3CVCA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
source organism Phormidium laminosum
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvcA00
1QNIA 3CVCA 3NJLA 3OM3B 3T6VA 2HX9A 2ZONA 4CSZA 4G7QB 3IN0A 1BXAA 1AQ8A 7PAZA 2B08A 1I53A 1TEGA 1BYPA 2QPEB 5AFAA 2YARA 2HZHA 4F7KA 2FQFA 1ZV2A 1OCOB 2X87A 3CG8A 4AKQA 2EINB 4YSQA 2BP8B 1J9TA 1AG0A 3DTUB 1ID2A 2TSBA 4YSTA 5FC9A 1DZ0A 5B1AB 4DP5X 1OE2A 3CDZA 2BWIA 4UANA 3EH4B 3UAAA 3WNIA 1CUOA 2CCWA 3X1NA 2N0MA 3T6ZA 1KCBA 3NP4A 1DYZA 5I6OA 2XX0A 4KOBA 3SBRA 1BQRA 2R7EA 2UXVA 1ADWA 2PP8A 3ABGA 3WKPA 1GY2A 2IH9A 2I7SA 2Q9OA 1PLBA 4AZUA 6PCYA 1ZPUA 3ABKB 4HAKA 2EIJB 5B1BB 4DP1X 2W8CA 5LDUA 1GS6X 2XXFA 2QPDB 3NJNA 2YXWA 2AANA 1NTDA 1CC3A 2AFNA 1AR1B 1VLXA 3FS9A 3AZUA 3ASNB 2GC4C 2X88A 3WNJA 3GYRA 2YAEA 1J5DA 3NSDA 3PAZA 3NJGA 3X1GA 2Y69B 4DP6X 3UAEA 3IBOA 2FT8A 4GYBA 4DPAX 1W8EA 1NIEA 5A7EA 2FQGA 2MTAA 3SBQA 1GS8A 3FSVA 5AKRA 5D4IA 2IDUA 2XXGA 1SFHA 2IAAC 1ILUA 4WKXA 4BWTA 1FWXA 1JZHA 2XV3A 2QT6A 2EILB 4JKNA 1GS7A 2XWZA 1IKOP 3PAVA 3ABLB 3EH3B 3NJJA 2ZWNA 1KDJA 9PCYA 3KW8A 3OQRA 3WIAA 2UXGA 2UX6A 1JVLA 4E9SA 1L9OA 1FFTB 1J9QA 4YSCA 2IWEA 4G7SB 2IWKA 4HCFA 2PPEA 4BXVA 4P5SA 2YAFA 4DP0X 1SDDA 4YSUA 1OE3A 2EIKB 4BXSV 4GXFA 4L0PB 5PAZA 2VSMB 3EHBB 4CSPA 2YAPA 1WS8A 1W6LA 1A65A 3MX0B 1NIFA 4A2GA 3G5WA 1NPJA 1AS8A 1WA0X 2ZXWB 4G71B 5B1KA 4A2EA 4BWUA 3FSAA 1XB8A 4BK5C 2IDTA 3QJUB 3OMAB 1E5YA 3PLYA 2PPFA 1W6WA 1SF3A 2ZOOA 3S8FB 2DV6A 2GHZA 3GDCA 1NICA 2H3XC 4E9QA 2BHFA 3FU7A 2PPDA 4RH4A 1PF3A 4YSDA 4M4RB 1GR7A 1OCZB 1AOZA 1PNCA 3FU9A 1GW0A 2DYRB 3ERXA 2BW5A 2AZUA 3N55A 1JXDA 2RACA 1EHKB 2HX8A 1PZBA 1RCYA 4YSRA 5AZUA 4W9ZA 2GB2A 2IWFA 4A68A 1GY1A 4Q89A 3IEAA 1NIDA 1NINA 1NWPA 2I7OA 2Q5BA 1AZCA 5D4JA 1V10A 1PLAA 5I6LA 2J55A 2JKWA 1A3ZA 4HIPA 4E9TA 1IC0A 1AZNA 3EF4A 3S3DB 3FPXA 1ET8A 1JOIA 1KV7A 3ASOB 2H5UA 5F7AA 2DWTA 1ZDQA 4NB7A 2H47C 2XV2A 3NP3A 2VW4A 3QJTB 3RYMA 3U25A 3NJFA 1KBVA 1M57B 2XUWA 3DIVA 3QJRB 3ZBMA 3ZDWA 4FAAB 4NAJA 4DP9X 2HX7A 1PCSA 3OMIB 2I85A 4F2EA 1J9RA 2VW6A 3V9EA 4UAHA 1KDIA 1SDDB 5I5JA 2DWSA 3UGEA 3SBPA 4HZ1A 1MDAA 3T71A 2PLTA 1A4BA 3AW5A 4YSAA 4KNSA 2FTAA 1MZYA 1RKRA 2FT7A 2CUAA 2XX1A 2Y1AA 3IN2A 3FQYA 4PAZA 2JFCA 2GBAA 2HXAA 1BXUA 2MRYA 1PLCA 4DP2X 4P5RA 1AANA 3AY2A 1PMYA 2J5WA 3FU8A 4KOCA 1JZFA 4BDVA 1L9RA 2P80D 2IDFA 3WG7B 1BXVA 4YSSA 4KO5A 5I28A 4BWWA 3EH5B 1SFDA 2GI0A 4DP8X 1TEFA 1ET7A 4E9XA 1M9WA 2BP0B 2J56A 3S8GB 2EIMB 2E86A 4FA7B 2J57A 2CAKA 2BW4A 3ZIYA 4N8UA 3UACA 3NT0A 2CJ3A 4E9VA 1GYCA 4YSOA 1HFUA 2HRGA 3QPKA 1PZAA 1WS7A 3KW7A 1PY0A 1T5KA 2FWLB 3NSFA 1RZPA 3AG4B 4M3HA 1NIBA 1NWOA 4GP8B 1BAWA 4A2DA 3NJIA 2TSAA 3T6WA 5I5MA 3PCYA 4E9YA 2WSDA 2GIMA 1SHXA 3AG3B 1PZCA 3NYKA 3CDZB 1E30A 4G70B 4X4KA 4YL4A 2DY2A 1JZJA 1IBYA 3JTBA 1PNDA 1L9QA 2R7EB 1AS7A 1JXFA 4PCYA 1N68A 1JZIA 2IH8A 1OCCB 1WA1X 3QJSB 2NRDA 1ETJA 1QLEB 3X1FA 2AZAA 1ZDSA 5EHFA 3NJMA 1AACA 1KBWA 4A66A 2GC7C 2XV0A 2FT6A 1AZUA 1L9TA 3QQXA 4KO6A 5PCYA 3H4FA 4AX3A 2JXMA 3X1EA 4HHWA 1AS6A 1AG6A 1URIA 3N2JA 1NIAA 1OOWA 3H56A 3IE9A 3AG2B 3FSWA 4HCGA 3D12B 4BDVB 1PAZA 2PP7A 2XLLA 4KO7A 1NZRA 4KNTA 3TBBA 2DYSB 1QHQA 4TXVB 1WA2X 3FQ1A 5B7MA 4A2HA 2VSKB 2PCYA 5I6MA 1CYXA 2VM3A 3TU6A 2UXFA 4QLWA 1M56B 3BQVA 1AIZA 2OCCB 4HHGA 8PAZA 2FQDA 1ASQA 1SNRA 4HCIA 4AI7A 3WI9A 3JT2A 1KYAA 5I5IA 1IUZA 2LLNA 1A4AA 1ET5A 2VM4A 5B7EA 2BWDA 2YAHA 1KGYE 2GSMB 4W1TA 5TK2A 2XU9A 1IBZA 2PCFA 3DKHA 3S3BB 1OV8A 1V54B 3FYIB 3ZX1A 1FA4A 3PAUA 3CVBA 3MBWB 4JHVA 3BVDB 3FYEB 4A2FA 3PXLA 4KO9A 4YVUA 1XB3A 1JERA 1NPNA 2P80A 3QJQB 1AZBA 1JXGA 1TKWA 3OMNB 3L45A 4AKPA 2CALA 3QJVB 1BYOA 1XB6A 2BO0A 1E65A 2VMJA 4E9RA 3NJHA 6PAZA 3HB3B 1UATA 2A3TA 3NSYA 3OD3A 1SF5A 3FU7B 3T6XA 2XVBA 4WTQA 3GXUB 1JVOA 2WO3B 4GP5B 4DPBX 2FNWA 5I26A 3NSCA 2FJSA 1ASOA 4QKTA 1V55B 1E67A 2PPAA 4UF7C 1MG2C 4A67A 4E9WA 5I6PA 1XMEB 1ILSA 5IY5B 3UADA 1CYWA 1J5CA 4DP4X 2IDQA 4YVNA 2HLEB 1ZIBA 1L9PA 5F7BA 3TBCA 4Q8BA 1KCWA 1NDTA 4ZK8A 1BQKA 2BP8A 2YAMA 2UXTA 4KNUA 5D4HA 3FPYA 3S3CB 2OV0A 2YAQA 1J9SA 2W88A 1TU2A 1OCRB 4NERA 2VW7A 4N4YB 4ENZA 7PCYA 5B1JA 1WAEA 4MFHA 2YQBA 2WO2B 1MG3C 1A4CA 1OF0A 1JZGA 3ABMB 3T9WA 1BEXA 3NJKA 2BZ7A 3SQRA 2YXVA 4F2FA 4YSEA 1SJMA 5B1JC 2VN3A 3FT0A 3PPSA 4G7RB 4DP7X 3TASA 3WKQA 2OJ1A 2B3IA 1L9SA 5ANHA 2PP9A 2HRHA 3FQ2A 4HALA 2YAOA 1BQ5A 4EF3A 1SHWA 1X9RA 1F56A 2CBPA 3X1BA 1A8ZA 1AZRA 5I6NA 1EZLA 3CVDA 1N70A 1R1CA 1OE1A 1HAWA 4GP4B 3X2QB 3C75A 2QDWA 1E5ZA 2BZCA 2QDVA 4G72B 5TK4A 1HAUA 1ASPA 2PPCA 3HEIB 4YSPA 2AVFA 1RZQA 1YLBB 1AAJA 2XYBA 3H4HA 4AKOA 5E9NA 1MZZA 1GSKA 1ZIAA 5I6KA 1CURA 4GY4A 4K9JA 5B3SB 3CZUB 4DPCX 2BP0A 3TA4D 3V9CA 1X9UA 1JZEA 3AG1B 1B3IA 2IDSA 4JHUA 5B7FA 3UABA 3FSZA 2FQEA 2UX7A
chains in the Genus database with same CATH superfamily
