1JPGB

Crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpgB00
5HGGS 3FT4A 4TVPD 3QG6A 4KUCF 2HLAA 1R6VA 3C5JA 4AEHL 2QV2A 3ARDA 1TTGA 4U1HA 2AKRB 4NQXB 1UWXH 5HHVL 5T33L 2HFTA 5DD6A 1B6DA 1Y6MR 2QKIB 1BECA 4NO3B 2OSLB 3B43A 5HDLA 3Q1SL 3MRMA 1FBIH 3QQ9D 4P99A 5DJ8B 2CSPA 5FECA 3SJVA 3B5HA 4LDEB 5I1CL 2BSRB 1EO8H 3X11B 4YHNB 1S9YA 3GSXB 1WC7B 3K46A 4X7SH 1OP3H 4MWFB 1VFUA 2EDOA 1TPXB 2GJZB 3VCLB 5BV7H 4NRZB 1P84J 3MRRB 3RZCC 5FKPA 3WJLA 3VFPB 1IGMH 4XWOC 3D85B 2YHGA 4OCNC 1KLFA 4OCMC 3BE1L 4NQXA 3RTQB 1YEGL 1EFXA 3V8CA 1QOKA 5I1AB 1CR9H 5JOFB 1KB5H 3PL6C 2X4OA 4P59L 1BFVL 5F9DC 3E2HC 4HCRA 3S96B 1RZKL 1U95B 2AAVA 3W0WD 4WU7A 4POYA 43C9B 1UWGH 5GRWA 2R0LH 5IMLA 1L7IH 4UBDC 2XQBH 5GS0H 3GMPB 4LAJH 4KXZI 4D0BA 1JRHI 1N7ML 3WN5B 3ECBB 2HWZL 1K3ZA 4IRSA 4JRYB 2G5BB 3I02B 3KXFA 3UBXI 4XNZB 5GRXG 2ZCHL 2DQGL 2AK4D 2A9ML 3OXSA 5C0DA 4X9HA 4LHQB 3QNYA 3DXAA 1CGYA 3VFWA 1LP9A 5K9KB 1F3JA 2R56H 5ESAB 2F74A 4RFEB 5KS9F 1T4KA 4L8SC 1CCZA 3V5KB 1J1OH 2IG2L 1OWWA 4BQBA 4TNVK 2XTJD 4MJ2A 2EIEA 3P9MB 2E8ZA 5SWSE 3MLXL 4W6XB 1WWWX 5JR1L 3DRQA 2D4DA 2Q86A 1IAKB 4M93C 3WSQH 2GCYA 1VGEH 4WI3A 3AM8C 4P2RD 1Z0NA 3FFDB 4DVRH 1S7TA 4Y5XA 5KSUB 3UTTA 3FT3A 3N1MC 4AEIL 1MJUL 2NXZD 3QAZC 4WWKC 5E9DD 2G2RB 3QZWB 1N0XL 5CJXA 1GGIH 2R2EB 4W4OA 4JRWA 32C2A 3F12A 1FAIL 4QWWC 5F6HJ 3QFJD 4ZXBA 3SGJC 3QCTH 1UXSB 3S35L 5ESVB 4LLQA 2QADB 4Y2DD 3TV3L 1MHEA 1QRNE 3S4SA 2VL5A 3MFFA 3MRQA 2C7UB 4OM0L 4HS6A 3IKCA 4TVSa 2EDFA 4NBXB 4XPFH 1KIRB 4P4KD 4GSDL 3VRLE 4QOKE 5JXAH 4MA3B 1S7QA 1XH3A 1MRFL 5FOBB 1TFHA 1MH5B 4HUUB 5ELIA 3ARBC 12E8L 2DJSA 4OZIE 4O9HH 3MRGB 2ZUUA 3PQYD 5DTFB 3JV4B 2W92A 4EDXA 5L2KE 2APWA 3LQAL 1J18A 5F88B 1KEGL 4KMQA 5ID0B 5ECJE 1PQZA 4IRJD 4PJCE 1ES0B 2DBLH 4YE4L 4D0CB 4L1HA 3EUUA 1DQJB 2VNCA 3F7YB 4R97C 3U7YL 4XBPA 3M17B 1QEWB 2PYFA 3SE3A 4NNPL 3CH8A 2VUYA 1O7VA 3WO3B 2DQFB 5GZOC 1DBKH 1MCSA 2VLJE 3CVHH 4K7PX 5C2BH 4F7EB 5E70A 3QDJA 3U82B 3DMMD 1A6TA 35C8L 1N0XH 3HE6B 3HS0B 1NUDA 2F53D 1B0WA 1T03H 3V2AR 1MWAA 1NLBH 3L3DA 3HC4H 5MI0C 5BS0D 5FM8A 1HQ4A 3FT2B 1L7TL 3KLAB 5CZVH 3S36L 3P4MA 3QQ3B 2D7MA 1Q0XL 3PL6A 4RA0C 4ETQA 1CFQB 2DQCH 2DN7A 2FX8H 5TGBB 4I48B 5T1MA 4HS3B 1UYWL 4BQCA 5JORA 1WK0A 2H8PA 3SDXF 5LQBH 2LU4A 2A0LC 4K2UL 3QQ4A 4LSPL 5D7KE 5IK3B 3WD5H 5DFWH 1BFVH 2DQTL 4RQQA 3HA0A 5ITBH 5HDQL 1IEBA 3DV6A 3CDFA 4P4KB 3RVTC 4OT1H 3P4NB 1HDMA 3MLTB 4JEGB 3HC0B 1IAII 3RGHA 4QRQA 4N90E 2YD8A 3HZVA 3S97C 4FQIL 1XIWB 1MEXH 5FUCC 4K7FB 2VZUA 2RR3A 4F8QA 1CGWA 2P5WB 3A6BH 5EBLB 3MMEA 1U92B 1RFDH 3O6FA 2VZTA 2WSKA 4I0PD 1LP9E 2AP2A 1ZAGA 4YPGB 2Q8AH 4Z0XA 3D9AH 2VISB 2R29L 3NZHL 2IANE 2JB5H 2VDMH 4JFFE 4XWOD 1NFIB 2PW1A 3TF7C 4K2UH 2FJGA 4CL7A 1G7MA 4OF6A 3TJEL 5I15L 3GI8H 3H3BC 5T33H 2GQHA 4ZO8A 3SOBL 1BAFL 1M6OA 4FQIH 4BFEA 1FN4A 1T0MB 3E3QC 3MV7A 4GAGL 4JQVC 1YJDH 4WNQB 2EDWA 4MXQD 3GBNL 1ZA3A 1G9ML 2L7UA 2EXYD 4QRQB 4MAYC 4IS6A 2FEEI 4U31A 2NTSP 4JN2B 5BVJB 4WTXA 4YHLH 2QR0A 3QCVL 5HGDA 4G9FB 1BFTA 1CVRA 4UILH 3ET9F 1CE6A 1I75A 3LN4B 4QRTA 4AM0B 5DS8A 1U8MB 4LSSL 4PRPE 2V5RA 1BJ8A 4NO5A 5C09E 2RGSA 4OCSL 3T0AA 3LQZA 1NFDE 3V52H 5BMFH 1NMAH 2B4CL 4O2FA 2V17H 1OTTC 2DWDA 4P57A 3EOYG 3FQTA 1VEPA 2HVKA 4XAKD 3R8QA 1GOFA 1EEZA 4FQ1H 3SDXE 5I19H 4UNTA 2GTWB 3ARFA 4ZS6C 3IKCB 4DUVA 4UMGA 4KRPD 5D7JD 1BOGB 3OGCB 1FDLL 4LKXA 1BWMA 5DF0A 5F9AC 2IFGA 4YDIL 1H5BC 3PWVA 3ARRA 2WZPD 4ZMAT 5D1QD 4JFYA 3EOAA 4OTXH 5GS3A 1H3TA 4D3CH 3U1SH 1G9NC 2PTTB 5D5ME 5L88H 3P2TA 4AY0A 1JZ5A 1LE5B 4G8IB 5IR1A 2EXWD 3V79C 4N0RA 3O2VH 3L7EB 2HFFB 1KB9K 3T3ME 1XF5A 5ID1B 1RV6X 1IKFH 2OTWB 3FQXA 3HI6L 4LSTL 2ZJSL 3NCBB 1UKSA 3HPLB 4KHTH 4TOYL 5CMAB 1MJUH 4NFCA 5D7KD 4F7TB 4OJFH 4O2EA 4AT6A 2BNRA 5FYJU 3LZFH 4P4RB 5C09B 2D7TH 5DUPH 4KK9D 2HT4C 2ILLA 3MODL 3JBG7 3FZUD 2AJYH 4L4VD 5EOCH 2ZG3A 2VDRH 4IOIA 3AREA 2QSCL 5JW4N 3RUGE 5JHDE 5KVEL 1X6LA 5BMFL 4FN0A 1FVEA 2OR7A 4UIMA 2MPAH 2G5BA 3I02A 2F8XC 2X4RB 2YS4A 4KK9C 4NO2A 3G9VA 4HH8A 4LVNB 4NRXA 1KPRB 4KI5F 4HH9A 2MOVA 5SX5H 4KDWA 4M1GH 2YEZB 2Z91A 1N3NB 2AEQL 4P9HH 2C3XA 4M3JA 1QFPA 4MD0A 1A9EB 3IDGB 3UTZB 1W0WA 4KRPB 4P3CH 4XMKL 4YDIH 1AIFB 5I8CA 2LTQC 2BDNL 1K8IA 2BVUA 1IM3A 1MF2L 1B0GA 4Y19A 5I1AA 4HIHB 5GISH 4CW1B 3QPXH 3NCYP 1RURH 5GRUL 1RMFL 3C5ZB 4WU5A 1T7WA 4MAUH 2ZKHL 4LVHB 3BEVB 3D3VB 2B8OT 3PWUA 2B7DT 4UB0H 7CGTA 3OKEB 1GGBH 3P9LA 1LO2L 3HZMB 2ED8A 3WYRA 3K80A 4XWGH 4XNQB 5C0AA 5EIIA 2G9HA 3MUY1 5ISZA 1IZKA 1MREL 1UKTA 4U0QB 2UV3A 5J12B 3BT2H 1NGYA 4KU1A 5JHLH 2RFXB 1ND0B 1NGPH 2FECI 1SMOA 3U9UB 4PGJA 4U3CA 4NC2B 5SWZD 2MCPL 2WBJD 1CIUA 1U36A 5CKAA 2FJFB 5DGQA 2ADGA 3V7AE 2X89A 5F7MC 4HWZA 5CEZL 3ZDXF 2H9GB 1LO2H 4NZRH 4IJ3C 3BQUB 3DURB 4WU5B 2Z31C 5I74B 2HLFD 2Z93A 1FNAA 2ZKHH 3SGKA 3DHMA 5EU3A 1RVFH 2R23B 1IGML 3DVGB 3CZFB 4LCYB 5D2LF 3GI8L 1D5BA 3PWPE 4Q9QH 1JV5B 3GBMH 1Y6KR 4BFBD 3VRJB 2ENYA 4QNPE 4JM4H 3TCXA 1MJ7L 4HUMB 1QVOB 4PG9B 2Z35B 3HZYA 2DMKA 1CG9B 5D72L 2Z35A 3HZYB 1FNEB 3SDDC 4LCWA 3IETB 5CSBA 1OB1B 4RFOH 5GGVL 3MXWL 3QSKB 4NKOA 3SKJL 2EE3A 