3A6CL

Crystal structure of hyhel-10 fv mutant ln92d complexed with hen egg white lysozyme
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSDSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 25
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6cL00
2AXGB 2H1PH 3BUTA 4MJIA 1PY9A 4EIZC 5DVLA 3ULVE 4PRAB 3NZHL 3WHE0 4JFZL 5BS0D 4C59B 3WNLA 3I02A 3FQRA 2X9XA 4JO3H 3MPCA 5CLTA 1A21A 4PJCB 2MMXA 4QHUA 3T2NL 2AI0L 2WP3T 1LO3L 3NPSB 4JQXC 5INCA 4HZAA 3VJ6A 3MUJA 5FDWB 4LAQL 3KG5A 3MLTB 5JOPE 1ZTXH 4POZC 4JM2A 5D96B 3PL6B 4KKAD 4Q58C 3T0DA 5FO9B 1XIWB 4P4RA 1JYVA 1L4IA 4MCYA 3C5SB 1IARB 4WO4B 1SM3H 2E9IA 5J1AB 3WDHA 1WFNA 1WSST 2ICWB 4D0BA 3OB0K 5LJYH 2NY0C 3CLEH 1T20A 1IEAB 3PF2A 2YRZA 5IBLD 4LPCA 4UNTA 3S34L 1PFCA 4JQIH 5C8JB 2HKFH 3MLRL 2EDOA 2OM5A 4P4KA 4JANA 4M5YH 2OMBA 3S97C 4JZNB 5LAXB 2DBJA 1M7DA 4WEBL 3FZUD 3ROOA 3ZKNC 1X5HA 1JRHL 2CIKB 4QTHB 4OV5A 5DHYA 1ADQA 5KSAA 1RZ8B 1G7JB 1UEMA 4AENB 2MHAB 5HGBB 2Z92B 4GMTH 3S7GA 2NY5H 3GSRA 2B4CL 1D9KA 2VAAA 2NX5E 2Z91A 3JV0A 4YHIA 4MD4A 4Q9RH 3U6RA 3WLBA 2PR4L 4DZ8B 1GGUA 2RR3A 3MYJB 5F9WB 1Q9LB 4FZ8L 1MAJA 5FYKD 4GRWH 3QDMA 4UZGA 3HC3L 2FO4A 1MFAL 3DBXB 3WKMH 5CGYC 2HLAA 4Y16B 3B5HA 3O2VL 4X4YB 3NZ8B 4V1DE 5IB3B 2VLKE 5A2KH 2A1WH 3ZKMC 5DC4B 3VFOA 3EFDH 4C55A 1CXFA 5T1MB 3UYOD 5IJVB 4WY7H 3PGDA 1OTTD 1EGJL 1KCUL 1Q72H 4X4XB 3BJ91 4NT6A 5IVXB 3QRGL 3IFNH 4F37F 1DE4B 1UM6H 5HHNB 3QIUA 3WIIH 5BOPA 2J3SA 5GGSB 3RP1A 1JWSB 1IEBA 3DGCR 4H20L 3AY4A 4HK0B 2YEZB 4N0UE 4Q9CA 4XMPH 4F9LA 1NCBL 1J0YA 2OBGA 2VSDA 1MCWW 4JN1H 1GJIA 4KQ4H 4QOKB 4TSAL 3D25B 3GMPB 4ZOBA 4C57C 4GQ9L 2H6PB 5DQDL 2H8PB 1FO0H 4I0PB 4ZDHB 1L7TL 3DURA 2WK2A 3LQZB 4HPOL 4M3KB 2OSLB 3QJFB 3ZKQD 3KJ4B 4YIQA 1JV5B 1DDHB 5ENWA 2JJSA 2F53A 5BZDB 2E7CA 3TO4B 5T5NF 4HDIA 1MF2H 2CRYA 3MV7B 5FGBC 4HQQH 4OI8A 3K74B 1JL8A 3QCTL 3QRFM 2DI8A 3DNKA 3FT4A 4LEOA 4M4RA 4FQIH 5HYJA 1RFDL 5LWYL 4OCRH 4PBXA 5HI3C 3RVVC 3VFVB 5MEND 4FXKB 3VWJA 3U2SB 1J5OL 3IDIB 4R4ND 5E8EA 2ED9A 5D96C 3PL6C 2X1PA 2QADB 3GI9L 4JJ5A 1R3LB 3O0RL 3UPRB 4Z95H 3CH1A 4GKZB 1XIWC 2ZP0T 1CXEA 5CLWA 2Y4SA 3KLHC 4MA8H 4BZ2L 4WO4C 3MGAA 1NCUA 5C0CA 5C0GB 4LCCA 3O3DB 5JW4R 4PG9A 2G5BA 3LEYH 1A6PA 5C0BB 4LFHD 4GAGL 4NBXB 3X14B 2NY7H 5I1KL 3WN5A 3KPRE 1FYTB 3MBED 1L7IH 4ZPVA 1A0QH 4QRPB 3ARYA 1A1MA 2ZUXA 1TZHA 1KC5L 1J1PL 3VFGH 3MJ7B 5EU7E 4YHMH 3K0WA 4L29A 3NVQA 5DMGC 1LO0H 4PRNA 2I07A 5I8EA 3VWKD 4X6CF 1R5VB 1A7NH 1RUMH 5F9WC 1H3TA 4YDIH 1T21A 4FP8L 5IKCA 1AQDA 1IZKA 4Y16C 5J6HA 4M62H 1SYVB 4OFYD 3TGXA 3U0PB 1KLGA 1GPOL 3C60B 1S7WA 1N5AA 2DLEA 4NO2B 1BEYL 4L8CA 4RNRA 1SY6A 5ELIA 2MPAH 4JGMA 3CCHB 4JHAH 4NRZB 2QBWA 4U1MB 1YMHB 3MUY1 5E08L 3BKCH 5GS0H 3M8OH 1NH6A 5GGTH 4PV8A 3UTPD 2BSSA 1DQMH 3QDJD 5MEPB 4DKAA 5D7KE 3Q5TA 2R0LH 4JFDA 3MRGB 4CW1A 4X6DF 2DYPA 1J10A 3QQ4B 4O2FA 1EA9C 3MLYL 4PJFA 1ZAGA 4Z7VE 4LHUD 5EO9B 1K9TA 4CAGA 1UXWA 1S9XB 3SQBA 5IG7B 3MFGB 4L4TE 3A6CL 2HTLD 4NRXA 1F11B 5F1NA 1EEZA 3HAEG 1RUAH 3V7AG 1R24A 3IB4A 3QG7L 4UTAH 3I75A 3IU4L 1FFRA 3UDWA 4XP6L 3AGVA 2Y5TA 4PJ9D 4M61A 4I0PC 4TUOA 4YBLB 1MREL 4PJCF 3DXAB 4XVUD 4TQEH 1ACYH 3KJ4C 1KUMA 5BZWA 4JRYE 2EDLA 3FO1B 4XC1L 1ZLSL 2AJUL 1G7IB 2G75B 3TO4C 1N2RB 2P8LB 4GXUN 2UVFA 6CGTA 4KZEL 4L4VE 1KBGL 4HLZH 3O3BB 4E41D 3EOTH 4GRWB 5E0QA 2EYTA 3PQYA 1YEKL 2P44B 2YUVA 3Q6GH 4XH2B 5J9PB 1HHKA 4OQTA 4BSWA 2YK1H 4L9LA 1I3RB 5C08A 4LRNL 2QADC 4U6TA 5INDA 1UWXK 3ZYOA 3OBAA 3W9DB 4QYOB 2HLFD 4M43L 1SJEB 2P8PA 3GHEH 5TDNB 1I8IB 3RWFA 1W8OA 1CFVH 1X6NA 1RHHA 3H42L 1S7QA 2VZUA 2O5YH 4YUEL 3L95B 3QIWD 4PTTA 2AS5M 4I4WA 1SYSB 1WBZA 5BV7L 1JNHB 5IUSA 1QRNA 3LKRB 1IM3A 1T6VN 3OHXB 1T1ZB 3IKKA 2AEQH 1I7TB 1KTLB 5BW7A 3T0VA 2QSCL 3RNKA 1QBAA 4JO4L 1LDPL 3CU7A 2I24N 4M6ML 4DAGH 3PDDA 2I60L 2A0LD 3OKLA 3QH3A 4FFVC 4K3JL 4L8DA 1WIPA 3QT2A 3VD4A 1EH9A 5FF6A 3O6FB 2VXVH 3C2SA 1QEWB 2BHUA 4XBEH 3VRIA 2OZ4L 3S35H 1FO0B 4CJ1A 4NFBA 5KANI 1D5XA 4H1LH 5F6HJ 2BFVH 3HE6B 2G5RA 4HLZG 5FUCC 1RZFL 1NGQL 3PWPE 1ITCA 3SKMA 5IVXF 1GVIA 1CI5A 1LNUA 3WIFA 1NAKH 5TE4L 4IRJC 1LWRA 4UV7H 4ZFGL 4RGNB 1EFXD 3WNNA 4HKZA 4RWYH 3MACL 4HZLA 4Y19E 1CQKA 2WIMA 2EH7H 4JE4B 3D48R 2WIIA 2ZSVB 1U8OB 4AIOA 2VDLH 1QSFB 2WBJD 4KXZH 1PEZA 2HRPL 3HB3D 4U6XA 3H9SE 5KVFH 4BQ9A 1QLFB 4RMSA 4ZD3H 3NH7H 2RJMA 4IRSB 5L7XH 4XAWL 1QLEH 1T5XB 4IHOB 1GAFL 1LHZA 1P7KB 2AAVA 4OGXH 3FO2A 1KJ3L 2KPNA 2OI9B 2C7UB 2WINB 5FUZL 5SWSA 3VDCA 1ZA3A 1QFWL 2MCG1 2UY7A 3QFJA 4MNGE 4P2YA 3PG2A 2ARJB 1HKLL 2UZIH 4KKCC 1DLFL 4OIBA 3KPSB 5MI0B 4DQOH 5F3HA 4Y4FA 3PV6B 4K2UH 2YZ8A 3AM8C 4GG8B 4E0RB 4C4KO 2JLLA 2Z4QB 5EU3A 2G9HA 4J8RA 1DVFC 2XXMB 3GSUB 4GW5A 4NQSA 1OVZA 2YC1B 4RMQA 2O5XL 1F58L 2WWMD 3VFMB 3MV8D 1SMAA 2R4SH 3BYYA 4MAYB 3S96B 1MI5A 1N0LA 1EPFA 3BHBB 2KDGA 3QNZB 2B1HL 3ARQA 4J4PD 3RIFK 5T33L 1E6OL 3LKSB 1K3ZA 1A7OH 3OX8B 4GW4A 5CEZL 1AGCA 2W60B 3VRJB 1I8LA 3WXWH 3WIHA 3T3PE 1H5BA 3EDKA 3FB5B 2GI7A 2YPLB 5FYKH 4H8WL 5D2LA 1AO7D 2NLJA 1BVLB 5IOPA 4EZMA 4TNWK 4KDVA 1JHKL 2GUOB 1NPUA 4HPYH 1F4WL 2HH0L 4OCYH 3LV3B 3TVMD 4BH8A 4M8QA 3KXFE 5I1JH 