBA 1GS7A 1KDIA 3IE9A 2VSMB 1BXUA 2FQDA 2H47C 3CDZA 2UX7A 1KCWA 1NPNA 2YAQA 1NINA 3X2QB 3AG1B 4M4RB 2ZONA 2FTAA 2J55A 5B1AB 3PXLA 3BQVA 6PAZA 3SBRA 3WG7B 4FAAB 2FQGA 3MBWB 3NP4A 1T5KA 2GC7C 3S3BB 1OE3A 3CG8A 1AG6A 4KO7A 2QPEB 2IH8A 1W8EA 3CVBA 3DKHA 2OJ1A 3KW7A 3QJTB 5IY5B 1WA0X 2TSAA 2FNWA 2UXGA 5I5IA 2GB2A 2VW4A 2VW7A 4GP8B 4YSOA 4HCFA 1ASQA 3FSVA 7PAZA 1EZLA 4KO5A 4HHWA 2PPFA 3TA4D 2E86A 3QJUB 4DP0X 4YVUA 3ABLB 1OOWA 3V9CA 2PPAA 3QJRB 3FQ1A 1V10A 4E9SA 1SF3A 1VLXA 4BWTA 4X4KA 1JXGA 3SBPA 4YSEA 1PNCA 1PZAA 1TU2A 1RCYA 3UAEA 4AI7A 1CYWA 2YAPA 2B08A 1MDAA 4M3HA 4AKPA 7PCYA 1QNIA 3GYRA 1SNRA 1ZIBA 4GY4A 2BW4A 2UX6A 3T6VA 4WTQA 3NJIA 4MFHA 2GHZA 3WKQA 1JZGA 2JKWA 5ANHA 3H4HA 1A4BA 1X9UA 2W88A 4JHVA 3ERXA 2IH9A 1ET8A 1JVLA 3ABMB 4G71B 4DP1X 1XB8A 1SHWA 2BO0A 2BP0A 2I7OA 3UADA 1ZDQA 1BQKA 3QJVB 4ENZA 1PLAA 2FJSA 1QHQA 3NT0A 1WA2X 3EH3B 1AS6A 1QLEB 3SBQA 1AG0A 1SHXA 4UF7C 4HAKA 1M56B 3TBBA 4F2FA 4BDVB 1FA4A 4A2FA 3ABKB 2Y1AA 2DY2A 5I5JA 2GBAA 2XV0A 1M9WA 1SFHA 1FFTB 4YSCA 2FT7A 3IN0A 2BW5A 3OMIB 1ASOA 1XMEB 2WO2B 2AZAA 3S8GB 5B7FA 2HX7A 3N55A 5PCYA 1PNDA 2H3XC 2XX1A 1IBYA 1E65A 1ETJA 3EH5B 9PCYA 2ZOOA 4NAJA 1JZHA 2R7EB 1JZJA 3IBOA 3D12B 1WS7A 3DIVA 1JERA 1MG3C 2Y69B 2HRHA 1A8ZA 5F7AA 1A65A 1AS7A 1RKRA 4KO9A 2EIKB 1ID2A 3X1FA 4KNTA 3WI9A 4F2EA 1EHKB 3JT2A 3QQXA 3NJGA 4A2HA 3AZUA 2VM4A 4WKXA 1BYPA 1E5YA 4FA7B 1L9TA 1YLBB 2GSMB 1RZPA 4BXVA 2OCCB 4Q8BA 4HIPA 4BDVA 5B7MA 3PAVA 2AFNA 2Q9OA 3X1NA 1AZNA 1AZCA 5I6LA 3CVCA 2EILB 3V9EA 3T6WA 2ZWNA 3NSYA 8PAZA 1GR7A 4E9XA 2CAKA 2BHFA 5B7EA 2VSKB 2LLNA 1ZPUA 3PAZA 1XB3A 4CSPA 1E30A 2PP9A 1JZIA 2QDVA 1IUZA 4YSAA 5B1JA 1NIFA 2QT6A 3SQRA 3H4FA 2OV0A 2XV2A 2CJ3A 3NJKA 1ET5A 4KNSA 2PP8A 5E9NA 4YL4A 1PY0A 2CUAA 2XYBA 4BWUA 2HX9A 3TU6A 2PCFA 5LDUA 3H56A 5I28A 3WNIA 1L9QA 4DPCX 3EHBB 1JXDA 1A3ZA 3AG4B 4BK5C 3AG2B 2X87A 1ZIAA 1SDDA 1PLBA 1NIAA 3OM3B 2JXMA 3FQ2A 1AQ8A 4W1TA 2EINB 5B1BB 3X1GA 1FWXA 4BWWA 2PPEA 4JKNA 1GYCA 2YAFA 1GS6X 3FSZA 4HCGA 3NJFA 4YSRA 4DPBX 2I7SA 3GDCA 1HAUA 1L9OA 1IKOP 3NJNA 2PLTA 1TEGA 2BWIA 3NP3A 1OCOB 2I85A 3DTUB 4QKTA 1OCZB 2IWKA 4YVNA 4A2EA 1L9PA 1NDTA 3FS9A 5D4JA 1UATA 1B3IA 2XVBA 1NPJA 1NICA 1JZFA 3FU8A 4E9RA 1MZYA 5B3SB 2QDWA 1PAZA 2XUWA 2YQBA 3C75A 3EF4A 4PCYA 2GIMA 3NSCA 2DYSB 2W8CA 2HZHA 1J9RA 3OD3A 3FU7B 4GYBA 4GP5B 2YAMA 2YARA 2AVFA 1J9TA 2PPCA 5EHFA 2DWTA 2IDUA 2Q5BA 3N2JA 1A4AA 2HXAA 2GI0A 1KCBA 1GSKA 1AZRA 1J9QA 1NWOA 2IDFA 1BEXA 4E9YA 2PP7A 1ASPA 2BZCA 4P5RA 4BXSV 3FSAA 3JTBA 4G7RB 1AR1B 1NIEA 2H5UA 5I6PA 1DYZA 4A2GA 1ILSA 3NYKA 1PZCA 2BP8B 2IWEA 2HX8A 3TASA 5AFAA 1BAWA 3S3CB 5I6OA 1WS8A 3L45A 1OE2A 3TBCA 4ZK8A 1MG2C 1W6WA 4AKOA 2BWDA 2X88A 3KW8A 2EIJB 2AZUA 1L9RA 3GXUB 4YSDA 3G5WA 3ZX1A 4G7QB 3S8FB 1BXVA 1WAEA 3OMAB 1KBVA 4N8UA 1V54B 1OE1A 3CDZB 2B3IA 1IBZA 3PLYA 3NJLA 5D4HA 1BXAA 2XXFA 4PAZA 2XLLA 2MRYA 4DP7X 4DP4X 4EF3A 3IN2A 3ZDWA 1AZUA 1KYAA 2XWZA 3WIAA 3WKPA 2YAOA 1NIBA 1PCSA 1V55B 4F7KA 2AANA 2J5WA 1PLCA 2BZ7A 2UXTA 1JZEA 2VN3A 2DV6A 3BVDB 1CYXA 1OF0A 5AZUA 4E9TA 2N0MA 4AKQA 4QLWA 5I26A 2RACA 3WNJA 3FPYA 1GY2A 2YXVA 1URIA 1OCCB 2R7EA 5FC9A 2DWSA 1DZ0A 2FT6A 1WA1X 3T9WA 1R1CA 2WSDA 3CZUB 4G7SB 5A7EA 1ADWA 1I53A 1KDJA 1AAJA 4TXVB 1XB6A 3MX0B 4G72B 4DPAX 1ZV2A 2DYRB 2CCWA 4HZ1A 2VM3A 4YSUA 2J56A 4HCIA 4E9VA 2IDTA 4KO6A 4L0PB 1SJMA 4N4YB 1GW0A 1OCRB 1SF5A 3UABA 3AG3B 2NRDA 4YSSA 1ZDSA 1N68A 4YSQA 3IEAA 2FQEA 4JHUA 4AX3A 2FQFA 4A67A 2BP0B 5I5MA 2CALA 2IDQA 3FPXA 3ZIYA 3UACA 2A3TA 1MZZA 1PF3A 5TK2A 5TK4A 1BYOA 3S3DB 5F7BA 2HLEB 3PPSA 1NZRA 2XU9A 1N70A 1F56A 1J9SA 3X1EA 1PMYA 1A4CA 4UANA 3NJHA 1BQRA 3T6XA 3FYIB 1AIZA 2XV3A 2GC4C 2VW6A 4KNUA 1J5DA 3X1BA 2IAAC 2XXGA 5D4IA 3ASNB 3FSWA 2QPDB 3OQRA 1CC3A 4DP9X 4DP5X 2HRGA 2VMJA 3U25A 3QJQB 2YAHA 4Q89A 3OMNB 3FT0A 2PPDA 4NERA 1BQ5A 1J5CA 2ZXWB 4YSTA 3NJMA 3AY2A 3FU9A 1KGYE 2JFCA 5B1KA 1NWPA 1RZQA 5I6NA 1GS8A 1E5ZA 4A2DA 4KOCA 1SFDA 1JVOA 2J57A 2MTAA 1ET7A 1TEFA 1OV8A 3ABGA 3UAAA 3ASOB 3NJJA 4HALA 4W9ZA 3T6ZA 2TSBA 1KBWA 2YXWA 2WO3B 1L9SA 3UGEA 3PCYA 1CURA 3FU7A 3FYEB 1M57B 2XX0A 3FQYA 2IDSA 4AZUA 4E9QA 4DP6X 3HEIB 3EH4B 4CSZA 4UAHA 1JOIA 1PZBA 1GY1A 1W6LA 4G70B 4E9WA 2UXVA 3HB3B 3NSFA 2EIMB
chains in the Genus database with same CATH superfamily