3KYNB 5CIPB 5M94B 4YUEH 4PJBF 5IW6A 1M7DB 4KQ4L 3BPOB 1NSNH 4OF8A 5ENWA 5FO9B 2DD8L 2YPVL 3HNSL 4PGDA 4LNRB 1NMBH 1A4JA 1MI5E 4OSUH 1ZA3B 1OT1A 1UKQA 1JPGB 1PKOA 4Q0XH 5HI3C 4UTBL 3RVXC 2AQ2A 2ICEA 1NJ9B 1FPTL 1WT5A 4OKVA 5I15H 3VFMA 1CT8B 4ZUSB 1MCLA 5GIRA 4NQDD 4XPAL 5GISL 3VXSE 2H2SC 1AD9A 2V6HA 1W0VB 3JV0A 5I1EL 2HT3D 4WI8A 2YEZA 2Z91B 4N0UA 3H9HA 5IW1A 4MDIB 1I1FA 3V0WH 4BH8B 5FYKH 1JZ6A 3N1FC 3MV8D 4DGYL 4EDWL 3ULVC 4DN3L 2VJXA 4FFWC 4Y7MA 1QLEH 4OCRL 4PP2B 3ZHKA 2XPGA 3IJYB 5F8RC 5GS1A 1J1PH 5CJQL 2GI7A 5EU4B 3IXTB 5F7HA 5DRWB 5E9DE 1UWEL 2WP3T 4J3WA 4PTTA 3T0VA 2E7LC 1HYRC 1JNLH 3BN9D 4UU9B 5IESH 4UT7L 4G8FB 1S7VB 3O6ML 3P0GB 1B2WH 1RIUL 2AJYL 3U7AA 5D1ZC 4EUPB 1IGCH 1OD7A 4EQ3A 1KGCD 4KTEH 4PJ5E 4E42A 1LDPL 3PV7A 1G7PA 1IKNA 3VFRB 1VACB 1Q94B 4E41E 5DQDH 2N7BA 3MV9A 2AEWA 3DMMC 3K7UA 5DK2A 3KPMB 1MHHA 3VFGH 2D0GA 3IS1X 3MCKB 2HFFA 2VE6A 4TVPE 4I0CC 3C08H 1AQKH 1TZGL 4RAUA 3HN3A 4HMEA 2PN5A 5C0AE 3PP4L 4OGYL 4ZAKB 3ISWA 5J9PB 4HS8H 1JGUH 4D3CL 5DRWA 1OP5K 4PUBL 1IGJB 5FYJD 2YA2A 3V4PL 3FN9A 1MPAH 5BVJA 2B0SH 4JCMA 1EHXA 3RWJB 1OTSD 3QXDB 1OAZL 2OP4H 1JFQH 1NKOA 3S3SA 1FH5L 2Q76A 2D7TL 1M7IB 5ITFB 1KFAL 4PR5A 4NQEE 5EBGA 5LVEA 1P7QD 2IFFL 4NQVB 5HDOA 3B2VH 5I1DA 4EDWH 5KN5A 3OB0K 1R5VB 2E6PA 5ID0A 3JV6A 2P24B 5SV3A 4AEEA 4NJAL 2XN9B 4P2QA 1KELH 2D03H 1WEJL 3C5SA 3CSPA 4QOKB 3RDTB 3HPLA 3BQUC 5D70L 4LLYA 5EU5A 3CXHJ 4JO1L 2H26B 3O2VL 2OTWA 4V1DA 4LGPB 2W65A 1KCKA 3NGBC 3QI9B 3U6RB 3WV0A 3FQNB 5HYJB 5DJ2A 5T3ZD 1HILA 5FOJA 2Y5TB 2XZCH 1F6AB 4IRJA 5DR5H 1W72H 5T1KD 4MZ2A 4ODTH 3V5KA 5F1NB 4IRSC 3MMEB 3GSUB 5HHQA 1CWVA 4IS6B 4W6YB 3G04B 5IB2B 3VXQA 3SDAD 2BXYA 5DYOA 2ICES 2IALA 3DXAE 3CMGA 2CLZB 4J4PA 5F7WC 1OQXA 1H15A 3DI2B 4M6NL 5D96C 2DI7A 2Y06H 1RJCA 4U6VL 1L9MA 1ORQB 3N06B 3VD3A 1HSBB 1FIEA 4LEOA 3K4ZA 4MXWL 3GJFK 4Y2DA 3MR9A 1IEAA 3L3JA 3V95A 3HE7D 4WUKH 1U95A 3WHE0 1KJ2H 4N8PA 4U6HB 4F7CB 4UINL 2RAMA 3OHXA 2UVEA 5E1HB 4ZFZA 3LN9A 1MQ8A 3V6FA 3L3DB 5IIEB 1A47A 5ANME 4OIAA 1I85A 3RWDB 2PETA 1QSFE 2QHRH 1EHLH 1QFUL 1I7TA 3OMZA 1D5ZA 1BWWA 4S1QH 3ARGB 3G04A 5IB2A 1RIVL 4G80A 1I9JH 2DMBA 4G80B 1V3KA 3OR7A 5FGRA 4ZO9A 3VDCA 1OD9A 2APFA 2HH0H 1KTLB 3FO0H 4HLJA 3QIBB 3B9KA 3KPNA 4YNYB 4PBXA 3I3DA 4WTZA 1DANU 3DOSA 1GZPB 2HKHH 3OZ9L 4L3CB 5IJVB 5L7XH 3HR5B 5CEXA 2BY1A 4ZUUA 3IDUA 5CBAB 5HHMD 1N64L 1HINL 1INQA 2DWEA 3C5SB 4NO0D 4QOKA 2EIDA 3FJTA 4NKQB 4X6FB 5D2NB 3PWPB 3C60A 1U3HC 1AI1H 1FZMB 2GJ6A 5T3XD 5E2TL 2OTUB 1CR9L 4MNGB 1ZT7B 4GMTL 4YPGA 4H5SA 3B2UD 4LIQH 4PJEF 3R0NA 1LK3L 4NN7C 1U8PA 4GOSA 1CL7I 4UDTA 1G7LA 2CO6B 5GS2H 3MRKA 4KPHH 4XP1H 3TESA 4KRNA 1RJLB 4HKXB 4OB5H 3UJIH 3TVMB 3O3AA 4PJBE 4GG6B 4JRXD 1GPOH 1F11B 3VU2A 5H35A 4F3FB 4OQTH 2I9TA 4LSPH 4ENEC 1HZHH 2X9YA 4JFHD 4M5YH 3VH8B 1K9TA 4Q74A 2IH1A 4OFKA 2O5YL 5IEKB 4DK3A 4OV5B 3LRSA 2FZ3A 5CUSL 4AEIH 2QKIA 4ODVL 4P2QE 3DO7B 3RX8A 3WL9B 4DVRL 4K7PY 4Y16A 2E27L 1LEIB 3DETD 4UAOB 4EUPA 3SJVD 5I18H 4NZTL 1EAPB 4P9HC 4QRUA 5I0DA 1MCDA 2PXYB 4LDLB 3PWLB 4KH2A 4OCXL 3MBEC 3VE0A 1D9KD 4R7DB 3MRBB 2YK1L 1GAFL 3FN0L 1OAUL 3S3PA 3RTQD 3VMOA 4YHMH 4WDIB 2G75B 3IU4L 4WVRA 1PSKL 3PXHA 3QNYB 4B5EA 4I5BA 1N3NA 4M9PA 5LGKA 5CJQH 3ZHLA 4MQ7B 4CN6A 3HNTH 3F7VB 1MHCB 4UUJB 2WIIA 1DQJA 3F7YA 5HTSA 3SKUD 5IMKB 1KXTB 3U46B 4MAYB 3S35H 1UJ3C 2CD0A 4HPYL 1XGPA 1P1ZA 2R9HD 2VR4A 2DKSA 1KCUH 4ZUTA 3VXOA 1ZHLA 3MV01 2P5EB 3ARYA 5FYKL 2EIBA 4YFLF 3WUZA 5IWLC 2AJXH 2D9QB 2YKLH 3U0PA 4JR9H 3LZFL 4G8GA 4Z5RB 1SJHB 5SX4I 2R9HC 3EYUH 2JIXD 3UO1H 2CDEB 4M4RA 3IVKA 2ZOLA 1RZKH 4KHTL 4WUUB 3QFJE 4R4FH 3BSZL 1R3KA 5DD0H 4FQCH 2RCSL 4I13B 4Y5YC 4FA8A 1RULL 1KB5L 4Z6AT 1YPZA 1I7RB 3C6LB 1XGUB 3IDIA 1IGFH 4FMKA 3V4VL 5C0DB 1OB1A 1QKZH 3QCTL 3MRRA 4IDJH 2DAVA 1Z5LA 2JF1A 4PYHA 1T2JA 1KPVA 2JE8A 4DK6A 2DM2A 3HG1A 4WHYG 1TVHB 4WW2F 3T8XA 5BV7L 1QFWI 4XCCH 1HH9A 2X4NB 2NXYD 4AK1A 1E4KC 3RGVA 1PSKH 2VZVA 3RVUD 1KJMB 5SWSD 1J05B 3DWTA 1AC0A 1FDLH 4X4MA 2FJHB 2FLRT 3LKOA 5I1KH 3DROA 3GUTB 3FONA 1BOGA 1PYWB 2IMNA 4U6YB 1C5CH 5EDXA 2Z93B 5GPRA 2L4OA 5DK0B 1EO7A 4X99A 2B20A 1X5GA 4LSRL 1UZ8B 1LK2A 25C8L 2WUBH 1S9WA 2ERJC 2FX9H 3W9DB 3QNZB 5I73C 3VJ6B 2GJ6E 1U2CA 3HUJE 5GGQL 5MEOA 4Y4FD 5MI0B 3ZE0E 4JY4A 4LIQE 4FQXA 1BHGA 4R90L 3ZE0F 1BF8A 2P8MA 3HNVL 1VADB 2QTEA 5DVLA 5FHAL 2P5ED 3ZHDA 5LGJA 1DLFH 2XTJB 5L0QB 2CIIB 4PJBA 1XGQA 1JI2A 4CN4A 3KLHC 1QLFA 2XQYG 1BBDL 4NQEB 5E7BA 5E8NA 4V1DD 3F58L 1RIHL 5EU7C 3F58H 4YQXH 1QRKA 2APXA 1ZLVH 4WUUD 1YC7A 4OB5L 4N8CL 2BMKA 4GAGH 3TPKA 3A67L 3PGDB 2EEBA 2J88H 2CJUH 1LK3H 3BEVA 3G5ZB 3L3HB 5JPNA 2X1QA 1QFWL 4X0KA 5LGHH 3DVGA 3TA3D 2VLRB 3SO3B 2M26A 4GW4B 5C6PB 5GGSA 1PLGL 1IGYB 2VC2H 4XPTL 5EZJB 4KGLA 4LCUA 1JL8A 5DHYA 4X7DC 5JW3H 1J0ZA 1R3IH 1TDQA 1MCCA 5EUOA 4L9DA 1W0WB 1JBJA 1MRCH 3IU3A 1JNHA 4S2SB 5B22A 4XMPH 4ZUWB 3CLEH 1ZA6A 4MNQD 2P48B 2UY7A 1T04B 4MXWH 1AKJA 4FG6D 8FABB 1PG7H 1Q9KB 5HSFA 4ENED 1D6EB 4GKZA 4HBCL 4BSJA 5AYUH 1AD0B 4HWNA 1XF2A 3O6FB 3PQYB 2E7MA 2PCPB 4M4PA 1EPFA 5FHAH 4RIRB 2FYYA 4H1LB 4EJ1C 2FIKB 