1JPGB

Crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpgB00
1E0OB 1IAOB 2WZPD 1RUAH 3RA7L 5FM8A 1LO4H 1U3HD 2R69L 5D6DC 1Q9KB 1R0AL 2DMBA 4XZUB 4QY8A 3PL6C 2EXWC 4DVRL 4IRJD 5C0AE 4G9FA 1J1PH 4LLWB 3KPOB 2QR0A 3WXVH 4LIQL 1ITCA 2A83B 2OK0H 1I3RA 3WD5L 5GGSY 2IFGA 1XIWC 3BRGC 2Q3ZA 1A47A 1EEZB 4Y4FB 3E3QC 2ZNXA 5BQ7A 1MJJB 4GW5A 5SWQB 1T1XA 5C0ND 5IVZB 1CFTA 3F7RA 5DRXA 5D7LE 4YZFF 1LHZA 2DLHA 4PV9B 1AD0A 5B22A 4BZ2L 1WLHA 2R0LL 4LRNH 1ZANH 3BVNB 4DJMA 4NWTL 2DJUA 5H2BB 1A6ZA 1N2RB 1GHFL 1FVDA 4G8GE 4EOWH 4Y2DB 5JW4R 1P7HL 3PGCB 1A6AB 2WIMA 3H42H 2GY7B 3MROA 3KPRA 4XPBH 1ETZA 3RWIB 1N6QH 4YPGA 3OTTA 4U1HB 3S37X 3D85A 4KHTH 2VQUA 4WUUB 3Q5TA 1H8NA 2HJLB 3MLUH 5I1CL 4HX1B 4Z8FL 4P2RD 3VD5A 3WLWD 4XP5H 2AV1B 3VWJB 1J1OL 4OM1H 5FOBB 5F1NB 3EO1A 1BZ9A 4GAGL 3FHQA 3ZT6A 1NANI 1XF2B 1T7YA 1FL3B 5HVHB 2J6EL 3GMLB 4R97C 3R0MA 4BH8A 4FMKA 3PE9A 5MEND 1ZLWK 1E27B 1T1ZA 2NW3A 3PWUB 3PWPD 1HDMB 4HH9B 2BVOA 2WBJA 4L3ED 3MUGA 1INDL 3HS0A 2VLJB 4G7YL 1FCGA 2DN7A 4V2BA 4F9LC 3LKQB 4S2SB 5D93B 3RNQB 4K9EC 1OSPL 1IC5H 4QHLB 3P0YL 4Q74A 3QDGB 3W0WE 2DQTL 1ZLVK 3T3MF 5C9JA 3QIUC 3V0VB 1JGDB 1JHLH 3UZEA 3KS0H 1J0HA 4TRPL 4LLYA 5CP3H 43CAB 2YOCA 4PJCA 3VW3L 2EDWA 5E4EC 1F4HA 1ZHLA 1BVKA 1CD1B 1LO4L 2Q6WB 5MERA 4PRHB 5F7KC 2ATPB 2GT9A 4LSQH 3TCLB 1J1PL 3O6MH 3TO4D 4C56D 2FR4A 4Z7OE 1IAIH 5HYJB 5AUMB 1MCCA 4HV8A 4WWID 2VO5A 3DUHA 4LPVA 3FB7A 4PD4K 3Q6GL 2QSTA 1M7DB 2Z8WC 3LSOB 4ISVB 1ADQH 4OJFH 1DSFL 4MAYC 3D69A 4OGZA 3G6JB 4I9WD 4IMKA 1A6PA 4BQCA 3QQ4B 3U9PL 4K9EL 5TH2A 3I75B 1RHFA 3JV0A 4P59H 4U6TA 3WUWG 2XRAH 4PPTA 4WI3A 4G6KH 4LPYA 5DZNA 5D5MF 1CU4L 1BJ8A 1NC2D 1W2KT 3PL6A 1DN0A 3H42L 2BHYA 2P5EE 1EAJA 3NIFF 4BZ1H 1IMHC 3SBWC 2XOTA 1D3CA 1SJVA 2CMRL 4JO3L 4H88H 4YHOL 2CKNA 4R90L 1XIWA 5HJ3A 2AK1L 1QEWB 4FRWA 4IOIA 3VXUD 3ZDZF 1I9IH 5BS0E 2EXYC 4F7MA 1I8IB 5A2KH 3IAGC 3ZKXB 5TE7L 2J6EA 4OLZH 4W70A 5DJXA 2CLZB 2IGFL 2RGSA 1QBML 4TNWK 2B2XH 1PBYA 3RJQB 1D6EA 2FGWH 4XNXL 5E8OB 3CPLA 1CD0A 1VKXB 3S96B 1EVUA 2Y6SC 2W0FB 3PDDA 2OR9L 2ZUWA 4GXUN 3PQYA 3MMEB 4G3YH 5GJTH 4HKJB 5DQ9A 2ED7A 4GBXD 3V4PL 1HXMA 1MCEA 2OR8A 2P7TB 4KRNA 4W81A 4PRPE 3SO3B 1XR9A 2MHAB 2NMSA 1EPFA 3CZJA 3IDIA 4YPJA 3RUGA 3WNMA 3NPZB 3GGWA 2Y1VA 3G5XA 1JFQL 1NCCH 3MJGX 3UTSD 5E94A 3I3EA 2IFFH 4ALAH 1OWRM 3U7AA 5DHYA 2IADB 5KSAD 2DM3A 3HAEA 1DUZB 3VE0B 2EEAA 5J13C 4HWBA 4RMQA 3GO1L 2F54A 2OJEB 2AEPL 5F8QC 4LAQL 1GSMA 1IAKA 4JM2C 4LQFL 4MQTB 4OTXL 5A2JH 4Y5XB 1WWCA 5EORL 3IDYB 3V8CA 1KN2H 1VEPA 5I16B 1OGTB 4M5YH 3H7LA 4KUZL 1PY9A 1QRNB 3BPNB 3GSRB 3NIDE 1KNOA 4LSQL 1GOFA 4ZD3L 1AP2B 4L8CB 2ZOKB 1IARB 1MIEL 3IFOA 1IAIL 4F9LA 1IGIL 4R9HA 5IVOA 1U8HA 4L4TA 5GS3A 2BVEA 2G5BA 3KPNA 3S7GA 3DGCR 4PRAB 1U8LB 4OJFL 5SX4I 2O5ZH 4LCIL 1YECH 1GZPA 4N0CD 1ZHBA 4Y4KD 3QIUA 1U8PB 1CICC 3OJVC 1YNTB 3K2MC 4OZGB 3C08L 1UM4L 4P59L 2DJSA 2YR3A 3GNML 3CFDB 1DL7H 2FO4A 4R26H 1XGRB 3STLA 4JVWA 4XPHH 2VDKH 3DX9B 1ZLUH 3ROOB 12E8H 1WBZA 2NX5E 1T7WA 3C09C 4HGKC 1ZA3A 2VLLA 5LAXB 4NCDA 2NZIA 3TIEA 2H6PA 3BO8A 5D72H 1A7NL 1KCSH 1I7UB 4MDJB 2X4PA 5BO1H 1IGJA 4MAYA 2B2XL 2FGWL 2VISA 4L4VE 5F8RC 4H26B 4OGAC 3KNBB 3RWEB 3DXAE 5D7SH 4XHQA 3VXSB 2XICA 3FB8A 3MACL 3ARRA 5GJTL 1LP9B 1I7RB 3QQNA 3BXNA 3MCLL 2F74A 1M7IB 4GKZB 1CFSB 4EIZC 5I0DA 2VXTH 5FCUH 2IG2H 5IB2B 4EI6B 1S7RA 4R7NA 2UYLB 3SBWA 1KXTB 3FONB 3PGDB 5FKPB 5JHLH 5ITFA 4LNVA 2MCPL 5BS0B 1CTNA 3WFCH 2WUCH 2IFFL 2YPVH 1F97A 1OGAA 5DHVA 5E6IB 3MJ8A 5I66A 5CBAB 3NFNB 5FYLL 5KS9B 3SDAC 4OZFH 4Y4FD 4GJTB 1FL6B 1H3TA 3EZ8A 4L9LC 4LL9A 3C8HA 1A21A 1D5BA 4NFBA 3ARFB 5IVXA 15C8L 1KJ3H 3KPMB 5TDNB 3CUPA 4KKLC 4K94H 4MCYB 4AIOA 4NQDB 1ZHKA 4W6YB 4QXGH 5J9PB 4WHTB 2BJML 4G9FE 3ARGC 1MI5A 1CQKA 2BHZA 3UC0L 2CXGA 5FYKE 3AU1A 3B43A 4MD4B 4TNVK 5JIHA 3OKEA 35C8H 1IGCH 4HWUA 4U49A 3SDCC 4FQXC 5IK3B 1NFKA 2YEZB 3VD7A 2AJXH 1A7BA 3ZDYE 2OTUB 4IJ3B 5K59E 1E4XH 1IM9A 1O7VA 3LD8C 4I3RL 2Y06H 3T2NH 4G6ML 4LCCB 4XC3H 3MRGB 4AQOA 4JM2A 4TUJA 1I1AD 5C0JA 1NFDB 5IG7A 5EN2B 1A1OA 4JZNA 1DL7L 5JPMA 2FD6H 4JQVC 2PTTB 3BPLC 4OZIA 2F5BL 1IEHA 3VFRB 1T21B 1QBLH 3OKDA 3P77B 4OD3H 4P3CH 3KYOA 4Z7WB 5IMKA 1T5WB 4LCWB 1CGVA 2VE6B 3QFJA 4PB0L 5ID1B 2GITB 3QUMA 4L1DA 2PF6A 5IW3A 1A3LL 5TDPA 2M8XA 2VLJD 2DWDB 3T65B 1PJ9A 4S1RH 1Z9MA 1CICA 4F3FB 3H2WA 1DBJL 2RJMA 4ELKB 3TT3H 1G0YR 1U91A 5I1JH 3QHFL 3HC3H 2IPKA 3ZTJH 2V5TA 3VXRB 3OAYK 1CLZH 3KJ4B 5EIVA 1JL8A 5DD0L 2CK0H 4G8FA 4PY8J 1LVEA 2UZYB 4YXLH 5K9QI 1UWGH 2P48B 1BOGA 2BZDA 1BJ1H 2P8PA 1W8NA 4I8DA 1RV6X 3MV9B 1JPGA 1RZFL 3QDJD 4BH7A 3FQWB 1YEDB 1MCDA 5KVGL 2G60H 2DD8H 1NBZA 1J1XH 3NN8B 1QLEL 1FFOA 4NQSA 4QEGA 1FN4A 1OPGL 1ZWIB 4LEOB 4CVXB 4MAUH 3TH4T 1S9VB 4JB9H 2H2PC 4DCQB 4PJCE 1WTLA 2FB4H 4LIQE 4PGCB 3MLRH 4JFZL 1MH5A 4UDUA 1OAUH 3BEVB 3OGCB 4NUJB 1A5FL 2Y9RT 2LTQB 4MA3B 3JWDH 3MLZH 2EH8H 1M05B 3NH7H 5ANMB 1IGTB 1PQZB 1JUFA 5ACZB 5EOQH 4P3DA 2FIKA 4KTYA 1J5OH 2HRPL 5D1ZD 3S35H 1HWHB 4XNMB 3LRHA 1E4XL 1DANT 3SDAA 1DQQB 1IILE 1KACB 2JJWA 2E6JA 4L9LA 1UA6L 4UZGA 4M62H 4LHQB 4PRNB 