3A6CL

Crystal structure of hyhel-10 fv mutant ln92d complexed with hen egg white lysozyme
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSDSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6cL00
4Z76A 3WHXA 1RMFL 2RQ8A 3NIFF 4H8WH 3NBNA 1JWUB 1QFWM 2WP3T 1WSST 3D69A 3HNSL 4HPYL 3B9KC 3C5ZC 4BSWA 2F5BL 3HI5L 1WIUA 2F54A 4LPYA 5IB4B 2R2BA 3NABL 3Q0HA 5ESVA 5FKAA 1BFTA 1DEDA 4MJIA 3SE9L 1IC4L 2FX9L 1SVCP 3LOWA 4PY7A 4F7MA 3CFEA 1TCRA 3BPNC 3TVMD 4QTIL 3G5VB 4HD9A 2IAMB 4JKLA 4P9ML 1JRHH 4EXKA 1HHGA 4Z7NE 3MUJA 5LAXA 5DMKA 4C55A 1MWAB 4PRPD 4R0LA 4UV7H 4EQ2A 1CD0A 2D31B 2NX5E 4Z78A 4BQCA 2D03H 4NNYA 3G5ZA 3VXME 2AEPH 3U1SH 3K3QA 1KN4H 1G0XA 4HULB 5EU5A 3DURB 2K1MA 4M8VA 5AYUL 5A16A 5MENB 4NDMA 4XCNA 4GMTL 4NJ9H 1KT2B 5T33L 2APWA 2CKNA 1PAMA 3QWRA 4Q9CA 3FT3A 4XPBL 3VXSB 1T80A 4IRZH 1IEHA 3CMOL 3LIZL 3AUVA 2Z0BA 5D7JD 5HHOE 1OAXH 3QQ4A 2GITB 4PY8J 4Q0XH 4EOWH 2CKBH 4D3CL 5ESAA 5B38B 1ZA6A 4MVBC 1DN0B 2ICEB 1FRGL 2B1AH 3QHFH 3PQYA 1C12B 2DQIL 1CK0L 2X6MA 4LRNH 4XC3L 4J4PD 2YOCA 2ATKB 4KDTC 4IOIB 3O3AA 3SDCC 2ESVB 3IVKA 3LEVL 4HS3A 4JZNA 2W65A 3F6IA 1FSKB 4NCDA 3D25B 3ZE2E 3ZT7A 5B8CB 5I1HL 5JOPE 2R4RL 4NNXB 3IJHA 5TQ2H 1NC2B 1N6QL 1YPZB 2VE6B 5I73B 4UV4L 4LPXA 3G5YA 3PWNA 3W82A 3CVHL 4M48H 3QI9B 5FHAH 3O45A 5HYQB 2A0LC 3BWUC 4BFBD 4IMLA 1U3HC 3JWNC 5F9JB 5BZDB 3P30L 3IFLH 3C60C 5C0EA 1PX4A 3MV8E 1F5WA 1CLOH 1ZGLA 3AXLB 4M62L 3VXRD 3HMXH 4J1UA 3OKLB 3DWTA 3GSVB 5D7LA 1GPOH 3L3JA 4ODTH 1NGYA 3L1OH 3VWJC 1KPVA 4OCYL 4PD4K 43C9B 1KC5L 1OAQH 4BM7A 4E41A 3OKYA 2HFFA 3H3KA 1BREA 4G8FA 5DHVH 5IOPA 5DRNB 1G7QA 3IGAB 1G7HB 4KGJA 5DK0A 2E27H 5ENWA 1FNSL 2DOCA 1AD0B 5JZ7D 2HP4A 3EOAA 4MA1B 2P5WD 4FQXD 2X4NA 3VH8G 3IS0X 4AH2B 3BYYA 4DGYL 3BUYA 1GOGA 3QDGD 5FK9B 1X4YA 1D5ZA 3LD8B 5CJXA 3M8OH 3V0WL 2X41A 2DQFA 4L3EB 3HE6C 1AKJA 1CVRA 2HMIC 3PGDB 3LS4L 5EA0L 1AP2B 1JCKA 1QYGL 3FONB 2I07B 3HE7B 5JQ6L 4PJAB 3MLRH 5IM7A 4HIXH 1JNHB 4NQDE 4PG9B 5E7FA 3H7BB 3AAZB 5T5NG 4XWOD 4EI5D 5DC9B 2VXQH 4QRPE 5E9DE 1MVFA 3PJSA 3TV3H 3SKNA 3FN0H 1K8DB 5JPNB 4PG2A 3VFRB 3CK0H 4G8EA 3H9HB 4GKZB 5C0CB 1XGPA 4EN3C 4PRHB 3FFCD 4HLZH 4ZS7L 3TBWB 3RRQA 1I75A 4F58L 2W9DH 3O2WL 2Q20A 2QSTA 2XTJB 2KH2B 4NQUA 4X6CE 4N8PA 4R8WH 1KIPA 4K94L 4GW4B 4ZPVB 2QQNH 1PG7H 1J8HD 4OZHF 5KOVC 1OP5H 1N8ZB 3N06B 1S7XA 2P46B 4PJDE 2GAZB 3EJYC 4M4PA 5EZOH 2I9TB 3MYJA 2XY2A 1N64L 4OCRL 2AP2A 2P45B 2IANA 1HINH 3ARUA 3DXAE 3TO2B 3EYSH 3DO7B 3LQAL 2C7UA 3QDJD 5DUML 1QUNA 5DD3L 1UB5B 1FL5B 5ID1A 4YUEH 4R90H 1F8TL 4YR6A 3FAXA 4YHIA 3DJ9A 3ME0A 3KPSB 1HIMH 3BGFC 3IAQA 5DQJB 5GGRY 5F7MC 1ZT7B 2BHYA 4S1QH 3IDNB 4ODUB 4KJQD 2WQ8A 1B4RA 4LGRB 4U1SB 1YNKL 3P73A 3UX9B 4HX1A 2EC9U 4ORGB 1UH3A 3VFGL 4XBPB 5DMIL 2F8VA 1P4BH 2EO9A 4JFYA 5JLZA 1WWBX 4QT5A 1NAMB 5L2KE 1Q0XL 4NFBA 5CLWA 4J6RL 5IVNA 1IAKA 2IC2A 3QIUC 1JL8A 4N5EC 1T7XA 3U0WH 4KQ3L 2ZPKH 4KI1A 1VESA 2AXFB 1SY6A 2BSTA 4WNQA 1KPRA 4IRJC 3S3PA 4PTTB 5EZLB 3IFOB 3LV3B 3OQ3B 4JFDA 3GSWB 2A1WH 2WIMA 4KVNL 4LHQB 5F7FA 5D5MB 4QWWD 35C8H 2W0FA 4OJFL 1JFQH 4MS8C 1F97A 5L6YH 2EIDA 3FRUA 4AY0A 3V5KA 1F11B 1NKRA 1P5UA 5C07A 4ELMB 3C5JB 3MBXH 3VRLF 5DD1H 5F3HA 3GIVA 4M8QB 2ZSVB 4WWKB 4RFOL 1MOEA 4H1LG 4L4TB 1SEBA 1YDPB 4S1DC 1EZVX 2WUCH 4GXUN 3GMQB 4KGLA 4RMWA 4ZTPH 3SKUD 2GSIB 3W2DL 4P4RA 2HKHL 4H25A 2D4FA 3T0XA 4PJ5B 2WZPD 3CPLB 5EU6B 5EBMA 1A6UH 1KCVH 1EBAA 2X89D 4FQLL 3CLEH 3ET9F 4UBDC 3OZ9L 4JHAL 4F57H 3QPXH 3Q6GH 1NUGA 2KDGA 4OZ4B 2ILLA 5T5FL 1KUMA 1OTUD 5IW6B 4RMQA 3ETBF 5JXEC 5FYJU 3OKKA 3NA4A 3RUGF 4R3SB 3BESR 5KVFL 2WBJC 4EUPB 4ETQB 3OAZK 4R97C 4FXGB 1KCLA 3HPJA 1OAYL 3RWFB 5HYJA 3VE0B 1N4XL 3BGMB 4YDVB 4P4KB 3VFMB 1FO0H 4PGDB 3FCTB 3KWWA 3NTCH 3AB0C 3OR7A 4ISVA 4Z77B 1AXTH 1F4YL 3SDCA 4HG4K 5SWSA 2YHGA 3IDMA 2VDLL 3GRWH 1QBAA 4U6VH 4BUHA 1N5AB 4JRYE 1YN6A 1EPFA 4X0KB 1J05A 5JW4Q 1FGNL 2YWYA 3FQTB 3QEUA 4ONFH 5HGDA 5EBWA 5EIIA 5CP3H 2ICWA 2VL5B 3C09C 1QFOA 3CFCL 4LU5H 4QY8B 1CLZH 2YXFA 5E2TH 4Q2ZB 5CSBA 5IB2B 4OUUA 2BZDA 3ALXA 2ARJA 1NEZB 4O4YH 3B5TA 5EOQH 5ACZB 1HHKB 2ZWLT 5JW5A 3QUYD 1VACB 1FNGA 3ZSTA 2BVYA 4U33A 3OJMB 2QQLH 4DN3H 3LKQA 1DL7H 4ZD3L 1X5JA 5IK3B 2O5XH 2FX7L 3ZYJA 3ARYA 5CD3B 2ZUUA 3VWJA 1DBJH 4KK9D 4NWTH 3U79A 3O2DA 2G2RA 1DANT 4TQEH 2WWKO 1XZ0B 3U46B 5DZLA 1A9EB 2DJ4A 5IMMA 2DQUL 1S7UB 4NKDA 5KOMC 4F7EA 4FQIH 2F74A 4D9QE 5CS7A 5DJDA 4ENEC 3X3FL 5D7KE 1RUKH 2EE2A 1T1WB 1KEGL 4WHTA 1CI5A 4YEEA 3T0WA 3HE6A 5T1KB 1A1OA 1DBAH 5BV7B 3HPLB 4Y5XB 3DBXB 1JYWA 5E5UB 2VLJA 1QO3B 1HEZA 3OKEA 4LLAA 4LGSB 4ZFZB 5GS2D 1T04B 1F58L 3DV4A 1MRDL 4M1GH 5KW9H 2DI9A 5GS2H 2OI9C 5F7EH 3CXDH 4XPAL 1IQDB 2Z9TA 1MRFL 2QQKH 1CGWA 3PGCB 2Q8AH 3GJEA 3VFNA 2RHEA 4Y1AD 1NC4D 1UENA 5D8JL 1BZQK 1HH6B 1MI5A 3BZEB 4OZHA 3EHBD 1BEYL 1OT1A 1INDH 4M93C 2HRPL 2VQUA 5CEZE 3VMPA 4PTUA 4WUKL 3ZKMD 4CVUA 12E8H 1P6AB 3I3DA 5D71H 5IBTL 2IH1B 3R1GH 3HR5B 3V6FB 5D1XD 3DUSB 1GGIH 1A3RH 2VDKL 4G6FB 4QRUB 3RVWC 1MJUL 3ZKNC 1FFNB 5GRZA 5BOPA 4XP1L 4Z9KB 1A21A 1JBJA 2FCBA 2C3VA 1RIHH 4U6XA 2P1YA 4ODVH 4AMKH 4FQQB 1JPSL 3VU2A 2OSLB 2H2SC 