1ODAA 5E5UB 5TQ0L 3QH3B 1WFUA 2PUQT 5IEHA 1SY6L 4XXCA 2VO5A 4R2GD 1F42A 2AJSH 2QHRL 3H7LA 3VWJD 1KENL 5KSAC 3O2DH 1NAML 2D9CA 4KJWC 4L3ED 1H5BA 4OZFG 4X6DF 5CILH 2CIKB 1M05A 1OAUH 2I24N 4M5ZL 3WE6A 3VJ6A 3CX5J 3HE7C 3VFOB 2ADFH 3ALPA 1NCWH 1EGJH 5GGUA 4Y19E 1T21A 4NQUA 1VPOH 2XZCL 2AJZB 2PYEA 1YN7B 5J1AA 1FIGH 4UZGA 3VXRD 1YYML 1HXYB 2I07B 5HYQB 5T1DH 3RDTA 5AUMA 4HX1B 4YO0A 1A7NL 2QQLL 2E6JA 2XWJB 1TJGL 4QHLA 5GRZA 1N0LA 5A16A 1ITCA 3HE6D 4Y8DC 5EB9A 4KJWD 5J6GA 4QXTB 2X4TA 3LDBC 2KPNA 3UROR 1JF1A 1LEGB 3MRNA 3F7RA 1MRFH 5D5MF 3VWKD 2EDNA 2VLRD 3UTSA 3DIFA 4UIMB 2DLHA 4PP1C 2ZUTA 3RWJA 4DAGL 3EYOB 5IROC 3AU1A 4NQDA 2A73A 4KJYA 5F7EH 3ARBD 4Y1AD 3BSZH 2VXUL 4HGMA 5JQHC 4NT6A 3TLRA 4E41D 4M6AA 3VWKC 2HN7B 1G9NH 1T1YA 3SCMC 3BIAX 1BBJB 4DZBB 3TA3A 3UJIL 3QG7H 3ARUA 1VKXA 2L0DA 1CL7L 5L2KA 4P57B 3SN6N 3SDAC 3O11B 4IMLB 4WGWB 3FQNA 3WS3B 2JJTC 5CJ5A 2D31B 2EE9A 2XKNB 4HX1A 4FQ1L 1H0DB 5IVOA 3SE9H 1VFAA 2IH1B 1OAQH 4JLRA 3QUZD 3UAJD 1F4HA 5K9QG 4XNXL 3OAYK 3OKNA 3H9SB 3L9RB 4LMQE 4XP6H 1CBVL 4CU8A 1J0IA 2K9UA 3MRJB 1U41A 3C2AL 3QDJE 5LAXB 2FGWL 3TBTB 4NM4H 2P47B 3VG0L 5E7FA 2GFBB 4KKCD 1P4IH 3L3OA 3LRGA 1LEKA 4TNWF 4GKNA 1KLUA 1G7JB 3BXNA 3GJEA 3KLHD 3PP4H 4Y4HD 3WS6A 4KDTC 1EZVY 1X5YA 4X6DB 5CWSA 1U8KB 2NXYC 1N4XH 3ORJA 5HVHB 2VN7A 5JDJA 4QY8A 4P0DA 1WWAX 5INCA 3C8DA 1J5OH 2IEPA 5DURD 1DUYB 4G42A 1LVEA 4ORGA 1EA9C 3ARSA 3DO7A 3I84A 2VLLA 1XF4B 1DL7L 4Z7UE 3GGWB 3SOBH 4N0FB 2X09A 5CLWA 4S11A 5D7LE 3MOBL 4YHPB 3HG1D 3S37X 1CF8H 3EJZC 1L0XA 1GC1L 1F4WH 2GK0A 5EUKA 1JGDA 1WLHA 3HMWH 5A43C 4HBQA 3VW3L 3MJ7A 1J0HA 2CLRB 4X0KB 2DQHH 4YBQD 1BPVA 2ZUQC 5A40E 1MCEA 3QWQB 4QRRB 2ESVB 3BE1H 3B4NA 4QTHB 4ODBD 3IDNA 3NABH 3QWOB 4NQCA 1CXIA 5FFLA 5FUZH 5ICZB 3G6AA 1R3LA 4HK3J 5J56B 3DV6B 3D39E 4ZUVB 2NQCA 4QXGH 4B50A 3V0VA 1RUAL 2GJJA 1SEBB 4LAQH 1WBZA 4OIBA 3KR3L 3SHSA 1RIHH 4L4VB 4I1NB 1MCFA 2CQVA 3QIUA 8FABA 1EHLL 4X5LA 4XMPL 2FDBP 4XNMA 1TVBB 5D7SL 1INDL 5HDBE 4ISVB 4U6HA 1XGTA 3UEZA 4LCIL 4S0TD 5E8OB 4W4NA 2C9AA 1HEZB 2EIZA 3C60B 1LILA 3KPOB 4E41A 5I6XB 1T66D 5C0CA 1RI8A 1UM5L 5EU3B 4ELMF 3GRWA 3FQUA 1OL0A 1NC2B 2J8OA 4R3SA 1EMTL 4DN4L 4OKVB 3B9AA 1FJ1B 2UZYB 3ULSA 1JWSA 2C1PA 3MPCA 1LO5B 4JFOB 4AEHH 1T03L 2DQEL 2VLRA 3QIBA 4IDLA 1GZQB 1XGYL 2VAAB 4MNHA 3IDMA 5KSAA 3MUJA 2NY4B 5DURB 1G7HA 3CLFL 3QDGD 3VFPA 3MLTA 4Y16D 3KYNA 4KJPD 1LP9F 4KK8D 1RZFL 1V7NL 3D0LB 1ZEAH 3CDCA 4WUKL 1VEOA 3KPSA 1ZT4A 4C59B 3EO9H 3IJHB 3NH7H 1DBAL 1P69B 1R3HA 3SDXA 2DKUA 3MO1B 4XC1L 2IBGA 5E8PB 3GMQB 3QEHB 3QIWA 4JM2B 4NZUH 1XR8B 3NTCH 7FABH 2OL3A 4JQIL 1NBZB 3VGEA 3HB3C 1AGBB 2E7LA 2VDLL 1A3RL 5MEPA 1MCQA 1X5XA 1BBJA 1I1YB 4DZBA 4U1GC 4MAUL 3OWEA 1CFSA 5HD8D 2APBA 4Z76B 2D4FA 3NCCB 4OZIF 4KTEL 1FRGL 1Z0MA 4O02H 3E8UH 2Z0BA 4MDJA 4NDMA 5CKGA 1A7QH 2DB8A 4PJ9A 1EEUA 2CGRL 1YUHA 5I1HL 5CLTA 3LS5H 4RSVA 2A77H 2XZAH 4PJFA 1XIWC 4PP1D 2J8HA 3VXSD 2JJSC 3TBVA 3PP3K 3L95B 4ODXB 4D9RE 3KPPB 3DRTA 3INUH 1HCVA 3NZ8A 1P4LB 1AP2B 4Z95H 5E2UH 3O8XB 3PHOA 5ICYA 2NY4D 3MRGA 4ZXBC 4JFDD 1RMFH 5EOCL 1AY1H 3QG7L 3C60C 4O5LL 1FIGL 5EH1A 1CXEA 4WUUA 4NOBA 1G6RB 1UVQA 4KTYA 3V5DA 4JFZH 4JDVB 3HB3D 4X9BA 4OF0A 1JFQL 3BISA 4YLQT 1V05A 1WVZA 3GSNL 1J8HD 4JFZL 3VI3F 1LP9B 1MPAL 1TETH 1L9NA 2O61A 1N6QH 1CQKA 4X98A 1K3IA 5IFHL 4HUWB 1NC4A 5GS2D 5JO5B 2LAGB 2Q3ZA 4H1LG 4YEEA 2EDXA 1SYVA 4L8SA 1KPUB 5IJKC 1SYVB 4RFOL 5GGVH 2V2WA 3IU4H 4MX7B 3SKNB 3EOAB 4YWGL 3MACL 3MBXH 1CD8A 2A77L 3C2SA 1NFDB 2PTVA 2IQ9L 5IT2L 2P44B 1L7IL 3LY6A 3FMGL 1CDIA 2CGRH 3NFPB 5I1LB 1WFOA 2X89D 3QEUB 3MRBA 3FB5A 3ZYZA 1WCQA 4H8WL 2J6EL 1IGYA 3CSYA 3O41B 5D71L 2KZWA 5HHNB 1Q9OA 1S5HA 3TZVA 5E6IB 1YMMA 5C2UB 1WAAF 4U7KA 3N1PC 4RDQG 1T66C 3MRIA 4FXLA 2FZ3B 4U7SA 5DJZA 5F3HA 4GRMA 4EN3B 3RAJL 1KJ2B 4G8EB 3T0ED 3THML 2FYYB 3LSOA 4X4XA 2X4PA 5C0GA 5L88L 3WIIL 3D0VB 4X6BB 5GXBB 1L6XA 2XXMB 2XWBA 3CSBA 4X9FA 5FCUH 2HKHL 2FEDD 5HJ3B 1ZEAL 3FOMB 3X12A 2I26N 3LKSB 2DQIL 3MRCA 1BD2D 3MJ9A 1U3YA 4KPHL 1J8HB 1XZ0A 4LSVH 3CFKA 2VITA 3VD5A 2R0KH 2HRPH 5F1IA 4M43L 3SGEH 4XZUA 4XP5L 1KLGB 1RUMH 5KVFL 3RZCA 3MQIA 5B39B 2EE2A 1XGYH 2ZUVA 4WFHD 3BUYB 5IMOA 1X5AA 4NM8L 4UNVA 3MC0A 3RBSA 3P0VH 4QHMA 3T0EE 4MXVF 1RK1A 4CVXA 2R1WB 1T7ZA 3WFCH 1D5IH 1MWAH 4X6FA 4JRXE 4KV5E 1UM5H 3F7QA 4DUWA 1C12A 3P30L 4U33A 1DEEA 3NN8B 3N9GH 4L4VE 4GUPB 2ICCA 1WV7T 4KUZH 1FYTA 3DHJA 3QCVH 4RMVA 2PW2B 5CZXC 4UDUB 1IC1A 2IALB 4W6WB 3VD4A 3MJ8A 2VQ1A 3LN5A 2HJLB 1ORSA 2FLBT 3L5IA 1I7RA 5DXWA 5HHVH 4ACPA 5JUEH 4HPOL 5E8DL 5HHPB 5T1KB 4F8TA 1JUFA 4P4KA 3IDYC 2A9NL 1OM3H 4HMDA 1UADC 3MLRH 2ITDA 1P9MC 4M6MH 5ACMA 3V4UL 2MMXA 3EYFB 2BERA 5I71C 5IG7B 2GW5A 4M7KL 4HZAA 4LCCC 4PJ9D 1V7MH 3QEQD 1PFCA 1K8IB 3BKYH 3ESUF 4RGNE 4PLKD 1WUNT 2H3NB 3EJJX 3ZKNC 1ZANL 4KKLD 5TDNA 3H42L 3GSVA 2GITB 1INDH 2FJHA 2EIZB 1RJYA 1P7QB 1KELL 3ILPA 3QHZH 3GMMB 4UV7L 4KAQH 4E5XB 5C0BA 2VISA 4NO2B 5HJ3A 4CVZA 5INDB 4JY5H 1CK0L 4C56B 3QIWD 1E4WL 2XA3A 4XCFL 4WENB 4XCEB 1SM3H 3LEXA 5E94A 4LLWA 4AIOA 4FNLH 1RZJH 1MFBL 4P5TB 1BZ9B 