1EHLH 1IC1A 1A1MB 1E67A 2Z31A 3GZQA 4L2LA 3PJSB 3C5ZB 3WIIL 3AGVA 4NOBA 3AAZB 1QFHA 2H1PH 2YD2A 1IC4H 3MV7E 1H3TA 1MFBL 2V8LA 4MXQD 3MRFB 1WCQA 1AQDA 2WLIB 1BIIA 4K71C 4M9PA 5TFSH 2VLMD 3K4ZA 2PTTA 4WEMB 3CSYA 4NLHA 2B1AH 4OD3H 4L37B 4PJGE 4PYGA 3IXTB 4B9KC 4M5ZH 5FOBB 3TBSB 2BMKA 5D7IA 3GK8L 4HHGA 1Y07A 4M7JH 4H0GA 1EAPA 1QSZA 1RJZA 4KGJA 3UZVB 3D39A 3VX0A 4A2LA 4A66A 1CFQA 1LGVA 2JKNA 1RK0B 5ACLA 1P7HL 4LL1A 2NR6A 1OAZH 4KMLB 1OSZA 4KAQL 2Q10A 4FCAA 1QBMH 1GJWA 3UX9B 1NCWL 5C2UB 5HBBA 4H8WH 1BF8A 2R1YA 2ZKMX 1NINA 2UY6A 1OGAB 1FG2B 3FT4A 4RMRA 1K5WA 2YXMA 4HUKB 5FF6A 2FTAA 2QZ5A 3O3AB 5D7JB 2JKRM 3SPHA 5E5MB 1UCBL 1E4KA 2L04A 3CFJA 4HP5A 4XZ4A 1IZJA 5FLUA 5SX4H 1M7IA 3N42F 3ULUH 5E6YA 3WTYA 1W8EA 3PDGA 3O4OB 4HSCX 4JR9H 3ZT6A 4JG0L 5BJTA 3HJEA 5BMFH 1QSFE 2V4LA 4R90H 2R29A 1S7SB 1UC6A 3BP5A 3CN0A 3TA4D 4NWTL 3CZFB 3GI8L 2VDRL 5EWIH 1S9YB 2IG2L 3WXWL 5DEJA 2A6JA 2G9HA 2V2WB 2J5LB 1PKOA 2R0KH 1GC1H 3ECQA 4MQXD 3EJJX 3LKQA 3THML 1WIPA 1JV5A 2Z0BA 1VEPA 1YRKA 2W9DH 3LMJL 3UCQA 4YJZL 5JHBA 2YAPA 4P9ML 4NJAL 3TYFB 4D3CL 1KIRB 5C08E 2E7LA 3OB8A 1P5VB 1IGFL 3FN0L 1H6EA 4AEFA 25C8H 2BW4A 5EOCL 4NT6A 5KYWA 4H2AA 4QO1B 2AK4B 3TBWA 3HNTH 4KC3B 4ZS6C 5CINH 2R0LH 3SDAC 1KBGH 2X2JA 5DJDB 1ET8A 5DSCB 3GB7A 3FQTA 2RAMA 1A7OH 1KXQA 1BEYL 5DJYB 3KPRD 2GJPA 4CMMA 4ENZA 3A4FA 2YR3A 1WA2X 1W16A 2WB7A 1A9EA 3AREB 1QI5A 1MHPH 3DV4A 4JAMA 4PJAB 4F37F 3TBTA 4ESKA 5C8JB 3L2NA 3JWNG 3VU1A 4MD4B 3P2BA 3QWOB 1FA4A 4K3JH 1A7BA 3NCMA 1BLIA 4UBDC 5I16B 3TIDA 4MA3B 4EBQH 5AWNH 1SXZA 2OPCA 2Q6WB 3JWOC 1NFAA 1NA8A 1TQWA 4GAAA 2AZAA 1IM3D 4IDJL 1BQHA 3BUDA 3SN6N 2R27A 2UVFA 4A7GF 3KPQA 4HX1B 2Z6FA 1J10A 2B9AA 4XTRC 4HU2A 3FT9A 5F7EL 3SKOB 4NGHL 9PCYA 5HHPA 1D6VL 3GMNA 3D12B 2BSED 4CKVX 2G3ZA 4NNYB 4S0TD 1W8OA 3I02A 1A8ZA 1JYVA 3KPOA 5DRNA 4DSYA 2VQTA 3FN9A 1JF5A 3V5HA 1MCRA 3H9SE 3FB7A 1U8QA 2AJ3A 4OI7A 4K8RH 5E5UB 5AZ2H 1ZT7A 4XPGL 4OKVB 1NGPH 2B9BA 3MRQA 1BYPA 4WGKA 2OA9A 1KGIA 2E9GA 4N90E 4JFDA 2QL1A 1UM4L 1HINH 1OPGL 2XN9E 3QIWC 4M1CD 1KWGA 1QNZH 2GYSA 2WMPA 3EOBA 3PV6A 4ZDHB 1N0LA 4BUQA 4U31A 2MQ0A 4GQRA 3T4AB 1CU4H 1AO7E 1WFOA 2CJSA 1R0AH 4JZJA 2BHUA 1Q90A 1MCPL 4L29B 1YC7A 4EI5B 3IGFA 1HHGB 1Q94B 1XB3A 2BS71 1QLEH 2X4OA 3MV7D 2LT9A 1FBIL 1PY4A 2VZ3A 3E9UA 1KPUA 1RVFL 4UT6H 3RG1C 1ET5A 1OGTB 3LEVH 2BNQD 1FZOB 1DQVA 1M71A 3RTQD 4P2QA 3OHXB 4AMWA 4OZ4A 4FQIL 1O6SB 4TSAH 3QUXD 5DUPH 5MP6H 1L9QA 4DGIH 4RSYA 5BXFB 4GRWE 2WCGA 3QDGD 5GSRB 2WTPA 1J8KA 1LJMA 2E76C 4S1RH 2NY5L 3ARGC 4PB9H 5CIPB 4O2CB 1CB4A 4OFPA 2ADFH 4YSRA 3RIFF 1WD8A 1ZRUA 4J8RA 4J1UA 2EDTA 5ABAA 3S4SA 1M05A 4YHIA 1NFIB 4NLAA 1I4FA 1B3JA 3LN9A 1SXCA 4X5LA 2I9LB 2IWKA 4A2EA 1DZBA 3PP3H 3PWVB 4PJIB 1TJMA 4Y16B 5D4JA 1JTPA 1RV6X 2WQAA 3RJQB 2BXYA 3LS5H 3ARVA 4PFEA 3QQ9C 3CFDA 3MBWA 1BFVL 1QSFD 1GPOL 5CKAA 2XWDA 2EXYC 2L3BA 2BCKB 1I3GL 3LXCA 5CSGA 3BEVB 3TN0C 3GBDA 1CXHA 1TF4A 5D2NA 3U4EA 4EIUA 5JO5A 3O6LL 3ZDXB 3NSXA 1OB1A 5G2NA 3LRSB 4GP5B 4NSKB 4ZZFA 4HHAB 3PHOA 2AVFA 1WITA 4POUB 1VPOL 1CLOL 2PPCA 2ZTBA 3HZKB 4WWKB 3CLEL 5AOLA 2C4FU 2F68X 4AXWA 4YBQC 1ZMYA 5CJXC 1KEGH 2A6IB 3H0TA 3E3QE 5B8CC 3BVNB 4OCSL 5EZLB 2NY2C 1UB6A 5MEQB 2H32B 5CBAB 4ZTPL 5C9JA 5D4QA 5BUGA 4JX0A 1MOEA 3OPUA 5E6UB 1P7BA 4XO4A 2NNAA 2VNCA 3NPSC 3RKDC 4DKEL 2DL2A 2FO1A 4KXZH 4PVMA 1B88A 1TSHA 1UXMA 1Y6KR 2QPFA 2LOEA 3BH4A 2DQJH 3MV11 1RHHA 4JHZA 2NX5E 4PI2A 3MYZA 2Z91B 4FZEL 4X98B 3SZKC 3VI4B 4DESA 2MIZA 2IGTA 3IGAA 3SO3C 4BE6A 4MCYB 1UOKA 2R4RL 1BAWA 4YBLC 1Z3RA 5EZPA 2EC8A 2DZEA 5HI5D 4Z7OE 1E9QB 1I3RB 4HWUA 3F7VA 1BZ7A 3RWFB 1Z9NA 5I17A 1A3QA 1P7KB 4H8UA 2ICWA 4BFIB 2FEDD 4FJYA 5EFIA 1JI1A 5CLZA 1QBAA 2HJFA 5IBTL 5LXGL 1I8MA 4ZS7L 1VJSA 1MNUL 4K9EL 1TQTA 3I75B 4A6YA 1Q0EA 1V54B 3FTVA 1M1XB 2H2PD 4GB9A 3C5JA 2NXYD 4ANKA 4FFVC 3QS3A 2OK0L 1BXAA 4ZMQA 5HHMD 4JNXA 2CDGB 2XLLA 2MRYA 3R7QA 3BSGA 3U7YH 3VXUD 1JJUA 1T1WA 3H55A 4ZUVA 2FZ3B 3EOTH 1A1OB 1G1KA 4PJ5E 4YDZA 1T66D 3P4MA 4GUCA 2UYLA 4LRIA 1D5MA 3G7TA 4QRRD 2R56L 3MODL 3BUIA 3HE6B 3B34A 3TS8A 2HMID 1MAMH 3QH3B 1C7SA 4LU5L 2XWRA 3QIBB 4NNXA 3ZQXA 5I26A 1CPUA 5CM1A 5GSVB 2IH3A 1RIVL 4PJDF 2J6WA 4Y9BA 3HZVB 1TETH 1HYSC 5TF1H 1OCCB 3JUZA 1XGZA 4P59H 3DOIA 3RY6A 2OI9B 1ZA6B 4MB3A 4WU7B 3VXSA 4TQPA 4HUWB 4WWPA 1ZWIA 4M8QB 5AQ0A 2P42B 1MFDL 1WSST 2N7AA 4WY7L 2BVPB 1PGRB 3DX7B 5IFJA 3F7LA 2DWXA 5DWPA 3MX0B 1T6VN 1ACYH 3CJJA 3IDIB 4FFZL 5C0CA 5MERA 2A9BA 3R1GH 5D5MB 4YSUA 4Y2DA 2AJVL 5ID1A 2OLDA 3HUJA 1H15B 3WN5C 3GLZA 5E23A 2CGRL 5F7UA 5FUZH 1A2YA 5F96H 2KC0A 3GBNL 2P5WD 4EE2A 2NY0C 3ARWA 3QWRA 2WVTA 4U4IA 3CXDH 3KVPA 3OR7B 4KK8D 4NO2A 3F6JA 3QDJA 4U6TA 4BZ2L 3MV01 4GSDL 4JE0A 4M7KL 5F21B 4ABQA 3H53A 1IC5H 4JRYB 5AUMA 3SPGA 5I0WA 2R1XB 4IRSA 3PWNB 3ME0B 4PRDA 4KPHH 3PPSA 2CPUA 1E4XH 2QMKA 3VRJB 1IQDA 2WC7A 1KENL 2HT3C 2XFXA 4P57B 4OIIL 5D55A 5C0JB 3VVWA 5FK9B 3RUGB 1UWYA 1K4DA 2H9GA 4IJTA 3CLFH 4NRYB 4J7RA 5EBMB 4JRLA 1BJ8A 2IJ0C 3PIQB 4HPOL 3ZE1F 3Q0HA 2IANA 4JM2B 2ERJB 4MS8C 2QPDB 4ODSL 1MCOH 2FIKA 4KUZL 1C5CH 3BYTA 1A02N 4BD4A 2PF6A 3FO2A 4Z7QB 1F3RB 5C0RH 4FNUA 4PV8B 2PPDA 5HDBB 3NN8A 3UH8A 4FF9A 3RWCA 3S34L 4I88A 4M5YH 1I8IA 1RZQA 2ESVB 3QUZD 5AAMC 1E5ZA 2W9EL 3CHXA 2EDYA 1SFDA 3KVQA 1XCTA 5GGTH 3U0TB 3FB8B 1MW2A 3EYQC 1RU9L 1MIEL 3ABGA 3SHSA 3PGFL 5K1VA 1REIA 1FCGA 4XN1A 1DN0A 2TSBA 4NHCL 1XF5A 3JV0A 4G6AC 4YFLI 1MHEB 4CMHC 2VWEE 3D8MA 2JI3A 1W72L 4KZCA 4O51B 2G60H 4DN3H 3MV9D 2EEXA 1RXLA 2HVJB 3TCTA 4ABVA 4E9QA 5I1CL 4TSBH 2VE6A 5E8DH 5AW2B 3V6OE 5IHLB 5CAYB 3O2DA 4G1EA 1PL3A 4S0HA 2NX5D 2EXTA 5DHYA 4K9JA 2VSDA 4KOBA 1FVCB 1HFUA 4IBQA 4L2YA 1CLZH 2PCYA 4P5SA 3VJ6A 1KIUA 5FM8A 5KSUB 3MFGB 4AL8L 2DLFL 2YAEA 3IJ8A 4R2GD 3IFOB 1TZAA 4NCDA 1JHLH 