3LN4B 3DI3B 1X4ZA 3BP5A 1EA9C 1HHGA 3WDJA 3EDKA 1K5NB 1QNZH 4HQQL 3QB7C 5E70A 3IFNH 4JDVB 4I77L 2BC4A 3ARGA 1OP9A 3ZDXF 2QEJA 3RFZC 3V0WH 3AREB 3SCMC 1JRHL 2V6HA 5DUBB 1WJ3A 4XPGL 3BGMB 2VLKE 4FQXA 3SDCA 3QJFB 4MJ4A 2QQQA 2ZSVA 5F9JA 3QUXB 3A0OA 1JNNH 4ZFZB 5I8OH 4KI5F 5GSRB 4W68A 4PJAE 1KPRA 4X5XA 3VFOB 1Q38A 3G6AB 3PQYE 3NVQA 4JQVA 4DN4L 3QWRD 3ULVF 2K7QA 1I1FA 5DLML 1UWGL 5D1XD 4M1DH 3DVFA 1T66D 3L3IB 1MWAH 4YIQB 4KDTC 2H26A 1F6LL 4YDVB 1A2YB 4Q9RL 1QRND 5EU4B 1QFPA 4JQIL 2Z93B 5HYQA 2D7TL 1ZMYA 5CGYD 1UZ6E 4ZO6A 4NT6A 1FO0A 2F54E 4PLKD 1CZ8L 4BKLA 3TN0B 3KLSA 2VQ1B 3EOBB 5L6YH 1CE6B 2DAVA 4X4XB 4AY0A 4NKOB 2VDQH 2I25N 5LQBL 5FHAL 2VAAA 4QCIB 4EJ1C 2AXGB 3GUTA 1FORL 4FQPA 3AXLA 2FCBA 3TFKD 1OAZH 3QRFM 1AGCB 4HC1L 1IFHH 3DV4B 3MLZL 4MXVE 1TDQA 3QXVA 3IAQA 2X4UA 3NH7L 3HR5B 5IBUG 1FV1A 2BP3A 3HMWH 4LMQE 4YE4H 2NY4C 3GBMH 1EAPB 1M6OA 1J5OL 4ZS6C 4IRSC 5IBUB 3CD4A 1IKFH 2I26N 2XY2A 1DE4A 3HZKB 5I76A 1AGDB 3BN9C 3GHEH 1J8HE 4PJDA 4JN2B 4TSBH 1DLHA 4OF5A 5HHXH 1RUKL 3VH8G 3R4DA 5IFAL 4ETQB 4NQVB 4YGAB 1LEKB 3VH8B 3O3EA 1TJIH 4HWEH 1A3QA 2YC1A 1OAXL 4HGWB 3RKDC 3DX7A 1DFBH 2BOBA 4X98B 2P5ED 3ZLQC 5EUKB 4JKWA 4LKXB 5CJXC 5E95B 1U8NA 3WFBH 3F7PC 5A16B 1C5DA 1KFAL 4ONGH 1F02I 4WWKC 2YKLL 4I5BB 5FA3A 4PY8I 3CSYB 3EYUH 3EFDL 1JNNL 2JF1A 4M1GL 4Y8AA 4TNWF 5J3HC 2VJXA 5BS0D 3N1PC 5KVEL 4AMKL 1ZXQA 1MLCA 3GDBA 4GAJL 3SDDD 3VDCA 1KIPB 3AB0B 3FOLA 1EHAA 1B90A 2H32H 1NGPH 1KF9B 2BSRA 5DUML 4M61B 4KK6D 2BHUA 4PRDB 2ZCHH 3ARFD 5EUOF 5T1MA 5F7YC 1XCTA 1R3KB 2DS4A 4M1DL 2D03H 4G43B 3SCMA 4PRPD 3KR3L 2GJ6B 5T3ZH 2FHBA 4HAFA 1BGXH 4XCEB 2UZXB 4M1CC 3WS6C 4HKBB 2IH3A 3G5ZA 4BFEA 2VDRL 1S7WA 5HI4C 1P7QA 3TBVA 5FA4A 3OKOB 1CXKA 2DLIA 1F00I 5F3HA 5J6HA 3MLVH 4HK0B 5DTFA 4ZFGH 1ZA6B 3T8XA 5L6YL 2R9HD 4IOFC 4H20H 2X4TA 3S36H 2EIDA 3IFPB 5CBEB 3NFSH 5J12B 4LU5L 3QXWA 3NAAL 3PUCA 1EGJH 1CK0H 3T0EB 5I18H 5HHNA 3H3KA 2EDBA 5CJOL 1IZJA 3U0PB 2ZG1A 4MB3A 5T5NF 3QYCA 4KDTA 2DJ4A 3BIKA 1NC4B 1PG7X 2EH7H 3FQNA 1XF3B 4EKXA 5KVMC 3P30L 5IESH 2ERJC 3HMWL 3OHXA 5DI8B 3GBML 3MRQB 4HPOH 4CW1A 4KXZH 2XN9B 1DR9A 1AGEB 2BVPB 4AEHH 2ZUYA 1EUUA 5HGDB 3TYFA 1TFHA 4MCZA 4OF0A 1AI1H 2QJDA 5JDSA 5IW1A 5J1AA 1H3VA 3HC0A 3ILQC 1I7TA 1NL0H 4UDTB 2ZJSH 3LH2L 3WLBB 1EO8L 1N3NA 2NY2D 1I8MA 1FNSH 3VFSB 1N0XL 4XBPA 4CNIA 2WANA 4OZIE 2VDPH 1ZTXL 3L9RA 4D0BA 2JCCB 5F7MC 3OR7B 3WIIL 3ZO0A 5IQ9B 1S9WB 3S35X 3RWFA 4F33B 4OLUH 4ZDHB 2APTA 1NMCB 1UYWH 5IHZA 1A7QL 4QKXB 1JWSB 4PJXF 2V7NA 4PGDB 4X7TB 3D0LA 2CJUL 4M93B 5D5MA 2VDNL 3LKRA 3ZE0F 5CWSB 3V52H 4YHLH 5F1IA 1ZVYA 2DLGA 3ZE2E 3DETD 1S78C 3B2VL 5IKCB 4L4VD 5JIIA 4Z77A 2EE6A 3DXAD 4ONHA 4Y5YC 4DW2H 1W0WB 3UZQA 1L9NA 2KZ1B 3L3OA 1C7SA 2HG5A 3MRCA 1KYOJ 4QGYA 3X3GH 5TPWL 5L7XL 4DOHB 2QSVA 3MRLA 3MRFB 5FYLE 1MSPA 2OP4L 5GGVL 1YA5A 5CZVH 5CJXA 5BZDB 3PF2A 4WWKA 1RZ7H 1HH6A 2F58L 1R3JA 3U6RA 1SBBA 3MRRA 3OPZL 3WFEH 2MCG1 4GLRI 4HUWA 3MLVL 1MLBB 2UUDH 1RJZB 3M1BB 1A6UL 5EZOH 3TH2T 3BQUC 3N85L 4F8TA 5C0IA 5F89B 3D0VA 25C8L 1J10A 4ZAKB 1FZMA 4PJ7B 3EJZD 4LLDB 3QWOB 1YN6B 4MQSB 3LMJH 1EGJL 4RQQA 1VB9A 4WEUD 1DQJB 3LHPL 4YXHL 3B9EA 2VTFA 1MCJA 4XP4L 1LD9A 3IVKB 1TENA 5DWUL 3S3SA 3C6LB 5D7IA 5FYKD 3WS6A 1ERNA 1A0QH 4OLYH 1H5BB 3SOBH 1ODAA 1YJDL 3ARED 5F7WC 2L7JA 1I1CA 1NGWA 1YPZA 2DBLL 5I19H 3UTTE 1J12A 1I75A 5I8KL 4U1SB 4N8VA 5IMOA 4HZAA 3PWNB 5ALCH 4N9OB 4AJ0A 1JMXA 1YNKH 1FNSL 1WQVT 1OP5K 5ICXB 3FQRB 4LRIC 5E00B 3ARTA 1F58H 5HGHA 3ALWA 4LK4A 4XPFH 4OQTA 5FGBC 3RTQB 4X9IA 3MPCA 5F7DB 3D25B 4BSWA 3GSWA 4ERSL 5FF6A 1BD2B 5T33L 3P40A 1AE6H 4C58B 4JDTH 1C08A 3EJJX 4EDXA 2HLAA 2EIEA 3F6LA 2ICWB 4ODWA 5IFJA 2FDBP 3PWVA 1MFDH 3GI9L 4Z7VF 2OXHA 1YC8A 3WFHA 5D7JC 2GTWB 3IF1A 5J1SC 2AKRB 2BMKB 1BIIB 4U1LB 3BKML 5BRZB 3C8DA 4FZ8H 2PYEA 2VNCA 3RGVD 3PV6A 2JK5B 3JTSA 4X6CB 2R0KL 3NPSC 4FG6C 2EDHA 5EBWB 4L29B 4RWHA 1LGVA 1FFPB 3V7AE 5FM5O 1OARL 2YN5A 1FJ1A 3IXAA 5HDBE 5KG9A 2H3NA 4I2XE 3X3GL 3LOWA 4CVZB 5FO8B 1XGTA 2DMCA 4W6WB 4YAQB 3W9DA 4K3JL 4X6BB 3MRDA 3T0DA 3MBEC 4LFHG 1WSST 5IBLD 3WHE0 1S5IL 3SJVB 1AKJA 2C3GA 1OT2A 2Q8AL 5IR1B 5AZ2L 3P9WB 1TIUA 1MOEA 5GGTH 3MJ7A 3WFEL 5E5MB 1KJMA 3IGAA 4DVBA 5JIPA 2AK4A 4FFVC 4UQ3B 1ZV5A 4RAUA 2XTJB 4YHYC 3JUZA 5IQ7L 3GKWL 5KVDL 3BZEA 4YR6A 2A73B 4Y5YA 1JF1A 5JW5A 3CFBA 1T2QL 1V05A 5DRWB 1PAMA 3C60D 2YUXA 3QG6B 4G5ZH 1BREA 4JPIB 3WJJC 3DX6B 1V3MA 4U6YB 4UT9L 2VXVH 3GJFB 3MJ6A 1F6AB 1XCQB 2RCSL 3QEUB 2SEBA 5TE6H 4EDWL 5I1AB 2NY3C 4HW6A 2QADC 4XVJH 2HFGH 4FFZH 2XWTB 5C9KA 4JO2H 1J9CT 1LWRA 1FG2A 3SGEI 4O51A 2R8SL 5D6CA 2E5EA 4V1DA 2DTMH 5L88H 3P4MA 1UFUA 3PG2A 4OUUA 3S6CA 3ROLA 1C16A 3IT8D 3CLFH 3FFCB 1II4E 2CO6B 5EU3A 1E4KC 2V2XA 5JW3L 4XVSH 3O45B 1RZJC 4PJDE 1B6UA 4L8DB 3BQUA 4MJIB 4JFQA 2ICEB 3GJFK 2LAAA 3QDHA 4EXPX 3LKPA 4YUEL 1MRCL 3QO1B 4PJFF 1EJOH 3JTTB 4WW1A 3TEUA 2ICCA 4NRXA 1RU9L 2HTLC 3DTXA 5FV1L 2CLRA 2P24B 1EBAA 4GW1B 1IVLA 1AE6L 4MWFA 1NPUA 4YEFA 5DJDA 5DJ2B 3V5DB 2V9TA 5E0QA 2HKHL 4I0PD 3BGAA 3L5XL 1U9KA 1ZHNA 2NZ9D 2VLKD 4WHYH 3WL9B 5J6GA 2GJ6D 