4PD4J

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pd4J00
2EO9A 5BVPL 4F7PB 4YDIH 3BPLC 3QXTA 5ABDE 5L8LB 2FR4B 1K4CB 2E27L 1KLFA 1FL3B 2A6IB 3W9DA 4YHPA 3QULA 4TPRH 5K93A 3X3FL 5F9JA 3ZDZE 3VFGH 1JNLL 4MVBD 2BSSB 1SJEB 3DI3B 5KVEH 5C0BD 4Z78B 2MPAL 2DQUH 2Y07L 3M1BB 5CD5C 1DLFH 4G9FD 4JPWL 4RAHA 3RUGB 2PXYD 2X4RB 3WJLC 1U36A 1I85C 4IEFB 2AJXL 3MV7A 4F3FA 1J1PL 1C5DA 3D39D 5DJ2A 4ALAL 3F6LA 4MS8D 1SVZA 2VQUA 1MH5B 5EU3B 4L8BA 1B0RA 1EO5A 3QUYD 3GHEL 1YMMD 4LRIC 2CXKA 4NQSA 1AO7E 4ZAKC 3FRPA 5FGBA 4TSBH 4WEBL 3T0EC 2C7UA 1Z2KA 3VGDA 4J6RH 1EDQA 3O2WH 4P23D 3WCYA 4ELKA 5IFHL 4OGXH 1AGCA 1RK1A 2P4AB 3D0VB 3PXHA 2ENSA 2QV2A 4PJ7F 2ZUVA 3NCMA 4NKQB 2JB5L 4WRLA 5EORL 3ROOA 2P1YA 2ADIA 4X4XB 2JB6A 2PW1A 3G5XB 3OGOE 2LTQB 4OF8A 5ACZB 2ZOLB 5AZEL 4JQIH 5D6CB 1MCDA 3B9KD 5F7UA 4GAFB 4LAQH 1F90H 3FB5A 2QQKL 1QLEL 3D6GA 3QQ3B 4KPHH 4NZTL 1IAII 5E6IA 3BN3B 3U0TA 3SDDC 4NT6A 6FABL 4JZJC 1RY7B 5CZXD 5BS0A 4HS6B 5CINH 4PLJD 5CGTA 1NCTA 1KIQB 5IESH 3N9GH 4K94C 5HHOB 1NUDA 2CUIA 5I6XC 2EIEA 4LLYB 1CD0A 4QXUH 4YDKH 1UKQA 1KGCE 2Y6SC 1HDMA 4FQXB 3U1SH 2F53A 4V1DA 3OZ9H 3K2UL 1Q0XH 3CGTA 5T5FL 2OBGA 1EHNA 5EOQL 2I5YH 2DWEA 3QQ9D 3ARSA 1IAIL 5HVWA 4NOBA 3PL6B 3VXTA 3RWJB 5I71B 3V6ZB 3NFNA 1IM9A 4M48L 1SJHB 1KXVC 4HGKC 4LLUB 4HUKB 3BQUD 4Y1AA 2WWKT 2XWTB 4HC1A 4OV5A 3MX0A 4OIBA 5INDA 1X5KA 1KJVB 4YZFE 1MWAL 4PRID 3LIZL 4HMCA 3LS4H 5IHLB 4EQ3A 5JHLH 2LABA 3IU3B 4MZ2A 5LXGH 2VDLH 1QSFB 4MJIE 2FATH 2YN3A 1IE5A 4HUUB 3ZDXF 1G7MA 1CICD 3RWHB 3LDBC 3BIKB 3PV7A 4BQ8A 4JQVC 1NMCB 4XPGH 3PWLB 2Y36L 3DX8B 2VLMD 5FV1L 1X9QA 4DJMA 2XTJB 1MLBA 4F7PA 4Z9KB 3X13B 2FD6H 3VFNA 3QZWB 4NO2B 2GK0A 5SX4H 4G43B 1SJEA 4QRPD 1J0IA 4WW2A 5ICYB 4NQEE 5F8RC 4PGBA 4JAMA 4MD5A 3WS6A 3MRHA 1S7VA 2FWOB 3DVNA 3VH8G 1WVZA 3VXRE 4LLAA 1L7IH 3HPJB 3THML 5HHNA 4A2LA 4B0MM 5C3LD 4Q6IC 2VOTA 4WO4C 5CCKH 2DTML 5IR1A 5EU3A 5EOCL 3DUUB 5DGQA 4EDWH 4Q74A 3CSBA 4TUKH 5KS9A 4AG4L 4OF0A 4PJDE 3KPSB 4GW5A 4ZPTB 5I1CH 4LKCA 4DKEL 3LN9A 3EYUH 3RY6C 5JOPE 1JTPA 1DANT 1KCRL 4RA0C 5HTSA 1RHHA 4HAFA 3NTCL 2YWYA 3MA9H 2BNRE 3MODL 1QLRB 3BMWA 3D0VA 2HVKB 3GEWB 4X8XA 3KDMB 5C0BB 4HUVA 3V4UL 4WNQA 1ZHKA 4CL7A 5HGAB 5I1LA 1YQVH 1G0XA 3BVNA 4G9FB 4X6EB 1AXSA 1WBZA 5HY9A 1J0KA 2PXYB 1CG9A 2ATPB 2P8MA 5EUKA 1UZ8B 2PN5A 3D39B 4HKZB 5CJXC 4F7MB 4E42B 3D5OF 4RGOL 5I1HL 2HTLD 5HYJE 2QLVB 1I3UA 1UT9A 1YMMB 3QHZL 4KJQC 3DNKA 4HC1H 4HF5L 3P4NB 5LG1A 5MEOA 5JUEL 2J8UA 2C4FU 4FXGB 3SE3A 4POZD 4MJ2A 2Z4QB 4X7TA 4XMPL 4P23B 2VXUH 2FBJH 4I8DA 1QYGH 3RWIB 1BZ7B 2M2DA 5C2BL 4U1MB 2VZUA 3OPZH 3FFDA 4WHDA 4FQLL 5TE7H 2VLRD 3S98A 4C54A 2CKNA 3DBXB 3TZVC 1RUML 4MB4A 4WI6A 1IGCL 2R69H 4YWGH 1PJ9A 4PJHB 4UINL 3RWCB 2ATKA 4QF1B 4I0PC 3QCVH 2E7LC 1YEHL 5CUSH 3B9KB 1D5BA 4OFVA 3O2VH 3BYYA 4I3SH 1CR9L 2R0LL 3QA3A 1SJHA 4LLUA 3RFZC 3RVVD 4R4BB 4NWTH 2A74A 3ALXA 4XNXL 1X5IA 2CLRB 3U36B 4XC3H 3OAYK 4YDLC 1IGYA 4JLRB 3C6LA 2VXQL 3VD5A 1SJXA 4G8GD 2E9JA 4M61B 1P7KA 2O61B 2X4TB 4HPOL 1PDKA 3IU3A 5F9OL 4PJFB 4ZXBD 3RAJH 2K9UA 4GXVH 2NY5C 4L8SC 3SDYH 1XGUB 3SJVD 1XGTB 4QHMB 3KR3L 4P9HH 4Q9RL 2C1PA 2AERT 4H1LB 4MA7H 1U8IA 3TYGL 4BZ1L 1Q0YL 4HULB 3ULUC 1RZIB 2JELL 3IDUA 2A38A 4NZJA 3X13A 2IFGA 2RAMA 3RTQD 4NO2A 3S35L 3TWCH 1T5XB 4PJ7E 4HIEB 3ZLQC 1G7IB 2YK1L 4WFEE 4U6YB 2D3VA 2P5ED 4OT1H 4MMXC 3PG2A 3WFHB 1Y0LB 1IFHH 3BZEA 5J6HA 5ICYA 3L5XH 4DK3A 4Y88A 1SBSH 2OR7A 3LMJH 2KPNA 4NBXB 3MLTB 3WDJA 1JPGB 5IOPB 3VA2C 4PRIB 4JEGB 1A7PL 4I2XB 5IQ9A 1N6UA 4MJ4A 3EJJX 4WFHE 1HYSC 1AXTL 4DGVH 4GT7A 3NCEB 3DUUA 1X4XA 1N5YH 4DKFL 2CIIB 1CICB 4ZPTA 4RISH 3MRKB 1K8DB 1KFAL 1I8MA 1FFPB 1R0AH 4PLKC 4GKSB 4NPYA 1KG0A 3PWPD 4GRLD 3KPQA 2UUDK 1QLRA 3X11A 1NCWH 1NAMA 2IANE 3GI8L 2DLHA 2DWDA 4K8RL 4PGCB 5F21B 5C0BA 4EIZC 1VPOH 2Q7YA 1HEZB 4PJAF 4G9FA 2GCYB 1RZJH 1QA9B 2PXYA 3QIWC 2ATPA 3MLPA 4QRRD 4HKXA 1N6QL 1UZ8A 1DQLH 4DVBB 4F7MA 4KKAC 4E42A 5HGHB 5E8OB 4WHYH 5HPMB 3QUYA 1F6AA 4M5ZL 2FIRT 3OG6B 1FYTD 1OOAA 4PJ9A 3GBNH 1PD6A 3E3QE 3V9FA 1YYLL 2EH8H 1CD9B 1LQSR 2UWEB 2VDKH 4HPYL 1FFOA 1INEH 5EPMA 5TE4H 8FABB 2OTWB 4OTXL 1W8OA 1ZT1B 1CFVH 1T4KB 4HKJB 3RWIA 3W9EA 4XP6H 3FONA 5I19H 1TQCC 4K9EC 2J12B 2G60H 4JFZL 3SBWA 1NJ9B 5DJYB 4Y8AA 3QCUL 1EIBA 1RZFL 3GBLA 3BKCH 2HG5B 3R06B 4PJHA 1DQJB 3J8F7 1U8QA 4QF1A 1FN4B 2NPLX 2FZ3B 5GJTL 2DMCA 2GSGB 5DD1L 3U4EA 3VFSB 5JORA 1QKZH 4LARL 1R24A 2CSPA 1OAUH 1YECL 5EU4B 3GI9H 1FGVL 3E6FA 4G8FB 4KRMB 4U2ZA 1FNSL 2WUBH 5K59E 4M61A 5ILTH 5CGMA 1HYRC 3ESUF 5T1DH 4PJFA 5CEXA 3WS3B 4KTYA 4X0KA 2ICWJ 3NCJL 5IBTL 2RIKA 5HD8C 1KEGL 3HN3A 2VLRB 4UT7L 1JV5A 4O2FA 5HHQA 4N1CA 3B83A 1IJ9A 1CS6A 3HFML 4KV5F 3O3DA 3VCLA 4Y5VA 2DQGL 4U0RB 4HIEA 4Z7QF 4KDTA 1U92B 1ED3B 1KTKE 1NAMH 5A3ID 3V52L 3BQUA 1D5MB 2I25N 4Z7WB 2VQTA 3KJ6L 1UH3A 5F8QC 5D70L 5AWNL 3T4YA 1WCQA 3MLRH 4XCFH 3OKDA 4TRPH 4AIOA 4D3CH 4G8GB 3BPOB 5SWQA 1DN2A 1I9IL 3BRGC 2NY6C 4DVRL 4ZXBB 4F15C 1PKQE 2HJKB 3HC4L 1T1ZB 3ZYOA 3EFFB 3OL2A 4U05A 3NPZB 2E9BA 3L5HA 