4FYRA 3MREB 4YDVB 5IGXL 1RJLB 3APFA 4Z95L 4CBZA 2W81C 2FGZA 4LDOB 4R7DB 2Q7YB 5ESAB 3OKEB 4KHXH 2LFGA 3CHQA 1LHZA 3JWOL 4XHJD 3WFHA 3KXFD 4YQXH 5E6IB 2E56A 1AZBA 4IIZA 5T1MA 4E36A 5IJCC 2C5DC 4FQHA 4PJHF 4EVNB 5F9JA 4H1LB 1EANA 1QI3A 1S7RA 4XP5L 1NPNA 3L1OL 4IBLT 3H2QA 3BZEA 5CJQL 2XTJE 1ZPLA 3PXLA 2CMRH 2A4CA 1MHHA 3FMGH 4Z7NB 1ITCA 2FQGA 3TO4B 1D9KA 1FFNB 1NL0H 3G5VA 5HHOA 3PNRB 3GSVA 1AG6A 4FFYH 1WHPA 3MJ7B 3UJTH 3Q44A 2LTQB 3KW7A 4PLJD 4PP2B 3DSFH 4L4TA 4TVUA 4FMFA 1L6PA 4XAWH 4YL9A 2A1WL 2ZP9A 5HDWA 2VW7A 3A67H 1KV3A 1NLDL 4PTUA 4C56E 4X99B 5FA3B 1CGXA 3W57A 3BAWA 3FQXA 5EZIH 2CO7A 3FF7A 2AW2A 3NCYP 1J1XH 3P3YA 2MPAL 3CXHJ 2DM7A 4GO8A 1QASA 4KDTC 3HS0A 3SKNA 2VERA 1YUHB 5C09D 3PHQA 1YYLH 3V9CA 1IEAB 4BWTA 4DJMA 4ENEC 1E27A 1FP5A 4X4KA 5T3ZH 3SBPA 4JE4B 1TU2A 5CMAA 2Z7ZA 4OH2A 1GHFL 3WFBH 2BOBB 2EIDA 4NO0B 3FCBA 4PJDE 2RFXB 2VITB 1CBVL 1F11B 2DMKA 2E46A 2D3NA 3F7QA 4NQDB 5ANMA 5JA9A 2AEPH 3PS6A 4CKQA 3ARFD 4J8QA 3DSNA 3F6IA 5FFLA 4F7EB 2DQEH 4HT1H 1E28A 3TURA 1GZHA 1UZ8A 3V7AE 2O6EA 4JHVA 2C3HA 3OLIA 3BYYA 4B50A 3Q1SH 5IMKB 2EE3A 1S9WB 4G71B 4FLSA 4HIHA 2IQ9L 4UILL 1IARB 3UTTB 4RGNC 4ZBJA 4B41A 1DQIA 1K9TA 2ZSWB 4PREA 4YXLL 4HGWA 1CFNA 1XV8A 3BO8A 3L1FA 4PJCF 1MHCB 1BWMA 2OZ4A 2SEBB 3B83A 5GGUA 2CU9A 2R69A 3N5AA 4TL5A 2FYVA 3I6KB 2QHRL 3ULVC 2Q8AH 4A2FA 1ZHLB 5IOPB 4XNUL 5BQDA 4F8NA 4P23D 4F7MB 3LRMA 1T1YA 3QXWA 5LNGA 3L17A 2HJKA 3SBWA 3GS0A 5M94B 5BOZG 3VFTB 3T8XA 4ZOCA 4FQ2H 2B4CH 1ZHKB 2RH0A 4S1QL 3T2NL 2VXVH 1H3PL 3ZHFA 3N55A 2EACA 1A4KA 4OLYL 3VGAB 5K9KA 5INCA 1E65A 4LLQB 2A5UA 2OCJA 4F7CA 2ENJA 3TOPA 1T7VA 3W1ZA 5L4FA 2RTTA 1IZKA 5GRJL 4CNIA 5A2FA 35C8H 3B8YA 4GSQA 1U8PA 4PD4K 2EEBA 4D9LL 4F2EA 4CVWA 2XZCL 3VCLA 1JF1A 3NCYS 3ZY7A 5I1EL 2PXYC 4JY5L 1QEWA 5IW6A 5B3JF 5FGRA 1N5AB 3DPBA 1HHIA 1KPVA 3TPKA 3ZE1E 4PJBA 3MRJA 4FA7B 1KNOA 2VLRD 2O93L 4C47A 4DUXA 4P3CH 4F33B 1CTNA 3DV6A 5EIIA 4TUUA 1TQBB 3VD0A 4S1SL 3HI5H 3O9WC 2YBRA 4I2XE 4OLZL 2FHBA 1QA9B 1EK3A 3QJHA 3TVMC 4ZMWA 2MCPH 5KVFL 5EDXA 1MY5A 1UADC 2CE6A 1GR7A 3VA6A 3HMXH 5DHMC 2GG1A 3F58H 3S48A 1J8HE 1UKQA 5B7EA 1P1VA 2OAAA 4MNGA 2MCG1 4ELDA 5L6YL 5GZOD 1IBBA 3B7TA 4L9LB 3K6DA 2AXJA 2ZCLL 3DTXA 3BN3B 1NIFA 3PAYA 1JHTB 2HA1A 2MNWA 4LSDA 5FS5A 2YUWA 1IV8A 2WTRA 4Y5XC 4MB5A 2VIRB 4WUKL 3CQPA 1DLHA 1NFDE 5E56A 5EBLA 3VXRE 4KKPA 1OO2A 3ZDZF 4U1MB 2WWMD 5I2IA 3L54A 5EORH 4E5XA 3I50L 4DPCX 1JXDA 3GHEH 3V5DA 2KQNA 3AG2B 4XMKL 5E99L 4MAUL 4U0RB 1EGJL 5IVOA 1OQOA 3GT6A 3FQ2A 4CJ1A 3FBQA 1E3FA 3HR5A 2EINB 4LEXL 3NCBB 1KTRL 4JKNA 3MBXH 4ZT1A 3SOBL 3CAFA 1D7CA 1F1GA 4OIAA 4BFNA 1I7TA 3LN4B 3BWAB 5KS9F 2Y7MA 2XTJD 4Y4KB 3MJ9A 4IS6B 4OCXH 1S7XA 2J4WH 1OPOA 3JV4B 3KPRA 1HSAB 5ESQB 4H4NA 1QATA 1L9PA 4GMSH 3KMDA 2I60L 4ZQKB 2NZ9C 1D7DA 4F9PA 3MRNA 3AXLA 3LKSA 2E9IA 3Q2LA 3US0A 4E0RB 1NGQL 1MH5B 2GIMA 4D9RE 2NY7L 3O4LD 1WC7B 4PJHE 4PWHA 4U1IA 2MNJB 3WHXA 3EYSL 4E9LA 1KFAL 5E8NA 5H2BB 5I1KH 3LHPL 1B4LA 3N0AA 5ITFA 1B0RA 3BDXA 2ADGA 1G9MC 4GW5B 5LGHH 3E38A 2Z1PA 4H5SB 1DVYA 2XDHA 4EKXA 1A6TB 1E9PB 2HXAA 4E68A 1JD7A 2FL5B 4R5XA 4UYQA 2BSEA 5BV7C 3FH5A 4YK4B 2F7OA 4FHJA 4M1GL 1SN0A 5ITBH 3DX6A 2H5UA 1CXEA 1A6WL 3U0PB 3JUYA 2Q76A 3S36H 5IR1A 3EBHA 1F4WL 1G7LB 1FJ1B 1TTCA 1CTOA 3HI1B 4BH7B 2BP8B 2VDKL 3QXDB 3S2CA 2GCYA 4IBYA 4RGOH 1QR1A 1FSKB 3FOMB 2I69A 4CJ0A 4NENA 3K8LA 2CK0L 1UACL 1M3JA 1DVFD 2QKIC 5GHWL 4PS7A 1F42A 2J2ZB 2UUDK 3BESR 3GBMH 1I1AD 1JRHH 2BVUA 1AGDA 1N5YH 1Z6JT 4QXTB 1QP1A 2DS4A 3GLAA 2BVOB 1HOCA 3RNQA 3V4VL 3NCXA 5LVEA 5DTFA 3UTSE 5DQDL 5JHLH 3NSJA 5E1GA 1JNLL 3L08A 3SCMD 1OP4A 3Q05A 4JZNA 2EVHA 3S37H 3NJLA 2EZ0C 3K46A 5DEGA 2YBGA 3NEEA 5IHWA 5HJBA 3WS6C 1R9FA 4P48A 2DMCA 3A6CL 3GF8A 1B90A 4UT9L 8FABB 1VFUA 5FYJE 2V33A 1OCWL 3O6KL 2BNQA 4Y4HD 5LO7A 3RTQA 5I66B 2UZIH 4RX4A 3NAAH 1J1OL 1QLFA 2O6CA 1U8IB 4M9OA 3BD4A 1FE8L 3EFFB 4PJCE 1OF0A 3CPLB 2N0MA 3Q6GL 4KFMA 3UBXA 3U9PH 3QDGA 5K9OA 3DETC 3B7YA 1A6AA 3E8VA 1B9KA 1HKFA 1L5GB 4HMEA 2E8ZA 2YKLL 3UBFA 2ZCHL 2DWEB 3U9UA 3PYCA 5FC9A 4ZSOB 4ACTA 1MRFH 1KIQB 1S46A 2C3XA 2QADC 3T9WA 4Z76A 3NABH 3GSQA 1KBBA 2FLBT 3ARDC 1BREA 4G7SB 5IFAL 3OKLA 2MOGA 5K1NA 5E6ZA 3VXPA 3TCXA 1UJ3C 1P7QD 2PWDA 5C1MB 3WIFB 2HLAB 5J9PA 1HZHL 1URLA 3EJYC 3ET9F 4XB7A 2VRKA 3IDMB 5HYSG 3LEXA 4JPKL 3MCYA 2W0FA 2C7UB 1LE9A 4PLOB 4YR6A 2WM0A 3D5OF 2HN7B 1T83C 3A5VA 1DQLL 4GG6E 1GGCH 3LKRA 3ARBD 1P9MA 1RUML 3LSOA 5AZEH 1U3ZA 1TTGA 3HHSB 3W37A 5TDPA 5B3JE 2BP0B 3CXHK 4ZPVA 4Z77B 1NCCL 1HIML 4JHWL 2A3TA 5EBWB 3RFRA 1MZZA 5KYXB 1J88A 5HYQB 2DQCL 3WJMA 5EH1A 4C83B 2DQHL 1UKTA 2CKBL 2ENSA 3KCPA 4RQQB 4HFWA 5DVLA 4WLCA 2ZKYA 3FW6A 2X5PA 4ODBD 3MRBA 2B59A 4BBWA 2WAHA 2Z7UA 1DN2A 1KGCD 4IOIB 3APMA 3VD1A 3S5LB 3GTNA 1W2KT 3VWKD 5C92A 3D85B 1AIZA 2YO3A 4ONFL 4KNUA 4BFEA 5CD3B 1BD2A 1J5DA 3EO9H 2R29H 4LLAA 4K5OA 4TUOA 5ISZE 4IBVA 3OG4B 1T0MB 3L95B 1T20A 1IAII 3ZDYE 1X5LA 5DI8B 4KKAC 1JDDA 2CH8A 2J43A 4CU8A 4UDTA 1U8OB 1VCAA 3UYOD 3FUNA 4JKWA 3UMTA 5FV1L 2VQUA 2ZXWB 