4PREB 4PJBA 5FYJH 4JY6A 5I8EA 4EQ2A 2N7AA 3D9AL 3VFUA 1G7IA 1JPST 1QZ1A 4CUCA 3G5VA 4XWGL 5TQ0L 4MZ3A 5ELIA 1SY6L 1I7ZB 4LRIA 2D31A 4U0RB 1HNGA 1RZJL 5FGBA 3WUZA 5CFHA 2VLRA 2NR6C 1SEBB 3KWWA 4PJGF 1YN7A 1QVOA 1NJ9A 4AT6A 3DVGA 3TWCH 1GGYA 4LLVB 2HT3D 4UOW0 3EYSL 5CMAA 3PV7A 1P4LB 2P47B 5FB8A 1RURH 4M7KH 1A1NB 2I24N 4RISL 2WBKA 4UV4H 5DDHA 5H94A 5IHUL 4WU5A 1CIDA 1QACA 1XF5B 3QXAA 5D7JA 2OR7A 1DBKH 2EDJA 4M3JA 1UH3A 3REVB 1ACYL 2WM0A 3HAEH 4K7FB 1WAAF 2XN9D 2X4QB 1Y6NR 3HLAA 1GYAA 4HWBH 2DQFA 1UQSA 4G42B 4JLRB 3DROA 3VA6A 1CLYH 3QAZB 1BQLL 1MRFH 2FX7L 4OZFG 1H3PL 5IMMB 2XWJB 1DDHA 3F58H 2X5PA 4FTVB 5IMLA 4OZFB 4P4KC 2ZG2A 3LEVL 4X83A 4XVJL 4OQ1A 5ESVB 4WCYL 3K2UL 3MBEA 8CGTA 3EYVB 4GQ9L 2X42A 3KYNA 1GPOL 3VXNA 2ILLA 1UXWB 1NCAL 1Q8MA 5BXFA 3CLFL 1R3LB 3VWKB 1KLUB 2Y07H 5AAMA 3ZKND 4FP8H 5FGCE 4XP1L 3O3UN 2BSTA 1ZKAA 4Y89A 3U30C 3VRLF 1BM3H 5DRZA 1ZT7B 2FWOA 5EOTA 3ZKQD 3FT2A 1MNUH 3CZFA 4Q0XH 1HILB 3V4UL 3QI9C 3VMOA 3WJJA 4PTUA 2YD2A 2HVJA 4OZ4A 5FUOH 2GK0A 4C54A 1KT2B 3U4BL 4Z7UF 2E9WA 4Z78B 3VFVA 3C6SA 3WKNA 3GJEB 1Q0XL 3V5KB 2EDLA 1A9BA 1RZ8A 2OJZH 3B5GA 4HJJH 4P23B 3RBSA 2ZUUA 1NFIB 1SY6A 4LDEB 5HI5D 1E4KA 4JG0H 1OTSC 4JO4L 3U36A 1XGUB 3O8XB 1MHPL 4HBQA 1RUQH 2VUYA 4YWGH 3OZ9H 4HT1L 4NYLA 4OD1L 1DVFC 1G7HA 4G9DB 4O58H 3GIZH 4JRXB 4ZUUB 5IWLC 1C5BL 4ZSOA 3SKOB 4TUOB 2DQCL 4P4RA 3DI2B 4MXQD 4NRYA 4F7PB 4NKMB 1GOHA 3BH8B 5I2IB 5DK2B 1KENL 3ZTJG 3CJJA 5C7XH 1RURL 2FSEB 3NCBB 3PHOB 1MHEB 1FL5B 3HE7C 3I2CH 3ZHKA 5CD3B 2OSLA 4X7FC 5KAQG 4KK5D 1LE5A 2VKWA 3WBDA 3RL1B 1CL7I 1B0GA 1G7QA 3QUZB 4Y4HC 1P9MC 3CK0H 2QSCH 1FGVH 4E42A 3D39B 1NCBL 4H8WC 5AWNL 4FXGB 1CLYL 1C12A 1ES0A 2W60A 4FXKA 5JO5A 2FHCA 2CUMA 4M6AA 4MQXD 1FNEA 3WSQL 1NEZA 3D18A 1WWBX 5D7IE 2Z31D 3TPUA 4LSRL 1RK0B 4POUB 5I1LA 1CXIA 3SGDI 5IV2B 4M5ZH 5B4MC 1YPZE 1T7VA 4ZOCA 2BNQA 3O0RH 1NDGA 4KJQD 4M4PA 1KCUH 1LDPH 3F7YB 3QZWB 5EU5A 2ESVE 3FN0H 4FABL 3RHWK 2CUHA 2EYSB 4LGSB 1SJXA 4HF5H 5FO9A 3RZCC 4N0UA 4X0KA 1A6TB 1TZGH 4O4YH 3JUYA 4XVUD 4P4KA 1JGEB 1HN1A 4PBXA 4X8XA 3P9MA 4H8WL 4KZDL 4ZUTB 3ULSA 4PLJC 3RWHA 3FMGL 5E8PA 1DEEA 4U6XA 1U8KA 2PTUA 2XKSA 3KXFE 3BKYL 4OZHB 1TCRB 3QUMH 4QOKB 3BP7B 4JO1H 2YUVA 3DRQA 5L2KA 1S9YB 5DVKA 1K4DB 3IDXL 1JTOA 2X70B 3P2TA 1J8KA 1FBIH 5EBGA 1WFNA 3VFTA 4XXDB 4NZRL 3X12B 4UTBH 2OS7A 5EBMB 5ICZA 3OB0H 1EX0A 1OQOA 1BFVH 1AY1H 3QI9A 2R0WH 5JPNA 5ICYB 4NO5B 2KL6A 1DN2A 5D70H 4RRPA 4LVOB 3KAAA 3HG1B 4NSKA 3HNTH 3TIDA 1JWMA 2I60H 1FZKB 2A6JB 4U6HB 4Y19B 4JGUA 5L0QC 3O6FC 3L3HB 4HZLB 5EDXA 1CVSC 5DMGC 3N9GH 2JLLA 3I2CL 3C8KA 3ECBA 4WO4B 2JELL 1PZUB 1NGYB 1BJMA 4I4WA 2FBJH 3I50H 2AK4E 4AZ8A 5JMRA 4JFFE 1A4KA 4PB9H 1TTFA 1MWAB 1YYMH 3V6FB 4WENB 4P49A 3WMSA 1W0VB 4MJID 1D6VL 1A4JB 3MCG1 4JFPA 1P2CB 5IWLA 1V3LA 3MV8B 5DEZA 1MAKA 1KEML 2E9JA 5CUSH 4X6EA 3RY4A 3LPWA 5DD5H 2XFXA 3BW9B 2ADIB 4S1DC 4XRCA 4APQB 3M17B 2OTWA 4KV5F 5BJTB 2R2HA 2IANA 2X1XR 3HE7A 4V1DE 3MR9A 3HNSL 5CZXD 1V3KA 3KLAA 2C1OB 4FQCL 5KJRL 1T04B 5E6ZA 4Y4HA 1P9MA 3KS0J 1FC2D 2IH1A 1CFVH 5GS0C 3VI3F 4JPWH 4X7SH 3UTTD 2YRZA 2ZKHL 3F7VB 4PR5A 3OAZK 3MNZB 2DBJA 2LAGB 5SV4A 2JJVA 3MZGB 3FT4B 3MUY1 4DWHA 3FN0L 3QEHA 2YUZA 4O2FB 4EBQH 4LARH 5DJYB 4BFIB 2DQUL 2X4OA 3TP4A 1DUYB 3VXMB 5JDJA 1OTTC 5IFHH 2DQJH 1FDLL 2VDOH 5B39A 3FT3A 3KJ6H 2NY1C 4KJPD 4R3SA 4ZFFB 3QXDA 4HBCL 4QXWA 1G9MC 4GRMB 4QXTB 4U1KB 2QQNH 4GW4B 4HUVA 4MJ2A 2YPLA 3ME0A 1OL0A 1FNFA 3S8WA 1XR8B 1MQKH 3SE4C 4U2YA 4G6AD 4U6VL 4Z7NF 5DJ8A 4EI5A 5IGXH 4UTBL 2NQCA 3R06A 2I5YH 3C5ZC 1HINH 5JHDA 4KH2A 3RU8H 4MNQB 1ZEAH 2YSSB 3STZB 4WUKH 2VXSH 3RZCA 1E6JH 5GS0L 3DRTA 2VLRE 2EDFA 1CI5A 1Q9LA 3HNTL 4PJXA 5DUPH 3HB3C 1KYOK 4XHJD 3KXFB 4FQIL 5HGBA 1KELH 4JGJA 1FAIL 3D5OF 4RDQF 3WO3B 4P2QA 2OX5A 3CGTA 4Z7QF 2PR4H 4FTVD 4HIEB 4PJ9B 5A3ID 1CT8A 2H32B 4R96A 5E1AB 3GZKA 1IQWL 3CFIC 1JZ3A 2GJZB 3CU1A 3ARSA 4HMDA 1S7UB 1K85A 1JPSH 3T1FA 1TETL 1JHTA 3G08A 4XX1E 1FO0H 1BIHA 1YYML 4WFHE 2YA1A 3VWKD 3AC0A 4UT6L 1OF2B 3I3DA 4MQ7B 4J7RA 1AJ7H 3B9DA 4ENED 5LXGL 1Z9SA 1CE1L 1QSEA 4UV7H 3OXRA 3CVHH 1FNGB 2XV6B 3WO4C 1EHLH 1OAQL 2R4RH 3MFFA 3QCUL 1KJ2L 3T0VA 4QRUB 3R0NA 3FQXB 5GZND 4QRQB 4PYGA 4H25B 3MRKB 4MD0B 4M7ZB 4P5MB 3O6FA 5ISZB 5C09A 1HSAB 1CG9B 5F6IB 4P2OB 1IEAA 5D2NB 2ZPKL 1CDUA 4PBVC 4TVSa 3GSNL 4O2CA 1MY7A 4F7EA 4CBPA 4JR9H 2R56H 1QO3B 4U1JA 2M26A 2JB5L 4G8EA 4I13B 2HMID 5E6YA 4OCSL 1HOCB 4CADA 3BYYA 4OGXL 1Z0MA 1U58B 2FJGB 1FLTX 4R2GC 1UVQA 4Y16C 2GIYA 1R5WB 4LARL 3GMQB 5IEKB 3NCYS 4X4YA 2GCYB 3LQMA 4ZXBB 4NC1E 4Z76A 4WFFD 4OFDA 3ARUA 3QDAA 5CINH 4GRLC 2FYYB 3NABL 5DYOB 3GB7B 1W72H 2AXFB 4XCNB 2P46B 1YMHA 2X1WL 1EZVY 2GJJA 4HS6A 5KSBA 1QR1B 3ULUF 2YD8A 4TSAH 2XZZA 3QEQE 4V2CB 1N5YH 4JPVL 3P4NA 1KLFA 5JQHC 3CIQA 2R29L 4GMTL 4EEEA 3LKSB 3ZZ1A 2AERT 4EQ3A 4AENA 1MFAL 3X3FL 4Z0XA 1HINL 3O11A 3DMMC 1QFHA 3CMOL 3HPJA 4NFCA 1RVFL 1T83C 1F5WA 2FX9L 3QUZD 2HJFB 5A40E 4Y5VB 4FN0A 3QIWB 3IFLH 5TGBB 4MHHG 3RDTC 4LHJB 3O3AA 4PUBL 5DJZA 4ZSOE 3QIBB 2OYPA 3L95A 2Z4QB 2PCPA 1SMOA 4QTHB 5DUPL 1TPXC 4X6DF 