3SJVB 5C0CE 3RRQA 4X4MA 2OI9B 1FFPA 1FC1A 4XHJC 4XAWH 2ZG3A 1NFDB 1Q94A 3RTQB 4EI5C 5JMRA 1KN4L 3UX9B 2CRZA 5I75C 5B3JE 2Q8AH 2P5EB 3E3QC 2IADB 4QRPA 4W70A 4LASH 2YS4A 1I1CA 5HHMD 3SHSA 1MFDL 1MFEL 1QA9A 2HKHL 2NY4C 1HKLL 3HE6A 5FDYA 3IFLH 5F7WC 4M93B 3K80A 5DRNB 4YIQB 1WF5A 2XXCB 1CBVL 4JO3L 2EEBA 1NBYA 5HGHA 3SKNB 2DTSA 4D0DA 5HPMA 3SKMA 3SO3C 4CVXB 4GO6B 4IDJL 5J57B 3TNMB 1A6PA 5IMMA 4ZS6C 4NRYB 4IS6A 1P1ZA 3ZHLA 3U46A 3BJ91 3UC0H 3NCYS 5D7LA 2NXZB 3NIFE 4QXGL 2VDNH 3EAKA 4ZFOA 1T4KA 3PWPB 4GRLB 4M1GH 1OM3L 3CXDH 2H26B 2NR6D 1OAYH 2I27N 2V2TB 3R06A 1JYXA 3TBTB 4LFHG 2CJUL 4QRRB 5JXEC 5IP4A 4WEMB 4JFXB 3WUWA 4HIJB 2IQ9L 3VXPB 1W0WA 3GK8L 2X09A 1W0VB 4KQ3H 3MPCA 3GM0A 3ARFC 1FYTB 1CDHA 1U8LB 3G5VB 4OCSL 5EU4A 3G08B 4G8FA 1MQKL 2DS4A 4CKVX 5IJKC 4I0KA 3IFNH 4OLXH 4GSDL 4PTTA 4NJAL 1RJCA 2MWCA 2BXZA 3HS0A 2O5ZH 4XXDA 1MCSA 4XPFH 1RULL 5CJOH 5DC9B 1RJZB 1M7IB 4WI2A 1QG3A 2D03L 2VLRA 2GFBA 4WUUE 1OAQL 4Y5YC 4KI5F 5C9JA 3D9AL 3DX6B 15C8L 1WITA 3O6ML 5F7DA 4NZRH 3CVIL 4KROC 4ZO9A 5CSZA 1H15A 1PLGL 1U8HB 1NCCH 2NY7H 3P0VL 5E8NB 5BO1H 3RVWD 3L3IA 3PGDB 3FFCE 3RPKA 3VFMA 1ACZA 3MUHL 4RZCB 1A1MB 4Y19A 3LN4A 5KVDL 4U6TA 2VKXA 2DDQL 5JTWA 4C4KO 2VDPL 3DMMD 1A3QA 1U8OB 2EDRA 4R4FH 4YNYA 3LKQA 3PABA 4G8GA 4PJIF 1MFBH 2B7DT 5B3NA 3QDGD 4CUCA 1A3RL 4L9LC 2DLIA 3F5WA 4WV1C 3KXFA 2B2XL 4P5KA 2DQJH 2EDLA 3EFFA 3SJVA 5ICXA 4IRZH 2Z8WC 3QUXD 3T2NL 4XPAL 5FECB 3IRZA 3MRIB 3W81A 5I30H 1S7UB 2Z8RA 1KCUL 4LSVH 2ICWB 1FGNL 2D7TH 1KIRB 1BOGB 1NFDA 3OHXB 1BFSA 2P49B 1J5OH 1NLBH 5I66B 1AIFB 2YPVL 2ZUSA 3MBXL 1Q1JH 3KS0H 4EOWL 4XVUC 2FNBA 5JA8B 2DN7A 5DR5H 4ZS7L 2JKXA 4JKPH 1DQML 2JJSC 3NZ8B 2DM2A 5C6TL 3HE7C 2AXFB 2ED9A 1ZSDB 3O4OB 4U6XB 5JHDA 4OD2B 1MVUB 1INQA 4QXTB 3PWNB 4J3TA 4QOKE 2XICA 2OP4L 4HFUH 4CVXA 1YEEH 4L3EE 3BKJH 4M7LH 4M7JL 4KKCC 4MDIB 3CH1B 3TNMA 4Q2ZA 5IGXL 2Y5EA 3ARWA 4BELD 4OZGA 5ID1B 2V17L 2UVEA 5T3XD 1KB9J 5ECJE 2XA8H 5F1IB 5CJ8A 2C26A 3KWWA 2ADGA 4U1LB 3SGDI 4LIQL 5DLML 1IBGL 4P3CH 2NY1C 4J3UA 5F6HI 3SDCA 3N1MC 5F9WB 2V7NB 3QDJD 1HH6B 5HHMB 4HJ0D 5CFHA 4WI7A 4Y4KD 5ERWB 3MTRA 2F9BT 1JZ6A 2Z91B 4WY7L 1JYNA 3V7AE 2WQ8A 4NNXA 4QRRA 3ILQC 3CC5A 4FFYH 2Q20A 4FQ2H 1J8KA 1HILB 2A0LD 1OP3H 3B9EA 3LD8C 3AGVA 5E8EA 2Q3ZA 4PG9B 4NSKB 1T5WB 1VHPA 5A40E 1U8LA 3G5VA 4YH6A 2D7NA 4P3DB 3TIDA 2X1WL 1EEQA 2WINB 5D1QD 3HI1B 1WZKA 4YFEA 4EBQH 3OKMA 1J05A 4P5MB 1S7RB 1P9MA 2DBLL 5IFAH 1B90A 3JTSA 4O51B 1V05A 3GMPB 1M7IA 2NY3C 2D2OA 1IC4H 4C83B 3CSYA 4NIKB 4Z7UE 3WO4C 1NBVL 5KSAD 3EYOA 4RCAA 4HFWB 4O5LL 3GMMA 4EKXA 3DX6A 2RFXB 3KYKL 3OAZK 4HJJH 4QTIL 3IKCB 4W6WB 1EHXA 1TZIB 5K9JH 2BDNL 3SGEI 2EYSA 2NZ9C 1ZLUH 4LU5L 1RI8A 4P9ML 1AE6L 1U8HA 4G6KH 5E8NA 1OW0C 3I6LE 4MNGE 4WI4A 5L6YH 5KAQF 4KXZH 3CU1A 1TPXC 3PNWB 3FQRB 1ZLSH 2CPCA 2YPLD 1MRFH 4LIQE 2GI7A 4CNIA 5CBAB 1AJ7L 4LPWA 5GRYA 2FYYB 1X5ZA 4FNLL 1I8KA 5C6WH 5DS8A 5MI0B 4RX4D 2CLZA 5SWZE 1QOKA 4GBXA 4XGZB 5F7KC 2YA0A 1O7VA 3VXMD 1NBZA 4JJHA 3H0TB 4MHHI 1UWXK 5E1AB 3CDYA 4B41A 3TV3L 4FABH 1YNKH 4OFPA 2IJ0C 1T6WA 3F65A 4B50A 5FECA 3MRGB 3CUPB 4YDJB 3QG6A 4DGIL 2YD3A 5HBBA 1RUPH 1IL1A 1RZ7L 2CKBL 3H9HA 2HLAA 2OK0H 5EZIH 4HWUA 5D96C 4JRWA 3HZYA 1DFBL 1EFXD 1BOGA 2YWZA 4X6CA 4P2RD 5FUCC 4O58L 4I3RL 5I66A 1AIFA 1C5CH 2VXTH 3QNYB 3I02B 4R90H 4BJLA 1WWCA 4OF6A 3TM6A 3ARDD 5D2NC 3HAEG 1HH9B 4LEOA 5JW3H 3RY5A 2H2PC 1U3HD 3KPOB 2P5WE 3DMMB 3R1GH 3SQOH 3BXNB 4KMTL 2AXFA 5I1GL 1ZSDA 3LKSB 4MD0B 4U6XA 1X3DA 3QDGB 5IMOB 4Q0XL 2CLVB 2B20A 3PWNA 4FFWC 2BRRH 2B1HH 5F9DC 1MRDH 4NUGL 3QUXB 3T4AA 3UYOD 3LKRA 3PQYA 4NQDD 1T22A 4GMSH 1R3KA 3UJTH 1MY7A 4U6HB 5F1IA 1XGQB 1M05A 4Z0BL 5C09D 2BY1A 3GMOB 3VH8A 1TTGA 4BH8B 4KI5E 1MHPH 1H3TA 3UTSE 1XR9B 2X1PA 4HLZH 4QHLB 1HH6A 4U6VL 5L88L 4HG4K 1JHLH 5ERWA 1OAKH 1U0QA 5EG6C 2Y7QB 4NGHH 1G0DA 1U8KB 5CEYB 5C86A 4WI8A 3NA9L 2VDOH 2JCCB 3HUJF 4H20L 3INUL 3MV9D 3OSKA 4OCMC 2WQRA 5IQ7L 4QCIB 4UIKL 1UWGH 4FFZH 4LSUL 5TDPB 4PJIE 2X89D 5DVOA 2NY2B 4NSKA 4PJEB 3GNMH 4N9GA 3QPXL 4P3DA 4UOJA 2VITA 3H42L 2DYPD 1CL7I 4ZUVA 1Q38A 5DJ0B 1X5JA 4BA8A 4P5MA 4XVJH 4IOFC 1KCLA 4DN4H 5T33H 1C1EL 4JPVH 1G9NH 1OHQA 1XCQB 3QDJB 5ALBH 1U41A 2FJFB 2N4IA 1U9KA 3HI6H 5FYKL 3VXOB 1KLGB 4Y4KB 5TPWL 2EEDA 2YBRB 5DFVC 4RFEB 3N85H 3H6JA 5HDLA 3MXWL 3WXVL 3MUY1 4LNVA 1A6WH 3LEVH 4CN4A 3T8XB 2F19H 3Q1SH 4XWOC 3ZKND 2D0FA 3MNWB 3OQ3B 4LBEA 5GRJL 3PNWA 3FQRA 4F57L 1HSBB 3WXWH 2YD1A 1BJ8A 1CL7L 2Z35B 5CBAA 2ERJB 4UAOC 1ES0B 2OJZL 5JNYB 5D1QB 3ZE0F 4XGZA 5DD3L 4OQTA 1MCFA 3CPLA 1SM3L 1XCTA 4KHTL 5J12B 1Q9WA 4I18A 1KTLB 1Q8MA 4I9WD 3RX7A 5E1AA 5HPOA 3VI3F 1ZWIA 4HQQH 1BFTA 4K3EL 4ONGH 5JLZB 4M8VA 1F8TL 4XNMA 5C7XL 2GYSA 1WFNA 2IMMA 2AVGA 4RGMB 1EEYA 2X4OB 3MSPA 2AJ3A 4M1CD 3PWVA 7FABL 4F9PA 5IB3B 3RVXC 3B9VA 5F9AC 1G7QB 4BUHA 2DQFA 4KKLC 2QADD 4P5TA 3ZKXB 5AAMA 1XFPA 1XF2A 3KHOA 1NCBH 3I02A 3MRLB 3VE0B 3SPVA 2GK2A 3P9MB 3S37L 1X5XA 1JGUL 1I7UB 1HH9A 4KHXL 4XBGA 3PJSB 1WT5A 2AABL 2FHBA 3VGAB 3DMMA 4GRWH 4NQUA 