4ODHH 3A67H 4JDTH 4BSJA 2P8MB 4NQDB 5SX4H 1NGYA 1EO8L 3RZCD 1DL7H 5HGDA 3DHJA 3H2WA 5D7SH 4YBQD 4R0LC 4WUUA 5MHSD 3TBVB 2CGRH 2DM7A 5CFHA 3RIFF 3NZHH 5B38A 4JFZH 4WI2A 3O6FC 4P46A 2DTML 4LNRB 4C83B 3F7YB 4Q9BA 3RY5A 1BF8A 2X89A 5HI5C 1M05A 2PW2B 3T2NH 2AI0H 3HE6C 1LO3H 1H3PL 4LAQH 4KQ3L 1FE8L 1ETZA 4X8JA 3I3DA 1E4WL 4TNWF 2JKXA 3TT3H 2AV7A 2CDEA 1GZPB 5GGRB 2B7DT 3I6GA 4FABL 1ZEAL 4X6EA 3NN8B 2QEJA 5D5ME 3PWVA 5EC1B 1BQHA 3ORJA 2PCPB 1MHCA 3BWUC 1ES0A 3BXNA 1T6WA 4FG6C 2GTWB 4OF7A 5DLML 3QDGD 5DQJA 2X4SB 5CJXA 5DJYA 1G7MA 4NZUH 3S34H 2WWKO 2XTJB 3FT3B 4D8PB 1KIQB 3CUPA 4O9HL 3MLRH 3STLA 4C56E 1LILA 2DJSA 2Q76B 3ARZA 1E28A 1XF4B 2FEDD 2CUHA 5IVZA 4WEBH 1JRHH 2OI9C 4NNXB 4KKLC 3RU8H 1WTLA 4PJDA 5E9DA 4ZOAA 4LGRB 4CN4A 4GRLD 1FCGA 2B4CH 4CVWA 5CEZD 5MI0C 1HQRB 1HWHB 1A9BA 3BMWA 1D5BB 1XR9B 2PR4H 4JO1H 1GIGL 4UOJA 2VZVA 4G42B 4B7IA 3VXSA 3RFZC 4FZ8H 5EZLB 5DA4A 5CZKA 1T1YA 4X7SL 2FJFB 3O4OC 4GRWF 1MFAH 1HNFA 3O2VH 2AP2A 1PYWB 4KU1A 1ZV5A 1I9EA 4HKBB 4P2QA 4V2CB 1XR8A 3J8F7 5SV4A 4UMGA 1FV1B 1TITA 2GJZA 1C5BH 1K5NB 3VA2C 3LKOB 5D93B 1EGJH 1KCUH 2F54A 1NBYA 4J23A 4X99B 3BD4A 4H1LB 5MEOA 4WUKL 3FQUA 4NZTL 3DUSA 1ZS8B 4EBQL 3QFDA 2I5YL 2DMKA 3P4OA 1IM9B 1RK0A 2AK4B 5C1MB 3HFMH 4Z7OF 3ULUE 1G7LB 2HKHH 4MXVE 3UTZA 1T2QL 4E42A 4FMKA 2OR8A 4MJ6B 4QRUA 3SE4A 1CTNA 4H20H 2B5IC 2PW1A 2ZOLB 4N90D 5D7LE 3MRFA 5GS0C 3U7YL 4D0CB 5FA3A 5BRZA 1NCBH 4DFIA 4MD0A 3CFDB 5I71C 3VD3A 4TSAH 1U8MA 3DUHA 5JW4N 2R1XB 1NDGA 5BS0B 2W38A 5I30L 5DQDH 1I9RL 3QULB 1L7TH 3GBNL 2D4FA 3UTTD 1DUZA 5AG9A 1CT8A 2AXFB 2BVPA 1S7SB 4RCAA 1HQ4B 4LGSB 5D1ZA 1YQ2A 1CICC 4WU7B 3D69B 5LKNA 3P2TA 4HIHB 3MRIA 2N4IA 3GMOB 2Y07L 5DEGB 5L0QC 3I6KB 4PGDB 2NW3A 1X7QB 4NO5B 2A9NH 1KEGL 4OSUL 4QNPE 1RFDH 2VH5L 4K7FA 4EI5A 1MCNA 2OTPA 2YSSA 5LWYH 1S9WA 4QWWC 2JB6B 3CC5A 2I9TA 1J5OH 5IM7A 4LF3B 3U79A 4U1HA 3I3EA 3P4NB 1TPXB 3IGAA 2R2EB 3GI9H 3O0RH 5TJWK 3MCLL 2IBZY 1K85A 1NCCL 2GJJA 5A3IC 5H37H 5TDPA 3MRRB 3FQWA 4TRPL 4M4PA 4RDQG 1JE6A 1EIBA 1I9JL 1LO4L 4UUJA 5IBTL 4GAGH 4P9ML 2XTJC 4PLKD 3G5XA 2EE2A 2ILLA 2P5EE 3P0VL 5EBWB 3PE9A 2QQNL 4NQEE 1KC5H 2P49B 3LVEA 2VC2L 2BOCA 5F97E 5HY9A 4PB9L 4I1NB 2OR7A 1U3HC 1YEJH 1REIA 3PNWA 2CO7B 2BVOA 1DLHB 3BUYA 1N59B 4NSKA 1K8IB 3PWLA 5F7EL 1KJ2A 4KUCF 4NQCD 4F3FB 4JGUA 4ZO7A 3IYLW 3H7BA 4FP8H 1YMME 2IH3A 1XAUA 3ES6A 1FC1A 1BEYH 4U31A 3GMRA 3BQUD 2IPTL 3B4NA 3RL1A 5DR5L 2P5WE 2DQCL 3U36B 3D0LB 1JTOA 2W91A 2VZSA 3ZO0A 5E08H 1UVQB 5IV2B 1QVOA 2W9EL 4XP1L 4IMLB 3BZ4A 5SWZD 4NKDA 3QCVL 3M17A 4WNQA 3WNKA 3FB8B 1UCTA 2GJ6D 3HZYB 3MLYH 1BHGA 2BERA 2JCCB 4HJJH 3V52L 5ETUA 3MRQB 4G6FD 3ZE0E 2QJDA 1S78C 4PJIB 5AZEL 4N0CD 4X0KB 1N6UA 1W72L 1RJZA 4LKXA 3QG7H 3IU4H 2A6JB 5E94A 4XP6H 1FPTL 3QXUA 1A4KA 2COQA 2ZG3A 1MREH 3D3VD 1BX2A 5I66B 3BGMA 2Q3AA 3IJSB 3RTQA 1L0QA 5CIPB 4P23D 3SPVB 4Q97A 2F5AL 1NC4D 3AREB 4XC1H 3MLUL 1ZT7A 5ILTL 1U8LA 4R26L 3WKNA 4KZEH 3MRCB 1IGTB 1KBGH 5GSVA 1RJYA 1OSZB 1XCTB 3S4SB 1YEKH 2YS4A 4PG2C 3CVIH 4W4OA 3VI3F 4YFLI 3O6KL 4XP5L 3RWHA 4JVUA 4LRNH 1TPXC 3S5LA 2J2ZA 1OP3H 1OAZL 4OZHE 4JLRA 4Z7WA 1KCKA 2HVKB 1QO3A 3MBEB 4ALAL 3EO0B 1LD9A 1FFOA 4P49A 3FZUC 4B0MM 1KNOA 4TOYL 2C26A 4HBCL 4EI6A 2DLTA 4MNQA 1MLBA 4YUEH 1EUUA 3HNTL 1WZ1L 4XPAL 2QQLL 1MH5A 1X6LA 3T4AA 5BV7H 1KPUB 1TETH 1ZLUK 3VWKB 4YFEA 3BIKB 3FO9A 3LDBB 4O2EA 1T7XA 3MA7A 2W9LA 5AZ2H 2QSCH 3IAQA 4JO4H 1LDPH 3EW3B 3I84A 4YDVB 3DX8B 3W0WE 4M6MH 2RB8A 2BRRL 4WWKD 4YHLL 3I02B 4OI9A 3EOBA 4F58H 3MLPA 5C09E 2OZ4H 3BO8B 5DK0A 1OLLA 3MRDB 4XCFL 3ALPA 1RZFH 1KGCD 3OZ9L 3FB6B 1VERA 1A64A 4DCQA 4GG6E 3QDJB 3VJ6B 1CGTA 3BN9D 4KK5C 4YHNB 5TE4H 3MRKB 4ZO6A 15C8L 3MREA 4ZFGH 1QFWM 4P4RB 4BA8A 4LHUB 5F9JB 4OFVA 3MACH 4IDJL 1NCDL 3IXAB 4IS6A 3GUTA 4MHHI 2PYFA 5I0DA 1FJ1A 3LPFA 3WFBL 3K2UL 4HEPG 2HRPH 4NQVA 4MCZA 1CBVL 4CU8A 3HC0B 4JRXE 5FIEA 3DUUA 4JDVB 4K94L 4PJ9B 2RHEA 1GAFH 2YWYA 3EZJB 1KJ3H 2PETA 4LSRH 5FUZH 1JNLL 4D9LL 1QFWH 4LOUD 3VXTA 3FAXA 4TYUA 4JZJA 3HI5H 1F00I 5GZOD 1HKLH 1GOHA 2VL4A 1NJ9A 2CRZA 1DLFH 1IC1A 2D7NA 2RAMA 1BFSA 1MNUL 4G6KL 2Z91B 4OCNC 5DUBB 2PO6D 1P4IH 4U1LB 3RDTB 1L6XA 1B4RA 4QT5A 1PZ5B 1S7XA 1ZLVH 1G6RH 2H3NA 5E7BA 2XZAH 4R4NC 5GGUA 1JYXA 4OT1L 3AREC 1JPFA 1F58H 1VDGA 1UCBL 2OLDA 3VFOB 2F15A 2N7BA 1LGVA 4Q7DA 1KPRA 3SBWC 5KS9E 1AY1L 4AK1A 3BW9B 2CK0L 1E6OH 2W0FA 4DWHA 5GRVK 2N56A 5ALBL 3ZE1E 1KENL 3FCTB 2R23A 5CEZH 4MQ7A 25C8L 1RVFL 5DMIL 1JTTA 4YZFF 3ARDA 2WQ8A 4XCYB 4EDXA 3V6OA 4PP2A 3W2DH 3C2AL 3ZKXB 4H8WH 3KYNA 4HS6B 3FKUS 2Z31D 3DVNA 5C0AE 5E1AB 4WW1B 1G1CA 3JWDL 4OF5A 1JHKH 1LK2B 5DFVD 1PJ9A 1QSEE 1F4WH 2HH0H 5DD1H 2AQ2A 1U93B 2FSEB 2KQMA 4L3CB 5DJ0B 1EO8H 1FVEB 3O8XD 1UB5B 1WVZA 1QFHA 4OUUB 4HMCA 1KXTB 2G60L 1KULA 2R2HA 4MX7A 1FVCB 3CDGB 3QUMH 1CD8A 5ENWB 2F53B 5FOJA 2V9TA 4G8GE 3N1GC 1RSFA 1UH4A 2DTMH 1CDHA 2XT1B 2OL3L 4ZYKA 3FT4B 5MENA 3MODL 1SEBA 2HFGL 1H3PH 1HHJA 1OAQL 2F74A 2X4RA 2WBJB 5E8EB 3BPCA 5FM5O 3OKMA 2IALA 1QD0A 3QXTA 2V2TB 1TJHL 12E8H 2CXGA 2NY3D 3TYFA 4JJ5B 1X5AA 1ZEAH 2ERJB 5KOMC 2D31A 2JCCF 3V7MA 4LSVL 1EV2E 3UO1L 