4F7CA 1X5AA 1X5FA 2IQAB 2NNAB 4AEIH 1H3XA 4GG8A 4QRPB 2PR4L 5JNYA 5C0RH 4RGNB 4U33A 4QHUB 5L9DL 1V7NL 3VJ6B 3W9EB 2E7CA 3MLTA 1IC7H 1DBMH 1T5XA 3S5LA 3SE4A 5HHOB 2GKIA 5SWZA 3SEPA 1YMMB 3C5ZA 3O6KH 4JZJB 4EVNA 4NQTA 1RI8A 4OV5B 4EN3C 4YHNB 4FQQB 4UIKH 3HE6B 3PNWA 1KG0B 3CVHL 3JBG7 4M43H 4QRTA 4S1QH 4ZFOB 2BFVH 3RWDA 1EEYB 5I1EH 2Z91A 3GSNA 1ONQB 1G6RA 4QT5A 3BSZH 3AS2A 3E6FB 3FQTA 1FAKT 4IIQC 5T1LA 4ZQKB 2EEBA 1CGSH 1FQ9C 1IAII 1MHHA 5C07A 5KN5A 3LKNA 4GUPA 1JNJA 4AG4H 5BVJA 2BNQE 3VFGH 4CMMA 2R56L 4NIKB 1A3RH 4QOKD 3HI6H 5KANG 4N1CA 5I17B 1AXTL 4J2XA 2J5LC 3MXWL 4JAMB 1UH2A 3FTGA 1UWXK 2BNRB 2EECA 4U3XA 1PW3A 2QR0B 1SYSB 4ODXB 2CH8A 3E2HB 4Q9QH 5TQ2H 3DUUA 1KLGA 4N0UE 3MRPB 3I6KB 2DYPA 5BQ7B 3NZHL 4GW5B 1N6VA 2DL9A 3HN3A 1KTKE 1T1XB 1LK2A 4LEXH 1A1MB 3FKUS 3MV7E 5DQDL 2BCKB 2ADFL 1RULH 1RJCA 3CX5J 4X7CC 4Y19D 1UJTA 5EA0L 1U8QB 3L6FA 2ZCKL 3VXTA 4WO4D 1FVDB 1FNAA 3O81A 1EMTL 3UAJD 2DQDH 5DURB 4LVHB 3KPRB 4LHUA 4D8PA 1MJ7L 2F9BT 4Y16A 4LSDA 3ORJA 4L3CA 3BMWA 1K8DA 3C2AL 3UDWC 4OSUL 4GRLA 4PG2C 2NPLX 3MFGB 1BFSA 3VCLB 1FVCA 3CH1A 3MV8D 2XZQL 1FVEA 1N0LA 4M6NH 4NJ9L 1X7QA 1S5HA 1B0WA 4IHOA 5DMKA 1CBVH 4BH8B 1WEJH 4KDWA 5GGSA 4YDKL 4LGRB 4OKVB 2BVOB 3K8KA 5HDOA 1T83A 5KVFH 5DJ0A 1YYLL 3MUGB 1FYTB 1QPXA 3O9WD 4YEEA 2WW8A 2J8UF 3HR6A 4EUPH 2YA2A 3RDTA 3VG0L 3A67L 4LSSH 4XP6L 5FUCC 2V2WA 1JGUH 3QCTL 3QH3A 2AXJA 4RIRA 5J56B 3OJMB 2QQKH 5FO7A 3DX8A 1T20B 1YEIL 1CWVA 1JI1A 4R4NC 5TE4L 2UWEF 4J3XA 1RIVL 2OMBA 2WK2A 4WV1C 4C83A 4LLYB 1F3JA 4AG4L 1P4IH 4ODTH 3MRHB 1ZHLB 1AFVL 5D2LF 2VITB 5MERB 4U1MB 5DJ6A 4NN7C 1OM3L 2GT9B 5KSUA 1PZ5A 4OBSA 5E2WL 4EN3A 2FR4B 1U3HC 3RHWF 1NCDL 3U7YL 5E5RB 2XIDA 2ESVD 4IRJC 4B5EA 4OQTH 2CRMA 4GQPH 4KGLA 1ED3A 1B0RB 3F7QA 3JWOH 3TJHD 4F15C 4NQXA 3GMPA 5CJ8A 4IIQA 5C0NC 3MLSL 4H0HB 3KXFD 4JPKL 3MRJA 4ZOEA 5E8DL 4PJ9D 3CDCA 3HI5H 4OUOA 3CXDH 3V9FA 3CXHJ 5CILH 1A6VL 4LLQB 2Y23A 5I1DA 4Z7UA 1F11B 4WHYG 2OI9C 1ND0A 4UTAL 1JZ2A 5HJ3B 2MPAH 1OSZA 4IOIB 5ACLA 3MV7B 3WXWH 4F7MB 5F44A 2CDEA 2H2SD 1JF5A 1IQDB 1ZT4A 2XI9A 4IS6B 2CDFA 1D6EB 4GXVH 4NNPH 3WLWC 3CPLB 2HRLA 5JXAL 1WIOA 3HZYB 2LU7A 4HFUL 1FE8L 1OW0C 1FH5L 5ISZD 4GOSA 3U9UB 1X5XA 5T1KA 5F7EH 3VGGA 1HXMB 1P4BH 2A9ML 3MCKA 1U92A 4JFFD 3RUGB 2XY1A 3OF6A 2YA0A 3G6DH 2YZ1A 1GZQA 5E94B 1IJ9A 3HAEG 4FFYL 4PLOB 2XA8L 3UDWA 3FO1B 2DKSA 4QRRB 1JGUL 1FFNB 4WDIB 4PG2A 3HAEB 4UUJA 5T3XH 2CO7B 5F93C 5BCAA 3JSSA 5C09E 1IAKB 4JFHD 5GRZA 4RBPK 2VZTA 3U1SH 1DQML 5CP7B 5DSCB 5IEHB 4LSTH 1QYGL 1QFWH 4B0MM 2W07A 1KNOB 1E4XI 4NJAL 5ALBH 2M1KA 4JFDB 2V2TB 3F5WA 1QSFA 5E9DB 4XNZC 4R0LB 3QCVL 1MEXL 4QWWD 2A6DA 1U8HB 4L4TB 4LCYB 3TO4C 5J8OA 3KPNB 2G5BB 5FFLA 2R23A 1PYWB 2NY7L 3QIWD 4GKNB 4OCXL 4KWUA 3W2DH 4PGEA 1FIGH 4RCAA 4YBHA 1M4KA 1GZPB 2B39A 1ZHBB 5C3LD 2QBWA 3QIUB 4MNGE 4JFEE 4HS8L 4OLWH 1LEIB 1I8KA 2R1WA 1ZGLB 3B9KB 3MYJA 4WV1A 3SDXA 3MLWL 5DT1L 4QRPD 2FO4B 5I1HH 3STLB 2XA3A 4FZEL 4Z7OF 5LGHH 2ATKB 5CILL 3I85A 5SX5H 3HCVA 1GIGH 3BEWA 1WBZB 3L3KB 3IRZA 3PDGA 1BFOA 1ZA3B 1U3HA 3IJSA 4MXWH 1F90L 1RJLB 4PGJA 1YMMD 3TIEB 1JBJA 4IRJA 3BO8B 3OAUH 3WFDH 3P0VH 4MZ2A 3HE6D 2R2EB 1YEFL 1BQSA 1X5YA 2J88H 3MGTA 2VISB 2WINB 3CU7A 3OQ3B 3ALXA 2I07A 4D3CH 5DVNA 3I02A 3L5WA 3K4ZA 3HZVA 3BUYA 1HZHL 5HDLA 3FRPG 4CL7A 5F7EL 4BQ6A 3BKCL 1R3HA 1P4BL 2F74B 5F3BA 5EU6B 5SWZE 1KBGH 4UILL 4OCWL 4PJ8B 3UTOA 4GBXC 4WFHD 3B5HA 4NM8L 3U48A 1L0QA 3DIFA 5MP6H 2BNRD 2XWBB 1Z3GH 2HWZL 4HCRL 1N4XL 1FZJA 4WJ5A 1OGAB 4CN1A 4XNYH 5DF0A 5KSVA 3MJ8B 2F53B 1CGXA 1XZ0A 3QDMA 4P2RA 1UKQA 3MGOA 5KSAC 1NAML 4ZPTA 1VFMA 5IVXB 1OW0A 1HQ4B 1XH3A 4LSTL 4HUMB 3SO5A 5DMYA 3O2DA 4WFED 1A9EA 1ZHKB 1WZLA 1EHXA 2DRUA 3ARDB 1MI5B 5MENA 1GGUA 1CF8H 4JFOB 4YC2C 1TJGL 4OIAA 1T4KA 1LO3H 3DECA 3PWPA 4DZ8A 5DURD 4NNXB 1UCBL 4L3EA 1MVUA 4JKPL 3ZYJA 1RJYA 2Y25A 1DTUA 1AR1D 2XKUA 1IM9B 2C7UA 5E8EA 3W2DL 5CAYB 1CTOA 1V7ML 1VGKA 2L0DA 5J13B 5FUZL 4DGIL 4PJHE 4TUJB 3AMKA 5D9SB 3HMXA 5C0JB 1RUML 1F2QA 5IG7B 3NIDF 1A1OB 3ZL4H 4JZNB 32C2A 4N0CC 4Y4KC 5C3TA 3QR2A 3LS5L 2ITCA 2Z9TA 4KMLB 5DS8A 3K81A 3OKDB 5I73C 3S88H 2NXZD 3GRWL 5IMKB 4ZS7H 1UEMA 2DQEH 3TBWA 1NCWH 3HUJA 3RWCB 3QUMB 4XVTH 5ENWA 3TYGL 5J11C 4GG6B 1KB5A 4LF3A 2YHGA 2DM7A 4DUWA 5TDPB 4C56A 5ID0A 1FYTD 1L0YA 3EJYD 2E3VA 1YEHL 4RNRA 4BA8A 4HJGA 1CICB 1U93A 5IROC 1U91B 4BJLA 4L5FL 2ORBL 2C3WA 2IPKB 3CVIH 1PDKA 4WY7L 5KZCB 1VPOH 4HCRA 3ULVH 1ZLWH 1HCFX 1LO2L 1IKNC 1BOGB 4RGMC 1YEEH 1LO5A 1NC2A 1R6VA 4AH2B 5LVEA 5C0BB 4X9BA 4BH7B 1BZ7A 1WBYA 1UEYA 1S7SB 1G7LA 3EZJB 1NBZB 3FCTA 3B83A 4GAYB 2QTEA 4ELMB 1FFOB 2EYTB 4NQSB 5GGUB 3VXUA 1CXLA 2PKDA 4OF8A 4PJEE 2NW2A 1ZLVH 3V6OA 4HLZG 4KPHH 4JN1H 1RPQA 2RIKA 4Y4FC 1T1WA 3S3PA 5C8JA 3FN9A 4XPTH 1Q72H 4IEFB 5F7UA 2BVQA 1Y0LA 2OM5A 2XPGB 3HZMA 4G80A 4JY4A 1CS6A 3H0TA 3HNVH 4GBXA 5E2JA 2XG4A 1BHGA 3BRDA 3IXTB 1L9MA 2RHEA 2P5WB 2DQGL 3UYPA 4DAGL 1R3IH 5JZ7D 2O5YH 4P3DB 4BYHA 3RX8A 4K7PL 3U2SB 4LPCA 3FB6B 3C5SB 3UTSA 1ZS8A 3SDAB 5FYJD 1S3KH 4KKBD 2AJUH 4F58H 3REWA 1HCVA 1YQVL 3MV7D 3PIQA 3TBTA 