2CIKA 4KFMA 4MQSB 3S34H 2OI9C 1HCYA 4L1HA 3SJVB 3V9FA 3BH4A 2B08A 3APCA 3Q2VA 3RFRA 4JRXE 5JPNA 5I74B 3KS0J 1KJ3L 3WAJA 7FABL 1N4XL 5EOTB 2COQA 4FGMA 4V1DA 3JBG7 5HYSG 4PHXA 1UZ8B 4J8RA 1SYSA 4J4PD 4XMLL 3M46A 4C4KO 3CZGA 4X6CA 4FYSA 3O6FA 3IJSA 2HFEA 3QIUC 4LF3B 5E51A 1KCUH 3H9HB 1XV8A 4QTFA 1TFHA 5E1IA 5C0CA 1G6RL 1RIVH 3QHZH 2LTQB 1F11A 5IQLA 4P9MH 5B1BB 3FQWA 2R69L 3MHZA 2W8CA 3S98A 4J5VA 1MHEB 4S1QL 2IH1A 4NNYA 2Q6WA 2BC4B 3US1A 2OR9L 2W0PA 2YXWA 4LIQL 3SKOA 3T3ME 5C0AA 3S3PA 1NTDA 2GJPA 1MHHA 4S2SB 4Z9KB 5DMKB 1F1DA 4FXKA 3QHFH 1AHWC 5IT2L 2X88A 1I7TB 4ZS6C 3S5YA 3GYRA 3KPLB 3IJEB 1KEGH 3DSFL 1HCZA 4FCAA 2G2PA 4HS3A 4UOQA 5CJ5A 1MREL 3NIFF 1YQ2A 4CC1A 3NJGA 4GH7B 3DXAA 1ZHNA 2LVCA 3HZKA 3VXNA 3RDTA 5J9PA 1IILE 3P73B 4QRPA 2JWYA 2BCKA 2NY6D 3ILPB 2V17L 1OSZA 3MO1A 4GQZA 4TVPH 4MJJA 1HYSD 4P2QE 1TITA 1XL4A 4WWKA 1GC1L 3G3LA 3SBQA 5A7BA 1OQXA 5A2BA 3AU0A 5F1IA 5GS0D 4IK7A 4KI1A 3EFDL 4BV1A 1OARL 1ZA3A 2QKIB 3CXHJ 1RHFA 2WKGA 4YHIB 4XN9A 4QRFA 3S7GA 2GKIA 2ICES 2F7QA 3MYJB 4XMKH 5C1MB 2YPVA 4ZX3A 5GZOC 3HMWH 4QRUA 1HQRA 1GS7A 4JRXD 1IKOP 4FQ1L 2YKKA 2FJGA 4IMKA 2O5NA 3NTCL 4KUCF 4YUEH 9PCYA 3LZOA 3OQRA 4YK4B 1P4LB 2APXA 1GMIA 1L9OA 3ARDB 1IM3D 2VKXA 5DJZB 3WMQA 4BQ6A 5JPNB 3K72A 1V7NL 4HCFA 2KDYA 4KBPA 3BDYH 1OE3A 5EO1A 1R6VA 1ZD6A 2MQ0A 3DBXA 2NX5E 1JJUA 2W0LA 4HOMA 3FN9A 4U6YA 4F8PA 3VXOA 5FR3A 2H0FA 3JSSA 8CGTA 2VDML 1SYSB 1KCLA 1P4BL 2XN9E 1A0QH 4X6CB 5TE4H 1FDLH 3O6FB 1XB8A 3IJSB 1SJHB 4BK5C 4X6FA 4Z3JA 3OJVC 5IVXB 3MA7A 3GSNB 3VDCA 2E0PA 3PLYA 3AQYA 4M7JL 2Z31D 2XSKA 2PWDA 3TEXA 5I30H 1MCJA 4OZHE 1FZMA 2VDOL 2H3XC 5IFHH 3FQWB 1CGXA 3BQUD 5DK2A 5LGKA 3NBNA 4ICWA 5DEGA 2VR8A 4PV8A 3B2MA 3EJYC 1D7CA 2NY1D 3RL2B 3DRTA 4HT1L 3MCLH 1O7VA 4FXKB 2BW5A 2AZUA 2NNRA 4Z7QE 1AP2A 5C6TH 3KBFA 4MHHG 4EDXA 3UTQA 4GBXA 4B9KC 4LLDA 3NA9H 1ZHNB 3A6OA 3UBFA 1FE8L 3VXNB 1P5UC 2AP2A 4Q89A 3RDTB 2QKSA 4YDKH 4X5RA 5D4JA 4NP4H 1YEGL 4WKZB 1NC4B 2VR9A 4ALAH 3DJZA 5SWSE 1IC0A 4LCIL 1BF8A 1RJLA 4X7DC 1RZFL 1FSKB 3GIVB 1VZIA 1GGTA 5FYLL 3ASOB 2AK1H 3Q5OA 4DFIA 2C8NA 4ZFOL 5DA0B 4BCXA 4YBQC 1JZDC 3TBVA 2GK0A 4UQDA 5FW8A 4M1CD 4E2OA 5ACZA 3QJRB 5LKNA 2VMDA 2OW7A 1BMWA 3WSQH 4RLDA 3S5LA 2ZOLA 2WLMA 5EOCH 3C5SA 4BUGA 2NY7H 3GO1H 4NPYB 1MFAH 1AGDB 1QUNB 2DPKA 2GY7B 3FAWA 3KGTA 4HKBB 5E99L 5FK9B 4P57A 5GGTH 2ORBH 2XN9D 3SPCA 4JQVA 4G6AC 1NC2D 1XH2A 1HILB 4U6YB 1A4BA 5I9QB 1IAIL 3TM6A 2FLBT 4YSAA 2IALA 1CZ8L 2Y1AA 3IN2A 3M1OA 4PB9L 1SEQL 5LN8A 5CEXA 4NNXA 3UO1H 1OGPA 1AGEB 3AXLA 3FO1A 3AAZB 3IGUA 4TNFA 1MJ7H 3VM7A 3RY5A 5L2KE 4MLSA 4OM1H 2YBRA 4CU8A 1PKOA 2X6VA 4OZIE 4D8PA 1E8XA 2X2IA 5C08D 3B7SA 4ZPVA 3SDYH 5HSFA 1FZMB 35C8L 1B0GA 4AIZB 2VITA 4RSYA 1IIKA 4U6HB 4R3SB 5TH2A 1YY9D 5DQDH 2A9DA 4A04A 4FOMA 3QO1B 3VW3L 4KZDL 5DMIH 1X44A 2XZQL 3B9AA 1VADA 3V4VL 2WZ5A 3MOBH 4WWKC 4YZFF 3VNZA 3ZIYA 2AHIA 3N6YA 2K3TA 4GBXB 1FAIL 4JB9H 1YEJH 5SWSD 1MNNA 4TULL 1U8IA 4MRCA 4NQUA 4CU6A 3WXWL 1M4KA 1A64A 2BVOB 3ECWA 1JPSH 3NSFA 4I13B 3N9GH 4PRPE 5EUKA 2IOOA 4PG9A 1M53A 4XOAA 3MNDA 1PZ5B 4PJAE 5IQ7L 4W9CC 2GIMA 4TNEA 3V5DB 2ZCHH 4QGYA 4MDRA 3VGBA 1C5CL 3DHJA 3KCPB 3CDZB 3KPPB 3NEXA 3NYKA 4G70B 4GRLA 4TSBL 2ZUUA 2AJZB 3HC0A 4MS8C 1EFXB 4QJ3B 3BAEH 3RI5F 1K5NA 5I75B 4G9FA 1RQ5A 5KTEL 1FUNA 3KYOA 3EF7A 2OMXA 4S0SD 1NM9A 2AXFB 3PWNB 4OVVA 5TDOA 3RZCC 3LNHA 5GGRA 3T4AC 2EUZA 2LW3A 3KWVA 2BNUA 1BZ8A 2ZWYA 3GMPB 2FT6A 5HDQL 5FHAL 5F3FA 5IESH 2FEEL 1BGXL 4QO1B 4DERA 1F2QA 1BIIA 4NNXB 3ZZLA 1EDHA 1I1AD 3QBTB 1U92A 4Y4HA 3BZFB 3D9AL 4Y4KD 2YBRB 3SY6A 2HJKB 2J88L 5HI4C 1MVYA 4C54A 2WKOF 1MHCA 2VDLH 4MAUH 3F8UB 1G7LB 4EIUA 4JM2C 3NPSB 4KNTA 3NIFE 5DO2D 4EMZA 5TH2B 4Y1SA 3BPOC 3DURB 5LGJA 3C60A 1J8KA 5I15L 5FYJU 1OD9A 5B7MA 3QZWB 1EH9A 5IF0A 1DN0A 3Q1SH 5I6MA 1N8ZA 2B0SH 1VADB 2ZX7A 5I0YA 1CICC 1I9JH 3NEOA 1OLZA 1IKNA 4KZCA 4FD0A 2NY5C 1LILA 3L2LA 2QR0A 5E2WL 4TM9A 4HHGA 4OD3L 1Y0LA 4UIKH 3TXAA 5A2FA 4EDWL 2XN2A 5MEQB 3WI9A 3EYUL 4Y2LA 1R3LA 4DVRL 2R29L 4P2OD 3NRQA 4K3EL 4JKWA 5EUKB 4WW2C 3TJHC 1S7VA 3BSZH 4TTDD 2YAHA 1QEXA 3L3DA 3TH3T 2JNZA 2VLRE 3FTUA 4XPBH 1DUYA 2EDFA 2FJFB 3KGUA 3PAUA 4DGYH 4LPVA 3CHOA 2IANA 3P3UA 5ICZB 4KO9A 3SGDH 4TQPA 4GKNB 1QSFA 3JTTB 2V5SA 4OLYL 1GPOL 3RG1C 1FC2D 3OMNB 5J11C 4JX0A 3QFGA 2M1KA 2NR6D 1NCWH 5A6IA 5BUGA 2A74C 3AREA 1BFVH 2OMXB 4TOYH 25C8H 1W72B 4HA1A 1IFHL 4GS7B 4IKLA 4WUUA 1QSEB 1ORSB 1TEYA 2XBTA 4J3SA 1QI3A 4I2XE 2G60H 2ZPKH 5C09A 2BIIA 3BFWA 1SJXA 1U6AL 1EEQA 2FSDA 1JNLL 1IGMH 4HFUH 4XXWC 5BQ7B 4ZX6A 5I26A 1UA3A 1XGZA 1QD0A 1SMOA 1FFOB 4JY6A 3HIZA 4Y4HB 1KELH 4B9YA 1OCWH 5B4MD 1T6BX 1L9MA 1JPEA 4BA8A 2D2OA 5C3LD 3UADA 1CL7I 1K8IB 1KYOK 2R0LH 5BCAA 3H9YA 4ONFL 3C08L 4N5EC 1EVTC 3CCHA 3TBCA 2D4FA 3O6KL 3GS7A 5LNDA 1BVKB 3L4VA 2UXTA 5LGJB 3EOAB 3C60B 4JFFE 4WFGE 3DX6B 2BHZA 4I0PD 4P5TC 1TU2A 3MJ8A 3KBPA 1PX8A 4LGSB 3PFUA 5L9DL 3AB0C 4F2MA 4G3YH 5L8JB 2YQBA 2WO2B 3NN8A 4MCZB 2E46A 4E41D 2VLRD 2Y06L 5KYNA 4QXWA 3A0OA 1E6OH 4GW1B 2JCCA 1S7VB 3RP1A 3WENA 1CDIA 1PZ2A 5LQBH 1IU1A 1QQDB 3INUL 2X9ZA 4RWHA 1IFRA 5DZ9A 3FN0L 5KN5A 1DE4B 2DN7A 1MRCL 3LVTA 1HAWA 5B8CA 1P5VA 4DEPC 3FH7A 4HZLB 5DEJA 4CSSA 1MVUB 2OPCA 3PQYE 3AREB 1R3IL 4LLUA 2OX5B 1CGSH 4CA4A 4TVSa 4XO8A 3QEQE 1S78C 1T2QL 3PJLA 4WV1C 2LT9A 3DHPA 1FI8C 4Z7AA 3TN0A 2EC9U 5LCVA 5T33H 1MCLA 1IEAA 3G7TA 