3QUXC 1TITA 2XRAH 3BPCB 3OHXA 3WIIH 2V5MA 4Z5RB 3R4DA 4HUUB 2NXYD 3FHAA 4WW1B 2JB6B 3PABB 2C4FT 5E99L 1RZ7H 3SDYH 1OPGL 3GNMH 5IROA 2E9BA 4KKCC 5ETUA 1QQDA 4EQ3A 3RZCC 3BDYH 4OF3A 1T4KB 1C5CL 2P7TB 4OM1L 1YEJL 1ZHNA 3HB3D 5KSBB 4YHZL 3TFKD 5BVJA 1U95B 4QNPE 4ZUWB 4JY5H 3GI8L 2X4TA 4YC2B 1HWGB 2GJZA 1DBML 2R2HB 4RWYH 3BI9X 4PRAA 3MLUL 3ARGC 2O5YH 3ZE1E 1CQYA 3BKJH 2WNGA 1H3PL 5D2NC 2AXHA 4M7ZB 5KS9E 3RTQB 2AV1B 5EOTA 3MLXH 4NP4H 1XF4A 2XI9A 3UJTL 1KB5H 4NT6A 5DUPL 4N68A 4K71B 3VGHA 1J18A 3H3PL 4JB9L 3G04A 4U49A 5HI5C 3SGKA 4ZSOB 5F44A 3W0WA 5GS1A 1FYTD 5C0NC 3N50A 3GK8H 1ED3A 1MPAH 3SOBH 5E95B 3BW9B 1TVDA 2DQDL 5CEZL 2WV3A 3L7EA 1I1FB 3RKDD 1NBYB 4G8IB 1LO2H 4HF5L 5C3LD 5B39A 1QNZH 1KTKE 1A4KA 3RIAK 3UYPA 2HWZL 1BOGA 3QCUH 3ARRA 5TGBA 3J7HA 4N0YL 1XR9A 4TSBL 4QRRA 5ACMA 5IV2B 5KVDH 2VDRL 1KACB 1EJOH 2O5ZH 3DRTB 3GEWB 4ZXBC 4LQFL 4LAQH 4PR5B 4FXKB 3BH9B 1OTTC 4ZUTA 4I5BB 4YDJA 3RUGA 4WDIA 2GK2A 5JHDB 1AGEB 4NO3B 5T1LB 3TA3D 2IWGA 5ABDE 4X7SH 4WW2F 1CIDA 2XZAL 1CFQB 1XGRB 3VG9B 5JXEA 4RQQA 3OAUL 3EYOA 1F3JB 1Q8MA 2WBJA 5TF1H 4F9LA 3MQIA 2AGJH 4G6JL 5EOCJ 3TPUB 5ISZB 2NY7H 3WL9B 2NW3A 3FQRA 3VW3L 5DDHA 2NLJB 4NO2A 4RGNB 1U8LA 3JSSA 3H0TA 4PBXA 3RHWK 2DBJA 3SJVB 1RAMA 5GGTA 3EJZD 5TH2A 3GSNL 1N0XH 2IPUK 1QSEB 3D85A 2YC1A 2BMKB 3EYQD 3QJHA 2HG5A 5IHBA 3UTPE 3VDAA 1CXFA 3MLSH 5HSFA 5F3BB 3QUZC 1E27A 1YUHA 4MB5A 4X9BA 4DZBA 3ARXA 1FL6B 2R8SH 1K9TA 4XPHH 4JN1H 2QQQA 2W0LA 4S0TD 4CL7A 2LAAA 4JO2H 4MNGB 1J0KA 4K3JH 1FZKA 3LRSA 5JUEL 4HXAL 3RI5K 1UZ6E 5C0AA 2NZ9C 1B0GB 1CGXA 2R4SL 4NHCH 1MFCL 1XGTA 1E4JA 4JQXA 4NKOB 2VLRD 1KFAL 1TVHA 4PY8I 5IVZA 3UMTA 4PGCA 1EO8H 1J88A 1CICB 5HJ3B 1WWCA 4CU7A 3E2HB 4IJ3B 1IGFL 2HT3D 4FRWA 4HJ0C 5KVEH 3C6LB 3KXFB 2CUMA 5EO9B 5CHNB 4JFZL 1PGRB 5FHBL 4K3EL 2M1KA 2Y6SC 3ZTNH 5FUOL 2P5EB 4O5LL 4U31A 4OQTH 2ID5A 4G9DA 3TN0D 4FQHA 3TO4C 1QLRB 1XIWC 1KLGA 1QD0A 1G7JB 1QEWB 4GKSA 5HHNB 3CLFL 5I1KL 1FNLA 3DUHA 1OGAE 3VD9A 3I75A 4U3CA 2XWTA 2CK0L 1ZT1A 3INUL 5TE7H 2VXSL 2E3VA 2RJMA 3RZWA 3SDAD 4E0RA 4NC1C 1T89C 1IGJA 1NSNH 4X8JB 4XVJH 3B3IB 4HJGA 3BEWA 2E9IA 5FM4A 4A2LA 4QRSA 1CXHA 1BX2A 2CLVB 5T1MA 1OT2A 3KPLB 3CVIH 4K23H 5CUSL 4QCIA 1D5BA 3WXWH 1RV6X 1NFDE 5K9OB 1NGXA 2ADIB 1YQ2A 5DD0L 2R2CA 1YEHH 1VSCA 4QXTA 5DI8A 3L5WA 1KJVB 3PWPE 1UM4H 4AL8H 2PNDA 2ORBL 3CVHB 4S11A 2PYED 5JIIA 1OP5K 1LK2A 3ARFA 2NX5B 4RGMC 1BBJB 4NO0D 3ARDB 4Y19D 3DYMA 2KQNA 4OV5B 1CS6A 1OAUH 3VFPA 1Q9KA 5KSAA 2A77H 4XB8A 3S37X 3WLWC 1IGIH 2VR4A 4Q6IA 3X11A 4HZLA 4MNQA 2IBBA 5LGHH 2BVQB 5H2BB 2V7HB 4FFVC 4OFYD 3U4BH 1R3LA 2F54D 1VERA 5DHXB 3QNXA 5IWLC 5LVEA 1UVQB 2GTZB 4R4BA 2G5RA 3IDJB 4MJID 5KVMC 5GGQH 3VFWB 2LTQC 3U7YL 4O02H 1U8OA 3QDMA 1KXVC 1X5FA 3P4NB 3PWJB 1X5XA 4X6FA 3MLZH 5DHYB 4KRLB 4Y2OA 3P4LA 3L3GA 1DSFH 5I74C 3TZVB 1CDJA 1AGCB 5D2NA 5D1QB 3P11H 3OKNA 4MAYA 5HGBB 5BVPL 4APQC 1MCKA 3TC9A 1MIEL 5FCSH 4S0SD 3BZFB 3WFZA 9CGTA 3FB7B 3T77A 1KCSL 1LE9B 2IBZX 4LSSH 2LU7A 4GRMB 1Y6KR 4DGVL 1MLCB 4MNHA 5EB9A 4GXVL 1F2QA 2Z8WC 5BQ7B 1I9RL 4WTWA 1OSZB 3QWRD 1HHHA 1NGZA 1YMME 5MEPA 1T7VA 1S8DB 5ILTH 1RVFH 3K2UL 4ELKB 3TVMB 1QBML 2XN9A 4NYLA 4HS8L 4QXGH 1BBDL 1XCQB 3GSOA 4NN6B 5EORH 4Z8FH 3MV8B 4LCCA 4PP1C 3E8UH 4Y5VB 1HI6B 2XWBA 5IBUB 4HEPG 4NN5B 5C09A 3PQYD 4CJ0A 1OWWA 4JDTH 4MLSA 1UKQA 2BY2A 3CDYA 2ATPA 2FWOA 4X4XB 1C08B 2RB8A 3P9LB 3IFPB 4GAGL 3GJFB 1RD6A 5IMOA 2OTPA 4X4MA 1UM5L 1AGBA 1ZWIA 4K8RC 1LP9E 2J8UE 1F13A 4E5XA 4XRCA 4XVTL 4YX2H 1AQDB 4HKXB 5D7JB 3ZE0E 2EC8A 2I9LB 1U3ZA 3BP4B 3RWJB 3L5JA 4M9PA 4JPIB 5L9DH 3QEQA 1I1AB 3S4SB 1WWAX 1RUQL 4Y4KB 1PZ5A 1X5YA 3CX2A 4H5SB 5D7LD 5IMLB 4UTAL 3WHE1 1HQRB 5IF0B 2BP3A 3QHZL 4E41D 4QRPB 5E9DB 5ALBL 2R1XA 1B4JL 4R7NB 4U6YB 3O11A 3ALPA 1RU9L 3GHBH 4YXLH 4HH9A 3EFFB 4UDUA 1A0QL 5K9KA 1YY9D 3AREC 1XF1A 3EYUH 3R06A 3SGEI 5L7XL 4X6CB 2V17H 5EULV 5D70L 1S9KC 2FGWL 4XP4H 3L5XH 4PJDB 5DJ6B 2VOTA 4AEHL 1AKJD 1JWSB 4M1CC 3S3JA 3BD5A 4HFUH 3MOAL 5I1JH 1QRNA 3MO1B 3V4PL 1MCWM 3DXAB 2WSKA 1PDKA 4N90E 1MJ8L 5D6CA 1RZKL 4JR9H 1VENA 5IB3B 2OZ4L 5DHVB 3UTOA 2Y5TA 3QO1A 3I9GH 4K2UH 1BF8A 4M43H 3KS0H 4FQXB 4XI5D 5HYSB 1QFWI 2YK1H 3ROLB 1RURH 2EYRB 3IT8D 1F6FB 3SE8L 3CNKA 4LDOB 1I1YB 4ZUVA 3PGFL 3VD5A 1S5IL 5EBLB 3MRHB 1JPGB 5JPMB 3CUPA 3QXAB 3WS6C 1I3UA 4H26A 3TJHD 3ECBA 2Z91A 3RA7L 2IAND 2GW5A 4Y16C 3MROB 4PGEB 3HRZA 3LPWA 3QG6B 2IPTL 3MXWL 1T0MA 5GHWH 2F15A 3GMOA 1JZ8A 4EI5B 1NDMB 5C08A 2XWJB 1U8PB 2Z92A 4QO1A 2A6DB 5IBLC 5HYEA 3EW3B 5I0ZA 2LV4A 2YEZB 5MEQB 2HTKD 1EJ6A 4FMKA 2XZQH 2EICA 2HVJB 1A7OH 2QHRH 5KVGH 4GG8A 4ZFOL 1NCCH 2BY1A 1YPZF 1T20B 1BAFH 1OGTA 2FD6H 2EH8L 4KI5F 2DKMA 1IC1A 4DTGH 4NUJA 5ICYA 2W60A 4XAKD 1R3JB 5C86A 4MCZA 4PJ9A 4PS4H 3CZJA 2EDQA 3HHRB 4JFPA 4LSUL 3BP6A 4XMPL 4N0UA 3BHBA 4GLRH 4LNVA 2H32B 3ZYIA 4QRTA 1T22A 3HC0A 2AKRB 1K8IB 5DJAB 1KEMH 1S7WB 5TPWL 2QL1A 1BQHB 1DVFA 1SY6H 3UO1L 4LP4A 1JGDB 4KQ4L 2KQMA 4KKAC 4JFDD 3ZDZF 3MBEC 1TZIB 2FJFA 4PBWD 2OQJB 5GZND 4AEEA 3T4YB 2R69L 2X7LA 1R5IA 3I02B 4PYGA 4LRIC 2L4OA 1VDGA 2CDGB 3PP3H 4JZJB 3FQNB 4OSUH 