4KRMB 3JV4B 1VFOA 4PJIF 1NDMB 2FIRT 4PG9B 3OJDB 2G5BB 5L2KD 1S9VA 1QKZH 1HXYA 4U2YA 5F9OL 2YD9A 5HHOA 4G9FD 4D2NA 1J12A 5DRNB 3H8NA 3T2QA 4CMMB 1CFBA 1CFQA 2BX5A 5IBUG 3U4AA 4JHBA 4RISL 4HH9A 4LCWA 4YXKL 5JQHC 3TT1L 2APBA 4O4YL 4QHMA 1IC4L 4Y5VB 1L9NA 1GIGH 5E8PA 4I9WD 3MV8B 5I8EB 4ETQA 3D0VA 3G5YB 1T7VA 3VI4F 2AABL 4X7SH 3RDTC 3SY0A 4AYFA 4JKPL 1VHPA 3HNSL 4NJ9L 1A6AB 5DJZA 1NSNL 3IAPA 4HUUB 1R5WA 3LN9A 5I16A 2DN7A 1TZGH 4HWBA 5D2NA 5FEBA 3H9HB 3MLZL 2R56H 4KK8C 1DANU 1AO7B 4WUKH 3BZFA 4EBQH 4KJWC 4XRCA 5IROC 3QEQE 1VFUA 3UJJL 2MKLC 1MWAL 2E9WA 3EFFA 3QWRA 5EIVA 4GFTB 3TVMB 1EAPA 1T2QH 4I3SL 4JFYA 2VXUL 2APTA 2EICA 3GBML 4PJFB 3LB6C 4LP4A 5D70L 3QAZC 3ZKXC 2J8UA 4LCYB 3AY4C 2A77H 3CSYB 4NDMB 4RDQF 4Z78A 43C9B 2KQNA 2E5EA 4ZNCD 3FOMB 4ZQKB 4AIZB 2BNRA 1R24B 2A0LC 4RGMB 3IETB 5I30H 1W0WA 3I75B 3KNBA 1I75A 3ESUF 1I9RH 3LOWA 4P9HC 1YN6B 3GBNH 1KB5L 4WENB 3BAEL 1BPVA 4U6YA 4DK3A 5CS7A 2QTEA 2XV6B 3WE6B 1S9KC 4PJ7E 5EOCH 1TQCC 2JJSC 3ZT6A 1XF3B 2Y07H 4X4MA 5E2VH 4GS7B 3BD5A 2DOCA 4EIGB 1KEGH 3RWEA 4OSUH 1SJXA 3RA7H 5IIEB 1C5CL 5DUML 2IH1B 1G7QA 3CDYA 3F5WB 1QBLL 4LLUB 3V0VA 4R8WL 3QDGB 1ZHNB 3V8CA 1G6RB 2V7HA 3VXRA 3GGWA 3QNYA 4L9LB 5JDJA 4HJ0D 5HHQA 5F1SA 3OPZL 3V0WL 2ERJC 1NCCH 1B4JL 4OZGB 4WI3A 1MCIA 2ZCHL 4JFXA 4PJGE 4G8IA 4TRPH 1INEL 3THML 1LEIA 4LCCC 4S11A 1I9JH 3E3QC 1LO4H 5IBTH 1RHHB 1IL1B 2V5YA 4P9MH 5DO2D 5IQ7H 2P47B 4H25A 1F3RB 4FQPA 4MMZC 3SDAA 1AR1C 5B38G 3G04A 4DKFH 3WN5C 3GM0A 4WHCA 3P0VH 5C70A 4ELKA 1IM3B 3EJJX 4KPHL 1UWGL 3RVUC 1P4LB 2QQNH 5IK3B 1BF2A 2VC2H 4PJ5E 3Q0HA 4PB9H 5I8KL 2XN9E 1I3UA 1J11A 2R0ZH 4L8DB 4NRYB 4AJ0A 4GJTB 5ADPL 4NQXA 1R0AL 4Y5VC 1ZA6A 3VG9C 4LQFL 5T1KD 3REVB 3GJFH 5IBUB 1BQHG 1GHFL 3DO7A 2QHRL 3SKMB 3TJHD 3T1WA 4N8VA 4ELME 5HYSA 3TIEB 3RGVD 5EZOL 1S8DB 3MLSL 5IHUL 3N1PC 3QUMB 2NZ9D 4O2CB 2CDFB 5DR5H 2DQCH 3SO3B 1H0DB 1J0JA 2LFGA 1YNKL 4ZUSB 2NY4D 1MEXL 1H9VA 5EWIH 2W9EH 4XP1H 4Z7NE 4M9PA 1WT5A 3QCVH 3WFCL 2NY1D 2AW2A 5E6YA 1J1XL 2B2XL 3PV7A 5KN5A 2ZUSA 3HTLX 3OKKB 5EBLA 4G6ML 2FEEL 3DLQR 3V52H 3MFFA 4P2RE 2DLHA 2AQ3A 1HDMA 2GK0B 5AZEH 3B5TA 4FS0A 2HG5A 3FRPG 4YBQC 1W72H 1OP3K 1QFPA 5K59F 4KK9D 4RGMC 4PRHB 4ODUB 5EO1A 3UDWC 5HHXL 4BFBD 2AJZB 1CIDA 2GKIA 2NX5A 1NLDL 2G9HB 4JGJA 3V6BR 1RZIA 2V2WB 1NL0L 2H26B 1A2YB 5DQ9A 2F5AH 4NQSB 4OGAD 3MLUH 1LEGA 5ILTH 4R26H 1MLCA 5E2TL 1BOGB 4HD9A 1C1EL 1P7QD 1GGIL 1XF5A 4PLJD 3VFWB 2OQJA 2VUOA 4M6NL 1ZLWH 2BSTA 2J5LB 5I17A 1KLFA 1RIUL 2LVEA 1FG9C 3C87A 4GAFB 4U6HA 4GKNA 3O6KH 1JUFB 3G6AB 4XP5H 2K7PA 5H94A 4M00A 4L9LC 1Q9OA 2DBLL 2FIKB 4LVOB 1AGCB 2JB5L 3L7FA 4W4NA 1CDCA 4UQ2B 4M8VA 1VCAA 2PN5A 3F62A 4ALAH 5JR1L 5CWSA 2NLJB 1FSKB 3KLAB 2VDNL 1HILB 1ERNA 1IQDB 4TOYH 4YXLL 2FHFA 4HBCH 3DMMD 4N0UA 1WZ1H 2JK5A 5IF0B 4XPAH 4NIKB 2VQUA 4M8QB 2AJYL 4OFKA 2OMNA 4M7LL 3ULVL 4YHOL 3H0TB 1WF5A 1S7TA 1NGYB 1BQLH 5IMOB 1JYNA 2E7LA 3SKNA 4F7PA 4NQCB 4MDIA 4Z7UA 5BW7C 3D39D 3QDAA 1BFVL 2BRRH 1U2CA 3HCVB 4LEXL 4MDJA 4ENED 5HVGB 5D1QA 1OY3B 3BQUB 5HHMD 5I18L 5C2UB 3TNMA 3FQNB 2DM2A 5DJ2B 4XCFH 5CAYB 4FFZL 5SWZB 3S3SA 4X9GA 3DSFL 4PJFF 3SO3C 3MR9B 3PWVB 2XKUA 4IDJH 1NCDH 4QHLA 3T4YB 1FFQA 4LSPL 3HLAA 1ZLVK 5E5UB 3LSOA 1F4XL 5DQJB 5FGCE 1AGBB 4ZFOL 3QXDA 5MP6H 1MCCA 3VFSB 5DJYB 1CBVH 4KRPD 3KGRA 5MERA 3MRNA 1MHHB 4XMLL 1D5ZA 4RQQA 3IAGC 4K94H 1F6AB 1D6VL 3KPRA 5T1LA 1JNLH 4D9LH 3BKYL 4NOBA 2P45B 1QQDB 3Q5OA 2VXTL 4P23B 3N1MC 4U6VL 1U6AH 5JDSB 1NC4B 1XMWA 1G9EA 4TUJA 4M1DL 1MNUH 3SDXE 1KACB 4G6KH 4MA1B 4ODSH 1FAKT 4Y4FC 3T2OA 1FNLA 4JG0L 5CJ5A 1WBXA 2ZPKL 3BVNB 5EOQL 4HXAL 4V2BA 1FGVH 2VLJE 3NA9L 1WWWX 1NCTA 2H41A 1DQDH 5HTSA 4OT1H 1MJ7L 1UCBH 5ICXB 1MCHA 3TWCL 1WEJL 3ULVD 3WFHA 2XQBL 4OZGF 5E00B 4I18B 1AY1H 1CQYA 4Y89A 5MEOB 3HPLB 3P9MB 3GJFB 4H5SB 3DUSB 4LSTL 2J5LC 2CK0H 5B4MD 4PY8J 5HVHB 4AQOA 1IGYB 1YN7B 3QG6B 4MVBC 3SGEH 3P4OB 1KENH 1UGNA 5CUSL 2EDJA 25C8H 1FNAA 5JOPD 4LVOC 4MMXC 2VLLA 4E42B 5ACMA 1I8LC 1OWWA 2FX7L 4QRUB 2ZCKL 5F7FA 2IG2H 1TXKA 1JGLL 4ZSOB 3O9WD 3TYGL 4Z7VA 4X5WB 3MRFB 1MCOL 1VSCA 4MD5B 4LK4A 5LVEA 1NEUA 3RWDB 4NC1C 4K8RL 5BRZB 3JWDH 4Y4KA 1KLUA 4L4TA 5I1LA 5CEYB 3ULSB 3TPUA 1IVLA 5F70A 4A6YL 1OQXA 3VG0L 4G7VH 1B9ZA 4OKVA 3HS0A 1NFDA 2BVPB 1JK8A 4HWZB 3SCMD 5E1HB 5EPMA 3ZHKA 2G60H 4HGKC 4Z77B 5HI4D 4BH7A 4Y88A 3F7QA 5E6ZA 1W72B 2QQQA 3QUZD 4GAYB 5KJRL 4NNYB 3IF1B 1NMBL 1YDPA 2MKWA 3N85L 3MGOA 1T0NA 4X9BA 2VJXA 3S5LG 2NW3B 2CUIA 2XWTB 2OL3H 4JFEA 2A74A 4KJYA 5D4QA 3N1QC 4EI5B 2YSSB 2HFGH 1OAQH 1S9WB 2HTKD 1M7IA 1GOGA 1F4HA 3T3ME 3DTXA 3D2UD 3ARBD 3TA3D 1TJHH 3IGAB 4JY4A 4PV9B 4V1DD 4K3EL 2Q8AL 1AIFA 2VLKD 4LSVH 3UO1H 4JFQB 4WU5A 4XBGA 1F97A 3FQWB 3H9YA 3RI5K 5D71L 3G6DL 1G9NL 2JELL 5FFLA 4WTZG 3QPQC 5CJXC 5JIHA 1XH3A 4PLOB 3X12B 5F9OH 5JW4Q 5F1IB 3AU1B 4R7DA 1K2DB 4S0SD 2PO6B 1FL3B 3EGSA 1FFNA 1VFAB 3VGBA 3NA4A 3BESR 4CADA 4J3SA 3UZQA 5T3ZE 1T7YA 4LSUL 4RISH 5DYOB 4YXKH 3V4PL 4JPVL 2E8ZA 4P23C 3TT1H 4HJGB 3DRQA 1EBAA 3V9FA 1IC4H 2BVOB 5GISL 4F7CA 3ZE2F 3BUYB 3DYOA 1M7XA 3PWLB 2AABH 1J0ZA 4R97B 4JKPH 3C6LA 4OM1H 1CE6A 2GFBA 