3I6GA 3H9HB 1YNTA 1E4HA 1HYRC 1Q0XL 1N59B 1N9PA 3HLAA 1GS8A 4LPYA 4D9RD 1JPTH 1QO3B 3MV7B 3GEFA 4MZ3A 1OV8A 5J57B 3P0VH 3V0HA 3EADA 3BP6B 4X4XA 1JPSH 3ASOB 4KI1A 4W9ZA 3WU1A 3D3VD 4HPHA 1T89C 1KBWA 3KBPA 3VXUA 4F15C 5KS9E 2AJYL 2VLKE 4PJGB 4JY4A 2DBLL 3SKJH 3WNMA 5CD5D 3QB7C 5GS1A 3FRPB 4J6RL 1FGNL 3M86A 3FU7A 2XX0A 5DJ2A 4ODTH 4LESA 4NKIL 5CCHE 4QRRA 4O02B 4RAUA 4FNLL 1SDYA 4MDJB 3QUMB 1YY8A 4HC1H 4HJIA 2P46B 4UAHA 1FNGA 2VLLA 1NQBA 4U6YA 3GMQB 5DD0H 2XRAH 4MCZA 1HCFX 3NACL 4RH4A 1FNEB 3QR1A 4XXDB 2ZOKA 2P80A 3OJ2C 3V8OA 1AS8A 1U9KA 4OT1L 1UOVA 2ZXAA 3ULUC 1Z3GL 3QRLA 4TRPH 4EKJA 3KLHD 1MLCB 2XVGA 3QPKA 1S9VA 1MDTA 3HE7B 4G42A 3CDGA 3UTOA 3FTZA 4KJWD 3B6SB 3LZFH 3U79A 3WYRA 4E41D 1PPIA 5AKRA 1V05A 4TVPE 3DVNA 3UTZA 2ENQA 4YXHH 3DHMA 1K2DB 3VAEA 3WS3B 4QHKI 3WEXA 4OCNC 1GC1C 1JPGB 4GBXD 2NT0A 2ZJSH 1EJ6A 5TDNB 4DKTA 4HUUA 2ATPB 2K45A 1AANA 2HLFC 4LL9A 5E08L 4ODUB 1ILUA 1MSPA 3WFDL 1L6ZA 4YIQA 2D73A 4EXKA 1U8LA 3IE4A 2WZPD 2FBOJ 3ZMEA 4PJ9C 1MW0A 4TYUA 5FYJD 2P5WA 1DQQA 2XZQL 1IAIL 4I9XA 2GTWA 4KKBD 4JPVH 2EIZA 2QSVA 2YA0A 4Y88A 4LBEB 4DCQB 4XCCL 3AJ7A 4GFTB 1T03L 5HDLA 2BSTB 2IDCA 4DKAA 1FFPB 3GUTA 1CDCA 4TF4A 5C08B 4B9PA 3GMLA 4FD0A 2DPKA 5JLZA 2DQIH 1LEGA 3CG8A 2G75A 1N7MH 2VKWA 4G43B 1WT5A 1BP3B 2CO1A 2WYHA 4I48B 2Y3AA 3MGOB 2NLJA 4Q52A 5FDWA 4XC3H 3UMNA 4LPVA 2H6PB 5D7HA 1K8IB 2YFOA 4IBZA 4YSOA 1YHPA 4PJ7F 1XF3B 3JV6B 4OJEH 5EU4B 4DGYL 5KEZA 1ASQA 1TVDA 4UTAL 4L8BA 1B0GA 1BX2B 3DHPA 4LCCC 4KKRA 3SDCD 4HIIA 2DWDB 2EO1A 5FKPA 3VFPB 5C86A 3EGXA 3NCCB 4YHKL 3OKDB 1E8XA 3FQ1A 3MA7A 4KI5F 5LN8A 4WEBH 4PW3A 5FFOA 2NQCA 1EEUA 3COOA 4BEIA 1MDAA 4AIZA 3K71A 2ITFA 2XJKA 4W9IC 5E8OB 4OM1H 4BSJA 2DB8A 3ZO9A 3GI9H 4G7VL 4PLNC 4NO3B 3DGDA 1PBYA 4LIQE 3RX5A 3O3DB 4GAJH 4ILDA 3HFFA 3NQIA 2F53A 1PZ5B 2X0VA 2ZSVA 4WO4C 4DEWA 7CGTA 1UD3A 1ZS2A 4YHOL 5GGSY 1OY3B 4K8RC 3CZLA 2Z9TA 3MV9A 1D2OA 1O7DE 1SHWA 4BM7A 2BC4A 3FRUA 4H25A 3FCSB 4L1BA 1NAKH 3BKYH 4E2OA 3R06B 2IXQA 2OMZA 4JPSA 4R0LC 5EU7E 4N0YH 4H20L 3H9SB 1SHXA 4UF7C 5G4OA 2APWA 5JOEA 3RURA 3HFML 4I1PA 1IL1B 1EUUA 1KCRH 2VL4A 3MLUL 5ISZD 3RL2B 1YY9C 3RWIB 4YC2B 3RWJB 4QYOA 3JV5A 1EFQA 2NY1D 3X14B 2XN9B 5B4MC 5I71B 4UU9A 4W9EC 4I7ZC 4PP1C 4YDJA 2XWJB 5I1DB 3A6OA 4FL4B 3OMIB 4RMVA 2OYPA 2BS8A 1BWWA 2HWZL 3BPNB 1KCUH 1KUMA 3CVHA 2GJ6E 1AO7B 1O9VA 4QRUB 4LPWA 4K2UL 5EEVA 3L3HB 3SGDH 2CXKA 3G5ZA 2ZOOA 4JO1H 5E2VH 5GGQL 1XBRA 3KPLA 3F05A 3U1SH 1MG3C 2DIAA 2Y69B 1MCJA 2R0WH 2HRHA 3DDGA 3S2AA 3U46A 4KO9A 4LCWA 3E1F1 3KXFA 3VRIB 4M6AA 5CEXB 2ZUYA 4HBCL 4K3DH 1HSBA 4BK8A 1RK7A 1CXIA 5MI0B 3P3UA 1RLBA 2VLKD 1HT6A 3QNZA 4OFVA 3PNWA 1PLGH 2VTFA 3VTAA 2PW2A 1NSNL 2GSMB 1WTLA 1ZJAA 5BV7L 5GZNA 4TPRH 2AFNA 1ES0A 3K72B 3KPMA 4GRWB 4LLMB 5I6LA 2A6DA 2DKMA 4DGUA 1JD9A 2P1YA 3T3PF 3NH7H 4JREB 3B7UX 4ZUTA 3QI9C 1K3ZA 3Q3GB 1TCRB 2OMVB 4XNXL 4N0RA 4A6YH 1FL3B 4IMKA 3RWEA 4HSQA 1ZPUA 3VXME 2MCMA 1AR2A 4PI0A 5EULV 4HPYH 4BGLA 5LCVA 1HZLA 5E4IA 5FHAH 3C8KA 5HJ3B 5IBLD 4B9JA 3GHPA 4HMCA 3S5YA 2WBKA 4YZFF 3BUTA 1ZT4A 3WE6A 3GXNA 3W56A 3I85A 5IF0A 2ZOUA 2R4SL 1FYTE 1BAFH 1YNTF 5C09A 2F0CA 1ZVYA 1KTLB 5FM4A 3IMWA 3IM1A 5E2UL 3EYVA 2QVFB 3EYOB 1A0QL 3LVEA 4H0LC 1JZ3A 4LVEA 5ICUA 3KCWA 2DBJA 3QUZB 2F7RA 2QQNL 5C0FB 1ZIAA 4U1HB 1XGYH 1GSMA 5JA8B 3LQAH 3TV3H 3SZ6A 3UJJH 2XQBH 2DLIA 1MRDL 3MRLA 4QWWC 4ACPA 1S9XB 1TYRA 3X1GA 2H41A 5BCAA 4GMTL 4W9HC 1NEZG 1CK0L 7FABL 1JMZA 4OZGA 3EHBC 4CVUA 1EXHA 1JK9B 2WTOA 4Z7WA 2FBRA 5IWLC 3IFLH 1XGTB 3REWB 4WHTA 1DBKL 3FQNB 3N42B 1I9EA 3G9VA 4XBGB 4ZFZB 4WJ5B 2CM5A 1B3IA 2XVBA 3N91A 2CLZB 2BIQA 3IETB 4WK0B 2HSIA 3VFNB 2NX5B 1INEH 3QCVL 4KRMB 5DEZA 3QNXA 3KYMA 2DQMA 3DUUA 4JDZA 4BQ8A 3PJNA 5ECJE 1FYHB 4LQFH 5FYLE 4J39A 3FT3B 4P23A 4Z7OB 2HZHA 5LG6A 2XKSA 3MA9L 1SXAA 3LVTA 3FZUC 2GK0B 1XQ4A 4F91B 1ZCRA 4U1LB 3BE1L 1PU0A 4B9YA 5EHFA 1BFSA 1WP6A 2MPVA 4W9DC 4N1CA 2QQKL 4QPEA 1KJMA 1WWCA 3ECWA 3BMVA 2H26A 3TJEL 4F9LA 2EDQA 3AITA 1AZRA 2X44D 2OXHB 2AI0L 1YNLL 2BZCA 1KC5L 1M42A 4P5RA 1NMCB 4HOZA 3KJ4B 4QYAA 4ERSL 3GSOB 3AXHA 3V2AR 5SX4I 2X4RB 1BZ9A 5DF0A 2ODIA 1EHAA 4TVSa 7TAAA 4YWGH 1MY7A 3AQDA 3S5ZA 1J87A 4PJ5B 4PJ7E 5CKGA 4XPBH 5FYKL 3FCTB 1F2QA 2VLRA 4HJ0C 3LV3A 1S6NA 1TEYA 4OLXH 4YNYB 2F74B 1I7UB 1OE2A 4EMZA 1GZQA 1E6OL 2AVGA 4YAQA 3APDA 3ZL4H 1W6WA 3AY4A 4KI5E 1JNHA 1T22B 3VQ1C 2W1NA 1XSKA 3KLDA 3D87B 4GW4A 5CO1A 1A47A 4JQIA 4YSDA 5A2LH 4XB3A 3ILPA 3IJ7A 5K39A 3UEQA 5BS0B 2AV7A 3CZSA 1KBKA 1EHLL 3OV6A 3MMEB 3U7AA 2JVUA 1JFQH 1DQTA 1HCVA 1W15A 1FV1A 2YJLA 4MA1C 5GZOA 5L88L 2VYRE 5H4ZA 4HGMA 4NQTA 3SGEI 4FXGC 3ZSSA 1T4KA 4U7MA 2H1PL 1IC4L 3K80A 1YMHB 5IMLB 1AZUA 2P8MA 2Y2WA 3G08B 5TFSL 2Z1KA 4C8XA 4XE5B 4BHUI 1V55B 4A63A 5IHZB 1IAOA 4PH8A 1XH3A 2XWBA 1WAAA 4ISVA 2Y0SA 5TGBA 4MYWB 1Z5LA 2H2SD 5IUSA 3ZQWA 4R8WL 1MRCL 4PMFA 4PS3A 3O2DH 2RACA 4PUBH 1YYCA 4QF1B 1S7TB 2CBQA 2VZ1A 2NT1A 3PQYE 5KJRH 3RPIA 4OZHF 3ARFB 1URIA 4RAVA 3NIGF 2RR3A 2FT6A 1OAZL 1WA1X 4LVNB 2N7BA 3LRKA 1QBML 3TZVD 4H8WL 