5KSAA 1P84J 2F8VA 3OG4B 1VFBA 5A2LH 3GRWA 3BP5B 5IB1A 4M6OL 4U1NA 1I1AC 4DKFH 1U42A 5HYIA 1KC5H 4TUKH 3MXVH 5EO1A 4C4KO 3ARGB 2D0HA 4LSPH 3ZDYF 4KJYA 5K59F 3IDMA 4ETYA 5HVHC 5C0FB 2WUBH 2Q87A 3SDCB 5I74C 1QD0A 2ZSVB 5F9JB 2X41A 4HXAH 2XTLA 1GCFA 2B20A 3LD8B 5CSGA 2GEEA 5GGQH 3O4OB 4P57A 3V95A 5LKNA 5ECJE 1IT9H 2ADGA 4QRRD 2EKSA 4X5XB 5D93C 3DBXA 4Y4KA 4JFXA 1H3GA 3BPLB 1EERB 1AO7E 2R1XB 2Z0BA 1QFUH 1VPOL 5CSZA 2A6IB 4ONFH 2VXUL 1I1FB 4HLJA 4UT7L 1U8JB 4DKEL 5J1TC 4LLAA 1U6AL 4YXKL 4P5TB 1ZVSA 1KXVC 3GSUA 4HUXA 4JFDD 3UYRL 4HPYL 5E9DD 4F37K 1I3UA 4NT6B 4K71C 1FO0B 1A6WL 1MCRA 1CFNA 4XC1L 1JPTH 4RGOL 4OCNC 5IROA 4HIJA 5IB4A 5SWSB 4JN1L 4O2EB 2DB8A 2IJ0C 3WNOA 4JRWA 3MOBL 3B9KD 4KXZI 3GUTB 2Q7YB 3CLEL 3AXLB 4FQ1L 5B3NA 1IKNA 3BP4A 4E0RA 2GUOA 1QSFE 2NY5L 4DK6A 3MBXL 4NNYA 1IAOA 2UVFA 1VFAA 1BEYL 3P3YA 4KJWD 4TPRH 5LGJB 2ARJQ 1M6OB 5C6PB 1DE4B 5GRUL 4PJCF 5I76B 4N5ED 3JVGC 2F19H 3KPOA 4OLEA 1DLHB 2A83A 5D1ZC 4HIHA 3QFDA 1RHHB 1CGTA 3SDXE 3ES6B 1EEZA 4Y4FA 5IHBA 1G7PA 1MJJA 5SWQA 4DKFL 3O3EB 5IVZA 4G7VL 4N8CH 3KHOA 4PV9A 1W72B 1A7RH 1FFRA 3MRBB 5ABDE 3O4LE 4PG9B 5GRWA 3NACH 3H3PH 5EU6D 3QJHA 2AI0L 3BVNA 5EFIA 2OQJA 4LOUD 4RMUA 5H2BA 4PJ8D 1N2RA 1QQDB 5GRXG 3FAWA 3UJJH 4LVNB 3PGCA 5BW7C 3SO3C 2BNUB 1MF2L 2DQHH 2Y5EA 2W9EH 3NIGE 3RWIA 4U1HA 1H9VA 4WVRA 1RIHL 4I18C 2F53D 3FOLB 5C0DA 2HJLA 3QQ9D 4LPXA 3PGFH 5EOCH 5CEZH 1I1AA 1IGFL 2W9DL 4E41B 1R24A 2UZIL 3PXHA 2AV1A 2APFA 4N0YL 2RAMA 5T1MB 3BWUC 1XCTB 4KHXH 5F1NA 4XMLH 3SCMB 4A6YA 1XF2A 1FL3A 4Y5XC 4R4BB 4Y1AE 1UXSA 3IDYC 4TOYL 3GMLA 3ARDD 5D1XC 1T66C 3G5ZB 4PJAF 1E27A 3O2WL 4JGMA 3BPNC 4XNUH 3PWUA 1NSNH 4WW2F 5JTWA 5CGYC 2VLJA 3T8XB 2CRZA 4NHCH 1P1ZA 2IF7A 3RNQA 2HVKA 2R2CA 4QHLA 3IDJA 4PLKC 4ZUVA 1CLOH 4NN5C 3P9LB 4DGYH 2Q86B 2QL1A 4NGHH 1UZ6F 4POYA 1JGDA 4M7LT 2LU4A 2H9GA 3U0TA 3H8NA 3FZUD 4MA7L 3FQNB 2UVEA 43CAA 4KKNA 4NUGH 2UWEA 3LEYH 2P44B 3RIAF 3WJLC 3TFKC 1CD1A 2Q6WA 4CW1B 3EHBD 2AV7B 2AABH 3QDJA 2ATPA 3EO0A 3RX5A 3TCLA 3UJTH 1RK1A 3VRIA 3B8YA 5IW1B 5J1AB 3NOIA 3Q48A 3HC0B 1IL1A 5AUMA 4KAQH 4K3EL 1I8MB 3LSOA 4ISVA 4OM0H 4GMSL 3R1GL 4ZTPL 4MXVF 3VGHA 4KZEL 3WIHH 1G9EA 1TNMA 4YDIH 5FHBL 4YQXL 3L9RB 4D0BB 1XGQB 4HK3N 3NACL 5C71A 3HUJE 3RWFB 3AMLA 3TT1L 2DM4A 4J6RH 4U7SA 1EDQA 5IHZB 3E6HB 3LQZB 1MCOH 5GISH 5LCVH 5C0AA 2XNAB 5C0BD 3B6SB 3IB4A 3JVGA 5D5MB 3EO9H 3GK8L 3PHSA 5D1ZA 1KGCD 2C4XA 5F1IB 1HYRC 3INUH 5L2JA 3ESUF 3G9VA 5GQBA 1UWEH 4U7KA 4I9WE 5DK3A 1CDYA 1DANU 3SDDC 5D7LA 2CLZA 2HG5B 3MRCB 3OAYH 4G6FB 4PJIE 5IT2H 4I0KA 5F96H 4FOMA 4YH6A 5E8OA 5T5FH 1DZBA 4KK6C 3S96A 2W0FA 3ARFC 3MMEA 3C87A 4G8GA 1XGPA 4CVUA 1PKOA 1WICA 1HH6B 3GSXB 2P7TA 4LKCA 4K3DH 5BW7A 4UINH 2P5WD 3U6RB 2MHAA 4XNUL 3MRIB 4HUWB 3VXUE 1NANH 3SE9L 5F1KC 2VC2H 4I18A 4EUPG 1G6RH 3BE1L 2FBOJ 4HEME 3MJ9H 3D0VB 5HYFA 1REIA 2VDLL 1FZMB 4TN9A 3VD3A 4EUPB 2EDTA 2IADA 4ZODA 4IJ3C 1LK3H 2R9HC 1DUZA 5CGTA 4RQQB 4DGYL 4KMTH 4JHWH 4F57L 4LCCC 3QWRA 1RIUH 3U4EB 4Y5XA 5BMFL 1LD9B 5E08L 2HH0H 1OTUD 5D1XA 3H9SE 3B8SA 1OGTA 2IAMD 2ARJB 5INCB 2JIXD 3I9GL 3KLHD 4N8VG 2VIRA 3UTSE 5FKAB 3FO9A 1AP2A 1MREH 4N8VB 4Z0BH 7CGTA 5ESQB 5IMOB 1ZLSH 4JVUA 3K8LA 2BVUA 4H1LH 3RBGA 2XZAL 1UZ8A 3TZVB 4LLMA 1PLGL 3X17A 5HGHB 3UPCA 4TULH 1KEGH 3BRFA 4ZUWB 1K4CA 3BT2L 3BIAX 4BSWB 2NY2C 3GSWB 5FF6B 4PJ5E 1OAKL 2W1NA 1U8PA 4POZD 1L0XA 1TZHA 3VI4E 1MFBL 5AAWA 5AG9A 3GSQB 1Q1JL 1NEUA 2R4SH 5D8JL 1C08B 1WFTA 2CQVA 1NGZA 3QEGH 4ODWB 3BHBA 5IFJB 3CFDA 5D71H 1XGRA 3PWVB 3WJLA 1K8IA 3BAEH 4JM2F 3KJ4C 4S1SH 3DX9A 3WFHB 3IF1B 3CFJA 4OF7A 2Y36H 4P5TD 2PYEB 4P9HC 4NPYA 4MGXA 3IJYB 5C70A 5LAXA 4OZIF 2VXQL 2CD0A 3INUL 2X6MA 5EULV 3S37H 1MCQA 2ID5A 4RMRA 5F7HA 4MDJA 4HMCA 1FJ1B 1E6OH 5FYJU 3DETC 5JLZA 1JGVL 4TQEH 5SWSD 5KG9B 1F3RB 2H3NB 4CN4A 4O5LH 4H26A 3RWEA 3QHTC 3MRDB 4OCYH 4D0CB 1OAYL 1LP9A 1I7RA 1AKJB 1JYXA 3ZE2F 2P5EA 2V9RA 1CFSA 1TVBB 3DLQR 5D96B 4EI6A 5K9JL 4FNLH 2WIIB 3IGAB 4J3OC 1KB9K 3Q3GA 2VC2L 1OCWL 5FKPA 3RNKB 1YEKL 3MNWA 5BS0A 1F4XH 2AJVH 3BGFB 3LKOA 1JF1B 4KGJA 4D9RD 3CFBB 2MTPA 1PX3A 1I9RL 3SDDA 4JRYB 2OZ4A 4HUUA 3EDEA 5KS9A 2AAVA 3RVVD 3S34H 1FL6A 2SEBB 4OIIH 3M8OH 3EJZC 5HYSG 4U05A 4DTGH 3U46A 3ARFA 3KPMA 5HYSB 2VB5A 5TDNA 3UO1L 5D6CB 4KVNH 4PRPA 4OUUB 1FFQA 4MCYA 1VDGA 3ROLB 1E4JA 3BYTA 3VGEA 4TTDD 5I15H 2P8MB 5LG1A 4WHTA 5EU3B 2V2XB 4X4MA 2NXYD 2QHRH 4L9DA 4OFIA 3LPGA 1MREL 3V5HA 4D9LH 3AREC 5IVNA 1CL7L 4WFGE 3NGBB 3ZT5A 4UQ2A 1H0DB 4QTIH 5D1QB 2F15A 2VMFA 2YEZA 2IQ9H 2OTUA 4NRXB 4R4FH 4YGVA 3ZT7A 3MRGA 2CLRB 4X80H 4XMKL 2F8XC 1GRWA 1YNLH 1WV7T 4E41D 1NFDA 4ODBD 3GFUA 3X13B 2J4WH 1NLDL 2RR3A 1EFXB 3VFNB 3A6CL 3VFRA 1T21A 2FLBT 5GPRA 4PJBB 3P77A 3TCXA 4P9ML 4D94A 2CUIA 1UB6A 4ODVH 5I8CB 1JVKA 3IS0X 1RZKH 1T5WA 1AQKH 1G7IB 1DQTA 2HFEA 2VE6A 5JW4M 2GFBA 5ID1A 4WUUE 4OCMC 3S37L 1BBDL 1NUGA 1KULA 1LDSA 3RGVC 4K23L 4XCFH 5I1GL 4GSDH 4TQEL 3OKNA 1YN7B 4AT6B 1AO7D 1KN4H 3DVGB 4KK8D 2IPTL 2YN3A 5CIPH 4ELKA 4X8JB 1I1YB 2R0ZH 4NCC1 4O02H 3QUYB 5DA4A 1JWUB 4K2UL 5DDHB 2CDGA 3NCMA 4WI5A 4WU5B 3E1F1 