1IGCL 5E4EB 1AC0A 4K8RD 2EIBA 3RI5F 2ENSA 1NBQA 2XNAB 4OIIL 1FN4A 5A43C 2R1YB 3OG6B 3BKJL 2VE6B 3RL1B 1IQWL 3MLZH 4WI9A 1DR9A 1S7VB 5B8CA 1C12B 4Y8DC 1NBVH 4Q0XH 3CFBA 4I18C 1BFTA 3O81A 1CGVA 3QDME 4ZS6C 2VABA 3MJGX 2CMRL 5T3XH 4IIQB 1NC2A 4HKJB 3HI1A 4WNQB 3UJJH 4P5MA 5DD5L 1BIIA 4EN3A 2UWEB 4OLYL 5D6DA 4X6BA 5DRWA 3GBMH 1J8HE 3H9SA 4PGBA 5D70H 3B8YA 3SE4C 1E4XL 3NCBB 1J87A 3TBSA 4AM0B 2DI9A 3DX7A 4N5EC 1BZ7A 4PRIE 1UKTA 4D0DA 5BVJB 4ZNEE 1KJVB 3EYQD 4MNGA 1MQ8A 1UA6H 4AT6B 4HIEA 5E94B 4NGHH 5DJ8A 5BJTA 1KB5H 3BAEH 2CIIB 3BH8B 4XVSH 4F2MB 1HYSC 2DQIL 5JW3L 3MNZA 5AAWA 3BGMB 1DBAL 3IU3A 5D1ZC 1KIRA 4G80A 4JAMB 4LPUA 3PDOB 5KG9A 2NY3B 4EUPA 1U8LB 1HNGA 4WHTA 3FRUB 2R2BB 1ZHLA 3NCYS 1C5CH 5DUMH 1C08A 4CNIA 4EI5C 4NZJA 2EECA 1QBLH 2ATKA 2UUDH 4R8WH 1U36A 3BRFA 3KLDA 5L2KB 3SGKA 4OZ4B 3LQAH 3VXMA 3X17A 2XKNB 3RWHB 2EC9T 4Y5YA 3OPZH 3V0WH 1EEYB 4G9FB 3MV9D 2YA2A 4M48L 3QHFL 3GJFK 3BP6B 1B4JH 4EXPX 3TJEL 1B0WA 2ADFL 4ZAKA 2EEAA 3W11C 5HYJE 1LD9B 1FFOB 2AKRA 3MJ8A 3D87B 4XHJC 1INEH 5F7DA 1YYML 4KY1H 4FQLL 4QF1B 3U4EA 1KCSL 4OD2A 4EI6B 2ATPB 4RFOL 4FQ1L 1RUQL 2JE8A 4X6CE 4RBPH 3TCLB 3I50L 4XNMA 4C58B 2FR4A 4ORGB 1OL0A 4ZUUA 4KPHH 3RZWA 1UWGH 4MQXC 4O2EB 2VLRD 5C0CE 1EK3A 2OJZL 3R1GL 3RNQB 3WS3A 5CBEA 1H15A 5GGSY 4ERSH 4FQXD 3FMGL 2XXCB 5J56B 1KOAA 5ADPH 1R0AH 5IVOA 1AD0A 5GS1A 4LQFH 5HHPA 3WD5L 4WI6A 5E2UL 1HEZB 3EYVA 1GHFH 3ARFD 4P48A 2QHRH 3MJ9H 4R97C 4OB5L 2OP4L 4QHNB 4ODXA 5E4EC 3MLSH 2NTFA 5KSUB 5JHDA 4Y2DD 3BP5A 4BZYA 3D18B 4Y5XB 3MREB 3RPIA 3V6FB 4JVWA 4MYWB 2F8OA 3ARXA 3H7LA 2OL3B 1KB9J 1YNKH 5TQ0L 3GUTB 3SOBL 1MEXH 2PYFB 5D5MA 2PTUA 4IIQC 3L5WB 1E4JA 2X1XR 1J1XH 3GMNA 2B2XH 4MCZB 4RZCA 3TCXA 4YDKL 4PJCE 3X3FL 4G6MH 5I73B 1BBJA 1ZLWK 3QO0A 3EUUA 4PREA 1JGDB 1OGAD 3SDDD 1XGTA 1FLRL 5EZJB 4I8DA 1FFPB 2CLRA 3TH2T 2BY3A 4R9HA 3QXAA 5CJQL 4JZJB 3AB0B 1I1AA 2VKXA 3GKWL 1DBKH 4GKSB 1NJ9B 3VH8B 1MJJA 1R3KA 4KI1A 2QHLA 3UJIH 1HH6A 1MJ8L 2YD8A 3ROLB 1INQA 1NLDH 2CH8A 3MXVL 3IXTB 1KIPA 3O2DL 1NL0H 4QT5B 3D9AL 3OJVC 1MHPL 1EXUA 4TVPE 5E56A 3RTQC 4FXGA 2YD5A 1F45A 4HHAB 2OTUB 5E2TH 3GJEB 2NY3C 1ZWIB 3W9EB 2IADA 3UTQB 2XG4A 5HDOA 3WLWD 1UACH 4ONGL 1I85A 1OOAA 3SKOA 1A6TB 1A6WL 1RIUH 5I8OL 2W0FB 3RWJB 1MUJA 4Z5RB 1WWAX 2GSGB 3V4UL 4K7PY 1I7UA 3C9NA 2R23B 4MQ7B 2JB5H 3WUWB 5DF0A 1QA9B 1AHWA 5JR1H 1IGIL 3RBGA 4NHUB 3FN9A 3GHBL 1IJ9A 1M6OB 2MQ0A 4ZFZA 3PQYE 4YXLH 2IJ0C 4WI7A 4QRRA 1SVZA 5F96L 3QI9D 4Y19D 3JTTB 5SWQA 5C08E 1VGKA 4OLVL 4NP4L 5ANME 2AJYH 4JY6A 3O8XA 2H9GA 3ULVH 4M7LH 5IEHB 1ZK9A 1MY7A 1H3WM 2UVEA 1CLOL 4HS8L 2W0LA 4YPGA 3P9WB 1CCZA 3E6HB 3RWIA 3L3JB 3EDJA 1XF1A 2ESVE 4F7MB 1BFVH 5B21A 2EDBA 2R2HB 3GSOA 4LEXH 1TVHB 4QXUL 2O93L 2QKIA 3T1FB 1RPQA 1T22B 4LPVA 1RJLA 1RZJL 3MNVA 3BPNC 3L3KB 1JHLL 5I18H 4U1IA 3VA6A 5JIKA 2NR6D 1ORSB 2H2PD 2Q7YA 1J05A 2NY4B 1II4E 4PJHB 4RX4D 4HIIB 1HXMB 2VRAA 5M95B 5FAAA 1QNZL 2Y25A 4YNYA 3B9VA 1AGFB 4ISVA 4X83A 2UWEF 4Y5XC 2C4FU 4Z76A 3QYCA 4P5TD 3EJYC 4LSPH 2IAND 3WHE1 2EDWA 2A83B 1F4XH 4ZPTA 1MIEL 3QISA 4XNXL 1U91B 3HR5A 3HZKA 4ZXBA 4HUXB 4AEHL 4XMLH 4KJQD 1O7SA 1OP9A 4Y1AB 5L2JA 2XRAL 5HHOB 3NGBB 2Y7QB 4IOFC 4JFPA 1OTSD 4PB0H 5I73C 2VO5A 1D6VH 2VDML 1BD2B 4LVEA 3BKYH 2P5EA 4PYGA 1U92A 1OLZA 2VXTH 4GLRH 4JZJC 4U6VH 4AEEA 3AB0C 4LCWB 4N8VG 5AG8A 5HYSG 4M1DH 1QYGL 4PJEB 1HSBB 4G6JL 2V2XA 5E8PB 1HCVA 4JG0H 3DV4A 3KXFD 3U0WL 1LO5A 2ZPKH 3FONA 3NACH 4WJ5A 3GMMA 5EOQH 4HXAH 1LP9E 4JFHE 1FNHA 3U4BL 1U58A 4OLZL 1MHEA 3NA9H 3QFJE 2X40A 4X7DC 4OF0A 4U7KA 3TFKD 5ICZB 1YC7A 4N1HB 4FHBD 4QRPE 5I16B 1A22B 1MJ7H 2C1PA 3TWCH 5JNYB 1WEJH 4HJ0C 2R9HC 3CIQA 2XQBH 4X6FB 1MCBA 1F6LL 1WUNT 4AMKH 4LSTH 3DROA 3GO1L 4CL7A 5CEXA 2HT3D 2Q86A 3DMMB 3MQIA 4XRCB 5F7UA 1I8MB 5CUSH 1WZKA 4GLRI 5EDXA 5DO2C 3OR7A 4UTBL 3EFFB 3MGTB 4I5BB 5I76A 3L3OB 2FX7H 3ARDC 3TBYA 3FFCA 2ZCKH 4QKXB 4WDIA 1EBPA 5ESVA 1JGLH 1MI5E 4WIQA 3TYGH 1Z6JT 3CJJA 4LLYB 4Z78B 4K8RH 4N0YL 1E0OB 3BISA 3KPOA 2ITCA 5F6IC 1X5XA 3F12A 4YE4L 2CO6B 2NQCA 1G0YR 3H3KA 4POZD 2D7PA 1W0WB 1CU4L 1NCWL 1F8TL 4A6YH 2ENYA 3AAZA 5KVDL 1W8NA 1S7RB 2VDQH 4MHHG 5M7QA 3MLXL 1HWGB 4C56D 3S8WA 5D2LE 1Q9WA 1ZXQA 3L3IB 3MRLB 1NMCC 4MSWB 4U6YB 4L8SA 4CU7A 4KTDL 3KYOA 4UQ3A 4G6AC 3RJDA 2H32A 3TJHC 5E03A 5EUKA 5FKAA 1EAJA 2A38A 1FNEB 2NY0D 2OR9L 1RAMA 1HOCA 1NMBH 4YJZL 4OFDA 5IR1A 2Y06L 5EUOB 2DQDL 1BM3L 1N3NA 3F58L 3KVQA 1G7QB 1EZVY 3ZKND 4WUUE 3CVHL 5DHVA 1X44A 4NWTL 1ZGLA 4PJXA 4MXQC 3GGWB 3ZDYF 1B6UA 4KRPB 4FTVD 4K3EH 2Q8AH 2FX9L 4EOWH 5FB8A 1S5IL 4OZHA 4PRPD 2IQAA 3MROA 4JFXB 4LKCA 4AEIL 2J8OA 5D71H 3G6DH 4YHPA 1G9NH 1MJUL 2JELH 2M8XA 4CN1A 1TNNA 1P5VA 1UH3A 2YXFA 3K1KC 1AXIB 3UJTL 1AXSA 1CD0A 4KK9C 3K2MC 3LQAC 3ARGA 3SDAB 3G04B 4BZ1L 4GRWE 3ZKMD 4H88L 3O3UN 4GKOA 4GOSA 5C6PB 3BPOB 5DGQA 1RIHL 3WL9B 1AGDA 1WBYA 1UWEH 1MWAA 3IDJA 1HHHA 4LSUH 3V4PH 5D7LD 4JPVH 3DV6B 1FZKA 4P3WA 2D2OA 5IB4A 5T1KA 3K4AA 4GMSL 4WCYL 2MQ3A 5GISH 1U8JB 4LLAA 2NW2B 3DETC 4PLJC 3RGVA 5ITFA 5C09A 4PJDE 3DO7B 1IGCH 5E9DE 3G08B 1WK0A 3E8UL 4U1KB 4ZS7L 3O41B 4XZUA 5ALCH 2PYED 5F8RC 