3CCHA 2YOAA 1EJOH 5J56B 5T5NG 4RA0C 4HMDA 1OGSA 4V11A 4ALAH 1XGRA 1AAJA 3M07A 2N56A 3OB0K 4QXUH 4WQOA 3L3IB 1MF2H 2YC1B 3QK0A 2AQRA 2MMXA 1KY6A 1QWNA 2X3CA 3STBA 1LILA 1R5VB 1ZEAH 4JR9L 3MRPB 4NKMA 5DS2A 4AQ8A 2NRDA 2WQWA 3K2UL 3O4LA 3ZKXB 4R90L 2NYYD 1G1CA 4ADIA 3PFUA 3QO1B 2CALA 1Q1JH 4PGDA 1A7QH 1FZKA 5EWIL 1KACB 4XB8A 4J3XA 1GC1L 4AC4A 3BISA 4Y1SA 1PG7X 4HUMB 3RZCC 1QRNE 1IFGA 5DD6A 4EPSA 2LW3A 1LP9F 3WE1A 1BCIA 5D93B 3TEXA 3DJRA 4OFDA 1EPFA 3ZMNA 3ELAT 3P0YH 3EOAA 5DQJB 25C8L 5F9WB 4U1SB 4FE9A 1RPUA 4K55A 1EDYA 2X4UB 5AB9A 3HNTL 4U7SA 5JW5B 1SZNA 5CINL 3C2AH 3IF1A 3JT0A 1TXKA 1RI8A 2R0LL 2VXUH 4AK2A 2PUQT 5AW6B 1KBGL 1DVFA 2AS5M 2N01B 4X0KA 1A7OL 1I1AA 4HGKC 4MDIA 5ICXB 3G5XB 4UIKL 4U3SA 5A1AA 3IMUA 5FGBA 3W5MA 3NJMA 3ZO0A 3AY2A 1MHPL 2AEIT 3CMGA 1D5BA 2JFCA 1KMGA 1ZSDB 4HD5A 5FYLD 1YG9A 3MOQA 3SCMA 1OWRM 3CSYB 3DX2A 1UD8A 2VXTH 4K3JL 3BPOB 1U4EA 5C6TH 3V0VA 3KYKH 4F5CE 3QDME 2ATAA 1CFTB 4Y5VC 4EBQL 4Z3JA 1OHZA 5E95B 3RQ3A 1WICA 1HHJA 3L4TA 1ROCA 3I3EA 4Y4HA 3P11L 3RX8A 1VESA 1L9SA 3WTTA 5HYJA 3U7WH 4FN0A 4I3RH 5I73B 4Y19E 5FR3A 4K94H 3WHE0 1PCXA 1BZOA 4W4OA 3MRIA 4B9CA 3VM5A 2DEWX 2ZWZA 3BEWB 4KTYA 4PEEA 1T1XA 3VFVA 1PTZA 2OZ4H 5FUCE 1UM5H 2ORBH 4GAFB 2R69H 4KX7A 3I6LE 3ORJA 4BKTC 2Z93A 3RY5A 3RPKA 5JXAH 1F02I 2E0PA 2Y6SC 1MVUA 4K8RL 4X7TA 5AZ2L 2E8YA 1NGPL 1YEDB 1YMMD 3RVWD 3WHE1 1QQDB 5IB2A 3UPRA 2X70B 1HINL 4XBEH 1IGMH 1BSIA 1P7QA 1Y0LB 4ZFFB 3NUKA 4AEIH 4DP2X 3LX9A 2FUTA 4HXBL 4AJ0A 2G5UA 2WP3T 4N6RB 3GS4A 2JXMB 5DFVD 4YFEA 1CU4L 4HKJB 1R0AL 4ZODA 1AACA 1CFBA 1SMOA 2Y5TB 4PS8A 2YZ1A 1IT9H 4C56B 3PL6B 1HNGA 1QLEL 1AI1H 4G1MA 4NQVA 4WW2F 3TEZA 3EYFB 5EA0H 1GS7A 4UT6L 3R19A 2AK1L 4WI8A 4U1GB 4BKLA 2NXZC 1JWMB 1JF6A 3TTSA 4PLKD 5DZNA 3LEVL 3LKNA 3S6CA 3X2QB 1ML0A 2J55A 2X41A 1IVTA 4P5MA 3BQUD 4TSAL 5DUPL 1A3LH 4PJDB 5DHVH 5MP6L 4I0PB 4DGIL 2ZP8A 3UP6A 3GRWH 4HZLA 4QXGH 1F3DH 1UOLA 1SXNA 2Y7QA 4A04A 4XCNA 4GKNB 3RA7H 5IQLA 3MGTA 1YN6B 1HK6A 3VWKA 4S1RL 4OLUH 2BSSB 4HK0B 4GJTB 3V9FA 3STZB 5BO0D 5D1ZB 5EO1A 2YSSB 1PKQA 1RAMA 4U05A 3HS9A 4TUJB 3DX4A 4G5AA 3PP3K 3DV4B 4JAMB 3OSVA 4HHWA 1M6OB 2YRPA 4X7DC 3MVSA 4MHHG 1IJ9A 3D4ZA 4B9FA 4E9SA 1MCFA 1SF3A 1VLXA 1WD9A 3EJZD 3VWJD 3DURA 2B4CC 1W9XA 2VR5A 1H5BC 1DTUA 3AC0A 3ARUA 4L3AA 4AGPA 5JXED 1EEZB 3BIKA 3O8XB 4OZHE 3OKOB 1HXYA 2Q2LA 4JO5A 5EOQH 2R2BA 1SBSH 4NC1E 5KTEH 1LWRA 2K0RA 1P1ZA 3D3VA 5T5FA 1ACXA 4HDIA 1X9UA 4TULH 2C9PA 2VJ8A 4WWID 1WAAF 1X5JA 3MJ9H 1QRND 2IFGA 3P4LA 4ABUA 4DFIA 1KEGL 4NUGH 4G6MH 1U4FA 2XG4B 1KJVB 4HZAA 1TG8A 4JW3A 1NUNB 3NT0A 4MXWH 4NOFA 4NPYA 2YPKA 3F04A 4HWNA 4YE4H 2QPSA 2AV1B 2V9UA 2HKFH 3FQUA 3ZE1B 2I27N 2DQJL 4YHNB 2MCAA 3B9KB 1LK2B 2K9FB 3DMMC 5L8KB 3BPCA 3M7OA 1J5OH 1M9WA 2WJ5A 4I2XB 4Q9CA 1SFHA 4JZJB 2LU5A 1CDBA 1HL8A 3RI5K 4XOBA 3GXPA 3P4NA 1ASOA 2WO2B 4XODA 3WTUA 3FK3A 4E41A 1MLBA 2ZG2A 5CU5A 2YGNA 3KGRA 3QVAA 3M8OH 1LP9E 1AQHA 1UD2A 1J8HB 2I07B 3S0PA 2ADYA 4UNTA 3FT2A 1U3HC 3MRHB 3U36B 1D5XA 5ACMA 1E4XI 1A65A 2UVEA 2X6AA 3ARBB 4F27A 2WXPA 3SPVB 2W07B 3IMTA 2WHVA 2FEEI 4IOFD 2WZPA 3ABZA 5F3BA 3D69A 5HVHC 4JFTA 2EDOA 4V1DE 1SOKA 3RVTC 4ETYA 1JYWA 3CSPA 3MTRA 2VM4A 3U7YL 2WJ7A 4TTDD 3GXDA 1E50A 4KRPC 4UV4H 3EOTL 5FB8A 1LEIB 3VXRB 3QC6X 4Y19D 4JFFD 3SPIA 4ES9A 5B38G 2VN7A 3KBHE 4M02A 2C1PA 1AZNA 1T0NB 2B15A 1MAML 3L3GB 2QJDA 3K4DA 3DDFA 3I6LD 1AD0A 3WUWG 4M7LH 3FQWB 3UTPE 3TC9A 3WNPA 1TETL 4LSRH 2YQ2A 3WV0A 4AW7A 3FTGB 1QFWH 4P59L 1JZIA 4GIOA 3MNMA 4XBMA 3CUPA 5EO0A 5A3ID 1EERB 1ODUA 3NVQA 2L7EA 3F7YB 2O6PA 4QXWA 1DUYA 1WWWX 3NJKA 3N50A 3EYUH 3GMOA 5EF2A 3REVA 4W9KC 5BZDB 1W91A 3CFDB 1UA3A 2PTVA 3BH9B 3TNMB 5D71H 3QAZC 3D2UB 2HX9A 3TEYA 5FV2A 4L3CB 3B9DA 2PABA 4S11A 1ZLWH 1BW8A 1ACYL 1KGXA 4F2ME 3D50A 3T08A 4APQB 5BRZE 1YEFH 1OB1B 3EG9B 3R1GL 5ADPH 3VSTA 1NOAA 5DRWB 1DQDH 1D7FA 1LDSA 3MCG1 4I3SL 5IEHB 3FUDA 2Y7NA 1Y6MR 2APBA 3DGGA 4PJHB 4A38A 4KDWA 5FIEA 5GXBB 1SJHB 3HG5A 3HG1A 5FUZL 1EJFA 2COQA 5F96L 5B1BB 1VACB 3QUML 5DUBB 2X53A 4N20A 5D9SA 3ZYZA 5CF3A 3M1BA 3PV7A 4D0DA 3N41F 3X13A 4L5FH 4POZC 4S0SD 4PS4H 4XO3A 1G9EA 5C0AE 1IE4A 2I85A 1IC5L 3DTUB 1L6XA 5IIEB 4N0FB 2ZUQC 1OCZB 2PWEA 2V2TB 4KPHL 3U1PA 1E4XL 2VDLH 2WZ0A 3PWLB 5ENWB 1NPJA 2WD0A 5INDB 4QD2E 1MFEH 1E9OA 1F41A 4KKCC 3BVUA 9CGTA 1A21A 3BRGC 4U33A 2VO8A 5I76B 3QXUA 3KR3H 3CLFL 1OF2A 1ZTXH 2GITA 2YD3A 1ZHNA 1NC2D 2DMGA 5KVGH 3KYNB 4GSRA 3JZYA 1U42A 4S2SB 1U58B 4ZXBB 3W9EA 3EJQA 1J9CT 4Y5YC 1MCOL 1K8DA 2Q1EA 1FN4B 4OCRH 1C5CL 5JTWA 1MVYA 4WNJA 5I8OH 3DTDA 5C0RL 4JFQA 3UTSB 1DVQA 2CIKA 4F8TA 4GBXB 4M5YL 4CC1A 3CFBB 4BXSV 3T0EE 3P4MB 2OMXB 3ZHDA 2PR9A 3T65A 2WXQA 5GGTL 4NQCE 1NC4B 5DYOB 4RMWA 1HH9B 3FAWA 2LLLA 3VNZA 1RUAL 3U2SA 1J0YA 1R3LA 2P44B 2FWOA 1FRGL 3RL1B 3D09A 3S3CB 1T2QL 3OL2A 3PUCA 4DN3L 4PJCB 4HAGA 5EC1B 2TRHA 2AZUA 4JG5A 4TSBL 1L9RA 5B8CA 4WJKB 4ZO6A 5E8DL 4AV5A 4EUPG 3VFSA 2XNAA 3IJHB 4PVNA 4C4KO 5C97A 2R8SL 1WAEA 2ADJA 1XCQA 3JTTA 3IFPB 4N8UA 4PRID 3FDWA 5C0GA 1DFXA 1GZPA 2WINA 