2VR5A 3LEYL 1S3KL 4GXUN 3EYVB 5FYKE 2JF1A 4AMKL 1E4KA 5CJ5A 3FOMA 3QDGA 5IMOA 2GW5A 1RUQL 2CLVA 4PD4J 2BZDA 4QHKJ 5FHBL 3QEUB 2WSKA 2JJTC 5TQ2L 1CLOH 1S7XA 4JFYA 1AO7D 3VXSA 2ZNXA 5GS1C 1TNNA 2XQYK 3RVUD 5DRZA 4FQQB 2X70B 4U6HA 1JPTH 2Q3AA 3HHRB 1XGQA 4S11A 1G9EA 2BVPB 5LQBL 5DQDL 3MCLL 1EFXB 2BHUA 4KJYA 3EIFA 4P2RB 1AGEA 2IPTH 2GY7B 2DJ4A 4K71B 5DMKB 3JWNC 4E41E 3BGMA 2BMKA 5GISH 4QHLA 2Y06L 4KRPB 1I1AC 1U3HB 1VSCA 1ZA6B 2XXMB 1U8KA 4NQCE 3K1KC 4EJ1C 1OPGL 4MWFA 4MAYD 5I2IB 4G5ZL 2DQHL 4L4TE 3N0PB 4R3SB 4DEPB 5HHPA 1F11B 1GPOH 3TP4A 4PJEA 3DSFL 1GOGA 1LP9F 5IT2H 4MQ7B 4TVPL 1N8ZA 1LO5B 1PZUB 1U2HA 1VDGA 2W0PA 2J5LB 5ISZE 4NQDB 1MLCB 4OQTH 1KN2H 1RJLB 5DJ0A 3O6KL 5ELIA 5C09B 1S9VB 3ZKQD 2A6DB 3MLYL 1N64H 3MRFA 1KGCD 1YC7A 1F58L 1N59B 1FORH 4KK5D 5E2TL 4Z8FL 4FG6C 4ZOCA 4OAWB 3QDJA 4TTDD 3MNZB 3NFPB 2CR3A 1OSPH 1LE5A 3U4BH 5TFSH 1H0DA 2WBJD 3C8KB 3SDXB 3TJEH 2BVYA 3GKWL 1DUYB 1KJ2L 2YBRA 3T09A 4RFEA 2CK0H 3TESA 3KG5A 4ZAKB 2RGSA 3U83A 3CFCL 3T8XA 3DUHA 3MV9B 4QY8B 3J7HA 5I8OL 3QG7L 1DQQB 3AU1A 4Z0XB 3UDWC 1NDMB 1PG7X 4YE4L 2R23A 3VW3H 1UVQA 4KY1L 4S1QL 1U42A 1BGXL 1ES0A 1XEDA 3ES6A 1S5IL 4ODSL 5JNYA 5D1QA 4IRSA 2ICEA 1QBMH 2DYPB 2UZYB 1AD0B 5HSFA 4JE4B 4MJID 2PR4H 4NJ9L 5IVNA 4MYWB 4FFVD 3ZYZA 4Q9QH 4LQFL 1JPSL 1KPVA 2X4OA 3C5ZD 5KSAA 1OCWH 4OFIA 4X6DA 3FHAA 4PJBB 4PJGB 4PJ5D 4KK8D 5E99H 4OKVB 1NFKA 1T20B 4HUXA 3NBNA 3VD3A 3GSOA 3SDDB 4TVPE 2EXWD 5ANME 3MMEA 1G7QA 2D7PA 5GIRB 5C0JB 4Z7VA 4FP8L 4AIZA 3V6BR 5I6XB 1PG7H 1FBIH 3IDYB 3QWOB 5E2WH 4NQED 3LH2H 4K23H 2YPLA 2LAAA 5GRUL 3TA3D 4RDQF 3W39B 3VXRD 1E4WL 2VZ1A 3FO1B 3ZE1F 3EYVA 3VXMA 3K8MA 2VE6A 1TJHH 1F2QA 3IF1A 3NIDF 2BOBA 3GSRA 3WD5H 4UT6H 1GGUA 2EYTB 3UMTA 5KSVB 1NPUA 2R1WA 2XI9A 1HQRB 3ZHDA 3X3GL 2BCKB 4PJXB 1DBAL 3WMSA 1T21B 1UB6A 3JTTB 3LHPL 1BIIB 3IDJA 5T3XH 3RWGA 2G5RA 5IBUG 5DK0B 2BVPA 3RDTA 5FUOH 1JPFB 1HHHB 4GUPB 4LSTH 3BD3A 2QADB 3DJ9A 3QEQD 4YDIL 3PHOA 3RHWF 1AGFB 4P2QD 3ARDA 5FKPA 4TPRL 1EA9C 1CGUA 3VFGL 5E4EB 3QI9A 3I85A 3WFCH 1ZA6A 3UTOA 1D9KD 4KUZH 5KVEL 5IFJB 3D85D 3ZDYF 5JO5A 3TCXA 3BZFB 1DLFL 2OS7A 2HMID 5I2IA 5DJ8B 5HYJD 4RMUA 2PW2B 4R3SA 4BFIA 1F11A 1R3JA 4YGVB 1WAAA 2Z9TA 1AO7B 2IG2H 4XX1E 4V2CB 3VI3E 4MSWA 2Z8VC 1WWAX 3LQZB 4ZO6A 1KXQE 2PCPB 1GZQA 2P8LA 3G9VA 2I07B 1BQHG 5GHWL 3T77A 4M3KB 4TSBL 2VJXA 4J6RL 3L7FB 4OGXL 1N0XH 5AYUH 1L0QA 1VGKB 1NEZG 2BJMH 5T1MA 5A16B 4U4BA 1R3LB 5I18H 2AP2A 5FOJA 1ITCA 1A7RH 4N68A 5FB8A 1U93A 4MAYB 3MV9A 1MCKA 1MCWM 4FA8A 3IB4A 1DQQA 3CFIC 5C0DB 4Z0XA 5EULV 1NBQA 1IQDB 2AGJH 1LD9B 4JQIL 1FZOA 2X89A 4JZOA 1IGTA 4LAQL 3MBEC 1F90L 1EHLH 1C08B 3S3SA 5EU5B 4KPHL 5AUMB 3U82B 1OTSD 4FXLA 5CINL 3GSQA 2LV4A 3K3QA 1P84K 3N9GL 4IMKC 4KTEH 3LRHA 4ODUA 3CDGB 4QXUL 5E4IA 4G7YH 4YDKL 4HX1B 1JYWA 5DVKA 5KSBA 1H8SA 4OB5H 2WBJB 4PJGA 5LGKA 4OKVA 4ZUTA 3U1SL 4KKBD 5DQJB 1RFDL 5AYQA 3OZ9L 1Q0XL 5C0JA 4WFED 4BSVB 2I5YL 2HJLB 3FQTB 2H8PA 2MHAA 2C3WA 3T65A 1X6NA 3RNKA 4GH7B 4KRLB 3W39A 5KS9F 5EBWA 3WHXB 1WLHA 3T0DA 2J4WH 3JV4B 2FX8H 4WFHD 1OL0A 3HA0A 4QRUB 3GJFK 2EYTA 4MJIB 4IRJD 5GGSY 3LS4L 3K4AA 2IQAB 5JHLL 5H35B 1CFSB 1YJDC 2BCKA 5B8CC 2VDLL 4PJXA 5EA0H 3V7MA 1T21A 3C5ZB 4X83A 2GUOB 2VR9A 1CDGA 4HS8H 4XPGL 2V2XB 4CDHA 2HWZH 4GUPA 4YBQD 2IAND 4RSVA 2LFGA 2AXHA 1F6FB 3MREB 5IM7A 2FD6L 1AGFA 2IALA 4NQEB 4D8PA 3VDBA 3GMLA 4J4PA 2DI7A 4EUPG 5F72S 3F12B 4OZIE 2Z93B 3VXRB 5EO9A 4FRWA 2HT2C 4PP1D 2J8UF 3OXRA 3BZFA 2WNGA 2QQQA 4NBYB 3WHE1 1E6OH 5DJ8A 4WTWA 3HPLA 3V0WH 5FEBA 5L2KA 4GRMB 1AI1H 2PW2A 1L7IL 4OGYH 2FIKA 3SCMA 4I77H 4PJDB 1XGPB 4I5BA 4PGEB 5CCKL 3FO2B 2ZPKL 1OLLA 2A77H 3S5LA 1ZHBB 4EDWL 5HI3D 3VA6A 3IXAB 4TUKL 3U7AA 4OI8A 2I07A 5ICZB 5I1CL 4JFDD 3EYUL 4PTUA 1FV1B 2BNRB 1YEKH 5F1SA 2V9RA 4LP5A 1UYWH 3VD9A 3WLBA 2X4PB 1MIEH 4P2QB 4KJPD 2CIKA 3MA9L 3VWJD 3MV7E 3V0VB 3BD4A 5A16A 5F1OB 1KT2B 2YSSA 3P0YH 1D9KB 1CXEA 3LV3B 3D85B 3ZTNH 2WUCH 4NP4H 4ENED 5DEFB 1YQVL 2AJUH 4MAYA 1N2RB 5JA9A 2P46B 5HYJB 5JW4N 1IQDA 4OZFG 2P47B 2R2HA 3Q6GH 1FL5A 1V8HA 3ZE1E 5HI4C 3WNOA 2AXJA 3NIDE 4K8RD 1RAMA 1T7YA 5M94B 1IGIH 5AUMA 4HC1L 1DL7H 3MRNB 2HFTA 3VFRB 1XIWA 2BX5A 3OJMB 3DVGB 3DIFB 3MLVL 2VXUL 2FBJL 5FCUH 5F88A 4EN3A 5GS0H 4OSUH 1QYGL 1G7PA 4HX1A 2J2ZA 5FK9B 4GG8A 3UPAA 3OPZL 3AXLB 2V5MA 5GGSA 5TE7L 4UNUA 4HMEA 3ELAT 4YBHA 2Q7NA 2GQHA 2VYRE 1JGVH 2R69L 1X5HA 1NAKH 2HJLA 3FQTA 1A4KB 3ZDYE 3QCVL 5BS0E 5J9PB 5DFTA 1KXTB 5CUSL 3O2VL 4I3SL 4MMZC 2BVQB 2MOVA 4QRQA 4XT1C 3V8OA 4NWTL 3HNTH 3O3EB 2NXYC 4XC3L 3RZCD 2NTFB 3DHJA 2F53E 4L8DA 5IHUH 4V1DE 4N0YH 3C9NA 3VG0H 4HHAB 5C0CD 5H35A 3RAJL 1CT8B 3NZHH 2VH5H 4IIQC 4ZFGH 1OWRM 4TNVK 4PJ5A 3SDYL 3MJ9A 12E8H 4H0HB 3L95B 1ODAA 5DUPH 1NEUA 3CVHA 4PJ7B 4P9HL 2XN9A 1FZMB 4Y1AE 4MA7L 2CRYA 5FO8A 1MHHB 1JNJA 3MREA 5L0QB 1YY9C 2BNQE 3TWCL 2CGRH 1I7RB 3MRMA 3IDIB 4XP9H 3TA3A 4OT1L 2B4CC 1IFHL 3VXRA 5EOTB 3L5XL 4JJ5B 5D9SB 3JZ7A 1G1YA 5DZLA 3DUSB 4NNPH 3LMJL 3IJSA 5T3ZL 2E27H 3DI2B 3BH9A 4IRJB 4PP2B 2LVCA 3QPQC 