4DEPB 2YZ8A 4F37F 5ETUB 1ZOXA 2Q8BL 2RFXB 3CAFA 5IBLC 3F62A 2G2RB 2VN4A 1MFEL 5DQJB 5F88A 4IOSD 5ACMA 2KKQA 1NLBH 4GT7A 3HLAB 1BZQK 3NPSB 3IJHB 2VSDA 3FQWA 2CK2A 4K8RH 1HI6A 1T03H 1TQCC 3KPPB 3BZ4A 2B4CL 3ETBF 4OI7A 1YEDA 4P46A 4JG1L 3QBTB 4UB0H 5JQ6H 3LQAH 5HD8D 3QRGL 3K1KC 3QDGE 3SPVA 3NN8A 4L4VA 1A64A 4OB5H 3DXAA 1BLNA 3X11A 5E7BA 1HNFA 2A9NH 3RAJL 5IMLB 5I71B 4CVXA 3C60C 1URLA 3SE8L 4DCQA 4HUKB 1H8OA 4C4KT 1U95A 2Q76A 4PGCA 3VXNB 4RSVA 4PRHE 5BXFB 5I15L 2BXYA 2OLDA 4HFWB 4M6ML 2JJTC 2VZ1A 4LSVL 4XCCH 3LAFA 4G8IB 4MA3A 1GC1H 3IKKA 4JANB 5HYJE 1M05A 3QPXL 3TPKA 5TF1L 3NTCL 5ACZA 2FWOB 1SBSL 3FT2B 1BBJA 4YFLI 8FABB 1P84K 1UACL 4XNMA 3RZWA 5HDQH 4Z6AT 3UJIH 3G6JE 1R5IA 2CRYA 1FZOB 4M7LH 2GK0B 1XF4A 1YNLL 3K7UA 4NO3B 4NZUH 1S8DA 3VFVB 4G6FD 2VABB 4PRNA 2AQ1A 1A9BB 1RZ8B 2COQA 3O4LD 2UY6A 2VSCA 4PJDF 4KVCL 1CXFA 4KTDH 1DQLH 1G1YA 1DBBL 1NGQH 4DFHA 5FCSH 3UBXI 5IB3B 2YRLA 5CJQH 4JDVA 3QO0A 4I0PC 2NZ9C 3U36B 2AEQH 5I6XC 5DUBA 5MEPB 4W6XB 2X7LB 4ODSH 4QXUH 1MFCH 4YFDB 4NYLB 1G7HB 3AVEA 2CGRH 3MX0A 1DQDH 2Y5TB 5KW9H 5KOVC 5FECA 2AJYH 1KN4L 1E4WH 4P4RB 4NRYB 4XP9L 1MCPL 1FGNH 3T04D 4WW2C 3GMNA 1N8ZA 3VFOA 3G6AA 4NM4L 5J12C 2NY6B 2HT3C 4Y1AD 3BKJH 2OSLB 1LE5B 3ZTNH 4LBEB 1L6ZA 3S3JA 1G7QB 4XBEH 2VL5A 4WNQA 5HHVH 4G6JH 5EU4A 4E42B 2Q7NA 2Z93A 3RGVA 1B4JL 4DN3H 1ES0B 5JO5B 4OB5L 5CEYB 3STBA 1JGLH 3TZVD 3TJEL 2YMXL 2A9NL 2VQ1A 5DD1L 3EOBA 3IU4H 3O2DH 5DD3L 2H41A 3JV5A 3MA9L 1KOAA 2CKBH 4N1EA 4NKOA 3D18B 4JJ5B 1PSKH 3TPUB 3VXPB 4OFPA 4DGVH 3O6LH 2VLMD 4RFOL 1KCRH 5LBSH 1QRNE 3D3VB 1TMCB 5E2VH 1XGYL 1YEJH 1MIML 1GC1L 4YK4B 1NDGB 5JMOC 1RMFL 3O3BA 3MO1A 3ZKNC 2C26A 1EAPA 4F2MB 4UIMB 5EU5B 3B3IB 4GS7B 1OP5H 3HZKA 2B1AH 2G5RA 1JN6A 2FNBA 4M93C 4M7LL 3C60A 3P9MB 4OZGE 5F9WC 1RUAL 1DEEB 4ETQA 1U8KB 2ZUQB 3MODH 3AFLA 4KTDL 2X4SB 2D7OA 1KB5H 4HGWA 3DRQB 5CJQL 3GMOA 3WXVL 2FJHB 3PP3K 5L2KB 2OK0L 1X6LA 4DK3A 2JJTA 4WGWB 4X98A 3VFTB 2BOCB 5EUKA 2X44D 3U30B 4LKXA 5HI5C 3JV6A 3KPLA 5A16A 4Q58C 5FDWA 2GQHA 1K6QH 5BVPH 1G0DA 3QI9B 3CSYA 4FFWD 1RD6A 5JPNB 5FDYA 1DQDL 4J23A 2AJYL 3O2VH 4LRNL 3VG9B 1JWMB 1JYWA 1ZANL 4JRYD 1KIPA 4M03A 3VXSE 3PHQB 1C8PA 1ORQA 5DMJB 1LP9E 3EYFB 3IS1X 1P7KB 5D6DA 4RZCA 3WUWB 4EOWL 5TF0A 2AP2A 4M61A 4I3GA 4MXQC 3C8KB 4XPBL 1HXYB 5AZEH 2PYFB 1N6QL 1R3KA 5MI0C 1HEZA 1UH4A 4KHTL 4I0PA 2V17H 2VLKA 5EUOB 2GJ6A 1A4KB 3MLUL 2FH8A 4KK5C 4NKIH 4I3SH 1X5HA 4BSVA 2R2BB 3K4AA 2ZCLH 4XCEA 4RA0C 3MLYH 4XP5L 1H5BC 3MOAH 3DGGB 3GHBH 3TVMD 1BAFH 4OM1L 3OKOA 5KS9E 5D1QD 4MLIA 4PJAA 4HK0A 1ZA6A 2XT1B 1KTLA 3B9AA 3EDDA 2AJSH 4WW2A 5CBEA 2OTWB 2VZVA 1ZVHA 2R2HB 2IANB 3LN5B 5DC4B 3KLAB 3W5NA 4MQXC 4NQDE 3H9SD 1AD9B 3U0PA 2Z31C 3AAZB 4X4ME 4Y4HB 1EFXD 1X3DA 2X4RA 2IH1B 1T0PB 5T5NG 2GAZA 2ARWA 1IC5L 5DI8A 5EWIH 3GJFH 4FHBD 2XN9A 4PGBB 4OFYD 1AGEA 3SKMB 4KJQC 3P11H 5TDOA 5HGDA 5D7IF 4NRZA 5B39G 2P42B 1EXUB 2OL3H 1JHLL 1JK8A 3GBNH 5DC9B 1UG9A 1NFDE 3NMEA 4PJ5D 1YPZF 4R3SB 6FABH 1CYGA 3ARXA 2N4IA 4C55A 5IP4A 4XVUC 5L8LB 4HK3J 5C0GB 2YPLB 2JB6A 5C92A 3O6ML 5C08E 2I9TB 3ULUH 2A1WH 3QUYD 1IEBB 3BH9A 3QISA 4Z7WE 5GS2H 3OR7A 4LCWE 3GSOB 4EI5B 4JHAH 2AGJH 3EOTH 4ZDHA 5JHDB 1ADQL 1LEGA 4XBGB 3OWEA 1PEWA 5J7CC 4X7TA 1J8HA 3D2UD 1VEMA 3DRTB 5DEFB 5B21A 3O2VL 3QT2A 4PJXB 2XRAL 4G6KL 3CFCH 4ZMAT 4MB4A 4P2QB 3VXRE 5BOZG 1W0WA 2VWEE 4CAGA 2X1PA 1CT8B 1L7IH 4RX4D 1HIMH 2BSSA 4R96B 1TJHH 4GRWB 4U31A 4BZ1L 5AZEL 4H88L 3MLPA 1I3GH 2Q20A 3T1FB 1JHTB 3MV9E 5DO2D 5BZDA 1I9IL 3MLYL 1SYVB 4XAWH 4OLZL 1QSEB 1YQ2A 1A02N 2LQRA 3FB5B 3ARBB 1Y6MR 3N50A 2GSGB 1TVHA 2EC9T 5GRVL 1PKQB 2Y4SA 1XMWA 4MDIB 3M1BA 1A8JH 3UTQB 4G3YL 5F89A 4PJ7A 1AXSA 5C0CB 1YN6A 2ENSA 3L3GA 4XMPH 4ZPVB 5I30H 4OIBA 2G75B 3BPOB 1WGOA 2DLFH 4O2CB 5HHPB 1TZIA 1L6XA 5A43C 2PW2A 4U1JB 1YEGH 2DLTA 5CZXC 1NCCL 1H8SA 2YWZA 3DJ9A 1ZSDA 4Z9KB 4ALAL 4U0QB 5ANME 2EE3A 4CADB 3PWJA 1H5BA 2PXYB 4IDJH 4OGYH 4WFGD 1UVQB 5TFSH 1L4IA 3TBYB 4HHAB 4X4YB 2XQBH 3QG7H 1NAKH 1KN2L 2YPKB 4LDOB 2APBA 4M5YL 5ICXA 5CGMA 5E00A 4HS6B 5KSBB 4KI5D 4KJPC 5BV7H 3D25A 4NKDA 5GRJH 3P4NB 2PW1B 2Z31A 2NY6D 4Y2DD 4TSCH 4UU9B 4AENB 4ZUSA 4QHKJ 2DWEB 4WI6A 1JTPA 3O11B 3IDNB 3L3DA 1HHKB 1IC4H 2RB8A 3HPJB 2K1MA 2FJFB 4N8PA 5D7KD 3ULVD 1QKZH 2O5ZL 1FLRH 4WUUD 4G6AC 1YECL 2GTWA 3P73A 2BMKA 4YHIA 1J0ZA 1BIIA 4U1LA 4Z7VB 3O3AB 5DJZB 3T09A 2JK5A 4DKAA 3L95B 5E56A 3VWJD 4F7CB 1BVLA 4PJBF 4NCC2 4R26L 5EBWA 3THMH 4GG8B 1LO0H 4XPHL 1FFPA 2VDKL 4A6YH 1F45A 5FV2A 4LASH 5C08B 12E8L 2OCFD 3QAZC 4XHJC 3S5LG 5AG8A 2VZOA 4CVZA 4K3GA 1UM5H 5FO8A 3OB8A 2MQCA 5A3IC 4YAQA 2CPCA 3IKCA 3S5LB 4X6BA 3I6LD 5D72L 3C5ZB 1JPFA 1KCSL 3D3VD 5BO1L 5IR1A 3U7WH 2W0LA 4NHUB 3PNWB 4K94C 5E5MA 4QRTB 4ODHH 3VWKC 2IALA 5D7SL 4ENEC 3QDGD 1NMBH 1WZMA 2E27H 2Z91B 3MUZ1 3UTPD 4XB8A 1G6RB 2A73A 2X1OA 1KV3A 4QT5B 3PP4H 3U4AA 3FQTB 2BERA 5DRWA 5SV3A 2VXTL 5FCUL 5T1LB 2IG2L 4F8QA 3QG6A 5GZNC 4JPIA 2X9WA 3RVXD 3FRUA 5C2UB 5C07B 5KN5B 4KTEH 1F6AA 4WRLA 4CMMB 4PRHD 2A38A 5JHLL 5GIRB 3V6BR 3EFFA 3WFCL 2WUCL 1WC7A 2YPVL 3FTGB 5AYUH 4GKOA 