3PQYE 1YQVH 1MFCH 3EW3B 5CBEB 3RWHA 3EGSA 2DQUL 4AIXA 1OARH 4WY7L 1F8TH 5DDHA 4ZNEE 4OLVH 4ZQKA 1KULA 2BY2A 5FCSH 3SDYL 5EZIH 4YR6A 4LLVB 4LSQL 5DJ2B 4DOHE 1DSFH 3CMOL 4ORZC 4G8GB 4IIQB 3K0WA 3B9KD 5AAWA 4PJDF 3S6CA 5B38B 2FGZA 4NZDA 1T5XA 2I5YH 1A7PH 4EOWH 3RP1A 1MIML 5MEQA 1OVZA 3VMNA 1Y0LA 5F44A 5EA0H 1AQDA 2P46B 3CFDB 4XPFL 2BHYA 5GGRY 3S4SB 4ALAH 3I2CL 5C0JB 5FHBH 1YZZA 2VXUH 5JMOC 3ZYJA 1UZ6E 3LQAC 3QIUD 4B7LA 3F62A 4Q2ZB 1FRGH 2A0LD 2VZ1A 3WNLA 5EO0A 2EDJA 4U1JA 5T1LA 2YUXA 1LEGA 2HT3C 4O4YL 3BHBA 2BC4A 4JPWL 3GSVB 3OKMB 3OPZL 2NCMA 3CUPA 2BCKB 2OCFD 3QIWB 1UJ3B 4S10A 1B9ZA 3KHQA 2DI9A 1E28B 4XBGB 4NKIL 4OCWL 4ZG1A 3G6DL 1NJ9A 1FL5A 1Q0YL 1XF5B 3LN4A 4J8RB 4QRTB 3OJ2C 4GG6F 2HJKB 2F5AH 15C8H 4JFQB 3WE6B 4QRPB 1FPTH 1YECL 4OTXL 3MOAL 5E5MA 5AYQA 5F93C 4GW1B 4XMLL 3QEGL 1CGVA 1P5VA 3UXFA 2CMRH 1BZ9A 2MQCA 2WWKO 4UAOC 1MIMH 4NKOB 1MHEB 1JZ2A 3O3DA 1S8DA 1JPSL 2J6EA 5H2BA 2A6DB 1FN4B 1GGCH 3TO2A 1HHJB 2ADJB 1DVFA 1D6EA 1QFUH 3PL6D 4KHXL 2BVQB 4NN5C 5HI4C 3LQMA 1YNLH 3RVVC 1RUKH 5CEZE 4M6OH 5HYSB 1AGBA 4TSBL 1O0VA 1WICA 3BMWA 4JZJB 4FQHB 1QSFA 1S7UB 2R23A 2NY5L 1SY6A 1NC4D 5DMYA 1UWGL 2YN3A 1D5MA 2HT4D 1AXTL 4U1KB 4BZ1H 3S4SG 1T6WA 5CCKL 1FC2D 1YEEH 1FO0H 3OL2A 4MD4B 5HGAA 1P7HL 2GUOB 4KKLC 5MHSE 3T04D 2WMPA 4MQXD 2ERJB 4JCLA 3L6FB 4N8VG 4Z78B 3L6FA 4NCDA 5FM5M 3ZL4H 1T2QH 5L6YL 2V5MA 1A5FL 2BNRD 2W38A 3G5XB 3P73A 1LO4H 2A38A 5D2NC 1X5HA 3RWDA 4TTDD 3PQYA 2QQKL 1KT2B 1H3XA 2EDKA 4Q9QL 2YD4A 3LPWA 4FQLH 4TYUA 4HQQL 3UX9B 5DI8B 4R3SB 1BVKA 3WLWD 1D5MB 1UACH 4DJMA 3GMPA 3PNWA 3PABA 1OLLA 1S7UA 3W82A 5FA3B 3NA9L 4HSQA 4LOUC 3BGAA 3O2WL 4ZPTB 1RUKL 4OF5A 4HD9A 5MEOB 1A6UL 1NEZB 2FX8L 1Z6JT 3JUZA 4LEOB 1R5VA 4OD3L 5E6IA 5C0BD 1PBYA 2ZSVB 3OKKB 5EOQH 1IE5A 1V8HA 1NUFA 1FFQA 2AEPH 3PIQA 5DHYB 4F80A 2OR8A 1WITA 3ELAT 1RZJC 4GQ9L 5CP7B 3WIFA 3P4LA 4M43H 3V6OC 1NL0L 1YA5A 1DCLA 4KRLB 4F7EA 4KQ3L 2A6DA 4PGCB 5D7JA 4GRWH 2CRZA 5DLML 3L3IB 3DROB 3TYGH 3GUTA 1F90H 4DVBA 2MCPH 4UIKH 4WHTB 3CK0H 4P2OC 5BZWB 1WT5C 3QO0A 3KYMA 3RBGA 3HRZB 3G5VB 4L3EA 5ADPL 5CEZD 2J5LB 3THMH 3VWJA 3TBWA 1X5ZA 4MJID 4I2XE 4WCYH 1MFAL 1MJJB 4M48L 4Z7UB 4GLRI 5C0AB 5IB4B 4OAWB 1DBBH 2DYPB 4GXVH 1UA6L 4GRWE 3ROLB 2ITCA 5EC2B 1UM6L 1H3PL 4D9QE 3LEVH 4LL9A 4OLZH 4JDVA 2IADB 4PJ5B 2QSTA 2WUCL 5FYLL 2RCSH 4F7PB 1DSFL 4AT6B 2W9EH 4JO4H 2P8PA 3D85D 4MJ4A 3SDCC 3MBEB 2C7UA 3ETBF 3UZEA 1A1OB 5JW4M 1J10A 4PG2A 4RMSA 5I16B 5DJYA 1KYOK 3B3IA 4LSDA 4F9LA 2VH5L 3T3PE 1T22B 1P53A 1IKFL 4PJAA 5FDYA 3L3OB 4PJCB 5I76A 4AIZB 1A7PL 4EOWL 6CGTA 4PJDB 4G3YL 1C1EH 2V2WB 3SKNA 3STLA 2UWEF 3W0WA 4CUCA 3RZCD 3WXVH 2VSCA 4EUPH 4BKLB 4AMKH 1PAMA 3ILPB 3W2DH 2DLFL 1I8IA 1JYVA 2Y07H 4G8GE 2XZQH 4NUJA 3QHZL 1QPPA 4MB4A 4WDIA 4C83B 1DQQA 1FORH 1PEWA 2AK1L 3GKWL 2H41A 3VRIA 3UYOD 2QQLH 2CRIA 2JKXA 5FF6B 4LRIA 4MJ5B 5DC4B 4YR6B 5I6XC 4HG4J 1N59B 2CDGA 2JCCF 3WL9A 1FZJB 2DQUH 3ULVL 2LU3A 4R0LB 1LE9B 3Q6GH 4LNRA 4M6ML 4Z5RA 4MJIB 4PTTB 4L8DA 3AAZA 3NTCL 1NMBL 4MZ3A 1VFBB 1BQHA 3P0YH 3TGXA 4ZFFA 3AU1B 5IVXE 3MFGB 3I3BA 2FNBA 4GUPA 4GBXA 5FYJL 4F57L 1FGNL 4N0CC 4NCC2 3WNOA 1KG0A 3F7VA 4UUJA 4L8BB 5IMKA 3WNKA 5T1LD 2X10A 1X5FA 3W5MA 2D7QA 4EIGB 3W9EA 3OR6A 1JYXA 4PRAA 1I9IH 4POUB 1RZGB 4PV9A 2QQNH 3VI4F 4WEMB 1T20A 3IJSA 4KY1H 1NCUA 2R0LL 3Q0HA 1GVIA 3RDTC 2Q6WB 4GO6B 1YJDL 4BSVB 3NGBB 3QI9C 1UCTA 3CXDL 5F6HI 2IANB 4JFFB 3HPJA 3MRLA 4NSKA 4O2CB 4EBQL 3QRFM 2H9GA 3O2DL 4BFGA 3V5HB 5DUBB 2E3VA 3C9NA 3QUYA 2ZSWA 1KBGH 1FFOB 3EO1A 3PGDA 2R8SL 4R2GB 1DUZA 3KPLA 5T3ZL 3QUMA 3RVTD 4B53A 1J8HA 1XZ0B 1DLHB 3PABB 4XP5H 2A9MH 1JZ7A 4K23H 3ROOB 3O2WH 4NRZA 3VDAA 4OD1H 4XC3L 5HGHB 2VQ1B 4JZOB 4Z0XB 3VH8G 1HOCB 2C3GA 3GSXA 1U3HD 3TBYB 1SHMA 2WWMC 5D7SH 1T1WA 3K8LA 4NKDB 3VXRB 1LGVA 1QG3A 5LXGH 1BBDH 1BIIB 2JJSA 1H3GA 4LP4A 1NCDH 4AH2A 3E6HA 3EYSH 2V5TA 3L3KA 3VXSA 5HVWA 1E4JA 5JW3L 1C08A 3Q1SH 2NXZC 1RK0A 4WWKD 1TTFA 3ZMRA 5I75C 1RK1B 4Y8AA 1RIVH 4Z18A 3MV7B 4P3WA 4KFZC 3QFJB 4DTGL 2Z8RA 5CZXD 2BNQE 3WNMA 4YC2C 2IBBA 3L7FA 3IFLL 5GGTA 1FNHA 43CAB 4HKJA 1AGFA 2ZOKB 3QPXL 4P5KB 4HFWA 1IAOA 2NY3B 1MVUB 3IAGC 5DJAA 3SDDB 1UYWH 1D9KA 3OG4B 2ZPKH 3ZT6A 3DX8A 4K3DH 5DC9B 1QYGL 3NACH 1QSED 1LO4L 4MLIA 1FZKA 3T77B 3MRCB 4QHUA 4L8BA 3RIAK 5H8DA 5E9DA 4LMQI 1MCWM 1CICC 3FZUC 1RUAH 1WTGT 3VXRA 3UYRH 2R2HA 4P49A 4YX2H 1WBZB 4P2RA 1QLFB 3IDJB 4HIIB 4K8RD 2Y7QA 1N4XL 3X3GH 4PJBB 4GG6E 3VGBA 1U8IA 4F2MB 3AROA 3QR2A 4NHUA 4F57H 1JRHL 3SGJA 4F33A 2V2XB 3P9WB 2Z31B 4J3UA 1OGTA 1K8DB 1A8JH 1JHKL 4F37K 1JF6A 2ICWI 1J0YA 3MRIB 4F7MB 1U8OB 4HXAH 3GSWA 3LKPA 4J6RH 25C8H 3FRUB 5I0ZA 3MRFB 3I85A 3QUKA 4N1EA 3LD8B 3TO4B 4X99B 1XIWD 4ZAKC 1I1CA 2D3VA 4U1KA 4GXUM 3RRQA 1IQWL 2NW2A 1C16B 5IB5A 1PEZA 2NY7L 4LF3A 1UZ6F 5TF1H 1J5OL 1CFQA 2AS5M 3FB6B 3GEWB 4L29A 2I9LA 1OF2A 1ACYH 1U6AH 4QEGA 3VXUD 4WGVB 5KVGL 1J86A 3DGGB 4WWKB 2DMCA 1IT9L 4ONFH 1AHWC 3SJVE 1R0AH 4Y5VB 4QY8B 2APTA 1I7UA 3FQRB 3NVQA 5BVPH 1NEZG 3C60D 4PLNC 2VL5B 3V4VH 1JN6A 3KJ6L 3NIFE 3RKPA 3AY4A 2B5IC 1TZIA 1DQML 3BP4B 5EG6C 