4GRMA 3VXUA 5GQBA 1QQDB 2DJUA 1WWBX 5D93C 3BGAA 4C55A 1XGPA 1HNFA 4DKAA 2B5IC 2QEJA 3S6CA 3C87A 1ZHBA 3BEVB 2DLFH 5D2LA 1E4XH 3HAEA 3Q3GB 1KPUA 1MCLA 4RISL 3TNNA 1B0WA 5EIIB 5FGBC 3U9UA 3BMVA 2BHZA 2ZG2A 1KIPB 1R0AL 3HRPA 1FLTX 2GTZB 2IANB 4OGAD 3QEQA 4QHUB 4NN5C 5BW7C 3PIQA 2X4PA 4MQXC 4P2QA 1ZHNB 1MOEA 4KKCD 3V0VA 1NCWL 1D9KA 2EECA 2JIXA 4CBPA 4LP4A 3LV3A 3MV8E 1VPOL 1P6AB 3CAFA 1CLCA 1Z3GH 3DROB 1RZJL 1U8NB 1WBXA 5IFHH 5KS9E 1NFIB 2ZUYA 4U7MA 1DQLL 5HVHB 43CAB 1O7SA 3U6RB 3F7YA 4LQ1A 3MRRB 5C8JB 1I3RA 5BV7C 2MCPH 3GB7A 3V5DA 1UJ3B 3GBNL 1L7TH 4JFDB 2EH8L 5J1AA 3N1PC 2CH8A 4S1RH 3HC0A 1INEL 4Y16C 3ZTJG 1G9MH 5TE4L 4XRCB 1CFVL 1QZ1A 5FA3B 5T3ZE 5DJDB 1CF8H 4GW4A 1NGQH 1AHWA 2YZ1A 4HDIB 5FK9A 4XP6L 4MD4A 4GXUM 3AXLA 5I19L 3MJ9H 3GKZA 3CX2A 2ZOKB 2G60L 3CVHH 4L9DA 1OSZB 1KIUA 1CFBA 3MRBB 1EGJA 3BKCL 1CXLA 3FFCD 1K8IA 1WFTA 3RJQB 2HFEA 4UTBH 2J8UE 1QSZA 4HKBB 2AXGA 4NRZB 4GFTB 1ZT4A 4J1UA 2MSPA 1PFCA 1BECA 1QKZL 1BMGA 2IMNA 3NGBC 3IFPA 5I1JH 4NQXA 1XZ0A 1OAUL 3GI9L 5CD3B 3EGSA 3EDKA 5EZLB 4MNHA 4Q9CA 3L5IA 2VXSH 5IG7B 2WUBL 2FH6A 1T0PB 5ILTL 2QSQA 3I3DA 4KAQH 4HHAA 4LHUD 4JG0H 1FVEB 1CT8A 4O9HH 2KQNA 3HAEH 4ZOEA 3ARFB 4HK0A 2V7HB 2A6JB 1YEFH 3VD4A 3FMGH 3BW9B 4N8VB 3SE8H 4QHNB 2X4QB 3PDGA 1BZ9B 4KUCF 3FQXA 1CTOA 5HVGB 2IAMA 1NAML 4JY4B 4WW2C 5GRWA 5D9SA 4IOIA 4FHBD 3FN9A 4Y5YB 4D9QE 1X7QA 3KPMA 4QOKD 1HCVA 3MLRL 1PKQB 3WS6C 5CSBA 4JPIB 2OJEB 2WM0A 4XCFL 4TRPL 4D3CL 4L3ED 1V7NH 3H7BB 5E94A 5C0CB 5DT1H 4AM0A 3OKKB 5I1AB 4P59H 5SX5K 2BY2A 2VWEE 1BBJB 2X5PA 4J8RB 4MJ6B 5EC2B 4AZ8A 2KKQA 1NKOA 4P9HC 1FC2D 1ZKAA 1KIPA 1VESA 3OKEA 2QTEA 1UENA 4QHUA 1BVKA 5BZDB 4L1DA 2ZSVB 4XAWL 1L6XA 4L8CA 4M6NH 4HCRA 4L4VD 4WV1B 1RZGA 3WDIA 2Q86B 1CDYA 1W72A 4CRPA 1P7QD 1ZHNA 4AG4H 3PP3H 2Q8AL 3UP1A 4LASL 4Q97A 1U58B 2FHFA 4R2GC 5D7IA 1AQDA 5GPRA 1EGJH 1TLKA 1NFIA 3IFLL 1XGRA 2LTQC 4KZDH 5J7CC 5IBLC 4NKDB 4ONHB 5C8JA 3MRRA 1FSKB 3EFDL 3QCTH 4G6AC 3BP6B 1DVFD 4G9DA 3NOIA 4JQXA 3MYZA 1C7TA 4JFDA 5DJ6B 4LCUA 5FXCH 3SE3C 4OBRA 5C0BE 3IS1X 3UC0L 4HWZA 2VDNL 4XRCA 4H88H 2ICES 3TBWA 4LCCB 5J11B 4M1GL 5D7SH 3CXDL 3QUZD 4L4JA 4XTRD 1H5BA 2W92A 3VWJA 3GSVB 3MZGB 4X9FA 3QUKB 2CRMA 1OAYL 5F7YC 5JDSB 2YOCA 2FSEB 2ARJQ 4ZG1A 3TVMD 2AEIT 1YEIH 1CD8A 4HGMA 3BWAA 3PL6C 5I71C 1U95A 5SWZD 3FZUC 3L5WB 3LRGA 4JFFD 5DC0A 3MRDB 3C6SB 4LGPB 1JZ4A 3C6LC 5EZLA 2EZ0D 5EU6D 3IFNL 1LDSA 4OLXL 3TO4D 5IG7A 1SBBA 4GKZB 4LDEB 5EUOA 4PY7B 4WUUB 4CMHC 3U7WH 2O5ZL 3SE4A 1HIMH 4PJHE 1V3MA 4KK6C 4XPFL 3MRPB 5CJOL 3L3KA 4ZUWA 1UZ6F 5ADOL 4X7FC 5HYSG 5I76B 1NMCC 2V7HA 1F3DJ 4X4YB 5ESAB 3BP5A 1UB5A 3QEHA 1A9BA 2XTJC 4NZRL 2WV3A 3FFCB 4QHNA 2I24N 1S8DB 2CDEB 3TBSA 2VWEC 5F9OH 4HCRH 5I9QC 5BO1L 1NCCL 3TT1H 3ZKSD 1VACB 2G75A 1W72H 1CDIA 4M4PA 1CE6B 2P5WD 4X7DC 1RK0B 4PJFE 4OZGF 4Q9RH 3MJ7B 1IEBB 3PDOA 3NFSH 1ORQA 3RZCA 4PB0H 1QLFB 5I8CB 4W4OA 2EDWA 1J87A 2YPKB 3O3AB 4CVZB 4WFFE 3OG4B 1MFBL 4RWHA 2YK1H 5C0CA 1G7HB 1F00I 5D8JH 5I1AA 2W0LA 1X5YA 3IDMB 3GJEA 2DQJL 1FG9C 4HUMB 1A2YA 1UA6H 4J8RA 3QH3B 2AJZB 2EXYC 2VISA 2W91A 4ISVB 4IRZL 5D1XD 4KI5D 1R5IB 3UTSD 3FB6B 5GJSL 5I30L 1M7XA 2BOCB 4B7LA 4LSVL 3TH3T 1A7PH 5CGYD 3LVEA 4KJWD 2D7TL 2ZSVA 1IC1A 5JPNB 1KENL 3JWOC 4ZFOL 2Z31D 2W9DH 3K46A 1J5OL 1NLBL 3DVIA 3R4DA 1DLHB 4Z18A 2ZUTA 4YX2H 4H0IA 4MVBC 3EZJB 1OP5H 1Q1JL 3IDNA 4JKMA 1EXUB 5FGRA 1KFAH 2YRZA 4WDIB 1LILA 3QNXA 3B8YA 5D96B 5DR5L 4JKPL 4QOKB 3MA7B 2PXYC 5IB4A 3B2VH 4L3EB 3QQ4A 4X4ME 1RMFL 1DUZB 1JMXA 4XCYA 5L7XH 1WQVT 1N3NA 5HGBB 4X98A 4MS8C 3IJYA 4K8RH 4HFUL 3QUYC 3FB7A 1YEEL 4R7NB 3BKJL 3BP6A 3LS5L 1R5VA 3MJ8B 2YC1B 3P9LB 4QRPE 5FYKU 4YDVA 3O3UN 4LNRB 2XA8L 4P23C 4JFPA 5DF0A 1B6UA 3JV5A 4LCCA 1TIUA 1RZKC 4P3CL 1S78D 3D2UA 3ARZA 3HRZA 3QUKA 5DMIH 4JVPA 2ADJB 3HTLX 2G9HB 3O4LD 1A6TB 3KJ4B 1BQHA 1V3LA 2YD9A 1JZ7A 3RVTD 5EH1A 3WJJA 4FFYL 3B9KC 4FQ2L 2CUMA 1FJ1A 5D7LE 3WL9A 4XI5D 3C6SA 5JPMB 1DVFB 5F70A 5CZXC 4KXZI 4PLJC 3ALPA 1FNAA 1NCNA 1I8IA 4EBQL 1P4BH 4Z7UB 2B0SH 4PY7A 4LSSH 1N5AB 1OF2A 5IFAL 1SYSA 4YBLB 4OZHA 3MRPA 4K3GA 3QUZB 3G5ZB 2WBKA 3ALWA 4YXKL 1IC4L 4WFGE 2ENYA 2R29H 2VLLA 4KC3B 4X4YA 4PJAA 1YNTB 6CGTA 2VZOA 4MNGB 5I74B 5FCSH 4NM4H 4HJJL 4N90E 5LCVH 5K9JL 4FMKA 3TVMB 32C2B 1CTNA 3QQ9C 4Y5VC 3IDGA 5K9KB 4I4WB 2HJFB 4KDTC 2XIDA 2XQYG 3RWFA 5L6YL 1KEGH 5SWZB 2AEPH 3T3PE 1WV7T 3FN0H 1ZLSL 1VKXB 3BQUC 3LKNB 1MRFL 1UACL 1IEBA 2ADFH 5J06A 4H26B 3JV6B 3EHBD 3MOBH 1JUFB 3TO4B 2J88H 4XCNB 2BVEA 1YNLL 3H9SD 4LHUA 5ITBH 1I1FB 2BRQA 4H25B 3C09B 1YNKL 4FABL 2APWA 2A73A 5JZ7D 2R9HD 1CICC 4XBPB 4ISVA 2ZJSH 1NGZB 3OB0K 4GRWF 4JFQA 1EEZB 1RUPL 2BOCA 2OK0L 5EZIL 4Y19E 4CMMB 4DVRH 3LQMA 1BQSA 5IB1A 4R96B 1T0MB 3R8BB 1DE4B 3KYAA 1C5CL 2VXTL 4G8GE 1H3PH 2P5WB 4R90L 3DRTA 5EWIH 1XGYH 1AKJD 2R56H 3Q48A 4EXKA 1EXUA 1U8PA 5JW3L 4HJGB 3KXFE 1S9WA 1DN0B 4L4TD 3WSQH 4QOKA 5FF6A 1ZAGA 3R1GL 3SQOL 1D6EA 3G6JF 1DUZA 1KN4H 1CFQB 2FLBT 4HIXH 5DTFB 4ZODA 4Y2DA 1L0YA 5IEHA 2BRRL 2B1HL 1M7DA 3OAYH 1MRDL 