2XYCA 3RBGA 2NY6D 5IFJB 2NOYA 2NCEA 3TO2B 1MFNA 3D52A 5H94B 1CLZL 5D4HA 1AYOA 4OGYH 3AS1A 5DFTA 1ONQA 3RDTB 1KTDA 4Q4IA 4DZBB 3IMRA 5FLVA 5A43C 2CD0A 3DXAE 2QTEA 2F61A 3EZJB 1FPTL 3IN2A 4JRWA 4V2CB 1JHLL 5SWSD 3SDCB 3WL9A 5ID1B 1E0OB 4XN8A 2NR6C 3APNA 3WO3B 1NIBA 2KYIA 4UV7L 4F7KA 5I0VA 3NRQA 4LSUH 3T1FB 2AANA 2J5WA 1LEKB 3SDYH 1A2YB 2BZ7A 2UXTA 4NI3A 1D2PA 3QEUA 2DV6A 1IGTB 2O5YH 4KHXL 1WGVA 3GC3A 3VH8G 3RVVC 1IGJB 4J4PD 5TE6H 1UCTA 5DVMA 1X4YA 4YQXL 3P73B 2WLLA 3T4AC 1GYUA 1FZMA 1SHSA 4PJXF 1KT2A 3MCLL 4MJID 1Z9SB 4HG4J 2D9CA 3HG2A 3MR9B 2E3VA 3LB6D 1YEJH 2QSQA 1K4DB 2H9GB 3MRDA 2CMRL 3ZTDC 4PGZA 3FMGL 2Y4SA 1OTSC 4G72B 2BWQA 5CP7A 1NL0L 5TH2A 1F0LA 3A22A 5I24A 3EH1A 3QW9A 4QI3A 2ZYIA 3UTPD 4FFYL 2VMDA 3JVGC 1QUNA 3UJTL 2J56A 2WO4A 1PG7H 1UOWA 2APVA 4JVWA 4PY7A 2FO4B 3BLPX 1SF5A 3UABA 3DSFL 4FQXD 4PPTA 1LO4H 3LIUA 4QGYA 5ISZB 4YSSA 2E7LC 3P9MB 2JK5A 3B2VL 4JHUA 4YEEA 2P48B 5IMMB 1CIUA 3RWCB 4A67A 4KROC 4WSJA 5EZIL 3BAXA 2OX5A 1WO2A 1J1XL 2C3VA 4HS8L 3ZIYA 4ZG1A 3BXNA 1NFKA 1KFGA 3AB0C 4UINH 1YYLL 4MB1A 3CC1A 3N9GL 3QA3A 2DEXX 4GIPD 5T3ZL 2IBZX 4MTMA 4FTVE 4GW1B 5LAXA 3L48A 3WFBL 1QSED 2E4FA 4QDGA 1J9SA 1WBZA 4AVIA 4ELKB 4JPQA 2IPUK 4WUUD 1MAKA 2AEPL 4U1NB 3T6XA 4JFOB 5KS9B 4OV5A 3QG7H 2VLKB 2VW6A 3QCUH 3T77A 5SWQB 2DQEL 4HT1L 4JDTH 4N9GB 4FXLA 1RUKH 4X7EC 3BI9X 4DN4L 5TPWL 3Q1SL 3I3DA 4PG9A 5DHYB 5LQBH 3MO1A 1U95A 3WAKA 5DK0A 5JORA 3MBEB 4NERA 3NA9L 2AJUL 4ICWA 5HHQA 1IILE 1IBHA 3E6HA 4DUVA 1TZOA 3S88H 2G30A 3OTTA 2EAEA 1PYWA 1A66A 2EEAA 2J57A 3QFJE 1ZLUK 5BQ7A 4ZX5A 5L2KE 3DX3A 1JYNA 3UAAA 4HALA 4DT2A 2APXA 3MCKB 3NFNA 1EEYA 3MOBH 3FFCE 5SV3A 4AQ1A 5FO9A 1UG9A 3IDGA 4FQ2L 1UZ6E 1JV2A 2B4CL 4WKZB 2GEEA 2VXVL 1KB5A 1J05B 3UTQA 3O45A 5T1MB 5D72H 3DO7B 2CJTA 4JBSA 1EXUB 5KW9L 1VAHA 3T0ED 1KLFA 3IK2A 2OFQA 3OGCA 4BZYA 4FC3E 3CMOH 4NQCD 1UWEH 2WOBA 35C8L 1LWHA 5AAMA 2AQTA 4FI6A 1B6DA 4OJYA 5ERWB 4UQ3A 2AMGA 4ZO8A 3ZOAA 5GS0C 1C5BH 1RURH 2EKSA 1DP0A 2X09A 3L7FA 4AENA 4JL2A 3SQOH 3C6SB 2BINA 2EIBA 2XPGB 1X3DA 2YFNA 6PCYA 1XIWB 4P3CL 2D7QA 2IAMB 4ORZC 1JS4A 3GZOA 3HI5L 3C2SA 3IJEB 3OX8B 4L4TB 4L3ED 3Q06A 4N0CC 4KJYB 4UZUA 3L5WA 3UGUA 4HCRA 2MCPL 4CDHA 5L2JA 2CBPA 2FJFB 3FQXB 1KSRA 1WZAA 2AKRA 3HMXL 1Z66A 3SGJA 2EICA 3ELQA 3F58L 3GSXA 4O5LH 4M6OH 5JDJA 5DMIH 5GJTH 3PHQB 1JXFA 4NB7A 4NNPH 2L7QA 1JWUA 4YDIH 5I6KA 4WV1B 1VFAB 4QHLB 2Z3FA 4F80A 4R4NC 1MUJA 5DS8A 5D1QD 5CCJA 3IMSA 4H26B 2WXLA 4NRXA 3DI3B 3D9AL 1HL9A 2ZP0T 3GJFB 4FKHA 5EORL 3N06B 1IM9B 3OXRA 3BKCH 3GHEL 1M3IA 5D70H 1R34A 4OGXH 1VGEH 2D9QB 2L7JA 1QFWM 3M7FB 4UQ2B 3AU1B 5IESH 2OJEA 4NI6A 2AAVA 4HIHB 3JWNH 4YHPA 2R51A 4R7NA 5LCVH 3BAIA 3MBXL 3E6FA 4IOSD 1Q9LA 4PREB 1W0WA 4HGWB 2Q20A 1EDHA 2V3FA 5BVJB 1U2HA 3LYRA 2WLHA 3FU5A 5D2NC 4U6VH 2PPFA 1HH6A 4OCXL 1QD0A 4YO0A 4OCLC 2J4WL 2Y2YA 3C09C 3H7LA 3V8CA 5KSAC 4GMSL 5JHAA 4NAMA 1PNCA 2AJXH 1GXEA 4Q6IA 4P2YA 3MYJB 4M3HA 7PCYA 2XWXA 5T1LA 3O0LA 4CW1B 1OAYH 2DQDH 2X4PA 4MSWB 2F5BL 4MMYA 4PJXE 4ETQB 4ZFQA 2BK8A 2QGEA 3QXVA 4OAWA 4WJG3 5I1KL 1DLFH 2GJ6B 2PYEA 5LGHL 3ERXA 1RK1A 1K5NB 4RGMB 1XR9A 1IX2A 3EBGA 2NY3D 3VFUA 4C54A 4I1NB 5IW6B 2FJSA 3KDMA 4Y4FB 5LLIC 4J3OG 1FHGA 3FBKA 2J3SA 3VE0A 1AGFB 1HE8A 4KRNA 2RHEA 5TE7L 4G9FE 4D8PA 5ITBL 2IADA 2J20A 1KBPA 2BNRE 2FX9H 2OW6A 3FTSA 3LQMA 3M45A 4JKKA 4ZFOL 1ZHBB 3AXIA 2EXWD 4NKDB 4UOQA 5DHVB 4BKSC 5MEOA 3TZVB 1YMMA 3QUYA 2EH8H 4RGOL 3KWXA 4WVRA 4GUOA 5MENE 1OD7A 3T4YB 3FTYA 3IN0A 3H3KA 2VLJD 2FR4B 4HOWA 3GBML 5B7FA 2A99A 3SY0B 1N5YL 4GQQA 1P4LA 3DTXB 2E6PA 4FYTA 1IEBB 4YDLC 1TZIB 2YGOA 4JFZL 1PS3A 2R9HD 5DJAA 43C9A 3VXMB 2P24B 1CDHA 3DVGB 5IVXF 3VFWA 2VR6A 2XBDA 2HFFA 3QFJD 5E8PB 5JHLL 4QR7A 3O11A 5C0BD 1H9DA 2ROYA 4G3YH 2WBJB 3RVXC 1RZKH 4QUOA 3S37L 2WGNB 3O3BB 4FLRA 4OLWH 5GRVK 3OKNA 3INOA 3CZJA 4MWFB 1JZ6A 3GSNB 1FYTB 4A2HA 2WQSA 1A8JH 2G2RB 1HEHC 3LQAC 3CFEB 1HXKA 2QV4A 3QCTH 2B8OT 5E1AA 2V6HA 3ARPA 5GRVL 4A7QA 3RY6C 2ICWJ 2NNXA 3L3KB 2NW2B 1MEXH 3FOLB 5IOKA 2UZIL 5DZ9A 5SWZD 3BQUA 3NAAL 4N28A 2IPKA 1BZQK 3V95A 2CHDA 4MAYB 1AZCA 4XNBA 4JQIH 4IKKA 2P3YA 1E2WA 3V9EA 3U9PL 5I0YA 1MI5E 3IKCB 2VZUA 4HA1A 4QRBA 1S7XB 1THCA 2F8OA 3BX7C 3EFOB 3V4UL 3BOVA 1MRFL 4HG4K 4Y2DC 2QDVA 4DK5A 3NABL 1G9NL 2QT6A 1ORSA 2FWUA 2RJMA 4UIMA 3QXAA 2CJ3A 3LKPB 2J88H 5E9NA 2IH1B 3BWUF 3VU2A 1T7WA 2CUAA 2BRRH 2JLLA 3BDYH 2B1OA 4NUJB 4EN3D 5IB1A 3VXQA 2VN4A 1RZIB 5CBEB 1DE4B 5IEKB 3KPPA 2Y7OA 3TBVB 5EU3B 3IRCA 4URTB 5JXEA 2Q7AA 3PF2A 5HI4C 2PWGA 5D1ZI 4IRSC 5CJ5A 1HDMB 1NCNA 2NZIA 3TO4C 2WWNA 4ZPTA 5AZEL 3V10A 2VISB 5DK3A 1I7RA 4JJ5B 3PU7A 3VFOA 4MD5B 4ZMZA 4X8JA 1QG3A 1MCEA 3LEYH 2V17H 5EN3A 2Q76B 4Q58C 2OMWA 1KCKA 3AUVA 1HEZB 1I82A 2X4TB 2KZBA 1OW0A 4MQ7A 1HC1A 4E9RA 1G7MA 1U3JA 1WZKA 2ZPKL 2X9ZA 5IG7B 4K7FB 1TR7A 4PJ7B 1HNYA 2VQ1B 1N8OE 1AIFB 4ABWA 3RILA 3OD3A 3EO9L 4FLHA 2VDNH 4CN6A 3W5NA 4JPIB 4MB4A 2H3NA 2WQ8A 2YARA 2AEWA 4Z7VA 3MQIA 5C2BH 3RU8H 4ZYKA 3N2JA 3Q13A 4G8EB 2NY4D 3IPBA 1F97A 3NFSH 1VFBA 1CXFA 