4BYHA 3NCJL 5DVNA 4F15B 4GMSH 1EFXD 3JZ7A 2B4CC 4ESKA 4ODTL 4KI1A 1Q0YH 5I2IA 3CAFA 3TN0C 5LAXA 4AENB 2XXCB 4JFHE 1Y18A 2X7LA 3VFTB 2OL3B 4K71C 2H6PA 3ZKXB 3S5LB 4RMRA 5L9DH 1A1MA 5E2UL 3S7GA 4GW5B 4TUOA 3ZKMC 4FQJL 4FXGA 1AO7E 4LF3B 4XX1E 5T5FL 5IB4A 1OPGL 4BK5A 3GSQA 3WN5C 1MUJB 5IF0A 2CKBL 1W2KT 3C6LC 5C0FA 1J8HE 5K93A 3D2UD 1I3RB 1HN1A 1WIOA 4LLUA 3X3FL 2FO1A 4M1CD 4JDZA 3D18B 2IPUG 4U3XA 3S9DB 4WFFE 3EDKA 3TZVC 3KJ6H 2GT9A 1OAYL 3PWVB 3C2AH 2AJSL 5EU4A 4RIRA 4K3GA 4CJ1A 5SWQB 4ONGL 2DQGH 4YHZL 3GJFA 1BMGA 3VE0B 3TN0D 5GGTH 2E7HA 3MA9H 4MCYB 3S34L 2NX5E 3WLBA 4OZGB 3DUUA 5GRJL 4X83A 3VFGL 4XC1H 3RY4A 4JG0H 2O26U 3ARDC 2CO7B 1UH3A 1DTUA 2AJVH 4S1RH 4BK4A 4JFPA 4U1MA 5IOPA 4OV5A 3ULUL 1RJZA 1ZSDB 4HMCA 4KRPC 3KS0H 3UTTE 5I8EB 5GGUB 2W59A 1EFXB 3VD7A 2IF7A 2YZ1A 2ZCLH 4WW2A 4OD2A 2XI9A 3H3KA 1QSEE 1NKRA 3MUGB 3BP7A 4XVTH 3HRZA 1A4JB 1W0YT 1B0RA 1JRHH 1UQSB 1TZIB 5LGHL 3BKMH 2HH0L 4HIEB 4GQPH 5D6CB 2DLTA 1LO3L 4I3SH 2WBJC 4P2RE 1E4WH 3Q3GA 4XCFH 3WDIA 2GTZA 3ULVD 1AE6H 1F45A 1ETZA 3HI1B 3EYVB 1BLNA 4AG4H 2Y6SC 4P3DA 1LO5A 5LCVH 1AR2A 5EZOL 3D6GA 3TN0A 2YN5A 4DUXA 5KVDL 2YXMA 3IDXH 4GH7B 5FB8B 5IOPB 5I1EH 4LK4A 3T3PF 2IPUK 5DJ0A 5IFAH 4M8QA 2EEAA 4YFLI 2VLRE 4HJGB 3LOWA 1DUYA 4XB8A 1DL7H 5F9JA 5IB1A 1TQCB 2QBWA 5EPMB 2J3SA 1CGXA 3ZKMD 4PV8B 5DRNB 4K9EL 1RFDL 3B5GA 4XNMB 2X4OB 3HE6A 5HYEA 1KSRA 1L6ZA 5GGTL 5BRZE 1KT2A 1AE6L 3VGAB 5B38G 2YPLB 4JHAL 3BWUC 5C9JA 5LJYH 5DD5L 4PJHF 1ZS8B 5EU6A 3BKCL 4J3TA 1MAKA 5C0EB 3JWOL 2X41A 2X4UA 2R1YA 2ESVA 4CJ0A 4LHJB 1EXUB 1OAYH 1ORSB 5D7IE 3QUXB 5H37G 4P2OB 1NUNB 4NNPH 1NGYB 3ULUF 4JN1H 3HR6A 3KJ4C 1BVLB 4QKXB 4HDIA 1DLFL 3KWWA 2A6IA 3TH2T 2Z4QB 1QVOA 4PG9A 1EIBA 3OXRA 3PGCB 5HGBB 3BRGC 3T77A 2OZ4L 1U8HB 2E5EA 3H9YA 4PJIF 4Z7VB 5T3XL 3D39D 5DJZB 5F3HB 4XXDB 3RX7A 3MLZH 3VG9C 4LRNL 1A3LL 4CVXB 3LIZH 5CSZA 4LSRH 1N26A 2F8VA 5SWZB 1QFWH 3JTSA 4I4WA 4M62H 3U9PH 1KXQE 3QHTC 4C55A 1S9KC 3TJHC 5AD0B 4Y19B 4RBPK 3RL1B 2A74A 4O4YH 4NGHL 1X4XA 2ADJA 4FZ8L 4Y4KC 3O4LA 1NCCH 1MCOH 4NNXB 4LSUL 5DFVD 1GJIA 5DZNA 2AK1H 1KCVL 4LLMB 3NCMA 1CU4L 3U0WH 5AZ2L 3WIIH 4DAGH 2P5WE 4B7IA 3QDME 5MEQB 2FHFA 1WSST 3RAJH 5FDWA 1DBMH 2AXJA 1KEGH 2MTPA 4RRPG 2J12B 2P8LB 2JJWA 1OF2B 3BH8B 3IAQA 4PLJC 4BQ8A 3KXFE 1K4CB 4JO1H 3GIZH 4WUUE 4QHLB 5B39G 4J2XA 3CDGA 4NFBA 3RNKA 1RD6A 1XEDA 2X4QB 4RZCB 2AABH 1A1OA 4HV8B 1CGUA 4EN3A 4WV1A 4I2XB 3MLSH 3VGAC 4WI2A 5FGBC 2XKNA 3SGDI 3WFEH 4LBEA 2IJ0C 1FE8L 3CUPB 1QBLH 3NFNA 1N6QL 5KSBF 3D3VA 5BJTA 3BIKB 3OKDA 3HCVB 3VGDA 4JZJC 2ORBL 1SYSB 5A2JH 2KH2B 4XNUH 2JCCE 4I3RL 1A4KB 5EORH 1KXVC 3UTQB 4C57C 1T1ZB 1QSEA 4DCQA 4O58L 1DQQB 5DQJB 2W0FA 3LEXB 4UBDD 1OGAB 3W81A 4IM8A 4NJ9L 5DA4A 2Y72A 4NUJB 4CMMB 4DGIH 5FGCB 1IC7L 4ZOCA 1JGLH 1XGPB 2NY4C 4PJ8B 1UXWA 3QISA 1F3DJ 5FO7B 1A6ZB 3UPAA 1HHGB 5DMKB 1OP3K 4M5YL 2QQQA 3OAZH 1FQ9C 3L5WA 2PO6A 4M1DH 4L4JA 1FNGB 3DI3B 5ERWA 2H3NA 2AI0L 1A9BB 3MV8B 1LE9A 3CMOH 4X80L 5J11B 1FE8H 1S7SB 3MRDB 4N68A 1CTNA 3MYJA 5JW4Q 1GOGA 2IG2H 4ODSL 4ONHB 3EDDA 1F4YH 1Q94A 2JJVA 1B2WL 3O6MH 3GKWH 1TJHL 4NN7B 1F3RB 3ZTNL 4NP4H 1II4E 4BSWB 1DP0A 2VWEE 5BCAA 3MNWA 3GIZL 4XRCA 2Z8WC 1S7RB 1ZGLM 2Q7NA 1ZT1B 4KTDL 3C6SA 3FOLA 2NY6D 4FHBD 3UDWC 4OAWA 4OV6F 4CMHB 1HZHL 4R96A 3T0XA 1OTSC 3IS0X 5ALCL 5FDWB 1DBJL 4YQXL 5HYIA 4Q9BA 5J6HA 4QWWD 5JQ6L 5I8KL 1AKJB 4P23B 2J8UB 3DX7B 1TZHA 1QFHA 2C3WA 4R97B 5TDNB 1DQDL 2EXWC 3ZO0A 1A1NA 3M1BA 5C9JB 5EUOE 3O4LB 2X2YA 2ICWA 1KN2L 4Y88A 4W81A 1TJIL 2V2TB 5DK0A 4PY7A 2ICEB 5IFJA 4HHAB 4PJHA 4U49A 5IQ7L 3GB7A 4Y2OA 3GHEL 1ZLWK 3WJJC 4GKOA 2R4RL 3O9WC 4YDJB 4XNZC 3NIDF 4U1SB 5C0RL 4MNQE 5F21B 5F1IB 4MA1B 3T1WA 4BFIB 4PV9B 4ETYA 3B5TA 3BD4A 2FJGB 1ADQL 1L4IA 1PZ5A 3QB7C 4K71B 1WCBB 4NO5B 5F7UA 3O0RL 2BFVH 3NCFB 1SBBA 5C92A 2J8UA 5B3JF 5EO1A 1HH9B 4JY6B 4URTB 1VFMA 2CLVA 3O45B 2XN9D 5I30H 3P30H 5FM5O 3UPRA 4ZS7L 3RI5F 3QO0B 1ZHNB 4CADB 1UCBH 4Y4HC 3C8KA 1N5AB 1LHZA 3F7PC 5ALCH 4XPBL 2QADC 4FABL 5GZOD 1DR9A 4MA7L 1C12B 4JN2A 1T83C 4HIXH 5JXEA 4PB0L 4POZD 1IM9B 2AEPL 2FX9L 2P7TA 3A6CL 3KYAA 1JNNH 4XXCC 4GXUN 4NHCL 3U4BL 2BJMH 4Z9KB 5D1QA 5BRZB 3CH1A 4J8RA 1UZ8A 4LPTA 2B1AH 3QHFL 1HHHA 4C54A 3LCYA 3QUZC 5TPWL 2AJUL 1GCFA 2JLLA 4LLYB 3EFDL 4M8QB 5KVMC 1AKJD 2CR3A 4YXKL 5D93B 4M93B 4P2QB 5EZOH 3MOBH 3MR9B 3VXOB 1CDGA 3ZYIA 5E95B 4PRDA 2HRLA 2ATKA 3RI5K 4L8SB 3OJDA 4OZ4B 1T1XA 1CD1B 3TO2B 2CRMA 1VA9A 5B8CB 4OLXH 5F71A 5EBLA 2IQAA 5DJYB 1BLNB 35C8H 2VOTA 3RKDD 1VFBA 3Q3GB 3BYTA 5JA9A 3PHSA 3T0EC 1EJOL 2ZG2A 4QRUB 3TBTA 5IBUG 3H0TA 2ZG1A 3EYQC 4FQ2H 3WHE1 2MHAA 1YNTA 2D7PA 4ODSH 5EA0L 4JR9L 2XRAH 5E2VL 1PQZB 1C8PA 4YHKH 4JHZA 1U8LA 4TN9A 3I3EA 3VXPA 2F8OA 3VRIB 1YMHA 4NWTL 4WV1B 2F5BL 2JTDA 4P9HL 5LKNA 5HVGB 1YDPA 3BESR 2GY5A 4U0RC 4A6YL 4EI5B 3FFCB 1D6VL 5IBLD 3TNNA 3QDMB 3KPRE 1GGYA 4LLDA 4Y4FA 4Z7WA 3T09A 4AENA 4HAGA 5JZ7C 4LVHC 3RWEA 2CMRL 5BZWA 5HYFA 4PJ7B 4PPTA 3C5ZC 4WI6A 2YWYA 3V6OE 3RZWA 1FVEB 5FYKU 1F2QA 1J8KA 4X8JA 2W0FB 3EYOA 3P11H 3GBLA 4YBLC 2E9WA 1EEYA 3WXWH 2LTQB 2F54D 