2ESVE 4ZFFA 1GCFA 1F3JB 2HKHH 2YC1A 3UTSB 1QBLH 4CW1A 1ZGLB 4Z77B 4GMSL 4MA1B 5F1NB 4RFOH 4AH2B 5DO2D 4L4VA 1XH3A 3QNZA 1MHPL 1P7QA 2OR8A 4ZOAA 3BD5A 2WK2A 2VUYA 5JHDE 2GAZB 5FA4B 1F4WH 2ADJA 4LKXA 2G9HA 2CKBB 3DTXA 1A6TA 1KTDB 1ZK9A 1JHLL 4RGND 1OAKL 3ARGD 4PRPA 5INCB 4YHKH 4KVCH 4NGHL 4U33A 2MMXA 3A6BH 4PJIB 3UPRA 2VDOL 4P4KA 4OZGE 1DP0A 5ALCH 1FIGH 4FTVD 1QHOA 1UWGL 2WWMD 4FFZL 1J1XH 2HTLC 1XR8A 3SGKA 3GSWA 1K9TA 5HYFA 5FM5M 3GNML 4RRPG 3KYNB 4HH9B 3WYRA 4ONFH 4NO3B 2CJUH 3W11D 3WNLA 4POZC 5BJTA 5MEPA 3DURB 2FHCA 1I8LA 3SKUD 2EE6A 4XVJL 3TPUB 4KKNA 3GK8H 4OZFA 1QFWM 1S7QA 3D87B 3NMEA 4DN4L 5KOVC 5T33L 3QUZA 1QR1B 5CP7A 4TVPD 4JPVL 1G9NL 3M17B 4Z7OE 1F4XH 1MQKH 3HI6L 3WFBH 5LBSH 5GZOD 1XAUA 4MNGA 5KSUA 1Y6NR 1HHIB 3N85L 4TUOB 3CXHK 1A6WL 3LEVL 1ZGLM 1X5GA 4U0RC 5F3BB 5IROA 5C08D 3D1MC 4Y0GA 2F19L 3KLSA 3Q1SL 4AQ1B 4ZDHB 1FL6B 5TDNB 2D03H 3LRSA 4JFFA 3RVVC 3WXWL 3DX9B 4ONOA 5C0AA 5C0EA 1MJ7H 3QSKB 2NW3B 4JHZA 1IZKA 4UOW0 2NX5A 5EU6A 3STLA 3TO4A 1E28B 3BPOC 4BQ6A 4JM2F 5L8JB 5LKNA 3RIAK 2XQBH 4R9HA 5BXFB 1TVHA 5F89B 3VFOB 4ZXBC 1I1FA 1BJ1J 4HQQL 1F4AA 4JHBA 5HGDB 4H25A 3DPBA 1ZE3C 1O0VA 4ONGL 5DRWB 3EO1A 4JDZB 1QFOA 3V4VH 1G7JB 5I1DB 2R0WH 1HI6B 4RMVA 3QIUA 4W6YB 3O0RH 1IVLA 4WJ5A 5EO1B 4CMMA 3CMOH 5IHZB 3EOTH 3RTQC 1T0MA 1DE4A 4YJZL 1A4JB 5AZ2H 2OQJA 1JK8A 5D7JD 1NCBL 4JZNA 1TTFA 2IBZX 1OARH 2CMRH 2ICCA 4JFHD 4OZ4A 3TYFA 1MRCL 3U2SB 1JWUA 4F80A 3O41B 4M93C 3HB3D 1CFQA 1NDGA 4NRXB 4F37F 3E6HB 3H9SB 3MBXH 4EOWH 4X6CE 3TLRA 1GZPA 5DMJB 1JI2A 4Y2OA 3ESVF 2G5BA 4U49A 5D1XA 1DQMH 1F3JA 5C6TH 1VADA 3UTSA 4HUNB 3DRQA 5H2BA 1QVOB 2E7BA 1KNOB 1JPTL 2W59A 3RGVD 1HHJB 2Z31A 2XZAH 4GRLC 4OZFH 2IPTL 3ZSTA 2GT9B 3UAJD 4LPUA 5GISL 3KPRA 2XWBA 2ED8A 1AKJB 3V6FB 1X5LA 1JHTB 2IBGA 1HOCA 1TVDA 2P48B 3BUYA 1IAKA 2R2EA 3TO2B 4L4TB 2RR3A 2X1QA 3OKNA 3UYRH 3HMXA 2C3HA 2QKIA 3PQYE 4X6FB 1UM4H 3PGCA 2WBWB 4ERSL 3QQNA 3KPNB 4PRNA 4TN9A 5ISZB 1I3GH 1GPOL 4D9LH 2XNAB 3BP7A 5IT2L 2R1YB 3UZVB 2KL6A 4FXKB 4RIRA 4P57A 2HLFD 4OQTL 1KN2L 2I9TA 4CU8A 3DURA 4H8WH 5DD6B 1P9MC 4GRWE 1CFNA 1M71A 1FORL 2AJYL 1QR1A 3QWRD 1P5VA 2C4XA 1U91B 1OSPL 5EC1B 5TFSL 3O4LA 3U4BL 5L8KB 1MFNA 3V95A 4RGNB 2R39A 3TJEL 5I1KL 3ARGB 1ZGLP 1HHIA 2CK0L 4TUOA 1NC2D 3V6OA 1EO7A 5GXBB 2E3VA 1PG7W 3KPLB 1F3DH 4JO1H 5E6ZA 4S1DD 4LGSB 2E8YA 5ETUB 1ZVSA 3MUGB 4WWKD 3DSNA 4Y89A 4OM0L 3NN8B 3I50H 1MF2H 5LGHH 4N9OB 5DHVB 1QBML 4XNQB 1P7HL 1U8MB 5F89A 4AEFA 3CLFH 4UI2A 2CO6B 4R97B 4EXPX 3MLZH 5GSRB 3LB6D 1IAMA 4JDZA 4Q9QL 1S7WA 5ANMB 1OQOA 5E95B 1NGYA 1HI6A 3FCTB 2NXYD 5FDWB 3CH8A 1VFMA 4OLYH 3QJHB 5B39G 3REWB 5IHZA 3HUJB 4UDUA 3ILPA 4EVNA 3RWEA 1A4JA 1PG7L 1IAOB 4PBXA 1FBIL 4PYHA 1WAAF 3WFEH 1JWMB 4XP1H 2VDRH 5A3IC 2AK1H 3LH2L 4JFOA 4K23L 5ACMA 4DGIH 4XMKH 1KJ2B 3QFJA 1KJMA 1AGDB 4LPTA 3LEXA 1DFBH 4PREB 2EDEA 3O41A 2D0GA 4KI1A 3O4OC 3HMXH 1TJHL 2E7CA 2IPUK 3E6HA 1G0YR 3WD5L 3H9SA 4UT6L 3HZKB 3V5HA 3WNKA 5B38G 1OVZA 1EVTC 3L3GB 4AY0A 2YXFA 1FYHB 2GITB 3B3IB 1X6LA 1C7SA 2ILLA 3EJYD 4J3SA 3UO1H 3H9ZA 4M7KH 5IVXF 2X4UB 3KPPB 1QVOA 1ZT7B 4Q0XH 4C59B 3I84A 5FUOL 4QTHB 1HHJA 4LSTL 5DI8B 1F97A 4NDMB 2LAGB 4ZNEA 4NUGH 4I13B 5D7JB 1GL4B 3K0WA 4PGDB 3RJDA 1B4JL 4KVNH 1DDHA 5C0ND 3WFCL 3TO2A 1IGJB 4KUZL 4JRYD 3VXSE 5KVGH 4ELMF 4X6FA 5DVMA 3P73B 3KPNA 5D4QA 2F5BL 5IK3A 1OGAE 4NO0D 3X14A 5KSBF 4UV7L 3V8CA 2YEZB 2FX9L 4JB9H 2Y5TA 3Q5YA 4XCCH 3INUH 3EDDA 1BVZA 3MGOB 3RGVB 4GW1B 1QBBA 4HMDA 3S8WA 2EDFA 1K4DB 5HI5D 1ZA3A 2NR6C 4JQVA 3QPXH 4KTDH 1N0XL 1NCUA 5AYUL 5I8KH 1U91A 2AK4D 5JIHA 3PGFL 1T1XA 3I2CH 5E6ID 3VGFA 1JRHI 2XY2A 3DVFA 5I18L 1GHFH 1UEMA 2K1MA 1A7RL 3V7AG 3UXFA 1VGEH 1WZ1H 3HCVA 4FTVA 1UGNA 3MUGA 3GM8A 2BVOB 2AGJL 1OTTD 1A9EA 1EHLL 4FQJH 5MI0C 1H8NA 3WIFB 5ID0B 1RQ5A 4V1DD 4WHTB 3QDJE 5DHVA 2AEQH 4WO4A 4DTGL 4AT6A 4P2OD 2XOTA 1U8MA 3SY0B 2BVTA 8CGTA 1RIHH 4X6BA 4KTEL 4TSAH 4FQHB 5GSRA 3P4MA 1JRHL 3RY6A 1SHMA 1MCPL 4G7YL 2R1XB 4XBEH 5CZVH 5GS3A 5ESVB 4OB5L 3EYSH 3Q6FB 4XWGH 2VRAA 4TSCH 3QJHA 2BNQD 2BY0A 2VZSA 3UPCA 3HUJA 2VIRB 1NC2B 5DYOA 4UBDD 2OR9L 2D9CA 4K3EH 1TZHB 3OTTA 5C08A 3RVWC 3AMKA 1YA5A 2PTTA 1U8JA 1IT9H 2EE9A 4YHNB 4WWKB 3RWDB 3BN9D 1NMAH 4FZ8H 4YR6A 1LHZA 5DJCA 2VQ1B 5HYSA 2GJZB 3DMMC 2X10A 4MCZA 4PREA 2J4WL 4X6DE 2FX8L 5CBEB 3BEWB 4G8IB 4EQ2A 5IIEB 3ARED 2HVJA 4G7VH 4LLDB 4P46D 4UIMB 3BZ4A 2EKJA 4K7FA 3L3GA 4Z7VE 3GSUA 2GITA 3GSXA 3QUXC 4UU9A 1RV6X 5EA0L 2SEBB 5CEZL 1RIVH 2I9LA 2P44B 2NXYB 2YPLE 4K2UH 4CAGA 1ACYH 1ZT7A 4HS8L 3LQAC 3IRPX 4QTHA 4JN1H 2V2WB 4NC0B 1MNUH 2C9AA 3MV11 1AGBB 2F74B 2RBLA 3FTGB 3VXME 4OZIB 2E7HA 2X1OA 5D7JA 3ROLB 1TCRB 4OUUB 3MV8D 3ARUA 5DJZB 1J1OH 2EDKA 1H8OA 3MJ6A 5GSVA 3CDCA 2E7LA 2OXGA 3LN5A 1FVCB 2H9GB 3P73A 4WU5A 1E6OL 3V0WL 1KCSH 3W9DB 4JKWA 5GS2D 1AI1L 1JI1A 4OGYL 3QULB 4I77L 3R0NA 5I0DA 2A77L 3VU2A 4TTGA 1UWXH 2ZP0T 4MLSA 4X5LA 5DHVH 5T3ZD 4NOFA 1GRWA 4LLWA 3IFOA 1T3FA 3RGVA 1AH1A 5B4MD 1YEKL 4GW1A 2E9WA 3WUZA 4R26H 3H7LA 1C5DB 3DYPA 3L3JA 