2ICWI 2DWDB 2VAAA 5I30H 4APQA 3BZDA 3PNWA 3T4AB 4HPOH 5HPMA 1RIVL 4ZNEE 1WGOA 2R0LL 5C07D 3VXQA 2VDQH 1EERB 1FN4A 2XA8H 3L3HA 1RZJL 4HIJB 4OB5H 5FO9A 3PHOA 3VCLB 4DVBB 5I8EA 1JV5A 4I0PA 1YJDC 4BKLA 4PV9A 5E08L 1YEEH 3ARBA 4I77H 4PJAF 1MUJB 5GS0C 4LHJB 3U7WL 4LFHG 3TYGH 4N8CL 4PLJC 1OQOA 4JRYB 2BVUA 1KIUA 4Y8DC 4PJBE 4HKBB 3MRPB 5E8EB 4PLNC 4WV1C 3E0GA 4CW1B 1UACL 2D4DA 1WF5A 4Y89A 3N1QC 4GW1A 5BRZA 4EKXA 3FB8B 3IDYC 1XR8A 4M03A 4GBXB 1MIMH 2GT9B 2HJFB 4MDIB 4MVBD 3S5LA 2CIIA 4FNLL 1H5BA 4OT1H 3IDGA 3UTSA 3VXNA 4JCLA 2VIRB 3SDCD 5D9SB 4PPTA 2ZNXA 1LNUA 1A1NA 5SWSD 1RZIA 5EC1B 1JF6A 4CVZB 3PXJA 2JIXA 2E9WA 4U1GC 4I18C 1CE1H 4R96A 1QSVA 1A9BA 1P7KB 1N59B 4LLYB 3DLQR 2C3GA 1YQVL 2QR0A 4LAJH 3PWVB 3TT1H 4JFEE 4HC1A 2O61A 3MRDA 1VKXA 5GRWA 4KROC 2CIKB 3VXUE 5GSRB 3OPZH 4U0RB 1IC5H 2PTUA 1OAZL 4D94A 1D7FA 2IPKB 2Y06H 5AAMA 4P57B 3BSZH 2HKFH 4GAJH 4YFLI 2VUOA 5LGJB 2AJVH 5FM8A 3RVTC 2WBKA 3VWJD 3IFNL 5IB4A 4OTXL 2NY5H 3ZHDA 1S9WB 3O2DH 2DMCA 2X40A 3JTSB 1DLHB 4O9HL 5ICXB 15C8H 2XXCB 1MNUL 5ICZB 2IAMA 2PETA 3WJJA 4I13B 1EA9C 4P3CL 3FQUB 2E7LA 3AREA 4UNVA 1S7RB 3V79C 4OCSL 4XNQB 1U8MB 3KYMA 4MXVE 1VEPA 4JE4B 4RISL 3G6DH 3K4DA 2VDMH 3HE6D 2MFNA 2ZP0T 4OD1H 2R0KH 2HMID 4NZRL 5HHXH 1W0YT 5D5MF 3X3GL 3FB6B 3ROOA 2ADJB 3ULSA 3OJDA 2VLJD 1UXWA 3LEXB 2LE9A 4ELMF 4X7DC 3MV7A 5MENA 4UOW1 4JANA 4PRDB 2V5TA 3F7QA 1KT2A 4Z7VB 2CRMA 3QNYB 3JV4A 5C9JB 2ZUXA 5F96L 2VZUA 3ZKXB 3HZVB 2J4WL 4MZ2A 3VXSA 4P2RE 1MI5D 3BQUC 5FUZL 4N1HB 3RY6C 5I1EL 1QFWL 4TVPE 2DQHH 2GITA 5CCKL 4HJJL 2NY3D 4KDWA 5B38A 3QFJE 4J3TA 5GJSH 2ICEA 4UU9B 5F8RC 3GSNB 5EO0B 5DO2C 1FL3A 2BNRE 3O9WB 1BZ9B 1UA6L 1BPVA 2Z8RA 3UZQA 2L7JA 1P4LB 2ESVA 3QP3A 2WUBL 1A7BA 4XC1H 2NXZB 2FECI 4P46B 4S2SA 3X12B 2FEDD 3U30C 1FVEB 3MJGX 4NNXA 2E7HA 3FMGH 2F9BT 1A7RL 1ZVSB 1NC2A 4N9OB 1YPZA 2VE6A 3QULB 3VI4E 2FHCA 3OB8A 4MMZC 3QI9A 3ULVC 4QHLB 2J8OA 5HYQA 4GMSH 3QJFA 3F58L 3D18A 2DL9A 4HK3J 4LVNB 2HJLB 5C7XH 2H8PA 2B4CH 3EIFA 1XEDA 3MNVA 4O2EB 5M7QA 1DFBL 4JRXA 2L7UA 3SPVB 1H3VA 3AXLA 1MHEB 3WV0A 1G7PB 1AO7E 4Y2DC 5J12C 1QHOA 4B53A 4DGIH 1MQ8A 1Q94A 1LO0L 3NN8A 5E6IC 1JNNL 4RAVA 4TOYH 2Q8BL 1QOKA 1PVHA 2APTA 5FIEA 4CN1A 2AJ3A 3RP1A 5HHME 3IF1B 2NPLX 3SE4A 3NFSH 3IGAA 1G7HA 3CCHB 4P2OC 2UYLA 1CL7H 1AD0A 4P9HL 3Q5TA 1H3XA 4HK3N 3W0WD 4AH2A 1IQWL 3GBNL 4HHAB 4OCXL 4Y7MA 1H3WM 2XKNB 2A9MH 4K7PX 3DVFA 5FK9A 4LRIA 3WCYA 1AE6H 1ZTXH 1CBVL 4TVPL 3B8SA 5ITBH 4L3EA 1I7TB 2Q7YA 2RCSH 4RDQF 3ZDXE 3PDDA 2AQ2A 1JGUH 2VL4A 3PGDA 2Z93B 3S5LG 1AP2A 3A0OA 1I1CA 2I07A 4HXBH 3MXVL 4PJAA 2ZOKB 4R6UA 5DJ2B 5DYOA 3PL6B 3QA3B 4QRRD 4PG9A 3H7BA 3AAZA 4JFQB 3A6CH 4TUOB 1KULA 1LEGA 4MA8L 1T0PB 1BZ7A 1BVLB 5H94B 3U0TB 3LY6A 4G6KH 1K8DA 1A22B 3QEHB 2B2XL 3VFRA 3H9HA 4GKZA 2VLME 4G43B 1OD7A 3K4ZA 3W5NA 1DDHA 5L0QB 1A7NL 2DQJH 4KUCF 5JXED 4OGXL 3TBWA 1NMCC 1G9MH 4S10A 4WFHE 3BPOC 4KY1H 4GW4A 4KK6C 4ZPVA 3KJ6H 3MGTA 1DN2A 1N8ZA 2EXYC 2ZUQB 1D9KA 1EEUA 2GAZA 4CADB 2I9TA 5DD5L 3M45A 1GAFH 4N8VA 1WFOA 1XH3B 3T8XA 2R0ZL 3WXVH 2AJZA 2OXHA 3TO2A 1J8KA 3UAJC 3ILPB 4HMDA 5DQ9B 3LKRA 2HFGL 1UB5A 1FL5A 4F2MB 5GGTH 5FUCC 1VEMA 3UZVB 2YA0A 3D85D 3KPSA 2YN5A 1FC2D 5DQJA 2WP3O 1NMAH 2KPNA 3IDNA 3IDXL 4LPCA 4U7KA 2EDWA 3MGOB 3PWLA 4YXKL 4U1SA 3RAJH 5TDOA 3UYOD 2GIYA 4ORGA 1I85C 5C0DB 5T3ZE 4V2CB 4YK4B 4C58B 4XBPA 3RVUD 1QVOA 4FTVE 3O41A 4K9EH 5DRXA 5C0AD 5KSBF 4OLVL 3M8OL 1LO4H 4O58H 1CZ8L 3W81A 3RIFK 3LKPB 4LLWB 1YYMH 1ONQB 5LCVL 2HRLA 2CRZA 5HDOA 2AXFA 1TDQA 2IH3B 3BE1H 3DETC 4I9WE 2ZOLB 5FDWA 1PY4A 4RAUB 4PTTA 4L1DA 5EZLA 2C4FU 1BMGA 2BK8A 5DK2B 3IFOA 1YNTB 3LV3A 4QXUH 3FQXB 25C8H 1NFDB 4OF6A 4WU5B 2J6EA 3GSWA 4OCWH 5I9QB 1DUZA 3MSPA 1KJ2L 4R2GD 4UUJB 5J3HD 3PWPB 3D6GA 3S96B 3RQ3A 3ISWA 1I3GL 3F7RA 3JWOC 2J1KA 1W0VA 1NMBH 1U8NA 4K7PY 5B38G 5EOCL 1F11A 1NL0L 1R3KA 2SEBB 1HQ4A 4MD0B 3REWB 4ELMA 3C5JA 3HR6A 3FO9B 4BYHA 4WWKA 4MYWB 3D0LB 1G9NH 1RZ8B 4L4TA 3UTQB 1YDPA 4JO3L 1FP5A 1AXSB 4X4ZA 1W72L 4N0CD 3BIKA 5HGHB 4UIMB 1ZLUH 1SEQL 1EIBA 1GZQA 3GKWH 4HT1H 5EU6A 1BD2A 5FYLE 1OWRM 1HXMA 1KXTB 2NY1D 5I6XB 4U3HA 1EAJA 2J5LC 2VZ3A 4KVCH 2BCKA 3RY6A 5IW6A 1UXSB 2K7PA 2GUOA 1BGXH 4FQ1H 1KGCD 1JZ2A 2X4QB 1H8NA 4ETQA 3I6KA 3VJ6B 5T3ZL 4JPWL 1FYHB 2VR9A 1F4XH 5DZNA 5CZVL 1OARL 3R0MA 3BGMA 4P4KA 4ODXB 3ARFD 3SKMA 3VFMA 2WINB 4PGDA 1IT9H 3LDBC 2OMNA 4XNYL 4IM8A 2Z4QB 4YHYB 4ODSL 4WY7H 2DIAA 1NGWB 3DHJA 2UY6A 4PUBL 2Y07H 5DJ0B 5KSAD 1VCAA 5I19H 2QSVA 2OK0L 1DLFL 4L8SC 4MNQD 5E4EB 5DMJB 5DSCA 4ZO7A 1N5AA 2DLTA 2IG2L 3QUKB 2E6QA 4RIRB 3FQTA 4PJHF 4F80A 1XGQA 2UVEA 2VL5A 5KANI 1LWRA 3QXDB 4QY8A 1LD9B 4ORZC 3W9DB 4Q2ZA 2VH5L 4LCUB 5IB2A 3FN9A 5FO8B 1NEZA 3QDMD 4GQ9L 5JO5B 3MV9A 1TTGA 1HHKA 4K3GA 2PYEB 2CGRL 2BY3A 4ZQKB 3SO3C 3NCYP 5FYKE 4IMKA 4NZUH 5DC0A 5E6IA 5IK3A 4MAYD 3QYCA 5FA3A 3OV6A 4X5LA 1IBGL 2A9NL 1MY5A 4HCRA 4YBLC 4Z0BL 1XZ0A 4MDJB 4P2OA 1A9EA 3U46A 4OZIE 3QXVA 1S7UA 5FYLL 5HI5D 4LNRB 1UCBH 1L9MA 2KKQA 3QWQB 4XVUC 5GRVK 1U9KA 1NUDA 4JFFE 2R0WL 4MD5B 4BSWB 1T1WA 3C87A 2DM3A 1YEGL 2R2BB 3C2AL 4R4ND 5ESVB 2X1WL 5M94B 