3QUKA 4OIIH 3MOAL 3RX8A 3P4LA 3BKJH 1IQWH 5D2NC 4XMKL 1DBJL 2VZOA 3WXVH 2CJUH 1ZSDB 5IFHL 3O9WB 2D0HA 4PJBA 3HMXA 2CMRH 1QOKA 1YPZA 1V3KA 2D7OA 3VFRA 1KTKE 1A9EA 5E6ID 3QZWB 2AJVL 2YMXL 4QRQB 5DD5H 3ILPB 4F57L 4NYLA 4OLYH 4UAOB 1T2XA 5EU6D 1X3DA 4YDLB 4YXHL 2BC4B 1E4XH 5CJBA 3KHOA 2UUDK 4MB4A 2ADGB 4J1UB 1VACA 4PTUA 2BNQA 3FQTA 2I9LA 5GGRY 3BI9X 4RGNE 5HI3D 3RVVD 2CQVA 5EC2A 1U8IA 3QUZB 1DEEA 2CR6A 4KC3B 3PL6D 5B39A 1VFBA 2DWDA 5T1DL 1UZ6F 4YH6A 3RRQA 4N9GA 5IT2L 3RY6A 2NX5B 4LSSL 2DQIH 3VW3L 4U3CA 3KLHD 4YR6B 4PJHF 1DBAH 4WO4D 1VEPA 4NQED 3D2UB 1X5IA 3STBA 1P7QA 1LEGB 1P1ZB 5AYQA 1VADA 3OXSA 4V1DB 1HCFX 3OGCA 4R90L 5A16B 2VLKB 3VRLE 4KK6C 5IP4A 4NKMB 3L3GA 5BCAA 5FM5M 3WDIA 4M1CC 2X4QB 3UBXB 5KS9A 3HI6H 2B0SL 4XI5C 4U1NB 4NKOA 2ZG1A 4U6HB 4GKNB 4M6OL 3L6FB 4OZIE 1YMMD 4DOHB 5H94B 3EOAB 4LVHB 3DRTB 5CINL 5DMGD 4M48H 4X5XA 4DN4H 3TJEH 2ADFH 3DGGA 1E27A 2YA1A 3ZTJH 4ZUVB 2P5WD 1AXTH 1ITBB 1YYMH 2QSQA 1GYAA 3VCLA 1KCSH 3QQ9C 2X9WA 1EHNA 2R0WL 1LEKB 2LU3A 4RFOH 4N0UB 4FQ1H 5C0AA 2JK5B 4WTXA 3INUL 4PJEF 2DQFB 3CK0L 3I50H 4UILL 3CFKA 5C0FA 1GGYA 4OCSH 3SDAC 5KW9L 4TTGA 4F7EB 4Q2ZB 1S7TB 2AV1B 4HX1A 3D39A 1MVUB 2M2DA 2RFXA 3N06B 3LEXB 5D7JA 2WLZA 3CLFL 4R4BB 2PUQT 3R1GH 2ZUWA 4HW6A 1K8DB 3FMGH 1CFNB 4CVZA 3ZYJA 3T0EE 4PBVC 3BH9B 3WD5H 4PFEA 5E2UH 4A6YB 3G5ZB 3MMEA 4G8GA 2VOTA 3FOLB 3B6SB 4K7PL 2YWZA 5ESAB 1BJ1J 4Y4HA 4OB5H 3HPJA 4LARL 2OP4H 1U41A 5EOTA 1YEIH 1YC8A 2XOTA 4QY8B 1UQSA 2A6IB 5TDOA 5DVOA 4QOKD 1KSRA 2E6QA 4U1JB 3IJHB 2UZYB 4QHLB 2HMID 5TQ0H 3HLAB 3RX5A 3GB7A 1X5JA 4JO3L 5DVKA 3UAJD 2YRLA 4N9OB 1RUKH 5EBMA 1Q1JL 2E7MA 3HUJA 3QXDB 1J86A 5J1SC 5C7XL 4YDKH 2D0GA 3X3FH 1D5ZB 3CFEA 4UAOC 2YBRA 3TO4D 4WV1B 4YDLC 4ESKA 1FLRH 3KPRB 5T1LB 2DIAA 5GS2D 5ABDE 1IAII 2D9QB 5DEFA 2PXYD 5HI4C 3M45A 3VE0A 5DRXA 4PJAA 3GKWH 3TP4A 3P40A 3WV0A 2VN7A 3QUZC 3LY6A 5GJSL 2AERT 3CLEL 3KPQA 1VA9A 1MJ8H 4U2ZA 1MPAL 2QADD 2CR3A 2HYMA 3QUXA 5EUOF 3MXVH 4Z0XB 1U95A 4WFFE 3O2DH 1BFOB 5EIIA 3D9AH 1MHPH 3U7AA 3O11B 4X7TA 2IFFL 4PR5A 3W0WD 4EQ2A 4YHYC 5C0BD 1YY9C 2A73B 1UT9A 1RZ7L 3GRWL 1F2QA 1W2KT 4Q9RL 1FYTD 5I75B 5DRZA 3FT2A 1A6WH 3HN3A 5I8OH 2GSIB 3BD3A 3AMKA 3NFNA 3V4UH 1CYGA 4NBYB 3C09B 1JZ8A 4PP1C 4FFVD 5F1KC 4LVHC 1JZ5A 3QEQA 1EEQA 1IGIH 2A1WL 2O61A 3LPGA 4JPWL 3WO4B 1N7ML 3ISWA 3DI3B 5IWLA 5F96H 3QA3A 2V7NB 1GRWA 2Z35A 3Q2CA 4OLVH 4NP4H 4Z7WE 2HVJB 3S37L 1FNSL 5E8NA 1NANH 4IRJD 3ULVF 3SCMA 4EUPG 4HS8H 1IAKB 4OTXL 2GT9B 4G5ZH 4JRXD 2AK4E 1RUPL 2E7LC 5EPMB 4NHCL 1LK3L 4U1GC 4QXUH 4BH7B 3E2HB 4QLRA 1CS6A 4MNQE 4WI4A 1RZJH 2V5MA 4KWUA 1SJHA 3TN0B 1JHLH 4JRYB 2DS4A 1V05A 4JN1L 4KQ4L 4P0DA 3MSPA 4KJYB 4JN2B 4L4VB 1IFHL 2W65A 3RX7A 3X13B 3VXUA 4BSVB 1HIML 3TA3A 5DHXB 4RAVB 3T77A 4YO0A 3TPKA 4LDEB 3QEUA 1QNZH 2FWOA 2BY2A 4HUWA 4JY4B 1NGXB 4KKCD 4UDTB 3WMSA 1AIFB 1AD9B 4R7NA 1OGAB 3GMLB 1BBDL 4XBGB 4K9EH 1T04A 2IPKA 4UU9A 2YXMA 4F9PA 4Z8FL 4OZFH 4XNXH 5DJXB 1DVFD 3M07A 1WIOA 4AEHH 3OSKA 3RUGA 2XRAH 3CH8A 3PJSB 3U46A 3KR3L 5TGBA 2ED8A 5MEQA 4JREB 3TIDB 1CF8L 3MBXL 3WUZA 2A6KA 1WCBB 2BHZA 3Q1SL 4CADB 3TBTA 1K4CA 2FL5A 3PWUB 4DUWA 4WFED 1YY8B 2VIRA 5KOVC 1ZHBB 2DMBA 1N8ZB 1QYGH 3V5KB 1KCRL 5EU7C 1CLZL 1JI2A 3H3PL 2CKBA 2XN9A 1QSED 4G6JH 4F7CB 3EO1A 3TH4T 2P7TB 3U0WH 4TSBH 3LPWA 2J88L 3ILQD 3MO1A 2X09A 4P3DB 3U4BH 4QRTA 1S5HB 4WRLA 5J7CC 1KTDB 3C6LB 4OLZH 5I2IA 3KPNA 3BEWA 3PWPB 4N0RA 3LS5L 4ELMA 3ULUH 4YHML 3L3DA 5FYKE 2BVQA 4J3WA 3HE7A 4JPIA 5GIRA 1EJOL 3VFNA 1ZT1A 3IJYB 2AJSL 1OP5K 2PNDA 2EKJA 4PRDA 4UNVA 2LQRA 3GO1H 1NC2B 1F5WA 4Y19B 3HI1B 4NO0D 3SJVA 3BPLB 4L3EA 4UTBH 2FRGP 4P5MB 4M62L 3C09C 4K3GA 1BIIB 1HH9B 3O3EA 3H9SB 4TUKL 3MV01 3O6FD 3X11A 5HYQA 4FRWA 1MY5A 3DX7B 1OSPL 3TBWA 4F33B 1BZ7B 3HE6D 1SEQL 2CXKA 5GS0L 4YE4H 4Y4KC 5J6GB 1DQML 4MNGB 3LAFA 1CU4H 3B9KA 2EKSA 1F8TH 4WFGD 3V6OE 5KVDH 3P4MA 2PTTA 5IFJB 1I4FA 3FTGB 2VZ1A 3U9UB 3IVKB 4KTDH 2LU7A 4HCRA 4KDTA 5LGKA 3ZTNL 3E2HC 3K3QA 2OR9H 1QTYT 4OJFL 1QSFD 4M3JA 3TN0C 1Q9KA 2Y06H 4WHTB 3S36L 1PQZA 3GI8H 4P57A 3U1SH 4R6UA 2DQDH 3RHWK 3FFDA 4KTEL 5GGVL 2HJKB 3QCUL 1BM3H 4HC1A 3GIVA 4CNIB 3FO0L 2X4OA 3CVHH 4KKLD 3QEHA 1U8PB 3U82B 1FNFA 2Y72A 1ACYL 2KH2B 32C2B 2FX9H 5ID0A 1MAMH 2MNUA 4JKWA 4PJ8A 1CG9A 3ARVA 1S5IH 3BJLA 3A0OA 1I1YB 5MENE 3MOBL 4ZAKB 4CVUA 3F7VB 4AEIH 3MJ8B 4WHDA 1MJUH 1N6QL 3EOTL 1DQLH 3UJTH 3IFOB 2EZ0C 4KMQA 2IEPA 1JNNL 2F58L 2X4UA 1UH2A 1ZHKA 4QXGH 2J6EL 1Q0YL 1LE5A 2VLRA 3LMJL 4M1GL 3P73A 4XNMB 4BZ1H 4H88H 2JJUA 4ZUUB 3KXFB 4OCLC 1RIHH 4HUVB 1IC7L 4FQXA 1CN4A 3RVXC 3EYFB 2GCYB 2N1KA 4JZOA 1A7PL 2YHGA 4E9LA 4FXLA 4JCMA 3UTSA 4GMSH 4WCYH 2X1QA 1AD0B 4QXTB 4ZO9A 1Q94B 1R3IL 2WSKA 3EYVB 3OKOB 1KN2L 3LKQA 4BJLA 2EEBA 3C6LC 2AXHA 1FZJA 1M71B 3NMEA 2AEQL 1LE9B 3BZEA 2WV3A 3E8UH 5GS0D 2VDOL 4ZS7H 2C1OB 2ICWI 3JUZA 3MOAH 4DAGL 5ISZA 4PY7B 2IAMA 4GXUM 4XMKH 2ZJSL 2PTVA 1IGMH 1OARH 5B8CC 2C3VB 3VXQA 5IFHH 4WW2A 5JOFA 1DBML 3S35L 1UWXH 5L6YL 2Y5EA 3QBTB 1CICD 1SJVA 2AJVH 1A7RL 2YMXH 3O4LD 5IB1A 4EN3C 2GTZA 4YXHH 5I1AB 4ZUWA 4PREB 4LHJB 1BZ9A 1XGTB 4C56B 4UV7L 3JV6A 1R5IB 