1MIEL 4L8BB 1QSEE 1B0GB 4HJ0C 1TTUA 4Y4KC 1QP1A 1WAAE 3DECA 3P0YL 3VGEA 4NQSB 3DO7B 3ZTNL 2WUCL 4NP4L 5CEZE 2C7UB 4ELKB 2A0LC 1AGCB 4M43H 1RK1B 3Q6GL 4Z95H 4NO0B 5F7NC 3UBXG 2ERJC 3NIGF 3WIFA 5ID0A 4F7EA 5D1QC 4TNWF 4L3CA 1IGIL 4BK4A 5E56A 4BSWA 1QD0A 4BSJA 4NKMA 1SY6A 1DL7L 5J12C 3ROOB 2A6KB 2ADIB 3LSOA 4YFLF 3SY0A 2E8ZA 3ARBD 5IVXE 2JB6B 2D4DA 4FQHA 5FCUL 5GS0L 3FB5B 3QWRA 4OSUL 2AI0H 5B22A 4RGMC 5KSAC 2AK4B 4XVTH 3MLUH 5ESVA 5E6IB 3U0TB 5I8EB 4UTAH 2X42A 3M45A 1M1SA 2EDHA 4TOYH 2XZQH 5DVNA 1JGVL 3ZKXC 4QHKI 1NAKL 2D0HA 1CXFA 3QRGH 4D9QD 3RWDA 3HMWH 4ELME 1XF3A 1LP9A 4JDTH 5D2LF 5KW9H 3GO1H 2VQ1A 2F53B 1J8HE 4V1DB 5CMAB 3HNTL 1U6AH 5KSBE 3O11A 4P2OB 3OX8B 4PJGE 3ARQA 3B4NA 2YUVA 5IHUL 4UIMA 1D5XB 4JFED 4N0YL 3VXTB 1HINH 4N0FA 3NFNB 4PUBH 4TUJA 4FS0A 5F7FA 3NZHL 4Y1AB 2VH5L 1T1WA 2IF7A 4OV5B 12E8L 1KYOJ 1HE7A 4GG6A 2BNQB 4G6JH 3PP4H 1B2WH 1WBYA 1BP3B 4K71C 1E4XI 4PRBA 3FTGA 3KPTA 1A7NH 2CGRL 3ARDC 3ULUH 4F9LA 1SVCP 4XP9L 1G7MB 5E1HB 1U3HC 2PUQT 1GC1H 2WMPA 1MELA 3QBTB 3MRCB 3D3VA 1CDUA 4PJCF 4PJXE 3U0PB 4NNPL 4DAGL 1MLBB 5DJAA 5A1AA 3AREB 4YXLH 3VFNB 2KZ1B 4DEPC 4P46B 2GK0B 1IC5H 4BH7A 1EJ6A 3OF6A 4WW2B 2DLFL 2J5LC 1E4XL 2APVA 3SDAD 4AEEA 4M7ZB 4PGBB 4J7RA 1SY6H 4JAMB 4MD5B 2W0FA 3MRHB 1S7VB 3DVNB 3T1FB 5AAWA 3DWTA 5CSGA 4JO2H 5FFLA 4OFDA 5HHNB 3W82A 3REVA 2VDQH 5IR1B 1FFNA 3MV8B 3O3BA 1H3XA 1E4JA 2P8PA 1B0GA 3QT2A 2UWEF 5L2KE 3I6GA 5KS9B 4PJ9D 4GW5B 4LKCB 3IS0X 4JRYA 5GHWH 5I1EH 1I7ZA 3S9DB 3DO7A 3OBAA 1NUNB 1Z3GL 4HSQA 2HTKD 1RHHB 1X44A 1JCKA 3MACH 2YD2A 1OP3K 1DCLA 4NO0A 4KGLA 3DGGB 2ITCA 4YFLI 4HUVB 4WNQB 1YPZA 1ZHKB 2MCPL 4R2GB 5I1LB 3BVNB 1AXSB 1WBZB 5HY9B 1T2JA 2A6KA 1L7TL 3AB0B 1CG9B 2P8MB 4CGTA 1FO0B 1UM6H 5EUKB 2JLLA 3FT4B 1G7LA 1UCBH 4S1RL 4Y4FD 1DTUA 1G9ML 1S9XA 1WFUA 4RBPK 1CF8L 3TH2T 1NGQL 4LLVA 5ITFB 5HHVH 2AK4A 4U1HB 4PG2A 3MJ9L 4QEGA 5I8EA 3AVEA 2OXHA 5MEOB 4EI5A 1G1CA 2J8UB 3CVHL 5D5MF 2QL1A 4IOSD 4OD1L 4X7TB 2L0DA 4F2MA 2NMSA 2X4NA 4K9EH 3ZKNC 3IDYC 2GJ6A 5DUBA 1K5NA 4UTBL 1T04A 5IHBA 2C3VB 3DV6B 3FFDB 1OQXA 4WFFD 5I1JL 1RFDH 2HRPL 5CMAA 5IB5A 4P2OA 3OX8A 1IGMH 2VL4A 2F54A 5KOMC 2ATKB 2ZCLH 3ARBB 2VXSL 4Z7WF 3O45A 5J13C 1MCOL 1D5XA 4KAQL 1D5BB 3O6FD 1DEEA 3QA3B 5KZCD 4JG0L 4O9HL 5CILH 2APFA 1CCZA 2A74B 4M1CC 4R0LB 5EDXA 5D7IF 1Y6KR 1IGYB 5DRXA 2BNQA 5E2UH 3VFPA 1I9JL 1JF6A 2MNUA 3C6LB 4PRAB 2DJSA 5KG9A 1YEFL 4YHZH 2QADC 4S2SB 1P7KB 3FMGL 5GRZA 3SE8L 4CMHB 1BF2A 5HVFB 2FGWH 4LCYB 4F7TB 1FG2A 1FPTH 2D7OA 5E4EC 3CNKA 1CLYH 3L1OH 5GGTA 4NHCH 4ODBD 3SKOB 3B5TA 3MRCA 3U0PA 2C1PB 1A6AB 1U8IB 4X9GA 4XNUH 5F3HA 4PJ5E 1Y18A 1TFHA 1YEJH 3AREA 4ZNCD 1V7NL 3LY6A 4P46A 2XN9E 5I9QB 4JFEB 1Q9KA 2A9MH 5DT1L 4HW6A 2VZVA 3TFKD 4P59L 5FYJD 5J6HB 2XKNA 3BZEB 3RVUC 2H3NA 5BRZA 1TZGH 3CFBA 4J23A 3T1FA 3HE6D 3VGHA 4ZUUA 4GOSA 3UZQA 4JY5H 2QQLL 5IQ9B 1D6VH 5TE6H 3CFKA 2ZPKH 4GKNA 4M6NL 3MV8A 4LLQB 4KUCD 4J3XA 4M6OH 4XB8A 3PDDA 3RKDD 4BFGA 3VXUE 1ULVA 4M4RA 1NUFA 1G84A 5C0RH 1I8MB 5D2LE 4MAYC 1EGJL 3KS0J 5D7LD 1DBKH 5DEGA 4NPYB 5EUOF 1KG0B 3CMGA 5D72H 5FGCE 3RQ3A 4KZDL 3KPQB 3DGGA 3X11B 1NAMB 4WGVB 2DWDB 3QEQE 4FQIH 3L9RB 2Y23A 3QCTL 4XX1G 3FQNA 4P2QE 2Q7YB 3WLWD 4L9LA 3ABZA 3F7RA 3FL7A 4GJTB 5A2IH 2HP4A 3U48A 2I60L 4WU7A 1FO0A 4HKXB 5EBLA 3FT4A 5D7KD 1T7VA 4WFGD 4KK5C 3A6OA 4P2YA 5ESQA 3RY4A 1FHGA 5IVOA 1BVLA 4H88L 4TTDC 3L5JA 1A1OA 1CE1L 5D7SL 3QUYB 5ITFA 1F6AB 4N90D 2WBJC 1J86A 4U1HA 3GBMH 3T0WA 4PJ9B 4PBVC 4ZSOA 2ZWLT 4XB7A 1FFOB 1MI5A 3TIEB 2EC9U 5EPMB 3MLVH 1BFOB 3H3KA 1YEIL 3W9EB 1IZJA 3EYFB 2JJSA 3FONB 2C3VA 1HHKA 4HS3A 3DV6A 4K7PY 3HE7A 4M6MH 4S0TD 5GGTH 4QRTA 2P45B 1QPXA 3GMQA 5F96H 4QNPF 2VZTA 3IAPA 2FJHA 4HZLA 3ARBA 1YEDA 1U8QB 1IEAA 2ARJA 5F7HA 1FVDA 3U4EB 4DZ8A 4FFVC 5JORB 3U7WL 4NC1E 4N0UA 1HIML 2O5YH 1UXWA 1R24B 3C5ZC 3E8UH 4Y19D 4KK8C 3A6CH 4R0LA 3HC3H 1NCDH 1EPFA 3E6FB 2EXWC 4PRAA 4S2SA 1LDPH 3BISA 4N0CD 2QSCH 1N7MH 1ZMYA 1I4FA 3B2UD 5E9DA 5CEXB 3KXFD 4HCRL 4LCYA 4O00A 4X0KB 1A22B 3O8XD 3TT1L 4F7TA 1MREH 1W72L 3BIAX 4APQD 3BIBX 3TA3C 1OP9A 3VWKD 1JV5B 4O2FB 1SYVB 3SKOA 5HHQB 2XWJA 4C57C 1A6AA 3NFSL 3MLXH 5CS7A 4PB0L 5B39A 2WAHA 3O3DB 3BJLA 1VENA 3VCLB 4Y5VB 2ESVD 5A2LH 5GS2H 5I15H 4JFEA 3O6FB 2F8OA 1Q9LA 3C2AH 5KZCB 5D8JL 3BQUB 3L7EA 4UILH 4JR9H 4ODHH 1UA6L 5J1SC 3T4YB 5T3ZH 1UWEH 3OKDB 1FO0H 1Z9SA 5I73C 5SWQB 4RQQA 5JHDD 3QHFH 4JANB 4K55A 2IFFH 2EIDA 2R8SH 5B38A 3DETD 4LLQA 1ND0B 2W9DL 1IKFH 1KULA 3RKPA 3D69A 4YX2L 3TT3L 2ZCKH 1LEGA 1O5DT 2FLRT 2XZCH 4MZ3A 7CGTA 1D9KC 2LU7A 3PHSA 3QDMD 4NN7B 4MX7B 1MEXH 5T1KA 2HMIC 4FQPA 1NLDH 1Q94B 3B2VL 4EDXB 4AEHH 1XT5A 3FJTA 5L7XL 4OZHF 3SDCD 5EZOH 1J9CT 2W65A 2DLTA 4QRPB 3L9RA 3VI4F 5GRVK 1H3WM 1JTTA 3SDAA 1QFUH 1UQSA 2YUXA 3HE6B 4MNQA 4UQ2A 2VLKE 3RX8A 1URLA 5D7IE 4XP4H 1NBYB 3PF2A 4D0DB 1AHWC 3SKMB 3W5NA 4K3JH 2Z0BA 4HLJA 5DMIL 5I16B 5IMMB 4IS6B 1P1ZB 3U46B 3ZDXE 3TIEA 2KQMA 5D7LB 4HEME 3QO1A 5D2NA 1BFOA 4ZFOB 2NZIA 4JFDE 4ORGB 1GYAA 1FP5A 3EYFA 4GS7B 1FNLA 