5IVXF 3DV6A 4L3AA 3PP3K 5T1KA 1LP9B 2J8UB 3HPLA 4WGVB 5JHLH 1HYSD 1VFAB 1DP0A 2XN9D 5L88L 1HHGB 2QHLA 5LAXB 3VA2C 5DMKB 1QO3A 2MPAH 4M7LT 1GJIA 2W0KA 3MA7A 1D5XA 1T04A 4L9LC 4Z78B 5K9JL 4O51B 2PCPB 1QPXA 3G5ZB 4WVRA 4XGZA 3DGGB 1S78C 1IFHH 1OB1A 5FOBA 3PGCA 5CD5C 3WS3B 1A7QH 3SQOL 1CLYL 1VGEH 5C09D 4NSKB 1U8JA 1F4AA 2HA1A 2X05A 1GL4B 5EU5B 3BDXA 1A3LH 1I8IB 4MA3B 4NFDA 3T2NL 4I2XA 2OJZH 2AV7A 3DVNA 1B3JA 1GC1L 3JV6B 3T2QA 3TJEL 5I1DB 5DEFB 3QUML 4XNZC 5GJTL 3SBWC 3FT3B 4ACPA 3DUSA 1MVUA 3MCG1 4M5ZL 4JQVC 4CJ1A 1X9QA 3IU3B 4WTZA 3D1MC 4Z7NF 1HKLL 1P84K 5BS0E 5FYKL 5ID0B 4UT6H 3V0VB 3H9ZA 1JPST 2FATH 3H9SE 2OSLA 3CXHJ 1NCBL 4K7PH 4LHUA 4Z5RA 4HUUA 4KJYB 3SGDI 5EZJB 1S3KH 3QEQD 1RULL 4DAGL 4WW1A 3UYRH 4OLWL 3PABA 3UDWC 2PR4H 5HVHB 3T65B 3A67H 1CFVH 4G9FE 2P7TA 5GIRA 5E2VL 4JZNB 4U1KB 2X9WA 2W65B 3BMWA 1IKNC 4ZUWA 5TQ0L 5FKPA 5HBBA 2EE6A 4Z7UA 1BQLH 2AABL 4NQEE 3HUJE 3G5YB 4PJGE 4DFHA 3NZ8B 3RTQA 2AV1A 4QOKE 4IMLB 5K93A 5IW3A 1I8LA 5AZ2L 2ZCKL 3HC3L 5C0EB 5IFJB 1FGVL 1QRND 4XPFL 1AC0A 4ZG1A 1ZGLB 3P0YH 4J1UB 2DLFH 4K3DH 4DKEL 2Y6SD 4Y88A 1GVIA 4PRIA 3L3JB 1NGYB 5INCB 1PYWB 3BW9A 3FRPA 5IHUH 4JG0L 2HFFB 3IJYB 1AI1L 4NUGL 4EUPG 4G8FB 1G7QB 2PTTA 5JA8B 5ENWB 1I1FA 4L4JA 1DQDH 1NBYA 4G8IA 3IXAB 1RJZB 4CVXB 1J0IA 3MLVL 3ZE2F 1L9NA 3BRFA 1NBVL 4K94C 1AXIB 2G5BA 3BIAX 2HT4C 3BUYB 4HWBL 2VLLA 1NCAL 1D5ZB 5CLTA 5IV2A 1A6TB 3EO1B 2DQFB 4I1NB 5MI0C 3FO0L 3DRTA 3NCEB 1MFBH 4PR5A 4FXKA 2YUXA 4BH8B 3BH9A 1L6ZA 1G7MB 4I5BA 4YXHH 3LEYL 1T0NA 3EFDH 4DKFH 3BKYL 5FA4B 1AGEA 5JHDA 1YN7A 5IM7B 5T1LA 4JFXB 1OCWL 1P7QA 3KPNA 3CU7A 1MCSA 2EKJA 4LMQI 4Y4HB 1F3JA 1JHLH 1YEIL 2D7TL 5TE4L 1NEZG 4PGBA 1TQCB 3SKNB 4M1DL 5C2BH 5ISZA 3WL9A 5D72L 4G3YL 2BDNH 4G6MH 3C2SA 5LBSL 4G8EB 5DVOA 1R3HA 2PW1B 2VXTL 3OAYH 1FG2A 1XGPB 3P0VH 1ZKAA 3ULUC 1T1XB 3SJVA 1KIPB 3HI6H 1IGMH 4ZTOH 4M7JH 5E00A 3BKJL 4PJHA 3WLWD 1DR9A 2DQEL 1G0DA 1EEZB 2WLZA 4L8SA 4FN0A 4PJ9D 3U0PA 3FKUS 4XTRC 3X13A 1K4DA 3EYVB 1TJGL 5F3BA 5DUBB 2MWCA 2QSCL 1QKZH 1SYVB 4RAHA 3VRJA 4YR6B 1UM6L 4OI7A 4G7YL 4YHIB 3KVQA 1K4CA 1DVFD 4JJ5B 5GRXG 1ZS8B 2R29L 2MCPL 1W8NA 4XWGH 1YA5A 1JPTL 2H45A 4GQPH 4PB0L 3BPLB 5BOZG 1B0GA 3RX5A 4LSRL 1AGFA 1PD6A 2IFGA 2JELH 3P73B 4NKOA 5FECA 5AWNL 3HCVB 4H88L 2Q3ZA 4APQD 2NY2C 5C0GA 2LAGB 4X6CF 3QG7H 4UT9H 4NC1E 4WI3A 2Z31D 2CXKA 1MHCB 4MAUL 3KXFA 5EO9A 4PJDF 4WO4C 5CHNA 3FZUC 5MERB 2VMFA 2R56L 4P23D 4WEUD 4I0PD 2X2YA 5IVXA 1V8HA 3ARBD 3C5ZB 1A5FH 4L5FH 43CAB 1LDPL 4GS7C 2FB4L 3O4LE 1J12A 4J3VA 1QLRA 4WNQB 1KPRB 2A74B 3NACH 1HSAA 1G7JA 5C6TL 1MCJA 5C08E 2JJSA 3BPNB 5HHNA 4J3OC 4WTZG 4WUUE 4JFDB 1FE8H 3AFLA 5E56A 4LLVA 4O00A 2V2TB 5J57B 2Z35B 5BRZD 4KKLC 3U36B 3VXUB 4L9LA 4WENB 5E70A 1QSFE 5J1TC 4RBPH 3FRUB 3VGBA 1UKSA 5F3HB 2NY6D 1TXKA 3Q5YA 3KPLA 5KN5A 1KF9B 3UTSD 5I2IB 2RAMA 2YRZA 1T83C 2ZCLH 2CR6A 1EEYA 5K9OA 4P4RB 2ADIA 3WUZA 5A2LH 2JIXD 1KJVA 3QRGL 4S1RL 1KN2L 3CVHA 3RWDA 5AZEH 5KSVA 2RFXB 3WKNA 4J3XA 3SGJC 3K1KC 3FB5A 2NX5A 1QBLH 4GSDL 3V95A 4D9LH 2H2PC 1S7SA 3KG5A 1BBJA 4JGUA 4KHXH 3ARDA 3V2AR 4HC1H 3VXMA 3S36H 4WGWB 2ZJSL 2VZVA 2NY0C 3KHQA 3KR3L 3T0EC 3THML 3HPJB 2GKIA 5DVMA 3O6LH 5GRUH 4IDJL 1T03L 3G08B 1X5AA 3BVNB 5HYJB 3U9PH 5H2BA 5GISL 4WJ5B 5MP6H 3UDWA 5M95B 4P59L 1WVZA 2FYYA 1N6VA 4LCIL 4ISVB 4RGOL 2KZ1B 2GTZA 3SDCB 4LMQE 1KYOK 2IJ0C 3IDJA 5SWSB 4BZ2L 3WFDH 3IDMB 3VFWA 1I9IH 1YNLL 1WC7A 4LSPL 5DVNA 4P2RB 2R1YB 4C56E 3PWJA 3QCVH 5DHYA 2IAMD 3EO0A 3O2VL 4BFEA 3LRGA 4FP8L 1A6WL 3KPRE 3HG1E 5HGDB 5HHOA 5JXAH 1AGCA 2ICWB 2OLDA 4JHBA 5HGBA 5D93C 1FDLL 4JHWL 1CFTA 4JCMA 2YRPA 1MCIA 1U3HB 4KK5C 1VEOA 2CMRL 3QFJB 2ARJB 1ZK9A 2CRYA 3C60B 1WEJH 5IHZB 3RNKA 3FB7A 1FNGB 2BNRB 1LE9A 1NGPL 4XVJL 4Y0GA 4FG6D 3LKQB 1R3IH 5FFLA 3VI3E 2BVOB 3HFML 3MV7D 1MLCA 1S9XB 5MEND 3VWJB 3WO4C 4R26H 5BZWA 2IALB 4Q9QH 1RUPL 5BQ7A 1YYLH 1WZMA 2IMNA 1OSZA 4FZ8H 3VWKA 3E6HA 2Y23A 2P24B 1S8DA 4NKDB 3VXSD 4FQCH 2W0PA 4F7EB 2F74B 1PEZA 3MJ6A 3MFGB 2I60H 1TZHA 4HQQH 4XMKH 1TZGH 1XCQA 1D6VH 3TLRA 3MV8A 1QLEL 1WTLA 3DOSA 3MJ9L 4TSCL 3HE6B 1HI6A 3BP7B 4Y5VA 5FF6B 2BJMH 1AO7B 5I1CL 4M61A 5EWIL 4ZFGL 3F5WB 1LQSR 3OKEB 5D1ZC 1IM9B 2F5AL 3DV4B 5DFVC 4EDWL 2D9CA 2ESVD 4X4XA 1E4XL 3P9LA 3IFPA 4BSVB 3BT2L 3WFHB 3GJFA 1FFOA 4NRXB 3VFNB 1NC2D 2FZ3A 3QPQC 1MI5B 4KI5D 4JREB 4F15C 3QI9D 4EN3B 4F8TA 4L1HA 1RHFA 2ZUSA 4HWUA 1NLDH 1BHGA 4PTUB 1FFRA 5HDQL 2LU4A 3T1WA 5I18H 2I9LA 3T0DA 2EC9T 3BP4A 3CAFA 1PSKH 3O6FC 1ZANH 3MLTA 5F93C 4JRXD 1UJ3C 1EEQA 3ARWA 3N1GC 1UZ8B 4JPIA 4NQDA 2FL5A 1I1AA 3U4AA 1HHIB 4NQTA 4QHKJ 3EDFA 1MAML 3KYKL 4Y4KA 4DN4H 5IMLA 3D3VE 5L8LB 1ITBB 1HQRA 4JN2A 4XVSH 4U6XB 1OD9A 2BFVL 4QRPA 5E9DA 1QFUL 1PX3A 4KPHL 4R7NA 4U6YA 3V7AE 3BGFB 1ES0A 2YD2A 2DRUA 3CDGB 3EFFA 4KZEH 1B88A 3C08L 2ZKHH 1ZVYA 4NQSB 3GSRB 2B7DT 4WCYH 4S1SL 4X6CA 1QQDB 2VKXA 2F19H 3LHPL 4K8RL 2KUTA 4L3ED 5DJ6A 3BWAA 1JWSA 4G7VH 1B9ZA 3MO1A 4TRPL 1W72B 3DXAA 5HI4C 4B50A 4WO4A 3VFOA 3ZL4H 4PJCE 4XP5L 3UJJH 3V4UL 5K59E 4LKXB 3QIUB 1A8JH 2IGFL 1M71A 4NCC2 4PJEE 2ADGB 5BXFB 4NJAH 4X6DE 4IRJB 4L8CA 