2H32H 1F4AA 4OZFB 1JZ3A 5HDQL 4QWWD 3CD4A 5JMRA 1I1AB 4JHZA 2NY0B 1DJSA 2VDLL 5EORH 4MB5A 4LLVA 1WAAF 3QNXB 5T1DH 5KVFL 5IESL 4ZD3L 3NH7L 2DLFL 1INQB 3C5JA 2IQ9L 3JSSA 1CDGA 4LSSH 4WGWB 2HFEB 3LD8B 3VW3H 5CKGA 4KKBC 1KG0B 1JGEB 4M93B 5A3ID 1KIPB 5D7IA 2X2YA 1N5YL 4OGXL 1EXUB 2HFFA 3JBG7 5JLZA 1L0YA 4PJ5D 3MRBA 4FTVB 4R90H 2UZIL 4R96B 2XTJD 4LASL 3MCKA 4P5KA 3V6ZA 1K4DA 3OF6D 4M9OA 3S9DB 4PRPB 4AG4L 5GS2H 4K2UL 3FB7A 4JFOB 1YNTB 5IMLB 4K23L 3GSWB 2B0SH 4YX2L 2BXZA 5ESQA 4M6OH 3SGKC 1OT2A 1TCRA 3HG1A 4E41E 3STZA 1SVCP 1U3HD 3JV5A 5D1XA 4ZAKC 4LCUA 3SDCA 4MLSA 2NXYB 2CRMA 4FOMA 4CUCA 2OCFD 5C71A 3OKEB 5CILL 5DTFA 3JZ7A 1MCPH 3KYKL 4LLMB 1KCVH 2R0WH 5CSBA 3CGTA 5D7LB 2JJTC 1I1FA 5SWQB 1A6ZB 4BFIA 2B1AL 1CL7L 5C07D 3CK0H 3VXOA 5KW9H 2EE6A 3OR6A 5H2BA 1A7OL 1F4YL 3IKCA 1PD6A 4KRNA 4NQTA 2XIDA 3SGDH 3WXWL 3RWIB 4G8EB 4OF6A 3ARRA 4NN5C 5JXEA 3GSOB 2UYLA 2VMFA 4D9RD 4L8BA 1IM9D 1I1CA 2OXHA 1NAMA 4K07A 5K9OA 5GS1C 4HPYL 3QIBA 5DD3L 2GAZB 4U1IB 3M1BB 5FKPA 4RX4A 3PWJA 1XGYL 3KPPB 2R39A 4QCIA 1YYLL 1J05B 1NQBA 1MFCL 5TE7L 1S78D 5D7SL 2HT3C 2FGWL 3G6JE 5FA4A 5E6IB 4OAWB 1RZJC 4C4KT 2IANA 2CGRL 1S7UA 2QL1A 5GRVL 3WSQL 5EU6B 3BP7B 1FDLL 1AKJA 4OLXL 3TZVA 2Z93B 4BM7A 3HRZA 5K9KA 3BEVB 2EE3A 2DWEA 1HHIB 5M94B 4MLIA 4UB0H 1B0GA 5HPMA 1Q1JH 3CVHB 3CMGA 4L1HA 2J4WL 5C7XH 1KPVA 5LGJA 2FATL 1ACZA 1KEML 1UJ3A 4JFPB 4OF8A 5CZXC 3TT3L 2IF7A 2YKLH 2XFXA 4K9EC 1U92B 3TV3L 1D6EA 4WI8A 4NQEB 4NUGL 3MRPB 3ZT5A 1I1AC 5GJSH 2ITDA 3I6LD 4HAGA 3ARTA 1P6FA 4X80H 1MPAH 4NZUL 2SEBA 5FK9B 3DV4B 3VMNA 3FONB 3GMMB 3LD8C 4HUKB 2Z8SA 4M93C 1U58B 3UXFA 2X4TA 2IFFH 4YAQA 3RU8L 1YMMB 1IGJA 1RZ7H 3GRWH 4OCWL 5DSCB 2GW5A 3TLRA 3GSVB 2XY1A 1T5WA 1XGPA 3J7HA 3T3PF 2P5WB 4JO1L 5HSFA 4NM8L 5J4MA 2LV4A 3LN4B 4RAUB 2Q86B 4UT6L 4KV5E 3GMQB 3OR7B 3CU1A 3OWEA 1NKRA 3ULUC 3OGOE 1CDIA 3UX9B 3PGCB 1RI8A 5B39G 4JPWH 4HEME 5ESVB 1N7MH 5I9QB 1J8HA 2RQ8A 5DS8B 2NXYC 2D7TL 3B3IA 2HN7B 1C5BL 4NN6B 3KJ6H 2EDEA 3F12B 1JWMA 4PRIA 4UOW0 2QV2A 4KK5D 3S37H 1FNSH 3KWWB 3HFML 4ZNEA 1UJTA 3BGFC 1RQ5A 2HKHL 4OTXH 5I74C 4NC2B 1JP5A 5AUMB 4JFFD 1RUPH 3OKDA 3LZFL 1JHTB 4DGYL 4NHCH 1PDKA 3L7EB 1LK3H 1X4XA 3K81A 3UZVB 5E24E 2HJFA 1I1RA 2H32B 2WWKT 5DK2B 1NEZB 4H0IA 1HOCB 1Y0LA 5DFWH 5JO5A 4S1SL 1F13A 1TFHA 4XPHH 5EH1A 1IFHH 3F8UB 4Z7UE 1HIMH 3LKNB 4ZFFB 1JPTH 4ODWA 2XKSA 3PIQB 2IBZX 3K7UA 5IB2B 4I2XB 2VLJD 3DVGA 5E6IC 1JZ4A 5C9JB 4G43A 4MA3A 2EYSA 4KROD 2GITA 2OTWA 1QSZA 4OZHB 5KSVA 1BBDH 5C6TL 5A1AA 5IQ9B 2A9NL 1CR9L 5DI8A 2XWJB 2Q87A 4Z8FH 3OXRB 2PXYB 4PUBH 4GBXB 1OGTB 5T3ZL 2Y23A 3BWAB 2Q3ZA 4OBSA 5DEZA 4XCEA 3DSNA 3IDNA 3ARED 1GZQB 3KR3H 4X6CA 2EXYD 3W39A 1CF8H 3MBXH 4HXBL 4IM8A 1AP2B 3Q1SH 1CD1B 1AGDB 5CP7B 1WBYB 4GRMB 3IDJB 1HHHB 4BUGA 1ADQL 3OAZK 1A4JB 3W0WB 5JW4M 2A9MH 5B3NA 1KCRH 1CLZH 2VXSL 3H3PH 4S2SA 1PAMA 5TH2A 1A1OA 2YPKA 4WHYG 1P53A 4PRBA 4MAUL 1DQQA 2J88H 1Z2KA 3T8XB 4B7LA 4OKDA 1QSVA 4U1SA 5CEZE 3W5NA 5KAQG 3HAEH 3WHXA 4X6DA 4XZUB 1XF2A 4GG6B 3LS5H 3V5DA 3ULUF 1XZ0B 1NFIA 4H26A 1EJOH 1YEJL 4DKEL 2FJGB 1I7RA 1KF9B 4MXVF 1NBZB 2AJSH 1VKXB 1N4XL 2P24B 2J8HA 2AXGA 2I27N 3QPXH 4HF5L 4XCNB 1VPOL 4PRAA 4M7KL 4ONHA 1A9EB 5ACZB 1Y6NR 5F7YC 4MJID 5FGBA 4IRJB 4TUKH 2W59A 1P69B 3L5JA 5TFSL 4PJCA 4WTWA 1NGWB 4JRXB 3R06B 5I9QC 2EIZB 1OSPH 3D85A 3ZHDA 4GH7B 1IT9L 4PTUB 5FDWA 1SEQH 3MLTA 4NN6C 4F8TA 2HA1A 1WC7A 3P0GB 3V5HA 4M7LT 4S1QL 1T1WB 5IW6B 5GJTL 2XZCH 5FO9A 4JM2D 1XIWA 3IS0X 4N90E 2DWDB 4XWOC 4WO4A 3E1F1 3ZL4L 4P9HL 4N9GB 5J1AA 1FNGB 3GSXB 1J0IA 2ICWA 4HJJL 4L8SC 4QNPF 1Z5LA 3ZTNH 5T3ZD 4JKMA 4OJFH 5FUOL 5C8JA 3UTTE 4WEMB 1QFUL 3OXSB 4JZNA 3S36H 1C7TA 1GGBL 3QUYA 5ERWA 4KTEH 3L3GB 5GGVH 2CIKA 3QCUH 3U0TA 1NFDE 4P4KD 2HMIC 5JIIA 3FO0H 4K3DL 1RZ8A 4MJ2A 3EYOB 3UAJC 4Z7QE 5KS9B 3SKJL 4AENA 2MHAA 1DVFB 5HGBA 1ORQB 2C3HA 5KSAD 1IBGH 2BNUA 2APWA 4RAHA 1UKSA 4JM4L 4DZ8A 1F42A 3NCJL 1Q9LA 3Q6FB 4DUVA 1ZVHA 1YEFL 4JFEE 5DMJB 3MOBH 3MRJA 3U83A 3DGGB 2Q6WB 1D9KD 4YEFA 4IOIB 4ONFH 3DBXA 3GSQB 4Y16A 3T08A 4J2XA 3RDTD 1N6QH 4EKXA 2BY1A 3NZ8A 4X4YA 2PXYC 5IB3A 2P43B 4GBXC 1JNNH 2F58H 2VQTA 2KUTA 3CVIL 2J6EH 1Q0YH 2CKBH 5F7LB 3LMJH 3CFKB 4M1GH 1TTGA 5T1MA 1QSEB 2YR3A 4IRZH 5ANMA 4U7MA 2FO1A 4XCCL 4BFGA 4AY0A 1IC7H 4KK8D 1CDUA 3VXPB 1A7PH 1DE4A 4KJWD 4OD3H 2ESVA 4L9DA 4P2OB 2Q7NA 4CVZB 3F6LA 2K3TA 5CP3A 5GGSA 1R3IH 1JWSA 3QIUD 2EEDA 3MMEB 4G8GB 4HK0A 1KN2H 2ZUUA 1TETL 4RIRB 3LB6D 4B41A 4XXDA 4Y4HB 3C8KB 3GIZL 4Q6IB 5FXCH 5AZ2L 2VDOH 4NO0B 4R0LB 4QOKA 5DDHB 3D25A 3GMPA 1LDSA 5F89A 3Q48A 2H6PA 4BUHA 2IGFL 4FZEL 2H8PA 4NQCE 1J7VR 2ZJSH 5TDOB 4I0PA 4XPGL 4DZBB 3RBSA 1TNMA 1SY6L 1AGEA 3MRHB 4OGZA 5J3HD 1DBMH 4F58L 2OSLA 5L8KB 3QJFA 3S98A 5L6YH 2ADJB 1JV5A 3ZE0F 1DDHA 5CD5C 4DKDC 1S9YA 3TO4A 4LLWB 1A7RH 2X05A 3SHSA 2X10A 1DN0B 2VYRE 3MV7A 1G0XA 4J12A 2F53D 1MCDA 1ED3B 1ODAA 1GC1C 5SWZE 3D5OF 4HCRH 3VFVA 3U2SA 1RIVL 2ZUTA 1ZLUH 2VL5A 3IDIA 5HYJD 1ZVSB 1NCAL 2GJ6E 5HDQH 3VE0B 4TVPL 1C16B 3VWJD 4BKLB 1R3LA 5F7KC 3UPRA 3C8HA 4GKZA 1FH5L 3GK8L 5IESH 2G2RB 2DLFH 2IQ9H 2BXYA 4U7SA 5IGXL 3F7PC 