4K9JA 3OAYK 4N2BA 2ATAA 4R4FL 4LLWA 3AM8A 1IT9H 4JY6B 2OMUA 2IGLA 5FPIA 2CO2A 5D2NA 4MNHA 4JAMB 4AKQA 1BVOA 4IHOA 3BKYL 4MD5B 2KLSA 5LAXA 2WJ7A 5JHLH 1V3MA 1VIWA 4JFFD 1BXAA 5DLLA 5DFVC 1I7ZA 4XN4A 1FZOB 1ZVNA 2VT0A 5C3TA 4HUXA 1DBML 4YZFE 4MWFA 4I0KA 4LSTL 1QMUA 3IS1X 2V2WB 2X9XA 3TNNA 3CFTA 3CDGA 2EE6A 2TSBA 4YSTA 1CFTB 2VKWA 2ED8A 1DZ0A 4PLOB 1Q94A 4M93C 4F2MB 1D5ZB 2VDKH 1ACXA 2DLFL 2E4FA 2N0MA 5INDA 1KXVC 4G5ZH 1PDKB 3NP4A 1DYZA 2XX0A 1PD1A 2MHAA 2R7EA 2FX7H 1XSIA 4YXLH 2ZUQC 2JCCB 4XH2A 1XCTB 1PY9A 5EF0A 3PP4L 5EN2A 2QQNH 4NT6A 5GGQL 4AQAB 2GSGB 1NBZA 2E8ZA 3TTYA 1FVCA 1ID5I 3U30B 1DBJH 1K85A 3PQYD 5JUEH 4MQTB 2VB5A 5IR1A 2YZ1A 2AFNA 3GK8L 3JV5A 3MC0A 4I7ZC 4ZS6D 1RAMA 4G6KH 4ZW3A 3ASNB 1FH2A 2WN3A 1OP9A 5B8CB 3Q05A 1JGUH 1E4XL 1P5VB 1JBJA 1UUSA 3ECBA 4JMNA 4JBSA 5ALBH 5TQ0H 2E9JA 4FULA 3L8QA 1PKQB 2FK9A 1IBDA 4K9EL 3MV7D 3L16A 5JR1L 3D48R 1BOYA 1A5FL 2CK0L 4NZFA 1GH7A 2AI0L 2PXYC 1I7RB 2H7WA 3EGXA 1ILUA 4LLWB 1UCTA 2EDRA 3FMGH 3Q44A 5GZOD 3LEXB 4MKMA 3VRJA 5D2NB 2BXZA 2OYMA 2QT6A 4MA8L 3BD5A 5LAXB 1UADC 2PO6B 3MCKA 4E5XB 1YG9A 5HD8C 1OVZA 3GHEL 1T6WA 4HUXB 1F13A 4E9SA 5GS2D 1I8UA 5AZEL 4FJ6A 3A6BL 4H0IA 4C59B 2WP3T 3Q8BA 4P5SA 2Z93A 4DGVH 3TF7C 3F01A 2PWFA 3IGLA 4RMRA 5F9DC 3MN8A 3QRBA 1HWGB 2MEJB 1AQKH 1QRNE 3RAJH 4M3KB 3WKNA 2BSSA 3APNA 4H8WL 5DYFA 4JZOB 3LRSA 3Q3GB 5CZRA 3LD8C 3GM0A 5DD5H 5A2CA 2PNDA 2B1AH 1ZV5A 1N5AA 2IV8A 1I3UA 3A23A 4WI6A 2A9MH 4OD1L 3K1KC 1Y18B 2V5YA 1XIWC 3ARGC 5KYWB 3PV6A 4PJ6A 4XH2B 2ZOOA 2A99A 2DKSA 2RQ8A 3WE6B 1JPFB 4NZTH 1WEJH 5C0JB 3UEQA 4HWBL 4Z5RA 3QWRD 1SJEA 3HHMA 1OSYA 3O45A 1NDGA 1AXTL 1YJDH 1VFAB 4OI9A 1FG2A 3OAZK 4JM4H 4Y16C 4EUPA 2APSA 2NNFA 3VSVA 1JGVL 4GFXA 4DO5A 4JHBA 1NCDL 3TN0C 3ZKMC 5IK3A 4P99A 3UC0L 3UEZA 1E7UA 3ECBB 4NQSA 1RCYA 4ZS7L 4QRPE 5KVGE 4BZ2L 4JDVA 2GB2A 1WIUA 3V55A 4I18C 2R56L 3IEAA 1UZGA 4U0QB 4Z7NF 2GITB 1F4XL 2ZYIA 2G5BA 3D0LB 2FWOB 3EF4A 2MNWA 3GSUA 4OJAA 1GGYA 1GYUA 3EIFA 3MBXH 4ELKB 1KLGB 1X5HA 3CN2A 3KD4A 4PWGA 4YBQD 5CEZH 1BQLH 3LV3A 1H9DA 5IFJB 5HVHB 3HC4H 1B0WA 4KTEL 5A2KH 2IXQB 4HF5H 1V3LA 4XVSH 5ILTH 3CHSA 4UQ9A 2XUWA 3KPRA 4XNUH 5BVJA 1Q1JL 1QRND 3ZTNL 1CFBA 5T1KD 5KBLA 1BAFH 3O6ML 2CJUL 3F58L 3QJFA 4UTCA 5E6UB 4BFNA 4G6AD 5DUML 1UCBH 1TJMA 1FLTX 2F5AL 5CFAA 5C6WH 3GSNL 4D9LL 3HAEG 3Q2LA 3CK0H 2B4CL 3LQAC 2IPUK 3LRSB 2YMTA 4LCWA 2O5XH 1Y1DA 3S4SG 1P7BA 1G84A 3L4TA 2ZXCA 5CMAB 5EC2A 1HZKA 4MX7B 2XG5A 3QP3A 5E8PB 5IBUG 2R39A 2Y3AA 1NANI 1R0AL 1R75A 3VA2C 4FI8A 4GUOA 4OTXL 1RU9H 2ZF8A 2ZG1A 2RJMA 2ZX8A 3PV6B 2QGDA 3BKML 1WIOA 3LIZA 3A67L 3LS5L 3FU6A 3MPCA 3DC0A 1GW6A 3I75A 4UQEA 1IIIA 4Z5RB 1SJEB 3NCYP 3O0RL 2VDRB 1SEBB 3O45B 3PGFH 4X80L 4FQJL 4Z0XB 3S8GB 3T5WA 1A02N 4M7LH 1S9XB 1RZIA 3I6GB 4HU2A 5IBLC 3WIIL 2A6IB 2JSFA 3CSFA 1R3JB 2CAKA 1C8QA 1EDYA 5K39A 3HI6H 3ZW3A 1IM3A 3HZMB 3R18A 3ZKXC 4FXLA 1EHLH 4DESA 1QFWI 2I60H 2ED7A 3FUHA 5EEVA 1BWMA 1QOKA 4M3HA 5ITBL 2WVVA 3GMNA 2YKLL 3AU1B 5DEZA 3U6RA 4WRLA 3NJIA 4QHKI 5CIPB 4P3WA 1JF6A 4A2DA 4ETYA 1FRGL 2AF2A 2JCCF 2X2JA 3FT2A 2VO5A 4EEEA 2ATPA 2JB5L 4MS8D 1PZCA 4RDBA 2LGNA 4PY7B 4ZX4A 4AV5A 3FFCE 1BZOA 3MVSA 1SUJA 2CO6B 2IH8A 3KDMA 3RZCD 1DSFL 5HP5A 2R4SH 2GABA 1IGIL 2B9BA 3G6AB 4UQ3A 4A66A 1Z9LA 2X3CA 4AGQA 1AZUA 4PI0A 1VGEL 2DTSA 1L9TA 3PXJA 5DVPA 2H0EA 1LO0L 3W39B 4L8SB 1HXMA 3B8SA 4Q6IC 1G43A 5L88L 2P5WE 3TBTB 4ZMLA 2XG5B 4HIEB 3WY1A 1DANU 2C9QA 3OKMA 5HI4D 2NY6B 4J3OF 5ID1B 4JM2D 3VFUA 1TCMA 1CL7L 5CSZB 2EJ1A 3EO9H 3MRQA 5L6YL 3WIFB 1MAMH 1IGYB 3C6LC 1IM9D 4IBZA 4M9OA 3V2AR 3MFGB 2P8PA 3HC3H 3ARSA 4RBPK 2GAZA 1R3KB 4Y5YC 3UP1A 5IB3A 4QXGH 1G7IA 4JRXB 3RTQC 4E0RA 1CICD 4HXAH 1AGCB 5ETUA 2VMCA 1CYXA 4PG2C 2Y2TA 4AEIH 1TYRA 2JV6A 1GHFL 4X6DA 4GUCA 4XX5A 4LNRB 1SM3L 4PUBH 1BA9A 1F45A 1IM3B 3CU1A 3L4CA 3WNPA 2GG1A 4AQ1B 3DVGA 4QHUA 3IBEA 3OGOE 5JMRA 1IUZA 3TJHD 2K0RA 2BSDA 3ZDZB 8FABB 1NC2A 2PMZA 3CH1B 4UM9A 2WVVB 4JZNB 3SKNA 3ATDA 1AE6L 1RJCA 1TTCA 2DOCA 2V6HA 4K0OA 4UZSA 4GQQA 5IJKC 1ZA6A 2F15A 5TK2A 4KRMB 1N6VA 3FFCD 4ODVL 3UJIL 2WSKA 1X5LA 2VIRB 1T1ZA 4OSUL 3ZX1A 3JXAA 2HUHA 5I71B 3RVUC 1Q4NX 4FZEH 4GKSA 2Z92B 2ZYSA 3O6LL 4MDIB 3U82B 1X5JA 4G9FE 2B1OA 1EANA 2Z31B 3EHBD 4OCRL 1CYGA 3EO1B 4RESB 5E95B 4LBAA 5C08A 2NXYB 4BHUA 1RZ8B 4IBTA 3US9A 3EJJX 5E94B 3BWUC 2ARJA 2NW2A 3BQUB 3HCVB 3OWRA 1N4XH 2NZIA 3NJHA 4JY4A 4JDEB 2EYSA 1UATA 2NY1B 1AFVL 1SF5A 2IPKB 2YPKA 1BVLA 3GXUB 1JVOA 4YH6A 1P2CA 4DQAA 1E8YA 2YOCA 3T65A 1HXMB 3CFQA 1C12B 4N2IA 1G6RH 4XVOA 4NZRH 3QFJA 4KMQA 2SEBB 3OKMB 3HS0B 4FNLH 3DVFA 4S1QH 4UDTB 5LBSA 1UJ3A 4JFEE 4P2RA 5DSCA 4LIQH 3MRQB 4KAQH 1ETZA 1I8KB 1JVKA 1ZJBA 2FO4B 2DQUL 2GPZA 4N2EA 3N43F 2D9QB 2GAZB 4MQ7B 2V7NA 1RZKC 3RU8L 3VE0B 3WJJC 5IT2H 3SO5A 4YIQB 4P5TD 2EEBA 3DSFH 4QHNB 1G7IB 3TURA 1J9SA 1JZ3A 4ZO6A 4Z7NE 2BY1A 5DFWH 4MSWA 2V3FA 3QS3A 5C0IA 5BS0A 5BRZA 4X6DB 2WCGA 1H3XA 2V17H 5I8EA 3OHXB 1Z0MA 2B8OT 2FH6A 3DVGB 4KXAA 4R4BB 3RX7A 4QHUB 1JZGA 5CN1A 4IU3B 2XN9B 5AKSA 1OARH 3EGDB 1CLYL 1NC2B 4XNQB 2Y1YA 4I9WE 1PJWA 1TETL 3K4DA 4L9LB 4K8RH 2Y3NA 