4J8RB 5I76A 6FABL 3G04B 3N85H 5HYSA 3W0WB 4JPVL 3ROLA 4UTBH 3N9GL 1ED3B 2EYRA 2X1XR 1PQZA 4XCCL 2IFFL 2XTJD 4D8PA 4D9RD 1E6OH 4BQ8A 4ERSH 5EBLA 5SV4A 1JPGA 2YZ1A 3LD8C 3L7EB 4FTVB 4X9HA 1D9KD 1B0RB 5I75C 5L2KA 2OXGA 5CEXB 1FNEA 5B39B 1J1OH 4YDKH 4QNPF 1J5OH 1CD9B 1OLZA 3CX5J 1DQTA 3HE7C 3D48R 5DGQA 4PGEA 4XNXH 3ZE1F 3MZGB 1CU4L 2VDPL 4LLUB 5KS9F 3V8OA 1UEMA 3BH8A 3KPSD 2CLRA 4LSDA 4JO4H 2OR8A 2XWJA 3EKCA 2A6DA 4MQ7A 3HC4L 3RUGB 5IT2L 2HVJA 3QZWB 3SGJA 2YD9A 3MOBH 1RIUH 4Y4FC 4DW2H 4ETYA 1GSMA 4RQQB 2NYYC 3EYOB 1T20A 2QV2A 2WBJB 3L6FB 1JHTB 1SM3L 3TBYB 1NPUA 4R97B 3H9YA 2V9RA 2EYTA 4TPRH 1FH5L 1J10A 1R3JA 4PRBB 3O8XC 2NW3B 1YY8B 1C1EH 1TJIH 4Z95L 2ARJQ 2JCCE 1QZ1A 4KHTH 3RU8H 4NO2B 1L0XA 1U8LB 4H20L 2H32A 2V7NB 3RVTD 2H1PL 5J6HA 3AB0B 1S7VB 2AKRA 4X7TA 1K8IA 5DJAA 5E7BA 4JQIL 1WFNA 1R5WA 2YC1B 1BQHA 2B0SL 3QJHB 1F00I 3MRRA 2HG5B 5DQDH 1OM3L 3WFCH 1VFOA 1JGDA 4OKVB 4P2QE 2OQJA 3FN3A 3T4YA 1YUHB 4LOUD 1FLRL 1NCUA 2CSPA 1LK3H 3I02A 4DZBB 3C09B 2CDGA 3FQNA 3ARZA 3MFFA 2EEBA 5IB5B 5TE6H 3G5XB 1CXEA 3QT2A 4OLZH 4KAQL 4MXWL 3GGWA 1M7DB 2Y36L 3UTTE 5IBUG 4GRLC 4GG6E 3SE3A 4NOFA 3AY4C 4WFGE 4WWKD 4HIJA 4QRQA 5C0AB 1QLFB 4L4TD 3VCLA 4DVBA 2BSED 4ZOBA 3WE6A 1ACYH 1TVHB 5I0DA 4I48A 4OD2B 4W68A 5E4IA 1MUJA 1SJHB 5EU6D 1BD2D 4YHOL 2AI0L 4JRYA 5ALCH 1ORQB 3Q1SL 5D96C 3UJIL 3LSOB 3MRPA 5GHWL 5DEGB 1A4JA 4FFYL 5F89A 4CW1A 4J2XA 4LSTL 4YHMH 4RRPA 2OX5A 3QUMB 5IUSA 1OW0C 4AK1A 2EDBA 4FXLA 3WKML 4GBXA 5ERWA 1JN6A 2GT9A 2HJFA 4OIIH 1KLGB 5DC4B 3GBMH 4GKSB 1T2QH 2OP4L 4MDIA 3SKJH 3ZLQC 2BOCB 3S4SG 4P4KD 32C2B 3I75B 1YEFH 1YMHA 2XWTB 4YLQT 1ZT1B 2JLLA 1UZ6F 1U2HA 3BKMH 4OIAA 5J6GB 2AEWA 3RNQB 1WIOA 2OI9B 4BZYA 5I16B 4OZIB 5EC1A 4HJGB 4U1NA 4CVZA 1YJDL 2C26A 3WJLC 4U6HB 5GS0L 1N59A 4LLYA 1BX2B 3OB0H 3WUWB 2CRIA 5ACLA 3VFTA 4LIQE 4YE4H 1D5BB 4ONGL 4PBVC 4M93B 3MV01 3HNVH 1EUUA 3L5WB 5TDNB 1QG3A 1K6QH 5F7DA 1Q0YL 3MV9D 2FGZA 2EDJA 4UT7H 1ULVA 2E7CA 2IPKA 5JDSB 2BSSA 1LK2B 4PGJA 5CSZB 5E6ID 5I8KL 1FFPB 2Z8SA 3HMWH 1HK6A 4HCRH 1ND0A 4OZFB 5LG1A 3TM6A 1Q9KB 1S9WA 3QUXB 1F3DJ 1OTSD 5I8OL 3PV7A 3JTSA 2XZCH 4HZLB 5ICXA 1B2WH 5HYSG 5ICZA 1ZLWH 3MLYL 1AFVL 3AMLA 4YEFA 3C5SB 1R3LB 1T66D 3FQUA 4LSVL 3I2CL 5EUKB 1INEH 1E4WH 1S7RA 3QNXB 3MACL 1U8MA 2C3XA 3L3IB 3RZCB 3V52L 1DBKL 2X4PB 2YSSB 4R4BB 1A6VL 2AJYL 4WFED 1NFDF 2X1OA 2AJUH 5T1KD 4OF5A 1M1SA 2H41A 3S37L 5BV7H 4X6FB 3I6LD 2APFA 2ADJA 3A6OA 2XOTA 3TIDA 3ARGB 5D2NB 4OGYL 5DD6B 1GGCL 4ZS6D 2O93L 3RGVC 3O81A 3S35L 5HYIA 1FNFA 3BFOA 4KUCD 2UWEE 4ONHA 1JYNA 1YEKL 4PYHA 5I8CA 3HZVA 3T77B 1F90L 5BW7A 3NA9L 3GMMA 4G9FB 2AJSL 2OL3L 4NKIH 5IR1B 2YD8A 4YHKL 4LIQL 2F53A 2FBJL 4PB9L 3ULVE 2J6EL 1CYGA 1FIGL 5T3XE 1NGZB 2EXYD 3ARSA 4FZEH 5MEPB 4IS6A 4NQEB 1ZEAH 4GUPA 3HUJB 5ESQB 4RBPK 4UU9A 4PJGB 4X80L 5KS9A 2HLAB 3GSNA 4A6YL 5EO0A 1KIQB 3KPQA 3SCMC 1LGVA 5IEKB 2CO7B 3O9WA 1CDUA 1BZ9A 1IGCH 3R0NA 2DI7A 4OLXH 4NWUL 3B9VA 5CIPA 1V7NL 3EOTH 1P4LA 1BLNB 1HKFA 4JDVA 3WFBH 1MRCH 4LHUD 3X12A 4ZXBB 1FVEA 2DBLL 4NN7C 1Z2KA 4YWGL 4OFKA 1KCRL 2NY5L 3QULA 2HLFC 2ADFL 1EO5A 2FX8L 5B22A 1AJ7H 1PJ9A 1KENH 3VDCA 4LEXH 3AS3A 3O8XA 4BJLA 1ZWIB 4P3DA 1MHEA 4OI8A 3GSQB 3M1BA 3RTQD 4MCYA 5D6DA 2H6PA 4FQJL 1U6AH 1W8OA 2CO6B 1UWEL 3IF1A 4XHJD 1VPOH 5DR5L 1RZKC 1X6NA 5JNYB 3WD5L 3DSFL 5H35A 4NRYB 3QEQB 4GKNA 3D39E 1PZ5B 3QUZB 4JVUA 2J88L 4PRID 3S8WA 4JZOB 1WAAE 4RRPG 4X4YB 3IB4A 5J13C 5JW3L 4LL9A 2JB5H 4JEGB 2F8OA 4M6OL 5D7SL 3JWOH 3ULVL 4HWNA 3EZ8A 5TFSL 1ZA3A 3LZFL 2CDEA 5T3XL 3JWDH 3IJSB 5HI3D 1J7VR 3A6BL 5SWZE 4B7LA 1N5YL 3R06B 2VXUL 5DJ2A 2OTWA 3PL6A 1U8HA 1Z9SA 3QA3A 1LP9F 2J8UF 2WWMC 3QIBC 3GIZH 1JHKL 4JFQA 1Q72L 1AR1C 1SVZA 5CMAA 1BJ1J 3MODL 4TUOA 2IQAB 3ZE0F 1JYXA 4AEIL 5DK3A 5FUCE 3U0TA 3TWCH 4KTDL 3QEHA 4NNPH 3LS5H 5KZCB 4I3RH 2I5YH 4GFTB 2HJKB 5JHDD 5T1LD 4TULH 4G43A 1P7QD 4LVHB 5DTFA 1EHLH 5AAWA 4BELD 4JRWA 3TT3L 1IAOA 3QXUA 5ISZD 3TO4B 5F7HA 3QIWC 4BZ1L 1XIWB 4CADA 3ES6B 1XH3A 4RGND 2Q3AA 1FPTL 2DM7A 4Z7UE 1L7IL 3SJVD 3DI3B 5DQ9A 4F2MA 1RMFH 1QSED 1T7YA 3VG0L 1IAMA 2H3NB 3HNSH 3OF6A 2VUYA 4HPYH 4LCWE 2DLHA 2F5BH 3HI5H 1UB6B 3MGOA 1BQSA 3NABH 4OCMC 3SE9H 1IC4H 1WFUA 2FX9H 2EDKA 2Q87A 1P1ZB 2FLRT 4I3GA 4IOFC 4LLMA 4QTIH 4P9MH 5C08B 1JPFB 1H8SA 1OGAA 4HAGA 4WUUB 1GGTA 1MHPL 1MFNA 4U1LA 4LCYB 3NCBB 1E4KA 3MLWL 3C9NB 2B1HL 1MJ7L 3LKPA 4LLWA 4RGMB 1WK0A 3NPSC 4YBHA 1ONQA 3OGCB 2NY4C 1OGTB 3B2VL 4M6NL 1A2YA 2QADC 4NUJB 1JK8B 3U4EA 2W60B 4RAUA 2DLGA 3KXFD 5AYUH 1A3QA 3IAGC 1YNTA 1LEIA 2HYMA 1C5BL 3VGAC 3AS2A 4JFPB 3HI1A 1KIRB 3O3EA 3ZSSA 4HV8B 1NFDA 4GMTH 4WU5A 5FO7B 3BHBB 2P8LB 4QRTB 4U1MA 5T33H 1J0YA 4YGAB 5ADPL 2IQ9L 3PWPA 4KRPC 4PJIE 3S96A 1CDIA 4XPBH 3F7VA 2DJSA 1K5NA 2LTQB 3CMOH 4QGYA 3LIZH 1RZFL 1Z0NA 4EBQL 1P9MC 4MD0A 3CGTA 3FO9A 1H3TA 2FJFB 1HE7A 2ZUWA 1RZ8A 2DIBA 5I74B 4D3CH 1AXSA 3QCTL 4NBXB 1ZXQA 1G1CA 4JM2C 1C7SA 4APQB 5HGGS 3RGVA 1FRGH 2DQIH 1CK0H 4XC3H 5HPMB 1V05A 3VXQB 2VABA 4BFIA 5FO9B 5C0BE 4JFHE 1Q9LB 2DAVA 4OBRA 5F9OL 2MJWA 3LEVH 4ZODA 1C7TA 1UXSA 4ZPTA 5I1HH 2R4RH 4CMMB 2YUWA 4OZGE 