4GRLA 3NIDE 5FFGA 3IXAB 1HILB 3N43F 4RRPG 4R7XA 2AP2A 2CR0A 4JMXA 4KVCH 4EDWH 1JPTL 4A7TA 3C60D 3UC2A 1UWXK 1ZVNA 3QXTA 3P0VL 4NN5C 4HUVA 5HY9A 1DQJA 2ENYA 1JPSL 4ZNEE 2W5PA 3BUYA 1PZCA 3KE0A 4XVUD 1G7QA 1G87A 3ZUCA 1TOXA 1V27A 1NEZA 3SE4A 3SYAA 5ID0A 3HC0A 5AFAA 4N6QA 2FJGA 3SKJL 5I6OA 4FFWD 4OD2B 4B5ZA 1BLNA 1YNKH 1SLUA 2FGWH 4ZUUB 3TNNA 4ZNCD 4JFFA 3ZGIA 2O26U 4ODTL 3A0OA 1IAKA 5E2JA 2L0DA 2G5BA 4QY8A 4HC1L 5JPNA 2CNZA 2DYPD 2Y07L 5KVFE 4EIBA 5DMGD 4XVSH 4Z3GA 3PQYB 4FG0A 2I5YH 4LLUB 1T3FA 5DD0L 4LSPH 3S8FB 1BQSA 2XRAL 3QO0B 5DLLA 2BNRD 4AGMA 3HAEG 4FNTA 4IIQB 2OQJA 4U6HB 2CM6A 4HOMA 4TRPL 2IFFL 5D7SH 3FONA 2ARJA 4XPHH 1P0SE 1Q9WA 1NCAH 4ELMA 1JPFB 2NNFA 3U2JA 2XA8L 3EGSB 3LZFL 4HH9B 1U93A 4PY8I 3I6SA 4D0BB 3VWJB 5KN5B 1U8NA 3FO1B 4YXHL 1PZ3A 2VN3A 1P4BH 1CFSB 4J3SA 2YD9A 2F1AA 1K4CB 3MNWA 4ZQTA 1NKGA 3BKJL 4JFYB 2F54E 2ZJSL 4IGBB 1MFVA 4D8OA 3F5WB 3LKOA 1JGUH 3DBXA 2YXVA 1SEBA 4IRJD 3V79C 2AEOA 2WVVA 1G1OA 2DWSA 3H42H 2BM3A 4RMSA 3VTTA 1R1CA 2IALB 4JPVL 1AR1D 1RHFA 4S1DC 5B3NA 1I7ZB 1QRNB 3BC9A 3MTXA 5E4EC 1EDQA 3RGVB 2LVEA 3IDYC 4HWZB 5C70A 4WENB 4HJUA 2Q3XA 1GGBL 4KJPC 3T3PB 1DDHB 2ED8A 4ZAKD 3QP3A 2YRZA 4XPAH 4YOKA 2DQIL 3KPNB 3HS0C 2GSGA 4Y8DC 5IVXE 1N7ML 4DAGH 3SGDI 1EEQA 2IDTA 5KVDH 3RP1A 2EDDA 4QRTA 1T0PB 2CRZA 5IB5B 4I3GA 1NC2A 1U33A 4P5TB 4XC3L 1GTNA 2VN5A 4HJGB 4U0RC 4BRJA 1YNTB 4DPRA 4EI6B 4WDIA 3H3PH 3ROLB 4F7TA 1X7TA 3KWWB 3RWDB 2DH3A 4PRNA 1UJ3A 5HGDA 2CO6A 5IW3A 1GZHC 3ZYOA 4WEBL 5AOJA 1H3UA 2ZF9A 3N6YA 3VTMA 5I0ZA 1H9VA 3UCRA 4XNMA 2ICWI 5J6HA 3ULVF 1KPRA 5H35A 1HWGB 5D6CB 4JANA 4X4YA 4K94C 3QDMB 2XHNA 2P8PA 3IT8D 4LNRB 1H3VA 2ARJQ 4OM1L 4NZRH 3GI9L 3US9A 2JKLA 1PJ9A 1VIWA 1HQRB 4B53A 4GAJL 5IMOB 3EKCA 3SJVD 5DMKA 2DAVA 4Y19B 4JFEA 4BSVA 1R5IA 3SBWC 3WY3A 4ZMVA 4MXQC 5C0DA 4HLZG 2X1XR 3M17A 1NAKL 3FT0A 3MJWA 1HJBC 1KXVA 3KLAA 1AOHA 3GXFA 4ORGA 4N0YL 1A7RH 3BT2H 4AIXA 1J8SA 1FHNA 4G42B 4M1DL 2JB6A 4PRIA 4E42A 2DJ4A 2VDMH 4KOCA 1KCRL 1OD9A 3RGHA 4NO5A 4XNDA 5J11C 1VDGA 4NWUH 2NUPB 4KHTH 3HRZA 4MLIA 5T5FH 2DKSA 3NJJA 3V0IA 3G6JA 2VCOA 1A7PH 2P52A 3BPLB 5SWSA 3TIEA 1ZLSH 2HVKB 4FXKC 2VM9A 2WO3B 2Y3NA 5J6GB 3MRMA 3QQ9D 4H8VA 3NGBC 1SQMA 3FYEB 2QLVB 3KL0A 5CHNB 5HI3D 4P5KB 5E2VL 1GRWA 2D7NA 1QBLL 3C6LD 3IS1X 3QGVA 4JO1L 4QKXB 3Q5YA 4GIAA 3U1SL 2VDPH 3AM8C 2R0WL 5C7ZA 3ZKQD 4QOKE 1RZ7H 3AQYA 3HZYB 1T1ZA 3HB3B 4J4PA 1CICA 1TMCB 2A74A 2OL3B 1M2OA 4X6DA 4PWKA 4PJEA 4TQEH 5DO8A 2OTUB 2N4IA 4G8GA 2CLVB 4I5BA 4MJIA 4QHNA 2XY1A 1WZLA 3DLQR 3CGTA 1VZGA 1BOGB 4NM4H 2MQ3A 1U91B 4TPRL 4Z78A 1KYDA 1CUOA 2P43B 4H88H 3QIUD 3SQBA 3BRDA 2AAAA 4RFNB 1AOZA 4G5ZH 5T1JA 2P5ED 1R3KA 4MQXC 3QPQD 3NH7L 4OLVL 1M7DB 4A6YL 4R84A 5CSZA 3L5HA 3SOTA 2D0GA 4FQXA 3PP4H 4QXVA 2A4ZA 4HPYL 3T2OA 3EO0B 4Z7VF 5I6XB 2EYTA 4UUJB 1XZ0B 2QKSA 1A14H 5F1OB 1UASA 3Q6FA 4X5XB 1FZJB 1HCZA 1UH2A 3L3JA 1OLLA 3CDZA 2UX7A 4Y2OB 4Q56A 5DVNA 2MHAA 1BAFL 4M4RB 2GJJA 4MNQE 5F6IB 2UY7B 4XBPA 2O5XH 3AWFA 4WNQA 1F3DJ 2F54D 3QEHA 5CWSA 2GC7C 2Y06H 1QSEA 4OZHB 2GUOB 2Z34A 4J3OD 2N1KA 4B0MM 4DIXA 4K7PX 3L3OA 1GMEA 3ISRA 1G7PA 3WDIA 3GMPA 4WUUA 3TV3L 3UJJL 2XQBL 5EEXA 1YDPA 1Z9OA 2OMTA 3B1UA 1F18A 4F9PC 2FDBP 1A4JB 3VUAA 3PWPE 4PRHA 4U1KB 4LDLB 4LLYA 4GH7B 4QRPA 2QR0A 4WU5B 3VW3H 3RAJH 1YEWA 3B2UD 3D18A 5EIVA 4DP0X 3IFLL 2K8QA 2QGCA 3C5ZD 1OOWA 4TNGA 4GXUM 3U83A 1S9KC 3B3IB 1JK8B 1J11A 1T7YA 2CNYA 4OF8A 3TCLA 3HVDA 2VL5A 4FOMA 4YDJB 2HG5B 2NY6B 1N8ZB 4FERA 3FO9B 1R5WA 4LQFL 2UX6A 4LEEA 3VXOA 4JLRA 1DJHA 4W9JC 1AFVH 1P5UA 2F08A 2JSFA 5KVMC 4PRAB 4QRSA 2A6KB 3IWUA 4ZUSB 5TD4A 1YN7B 1LP9B 2P45B 1JXJA 4LCCA 4LCWB 5J1AA 1M2VA 1BPVA 2X2HA 1HSBB 3D0LB 4V33A 5F3HA 5EZJA 3O6FB 4GXVH 2FCBA 3B2MA 3QJVB 4M1CC 3CFKB 2ZT9C 1X5AA 3DYMA 1OGAD 3EH3B 2Y1ZA 4JFXB 3IDNA 12E8H 2O1AA 4NQCA 4Q2ZB 3P77B 5D7JD 1GYAA 4V1DB 3VFGH 1E6JH 5E03A 4JRXE 4KK5D 3TA3D 5I75B 2GIYA 3Q43A 4XPBL 5ICYB 2AEQL 1W0VB 1IQWH 1H19A 1OM3H 1MWAA 4RGNE 2V7HB 4AH2A 1FGVH 2V3EA 3FB6A 1KXTB 4JO2H 3ZL4L 2HFEA 4L3EA 5CZVH 4G9DB 1JGLH 4ADJA 5JQ6H 3A4AA 1A9BA 4ADGA 4Z7UA 4R97B 1JBJA 3NZ8B 1S7WB 3C5SA 5IQ9B 1INQB 3RTQC 1FNHA 2EE9A 5ALCH 3MUGA 3Q8FA 4OQ1A 3FCGA 4AT6A 3QUXC 1CJYA 4B3EA 3Q8BA 1JFQL 2AGJH 2YEZB 5C3TA 3S96A 1U2CA 3QNYA 3KJ6H 1MREH 5CCKH 3BGFB 4XT1C 2VDRB 4Y7MA 2VN6A 4DZ8A 2B7DT 4N2OA 4NQEE 1U8HA 5KSBA 4F2MB 5D1QA 1AZVA 3QQ4B 2L7UA 5BRZB 2OCCB 3UZEA 1S7QB 2GFBB 4BDVA 2M1KA 2AK4D 4H1LG 4K23H 3B37A 5GGVY 3VI4E 1M9SA 4G6KH 3VI3A 4QOKD 2DI9A 2UZYA 1RULH 3HKZA 2XG5B 1GOHA 1NAMA 4IKNA 3O2DL 4ODVH 3GLEA 1CVRA 2OR8A 5E00A 4UM9B 5EN2B 2E6QA 1MCBA 5KJRL 3OR6A 1LDPH 4P4KB 5JHDE 1E30A 2WXRA 4FQLH 4FG6D 4P2OB 3ARED 5DUJA 3T2PA 4LLVA 4XAKE 5A2BA 1J5IA 5C0AB 2OV0A 4KNSA 1FFRA 1P9MC 1EJOL 1SJVA 1XR8A 4NPKA 4Z23A 1KTKE 5AAPA 4EDXB 1F90H 2F6AA 1MNNA 4N24A 1DVTA 4ALAL 6FABH 1AMXA 4JZOA 5LXVA 1GCYA 1ZGLA 4LCIH 4QXUL 2DQFA 1MF2L 2NCMA 2DD8H 3ESNA 1VA9A 1QTYT 4WW2B 4P2RE 1ZEAL 2Z92A 3G6JF 1SDDA 3VQMA 1H0DB 5DGRA 4LPUA 5CEZE 4IHOB 1LNUB 