1PG7H 3CDFA 4KRPB 2CXKA 5HYJD 4NN6C 1MCLA 1GVIA 2AJZB 4URTB 1NUNB 4M02A 2HMIC 3WE6B 3DUUB 3WO4B 1KLGB 5BOPA 3QNXB 5HVFB 4L8DA 1KJ3L 1HHHB 1S7VA 4MJIA 5H37G 4H1LG 2HYMA 3MOQA 4K94L 3I6GA 4KY1H 1W8OA 4H1LB 2W92A 3NA4A 3CDYA 5CD5D 4U3HA 4QXGL 3NZ8B 3L6FB 5DVOA 4PJFB 3DYPA 4B50A 2I9LB 4F7TB 35C8L 1IGMH 1HHIB 3QULA 4GW1A 1IGCL 3VXTB 4LHUG 2AJXL 3V5DA 3DVNB 4LHUB 4D8PB 3OJDB 1CXEA 2PO6B 1LE9B 2Y06L 4J3UA 4Y16B 3WL9A 3UTTA 3T2NL 3L1OH 1H3WM 4XC3L 4L3CB 1K8DB 3QUZC 1D5XA 3RVUD 1JV5A 1ITBB 4N90E 3VXOA 4GRLB 4ESKA 3MRNA 2VYRE 2FEDD 2FD6L 1FVCB 1I7ZA 4XI5D 4XH2A 4ZOBA 1F3DJ 1QBLL 1BECA 3LDBC 4OD3L 4P3CL 4W4NA 1SEBA 1X7QB 4IHOB 1UM5L 3ZKMD 3K0WA 4HH8A 3CH8A 4LLVA 2FX8H 2GJ6E 2DI9A 1OP3K 1T22B 4PJGB 4K7PY 5MHSE 1X5LA 2Z35B 1BWWA 1BFTA 2C3XA 1IE5A 4S1RL 4NQEB 1INQA 4JM4H 5I1KH 3HPLB 1MAMH 3TT3L 4NP4H 5I1JL 4P2YA 4LCUB 1VESA 2V2WB 3HC3L 1YY9D 3GMRB 3E8UH 4MD5A 4RIRB 5DR5H 3JWDC 4G42A 1QFWI 1CLZL 4JLRA 4WIQA 3DX8B 5INDA 3CCHA 2CK0L 1HQRB 4I2XA 1KPUA 4YXLL 1SJHA 3T0EE 5JUEH 3SQOH 4F9PC 4FTVA 5HHMB 1WWAX 1JP5A 3CDGB 2EDEA 2G60L 2DD8L 4OAWB 4PP2A 3BI9X 4RWYH 1C5CH 1J1XL 3OAZH 2XN9E 4YHPA 1AIFB 4EI5D 4PRIB 1JTTA 2Z92A 3QUKA 1R3LA 3VWKA 1KLUA 4QHKI 4MAUL 3UP1A 2FATH 1WWWX 1KXQE 1N59A 4JB9L 1OQXA 2FB4L 3CFKB 5DMIH 1ED3B 4H0GA 3Q1SH 1ZT7A 3MLRL 4PD4J 4NQXB 1HILA 1OAUL 5GXBB 1IM3B 3EYOB 1AR2A 2WSKA 4RMVA 3L7EB 3HI1B 2HKFH 3O3DB 4P2QD 3FO2A 3MRJB 4LVOC 3JWDL 3KYKH 2EH8L 3ET9F 1KT2A 2JCCE 4Z78A 5CEZD 5EOQL 3U0WH 1HKLH 3S35L 3K8MA 3QNZB 4Z7UB 4WO4C 3QPQD 2EDXA 4WEBH 3UAJC 2WV3A 3WN5B 5ADPH 3HC4H 4NQCB 2N7BA 1T0MB 3EW3B 1OSZB 4M62L 4RFNB 1QSED 2CDEB 1XGUA 4B41A 1ZT4B 3ARBD 5DEGB 3RIFK 1QNZL 1IGYB 2CDFB 1DBAH 1BVZA 3VXSD 4NWUH 3IFNL 4PIRF 2YD1A 3BX7C 1RQ5A 3VDAA 4ZUUA 3V0WL 3SKOA 5E8NA 4BUGA 3GMMB 5ITBH 4TUOA 2MWCA 4DOHE 1MRDH 5C0CD 5T1KB 1HYSD 2VH5H 4F7PA 4NKMA 4XPAH 5CIPB 5DK2A 3ISWA 3MV11 4E5XA 4ZNEA 5I2IA 3PHOA 4HIIA 4YFEA 1MCIA 1NH6A 3TO2B 5I8OL 4MJ5A 5C0EA 1F6FB 2P45B 1U8MA 2AXHA 4KV5E 1GZQB 4R8WH 4FA8A 5E6ID 3QUZA 2OZ4H 2PXYD 4AL8H 1FPTH 3O9WC 4GKSA 3DO7B 2YD6A 2YK1H 1N6UA 3E8UL 4OCRH 2NY0B 5C6TH 3LY6A 3KPQA 5ILTH 1G84A 5T1DH 4FXGA 1MJUH 4PJ7E 4FQLH 1MY5A 1MCNA 1F4WH 1B2WH 5CJ5A 5E2UH 5JUEL 3SQOL 1MWAL 3AS3A 1A7OH 4ZTOH 2MQ3A 1MCWM 4NQDD 5DHXB 1NGXB 3W39A 2HJKB 1EFQA 3F5WB 1RK0A 5IJKC 2C1PA 1J0KA 3EOAB 3OX8B 3IDGB 2A6DB 4YLQT 1HE7A 4LNRA 5EZIH 2VDQL 4HC1A 4HDIA 4PGEB 3RPKA 4BUHA 5JR1H 4UBDD 3MNVB 2D2OA 4GAFB 2BVYA 5IIEB 3QZWA 1FRGH 3ZSTA 1TTUA 2CIIB 3U82B 1I8KB 1T0NB 1NBYA 2H1PH 4WV1B 5F9DC 1OAZL 2B0SH 3TJHC 4F9PA 1BD2E 1IFHL 1JGEA 3FFDA 5C08D 4ZUTA 4BZYA 3LS4H 3CFEA 1P6FA 3HCVB 3PABA 4NN7B 4YE4L 5EO9A 3BEWB 3H9HA 4LCWD 1NCTA 2IBZY 4OZHA 4PJ9C 1IKFL 3OKKB 1L7TH 5K9KB 4QOKA 4IMLA 3IJSB 3GHEL 5GZOD 4Q6IB 3V4VH 3EBAA 4TSBL 4IRJB 3HC4L 5BRZE 4PFEA 5HHXL 2X70A 1C1EH 4XXDA 4X6CE 1ZK9A 5EBMA 4MNHB 1Z0NA 1TJIL 3MGTB 4HWEL 4F15B 4N9GA 1WCBA 2H2SC 2I07B 5ICYA 3I02B 4NO5A 3VXRD 3L5WB 2Z8SA 4LLUB 1DFBL 5IF0A 3HZVB 3VDBA 1FZKA 4U6HA 4Y19A 3WFBL 3EDFA 3NCJH 5IB5A 1MPAH 1R3HB 5F3BB 4M7ZC 4ONGL 1QPPA 5EOCJ 3WKMH 4HSQA 4IRSA 3RY6C 1WITA 3SJVE 3L3HA 4HZLA 3EYUL 3MV9D 5FAAA 4WO4A 1NGYA 3DIFB 2ICES 4KRPD 3WHXB 4GRWF 2XTJE 5HI3D 3S98A 1WZ1H 4BFBD 5LWYH 1MWAA 1NGPL 1R5VB 2GW5A 2WMPA 3N1QC 1XZ0B 4U3CA 3QDMB 4OT1H 4NO0B 2O26U 4P2RB 1W0VA 2ZCHL 3LIZH 1EBPA 1KCVH 2AQ3A 4MSWB 4YHZH 1YJDC 1P2CA 2D03L 3ZE1E 1VGEH 4J3SA 3FHAA 3MV8A 5T3ZL 3RWJB 3QNYA 2B7DT 1XH3B 2ADIA 1BGXL 2ZOLB 3M17A 2WWKO 4XWOD 4MA8H 1A9EB 1V5JA 5I75C 2CKBB 4U1IA 5MENB 1UWXH 2V7HA 2E6PA 5CKAA 1GAFH 2BK8A 3T2PA 2H8PA 4ZFGL 3PWPB 2C1OA 4DZ8B 4MVBD 3FFCE 1T04A 2APWA 3TV3H 4L3EB 4H20L 1T1YA 3S36L 1RJYB 2DQIH 2PO6D 3O9WA 3VMNA 2AEIT 3NFSL 4DZBB 4MJIE 3ULUE 4M7JH 5IW6A 4JCLA 5E8EB 2C7UB 2JJSC 1BX2A 1VGKB 4KDVA 4QWWC 4B53A 5JA9A 3NCEB 3VFMB 1N64H 1CK0L 3LEXB 4Y5VC 4WTXA 5I18L 1UKSA 3QIWC 2B1HH 2LFGA 4BFIA 2Z8RA 1DUYA 3NA9H 2BX5A 5ADOH 32C2B 4ODUB 1U2CA 2EH7L 4J8RA 1M71B 1N26A 4KROB 5EC1A 5IESL 2ITCB 3RRQA 5DS8B 4ZFFA 2WLZA 4HPOL 5FK9B 1HSBB 2CSPA 4KI1A 5HVWA 4GRMA 4U1KA 1SJEB 2VL4A 4GW4A 4AEHL 5IJKA 3IETA 4UAOB 3ELAT 2E8YA 3G5YB 3TBWB 5C2BH 1VENA 1AI1L 5ENWB 5J0BA 3MRMB 1KB5B 3QUXD 4K07A 4C56B 5KSBF 1NL0L 2ZJSL 4MS8D 3MLXH 4NQED 3T3PE 2J7LA 4RNRB 1WIUA 1MJ8H 2ESVA 4JZJC 2VDPL 4HJGB 4W4OC 5KTEH 3HE6C 2QQLH 3UZVB 2BDNH 4JREC 1I4FB 4M8QB 4HKXB 5HGGS 1AGBB 3UYOD 4XCYB 4OLUL 3KXFA 1UYWL 4PJ9A 4RDQG 5HHMD 2H32A 4QYOB 1LO5B 3FO0H 1NC2B 4YO0B 3TC9A 5I0ZA 3ESVF 3KPSB 2GJZA 2ED9A 3V52L 1BZ7B 3GM8A 2XXCB 4YHLL 2G9HA 1G7LB 1YZZA 3OR6B 1WZ1L 2IBGA 4PRID 4DW2L 3TN0D 1OF2A 1D5IH 1XEDA 2QSQA 1PVHA 3SGKC 2NW2B 3SDYH 2J2ZA 1FNGA 2JTDA 4NBXB 3OXSB 4FTVE 1RFDH 5C8JB 4QRUA 5CZVL 1QSZA 4QRQA 4H25A 4P5MA 5ESAB 1RZ7L 3HZMB 3RY6A 2HN7A 5ISZA 1HSAA 1CG9A 1N5AB 1SM3H 4GBXB 4ZFOL 2J12B 2Z8VC 1EGJA 2DI8A 5EZOL 4JFFA 1QO3A 2P43B 3RA7H 4HWZA 1Q9OB 3CNKA 2R69H 5EU7C 1R0AH 1ZS8B 4NQCD 4LVHC 5DD6A 4UMGA 3LMJL 3REWB 1GJIA 3BDYH 1G9NH 4LIQH 3TBTB 1R5WA 3H9YA 1AR1C 3GMQA 3WD5H 1VFBB 2NLJB 