2X4QA 1IMHC 4TTDC 3Q48A 3VJ6A 1N6QH 1G1YA 4HGMA 4UV4H 3KPRB 4UAOB 3SEPA 4ZAKC 3CVHH 3O3DA 3BUTA 1AHWC 1PFCA 3V4VL 4ODXA 2NX5D 4WIQA 2WINA 1GGBL 3MYZA 2KBGA 4X98A 3P30H 3ARDD 3WIFA 3VXMD 2Z4QA 4F9PA 1NGWA 1JZ3A 1XR8B 5DJ0A 1MF2H 4M62H 5C6WH 4PV8A 2EH7L 3ZYZA 5BMFL 5A40E 1L7TL 5A3IC 2CIIB 5EIVA 2F58L 1WZLA 4OCYH 3QUKA 1KC5H 1HXYB 2N7BA 4NZTL 3UTSB 3VXNB 1IM3A 5IFAL 4KJWC 5F21B 1F42A 1FNSH 3QXDA 1RFDL 1LNUB 3W9DA 1A1NB 1R0AL 1YMMA 4CU8A 5FO8A 4GH7B 5C1MB 3HNTL 1D3CA 5JO5A 4DGYH 4R96B 1UWXH 4PJBF 3RDTC 3BD4A 5HHOD 3V0WH 3D9AL 4QYOB 4Y8AA 3GMPB 1JGVL 2YKLL 5D1QD 5ADOL 1V7ML 4HIIA 1DQML 4RMRA 3LS4H 5EA0H 3MRDB 5JTWA 1QYGH 5JQ6H 4L4VE 4MDJA 2DQCL 5CJBA 4HUNB 4LNRA 3RWIA 2OZ4A 4NRZB 4MD5A 1QP1A 5DS8A 1Q1JL 5JOPD 3OG6B 2HT2D 1KNOA 3VWKD 2R23B 4PD4J 1O7VA 1L0YA 3H3BC 3DYPA 2EXWD 4DVRL 3ZKSD 3CSPA 3VD7A 1LP9A 2J8UA 2PYFB 2PO6C 5FCUL 3G9VA 1AIFA 2J8HA 3IRPX 4ZS7H 3VFUB 1VFAA 3O2WH 4F58H 1X4XA 4K94H 1TNNA 3AREB 3TEUA 5FV1L 3KYMB 2VQTA 5EU3B 3MV8D 4O51A 3KLHC 2PCPA 3DGGA 1N64H 4OCRH 1G6RL 4UDTA 1MHHB 3NFPB 3WS3A 1ETZA 4F37F 3QAZB 4NSKA 1FZOA 3ROOB 3LQAH 5DUMH 5DD3H 3D3VB 3ULSB 3OJDB 1F8TH 1JGLL 4ESKA 1UXWB 2HTLD 4WFFE 1RUAL 4TVSa 5DT1L 1I8IA 1Y18A 4MA3A 5EN2A 1JI2A 3MV7B 4UQ2A 3JV6A 1LMKA 2NR6D 4JANB 5I1DA 2X4SA 1MCQA 4W6XB 2VB5A 3B6SB 4NQCE 5A2FA 3JV4B 3GJFH 1FORL 5DEFA 1YNKH 4XNUL 4ZFOA 3BP5A 2EECA 3PP4L 4NFCA 3RVXC 3IU3A 1MFEL 4PJ7E 3VFGH 5DMIH 3C8HA 5ID0A 4KUZL 3V0VA 1MCRA 2CH8A 4KMQA 1K3ZA 5KG9A 5C0JA 4MXVF 1EFXA 1Q0XH 4J6RH 5IGXL 4KJYA 4NQDD 3VXOA 5EZJA 1I1AD 3MA9L 3CZFA 3T0BA 3MMEA 4Y4KD 2EIEA 2XA3A 1QFPA 4Y16B 4KQ3H 4WU7B 1FL3B 3T65A 4QRPD 1PLGL 4P9HC 5E9DD 4PJEB 2DIJA 2XKSA 3PDOB 4X6DB 4IHOB 1UCBL 3BN9D 4U1KA 5E2UL 1RK1B 5C9KA 4S2SB 3UP1A 1WZ1L 4P3WA 5C0RL 1T1ZB 4KVNH 4UZGA 1S9YA 1MAKA 4OJFH 1QHPA 2BOBA 1DQLL 2BNQE 3NZ8A 1AC6A 3QJFB 2X1QA 3D18B 3WBDA 1I7RB 4OLYL 1GHFL 3NGBC 3G6AA 5CP7B 5DFWH 2H8PB 4RFOH 5IFJA 4O2FA 2EEAA 3MNVB 3DXAD 4JRXB 5MEOB 1JF1B 3NCJL 2OYPA 3W2DH 1QBBA 2HKHH 3GHEL 1Q94B 2ZG3A 3NN8B 1N3NB 4RAVB 3Q2CA 3OXRA 1ZLWK 1S5HB 5INCA 1PYWA 2AJ3B 4FQLH 2FDBP 3IJYA 3MRJB 1UYWL 2DLIA 3OZ9H 4JHAH 5D7IE 2UYLB 4XPGL 4B7IA 3IXAA 1RJZA 4CVXA 5DMGD 5T5FH 4ZUUB 5KSUB 4K55A 4DUWA 5HVGB 3MBEB 5KVFH 3VI4F 4LLQA 1A6TA 1OAYH 2DDQL 3EO1A 3BGAA 3KHOA 1N4XH 3ULUE 2Q7YB 5L2KD 4B41A 1KCUL 2JCCB 2MOVA 4P5MA 1JJUA 4OM0L 4BH8A 1G7MA 4G5ZL 4ZOEA 1F4YH 5FA4A 4OCNC 3L95B 4JFXA 5DYOB 7CGTA 5IKCA 3FQWB 1N7ML 2VDLH 1UJTA 1EGJL 2DWEB 4Y4HA 2JKXA 3MRCA 5DLML 1DZBA 1LEGB 1FGNH 1BZ7B 4P2QB 1QPPA 2AK4E 5CJQH 5ANME 5F72S 3CFCH 3DRQB 2PW1A 3K81A 4O2CB 4WV1B 4KZDL 3W11D 1DDHB 1XF2B 2D7MA 1T1XA 1A6AA 4HAFA 4Y5YC 4YDIL 3QQ3A 2NY0D 3UTTB 2HH0L 1B0WA 3IDYB 4ZNEA 3CDFA 3MGTB 3EJJX 3BD3A 1HCVA 1DBBL 1D9KB 3EZJB 4JG1L 4A2MA 1EEZA 1U91B 5EUOE 4MB4A 4ZD3H 4JO1L 3ZDXF 2FX7H 2UZYB 2PW2B 1ZHBB 4N8VB 3T8XB 4X5WA 2DD8L 3EYVA 2AJZB 4YBQD 5DUBA 2BVPB 2H32H 3W5MA 3LKRB 1SYVA 4YFLF 1Q9OA 2DQUH 3D2UB 3DSNA 2VKWA 7FABL 4NOBA 2BY0A 4MQXD 4JJ5A 4KU1A 4PJBA 1ZS8A 4XWOC 4HG4J 1EXUB 4U1GB 3X3FH 4EI5C 4I18B 1KEGH 1CVSC 3L3DB 1UT9A 5J06A 4JY4B 4ZDHB 4NO5B 3PWLB 5TDOB 2Y72A 1MCCA 4X7CC 4UILL 3HCVA 5E2WL 1FQ9C 4KK5D 5E5MB 2NQCA 1BM3L 3VRIB 3ULUL 1AY1L 1MHCA 3QDAA 1QVOB 2JJTC 3O41B 5DRXB 1WWWX 1F58H 1MRDH 4KH2A 5JOFA 2A6IA 5MERA 4XPAH 1LE5B 1ZHKB 1MRFH 2GJ6E 1IARB 2VZSA 3F65A 3B9KA 3C5ZA 5DA4A 1DEEB 2MSPA 3WNOA 4JKMA 3MNWA 4NQVB 43CAA 1JIBA 4JRYD 5D8JH 2A74A 1MCFA 5FDWB 1XGUB 1OAKL 2OL3B 4U1HB 1XF5B 1BEYH 1Q9WA 1LVEA 4JFEA 2HRPH 4WUKH 4TSAL 1DUZB 4KJQC 2V2TA 2Z35A 1GZPA 3U36A 3VXUA 5IBTH 3V8CA 3AGVA 3HLAB 1NDGA 4JZJC 4GBXD 2VDKH 1MJUH 1W0VB 4Q9RL 1U8NB 4A6YB 4XP1H 1R3KB 3T0EE 1HQ4B 5F7WC 2FO4A 4FA8A 5I2IA 1QA9B 2BHZA 5E8DL 5F7NC 3BIKB 3SKOB 3L3KA 1KCKA 4W70A 3IAPA 4NPYB 4EJ1C 4FQ2L 1GZQB 1BD2B 1EFQA 5E99H 4D9QD 3BO8B 1OPGH 3MCKB 5D7KD 2AW2A 1HXMB 3RX8A 2RFXA 1C5CH 4OM1H 1YEJH 4JKPL 3BQUB 1MJJB 2BCKB 4YHZH 5CINL 3GDBA 2GUOB 3GI8H 1CLCA 1CG9A 1DBMH 2GY7B 3I6KB 4URTB 3MLUH 1I7UA 4QWWC 1H3PH 3G08A 3BVNA 3PG2A 4NQXB 4WJ5A 1R5VA 3SKMB 3LH2L 5E94A 1DQQB 4UIKL 3UJTH 5CILL 1EK3A 1UH2A 4KDTA 3ZT6A 2MTPA 5DUPH 1TCMA 4UB0L 2NTFB 3H3PH 4JB9H 1CGUA 2UWEB 2M26A 2E6PA 1U0QA 2EDOA 4P2RA 2R1YA 3U30B 5DSCB 3S88L 2DQDH 5CEZD 3CFKA 3RWHA 1KSRA 5CEZH 1XGQB 1BIIB 2DS4A 4R4FL 3MGAA 2R15A 4YDLC 4XCEA 4HF5H 4KXZI 3ALWA 4AG4L 3VD3A 1X44A 1OTUC 1U3HA 2R9HD 2HWZH 3QFJA 4PJ8C 4P48A 5CJOL 5H37H 3GO1L 3C60A 4N0YH 5IHZA 4CN6A 3MV9B 1W0WA 4C54A 4TSBH 1BQUA 2BNRA 2VDRH 5IIEB 5J12B 1X5IA 4DUVA 5E6IB 2BVOA 5FA3B 1S9XA 4LQFH 4EDXA 2Y1VA 2IALA 4P2OB 1FBIL 2P24A 2GTWB 2XZAH 1GC1C 3OAUH 4CBPA 3TCXA 2XKUA 1C16B 3EGSA 4OLUL 4G6JH 1K85A 2X4UB 1U42A 3DV6B 3VW3H 4Z7OE 5J11B 3BP7A 5IJKC 5FF6A 3U48A 3ABZA 1AO7A 3PWUA 1KELL 5EDXA 2RBLA 3F5WA 1QRKA 3GSNH 4M7LL 2XQBL 3O9WD 3QUYC 4GRWE 1ZMYA 1IM9A 3MA7B 1D5XB 1GRWA 5CIPH 2G9HB 4XNMB 4TUKL 2C9AA 4XGZB 3CDCA 5IJVB 4KMTL 1MREL 2NXZD 2NNAB 4BSVA 3RL1B 1OB1B 4P46D 3WFHA 5FOBB 4KK9C 1EVTC 2BSRB 4NC2B 4NRXA 5F9WC 3D39B 1U8JB 4OZIF 1NJ9A 3GZKA 2MQCA 3RWEA 