3FRPG 1JGEA 4OIAA 1A7QH 3CU7A 1I7TB 5MENA 3KYMA 3PWUA 4OLWH 1PX4A 1OTSC 2ZUUA 3FT2A 5E8PA 1DQDH 1OT1A 4ZO8A 5C6PB 4YO0A 3GGWB 3RIFK 3S34H 3FQUB 4Y4FA 3UTQA 1P4BL 3WUWB 2B0SL 2XPGA 4LSSL 4HH8A 3RI5K 1CYGA 1W0WB 4CJ0A 2J1KA 4GQ9H 2BSTA 2FO4A 2DQTH 4XZUA 5B21A 2R29L 5DURD 1AR2A 4KKBC 3OKLA 4OLEA 4GBXD 4Z5RA 3EBAA 3QUMA 4PTTB 4NM4L 4K7PX 1RVFH 5LCVL 5L0QC 3HS0B 1A7OH 1C8PA 4XXDB 1WJ3A 1H3GA 4YHIA 1MHEA 5BQ7A 1AP2B 2AEPL 3FN0L 5EUOE 1SEBB 2GFBB 1D7FA 1SYVA 3TBVA 3DX7A 1WFOA 5C9JB 5HYQA 1GXEA 4D94A 4LCWA 2ADFL 1LO2H 4POUB 5F7DB 1FNEA 3CFJA 5EIVA 3MOBL 5F44A 4IRJC 3OB8A 5CSZB 3C2SA 2J88L 1H15B 3EYQD 3O6FA 2YR3A 3L3IB 5ITBL 3VFMB 3AAZA 4Y19B 3LN4B 1B4RA 1OAXH 1T89C 4FOMA 5IEKA 2ZJSL 1TVBB 2NYYD 4S0SD 4YNYB 4K7PH 3LKQB 3PABB 2VAAA 4UT9H 4YBQC 1KLUB 4TQEH 4JANA 1A5FL 3F5WB 3EOBA 3KXFB 1ND0A 4HWBA 2DLGA 3MRQB 4P5KB 3O8XB 3OR7A 5EZJA 1H3PL 3BT2H 2JJWA 5ICXB 5EWIL 1XGYL 3VWKB 2R56L 5FO9A 3PQYD 3P3YA 4MX7A 4PP1C 3S4SB 4R4ND 5C07A 2XYCA 3DYOA 3WSQL 1FZJA 1G6RA 4XNYL 3DOSA 5K9QG 4EDXA 3ULSA 2Q6WA 2ESVB 3RNQA 5HVHC 4HIXL 2OMNA 5E5RB 2AJSH 3N1GC 2DD8H 3OR6A 2EKSB 5HI3C 5E5UB 3B5GA 3IAGC 4NM8H 1GAFH 1UJ3C 3K4ZA 2QSTA 2PTUA 3Q5OA 5CAYB 1WTLA 1QBLL 1KBGH 1NGXA 4JPKH 1LO4L 4RFOL 5JHDB 1QEWB 2OM5A 2UY6A 1INQB 1J12A 1VEOA 3EFDH 4KJPC 2R0KH 1H5BC 3RPIB 3VWJC 4JCLA 4YHYB 4Q2ZB 4D0BA 5FAAA 1A3LH 5I16A 4OZGB 3S88H 1F4WL 3QDMB 3P11H 4FQCH 4NKOA 4YLQT 4ENEC 3QUMH 1S7SA 4KVCL 4YHKL 3KWWB 3A6BL 2ADGB 4PY8I 2R0ZH 4DGYL 5GGUB 5ALCL 4HBQA 4ORGA 1FIGL 4GLRH 3SDCB 4K8RC 4OFYD 1J1XL 1I7TA 4AL8H 5KVFH 1QPPA 5EU7E 5BZWB 2RHEA 4U0QB 3P77B 3QISA 2JJTA 4ONFL 4NNXB 3GGWA 1ORSB 5KANG 3FQUA 3CC5B 3MYJB 5GS1A 3EOYG 2DL9A 1FRGH 1NC4A 5E8EB 2N7BA 3QAZB 1T83A 4HEPG 5GGVY 3UBXA 3FAXA 3TIDB 4QYOA 1F4XL 2H2SD 3BOVA 3WFBL 2IGFH 4PRHE 2IPUG 2Z8SA 5LBSL 5F1KC 1RUKL 1IKNC 3ZL4H 1MCJA 1BD2D 3OKMB 1J05B 1AXIB 3JTSB 4HWBH 1AP2A 5H8DA 3V5KA 1OTUD 2AW2A 3CSYB 5ADOH 3D25B 1SEBA 3EYOB 4XVSH 3GMMB 4OZHE 1MJ7L 3O9WD 4RAUB 3RZCC 3ULVF 2IWGA 5CP3A 4ZPVA 3VI4E 1G6RH 2EYSB 2VR4A 4PJAE 4RMRA 4LPXA 4P5TD 3IVKA 2XQBL 5FYJH 5MEQB 3LKPA 4N5UA 4CNIB 3V4VL 1I8KB 2VLJD 2R0WL 1TVBA 5DS8B 5DURB 2CLZB 4LCIH 4GBXB 3MRJA 3O0RL 1JPST 1MFCH 1KLUA 1NBZB 4BFEA 3CMOL 3CD4A 3EOTL 2IH3A 1AD9A 4TYUA 3UTZA 3MRQA 1JGDA 3QXDB 4N5ED 3O8XA 5DEZA 3WE6A 5CHNA 5AZ2L 4APQA 3DXAD 5KVMC 3MOAH 3VXSD 3VWKA 3QG6B 1OARL 2CMRL 3S4SA 5GJSH 1IL1B 3H9HB 2HLAB 4U1NA 1K85A 2GTWA 1FNGA 5IVZA 3HZYB 3I75A 2FEEI 4X6CB 1KENH 1OGAD 4JM2D 2ESVA 5A2JH 4OIIH 1PZ5A 2VUOA 2QR0A 1CD1A 1VFBB 2FX7H 3BPNB 1WICA 3K4DA 1L9NA 1FSKC 2EKSA 3WBDA 4M03A 4LEOB 3RL2B 1AY1H 3QZWG 2AS5M 3ZE2F 4ZYKA 3VMOA 2X4SB 4RNRB 1A6ZB 3A0OA 1RMFH 4OGAC 2EC8A 1QEWA 5J3HD 4LCCC 2XZAL 5J11C 2W60A 5EU7C 3RPIA 5M95B 2FEEL 3LS5H 3T4AB 3O2DA 3QDMA 3LKRB 3PQYB 3NH7H 1T22B 1R3KB 1LK3H 4CVUA 1MJ8H 3ZO0A 5KN5B 1M05B 3VH8B 3UYRL 2HYMA 5GGUA 3QB7C 3SDXF 3WJJC 4HV8A 1UM4L 4KV5E 4PBWD 4ETQA 1I3GL 4Z7QE 4L4VE 4D9LL 3UJJH 1MCBA 5BZWA 4M9OA 4GRWB 3P77A 5CP3H 5JW5A 1ORSA 3MYJA 2EDNA 3WEXA 1NL0L 3NABH 4H8WL 4PRPE 5SX5H 1YN7A 1LEKB 4DKDC 3F6IA 3B5HA 4JRXE 1CIDA 1BFVH 1BWWA 5FGSA 4N9GB 3NCFB 1AQKH 1D5ZA 2VITB 1PYWA 4IRSD 4JO4H 4P4RA 4ZUVB 5C70A 1J11A 1LEIA 4G8EB 2UYLB 2HFFB 4HXAH 4PJBF 4IMLA 1VA9A 2XT1B 4JO1L 2AJVH 4YXKH 2GY5A 3D25A 3CFDA 4RAUA 4KQ4H 4JKKA 3I50L 1MF2L 4QLRA 5LGHL 4MXQD 3S3JA 3CLFL 4LBEB 4F7CB 5MEQA 4LHJB 4MA8H 5CIPB 3MLZL 1UACH 1MPAH 3AROA 3VXQA 4JFFE 3CPLB 1MUJB 1XCTB 4OLYL 5C0AE 1BD2B 1ADQA 1Q9WB 4I18B 1EAPA 1YNLH 1ZWIB 3QXDA 2NX5E 5EU6E 4J3WA 3WFEL 4KH2A 4XNMB 4XP1L 2VDRL 4M5YH 2AK1L 1EEYB 3ZDZF 3O2DH 2AJ3B 4XMKL 3PWVB 4EI6A 4X7SH 5MERB 3RDTD 3ZYJA 3BKMH 1WK0A 5FO7A 4WUKH 5GGVH 3MBEA 3HMXL 2DQFB 4P5TB 1XF2B 1VFBA 4H1LG 3SPVB 4BFBD 1BM3H 1XF4A 2J8OA 3RL2A 4XBGB 3QI9D 5TF1H 1QO3A 4IMKA 3UO1L 4M7KL 2FEDD 4HD9A 2X4SA 4H0GA 4RNRA 1A6ZA 2VO5A 3FOMB 5H94B 5JOFA 1QSED 3U30C 4JY6A 1X4ZA 4MLIA 1S7XB 1R3HA 4JFYB 3DXAB 3VXSB 4GKOA 2EDDA 4F33B 4WENB 3VFVA 5CEZD 2GSIB 3VJ6A 4KVNL 2APBA 5DRZB 3KJ4C 1GOFA 5KN5A 2K7PA 3KLAA 1OGAB 3IAQA 5KVGL 1J0YA 4KJYB 1AGEB 3JVGC 4WTZG 4WGWB 3BGMB 2BMKB 1ITBB 5GGRB 1MCQA 5JQ6L 1OD9A 3FT3B 1OGTA 2WLYA 1DVFC 2NNAA 1K3ZA 3KPRE 2EYRA 4JB9L 5EB9A 4ODXB 4P48A 4XCCL 3FO9A 4MWFB 1I8LC 1FIEA 1LEKA 4YBLC 4X5XA 5HHPB 3QUZC 2A2QT 4XTRC 4M62H 3HKFA 1YN6A 4KTDL 4NYLB 3ZKMD 1N8ZB 2IEPA 5I8KL 5HDQL 3I2CL 2EDTA 2HN7A 5I74C 3T0XA 5GGRY 3L6FA 1KB5L 1ADQH 4G8EA 5EN2B 2UYLA 3TVMC 1GHFL 2HFFA 3MRFB 3G6JA 4LFHD 4NFDA 2WIIA 4LRNH 3QR2A 4LOUD 1VGEL 1WZ1L 1J8HD 4OFYA 2PO6D 1LE5B 3UTTD 1H0DB 3AFLA 5HJ3A 1BEYH 5KTEL 4FQJL 1AC6A 4F58L 2EZ0C 5IB2B 2YA2A 2AEQL 1BQLH 2OL3L 3TO4C 3ZHKA 1H3UA 3O4LE 5KJRH 3ZE2E 3AU1B 2HRLA 5D6DC 5FYLH 4F7CA 2R23B 4LSQH 1RIHL 1UVQB 3CFEB 3V6OE 3C09C 5CIPA 3WN5B 4TSAL 3D18A 3A67H 4XBEL 3ES6B 3HNVL 5CZVL 3HR5A 5LGJA 2LU4A 4IRSB 2ICEB 3EYSL 1MUJA 2FRGP 4OF7A 4XWGL 1BD2A 4TSCL 3QXAA 1NANH 5F93C 3F58H 4FQXD 4KFZC 4PJ8D 2O26U 5GZND 4NC2B 5GS0D 4OLUH 