4NC1C 5EB9A 5IEKA 3NA9L 1OD9A 4LP5A 3DHJA 3V8OA 2FZ3B 2OL3B 1D9KB 2FYYA 5DYOA 3GB7A 4C59B 3VGBA 1A0QL 1KIUA 2AXFA 1VADA 4OLYL 3SOBL 3FOMA 3DYOA 4KJYB 5T1KD 5I19L 2R1YB 3IDMB 2R0LH 4NWTH 2NXZC 2BVTA 3LKSA 4PJHF 1C7TA 2QLVB 1GHFH 5ALCL 3UTZB 1YNKL 1ZAGA 2JJSA 3K80A 5MEOB 1ZT1B 1F58L 4N90D 4P57B 2FHFA 4WFFE 4XPFL 4Y5VA 3QIWA 3EJYC 5TGBA 4JRXE 2EKSB 2BDNL 2NY0D 1U8OB 2EYRB 5I1CH 4Z8FH 4JDTL 4AM0A 4K8RD 3O41A 2Z4QA 4JFYB 4JFXB 4QTHA 2ITDB 3K1DA 4ZNEE 1MFDL 2NNAA 5CSZB 5I73B 4QRPA 1KTDA 4X6DB 4GAGH 3FO0L 5MHSD 4OI9A 2VUOA 4WI9A 4FZ8L 1FHGA 1NDMA 1ZVSB 2J6EH 3GSUB 3NFPA 4XNQA 2YD7A 3ARVA 1YMMA 3D39E 4OV5A 3WEXA 4W4OA 1INDH 4YHNA 4FQQA 3HE6A 4G7YH 3LB6D 4K3HA 4HIJB 1KG0A 3P4OA 4WU7B 4K55A 1MUJB 4RBPH 3P0YH 2ZG3A 3T0ED 4NO2A 1ONQA 5ERWB 2DQTH 3E6FA 1NC4D 5GGTL 3R8QA 4MX7A 4E0RB 1QA9B 4BK4A 4X99B 4TRPH 5EO0B 1VFAB 2VZSA 4OD2A 3VW3H 2XYCA 4PJEF 5I17A 2DKMA 4GXUM 4JAMA 4AIZA 1J88A 4LPUA 2BNRA 5JZ7C 4M00A 4G5ZL 1K2DA 3BDYL 1G9NL 1SYSA 4HIHB 3SGKA 5JXED 4ODXA 2VXVL 1CGYA 3QFDB 1UJ3B 4Q2ZB 3UCRA 5TE6L 2V9QA 3MRPA 3I6KA 1G7PB 1MQ8A 4KKBC 3Q6GH 2HFGL 4FFZL 4WI2A 4JO2L 1A1MA 1DSFH 4X4ZA 2DTML 2BCKA 5L88L 3BFOA 4OZHE 3U9PH 4K9EH 4QOKE 1U8QA 1MAJA 3LV3B 3QJHB 4XVSL 3V2AR 5J4MA 2FIRT 4PGZA 5EFIB 2OQJB 5BV7B 1CU4H 2VQTA 2VN7A 1KPVA 3B2UD 3RIFF 1EJOL 1U8IA 2CMRH 3GSVA 4JO3H 1HH9B 1JMZA 4YHOH 4FQ2H 4R90H 5C0DB 1WT5C 2AK1H 3QDMD 4NO0D 2AVGA 3HG1E 3AS1A 1PG7W 1I1AB 5FXCH 4Y19E 1Z9OA 2ZP0T 1R24B 3ILPA 4O00A 5TE7H 2IGFH 1QBMH 3MREB 3VCLA 2EZ0D 2I27N 2MNUA 4XNXH 5FYJL 3QEQA 4A6YB 1ZE3C 2HFFA 4OBRA 1S7QB 2OR9H 1UXSB 5I74B 4X9GA 4ORGB 4QHMB 5EZJB 4CGTA 3B9VA 3V4PH 5AD0A 4X5LA 4XTRD 3LVEA 4OKVA 2OMNA 4ZYKA 5B8CC 1KUMA 4YBQD 2BXZA 2A6KA 1FYTA 1JFQH 3FJTA 4ZAKD 1BOYA 4HJ0D 4R0LC 1P1ZB 5GGTA 3TWCL 2VAJA 2HVKB 3W5MA 1LNUA 3MV8E 3IDJB 4ZUVB 2J8UB 3JV4B 2L4OA 4M7KL 4R7DB 4UV4L 3FQUA 1T20A 2KUTA 3GO1H 1AH1A 2AEPH 1DBKL 4LAQH 2RBLA 4LQFH 2EDYA 3B9KC 4KROD 2H9GB 4OTXH 3C6LD 3U0TB 4QRSA 5DHVH 5EORH 5HVGB 3MRHA 1I1RA 2UWEB 1F8TH 4HWBL 2VITA 4U1MA 4KUZH 5DC0A 3QDJB 2MKWA 5F7LB 2CLVB 3EO0B 2CIKA 4K71B 4ZD3H 4JDZB 5D2LB 4KJWC 3H7BB 1RK1B 4WI4A 3VRIB 1MIEH 6CGTA 1MRFL 1IL1B 3F58L 1IGIH 3H9ZA 5EIIB 1O0VA 2EO1A 4Z5RA 3L7FB 2W91A 4N5EC 4RFEB 3VXME 4CMHC 3RTQD 3VFPB 1BQHG 4P5KA 2PNDA 2W65B 3TA3B 1BD2D 4R6UA 4LCIH 1B0RA 1J0IA 4PP1D 1BQHB 2ZSWB 4L8SB 3PWLB 3C08H 1UM4H 3V7MA 2Y07L 1JZ5A 3GNMH 4FP8L 3KYMB 1WCQA 4HWNA 4A2MA 4M9PA 4I48B 1SHMA 1BM3L 5C0AB 5BRZD 4LLQA 5CHNB 3SDXF 2PETA 2YBRB 3KPSD 1MNUL 2AEWA 4Q0XL 3M07A 5CLWA 4LOUC 4PJ8C 3SKJH 1F11A 4MNQE 5D1ZB 4FQ2L 2ADJB 3AROA 3RJDA 5FUOL 5L2JB 1A7NH 2YUWA 3MV7A 4J1UA 1X5KA 1IQDA 5D7LB 2OJZL 4U4BA 4IS6A 3QQ9C 2ED8A 1CDCA 3IU3B 4HJJL 1IZKA 2V5MA 1P5UA 3BWAA 3BPCA 4JG0L 3HZYA 3SJVD 3MACH 4CJ0A 3RWGB 4LFHD 3QQ3B 5F6HJ 3NIGF 4G8GB 1XGPB 4KKAD 3U9UA 3MCLH 1CXHA 5MEQB 4L3AA 4LKCB 1FIEA 1E28B 1RUQL 3F65A 5F7NC 3OZ9L 4YWGL 1OT1A 2AJ3B 4O58L 5T3ZE 2XTJD 3ARDC 3GIZL 4I18B 5BZWB 2DM2A 2MCPH 1WT5A 3FO1A 4QRRA 1FFNA 1EEUA 4WDIA 5C7XL 2GSIA 5I9QB 4M9OA 5FYLH 2X89D 4YNYB 1KIRB 5ISZE 4EZMA 5D2NE 1D9KD 15C8H 3CK0L 1CDHA 2QSCL 5CP7A 5D1XB 1G7JA 1F8TL 5DSCA 1YDPA 5IEHA 1FGVL 5DFVD 4HS3A 3FZUC 3FFCD 2VIRB 1DVFA 3PJSA 3FO9B 3L3JB 4JFDA 5C86A 2BJMH 5B8CA 3BZDA 3UC0H 2V2TA 3RL2A 3ULUD 4U2ZA 2FGZA 1S9XB 3EHBC 5E9DA 3FL7A 5GS2D 4HLZH 3VGAC 4R0LA 4LCYA 1UZ8B 4LLMB 5K9OB 3W0WB 1PYWA 4GKNA 4FQJH 1K4CB 3Q6FB 4I3RH 4NN5B 5JIKA 4G6MH 3RVWD 1TZHB 1LEIA 4M5ZL 4UOJA 1ZGLA 3P4LA 3B9KA 3KVQA 5HY9A 3O0RL 1G6VK 1NGZB 3BHBB 1TTGA 5HSFA 3VRJA 1K8IB 2LE9A 1RSFA 2ATKA 1KCUL 2F5BH 1LDPL 3CFJB 3DUSA 4BM7A 3L3KA 4PV8B 1RZIB 5B3JE 3SKJL 4NPYB 4HF5L 4Q9BA 1RJLA 4PB0H 2ZUSA 5DJAA 3RPIA 4YBLB 1TZGL 4O4YL 1U41A 1A3LH 4QF1B 3VFWA 2R2EA 3HUJF 5JLZB 1T2JA 4I1NB 2NCMA 2ZWLT 3BZFA 4QRPE 2QHLA 3QUML 2WINA 1PY4A 1DBJH 4JO1L 1BF8A 4RGNE 4NOBA 2WWKT 3OJ2C 4KKCD 3QHFH 4WI8A 4YDJB 2ICWJ 3KDMA 4CU7A 1FBIL 4IRZH 4WTZA 2EIZB 3V6ZA 5HHOE 2P5EB 2C3VB 5EU6A 5DD0H 1YMME 4QNPE 3FRPA 1BFVL 1AY1L 4PJ8A 2R0WL 3Q3GB 4NDMA 1S7TA 5D70L 4KQ4H 4PJIF 1RZFH 3MNWB 2XWBA 3LKOB 2I60L 3X14B 5KVGH 1D5ZA 1T80A 2YD4A 2D0GA 3SDDB 4PRBB 2F53A 4HUUB 1X5GA 1QLEH 4WEMB 3N9GL 1OPGH 2FBJL 3I50L 3U46B 1Q94B 2PUQT 4QHNA 1HQ4A 4PB9L 5CSBA 4PRPB 4JFZH 1IBGH 1G7MB 4NFDA 3BJLA 5IHLB 2BNRE 3ARDA 1OTUC 1A5FH 3F6IA 4RMWA 3V5HB 2IAMC 3BDBA 4JFOA 3WNKA 5KBNC 3KLHC 5CUSL 4UQ2B 3K4DA 4NNXA 5DD5L 3DURB 1BPVA 5F1OB 2HRPH 1KJVB 4FQJL 1H15A 4X7DC 3T0AA 5FGSA 3O4OC 4YGVB 3LPFA 1QLRA 4MJ6B 5D9SA 1UA6H 4U1GC 1QLFA 3WCYA 2ENYA 4WFEE 4L1HA 1CFVL 4P23D 4POZC 2DKUA 4JPWL 5GGRB 4X7SL 4BELD 1Q9WB 4HQQH 5EU7E 3ZMRA 2DICA 4S11A 1UB6B 3KPRE 4I77H 4EBQL 2EC8A 3O8XD 3MA7A 2X09A 1JRHH 2HFEB 3A6OA 1Q0YH 2GFBB 3NCCB 4OCLC 5F6HI 3RWCA 4XPGH 5C6WH 4P5TC 5IFHL 3ARQA 2DQJL 4GG6A 2VDOL 3H3BC 3VI4F 2RQ8A 5EZLA 3KJ6L 4JRXD 3TNNA 2KDGA 2MOVA 3AS0A 4HG4J 4MNGA 1EK3A 4JFEA 4JHZA 2NY2B 2QQNL 3OKNB 1NBQA 4PTTA 5GSVB 3F12B 3WIFA 5IM7A 5B38G 1QOKA 3UBXA 2GTZA 1MQKL 5B38B 4IRZL 1WBXA 5IGXL 2CDGB 2P8LB 4DN4H 2I5YL