1QQDA 2O5XL 3VXMA 1A7QL 3AM8A 5I18L 1MI5A 5GGRB 4I0PA 4CVZB 2I60H 2NZIA 1I7UB 2R2EA 1EJ6A 4OLZL 1YEDA 2AJ3B 1ONQB 1HI6B 5D5MA 3SKOB 3OKKA 3GSNB 1UM4H 2VXQH 3ZLQC 2WM0A 1RHHB 3QBTB 3MCKA 1YMHB 1G6RL 4Y0GA 1G7IA 4JLRB 3H42H 1CICB 1ZLUH 3ILQD 2AQ3A 1A7NH 2VLKB 3HAEG 2VZOA 1NGZB 2XFXB 4NUGH 5D93C 3IFNH 4ODXA 5HDBF 2BVPA 1JPGA 1G9NL 1Y18B 2X7LB 2M2DA 4LQFH 3S98A 5C08D 3MLXH 1F02I 4NO0B 3QUXA 2ZWLT 3OR7B 4X9IA 4PRHB 1F90L 3HZKB 4CVUA 2VIRA 1NAMH 3BDYH 2HMIC 2GSGA 2P43B 3VXTA 3U36A 2GYSA 1NL0H 4GG6A 4FZ8H 4OGXH 4DN3H 1M4KA 1MLCB 5J57B 4RX4D 4PS4H 5B21A 2V9QA 4Z76A 2DM4A 4Y5VA 1BQLH 2YOCA 1T3FA 4HK0A 3DJ9A 1I8KB 5EOTA 3I9GL 4QLRA 5KBNC 3ZDZE 1MJ7H 5LWYH 4CGTA 5I73B 3NAAL 4G6FD 4R26L 1CLYH 4YDKH 4P46A 5DD1L 43C9A 4XPAH 1YEHH 4R0LC 2AXFA 1QYGH 1NBYB 1S7XA 4HFWB 1C5DA 2BRRH 1HXMA 2GCYB 1CZ8L 2VWEC 4OFPA 4D9QD 3TWCL 4X7CC 5IQ7H 1A5FH 4ZSOB 2MSPA 2DYPD 5DEZA 2CIKA 2MKLC 1B3JA 2UVFA 1SY6H 1U8QB 3X3GL 3G5ZA 1TVDA 2DLEA 5ICZA 5KS9E 4P5TA 5FYLD 3QDAA 5K9KA 3BGFB 4PJ5D 3IDJA 4HIIA 3VCLA 3RVUC 3RWIA 4XI5C 5AYUL 1AH1A 3BZFA 3PXJA 5J6HB 3PG2A 5EO1B 4OKDA 5IK3A 1NMCB 4UV4H 3BRFA 4R96B 4K3JL 5FV2A 5B3NA 4ZD3L 5A3ID 4JAMA 1C5BH 4PV8A 5J12C 1B90A 2FD6H 4XH2B 4X6CA 3IFLH 1CF8L 3CFJA 4FQLL 4NKIH 4OCWH 2GY7B 1S9XA 4UTBH 3T4YA 1KNOA 3KPOA 4P5KA 4M9OA 4LPWA 3IDXL 3DVNB 3NFSL 1HQ4B 1I1RA 1YQ2A 1VB9A 1BIHA 2K3TA 3QNZA 2HJFA 3QZWG 3WIHH 4HKJB 1MY5A 5DUML 2E6QA 2X1WL 2KZ1B 3RNQB 4L8CB 5GRUH 4KDTA 2BVOA 4LU5H 2VLJB 5CGMA 2P7TB 2GSIA 3CXHK 2OLDA 3MXWH 3GJEB 5I17B 2BVEA 3H9ZA 4KROB 1DE4A 5EBMA 5ACZA 2DQFA 1KIQB 3IDNB 4NQCB 5C2BL 4QRSA 1HDMB 3HC3L 2AEQH 2OK0L 4PJXA 1MREH 4PJ8A 2WINA 2BVTA 2AW2A 5CEYB 2VTFA 4LVOB 3VXME 4IRJB 1KIPA 3M45A 3T2NH 3KVQA 4X6BA 3CFCL 1PY4A 4XP6L 1MQKL 2DRUA 5FYJH 4TNVF 3KDMB 3AFLA 5IV2A 2M1KA 4NN5B 5KVEH 3HZMA 2NTFB 4TUKL 4OZHB 2BCKA 3R0MA 4PLKC 1NCBL 3QQ3A 3P4MB 3VG9B 2NXYB 3D87B 3SBWC 2C3VA 2AXGB 1IILE 5I1DB 1Q8MA 1I3GH 5I1KL 1EBPA 3V9FA 1LK2B 1T1YB 5ANMA 5CMAA 4X7FC 3OB8A 3SDCB 3T65B 1T7XA 4OJFL 5FV1L 4XVSL 4PB9H 4Y4KD 1J87A 2OYPA 4Y5YA 3L1OH 3C8HA 3DPBA 2ZJSH 2NX5B 5H94B 1QLRB 4MHHI 4P9MH 4G9FE 1J05A 4LLAA 1QKZL 4IDJL 1NGQL 4HUVB 1F6LL 2DIJA 4AEFA 3KYKL 3PDGA 4LLDB 4Y4FB 2ATKB 4Z7WB 4WHCA 1ZHBB 5GRVK 4FQJH 3RIFF 3TNNB 4XP4L 4UB0L 2GK2A 5E99L 2F5BH 3F6IA 5JXEC 2MJWA 3K8KA 3N85L 1ZLSL 2WWMD 2OXGA 3UTQA 4O51A 2UZIH 1I4FB 3MNWB 3VFMB 5IHUL 1LDPH 5ANMB 2PXYA 4ERSL 1IQWH 2V9RA 2W1NA 1YEDB 1FSKB 2AJ3A 2AK4B 4RCAA 5HI5C 1KC5L 1CLOL 2OQJB 1M05B 4FQQA 3PWNA 1FYTD 1UVQB 3F65A 4P3CL 4YBHA 4PJ5A 5BXFA 1VKXB 1NPUA 2MHAB 2DI8A 1B88A 1T4KB 5HI4D 5T1KA 1MCPL 1DANT 2AV7B 3OKYA 2N4IA 4PGBB 3BGMB 4RWYH 4RMUA 3UJJL 4KKCC 4BQ9A 4TUKH 4J3SA 1P4BH 4BZ2H 4UT9H 2XA8L 1JGLL 4JPKH 4P9ML 5BQ7B 3NH7L 1AD0A 3HLAB 3RIFK 3DIFB 1KOAA 4DQOL 4PJCA 4EI6B 4PJGE 3VMPA 1FG2B 3W0WB 1IC4L 3MGTB 1OQOA 4JN1L 1K2DB 5D8JH 1P7QA 3ARQA 4U1NA 5ABDE 3KJ4B 4P5MA 1QSEB 4DCQB 4K7PH 4NRYA 3ARPA 3FB6A 1RJLA 2VLJA 5D4QA 4MB5A 4HW6A 5IB5B 3GM0A 3M8OL 5BZDA 1DFBL 5FUOL 3FFCE 2ED7A 5ACLA 4U3HA 1K85A 2B5IB 2QADD 1JHKH 5TE6H 1OM3L 4TPRL 3MV8E 5HHOA 3RIAF 5EWIL 3V0AC 5EPMA 4NIKB 5KANI 2DF3A 4HPOH 5E8DH 3X13B 1WTLA 1V3JA 3OBAA 3ZDYF 5K9JL 4XPBH 1AHWB 4HV8A 1HH6B 3EO9L 4HCRH 3C09B 5ILTH 5JHDA 1R3HB 4KUZL 3WS6C 4MJ6B 4U1LA 3UPRB 4APQA 4PJIE 1BFSA 4OQTL 4ODWA 3KYMB 2P5WA 3G5XA 3AS0A 3NN8A 1HOCA 4JG1L 5HHXH 4K3DL 4D0BB 4NN6B 1MI5D 4IRZL 3RVVD 5CD3A 2QL1A 2XZZA 1D5BB 1F11A 4RGNB 4XRCB 3I6KA 1O5DT 2VAAA 3OF6A 4KKBD 1U8QA 2H32B 4U1SA 1GGBL 2IAMA 3S37H 3BVNA 5HHNA 4N5EC 3SO3C 3R4DA 4PGEB 4OZFH 2EH8L 4JPIB 2YPLE 3BPCA 3D3VE 3NPSB 4K9EC 4YXHH 4IOFD 3PDOB 4X6CB 1KJ2L 4YBQC 1YPZE 2UWEA 2PO6B 3TYFA 2NNAB 3C8KB 1HYSC 2UYLA 1V5JA 3TBSA 3MUZ1 4XC3H 1S3KL 3I6LD 4WO4A 2VYRE 1BX2B 5C09D 2DIAA 3EBAA 4DEPB 2CR6A 5K9JH 4ZFFB 2VIRB 1MJ8H 2LU7A 3O6FC 2BP3A 3U36B 5TFSH 3SEPA 5C6TH 2VB5A 4QTHA 3CVHL 2ARWA 2JCCB 4YDJA 4GRLB 2AV7A 4JO2L 3H9SD 1U9KA 3ZE2E 5SWZE 3GI9L 5CIPH 4L1DA 1VCAA 1M7XA 1RULH 1I3RA 2PO6C 1MF2H 1RUML 3TZVB 5KVFH 4QRRD 3LPFA 4IEFB 1RJZB 1ZSDA 2F58L 4WO4D 3RJQB 3TJEH 4U1HB 2DICA 3V6FB 5FF6A 5E1AA 2V9TA 1ZK9A 2XFXA 2W65B 3GMRB 4XCYB 1A6VH 1NGWB 3LHPL 5I71B 4DKFH 1I3VA 5D2LB 5C0CB 4GAYB 2YSSB 3LB6C 4HC1H 3AVEA 4D94A 3LD8C 3TO4C 5IHZA 4JKPL 2JJUA 2Q8AL 3JTTA 2VLLB 1TZHB 1KCSL 1NFDA 1RY7B 1GGCL 4HLZG 2BC4B 4YDLC 3A6BL 4L4TE 4JPVH 3FQWA 2XWTA 5SWQA 5JXAL 1EEYB 3WJLC 3X17A 1MFEH 1N6VA 1MLCA 2JELH 1N2RA 2FATL 1FGVH 4GBXB 2W0KA 2CLZA 2IAMD 3TT3H 3JSSA 1NC2D 4M3KB 4Y5YB 4ZNCD 4FOMA 4PJGA 1CU4H 1JZ4A 1QFWM 1XGUA 3IDIB 3OX8B 3HMWL 4LLQB 4R7NA 4P2YA 5D71H 3DGCR 4G6AD 2BOCA 4JDZB 3RWCA 3UMTA 3OF6D 1P9MA 5I8EA 5HPMA 3TP4A 5A16B 1Q0XH 3GJFH 2AABL 4YXLL 2K1MA 4O51B 3C08L 5DQ9A 5JHDD 5J06A 4NKMB 4JFXA 5F7DA 3QT2A 5ISZD 1I4FA 3OKMA 5IJKA 3NPZB 3VDBA 1JHLH 4EEEA 3U0TB 3RTQC 4AM0A 2CK2A 5ETUB 3SE4C 3IXAA 4ZTOL 5JA8B 5BOPA 4U6XB 2BOBA 2YUVA 3VFTA 3NA4A 5MERB 1KFAH 3HNTL 1JWUA 4BKLA 1YEIL 3VXMB 2VXVL 3AS1A 4JM2D 4CMMA 4PRNB 4K55A 4YHML 2AQ1A 3V8OA 3HI5H 5BS0E 2QHLA 1DE4B 