3RY6C 4LDLB 2NY2B 3O3DA 4PGCB 1ZMYA 5F9DC 1N5YH 5C0BA 2VUYA 4HKXA 3WFEL 4LSRL 1LP9A 4PR5B 3X14A 5C0CD 5C3LD 5CSGA 4KVCH 3C5ZB 4JPKL 3HI5L 2EC9U 3D3VE 5AYUL 3MUZ1 4LASH 4QRPA 3JTSB 1AR1D 4N68A 4RMRA 1CGUA 5C0EB 4OZHF 1MOEA 4JJHA 4AG4H 1P2CA 3LH2L 3MLWL 4K23H 1JVKA 1XGRB 3FT2B 1F90L 1I8KB 3MJ7A 3RVUD 1P4IL 4NBZB 4YX2H 4FQJL 3O4OB 1PSKH 4QO1A 4WWID 1WLHA 5D9SA 1Y6MR 3HAEB 5JPNB 4OQTL 1G6RL 3JVGC 1KTRL 2XZAL 2EH8L 4KXZI 1R5VA 1FL5A 4RFNB 4PLNC 5CILH 4ZTPL 3B5GA 3E0GA 5EFIB 4Z6AT 3KYKH 1JF1A 1SYVA 3CZFB 3U0PA 3U7WL 3MUHL 3C60A 3VXME 2B1AH 1CL7H 3WYRA 1PY4A 2HJLA 3WDJA 4ETYA 1F4YH 4O5LL 4LBEA 3JUYA 4QHKJ 2B5IB 3W2DL 3ILQC 1I3GL 1Z0MA 5MEPA 5D7JC 3TNNB 3HZMB 4JRWA 3MRGA 5BVPL 4GG6F 4P2OC 5J11C 5I71B 4OI7A 3WFDH 4R3SB 3MYZA 3PHOB 5F71A 4JFDD 3V95A 1MAKA 4TNVK 1CGXA 5DD3H 4PJ7B 5DD1L 5EO9A 3BRGC 5CBAB 1XGYH 1S9XA 3BOVA 4E5XA 1YYLH 1BVKB 3BMVA 4Y4HC 1MFCH 1F11A 3ABZA 5TE7H 1BMGA 1CK0L 2BVUA 3WBDA 1NUGA 1ROWA 4YO0B 2FGWH 4Q6IC 2FNBA 4QEGA 3ZMRA 1CICB 2X7LB 1WICA 1CL7I 3O4LB 1RURH 3QUML 4XC3L 2UZXB 3WSQH 1QLRA 1FDLH 1KGCE 2QQKL 4OLXH 2NNAB 4R7NB 5L0QB 2YN3A 5DZOA 3DXAA 1DP0A 5FYJU 4PJGB 2L7JA 2CLZB 2FH8A 5JHDE 1G7IA 2G75A 2J4WH 1N2RA 2XZZA 2X4NA 2VTFA 2FATH 5B22A 1KEMH 5EN2B 5ID1B 1NFKA 3O3BA 12E8L 4J3OC 4HGWB 3QR2A 4HIJB 4XH2A 5LCVL 5J9PA 3TV3H 2DDQL 1IKFL 5SX4I 3TBTB 4LDOB 4NUGH 2VIRB 1VGEL 4Z18A 4PJ5B 3WS6C 1QKZL 2Y36L 2CKBB 2XN9B 2JIXA 3EO1B 5C08D 3W9DA 3WJJA 3BP4B 1CFSB 3B9EA 3QUXC 3T04D 5TDNA 1I8IA 2NY2C 3T65A 5I2IB 5LGHL 5KS9F 1JWUB 5BQ7A 3L95A 2GK2A 2Y1VA 5CIPH 3LIZL 3C5ZC 1SYSA 4HWNA 3ZE1F 1JNHA 4OCWH 3HE7B 3EO9H 3LKRA 1U3HB 3B2VH 3OHXA 1OM3L 1T1ZA 3VFNB 1TIUA 1I7TA 1ZT1B 1KTLA 1FORH 1QRND 5E8OB 4NM8H 2VDPL 4L4JA 5EULV 4HS3B 1T4KA 1G7HB 5JPMA 1JN6A 5K9JL 4MWFB 4IBLT 2DICA 4MNHB 2FX8L 3OJMB 4UT6H 1YQVL 3HZVB 5C07B 4X7EC 1T83A 1QEWA 2FECL 3O3EB 1FO0A 5F9AC 1TZGL 3WIHL 1B0RB 4RFNC 3AS0A 2E7BA 2D7TH 2X70B 4L5FL 1FRGL 2R56L 4P2RB 5IWLC 2WAHA 4KZDL 1CD9B 1JRHI 5IMMB 3ZKSD 1AR2A 1CDYA 5E5RB 2BVEA 5AD0B 3QWOB 3B9KB 5I1DA 2EKSB 3KYMB 4P3CL 3P4MB 1T3FB 1SMOA 2PTTB 4XNUH 5E5MB 5HGGS 1CTOA 1FZOA 3LZFH 4DGYH 1U8OA 4QRRE 1C8PA 1QSFA 3VDAA 4S1RL 2A77L 1QLFA 3FL7A 1MRCL 3PP3K 4IRSA 1Q9KB 4S1SH 4IHOA 1P7KA 1U3ZA 5L88L 2E8YA 2Z8RA 2C7UA 2WINA 3FFDB 5BMFL 4APQB 5KAQF 1U0QA 2CD0A 5KTEL 1O7VA 1BVZA 3QEHB 5SWSD 1IZJA 5J12B 4EVNA 3KPSA 3QFJD 4OCXL 3PV6A 5GS3A 4OZIA 4GG8A 4E0RA 4PS4H 4KMTL 5E95B 4PJ8B 5EOCL 2Z4QA 4G8FB 4NN7B 4PRHD 5E2VL 4Y4FD 5C6TH 3EYSL 2ICES 5CHNB 5HJ3A 1CR9H 1R3HA 3RA7L 5BO1H 4F9PC 5T3ZH 5F7MC 3DX6A 1A14H 2BOBB 3CFIC 5J57B 1LE5B 3VFMA 1R3JB 4MAYA 5FV2A 1VEMA 5C0JB 4HXBH 1C7SA 3QNZA 1Q8MA 3QWQB 5GRUL 4MXWL 3LKSA 1MI5D 1TZIB 5FYLL 1ADQH 2YRPA 3OX8A 2JJVA 4MVBD 5IEKA 4KI5E 2W60A 2FBOJ 2VXSH 3AS1A 4DJMA 5IQ7L 3FB5A 2YPLA 1MFEH 4Y2OA 3RKDC 3T0EA 4MAUH 1DANT 4DKFL 3BKMH 4FQHB 4FQQB 5GGTA 1PW3A 2VSCA 2LTQB 4KJPC 3LV3A 2XWBB 5JA8B 3DWTA 3OTTA 5IMKB 2P8MA 2YN5A 4NQDA 5BOZG 2DJ4A 4CU6A 5C0NC 3HE7C 3LEVL 2R0ZL 4DKEH 1A6UL 5FO7A 4B50A 1YUHB 3VXQB 1N4XH 43CAB 1DFBL 5JOFB 2EDDA 4LVNB 5IHZB 4HF5H 2YD6A 1VPOH 5K33A 4M7KH 2AEPL 4MJ5B 4WUUD 5JORB 1EJ6A 5FGCB 5IB1B 3EDDA 3FQXB 4LNRA 4UBDD 4U49A 5TFSH 4JFFB 5BXFB 2WMPA 4YDJB 4JDZA 2EYRB 4GW1B 1IT9H 2X89D 5I8CA 3IDMA 5EWIL 4S1QH 4N1CA 5GJTH 3CZJA 5GGRA 4YK4B 1FG2A 3NN8A 3C6SB 3B9KC 4LLVB 4PJ7F 3IT8D 2EDTA 3FFCE 4BQCA 5JTWA 3SDXB 3ZL4H 2PCPA 1MQKL 4P9HH 3QQ3A 5HGAB 3KPMB 2A6DA 3LKPB 2GTWA 4C54A 1I7ZB 2X4SA 3BSZH 4KDTC 5E7FA 2EDYA 3RL2B 5FUOH 3FT3A 4D8PA 1KIQA 2VLJB 3QPQD 3WJLC 1QFUH 3MRBB 2BMKB 1U8KA 1XF4A 4LU5L 4KROB 1GGBH 3V6ZB 1K4DB 4NNXA 3D1MC 4K3DH 1DUYB 3EOYG 4APQC 3SKJH 4PJGF 4KHXH 5FYLD 5J12C 5FHBL 2HP4A 5F88B 5E9DD 1HSAB 1HQRA 3STZB 1D5BA 1XR9A 4JM4H 5T5NG 3NCJH 2BSRB 3HNVL 4G42A 1YEFH 4PJ8C 5EZLA 4MZ2A 4NN7C 2FJFA 4LCUB 3SDCB 4U3XA 4J3XA 1XGQA 2HT4C 3VXSD 4I0CC 1PYWA 1U8NB 4PJXE 3KS0J 3RVWC 4A2MA 4HKBA 4BFIB 5IW1B 3RJQB 1FV1A 5H2BB 4P2QD 1K5NA 1FZMB 1WWBX 3Q3GB 3LKOA 5F7HA 5FOBA 2BCKA 2OS7A 4XCCH 5CJOL 3MRMA 5LXGL 4H1LA 1ZS8A 5JIPA 2XG5A 5F8QC 3REWB 5CMAB 5CSZB 3VFPA 2F54D 1IM9A 4ZS6D 2AK4A 3OQ3B 1TQBC 4X98A 4MJ6A 3BZDA 1A8JH 1LO2L 4H0HB 2CKNA 3K4ZA 1N64L 2ZOLA 4QCIB 4TULH 3OL2A 1BQLL 1KJ2L 3O6LH 1JPGA 3GIZH 4N5ED 2LTQC 4Z7NF 5FA4B 2R1XA 5BS0A 4LLQA 5BRZD 4A2LA 4RRPA 4MJIB 4U0QB 2IGFH 3QULA 4FZEH 2IAMC 1E6JH 1OTUC 4XPGH 2UY6A 1AKJB 2AXFA 1SY6H 4HBQA 4AH2A 1HQ4A 1MCRA 3FQRB 3FN3A 1WCQA 2AGJL 3L9RA 1HYSD 2BP3A 4WU7A 4LVNC 2FGZA 3D69A 3S3PA 3BT2L 1QRKA 4QHUB 4HIHA 5DMKA 1MFBL 1WQVT 5D1ZD 5INCB 2D0FA 2HAZA 4YHKH 3GMOA 3NIDE 5DEGA 5A2JH 3HMWL 4JM2B 1EVTC 1X7QA 4NO5A 3QEGL 3KLSA 2X5PA 2O5ZL 2MQCA 4PJBE 4PG2A 4XVJL 4MCYB 1T0MA 2JB6A 1RIVH 1YPZE 4EI5D 2XYCA 1D6EB 5KZCB 1NCAH 1VB9A 3UROR 3G5VA 4TVPH 4YFDB 1MFNA 2R2EA 2YOCA 1T7WA 4D0BB 1T20B 5MP6L 1AE6L 4YK4C 1FH5H 2OK0H 3GK8H 3MRRA 5IGXH 1TVDA 4P4KB 4JANB 3W11D 4EXKA 2X42A 1M7DB 4Y8AA 4XHJD 3ROOB 2BNQE 3WFEH 2GEEA 2X4TB 3DJ9A 4OV5B 5DHYB 5DMYA 3W5MA 1B3JA 4JPKH 5KSAB 4XP4L 3GSNA 1MCQA 1IGJB 1U6AL 1V7ML 5AYUH 4KROC 5EBWA 