5KJRL 3FB5A 1Y6MR 1EXUB 1KUMA 1JFQL 4FQ1H 2ARJQ 1T1ZB 2OMNA 4RISL 5IJVB 1HHKB 1OSPL 4IBQA 3NTCH 3K7UA 1SHWA 1EZVY 4IEFA 2E59A 1W72L 3CD4A 1EZLA 5D5MB 5C08B 1EO8L 1V7NH 1YN7B 3WKYA 3X2QB 1NEUA 4B7IA 3DYOA 3DK0A 3J27A 4WUUE 4Z7QB 1WHOA 4JFOB 5JPMC 1UFUA 3CLFL 4NBYB 3M17B 3TWCH 4Q9RL 2CGZA 1GIGL 3N1FC 2YPKB 1J0IA 3SE3C 1P4BH 3P54A 2WTRA 3W9DA 3OKKB 4JFDE 4NKOA 1JNNL 4Z7WA 2AC0A 1FO0B 2CO1A 2O1AA 4QRQA 3MRRA 3A3YB 4Q97A 5K1NA 1UXWA 3O2WL 4JFED 2FAUA 4M7JH 1QTSA 5SWSB 3V10A 2CO4A 2VERA 3RGHA 2F68X 2OMTA 4OGYH 1T83C 4RZCA 1U95B 3NJLA 3VQ1C 2D31B 2D73A 2P44B 4APQA 5DFVD 1U8JA 3BGMB 3DDFA 4CRPA 5I24A 4FS0A 2ERJC 4OF6A 1PCXA 3OPUA 5I17A 1OCOB 1VCBC 1X5ZA 4NQXB 1OGAE 4WEUD 5IQMA 2WXKA 3PS6A 2V7NB 1DJIA 5I73B 5F7NC 2W07A 4QPEA 2WWKT 3S36H 1WCBA 3KH4A 4J7RA 5AEAA 5TF1H 2ADGA 1FE8H 2V3EA 2AV7A 4NQCE 5BS0B 5JIPA 2C3GA 4K7FA 3R7RA 4R7DB 2EDWA 4JJ5A 1J8HA 4A63A 2OCJA 5I8EB 1YEGH 1YO4A 4HXBH 1ULVA 3KPSA 4Y2DA 3TFKC 2F7IA 2BOBA 3F7YB 4N2FA 3WTXA 3SBRA 4CSTA 4N86A 3D3VE 3BWUF 2VM9A 2QSQA 2VOTA 5FYLH 1CFNA 2OLDA 5AW7B 4QYOB 1EGJA 1ZPUA 1IGTB 2GY5A 2BVPA 3EYFA 5GZNA 1QFHA 4BKLB 4DQOH 3RWHB 1JYVA 3MRBB 1I1AB 3PUCA 3TYFA 3TZVD 1I8AA 2VJ8A 5DS8A 4Y4KB 3MCYA 3MOAL 4PJHA 1BYNA 3X12B 1OT2A 1IC4L 4ZSOA 4P8QA 2H1PL 3T08A 5KSVB 3MOQA 4S0TD 1J12A 2RH0A 5EBWB 3CZLA 1QR4A 3MMEB 5E99H 4F20A 2YAEA 5FF6B 5AZ2H 4GAYA 4MXWL 2FBOJ 5EN3A 4BE6A 4JFDD 4ZQTA 2G5RA 3DTDA 4L5FE 4IRZL 1EEYB 1IAIH 3D34A 3WDHA 1CZ8H 1FNFA 2H32A 4ISVB 2QL1A 4BK4A 4DPRA 2PXYD 2WCPA 2FNBA 3KR3L 2ZOTA 4ZMTA 4NKOB 3WTYA 1DUZB 1RVFL 2IAAC 2D9CA 1UJ3C 1KJMA 3LDBB 1UXWB 4UOW1 1A66A 3IM1A 1B0RA 4P46C 4PJAB 1M7IA 3QDAA 5TGBA 3FULA 2IFFL 2Y7QA 1OGAD 35C8H 4OW6A 4RZCB 4FCHA 2JJSA 4P2OB 4JRYA 5DFTA 2VRKA 4DK5A 1TJGH 1Z9SA 3QXAA 4KZDH 5FA4A 1BFOA 4NQCD 2OSXA 1J9QA 2YQ3A 3IFLH 1F3DH 1O5PA 2DEYX 2GSIB 4G7SB 5CJOH 3V4VH 4MA3B 1S7UA 1JK9A 5PAZA 5HHXH 1FAIH 2PYEE 3OKDA 3C5JA 2B1HL 3D3VD 1AMXA 3WFDL 4TULH 1DEEB 4K7FB 3WXWH 5EOCJ 3MUZ1 4KKLC 1VF5C 5AVSB 3NA4A 4JQXC 5E1QA 2YEVB 5HDLA 5C0BE 1XIWD 3ARGD 1K3IA 4A67A 4BK8A 5J1TC 2OMVB 2DYPA 2UZIL 2ZUSA 3QW9A 2YK1L 4H88L 5IQ7H 1NM4A 4XP6L 3OC8A 4NQQA 4LSUL 1GJWA 2AXHA 2FJUB 3HHSA 3ILQD 3S96B 1YNTB 4HWEL 4TSBH 4U3HA 5LB1A 1GGIL 1MW0A 4M4RB 4QI3A 4XMZA 1MIEL 3RPKA 1GR7A 5KTEH 4Y16D 1PNCA 4PJHB 2RCSL 5B39A 2NXZD 4D94A 4I48A 2BK8A 2EO7A 3FOLB 1BFTA 2YMXH 2XQ0A 1YEFL 2J5LC 2OBGA 4YLQT 2EDBA 5DJXA 4W9ZA 1MWAA 3B6SB 5HDQH 1SYVB 1BGXH 2I7OA 4QXTA 2EH8L 3JWOC 4I0PB 5E23A 1QFWL 4ZFGL 2PW1B 4G9DA 3H6JA 2WZAA 1D9KC 1LD9A 1U3JA 4AGOA 3D9AH 3DX0A 1THCA 4BIKA 4BFBD 1B0RB 4FXTA 2J88H 5JIHA 4L3CA 4Y7MA 2VLRB 4Y1AD 4E41B 1KB5H 1A6UL 2H6PA 4NB7A 2WNKA 1CLZL 2BMKA 5KANI 3QJTB 1KPVA 4ANUA 5IMKA 1KBVA 2DQHL 3AXIA 4PBWD 1BDYA 3ZBMA 5M95B 1XR8A 2CZNA 4XPGH 5E56A 3CFMA 3MU3A 1ZHBA 2PYED 3JUZA 5I15H 2HX7A 2ZXQA 5FA4B 3MA9L 3ALPA 3LHAA 3WUWA 2LLGA 2YUZA 3K2MC 4KUZL 3MFFA 5DRXA 4EPSA 5LLIC 4Y2DC 1OB1A 3KPTA 2VR7A 4UQ2A 4GJTB 5C0BD 2YD2A 5E2WH 4OFKA 3IXAA 4OD3H 2OMYA 1HIML 3KJ4B 3G5XA 3KPNB 3DRQB 3EYUH 2R29H 5HPMB 1GSMA 4WENB 4K3EH 3EJPA 5DVMA 4ZPTA 3MAWA 1AANA 5FO8A 4QR7A 1MCQA 5EZJB 3MV7A 3WGUB 3B7TA 1LM8V 4GO9A 1P6AB 4I5BA 5F9WB 3V6ZB 1MOEA 3N1QC 3RWFB 2Q7YB 3B9VA 4EAEA 3BH8B 3HHSB 1I3GL 4PBDA 1PZDA 4FF9A 4NZ8A 2P26A 4X7TA 3F85A 4K5MA 1JDDA 1GRWA 4OLYH 1MUJA 4CBZA 5IBLD 3ZUCA 5KVDE 3O9WA 4MAZA 4BH7B 4IRSD 2JF1A 5KVMC 3MUGB 5I1CL 2ILLA 1UQSA 4I48B 3W1ZA 1IFHH 1DN2A 5EBMB 3BLPX 1JV5A 2JB6B 3B3IA 1F6FB 4HKJA 1EAOA 4XBPA 3S0PA 5DJXB 1MWAB 4C57C 3O3AA 3A5VA 1U6AH 1DVYA 3G5VA 1JNLH 4F15C 5CR1A 2J6EA 3M7OA 3ZDYE 4OV6F 1NIBA 1NWOA 3L3KB 4G9DB 3ULAB 1LD9B 1NCCH 5DJ8B 3LS4L 5F1NA 1TTGA 3BT2L 2QLVB 1TZGL 5CN3A 5M7QA 2EDOA 4ONFH 3MBWA 4N2MA 1SOKA 3C08H 2XKUA 2H6PB 1JV2B 3KCWA 4U7MA 3KPRE 4Z0BH 4GUPA 2IBZY 3I02A 5IMKB 4B41A 1CXEA 3U6XS 2K6WA 3B83A 1IQDA 1ZHBB 5DRZA 1NLDH 3QI9C 5HI3D 1JXFA 3R19A 3FU3A 1OCCB 1N8OE 3LY6A 3IGFA 4I85A 2GJJA 4B53A 3FFDA 3PQYB 5L9DH 3B5GA 1GXEA 5F0PB 4UV7L 3PWPE 4XNMB 1AHWB 5IW3A 4JGNA 3SN6N 4JANA 3JV6A 5FAAA 2OMYB 4N0YL 5AVYB 1HI6A 5CF3A 4MJIA 3MJ9L 2JXMA 3THML 3EG9A 3L1EA 2ATKA 2OZ4L 4ZPTB 2APBA 1MW1A 1MI5A 5FO8B 3L3HB 1TZIA 4JFUA 3QXDB 3ML9A 4HCGA 1W0YT 3GMMA 4J3BA 4Z7WF 1UH3A 3MV7B 5BV7B 3VXSE 3INUH 4PRAB 4DTGL 4Q52A 3FN0H 2K3HA 3C6LD 2CPUA 4WSGA 3TJEL 5ALCH 1WYJA 4AYEC 4CC4C 1MRCH 1QHQA 3FUIA 3SCMA 5BQDA 3TESA 1SQ2N 1WVZA 5KSAD 3RTQD 3O9WB 4P0DA 2JIXA 3SKUD 43C9A 4ELMB 1RSFA 2NY3D 4MNGA 3FRPB 3RX5A 3QVAA 4HYTB 1KGJA 1E4KA 1JV5B 1LK2A 2B9AA 3CDYA 4G11A 4HKJB 4FHJA 4XBPB 4DKTA 4ZW5A 1PEWA 3O3EA 4YXHH 4R4FH 5BOJA 1DEDA 5CU9A 1DZBA 5D9SA 1OAXL 2FIKA 2K9UA 3II2A 4W1TA 2Z65C 5F1NB 1Z5LB 2ZX9A 1EZVX 3BKYH 3KEDA 3P9LB 5DWUL 4OM0L 4U1NB 3RVUD 3GMOB 3N1MC 2WLIB 3MBWB 5EO9B 1DFBL 4DGUA 1JPGB 4NO3B 1DBMH 3BW9A 4RNRA 3FUNA 3QEGL 3D05A 4LSTH 4OJEH 1DVFD 1CTNA 2J2ZA 1UASA 3QJQB 5ICUA 5KS9E 1HINL 1TKWA 2D3LA 2EC9T 2CLRA 3DUUA 3PWPD 3C6SA 2YGOA 3L45A 5J57B 2WV3A 1TLKA 5FFOA 1E65A 2CDEA 2UV3A 3BZ5A 3FQUA 4FMVA 2WBJC 1A1OA 4DF9A 2K4AA 4K71C 3WY4A 