1OSPL 1R5WA 3BRDA 4LOUD 3IDMB 2NX5A 3T65A 5C0CD 1U8IB 3LV3B 5EIQA 4F2MA 1KUMA 1JN6B 5F7NC 2F53E 3PJSA 1WBYA 3WIFB 1UM6H 3IF1B 3WFEL 2KKQA 1KYOJ 3CNKA 3O4OB 2YD1A 4Q7DA 4M7JH 2Y1VA 4FXKB 9CGTA 4EXKA 3LPGA 4FP8L 1WFTA 5D1ZA 3QDGB 3LH2H 2V7NA 3T2NL 1VENA 1S7TB 2PW1B 2NTFA 4L9LB 3GDBA 4P2OD 3MO1A 1FVCA 4GAFB 5D1XB 1IL1A 5HY9B 3DUHA 5GIRB 3TC9A 4KVCL 1FFPA 1F58H 3L5HA 4IOFC 3B9EA 3CX2A 3RX5A 4N1CA 3LKQA 3U0WL 2ICWJ 1SEBA 2ITDB 3BI9X 4XAKE 3E2HB 4HGWB 1TXKA 4NT6B 4X5XB 3K1KC 2PNDA 3BEWA 1Q9LA 2RJMA 4QXUH 2Y7QB 1CGSL 4GQ9H 5GS1B 4LPXA 2BXZA 4NQEA 5AD0A 7FABL 5DHVA 5IIEA 1RZIA 1KJ3L 5E2TH 2NNAA 2Y25A 3ULVE 5FECB 2HYMA 5F3BA 4HFUH 1OGAD 3Q5TA 1CGTA 2R2BB 5CCKH 1S9XB 5ICXB 1QO3B 1E6OH 2MFNA 5JR1H 1W8OA 3CC5B 3T0DA 3V4UH 3GHBL 4M7LH 3SDDA 2ATPA 2F54E 2R0WH 4V1DE 4PGZA 2V2TA 1ZWIB 1TIUA 3WDJA 5LCVL 3GI9H 4PGEA 5IFJB 1FL6B 5EZLB 3TPUA 4LAQL 4TRPL 3UTTD 2P1YA 4Q9CA 2E9BA 5AG9A 2CK0H 4M7JL 3CXDH 5DVOA 4PJGF 1FV1A 3EZ8A 4Q58C 1IGIH 1JIBA 1K8DA 2CXGA 1XCTA 1R5WB 3STBA 2EZ0D 3DTXA 2VDOH 5FO9A 5DO2D 4HBCH 3RGVC 3C5ZD 1B0RB 5CGYC 3D18A 3HI5L 1FO0L 3ME0A 3MGOB 3D3VD 1I7TB 5DGRA 3MUGA 1U8NB 3DX6B 1MNUL 2BSRA 3X11A 2J1KA 5L8JB 5SX5K 2DBLL 1C5DB 2YXFA 1FVCB 2NY6B 2IC2A 5HY9A 4EN3D 2VXSL 1T80A 4UI2A 3IFNL 4BUHA 4HUKB 3DX8B 1JV5A 4M6OL 2F5AL 2VQUA 3C6SB 4L9LA 5FK9A 3D5OF 4RGOL 3FO2B 1A1MB 3VGGA 4XWGL 1PLGH 1R3KB 4LCUB 3ZYOA 5D96B 1S5HB 4TQEL 4NJAH 2XACC 1ZOXA 1BD2B 4RISL 3BVNB 3EYQD 3BUYA 2VXQL 4WTZG 5F7LB 4HS6B 3T0BA 3LAFA 3NCYS 1WBYB 1Z3GL 1UT9A 3ZDXE 4AH2B 5JIPA 3OGOE 1BZ7A 1NMCC 1FZOA 1X5IA 2AJXL 1G7QA 2FJFA 1IGJA 3LKOB 3VW3H 1YN6B 2OI9B 3QIBC 3WXWL 4W70A 3RDTD 1X7QB 2OBGA 3QA3A 1QNZL 4NUGL 2J4WH 1IBGL 1JP5A 2R0ZH 2UUDH 3BGFC 3S88L 4APQB 4U6XA 1GOHA 4XNXH 4OGYH 1I1AC 4PREA 1BQHB 3UTTB 1GGIL 1T1ZA 2R8SH 1IT9H 5F88A 1R0AL 5D7LB 1S9VB 3QXAB 1MHHB 5F9WB 4X7TB 2Q7YA 1KCSH 3UJJH 2FO4B 4OLYL 1YPZB 1J11A 3X13A 4FXGB 5B3JE 1IARB 1A0QL 5KW9H 2GAZA 5I1JL 2FH8A 2P24A 3E0GA 4MMZC 3MODH 1JZ3A 1K4DB 4A6YB 1MCIA 3JUYA 3IF1A 3O6LL 2XYCA 3Q6FA 3FTGA 2DLIA 5KZCB 2ZCKL 4CW1A 1G9MC 4MCZB 3GSWB 3LKPB 5IWLA 2VDPL 4RZCA 1GGUA 5CJXC 3MV9E 3U0PB 1A7OL 2XN9E 4OZGE 2YPKA 1KENH 5GS1C 1FFNA 1KCRH 4H0HB 2FHCA 5C8JA 1ZHBA 1Z9MA 3ARDD 4HPYH 4GFTB 3H7BB 4IMKC 3E6FA 1QBMH 3BQUD 3L95A 2AERT 3JWDC 1AJ7L 1HSAA 1CDJA 1XF1A 5INDA 1MFAH 4JM2C 4JRYA 3PV6B 4LLMA 4HKZA 3O2DA 4F3FA 4OGAD 4QNPF 3CFEB 4NNXA 2VZ3A 4JFEB 5J8OA 2XTLA 2R0ZL 4I3GA 1UH2A 5E08L 3DMMA 3ULVH 1ZGLP 3MREA 5E2VH 4P48A 3DV4B 4ZSOE 1GPOL 4X98B 3W11C 5DQDL 1U8LB 4BA8A 2DTML 4L9LC 2FR4A 4F7PA 3VXPB 1CI5A 4C56D 3KS0J 4A6YA 3BKYL 2P8PB 4RX4A 1J1XH 4M7LT 3EJZD 4U1IA 4QHNB 3HHRB 3P9MA 1R5IB 3NFNB 4MHHG 1BP3B 1YEFL 3QJHA 1NEUA 2BNUB 1EVUA 1C08B 3U4BH 1U8OA 4D9LH 5DEGA 1K6QH 4HC1A 3G08B 4DKDC 1QRNB 2P5EA 1A64A 4O00A 4BQ6A 3SDXB 2IQAB 2G5RA 4DGVL 3QH3A 2G60H 4ELME 4H20L 1HK6A 4D2NA 3TBWB 4PREB 1N2RB 3WUWA 1OWRM 4MB3A 3DUSB 2EDBA 5E2WL 1YMMD 5KJRL 1NCAL 2VH5H 3VA2C 3DETC 3KXFB 1PJ9A 3KWWB 1HWGB 4C56A 5LXGL 3B9KB 3STLB 1AGEA 4G8IA 4PJ9C 4UQ2B 2XQBL 2XNAB 1NCCL 5J1SC 5C3LD 2HTKC 4FFVC 1FZKB 3DSFL 1VFOA 5ALBL 3OJVC 1R3IL 4PRBA 4HGKC 4GS7B 1I1AD 2R1WA 4NHCH 2V7HA 4Y89A 3EKCA 1FP5A 4ZAKD 5T5NF 5FGBA 3ARDB 4R9HA 3QNXA 3BPCB 4HXAL 3ARTA 2GTWA 3ARFB 3BQUA 3DURA 4OCSH 1Q1JL 1ZT7A 4MA7H 3QFJA 3P77A 4ZXBD 5GHWH 4XPGL 2D7NA 2GJ6B 3CFJB 5ICXA 1TJIH 2XIDA 1MJ8L 2YBRB 5IP4A 2R2BA 1OY3B 4NRYB 2FCBA 2R69H 2B39A 4OCYH 5DMJB 5DI8A 4Z7UA 1AXSB 2CKNA 2FD6L 3EFFA 3BPNC 4Z77A 4N5UA 5IFAL 2A6IB 3HC3H 1BX2A 3AY4C 2VAJA 3DSFH 1E4XI 1GL4B 4J4PC 4KI5E 4KMLB 4ELMB 1NGPL 1XCQB 1ZVHA 5I8OH 1Z5LB 1DQLL 3MA7B 4JY6A 1PZ5B 2Q87A 2W9DH 5E2WH 3QI9D 1MCBA 2DL2A 4X5XA 1Q1JH 4OM1L 4R6UA 3AC0A 3QDMD 2NLJA 4H20H 3QJHB 2ZZUT 1ZV5A 3G6JE 4ZO7A 4AQOA 1UH4A 1BQHG 4NZRL 4QHMB 2BVPB 3V5HA 3MJ9L 4H25A 3OB0H 1HHIB 1HXMB 3ZZ1A 1S7XB 4HZLB 3UO1L 2GEEA 3KXFD 1S7WA 4U6YA 4I18C 2BY0A 2PR4L 1IKNC 5C7XH 3ARZA 3DUUB 4G6JH 1KJ3H 3TT1H 1VESA 1JJUA 3KR3H 2QQKH 3P3YA 2NY1B 1QSVA 4K8RL 3HR5A 4OZGA 3OAYH 1QA9B 4NRXB 5JLZB 2XZQL 4G6FB 3C09C 3VXUA 2NY5C 1J7VR 4KJPC 1TVHA 1CTOA 1FO0A 1CFNA 1IQDB 4I5BB 5AG8A 1KPVB 5DRZA 1ED3B 1NC4B 2CPCA 4PJEA 4JRYE 4Z78A 4NBZB 5C0JA 1XGRA 1KJ2A 2KQNA 2OM5A 4HUNB 2O61B 2R15A 4PTUA 5LQBL 1AO7A 2WP3O 4ZDHA 1N5YH 3K4AA 4JVPA 5D9SA 2DL9A 3OAUL 4YK4B 1NGZA 4Z8FL 3OKNB 2FGWH 2WWKT 2GK0B 2LAAA 5EUKB 4G9DA 4NKMA 1UWXK 1T89A 1CLYL 1KN4H 1HNFA 2D03L 5D8JL 3B6SA 4Z7WE 3GFUA 5SWSB 3O8XA 1QPXA 2Q8BL 4JRXA 3W9EB 4GW5A 4TUOB 3CFEA 4YFEA 2Q8BH 3Q2CA 1ZTXH 4MCYA 4MYWB 4HEME 5FAAA 3L5XH 3EO0A 1A6ZA 2VDKL 4HXBH 4DFIA 4NN6C 4HH9B 4YHKL 4MAYA 1D7FA 1PZUB 4MQ7A 5CGYD 3CGTA 5AZEH 5IB3A 1WISA 3HE7B 5IB3B 3KYOB 1G7QB 4WI4A 2V5YA 4UIKL 2C1OA 1E4XL 3ES6A 2C4FU 3EJYC 5M7QA 2BOBB 4KKNA 3GMMA 5IM7B 1WAAE 3D25A 2EE6A 5MEPB 3UP1A 5D70H 3B9VA 5IW3A 4UT6L 5DC0A 1NLDL 4G7YL 4JRXB 4CN1A 3F8UB 4OF3A 5BVPL 3WIHL 1E28A 3L5XL 2PYEE 1F6FB 2I25N 1BQUA 4XGZB 2X70B 1AD9B 4XGZA 2EKJA 4Q6IC 2VABA 2FIRT 3B2VL 4NWTH 1K4CA 2XZAL 3GSOA 3WXVL 1T21B 1URLA 