3GSRB 4W70A 5F7WC 5LQBL 1D9KB 2VAAB 4YHIB 4ODSL 4MD4B 3U6RB 3LH2H 3WLBB 3MLWH 3UPCA 4MQXD 3DYPA 1F90H 4FQJH 3MUGA 3QDMB 3VGEA 4DUXA 2FO4B 1KELL 4GUPA 2HLAB 4OQTH 1FGVL 4UINL 1QBML 4CJ0A 1DLHA 1DQDL 2EH8H 1YEHL 1K8IA 2FLBT 5D1XC 4F3FA 2EXYC 1RD6A 1J8HB 3SDCC 2QSTA 3KHQA 2NYYC 4ZTPH 3PGDB 1MCLA 1RZGA 2D4DA 3U7WH 2W1NA 4KAQL 1QFWI 5GHWL 1I9IL 4NT6B 4BK5A 5AWNL 4UIKL 3U36A 3D0LA 3QIUB 4O5LH 3V8OA 5IV2A 3QAZB 1I3GH 1IEBB 1QZ1A 4IMLA 2IG2L 3MTRA 2BK8A 4JQVC 5JXEC 3AFLA 5BVPH 1Y0LB 3HZYA 4NCC1 1D3CA 1KJMA 3P77A 3QIBC 3D39E 1QG3A 3MV11 2APVA 3EBAA 1CK0H 3DURB 4G7VL 4HK3N 5HHME 4ODWB 4LCIH 2R8SH 1CLYL 5HGHA 3DVGB 2VQ1A 4YIQB 4XC3H 2FCBA 4G43B 1TQCB 4MA3B 2QQKH 2YUZA 5DD6A 4HDIB 4HGMA 3TZVC 1A3LH 1PBYA 5I66A 4LEOB 4XXCA 5HYJB 3FJTA 3SPVA 4UNUA 2YUXA 3RTQD 1BREA 3VWJB 1PG7L 3MRCA 4XCEB 1IGTA 4JM2C 4DK6A 4ZODA 3WNOA 3SDXF 1OSZA 1XCTA 3DPBA 2DTSA 3S4SA 1Q0XH 3CH1B 2E27H 3KPLA 5LCVH 2DDQH 1IKFH 1FLTX 1SBSL 3GM8A 2WBKA 2VWEE 3HUJE 1TENA 5C0CB 4LCCB 1VGEH 3L5HA 2Y36H 3MBEA 4S2SB 4HULB 3ZDZE 3UP1A 5IB5A 5JZ7C 3EO0A 3WN5B 1EGJA 1DQQB 4ZPVB 4P4KC 5LGHH 1A1MB 3PXHA 3R4DA 1TZHB 4PJAE 3WHXB 3LIZH 5KSAC 1KPUA 4L29B 4MNQD 3VWKA 1XCQA 1E4KA 4H26B 1OM3H 3NIFE 3MLVL 4PRNB 1I7RB 1D9KC 2I07B 4U0RB 3VG9B 3RVTC 2VDPH 4M7JH 4YDVA 4I13B 2KL6A 3DX8A 4ODVL 5EZIL 3ZYIA 4OFYA 1T21B 5K9JH 4NZDA 4OM1L 4DFHA 2FX8H 4ONHB 5IKCB 1YQVH 1AQDB 1P84K 5J6HB 3FHQA 1G84A 1KLGB 1S7WB 3BO8A 1N5AB 1KCLA 2X1OA 4L8CB 4B53A 1UZ8A 3WIHH 4RNRB 3MRDA 5EG6C 4L5FH 1DQTA 1FRGH 3D85B 3FB6A 3TEUA 3QDJA 2DD8L 2WZPD 1NBVL 4Q0XL 4DW2H 4CN6A 4KZDH 4KDWA 4YEEA 4YHNA 3SE9H 4PV8B 1WC7B 1BECA 3MRKA 2BSSB 3QHTC 5T3XL 3V5HB 4I77L 4JFDB 4LHUA 4P3CH 3CDFA 4HSQA 5F9JA 4CW1B 2DYPB 3IXAA 3QIUC 4O2FB 3EJYD 3E6FA 1UXWB 4S1RH 1Z5LB 2WLYA 1FP5A 4XNYL 4G3YH 3HC0A 1MRCH 3T3MF 4NRXB 2FBJL 5F1NB 4F9LC 1EEZB 3B8SA 4JDVA 4PJ9A 2YD2A 2FECI 1UA6L 3HR6A 4CVXA 5L88H 3QUYB 5ERWB 4IOFD 3SEPA 3U0TB 4NGHL 2L4OA 2Y5TB 3QP3A 4F37K 5BMFH 4M61B 5J3HC 4TUOB 3UEZA 4XVSL 1WZMA 5KTEH 5FGSA 4OCXH 2BNUB 5BZWB 2LABA 5DUBA 5GRWA 4JM2F 2MTPA 3D6GA 4KMTH 3L5IA 1KFAH 4E41A 4U1LA 3MRJB 5TF1L 3RDTA 1P7HL 3EYSH 3RIAK 1PZ5A 3VXUE 1AFVH 4X7CC 2KZWA 2EYTB 2D3VA 3PQYB 4DEPC 1HHKB 3VWJC 1F6FB 3LQAL 4EDWL 4BSWB 5C08B 2R9HD 5ANMB 1EHLL 2ZSWA 5B3JF 2NY6C 3P30H 5INDB 3BW9A 5GRUH 4MXWH 4DOHE 5IROA 3FCTA 5FYLH 4IOSD 4OD1L 2D7MA 5KSBE 3O6ML 4KY1L 2P8PB 2ESVB 3QIWA 1G0DA 3RWFB 4XCYA 3RUGE 1S7QB 4J3UA 4PTTB 3EDEA 3VGAC 3DHMA 4I4WB 4HS6A 3ARDD 1WBZB 1QRNB 4D9QE 4XXDB 1NMAL 3B43A 5E1AA 3UYPA 4WW1A 3RIAF 1LK2A 3RNKB 5FYJL 2DQTL 2CDGA 4GXVH 1U93A 5T3XD 2FSEA 4L3CA 5F89B 5DJ0A 3G6JA 2ZKHL 4WGVB 2YA0A 3OKLB 3QH3B 4ERSL 3LEVH 1A6UH 1FVEA 4HWBL 5FF6B 1UKQA 4MQSB 1UB5A 2NXZC 1AGEB 4OUUA 4U0RC 1DFBH 1RZKL 2B39A 1XEDA 3VRIB 1VFMA 4ZOEA 1D5XB 1FVCA 3CDGA 2AEPH 5HHVL 1D5IL 3MJ9L 1GGTA 2V5RA 4G6AD 1S9YB 1LNUB 3WIFB 3UPAA 1EFXA 5CZVL 3CAFA 1A5FL 4P2CG 4HKZB 3NPSC 3DOSA 2LAGB 2VL5B 2WBJA 4HZLB 2V2TA 3SJVE 4L3EE 2WIIB 5JXAH 2BJMH 1U8QA 4NZRL 4MXQD 4CDGC 2D9CA 3PABA 4U6XB 1MQKH 3JV4A 3MXWL 1NDMA 3WO3B 3OJDA 4KUZL 1CGYA 3FO2B 4HKXB 3DVIA 5SWSB 1LP9B 1ZA3B 4CKVX 2FZ3A 3OAYH 3QFJB 1IC5L 3BDBA 1A6VL 2YD3A 4LU5H 5DRNA 1DBKL 2FD6L 2M1KA 2R1WA 3BE1L 1HI6A 4CMMA 2R69L 4Y1AD 1FCCA 4GQPH 3UJIL 5F3HB 3QUYC 4Y4FB 5HHOD 1P2CB 3CX5K 1VENA 4K7PX 1BD2D 1OAKL 5EU3B 3UC0L 2XA8L 4M03A 3NAAL 4J8RB 2VITA 5FHBH 5D9SB 4AZ8A 1MRDL 3OKNA 4Y5VA 4GW5B 4LCWD 1JF6A 3HNVH 3MV8A 5IJKA 3G5YA 4MS8C 5GRJH 1FL5B 3GNML 3NIGE 3VU2A 2VR9A 5ICYA 1RK1A 1QPXA 2HFTA 2AJXL 3ARSA 4J4PA 3DETD 1HZHL 1A6AA 4FNLL 1UACL 1MI5B 1JF1B 1UENA 3B2UC 4HUUA 2XICA 3MV9E 5FYJD 2GHWB 1KB9K 1RU9L 4RMTA 3H9HA 2HJLB 3N1FC 4GW4B 1Z9SA 2OZ4A 4O02H 2RGSA 5CJOH 1AO7A 5LXGH 3DIFA 4PGZA 4LBEB 1G7PA 1H5BB 2GYSA 5D2LB 5JQ6L 3ZZ1A 5IOPB 4TSCL 3TVMA 1PGRB 2VLRE 1CVRA 1LO2H 3QWRD 5GQBA 4BH8B 1VEOA 3RZCA 1BJ1H 4WFHD 3VD5A 1N64H 4LCYA 3CSYA 4E5XB 4NDMA 43C9A 3FAWA 1KJ2H 3FOMA 4ZQKA 4KTYA 5HGDB 4AIZA 3PXJA 4CBPA 2F8XC 2VISA 3IETA 4WUUB 3UTSE 4BK4A 4R4FL 3NOIA 4K55A 2BNRD 5CJ8A 1YN6A 5B38B 1QLRB 2R2CA 4P46B 2AGJH 1DTUA 3EKCA 3MCG1 5J13B 4AEFA 3BT2H 3WE6A 1M05B 1MFBH 3K4DA 4MB3A 1WAAE 5DJAA 1XF3A 4HAFA 1ETZB 4X8JB 5ISZE 2X4NB 2DKSA 2C9AA 3HMWH 5CGTA 3QEGH 3V4VL 3EIFA 4DGVL 2AV7B 2O5ZH 4BQBA 2CDEB 1Z3GL 5IIEA 3I6GB 5DC0A 4KK6D 2IH1A 4X6EB 4XVJH 3F5WA 4LLUA 4NO3A 1BQHB 4NCDA 3QDGA 1ZHNA 1G6RA 1MCFA 4M1CD 1MHCB 5TE6L 1ES0B 5C3TA 3BXNB 5DURD 2XPGA 4XI5D 2DM3A 2W92A 1OGAE 4DN3L 3VXRD 1AE6H 1U8HA 3S37X 1Q38A 1G7MB 4YC2B 2JIXB 4OZGA 3OMZA 3STLB 1K3IA 3CUPB 5A40E 3KPTA 1E28B 4PB0L 5IVZB 5HPOA 3T65B 1IL1A 1OAXH 4S0TD 5BQ7B 4LRIA 4N5UA 3P0YL 4ACPA 4KH2A 5GXBB 4PJDB 4I3GA 4JR9H 3QQ9D 4GRLA 4XP4H 5E9DB 3VXNA 1V7MH 4DVBA 4QGTA 3F7RA 4JHWL 3SDAD 5LQBH 1P4LA 5IK3A 1A9BB 2P48B 1F3DJ 4NUJA 1T03L 3ZHLA 5D7IE 2XA3A 3VXSB 1T4KB 3NACL 1T1YB 5JPMB 1JN6B 1KELH 5EA0L 4NRYA 3S88L 3HC4L 4UINH 1QBMH 4P2QB 1YEHH 4P99A 3REVA 1EHXA 1XR8B 2DKUA 4NM4L 2IBGA 2GJZB 5JOEA 2B8OT 3TIEA 2F54B 1NBYB 1S8DA 1NKOA 4KAQH 4AMKL 3FQUB 3QUMA 3R8BB 2C3WA 3C60C