1MLCB 4KTGA 1T89A 4G1MA 2DLFH 1TTUA 3WDIA 3H3BC 3RA7L 5B38G 1JYXA 4MDJA 3VXSD 2JQAA 3C8KB 2VNCA 4L3EA 5GS0L 3AQDA 1V55B 3TBVB 1K5WA 3S8WA 4P06A 4RAVA 4PRBB 2B5IC 3UFIA 1XMEB 3GMMB 2N7AA 3PP4H 3QXTA 2VLLA 3PYCA 4W6XB 2UY7A 3P9WB 2P5EE 5GGQH 4TUOB 4WHTB 3RWIB 3ES6A 1M2OA 4MAYA 5FKAA 3VX0A 1ZIBA 1IC5L 1H5BA 4XPHL 4Y5VA 4KJWC 2H6UA 3E8UL 3GK8H 4LVOC 2AQPA 5JDSA 3LXUX 1WHPA 3SCMB 5ESAA 1X9LA 3WYRA 4OLXL 1E9PA 1A6ZA 1E4XH 2VCOA 1NDMA 3IKKA 43C9B 5F72S 1KJVB 5FLVA 1Q1PA 2OTUB 1CXKA 1G4RA 2CKNA 1TQTA 4WTZA 7PCYA 1QRNB 4O02A 4K9EH 4LT7A 1MPAL 1XGPB 4PGDA 5JR1H 4UTAA 3W56A 5T1KB 1EEUA 1KCRH 2CK0H 5T3XE 1HHIA 4PJFE 4C4UA 4F7PB 3BP6A 3VH8A 4TQEL 5D9SB 2ZOKA 3M86A 4YSEA 3TASA 1P6FA 2OJ1A 3H53A 2MFNA 4MA8H 3KWTA 3S35X 2APFA 3DUHA 3BSGA 1BJ1H 1UKSA 3ULSA 3FU0A 3WFHA 3GZQA 3GHEH 3VSQA 2AEPH 2WOYA 3HE7D 5TFSL 3KBEA 3E9TA 5AZEH 4NN7C 2CDFB 1OE1A 3A6BH 4AQ8C 2NLJA 4PWHA 4RGMC 4JGJA 4JG5A 4PJBA 1F90L 3RY4A 2QMJA 2BVUA 3QK0A 4OLEA 5TDPA 3Q6FB 3LEYL 1WFNA 2APWA 1CU4L 1KCSH 1F1AA 4AKOA 2VLJA 1TQCB 1R5VA 2JJWA 1L6XA 4MB1A 3E6FB 4PU2A 4W9GC 4KVNL 1TO5A 5DUJA 4OD1H 4MJ5A 2P5ED 3L54A 4N20A 4AZ8A 5AVRB 4DO6A 5AOMA 2Y36L 3P4MA 4GW5B 2I9TA 3FK3A 5HGHA 1DJGA 3HLAB 2YD8A 4TYUA 3V0WL 2ICWJ 4B9GA 4O4YL 4HWBH 4JCMA 2UY7B 3I3EA 5I1AA 2EAEA 4N2HA 4UT6A 3LKOB 1AXTH 4NQDE 1HCVA 3L08A 4Y19A 1I1FA 2LABA 3ROLB 2G4EA 2AJ3A 1E4KC 4CMHC 5JDSB 4BFJA 4G6FD 1JGVH 1WD9A 1NJ9B 1NCDH 3GXNA 3BLKA 3RX8A 3UC0H 1LE5B 5HVWA 5BRZE 4ZS7H 3TYGL 2WUBL 3EJCA 3RE0A 5AOZA 2R56H 1U8QA 3BSHA 3TFKD 3RZCB 3NCEB 1F4XH 2CCLA 4Y4FA 3T4AB 4BSJA 5ADPH 4QOKA 4L8DA 4LFHD 4NKDA 3C5XA 2I7SA 3GM8A 5HDOA 3MV9E 3MRIB 3FTVA 4UOW0 1S7QB 3FU5A 4KTEH 4NGHL 3DX1A 3EYQD 3H6AA 3HJ0A 4JPSA 1UD5A 1WFTA 3O2DL 2AANA 4FQ2L 4FKHA 1Q1JH 5CLTA 1PSKH 3KYKL 3ZTNH 1THAA 1NBYA 1AR2A 1VLXA 2H26A 3O6MH 4F7TA 3TEWA 2NLJB 2CJUH 2WQWA 3GINA 3LZLA 4JM2B 3HG4A 3WNOA 1GAFL 4DGIH 4Q9QL 2G3NA 4PWEA 1IM9B 1FO0L 3BPOB 2F5AH 4U7SA 2J8OA 1DQML 4HFWA 3GSNH 3VG0H 4D9LH 4AJYV 1JDAA 1VEOA 2B4CH 3DX8A 3OXRA 4JQIA 5FEBA 4Z7WE 2P8MA 4U0RC 2QTEA 1WUNT 5D8JL 4ZDHB 1U41A 2F8OA 4Z78B 4JKLA 4JW3A 3QYCA 4AQEA 3SPHA 4NHCH 4HUUA 4YNYA 4P46D 1R0AH 2WQUA 1G0DA 1N3NB 1TENA 1RUQL 1SY6A 3IDIA 4OTXH 3QUGA 4NQDD 3BKMH 3RVVC 2Q7AA 3RVTC 5HGHB 1PJ9A 3LS5H 3PJNA 2VGLM 4KKNA 3NZ8A 4WW2B 3T3PF 3KPMB 1HKFA 3JWDL 3O0RH 3PAVA 5I1AB 1D5MA 3UAJC 5EU7C 1A9BA 1RZJC 4X80H 4FQJH 4CILA 4ELDA 3FFCB 3WIIH 3F7VA 2G0KA 4NQEE 2YA2A 5J13C 4DP0X 3F65A 4YHYB 1AYOA 3M1BA 2EIKB 4RFEA 5F1SA 5IHZB 5LHDA 3EHBB 1BLIA 5J11B 3I9GL 1J8HE 2VZOA 2WB7A 1G7QA 1NIFA 1QG3A 4ZMQA 1U8QB 2A74B 4KKLD 4ZMVA 1CGTA 1WT5C 4XP1L 5ITBH 1KPRA 4HS8L 1AXIB 2W65A 4WK0B 2YKLH 5FOBB 3TBYA 3KPQB 3G6DL 4Y4FB 5IHBA 1E4WL 4QOKB 4FQPA 5K9QI 3LZRA 1S3KL 4Y7OC 1BQHB 1FRGH 4WAFA 1BMZA 2EADA 2JB5H 3ZL4L 2XG4A 2ED9A 4LCYA 3HB3D 1KLUA 1T0MA 4KJPC 4ZSOE 1G94A 3J2PA 4F7TB 4GT7A 1TVHA 3DX3A 5SWQB 3PDDA 2EVFA 3PHOA 3WY3A 1YPZA 3UH8A 5I66B 1MVFA 4FZ8L 2HLAB 1VGEH 3M07A 3OJ2C 3HVNA 4H4NA 2BIPA 1LO0H 1OP5H 2P8MB 4IOIA 5AAPA 5I6LA 5F96H 2JKWA 2GJ6E 5DU7A 2W95A 1A3ZA 4CNIB 2BSTA 3AB0B 5I0XA 4AQEB 1DLHA 2OP4L 4MMZA 2FBJL 2UZYA 4YNYB 4PRDA 3TWYA 3IDIB 1MJUL 2Z8WC 2CG9X 2QJDA 3KXFD 1JAEA 1UGNA 1CL7H 4YHML 5L6YH 3VWKD 5FHBL 4MZRA 4NQED 5FM5M 3RYMA 2EDDA 4GSXA 1X7QB 1D5MB 3CN3A 4LP8A 2FE0A 4KXDA 1ZVSA 3T8VA 2FUTA 2XXCB 4EUPG 2Z34A 3DUSB 1JTTA 1S9YA 4LRIC 5E70A 4FN0A 2BPBA 3M1BB 1DANT 4RFEB 5I5JA 2CKBA 4Z3EA 1EHXA 2Q3AA 4GRWE 2B14A 1SM3H 1YAZA 2HN7A 3UYPB 4PLJC 4ABUA 5AW5B 4QT5A 3JVGC 4XO4A 3UYOD 2X89D 4F8TA 4DEPB 2DQFA 4R4NC 1RKRA 4PAZA 5DS1A 2DL9A 2FEDC 1BJ8A 5FW7A 4KKCD 3CJJA 5MERA 2F1BA 3MJ7B 1I8IA 1KPRB 1AE6H 5KVFL 3SDAD 1T2JA 5J6GA 4LHUD 4OJYA 3UJIH 3B7UX 2E7LC 3Q2NA 4XTRC 1E9OA 1ADQA 1CFQA 1AGBA 1MY5A 1NUNB 4YSSA 1IC7L 3O6LH 3L3JA 3SE4C 4LLVA 2V5MA 4R8WL 3OKOA 5ID0A 4JFEB 4EZJA 2OTWA 2XG4B 4DP8X 1BZ7B 2HJLA 1MDTA 4R6UA 1M9WA 1IV8A 2E86A 4OGAD 2CBQA 1DDHB 3NRFA 4U1JA 5FA3A 1RV6X 1R3HB 4L05A 2LU5A 4YPGA 2D7NA 3NT0A 2Z4TA 2E6PA 3VGGA 3OX8A 4PGEA 1OK0A 3KLLA 5DHVA 3QR1A 1NUDA 2CO3A 1INQA 3NESA 2VABA 1DQQA 1T5KA 2UYLB 4X5XB 1K4DA 1RZPA 4AENB 3CUPA 3M1CA 3ABZA 3D51A 5E5RB 5HHVH 3D08A 2ZYRA 4M93B 5GHWL 1MRFL 3L5WB 2BSTB 1G9NL 4D7PA 1DLHB 5D55A 2UZYB 1SLXA 2NTSP 4PRDB 3FHQA 4L1SA 3U1PA 2COVD 4P4RB 2P49B 1B2WH 1DQVA 2H45A 2KH2B 3ATAA 5H4YA 4LLYA 4ZXBC 4CMMA 3OF6D 4K23L 2DY2A 4H8VA 3QI9D 3RU8H 4F37F 1GTFA 1N59B 2PABA 2XN1A 5C0GA 1ZEAL 5HJBA 4RSVA 3QC6X 3TZVB 1QLEB 4IKJA 3BAWA 1RK7A 1ZDSA 2VMFA 3EYVA 3L95A 1LEIA 1RH8A 4LSSL 4OZFA 4PJBF 1D5BA 2HVJA 3MV8E 1UD4A 2HN7B 2EIDA 3QPXL 4QT5B 2V8LA 2CUIA 2E7CA 2PTVA 4FFTA 3TA3C 5J06A 1SDYA 1IX2A 3G9AB 3I3BA 5MERB 4JFDB 3MRLA 1I8IB 5EBLA 2ITCB 3H56A 5AAMC 4CVXB 4Z23A 1TETH 1JF1A 5KJRH 2Y5EA 2Y1VA 4UT9L 3MNZB 2ZKHL 3T2OA 1JFQH 3RLSA 4Y9FA 5BXFB 3I74A 2PXYB 2ZQKA 3J7HA 1IBHA 4G8EB 4RISH 1OSPH 2HMIC 2CLZB 3N91A 2P48B 3QT2A 3L3JB 4KO7A 4G43A 1ROWA 3OKOB 1W72H 3CFDA 3MXVL 3B8YA 4Z3TA 1EO8H 1EHNA 4A7QA 4Z7UA 2QGBA 3GSOA 1J0ZA 2IF7A 3QJHB 3GWJA 4YHKH 3QIBA 3I50L 