1RHFA 5T1DL 1HI6A 5D5MB 2WINB 4G6KL 5AZ2H 3TIDB 3TA3B 3QUYD 3BH8A 1Q72L 4DKAA 3QHFH 3VRLF 5C0BE 5L2KB 2BX5A 3BZFB 4KI5D 4LCCB 4PTUB 1QLRA 1JGUL 5I1IH 4K07A 5AZEL 1XCTB 2H2SD 2WQ8A 3TV3H 4GAJH 5F6IB 1OOAA 4DVBB 4N8VA 4JE4B 1YY9D 4PJ7A 3TEUA 4BELD 3OGCA 2VDKH 4LHUB 4KI5C 3BPLC 32C2B 3F12B 1X5KA 3K2UH 1I1YA 1MHPH 3G6JA 2KUTA 2NX5D 3H9HB 5IW1B 2EH7H 2ITCB 5EC2A 4JVWA 2J7LA 1NEZA 4YHYB 4UINH 1AFVL 4Y4HA 1I8MB 4CAGA 5FA3A 1QZ1A 5EZIL 5KOMC 4YO0B 3KPRB 2H32H 1P6FA 3SGKC 4MAYD 1ADQA 2PYEB 1U8HA 3JWDL 3QRGH 1CDCA 1QP1A 1R24A 3KG5A 3DRQB 5FM4A 2R56L 4PJXF 5IG7A 2PF6A 1XT5A 1T6VN 4LPCA 4XP1L 3N50A 1RK0B 4PRID 2CUHA 3QUZA 2FIKA 1MLBB 4WJ5A 4LQ1A 3KLDA 5I9QB 3HZKA 3EYSL 3U7WH 2PCPA 2D7OA 3ARGA 1FYTB 4X6CE 4XMLH 4H8WC 1BREA 5EZLA 1JGDB 3TPUB 2A1WL 3QWRA 3SDCD 3WFHA 2DDQL 2PXYC 5DSCB 5KAQF 4PY8J 1CDHA 1VADA 4LCIH 3FOLB 1BEYH 4XVJL 3O6KL 3L3JB 4S2SA 2VC2L 3OJMB 4LDOB 3LMJL 4HCRL 1A2YB 4LPVA 4PRIE 1QBBA 3BX7C 4S1RL 2EH7L 2ARJQ 4U1JB 5T1LB 2XOTA 1XGTB 1HHIA 2Y9RT 3HFML 2HFEB 5MENA 4PB0H 3N0PB 2OZ4A 1CLCA 2OR9H 1S7SA 3MRDA 3VWKA 2CUMA 1A6TB 1CXLA 5HPOA 3RHWF 5BS0B 4P5MB 3QULB 4PLJD 2WNGA 5HHME 4ZPVA 1IGTB 3MJGX 4WJ5B 1I85C 1O7SA 3MGTA 3FMGH 3STZA 4HIEA 4APQC 3F6LA 5FHBL 3D39A 3ZE2F 2PW2A 3UYPA 1OSPH 1T1WB 4QRRA 2YMXL 3MV9D 2WIMA 1P4IL 5L8LB 5E5MB 2BRRL 5JQ6H 1V3LA 2BRQA 2EKSB 3HNVH 1WGOA 5FA4A 4QRPA 3GSOB 2VE6B 4G6KH 4U1MB 3QI9A 5GGQH 2X1OA 2E7BA 2HT2C 2X9WA 4D0DA 5KTEH 3OPZH 2P8MB 3U79A 3VFNB 1JPST 1FNSL 5EU6D 3TIEA 4D9LL 3DYOA 4W68A 1BQLL 1NBQA 2C3HA 5IKCB 2IFFH 2CKBB 4KZEL 1MSPA 1MCPH 1HQRB 2Q6WA 4KXZH 1HHJA 3AREC 4LFHG 2QQNL 5DD3H 2BDNH 2R0KL 2F53B 3EAKA 4UU9A 3GJFB 1A1NB 4FFZH 1PD6A 3T0WA 5KAQG 3ZSSA 1AY1L 3SCMA 2J5LC 4I0KA 4UT7H 1AP2A 3VXTB 3GIVB 4KJYB 3T2OA 3FL7A 1K2DA 4CU6A 1EGJA 4AQ1B 1YQVL 1G7JA 3NCJH 1I7ZA 4NC1E 1I8IB 5F9WC 3UBXG 5C3TA 1IFHH 4RDQF 3MV11 2J8UF 1KPRA 1FVDA 1JHLL 4S1DD 2FRGP 3BN3B 1QTYT 1IFHL 3BP5A 3BWAB 3UTSE 1XMWA 1OAQL 4P4KC 1YUHB 5K33A 4MD5B 1JTPA 1OHQA 4RGMC 3L1OL 3FO1A 3MBEA 1Q9WA 4LVOC 3GMRA 4XCYA 5T3XE 12E8H 3EYUL 2YSSA 4J1UB 2LFGA 1KN4L 2CKBA 1Z3GH 1IGCL 1VEMA 1F97A 4LARH 3JVGA 4H0IA 3AB0B 4YBLB 3MLYH 3AMKA 5L8KB 4KROC 2CDEA 4OZHA 1JNLL 1QR1B 4J7RA 4TVPH 3MLUL 2C1OB 2VXTH 3N85H 3V6BR 1CXHA 4GRLD 4RGND 3MLRL 1DVFC 3NZ8B 5DJ6B 1FGVL 5IVNA 5KTEL 3PHOB 5J13C 5JOPD 1QLEL 2NYYC 4OCRH 2YUWA 5FA4B 3OXSB 2R2CA 1RUQL 1MJJA 2N56A 3PGCA 5HGBA 4XCEA 1KB5A 1AQKL 1TZGH 1Y0LB 4LEXL 3MCLL 3U1SL 1HHGA 5DMKA 5JLZA 2FBOJ 1FVDB 1MHCA 3GMOB 3CFCH 3CVHB 3HUJF 4G5ZH 5EBMB 5ACZB 1UG9A 3FFCA 3PHQA 2EEDA 3RWFA 5TE4L 4PJCF 2ARJB 4YIQA 4K3EL 1K5NA 1VPOL 2EYTA 3OKLB 5DJDB 5IHZB 1FFNB 4MNQB 3VWKB 3WSQL 1S7WB 5CP3H 2C4FT 3RL1A 2PR4H 2X1XR 3UC0L 2EICA 5IVXF 2HJFB 3MRFA 5GS0C 4OLVL 2FBJH 4X4ZA 2AGJH 4Y16B 5D1XC 2EDLA 1KV3A 3WNPA 3WHXB 3BIKA 3OKDB 1TITA 4DFHA 2ICWB 1XR8A 3ARBB 3MRHB 4Y1AB 2JK5A 3PDDA 2DM7A 1YEGH 1IM9A 5GSRA 3I6KB 4X7TA 2HFGH 3CFKB 3FQXB 2BSSB 1NFIA 5DSCA 5DS8B 2Z4QA 4JQXA 1KACB 4MMXC 3EDEA 5IQ9B 4JM4L 1PG7L 4PJDE 1GZPA 4L3CA 3TO4D 5IJVA 5GRVL 5MP6H 3K4DA 5E8NB 3BDXA 5JHDB 1Z9SA 1HH6A 1CLZH 3BJ91 2VLME 3QUZB 1T04A 3L3IA 1FZOB 1BD2E 1V7ML 2YBRA 2IBZY 3VFVA 5IMLB 2IBZX 5D7JB 4FTVB 5HI5D 2YPLA 3QUMB 2APVA 3P77B 4PD4J 3ZL4L 1X6NA 1OTTD 3RNQA 2Q20A 3DARA 3IFPB 4Q6IB 4GLRH 4FZEH 1ULVA 5BZDB 2ZUQB 4JVUA 1PGRB 5BV7B 1G0DA 1G1CA 4Z7VE 5EN2A 2ATPB 3VFUA 3LRHA 4FQHA 4IRZH 4TPRH 3UC0H 4G6AC 1F4WL 3DLQR 4H8WH 4Y4HB 1NANH 3D48R 3PNWB 1BZQK 3DMMB 5JDSB 1AXTH 1IEAB 4ZS7H 3D69A 5CBAA 1JK8A 1RZFH 2FB4H 3CVHA 4TULL 1YEHL 2DWEB 4YHYC 3OXRB 4BJLA 3IKKA 1YYLH 3BZ4A 4F58H 6FABH 5TF0A 4XI5D 2NW3A 2D0FA 3CLFH 1KTRL 1BM3L 3MCLH 1FBIL 5FO8A 5C9KA 2DBJA 1EV2E 1QRNA 2R4RH 4PJAF 2G60L 2BNUA 2EC9T 3MSPA 2CLRA 3GSUA 1IGFL 2MWCA 3BP6A 5DUBA 2IGFH 1NCTA 1OCWH 1NBVL 3BJLA 5DJCA 1CDYA 1FL5B 2R0WL 4LQFL 1Z2KA 4WFED 3HRPA 1FLRL 2H8PB 1F58L 2ORBH 3KPRA 1CIDA 5IGXH 5ADOL 2DQIH 1G7MB 4OZHE 3IJSB 2D31A 5ID1A 1DEDA 2NY0C 2P45B 3BWAA 4JGJA 2XG5A 3PHQB 3RWFB 3ZTJG 4CMHC 1CVSC 4G42B 1DBJH 1I8LA 2P8LA 4O9HL 4LEXH 1I8KA 4U0RB 1D9KC 5E00B 5EOTB 4GRLC 1EVTC 1UB5A 3HMXL 1CGSH 3R1GH 2YWZA 4JPWH 5BQ7A 5I2IB 4YHZH 1ZVSB 1S8DB 5SX4H 3QA3B 4JFYB 3GNMH 3BPOC 4C56E 3S88H 5I1IL 1J9CT 2OXHA 4L8DB 3I50H 3QEQA 1EUUA 2DQDH 3EOBA 1ZGLB 5DD0L 3O9WA 5KSBE 1A7OH 1SYSA 2C26A 2C3VB 4R4ND 2RHEA 1U58A 2Z9TA 5J11C 3L3GB 2VXVH 3T0EB 2VLKE 3EO0B 3IB4A 4JFQA 1IC5L 4D0CA 3O41A 5C07A 2HJKA 4PJFE 4WWKA 2G2RA 3QZWA 4OZIB 3WFBH 5JORB 2R4SH 4JO4L 5GJSL 1U3HA 2OJEB 1X5LA 2Q7YB 3U6RA 1TQBC 2VABB 3B8YA 2ZUYA 3WKMH 3H9SE 5AUMB 2IPTH 4FFYH 1JMXA 3IDYB 5I66A 1Q38A 4YXLH 2YRZA 4QYOA 4DZ8A 4ZQKB 1KIPB 5EO0B 1AO7B 5J3HD 1X4ZA 4P23C 4G8FA 3QXDA 1F5WA 3E6FB 2XRAL 4JFEE 3J8F7 2Q76B 4ZPVB 4P46D 4UTAL 5C8JB 4PJAB 3GIVA 2ZUWA 5DD3L 1BFOA 2LVCA 3P4OB 4KRMB 4PRNA 1FAIH 5E4IA 2XTJE 4WFEE 3ILQC 5KG9B 3O3BB 5DLMH 1T5XB 3LQAH 5EO9B 4JKWA 5F1SA 2A6JB 2YPLD 3B2UC 4OLYH 2RBLA 1ZA6B 1G0XA 2EYRB 4V2BA 3MLWH 2IADA 2P42B 2I07A 1VSCA 4Z7VA 1CDUA 2VUOA 1NGWA 3QUXD 3WO4B 4W4OC 3LMJH