2ZIDA 5HGBB 1G5AA 5HGHA 1C7TA 1AD9A 2YAFA 3OAYK 1SPDA 5J0BA 1K3IA 2E7BA 2NUTB 1Q1JL 2PCPB 4A37A 4DQOH 5DJZB 5JZ7D 1QVOA 5D6DA 3QJXA 5HI5C 1ANUA 5B38A 3T0EB 3VGGA 4MX7A 2XWTB 4X6DF 3QBTB 4R7LA 1UATA 4XNZC 4PJEF 3P0YL 4X5WB 2GTZB 1N0XH 2GABA 3WUWA 1MCHA 4G2AA 1GZQB 1BOYA 2VDOH 2FEDC 4U49A 2XUWA 4YAQB 2YQBA 5FPIA 5IJVA 4DO4A 1WIOA 3DJ9A 1P6WA 2XIIA 4NM8H 5K39B 2H2PC 4UTBA 2NXYC 4QT5B 2AV7B 3B5GA 4HVBA 5IKCA 4OZIA 4GYBA 4PTTA 1XO8A 4EI5D 3T0DA 5GIRA 3W0WE 2VLJA 5IVZB 2UZXA 3WOVA 5FECB 4WI9A 4JCWA 4Y0GA 1T66C 3II1A 5D2LF 5GS1C 2D2OA 3U82B 4LVOB 2XVKA 3HCVA 5J3HD 3QFJA 2P47B 3KPTA 1XH1A 3ULUF 4M7ZB 5C0BA 2HMIC 2WN2A 3D4CA 5EPMB 3DXAB 5DRXA 4KFZC 5CZXD 3KYKL 3VG0L 2ADIA 5C6TL 1RP9A 3F7PC 5TGBB 2DEYX 4P46B 1L9MA 3O41A 1TZ8A 3TPUA 3L2LA 3WJJA 3U30C 2OTWA 1N3NB 3GMRB 1LO2L 5A2AA 2KZWA 3VFMA 4HS6B 1X7QB 1Z1WA 4U1JB 2WXMA 4YC2C 5SWZA 3QZMA 1R3IH 2GIXA 4I3RL 1XTLA 4K94L 2EIJB 3HPLA 3L6FB 2FX8H 3MROB 1NCBH 5EF1A 1TYJA 3WTVA 3G5WA 2OZ4L 1X9LA 1BXVA 1UM5L 1EFXB 2DDQH 2ORBL 2R69L 5JXAL 4MYPA 1XGRB 2K3HA 3QFGA 4IEFB 4HUCA 5I8EB 4RVBA 1DBMH 2UUDH 5D1XA 5CS7A 5FO2A 2C9AA 3W2DH 3LZNA 2XN0A 3BMWA 4P4RB 4CRPA 4DP4X 4DP7X 4EF3A 1BBDH 4NQUA 2YD8A 5AW3B 4KQ4H 4Z7IA 1IGML 1BM7A 5K69A 2R2HB 1PZSA 2B2XH 3T2QA 4AEIL 1KB5H 3FTUA 3V0GA 5ACZA 5HPMB 4DFHA 4EN3A 2V3DA 5LGYA 1QFUH 4KK8C 4UZSA 1RZJH 3RWGA 4R4FL 2ATKB 2WCSA 3IDJA 4FA6A 5JUEH 4LVHB 5I1LB 4WFFE 4WWKD 2W91A 2WZAA 3KLLA 4QLWA 3ILQD 1FZKB 1WZ1H 1HHKB 2QVIA 1IT9L 1QOKA 4PW9A 4KUCF 1C12A 2RCSH 1XGUB 1AI1L 1IGYB 3ZL1A 3GTVA 4ANUA 4BYHA 1WT5C 4JREC 1DZ0A 5EA0L 2PWFA 3ZSTA 2EECA 1XSJA 3HNVH 3EOAB 4C58B 3WJLA 2VABA 1I53A 2A9MH 2B77A 2CQVA 4NHUB 4FTVB 1F3JA 2V7NB 1T21B 4HCRH 1A3LL 3ZYJA 3K2IA 3GRWL 2FWSA 2ZWYA 2HJLA 2P28B 4QXGL 4EUPA 1BG9A 2W0PA 3RA7L 4E9VA 2UWEA 4ODWA 1SJMA 3DIFA 4OGAD 5J6SA 4OLUL 4A55A 1CT8A 3MRCA 5FEBA 1GA2A 3QUZC 3BJLA 2FQEA 2JELH 3VFRA 1SJXA 3KM1A 3QQ3B 5E6SB 4U3XA 2ISDA 1BQUA 2X4SB 2HRPH 3FPXA 2X1PA 3L1GA 2CO4A 3CBRA 3QUKA 1NM9A 2FHCA 1VGKA 4DQAA 2VQ4A 1KJ2A 5D7KD 2WW8A 3ZE2F 2P8LA 2D03H 2MH4A 4RDQG 2ZX5A 4PGBA 1CG9A 1UUSA 2DTMH 4Y7OC 5EO9A 3C60A 1THAA 4ODXA 3PGDA 2C26A 5HYJB 5L2KB 3BWZA 3VH8A 5HHNB 5EOQL 4XO8A 1GAFH 3FFCB 3GXTA 3HE6D 3N41B 1SBSL 2GC4C 1ND0A 3D6GA 3FSOA 5IB3B 3QIBD 5KTEL 4Z8FH 1D6EA 1IBDA 3MRIB 1Q9KB 1QFWI 4TULL 5FYKE 5ETUB 1HEJC 3RFZB 4RLDA 2J1KA 3DX9B 3MJ9L 4NUGL 3ZKMD 4G6ML 1T04A 4GUPB 2JE8A 1CD9B 1Z32X 4R2GC 2Z4TA 3BUQA 1BV8A 2G3MA 4LRNH 2DYPA 4MJ6A 2PO6B 2B1HL 5EF3A 1ESOA 4HISA 4YE4L 5LB1A 4JHAH 1DUZB 4U6XA 2BNRA 4UDUA 4MMZB 2OXGA 1COBA 3QORD 3RX9A 4I1RA 5JMOC 3HIZA 1S7VA 1NMCC 1Q9OA 1JGIA 1J5OL 3KJ4C 5IREA 4XHJC 1PG7W 4CVXA 5TDOA 5IB4B 4RWHA 5ESVA 3UGEA 3M8OL 3N44F 1AQKL 3ZT5A 5E1HB 5C0IA 1M7XA 2JKJA 2CXGA 2R1WA 4AOFA 2EVIA 4ZX3A 5JW3H 4HJJH 3FQ4A 5BZXA 5FGSA 1RUPH 4IRJA 4K71B 5DA0B 5AYUH 3OAZH 5IK3B 3GKWH 5DJXA 3HHRB 3FU0A 4H44C 3ZHKA 5E4OA 4CADA 4Y5VA 2ALAA 2OCFD 32C2A 4PLJC 1UD5A 2BJMH 3JWNC 4UV4L 2ZX9A 3KHQA 5M95B 3U6XS 1WBYB 2DLEA 3CSTA 4JY6B 5IM7B 3EDKA 5EU5A 1S5IH 1TTRA 4WCYH 1ZS8B 4ZAKA 4OQTA 4WI5A 1A6ZA 1IC0A 5D2LE 4JM2D 4M03A 3WTXA 5I18H 4M7LL 4LXFA 3VGFA 3ULUE 1AGEB 5E7FA 2QQLH 4LSRL 1SOSA 4DP8X 1VCBC 4I77H 4BH8A 3PY9A 1QFWL 2AC0A 3ULVH 1NGYA 3DURB 4LHUB 3LN5B 2XPYA 3UG4A 2ESVD 1FO0H 1ZLWK 3T04D 4K7PH 3ATDA 3ESMA 2ILLA 2FQDA 1AXSA 5KYYA 3Q2CA 2B5IC 4TLUA 3KNBB 3A3YB 3SDXA 1ZE3H 4WI0A 5D71L 4LVNC 2K7QA 4Z9KB 4EXPX 4FI7A 1Y1DA 4L8SA 2GAZB 2ED7A 3DNKA 2I9TB 4N85A 1YEFL 3WG7B 3B2PA 4YHLH 3RI5F 5ADPL 5A16B 2BH0A 1OE3A 1DQDL 3PUUA 2CJUH 4XX1E 2BERA 4HOXA 2ICEA 4PJXB 4LBAA 3TWYA 4NZFA 1NGZA 2F5AH 2FSEB 5FKAA 1VKXA 3V5KB 2H3KA 3RPBA 2TSAA 2E75C 3SJVA 2WGXA 1W72B 5DUMH 3S5LG 4UQAA 1KLGB 5I8CB 3L2MA 4L5FL 3RNKA 4P23C 4PS4L 4RFEB 1P2CB 1G7HB 1JTTA 3HPJB 4L3FA 3ZKXC 5KANI 3DYPA 2J8UA 3GIVB 1CE6B 1NDGB 2DM3A 2VDLL 3BPCB 5EUOE 1TO4A 4G9FB 5JPMA 1MFEL 4NPJA 4JGNA 1E7UA 5LBSA 3SDAB 4X6BA 4F9LC 1TTAA 3QFDB 2IV8A 3E8UH 4HKBA 3UBHA 4YHYC 1MLBB 5CEYB 4NDMA 1FIGH 1ZTXL 5MENB 1C8PA 3V4PA 5FUOH 2EDXA 3H54A 1IFHH 5KVGL 1RH8A 4X80H 3WKQA 3LZLA 1A4BA 1JNNH 4Q6KA 2Q3ZA 1RZKC 4UM8B 3N1QC 4HXAH 4OCRL 5E6ID 2VAAB 4DW2H 4ZMOA 1JVLA 5I8OL 2XC8A 3X3FL 2LR4A 3UZQB 3KYOA 5DK2B 1OLZA 3QG6B 1RZGB 2JNZA 4NN6C 1UWGH 3C6LA 4FEIA 2ENPA 3FRPG 1U30A 3ZKND 4Q9BA 1CN4A 1H8LA 4IMLA 3AY4C 1CL7I 4PHZA 5KWYC 1RJYA 2HTLD 3KEDA 4HAKA 4L4VA 4OVUA 1J0IA 4G8FB 5HGGS 1LE5B 4BFFA 5E9DA 2ITCB 4QRFA 3FHEA 2OSLB 5GZOC 4JKPH 4AIEA 2CR6A 4FP8H 4KMTH 1YZZA 1XMEB 3QIUA 1GKOA 1MI5B 1UZGA 4OSUH 4Z3EA 5ALBL 5FO8A 2P5EA 3EH5B 5JOPD 3WAJA 1CGYA 4B6ZA 4TTGA 3GMOB 1JZJA 4X6CA 1A1NA 1AKJD 2OM5A 4P04A 2WWMC 5FO7A 5F7AA 3CIQA 3QIWB 1HTYA 2OR7A 2GJZA 4GLRH 3T0BA 2WPGA 3K81A 4QHMA 4LEOB 4WTZG 5I9QC 5ICZB 2K6ZA 4NO0D 4ZMNA 4L8CA 2NNRA 4W93A 2EDNA 3DUSB 1ZGLP 4WKXA 4NQDD 3HNSH 3EZ8A 3OXSB 4EIGB 2C3GA 3A6BH 3VXNB 1JUFB 4FKKA 4XI5D 4Z0XA 3K5SA 4NBXB 4LSUL 5K5YA 2GKIA 2XTJC 3SDYL 4G82A 3DRQB 2EYRB 2MOVA 2PCXA 2VUKA 5L0QC 2O5YL