1OGAB 3L7FB 1FYHB 4YHNB 2PWEA 3LRKA 3BP7B 2P4AB 4UBDC 1EUUA 2E9GA 4AK1A 1ZHKA 2Q8BL 3CLFH 3TU6A 5CZKA 1E7VA 4Q9RH 2EE9A 4NOBA 3FL7A 3LPPA 3ORJA 4NOFA 4JG1L 4MMZC 4WLCA 1GIGH 5IROA 2RFXB 5CP7B 1HH9A 4J27A 1JNNH 1L3WA 3FO2A 5D7IA 2VABB 5GJSL 3ZE2E 5IBTL 2IOIA 1NCAL 2A0LC 1GGCL 3O2WH 4B3EA 5F3BB 2PCPB 1G7HA 4JHWL 4UNTA 3IWVA 5D96B 3T3PE 4R26H 1BQUA 3BO8A 3D3VB 3PWVB 2ESVA 3LD8B 3QNZA 1T80A 3QXVA 1RUPL 3T2NL 5MENE 1FA4A 2A6DB 2MCPL 4DAGL 4C47A 5HGBA 4A2FA 2IVFC 2YN3A 2DQEL 3ARGB 3K4ZA 3GKWL 1S7SA 2OMZB 4CMMB 5ESQB 1X5KA 1JXGA 4FTVA 5DYOB 5T5NF 3VXME 2DZEA 4R0LA 1U8CA 4JG0L 5T3ZH 2FL5A 3MV8D 1BYOA 3BZEA 1OP3H 3HI5H 2WBJD 3MRNA 2N7SA 6PAZA 3VFTA 1XCQB 2ZOUA 5IB1A 5ISZE 4U49A 4OR1A 4GO6B 3EYVB 3GXTA 4XR8C 4Y16B 1LEIB 3T6XA 2XVBA 2H41A 3E9UA 3VFRA 1TYEB 2NXZB 5DEFB 5BMFH 3N1GC 4JREC 4NAMA 5C07D 4QRSB 4HMCA 1YZZA 4NRZA 2JH2A 1BECA 3MRLB 3PF2A 4I18B 5EBLB 2PPAA 5FLUA 1JF1B 5GRVL 5E6ZA 4MJ4A 3GB7A 4PP2A 5JXEA 4I1RA 2F54E 2IDQA 2RBLA 4OV5A 5F97E 3TO2A 3DX2A 3RNKB 4KJWD 1R5WB 3PWJA 5CILL 4BINA 4G43B 1H3PL 1ONQB 1IC4H 4GKZA 5AQ0A 2H1PH 4ANWA 5DVLA 4Y1AB 3GSOB 3HW7A 4LL9A 3FPYA 5CAYB 4FNTA 4MXWH 1CGUA 2W88A 1OO2A 5E1HB 3VFGL 1OCRB 2DEXX 3DX7A 4HOXA 2Y2WA 3FZUC 2F74A 4IRZH 4X0KB 4DZBB 1X3DA 3LZQA 3VB8A 2PYEB 4R2GC 5B1JA 4GW4B 2PF6A 1P1VA 3KR3H 3P3RA 3VDBA 1QYGL 3FO2B 3ABMB 3GXFA 4ESKA 5C0BB 3W5MA 4N8VG 4KK9C 4LOVA 5J5EA 3WKQA 1G9HA 2IFFH 3QFDA 1NGXA 1VFOA 4AEFA 4GG6A 1PIGA 4LXFA 1NMCC 5D7JC 3VXMD 4DN4H 5FYJE 2VDQB 1TCRA 2HRHA 4HALA 2AQNA 1J11A 2D8KA 3BPLC 3BISA 1WAAA 5D1ZD 3MNWB 5G4MA 2QQKL 2E27L 3MRCB 2KC0A 4ONHB 5A1AA 5ISZD 4CU7A 1M05A 3SE9L 3MLWL 4PJ5E 2E5EA 2DQCH 1F58H 1U8CB 3EJUA 5D70L 1UEMA 2NY0C 3CFKA 3VI4F 1A1MA 3MRNB 5GPRA 3DVIA 2BZCA 2QDVA 1UXSB 1JN6B 1GYWA 2B1HH 3GHBL 3VFTB 3WFDH 5KSAA 5C92A 4I0CC 1RZQA 5EEXA 3H4HA 3Q8AA 2V37A 4HZAA 4IRSB 2ZYHA 4HHAA 1GSKA 1ORQB 3VWJC 1YPZF 3HPJB 3LH2H 2WSPA 2OKMA 4Y1TA 2F54D 2UZIH 5JW4R 3BUPA 4H88H 4NRZB 2YK1H 4FADA 3AG1B 5I16B 1LO5A 1FYTE 4LVNC 3ZKXB 4QMEA 2CJSA 4JY5H 4XP6H 3LKPA 4LSUH 3HNVH 5F7WC 5DO8A 1MH5B 2G3ZA 2JVUA 3CVCA 2XN0A 3I6LE 5TF0A 4HWEH 3GB7B 4PP2B 1RJYA 1GGIH 3IMSA 4U3XA 4OV5B 3WJLA 1MIEH 1ZANL 3PWJB 2X1OA 3QJOA 4UILL 5GGTA 2RCSH 3O41A 5FWRA 5CD3A 3CZFB 4ZFFB 5EU7E 3ZLQC 4JFPA 5IROC 2J8HA 5DC4B 3IVKB 1R33A 4N2AA 5MI0B 1YEFH 1KXTA 3TX4A 1WF5A 1QWNA 1XCXA 1KN4L 2O5ZH 4XGZA 3BWAA 3TIEA 3ZKNC 4O2FB 3V6FB 1NKRA 2EH8H 3FONB 4FL4C 4OI8A 1QFWH 1JS4A 1KNOA 3E6HA 3FOMA 3GJFB 4X4YB 1JPTL 4JPWL 4HISA 4M43L 1UWEL 5CBEB 5IHHA 5IQ9A 2BY0A 1IARB 2Q9OA 3FH5A 4ZNEE 1HEZA 2W9EH 1JHKL 3ABKB 3GMRB 4FQLL 1CLZH 4Q6IB 5IMOB 3FUMA 2IBGA 4OCSL 4OJFL 4PJ5D 4X8GA 5E5MB 5BZDA 1MCEA 4HJ1A 3OG4B 3BD4A 1XDTT 4EN3D 2VXVL 1Q9KA 3E3QC 4HMEA 4N2LA 4PGBA 4G1EB 3BVWA 2AXGA 1IAOA 1AC6A 3MA9H 2BNQA 3BRGC 3KM2A 5E8EA 1M05B 2XBDA 5CWSB 4KUZH 2GC4C 5KVGL 2RHEA 5F21B 3C6LB 4BZ1L 5IEKA 3UJJL 3X1GA 2RD0A 4GXVH 4O9HH 4XPTL 3Q6GH 2P7TA 3KGRA 4H0LC 5KSAB 1ITBB 3RTQB 2AK4E 3AWGA 1FYTD 2AKRB 2HFTA 2WXIA 4M8QA 4MNQD 1EJFA 5EEZA 3BCFA 1JYNA 2GCYB 2NY3B 5JXEC 3ZDYB 4APXA 3I6LD 4YEEA 5HHOA 5JOPE 3GKZA 1LEGA 4BWTA 5H37G 3RVVD 4DOHE 3RVTD 3CSTA 4Y0GA 4F9LA 4HD9A 4OUOA 4A6YL 1I3GH 1I82A 3DNKA 3MR9B 3UAJD 1RJYB 4YE4L 5INCA 1K3ZA 3IPFA 4LHUG 3GRBA 3PGCB 1X5YA 5BUPA 4U6VL 1HHJB 2Q8AL 1A1NA 5CD3B 3VX1A 1UD3A 4JFPB 1PFCA 3OJDA 2EC8A 2FEJA 4CN1A 1AHKA 1DVFB 1HHHB 5FOJA 4L4VA 2MWCA 2JK5A 3BWAB 3S2CA 3TIEB 2FX8L 3PWPB 2TAAA 2WW8A 4QHMA 4U6XB 2ZXWB 2BDNL 2VZVA 3F3HA 2YD7A 1FNGA 3BKCL 3GMQB 3BJ91 3IJ7A 3HE6A 1UWXH 3BUQA 4IW4C 4PJEF 4PPTA 2YD3A 4AG4H 3BT2H 3MI6A 4WSJA 1TZGH 2BSBA 2DV6A 2J1YA 4TNWF 4U6TA 5AVWB 4E9QA 1INEL 3VXUD 3IGAB 2BRRL 4NIYE 2WPGA 3VI3A 3QARA 4KJPD 3H3PH 5F71A 2DJMA 5BW7C 1XGUA 3UL4A 1OCZB 3CVHB 1KTCA 2MOGA 2DYRB 4UDUA 2BNQB 3ERXA 3ZDXF 2QHLA 5F1OB 2LU3A 3QG7H 2AK4D 1VHPA 2X0UA 2GIXA 4Z7UF 3OKEB 2NNAA 5DC9B 3SPIA 1U8KA 1UA7A 4LEXL 2NY5L 2QBWA 5JOPD 4KX7A 2JCWA 3BSZA 1HTYA 4N0YH 1QTPA 1J0KA 3VQLA 3AXHA 2EZ0D 3D39E 2Y2YA 4X5PA 4L37A 2OZ4H 4BSVA 1AZNA 2QFRA 1OZTG 4F7CA 1CXHA 5HHOB 5D7IF 4CVWA 1L6PA 2MOQA 2VDRH 2UWEA 3B9KA 2ZCKL 1KWGA 3POCA 4Q6KA 2EXTA 4DTGH 1G9EA 2ZG3A 4OIAA 4JFYB 4L8CB 2VW4A 4FABL 3FT3A 1WWAX 3TJEH 3FCSA 3I2CL 1IEBB 2E3VA 3HRZA 3FH8A 1P53A 5B39G 1OF2B 3PFQA 2DQDL 4GFTB 3TO4D 3G5YB 2NNXA 3BD3A 3IMVA 3BUDA 4WO4C 2AQ1A 4XP4H 3TBWB 4UAHA 1KDIA 2ADFL 4NI3A 2ZXGA 4HK3N 3L7EB 1I85A 3P77B 4N26A 1VFUA 3HE7B 4PLKC 5HY9A 1D5IH 5CIPH 3V6OC 2FEDD 5IMMA 4JE4B 2CDGA 4QHMB 1W80A 2Z3FA 4RMBA 2HXAA 5DZOA 4ORGA 3T09A 1OAXH 2GVYA 1PMYA 1XTMA 1KLFA 2V5RA 3OLDA 1N9PA 2OYLA 3HKZA 4ZMAT 1WH0A 5TDNA 4XVTL 1DFBH 3QRFM 4BD4A 2BP5M 2P5EB 4AWJC 2VC2L 1AIFB 2WAQA 3QEGH 2BWQA 3VI4E 4OJDH 1HINH 2J20A 1HEJC 4F3FB 2AQ2A 3BDXA 3MLPA 5GRXG 4AUJA 5J0BA 2PN5A 3WTTA 1ACYL 4NWTH 1ED3B 1HXYA 2ERJB 1BOGB 5E9DE 3K46A 4QNPF 3QEHB 4PSPA 4G6FB 2PYFB 4QWWD 5BPPA 1LWHA 3K6FA 3LIZH 4ZAKC 4DUVA 4RMSA 5D1QC 4M48H 2WLYA 4FX5A 4L37B 4KVCL 4PJFB 4CVZA 1A7RL 5GS0H 1HL5A 4BSVB 3TBSA 1I4FA 3ARFA 3ECVA 3L5HA 3RQ3A 2UWEB 5I8KL 