3OR6B 5B4MC 4EN3A 5EO1A 3HS0A 3I3BA 4I2XB 1RUMH 2AV7B 1NMCB 3DVNB 1P2CA 1UWGL 4YZFE 5JUEH 4HXAH 4NHUB 3BPOB 1HZHL 3NMEA 1M4KA 5E8OB 2R4SH 1MWAL 1MFCH 3O8XD 1NEUA 2Y25A 1WBXA 1UZ8A 5SWQB 1MVUB 1KFAH 2ZCHL 1HHIA 3VMNA 2D2OA 1NCDL 2E6JA 1J1XL 3VFVB 1HOCB 4P2CG 3O4OC 3V5DA 1IGFH 5LXGL 1RY7B 5I15L 1RSFA 3K74B 1JNJA 4JFZH 5DWUL 5FHBH 4K3EH 4LHUB 1HSBB 4OGAD 2X42A 3CDGA 5DJYB 5FUOH 1KJ2A 4V2BA 4O5LH 4QF1B 5E1AB 4KTEL 4I4WB 4NQSA 3GSRA 4JPKL 3KLDA 1UWXK 3GI9L 4X99B 3PHQA 3EHBC 3FFCA 4X9IA 3CLFH 5GIRB 5I1KH 2F53E 5F1OB 5FKPB 5CZXD 2CK0H 3INUH 2VXSH 1JZ5A 1E6JL 1W72A 4Z7UB 1XMWA 2IBGA 3M17B 5GGVL 3PL6D 5D1XC 2EDDA 5GSVA 4LKXA 3IU4L 3QIUA 1CFNB 4AM0A 3RWCA 1GOHA 4N1CA 2ADGA 2YR3A 5BXFA 3UTPD 2R1WB 3WHE0 3K80A 1U8QA 5AEAA 4IRJA 5CUSH 2EE3A 4J8RA 4YFDB 1OSPL 1R24A 5DD0H 4ALAL 4XZUB 2NXYC 4RA3A 4PRIB 1CDHA 2LQRA 1KG0A 2ORBH 1TJHL 5C0CE 1E0OB 3S34L 2VC2L 2AVGA 3J8F7 2PTTB 4PRHE 4FTVA 1B0RA 1VB9A 5CEXA 3HB3C 4RFNC 1SMOA 3TFKC 4KKBD 3K8LA 3TH3T 2G5BB 4KJPD 3LPGA 4AZ8A 2VLLB 3HUJF 4X7FC 5F7KC 4LLUA 4PJGF 2FSEB 4DFIA 2VAJA 1MQKL 3OF6D 2WIIB 2A6KB 4FFWD 4XCFL 5EG6C 3QBTB 2GSGA 1T0NB 1QR4A 5LJYH 3QZWA 3GJFK 1YN7B 1P7QB 2J5LB 4PJIB 3KPNB 2UY7A 3SHSA 3U7YH 2R2EB 2ZSWB 4PFEA 1H15A 5IVOA 3L6FA 1MCEA 1JHTA 5IG7B 5J1SC 1HILB 3TBYA 1OGAD 4PGBB 1JNLL 3FO2A 3S9DB 3LB6D 3BKCL 4PRBA 1YY8A 3RKDC 1R3HB 5BVPH 1FG2B 3QSKB 3FHQA 3LDBB 2V7NA 3EDJA 1EHNA 3QB7C 1MIEH 4B5EA 1S7VA 1PKQE 1TQBC 1A64A 1KCSH 3MR9B 4RFEA 4XXCC 5E00B 4PJHB 5C0BB 1IAII 4L8SB 4PLKD 4DGVH 3U0PB 2AQ3A 4OKVA 3X13B 3FT2B 1BOYA 5EZIL 1K4DB 4GXVH 3T2OA 3WYRA 1I9RH 4YQXL 3PWPD 2W07A 3VRJB 3TA3C 1CF8L 5IB5A 5DZOA 3G5XA 1K4CB 3K2UH 4NM8L 4KK8C 3L7FB 4LSQL 3HKFA 4PJ8A 1QBMH 1M7DA 4HS8H 1I8MA 5HHPB 1IEAB 4LASL 1IJ9A 1G0YR 5E0QA 1BBDH 3ILQD 4FFZL 5I1GL 1KBGL 1QLFA 3SO3B 1AGFB 3OX8B 5FECB 1QSZA 4GW5B 3RY5A 4OD2A 5C0GB 1SJHA 4YBLB 3RGVD 5FEBA 4GT7A 2D3VA 3CH1A 4ZNCD 5GS3A 3EJZC 4G6AD 4WHYG 1BFVL 1ORQA 2I26N 1IEBB 3LSOA 3EYQC 4PJ5E 2ZG1A 5DEGA 4YPJA 4PRNA 3CH8A 1MFDL 4OFDA 5IVXB 2AK1L 3QUMA 2DTSA 1UM5H 5FM5O 1WCBA 1RJYA 4Z6AT 1HSAB 5JW4R 4XVTH 4DW2L 2BOCA 4M6ML 4MJ6B 32C2A 4LPTA 5I1AB 4LLVB 3W39A 3QUYA 5D2LE 2QTEA 2BXYA 3SDDC 5J6GA 3KPPB 3RNQA 4L4VB 1F4WL 2EZ0D 4L9LB 3DTXB 4R7DA 5I16A 2OS7A 3I50L 1NAML 4OZIA 3MCLL 3FO1B 3STLB 4B0MM 4ZFFB 2ENYA 1RUQH 5GRJL 2V2XA 4U6HA 3ELAT 4UTAH 4OGZA 4JFFA 2A73B 4V1DE 3QHZH 2OR9L 4HBCL 3C8KA 2HT3C 3WUWA 3GMLA 3O3UN 5ALBH 3LN4A 5KN5B 1B4JH 3WLBB 1P4IL 1I3RA 1B90A 1EEYB 1RU9H 1CGTA 1YMMD 3V6OE 3CFJB 4KRNA 5FB8A 3K1DA 3V0AC 1NAKL 4PP2A 1F4HA 1A0QH 5TDNA 3DUUB 4P0DA 4XNZB 5L7XH 3TN0C 4J7RA 3RWDB 5D70H 4CDHA 5KSVB 5JDJA 5JDSA 5CGYD 2FGWH 1UQSB 3VA6A 1KLFA 5CSZA 3FB5B 1AQKL 4MHHI 5A43C 1FFPA 1MELA 4AEHH 1S7SB 1NCNA 5CAYB 2ED7A 3VXMB 5IEHB 3MOAH 4JGJA 4OZFA 3V4PH 3SDAC 3R8BB 4OV6F 3BISA 3QUXA 2BRRL 1MJ8H 5FXCH 3BZ4A 1RZKH 2ARWA 3C5SA 2OZ4H 1CT8B 2KZWA 2FYYB 3CSGA 5EUKA 1ADQL 4LARL 3L3IA 5CBEB 2LVCA 4NQCB 3RZCA 2X4PA 2YSSA 3HAEA 3WFEL 2JK5A 4POUB 3OKOB 1WC7B 5B39G 1CFSB 1BECA 1SYSA 2V5SA 5J89A 4HWBA 4JDZB 4CGTA 3EO0B 3SE8H 3CSYA 1GIGL 3PGFH 5BS0A 1D5MA 3FAWA 1S5IH 3ARGA 5HHOB 1T3FB 3H9SA 5DD6A 1CFTB 1LDSA 3RA7H 1QFHA 3RNKB 2IPTH 3MXWH 1ROWA 3QZWG 1F02I 2D0FA 3DIFB 4G9FA 2JJWA 3IXTB 3WNMA 1KTLB 1MEXL 4XP9L 2BERA 5IR1A 4IDLA 2FIRT 1ODAA 2Q76A 5BZWB 1S7TB 3VWKB 2XZZA 3E6HB 1FLTX 1Z9LA 4NQEA 3BJLA 5IMKB 3HUJA 2VXVL 3RGHA 1KJ3L 5ESQA 4PJGA 1KJMB 1U41A 2HLAA 5DA0B 4G8GE 1KIQA 4QOKA 1PZUB 2EH8H 5JIHA 5IEKA 3UC0L 1CDGA 1TZHB 4ZOCA 3W9EA 2EEDA 4XPTL 4R0LC 3RVVD 1BLNA 5MI0B 4WI4A 4XX1E 3MC0A 1CGSL 4LSUH 2HVKB 4HUKB 4XMPH 4ZXBA 4CVWA 1KB5A 4M61B 4UOW0 3V6BR 5T1DL 2VQ1A 2D0GA 5I1LB 3DMMC 5MHSE 2RIKA 5TPWH 5DJXB 1FAIL 5D7IB 2VZTA 3UO1H 3VI3F 2QLVB 5CGTA 4KQ4H 4PGZA 1IKFL 1FFOB 4M00A 2R69H 3RPIB 1OF2B 2NW2B 4QTHB 3B2UD 2FZ3B 2CR3A 1J0HA 3GSQA 4RWHA 3O6KL 4ODWB 5B3JE 2CJUL 4PIRF 5FYJE 1RIVH 2NY4D 2R0LH 2YPLE 4RMUA 4DZ8B 1ZV5A 2HN7A 1RZJH 2X4RA 4YHNA 3MRIA 4L3CA 3MLTB 5JNYA 2X9YA 5KTEL 4NQDB 2FL5B 5E08H 1MFAL 4NRYA 1IAIL 4Q9BA 1CR9L 3QUZA 2DTML 3U7WH 4JZOA 3P77B 4N8CH 4JN2B 4X4YA 4RZCB 4HSQA 3LCYA 2YA2A 4ZSOE 2AK4B 5ANMB 2YPVL 3BAEL 4XMLL 2G75B 4IRSC 1IZJA 4LLDA 5IFHL 1BVKA 1ES0B 1UACH 3CC5B 4AIOA 3RX7A 5IESL 5FGCE 3IJSA 1IC7L 4CMHC 2CLZA 1WV7T 5HYFA 5IQ9B 4XAWL 2V5YA 2NY2B 3D5OF 3VGDA 4F8QA 3BWAB 5EUOB 2IQAA 4FNLH 5F1IB 1Z9OA 2HJKA 1AGDB 4WO4B 3VFOB 4LDEB 3STZA 1PG7W 2GFBA 4M7KL 4Y4HD 3RIFF 1M71B 3OBAA 1YQVH 4GS7B 4J3UA 3TO4A 4MXQC 1XIWA 4FABL 1F6AB 3G6JE 1HWHB 4L8CB 1NCWL 2FRGP 5I76B 4WHDA 3ES6A 2E7BA 1PQZB 4POZC 1YY9C 5DJCA 4D8PB 3SDDA 1OAZH 2AEQL 4OZFG 1T89A 2PF6A 5FYJL 5CJXC 4HK0B 2H3NA 5L2KB 1FNEB 1DE4A 1J1PL 1UB6A 2DM4A 3IFNH 4W6YB 2V9TA 4OTXH 3QFDB 4PJCF 5K59F 3O4LA 1MLBA 2GJJA 1P1ZA 3BH8B 2CLRB 1Z3GL 4LGPB 1MNUH 3ESUF 4G80B 1JPFA 4M3JA 4WEBL 3JV5A 4PJEF 2VLKE 4WUUA 4MGXA 4MQ7B 4X6DF 4OCSH 3SGEH 4DEPC 1X7QB 4LCYA 5JORB 1H8OA 4PG2C 4MNGE 4RISH 2N56A 3B5HA 4M9OA 4XI5C 3C9NA 3VH8A 2VO5A 1QSFA 4I3SL 1VHPA 2G60L 4NBYB 4NZRH 1X4ZA 3OGCA 3PUCA 3X3GH 3MNZA 