3B9KB 3QQDB 4LEBA 4ETQB 1EDQA 1UB6B 4ZOEA 5GRUH 4ZXBD 5JXAL 1CK0L 4L3AA 1MCPL 4HK3J 1IC5H 4F1ZA 2N1TE 5L7XL 3VUAA 3UPAA 1ZGLM 5AKTA 4GG6F 1TZOA 3HI1B 4G59C 4U1KA 5FUCC 3T0AA 5D1XC 4MXVF 4RA3A 3T2LA 2HUEA 4OLXH 3BAYA 1WAAF 3CX5K 4K3DL 2ZAIA 3BEVA 1Y7VA 1IAKA 3F6IA 2EUVA 1PG7W 1M42A 2BOLA 3SYOA 2W60B 4PJGF 1KBWA 4QIRA 4UNIA 1MPAH 1Z3GL 3I6SA 5IOPB 1MCDA 4WEEA 3TA3D 4WCYL 4WWID 2O93L 3KYNA 5JHDD 4X8CA 3W37A 3SDDC 4HJGB 2YD6A 2EACA 4PTTA 3V0IA 4GXUM 4TQEH 3U0PB 1U8HB 5JHLA 2YJQA 1KIUB 1OOWA 3NFNA 5L4FA 4L2LA 3UMNA 3VGDA 4UOJA 4N8VB 3V8CA 4A1RA 1AR1D 1CGVA 4WIQA 1MNUL 2HMID 1WWCA 2OTPA 1E2WA 5TDNB 3WMSA 1ZLVK 5L8KB 5KBPA 3JV4A 2YXMA 3VXQA 1NZRA 4C56D 1OEZW 4QJ4B 2HFFA 3EKCA 3MNMA 5E9DD 4NQDB 1OAYL 4KH9A 1KJ2B 3Q8EA 4YXKL 1BXXA 4K94C 1P7QA 3FQ1A 2E6QA 4UBDD 3EJTA 4JO4L 4A2HA 5BRPA 5CFHA 5KBDA 2CJTA 3NZSA 4H1LB 5JZ7C 3LEYH 4XAKE 1CU4H 3MLXL 1MRDL 4Q6YA 4O5LL 4X4XB 1P7KB 3MNVA 4XN7A 1F00I 3X17A 5FO9B 2A0LD 4KVNH 4PEEA 4X6BA 5CM1A 1OAUL 2J8UB 4YDMA 4U1GC 1OGSA 1W8NA 4OD2A 1ET5A 1DQDL 3HJEA 2FYVA 3LEVH 3WELA 4CVZB 5DJ2B 1NEZA 4KRPD 5DJAA 1T1YA 1I1RA 3ARFB 3N42F 2PCFA 4O4YH 4YDIL 2UZPA 3JV0A 1PL3A 3HA0A 3BVDB 3SDAA 2JQZA 1P84J 4OKVB 1QLEL 1ZWIB 1WUZA 3RGVA 2HT2C 2XA8H 1XSKA 4PI2A 4AKPA 4WHYH 4Z76A 3HZVB 1ZLWK 3ZPDA 2BO0A 4U3SB 1ROCA 2ICWA 1WC7B 2WUBH 3HB3B 1C9SA 4EOWL 3AY4C 1PS3A 4PJEE 5E4EC 1A6PA 4HUVB 3D25A 4PJ7E 4EI6A 2WLLB 1XXFC 3IDGB 2MKLC 2J4WL 3QAQA 3KYNB 3W81A 4HH9A 4OLUL 2EE3A 3SPJA 2IPUG 4PTTB 3OZ9L 4N0RA 1QEWB 1E67A 3IKCB 4WU5A 1P4UA 1MG2C 1B0IA 3LNFA 5HYQA 1QABA 1QASA 3A4AA 4NBXB 3U0TA 4IMLB 3ZDXE 4P07A 5A43C 1LEKA 5HHPA 3UTSE 4XRCA 3LTVA 4FQ2H 1YCSA 3GT6A 4Z7UE 1HQ4A 4XOBA 4JLRA 2I69A 2HFFB 5E8OA 1LNUA 5JW5B 2BP8A 3KXFB 4PJ9A 5HPOA 1S4IA 1CD8A 2A6JB 1GAFH 1PAMA 3MRDA 4N3UA 4G8AC 3VWKB 4Q9QH 4NQEB 3DIDA 3FZUD 1FO0H 3SDCA 3CFJA 4JN2A 1DQMH 2B16A 1MIML 4R2GD 3KS0H 4N4YB 2FO1A 2IFGA 2MNJB 3KYMA 5D8JH 4DZ8B 3MNVB 2YQ2A 5GGUB 2ADIB 5JHBA 2VUKA 3U46B 5C9JA 4HCRA 4KGJA 4KK9D 1MCWW 2OSWA 5E2TL 3GXPA 4PJIA 4G7RB 1MCWM 3NFSL 4AMWA 2J1KA 1XBRA 1T3FB 5D7JD 4PVNA 1Q0EA 1QI4A 3L6FA 3QEUB 5ANHA 1LO3L 4AC4A 5EC1B 1I8LC 3UGXA 2CMRL 1WZMA 5C2BL 3SDAB 1T21A 1FFPA 3L2NA 4OGXH 3VXRE 2BVQA 2OJEA 4NN6B 3EGSA 3RGVB 4F8OA 3VI3F 1KY7A 4F91B 1AQMA 2NY0D 2ZAGA 2YS4A 3TEZA 3E3QE 2EDJA 4NCDA 5IOKA 4HPYL 4KX9A 3MUHL 2Y5TB 2ICWB 4AV4A 4F7MA 3REWA 3DV6B 3I9GH 1RMFL 1XBDA 1PIFA 5K9OA 2P28B 4YSPA 3FB7A 4DO4A 4YHPA 2XYBA 2IBBA 3V6BR 1AJ7L 3L9EA 4HS8H 1ESOA 5ABAA 4GY4A 4JO5A 5B3SB 1QA9B 2GTWA 3NEEA 2YD1A 3VH8G 3K6SB 1E4WH 3VA6A 4A39A 1YC7A 3CPUA 1WFOA 4S1DD 4X7FC 2VQ1A 1S3KH 1B3IA 4HIXL 1NKGA 3N50A 2DI8A 4FHKA 5HYQB 3H42H 3ZL4H 1JRHL 2DI9A 3IJ8A 1TO4A 1KFAL 2LU7A 2UWEF 4YHZH 1LEKB 3WFCL 5AFAA 3S2AA 1HX0A 2X87A 3VJ6A 5G4OA 2E6JA 3QORA 1LNUB 5ICYB 1FL5A 2ZXAA 2BP8B 3IXTA 3PL6C 1VEPA 1PVHA 4L0YA 3N40P 1N0LA 4N28A 4JVUA 3EFFA 3CFJB 1KENL 5F8QC 4DP5X 4FZ8H 4U1LA 3QI9B 4PS4H 4GRWB 1FVEA 4IOSD 5C7XH 3QNYB 4AVIA 3ATFA 3LQAL 3ULUC 2MKWA 1JG9A 1KCBA 1S7RB 1BV8A 1COBA 1EERB 1P69B 1U9KA 4X4MA 2VDQL 2FBJH 3MLTA 2BERA 2UXVA 4DIXA 2X9YA 2FGZA 3PNWA 1KB9K 1X4ZA 1MJUH 3MLSH 4ZFZA 4PJIB 3WKPA 3VXRD 3QRGL 4WI9A 5C07A 2OSYA 3C5ZC 3L6FB 4QRRE 1WAAE 1M2VA 3H55A 5GISL 4W9KC 4I9XA 1FFPB 2LHAA 2V7HA 2BVQB 2WXLA 1KGWA 2OJEB 3QH3A 3P02A 3IJYA 3EGSB 4OBSA 4PJGE 4QRTA 3F7KA 3KJ6L 4OAWA 3RWEA 3VFSB 3GSXA 3WNJA 3OSKA 4HJEA 2DWEB 3HLKA 5DJDA 2JELL 2EEXA 1CDCA 2F0CA 2G75B 3CV5A 3RPIB 4F7MB 5TE6L 1F4WL 3MGAA 3REWB 4L4JA 4TMPA 2PR4L 4PGZA 5K9OB 5A7EA 3ECQA 3LSOA 2FQGA 2YUVA 2AJUL 3FCUB 1A6TB 3IDJB 4WJ5A 5KVFH 3ZHDA 1U8PB 5KUMA 3N0PB 3NCXA 4BCZA 1UACL 5E03A 5IIEA 4BFKA 4IYKA 4ABWA 5DD3L 1IC7H 1CQYA 4LPTA 4PREB 2ZKMX 5CLWA 4AYSA 4QTHA 5JLZA 1KDJA 1PG7L 3QUXA 4NO0D 2Q10A 4RX4A 4R97B 5E7BA 1NFDE 3SDCC 4KKZA 3L5JA 2NYKA 1JVLA 3VJ6B 4YSCA 5HHQB 3Q5YA 3QORB 1YDPA 5ABZA 4NHUB 4NYLA 3IXTB 4HP5A 1SDDA 5DJ0A 3FAXA 4XB8A 4N8PA 1UB5A 4G42B 4GKOA 1N5YH 1CTMA 3EFFB 5JW4Q 1RULL 4IOFC 5DRNB 1V7ML 3V0AC 4Y8AA 3BFQG 5FO7B 3G5WA 2V2TA 3U7AA 3FW6A 4U1HA 2X3AA 2WBJB 1YJDC 3PUUA 3SKMA 1BX2B 3V6OE 4QRRD 5GHWH 1MRFH 5IMLA 2BSCA 4AMKL 3F5WB 4XHJC 5E2VL 4LAJH 3QULA 1S2EA 3Q01A 1U3HA 2CGRL 3LRHA 4AGMA 3SB3A 5C07B 3AITA 2ICEA 3VFVA 1SRDA 3IU3A 5KVDL 1M2VB 1V27A 3H54A 4K23H 2ICWI 4GAJL 2B5IB 2GUOA 3A24A 5LG6A 1VACB 3VDAA 3EZ8A 2V7HB 1E28A 3OBAA 5J7CC 1EPFA 3UTPE 1ZEAH 4ENEC 2HH0H 5HJ3B 4F9PC 3GSXB 3RI5K 1O6SA 1EHKB 1EAQA 2HG0A 2HX8A 2ENPA 5IB4A 1IB5A 2D7TL 3OWEA 2Q87A 4LSSH 5DJDB 4YSRA 5AZUA 1AC0A 1AOHA 6FABL 1JGEA 2JQMA 4X7SL 2IWFA 5KYYB 4NQVB 1AY1H 1DSWA 2WINA 3OB8A 4RGNC 1E5UI 2JKIS 4AVKA 2C1PA 4B5EA 4GG8B 3AWEA 3ZE2B 3TT1L 3CQQA 4Z3GA 2R2BA 1UEYA 1UC6A 5LAPA 4UT9H 5D1QE 4LGPB 3DPBA 1ZT1A 2YPLA 3FBQA 3U36A 1LDSA 4GIOA 4M9PA 1B4JH 2FZ3A 3MXVH 1QACA 1OGTA 1W0WA 5JLZB 3QUXB 1O6VA 1FLRL 3MRJA 3I50H 1MWAH 4WO4D 4IU2B 1I3RA 3VXMB 4FI7A 3G6JB 1J9RA 1PQZB 4OZGA 4EN3A 1YDPB 1X7TA 4PHZA 1RZ7L 5CJBA 3N04A 2ZSWB 5D1XE 1SDDB 5FUCE 4PLKD 2Q8BH 1FPTL 4L4VE 5D1ZB 2CBOA 3NK4A 5HGGS 5F3HA 2EYTA 4JG1H 3DGDA 4M7KL 5ISZB 4RGMB 3UZEC 3ZYZA 1W0VA 4OFIA 4WGWB 1G6RA 4WDIB 1AOZA 5GJSH 5DJ6A 1NCAH 2R69A 2WK2A 5F0MB 3IETA 3SKMB 2IDCA 1A7NH 4JHWH 1PLCA 1UOWA 2ZXDA 5IMLB 1NEPA 1AKJD 4JGMA 4WI4A 5I18H 3D1MC 2GT9B 1CD9B 4MNQA 5E6IC 3QULB 4K5NA 1RUPH 3OSVA 1OTUC 3MLZL 3T2NH 2WQRA 3CVHL 4DAGH 3VI3E 3AS1A 4HLEA 2FHCA 3UTPD 1ES0A 5LUMA 3GKWH 2ICEB 3IU3B 1HDMB 2ENSA 5TQ2H 1XVSA 3DO7B 4E9XA 4JG0H 4KTDL 2EIMB 5AUMB 1SBBA 4FG6C 5CP3H 5ESVA 2IC2A 1O6SB 1C1EL 1RPKA 1TJIH 4BFFA 4HIJB 2EQDA 4PRHA 3TLRA 1UFGA 1AO7E 4HLJA 1QR1A 5FM4A 2RB8A 2HRGA 4N0FA 1S9WA 4P3CL 1WFMA 4LSQL 2QSTA 4HQQL 2GBUA 2WINB 1JHLL 4ZAKD 3ZSTA 2UUDH 2BOCA 3BGFC 4ZI8A 4BSWA 5C7ZA 3MTXA 4UQIM 4GP8B 3ROOA 4NUQA 1RIHH 4NC0B 2JJUA 4G8GA 1LGVA 3UTTE 3MREA 1ZT1B 4K3GA 3QUKA 4XVUD 4M8VA 3T4YA 5CILH 1E30A 3IS0X 4H8UA 2H1XA 3GBML 3QJZA 5D1XD 1H3PH 1MFUA 1I9RL 2EDKA 3O3BB 2XWJA 2QGCA 1USQA 3L5XH 2QSVA 3G5ZB 5GS2H 1S5HB 2HT4D 4NKMB 3VFGH 5JIQA 4PJ5B 3W0WD 4GLRI 4LSRH 4OZGB 4EN3B 3VD1A 1RLWA 5D2LA 3NJMA 4K73A 5DQJA 4WW1B 5C8JA 3QO0B 5F3HB 2GC7C 1A9VA 2IGFL 3TEYA 3SDDD 5PCYA 4AX3A 2DS4A 1QYGH 2WQXA 4P4KA 4PJ8A 5CUSL 4JK0D 1FHGA 2X4SA 5CBAA 1V5JA 4HHWA 1FV1A 1UT1A 4WWOA 2V9TA 1G7PB 3AG2B 4LOUD 1CFSA 1QBML 4U0RB 4LEOA 5I1GL 1FYTB 4MNQB 1EXGA 5SWZD 3FF8A 4CL7A 1EAPA 5HBBA 1Y6NR 1NL0L 4IS6A 5E8DH 2QQKH 2E27H 5FXCH 4G6ML 4F24A 3TBBA 3RY6C 3U1SL 4PJXA 5KJ7E 3SE9H 2L7QA 3MLWH 3U7YL 2H0JA 1J1OL 3LZNA 1AO7D 1YQVL 5D70H 3U4EA 5I6XB 1XF2B 2PCYA 4JN1L 3IDYC 4XCYA 3VRLE 1CBJA 1MY7A 4MMYA 5G5DB 5I1IL 3GHBH 1QW9A 5E1AA 3MRFA 4AJVA 5T3XL 4NJ9L 1CIUA 5AAWC 3TO4A 5GGSY 2VDNB 1C7TA 1KBGL 1AIZA 2OCCB 5J13B 4YDLB 2FQDA 4MS6A 1NOFA 3KPOB 5D6CA 4ZFOA 3QNXA 4NO5A 4BSWB 5GIRA 4CBPA 3U4BH 2Y7NA 3ROOB 3DIFA 4FQXD 2J44A 5T1DL 1XGTA 4NP9A 1R24A 2FATL 1MN4A 5KW9L 4H0HB 1Q9WB 1J0HA 2E76C 4ZO8A 4TF4A 5ANMA 3SYQA 3O2VL 3VB9A 5F6IC 4UILH 5D1ZI 2HT2D 5IEHA 1DQJA 2YC1A 1JFHA 3UYRL 1OL0A 2XWJB 4AYBA 4PJDA 5FUOL 6TAAA 3VXUB 2Q3ZA 5E00A 4YGVA 2VDMB 2FSEB 4AL8C 1KN4H 4DEWA 2CIIB 1SLWA 5KBNC 4I3RL 4XNDA 3F12A 2MNUA 3NSYA 4ZOCA 1UOLA 5EV7A 1RUML 3RKDC 1M1SA 2AK4B 3MKGA 4JPWH 4OCWL 5H94A 4IJ3C 1KXQE 1UWEH 4PJ8B 1H3WM 3N3EA 2VDOB 4MRBA 5FKPB 5F7YC 3GSQB 4QKTA 4Y9CA 1FV1B 2VN7A 3CZEA 1LE9A 1R5IA 1JHKH 3CSYA 1BM7A 4X9IA 4PTUB 1U91A 4RRPA 1ILSA 4G8FB 5CGBA 3WS3B 4DOHB 5J6HA 1J5CA 1KJ2L 4OCSH 2EE2A 2A83A 4OJFH 4PJCE 3NIGF 3CSBA 4N22A 5CJQH 2VXVH 3V4VA 3VD3A 5IHUL 4UTBL 3B5HA 3WLWC 4BUHA 1KCWA 2YO3A 5KVGH 2VAJA 4YBLC 1BVNP 2QADC 5SX5K 1INDL 4LHJB 1BBJA 1KT2B 4POYA 4XCYB 4K8RC 1XH1A 4FLSA 5EZLA 4XPTH 5EO0B 5GSVB 3ZHLA 2VH5L 4ENZA 1T1XA 3MRFB 3TO4B 3HBGA 4RMVA 3KNBB 4A7UA 4AEEA 2PW2B 4YX2L 4OZ4A 4CW1B 5FYKE 2EKJA 5D7LE 1BEXA 5DUPL 2BZ7A 2ED6A 4NO5B 4NRXA 2WUCL 5GIRB 3ULUE 2VN3A 2ZZUT 3FT0A 2W91A 3TC9A 2XKSA 3Q8FA 1EEZB 4IK6A 4XMXA 1MFDH 1R24B 3IFNL 4J6IA 1PD0A 1LDPL 2Y07L 4HWNA 1MHPL 4UIMA 3FQ2A 5FGBA 4HG4K 2JKNA 4X9BA 5KUKA 2CBPA 4LBEA 1BF5A 2WOBA 2Q8AH 1R1CA 4X9GA 3K5SA 2EKSA 2Z7WA 3AUWB 3MGOA 5AWNL 3ZTJH 4OCYL 3MGTB 5E00B 1KPUB 2WLHA 2C4XA 3A4EA 1OAZL 2DEWX 4P4KC 4M5YL 1NBVL 2YFNA 3OKYA 4OVUA 2FX8H 4UM8A 2IAMA 1U8MA 1JF5A 1KZYA 3NABL 2BDNH 3MRMA 3JWOL 4OB5L 4Z7VB 4ODTH 3BKCH 4QCIA 3SGKC 1T04B 4LVHB 3HZYA 3A47A 2IH3A 2IEPA 1E9QA 2GJZA 1VPOL 4RWYH 5DMYA 4M1DH 1TVDA 2BHYA 1G0YR 5KYUB 1JHTB 3ARZA 3KLKA 5L4JA 2R2HB 5EZPA 2DDQL 3T2PA 1H19A 4Y5XA 2NQCA 3HG1D 1UZ6E 3QIWC 2YARA 3ELAT 2L7EA 1VGKA 2UY6A 3PL6D 1NGQL 2XNAB 4BE5A 4BH8A 5D71L 1J9TA 5GS1B 4YR6B 5FYKD 1BBJB 2R29A 2AQQA 4LEXH 2NY5H 5EZLB 2MCAA 1KEML 3ZZ1A 1MCHA 2K4WA 4M6ML 4OQTL 4R96A 3ULUD 2LV4A 3H2WA 5DDHA 1EZSA 2V3DA 3ATEA 3WHE1 1A7PL 3EUUA 4OZ4B 2YRLA 4ZTEA 2XPGA 3FQRA 1A14L 3OR7A 1KIPA 2F7RA 4IGBC 2VZUA 4NRXB 2EIEA 3QAZB 4X98B 2XC8A 4RAUA 4HAKA 3BZ4B 5JHDB 4LKXA 4FABH 3ULVC 2XWTB 3WHXA 2XXFA 2QPDB 3AROA 4HAGA 3O3DB 5T1MA 3V5KA 4BJLA 4CJ1A 5LWYL 3LKSB 3CHRA 3MRGB 4KV5E 2MIZA 1XF3B 4LBEB 3HG2A 1AR1B 2QLYA 4TSAL 4W9HC 3PP3K 4OGZA 1IGJB 4JRFA 2EKSB 3MGOB 4QEGA 5EUOA 3WXVL 3NSDA 4HX1A 3ZRCC 4C56B 4Z95L 3U2JA 5IW1A 2JTYA 5E9DB 3IF1B 3V0GA 3EH1A 1XX9C 5FECA 1U8MB 2K6YA 3C2SA 1VKXB 5IHWA 4YS4A 3DOIA 3G04B 2QSCL 2Z8VC 3FQXB 3NK3A 4H0GA 5D4IA 1U36A 4QCIB 3CZSA 4RGNE 1NGZA 2GJZB 5EIIA 4MMXA 3DVNA 2GEQA 2XZAL 5EU4A 12E8L 4ZFQA 3UBXB 2DKUA 4XVTH 2YLHA 2C3VA 4RFNB 4N0UE 1TVBA 4Y5XB 4JM0A 4KRPB 4U1MB 4LHQB 2N7BA 3JTSA 1U8LA 3VD5A 3GBNL 4DW2H 4G5AA 3GSWA 3T0EA 4ZUUA 1VGKB 3OAUL 5JIIA 2XFXB 4YGAB 2ADJB 3O8XA 4YSUA 5F9OL 2KPWA 4IOFD 4WI8A 4YZWA 4XBEL 5I2IB 1CE6B 1GZPB 3FTGA 4Q4IA 4XMPL 3D5OF 3L3IB 4R96B 5D2LF 1SY6H 3E2HC 5EA0H 5HDBF 1NPJA 3WD5L 1WA0X 5DDHB 1JZ4A 4A2EA 4BFIA 4M6AA 2JI1A 4JFZL 4XHJD 4HC1L 3IB4A 4KVCH 1A7RH 1IBGL 1J7VR 2Z91B 3OR7B 2X4OB 4IRJC 4NFCA 3BCDA 5DJYB 4MZ2A 4HGKC 4KZEL 4J12A 1M7DA 5I8KH 2Y7OA 1NLBL 1KTKE 1NGWB 3QDJD 4HUWB 1S8DB 5JXAH 1CK0H 1DVSA 2OXHA 1MCPH 4LKXB 1Q9OB 4PIRF 5DURD 5HYJD 5L7XH 2WIMA 3WHXB 1BVZA 4GIPD 3IFPB 1ZLSH 3VGFA 3ZE0B 3P4NA 1K2DA 3UC2A 4N6RB 2NT0A 3QCUL 4ENED 5IQOA 3FU9A 3QPQC 4K3DH 1UD6A 2C9RA 1M9SA 4FEIA 3N55A