2NY0B 1FVDB 3SDXE 3T0EB 4DOHE 1JK8A 2EYTB 4D0CA 2ED8A 1TNMA 1NGQL 3TJHC 3GIZL 1KIRA 1SBSL 4CU6A 4HV8A 4YHLL 3O0RL 5FO7A 3B9KD 3C5ZD 4JKWA 2P8LA 5J6HB 3NH7L 5F96H 1F45A 5IWLA 2NMSA 2RR3A 2WQRA 2MMXA 4X7TB 5TDPB 4F7TB 4ZO6A 2APBA 1R5WB 5I1IL 4UINL 3QDHA 5FUZH 2P5EE 3MRRB 5I1EH 1QFWH 2VDNL 4JFED 4U3XA 1MCOL 2HTKC 5CCKH 4HJJH 3ZTJH 3MJ9A 5AG9A 3VXUD 4ODHL 2P8PB 2D7OA 3MFFB 4RMSA 5D93B 2W9EL 1AD9A 1DQJB 1RHHB 3GGWB 3F12A 4MA7L 1UA6H 4F3FB 5E8PB 4QRQB 3WSQL 5KANG 1T2JA 1Q9LA 2W59A 5E03A 2JCCF 3WE6B 4BA8A 3LPFA 3V9FA 2WUBH 4MWFB 3HZKA 1NCTA 5J7CC 1YECL 5SX5H 3WIHL 4OFYA 1XGYL 4I48B 1OL0A 2W38A 3WO4B 4DQOL 3HZYA 4CMMA 1ZSDA 1EMTL 3KJ4C 1A7RH 4NGHL 4C56A 5DRZB 3KPRA 1HNGA 3HG1A 1BIHA 1INQB 3F58H 3RVXD 3O6ML 3WNPA 2Y4SA 1A4JB 5F89B 3IKKA 5GZNC 4QEGA 1DFBH 3B8YA 5ERWB 1JN6B 4HUWB 5IQ7L 3H2WA 5EC2A 5LWYL 1LO0H 1UGNA 5HYJD 1JNNH 1TETH 5EU4A 4YJZL 2Q8BH 1YEDA 4GG6F 2DQGL 1YMHB 5TJWK 1A7PL 1HXYA 4X6BA 3DMMA 4HUXB 4DCQB 5D1ZB 3FOMA 4P9HH 4JM4L 4LQ1A 4U1NB 4Z7WE 1IQWH 3GBNH 5KJRL 4NIKB 4OCXH 4P2RD 3IKCA 3LMJL 2A6JA 3GB7A 1MCPL 3B43A 4KMLB 1TVBB 4TVPD 1CBVH 4QYOA 3UPRB 3P4MA 5DRWB 1ZLSL 1JTOA 3GMPA 4TVPH 4EIZC 2B5IC 3VFTB 4F15B 2DQTL 1PBYA 2A0LD 4XB7A 2VDOL 2YA1A 1U3HD 3QFJD 3MXVH 3C60D 5F7DB 3O6FB 4XP6L 3MUHL 3H42L 1N2RA 1UJ3B 2BNRD 5GGUA 2OTUA 1WT5C 1EAPA 2BSSB 2HFEA 4GRWB 3NIDE 1U93A 4NRZA 4C59B 3I6GA 5F1NA 2WBWB 2I27N 4MA8H 2V6HA 1N6UA 3CSBA 4H1LA 1ND0B 2B2XH 2R23A 1D5IH 5BO1L 2UZIL 4N0FB 2COQA 4IRSA 1A7NH 2PYFA 2NCMA 4OGXH 1KPUA 3CJJA 3VFUA 1I9JL 4YPGB 4NZDA 3EO9L 1BFOA 3NAAL 4P2YA 1NLBL 2A83B 2XY1A 5EU3A 5DD5H 5GPRA 1U58A 3TNMB 2R0ZH 1RK0B 2AJXL 1AO7D 1MHHA 4PRPE 3NFPA 2VJXA 5E1HB 3PXHA 1IL1B 3D3VA 2HFGH 3MRNA 4DWHA 3TIDB 3UTZB 5HHMD 1MF2L 1IM9D 2FJGB 3HZMB 3U2SA 1M05B 3L5IA 4M02A 2NY5C 3B6SA 3TYFB 3IDXH 5ELIA 3F62A 4YXKH 4ONHB 4WHYH 5I8CB 4QXWA 2DB8A 2DICA 5LQBL 3GMMB 3QWOB 4EN3D 1UCTA 3NZHL 2BC4A 3AS0A 3KYOA 1TTFA 4NM4L 3K8MA 5J1AA 2F53B 2ENSA 3QEGL 1A14L 3BXNA 4OLVH 4LPVA 3WS6A 1CZ8H 3EJYD 4IS6B 5I75B 1CTOA 4GUPB 1XF3A 4PJCA 1VFMA 5KS9B 5HHVL 1LO3L 5LCVH 3KPQB 4Y16A 3AC0A 2FH8A 4WU7A 2H26B 2L0DA 4CRPA 4KRMB 4X6EB 4PJEA 3EOYG 5CIPB 3BYTA 3PDOA 4X6DA 4IHOA 4H8WL 1LEKA 4JDVB 2D7PA 4BQ6A 1RK1A 2VLMD 4W6WB 1KJ2H 1T1ZA 2UWEF 5EU7C 3MJ8A 3EOBB 3MREA 1JGEB 4WFHD 2IEPA 1I3GH 4HGKC 4Y4FB 4JREC 5EOCH 5F1KC 1NL0H 1I7RA 1JRHL 5CP7A 1ZT4A 4X9GA 2GK0A 3ULVF 1P69B 4UV7L 2NY3C 4JO3H 3O8XB 5LGKA 4P3DB 1W72H 1JF1A 3UBXI 5MEOA 2D03L 3IRZA 1SEQH 3M1BB 1N3NA 4MCYB 3QIUD 1S5HA 2H6PB 2AEPL 3WNNA 4N5ED 3U1SL 3L9RA 3MRJA 3VXRE 1KN4L 4EI6A 4IRJD 3TGXA 5H35B 4ZUUA 5KSUA 1B6DA 2FEDC 4GKNB 3MBEA 4NJ9L 5T3ZD 3OKDA 5T3ZH 4JPWH 3T08A 5IROC 2P5WE 4OF7A 5CZVH 4FTVD 4MS8D 1OARH 4IRZL 2JCCA 2P44B 1ZA3B 3QDGE 2CDEB 4XNYH 4F33A 2B4CC 4GRLB 4AIZB 1J9CT 2FH6A 4ODSH 1FFQA 1OAXL 3QHTC 3JUZA 4PUBH 4Q0XL 3L95A 2OTWB 4EOWL 4S1DD 2CKBL 1U8HB 1PKQB 3FQWA 1KOAA 2OK0H 2DWEA 4I9WD 1DLFH 1M7XA 3H6JA 3JBG7 5CMAB 2B1AL 3QHFL 4IBLT 3KPMB 2IG2H 4LRNL 4UI2A 4P2QA 1FCGA 3OXSA 3DARA 1Z6JT 5FGSA 2VTFA 4ZO9A 4UBDD 5D96B 3S7GA 5INDB 3DRQA 3WFDL 4O2CA 4WV1A 2VH5H 5DTFB 3SGKC 5E8NB 4OFIA 1XF2A 1KXQE 4P5TC 5GS1C 3RL2A 4OIBA 4GQ9H 1WAAF 2WBJD 1IAOB 5TQ2L 3UTTA 3KS0J 4GG6A 2CGRH 2W92A 3FFCE 3L3OB 3VGFA 4M48L 1U91A 5FHAL 2PW2A 1ZHBA 1IBGH 2A9NH 1QR1B 1J8HE 1HDMB 3IFLL 2BVPA 2EIBA 4Z0BH 3HA0A 4MMXC 4OLEA 3D2UA 5FYLD 1CLOL 4LVOC 2GYSA 4M6AA 5FYLH 3CFDB 3BRGC 3HMXL 1EXUA 2R0WH 3QDJE 4I18A 1GPOL 1FZJB 4ODTL 3L1OL 3B5GA 2ERJC 3L3DA 1OAQL 1YEGH 2I24N 4JY4A 4ZDHA 4NO5A 3C2AH 2E27L 1G9MC 2M8XA 5E5MA 4LLMB 4PJ8D 3FFDB 5L88H 3VRIA 3ZMRA 5F71A 1OGAB 5HDBE 4F9LC 1Z0MA 1OHQA 4U1LB 5D2LB 5K9JH 1WT5A 2XV6B 1LE5A 1ZHKA 1YZZA 1JE6A 1HHJB 3DROB 1DEEA 4Z7UF 2C3HA 3SQOH 3V7AG 1CLYH 4NQVA 3MLRL 1A2YB 3U4EB 4KFZC 4V1DB 4HIXL 1SHMA 4XXDB 4DUXA 1XGUA 4I0KA 5J9PB 2OL3A 4U1HA 1XF5A 3U6RA 3IDIA 1LEIB 3T2NH 1FHGA 1GC1H 3HI1B 3O3EB 4ENED 3TJEH 2VXQL 3VD4A 1WZKA 3DYOA 3OWEA 2N7AA 4U1MB 3TV3L 3FN0L 1BWWA 3OMZA 3QUMH 5GJTH 4WI5A 5CJQL 3HLAA 4MX7B 3CK0L 3F7VB 4M5ZH 1I7ZA 2GY5A 1K5NB 1ACZA 4A6YA 3E3QE 3JVGC 3Q6FB 5FYKD 3NFNA 1HKLH 2GQHA 2W9DL 5FYKH 3RVUC 5CBAA 4LK4A 4K9EC 4R8WL 3KDMB 1OQXA 2Q86B 1U8KA 1QA9A 2QQNL 1PG7L 4YNYA 4LBEA 3B83A 4JQXC 5EZOL 1NCBH 3BN3B 3ESVF 3SKOA 5C0FA 3D0VA 1RJLB 1HCFX 1RULH 4NPYA 4DAGH 2OR7A 3RGVB 4OLWH 1HINL 2JJUA 3EYSL 3MRGA 3BO8A 2GI7A 2J12B 4JFFD 3MCKA 2VABB 3DX9A 3MRMB 4MLIA 4IIQC 5F6IC 4YUEL 4R90L 3RKPA 4BFIB 3KYNB 5B3NA 4DK3A 3BQUA 1REIA 1MJJA 2P43B 3Q5OA 5E2VH 5B4MD 2EDTA 1HIML 5TQ0H 4ZPTB 4JGMA 4S1QL 4R2GC 3LKOA 4PJIF 5J3HC 1KB9J 2DKUA 2AABH 5F9DC 3F7YA 3RBSA 3O3DB 3RVWD 3MJ7A 3ZKND 3I85A 4E42B 5K9QI 4X5XB 4NQXA 1WITA 4YGVB 5DMYA 5AZ2H 2ZCKH 1DQQA 3HC3H 4X98B 3SCMB 3WIFB 1XCTB 1G9NC 1P4BL 1LO5A 1FGVH 3WN5C 4XPFH 1P84J 3X14A 2H2SD 2NTFA 1OVZA 3QUXD 4OZFH 4N0CC 2UWEA 1MCHA 1I9EA 4JY6B 2YN3A 4DKEH 4PV8B 5I71C 3PV6B 1EZVY 4NN7B 2DYPB 4TNVF 3RWGB 4NBZB 4JG0H 3U0WL 1AI1H 2ZPKL 4NUGH 1IM3B 1BIIA 4KKCD 2NY1C 3RZCD 1YMMB 3HAEH 3MLVH 3GM8A 5HPOA 5BJTA 1NBVH 4OZGF 2EDXA