1KPVB 1IT9L 4ESKA 1UG9A 5KSAB 4X6DB 1NMAL 4FZ8L 3JXAA 3O9WA 4NNYA 4HUXB 1DJSA 3GSOB 5MERA 3TN0D 5E8DH 4TULL 3MV01 3MMEB 2ITDA 4Z7VB 4AIZB 2EIBA 2MKWA 1RIUH 1MSPA 2C1OA 4G7VL 4J4PD 2V5TA 2QQNH 2YPLB 2NW2A 3ULUF 3EOAA 5D1XC 2VLJA 4KI5C 1MRCH 1RIVL 3GMRA 2OYPA 4PJDF 3VXMB 4MA1C 2VE6B 4K2UL 1YJDH 1ACYL 5CGYC 3IF1B 2O5XH 5DWUH 5H94A 2BOBB 3X17A 4KJWC 3GSRB 3QFJE 1DBMH 4JN1L 2Z31C 5L2KD 3VFUA 2R1WB 1MNUL 3SCMD 2FB4H 3G6DH 1A02N 2VL5A 3DXAA 4F33A 3H9SE 1UB6B 2GSIA 3IDJB 1J1OL 1N4XH 3WNMA 4FQ1L 3RWGB 4C56A 1HQ4A 3RDTB 1QRNA 1OGAA 4JM2A 1GSMA 1P53A 3PHOB 5C1MB 4NUJA 1KCSL 4U1GC 5GGRA 5EFIB 3FT3A 3ARDB 4FZEH 5FKPB 5CJBA 2VSDA 3QI9B 4ZNEE 1HXYA 4RMSA 1CZ8H 5JO5B 4ODXA 3K74B 4X7CC 4X8JA 1K2DA 4ERSH 2FECI 4IIQA 1QSEB 1T1YA 2FJGA 4BFIB 1CIUA 4R26L 1WC7A 1R3JB 2XKSA 1NSNL 5CIPH 3HNSL 1S78C 1V3KA 3OB0H 2AV1A 4NYLA 4L29B 4MSWB 4XPTH 4YK4B 4R7DB 3BYTA 4JGMA 2BC4A 1V7MH 2M26A 1GZQB 2P8LB 3GIZH 1XIWD 5EN2A 5TGBA 3T77B 3V6OC 5DMGD 1B6DA 1HNGA 3RVTC 1YDPA 1X5AA 2AJYH 1PSKH 5DSCA 2X6MA 4EN3D 4M43L 2YKLH 2GKIA 4NCDA 4XI5C 4YPGA 4Z95L 5I1KH 2FECL 5T1MB 4MXWH 5IVXB 1FFQA 4GG6F 4OCNC 5IB2A 4PV9B 5JQHC 2ZCHH 1A14H 5FB8B 1U93B 1EH9A 1FAIH 1UH2A 3QXVA 4RGNE 2YRLA 3MLSH 1TXKA 3ZT7A 2P24B 2XRAH 2UY7A 3W0WA 3CFEA 3WN5A 4OM0H 1FZOB 1OAZL 4JZOB 4LVEA 1IGTB 1TDQA 3MO1B 1KJ3H 2AI0L 4FTVE 3HZVB 4XVTL 3MLUL 5BW7A 1ONQA 1Y6MR 4UTAL 1MVFA 1F2XK 1V3JA 2OSLA 4ELMB 3GSQB 4TOYL 2XZQL 2DM3A 1JZ5A 2MCG1 5MHSE 4ODUB 1J8HB 3B8SA 3QRGL 3BHBA 1GGYA 5DK2A 2PO6B 5AEAA 4BM7A 5KSBB 3HMWL 3UTTB 4JDTL 3GRWL 5KW9L 4ZUTB 3GO1L 4AJ0A 1JHKH 3STBA 4M1DH 3VFWB 3EHBC 3QEGL 2XN9D 1U6AL 4HLZG 4RFNB 1JNNH 1SMOA 3QWQB 2H8PB 5TH2A 3HI5H 3HUJE 5FKAA 2MHAB 1ETZA 3ZZ1A 4BUGA 5JZ7C 1HINL 2R9HC 1WGOA 3T65B 5C08E 4PUBL 3RNKB 4BKLA 5E24E 2QSVA 1T0NA 4Y16A 5SWSD 3MR9A 5EBWB 2JTDA 2BP3A 1T66D 4G6JL 3N50A 3PP4L 1B2WL 3VXUD 3FHQA 3SEPA 2NY5L 3GZKA 3KYOA 5J13B 4QXWA 4PJ8B 5IF0A 3BPCB 1OT2A 2FH8A 2LVEA 4ODVH 3U79A 4QRSB 1A7NL 1OP5K 2D31A 3ULUL 1LE9A 2NCMA 4JHAH 1YPZF 2FBOJ 5L2JA 2VABA 3TN0B 1GC1L 1U3ZA 3LPWA 2E6JA 1FZKA 4AEIH 4ODTH 2B4CH 1CWVA 5IM7B 4YXLL 4O02H 2OZ4A 1A7BA 2IALB 4D8PB 5EFIA 3GMLB 3NACL 4WWID 1B4JH 5CWSA 4HGWA 3IXTB 4YHLH 4WVRA 1IC5L 3VFTA 1YYML 2JIXD 3B9DA 2DICA 3FAWA 1IM3A 5EO9B 5TDOB 1FQ9C 3OXRB 1EUTA 5JMOC 2R4SH 4PV8B 1SY6L 4J2XA 2ID5A 5DO2C 2LQRA 3HPLB 5E5MB 1QSEA 4JFHE 5L2KB 3ZE0E 1CU4H 2F5BH 4JO2L 3C60D 4WI9A 2FIKB 3SCMB 1ZLWH 4I5BB 3T2PA 4UV7H 2VDQL 5DA4A 4L29A 2UZXB 3S5LB 5AD0A 4WI5A 4R7DA 2FR4A 2FX9H 1K4CA 4RGNC 3ARGC 1FL3A 2A6IA 4U7KA 2FDBP 2DQCH 5C71A 3OAUH 5I1EL 4I1NB 4PTUB 2JJVA 2BSSA 4Z78A 3WLBB 3MACL 3M1BA 1EERB 2NY0D 2WWMC 4WW1B 1KC5H 1ZANH 5FV2A 3AM8A 3RUGA 3PGFH 2CIKB 2X4RA 4LF3B 2YSSB 1C5BH 5IVXA 4DK6A 3W11C 1DR9A 4PV9A 4YUEH 3ULUE 1MH5A 4CN6A 5BV7H 4DOHE 3RBSA 1UM6L 5K59F 2R2HB 1UCBL 2P24A 1FL5B 4R97C 3RU8H 3KLHD 2VAJA 2ZZUT 4JHWH 3MO1A 1XMWA 5MP6H 3IU4L 3HZVA 5HHVL 3WV0A 5GZOC 3GHBH 4YHOH 1UC6A 4DTGH 3AUVA 3IT8D 1XIWB 4ELMA 4LHQB 4K9EL 1JRHH 1J8HA 3P30H 1MCPH 5F88B 4EN3B 1G7PB 2PO6A 4GG8B 4O2CB 3UTTA 5DXWA 4MJ5B 2YXMA 3VG9B 4X4XA 5GGSB 1F6LL 3G5XA 5ACZA 3VFWA 2ZOLA 3H8NA 5D6CA 3CIQA 1GGBH 2OR9H 2YUWA 1IGML 4Y5XB 3QQ3A 5JXAH 2ZCLL 4NWUH 2OZ4H 4R8WH 4PGJA 1FNFA 4HS6A 2XKUA 2IAMD 3UCRA 3W2DL 1KIQA 4QRQB 4U3HA 5CILL 5HHOA 1MAJA 4LLYA 1BPVA 1MJJB 1LP9E 5E2UL 1RU9H 3S3PA 1SEQH 1DBBH 4FQXA 4L8DB 4YHZL 4PJ8A 3BPCA 2F58H 3C9NB 4QRSA 5D7JC 1HZHH 2FGWL 4KZEL 1IGFH 5CEZH 5B3JF 2DMBA 1FPTL 4PJ5B 2VMFA 1CLYL 3L1OL 3TN0A 4NHCL 3CVHB 3PL6A 2XN9B 3RWJA 3BSZH 3V6ZA 4D0CB 3HB3C 5FO8B 4XNUL 1TQBB 1SMAA 4LPCA 1YEJL 2XWTA 4WIQA 4GG6E 1F45A 4JGJA 3VDAA 3IXTA 3MRMB 1KJVA 2A9ML 2A1WH 3TA3B 5J8OA 4X80H 1JVKA 2VLKD 5TDOA 5SWSB 4PV8A 1TZGL 3OGCB 1QSFA 3IJSB 2PF6A 5E5MA 4HUUA 3RGVC 3BH9B 3VXUB 4IJ3B 3RWHA 3UAJC 3NIFF 3D3VE 4JY5L 3BIKA 1D6VL 1PBYA 4ZQKB 5TE6L 3PWLA 3RA7H 3DX8A 1ZVHA 4M6OL 2P42B 1J0HA 5D2LB 3HAEB 3F8UB 5DHYB 3ME0A 1Z9MA 1KPUB 3QZWA 1GC1C 3TNNB 3S36X 1BX2B 3DHMA 5C0RL 2YMXH 5FGCB 3U9UB 4G43A 4XMLH 5I73B 1JFQH 1KCKA 4ZTOH 1DBKL 3QEQB 4PB9H 4DQOH 1MHCB 3PIQB 3G5YB 3QIBD 5D72L 4WW1A 2VDMH 3LZFH 2FWOA 1CGSH 3UJIH 4LF3A 3HPJA 2JIXB 4FQIL 1YUHB 2WWKO 2HLFC 3SOBH 1GOHA 1WBXB 4M7LT 5ENWB 4B53A 4K3HA 4JRYE 3C60B 3KPSA 2L7JA 2WP3T 4DZBB 1L0XA 3F7YB 4S1SL 1I3RB 2N56A 1MCCA 2NXZD 3CDFA 3GB7B 3GBML 3V5DB 3IDXH 3S36H 4PJCB 5J1AB 3OWEA 3ZMRA 3HC0B 1YPZE 2HVKA 5CZKA 1CQKA 3KDMA 4LVHB 4S1DC 1HK6A 2NY0B 5HGAA 1JYVA 4U1KB 1IAIM 4GW4B 1AHWB 2EDBA 4WWKC 4X6EA 4O2CA 3TH4T 4MD4B 4MJ5A 3MROB 4M6ML 3IETB 5GGTL 1R6VA 3EDFA 3D39A 4HKZA 2AK4E 5F96L 4Y5XA 1K8IB 1YMMA 2DIJA 3CK0H 2HFEB 3P4NA 4GMTH 2AXGB 1ZT4B 1AR1D 4J1UB 4NZUH 4LDLB 3LB6C 4FXGA 2Z4QA 2O5YL 3IFPB 3E8UL 1M6OB 4NQXB 1HSAB 1XZ0B 2GJ6E 4P23A 2AAVA 3N1FC 1MJJA 3A6CL 3NCBB 5D1ZD 3HC3L 1NCDL 1BZ7A 1VFAB 1KPRB 3EGSB 4U1MA 1EJOH 4MNHB 1BBDL 2HT4D 2A83B 1Z9OA 1LDPL 2QSCL 1N7ML 3DBXA 4CDGC 4PS4H 4X99B 2F54E 1MREL 1CLZL 2YRPA 3RWCA 4F9LC 5IWLA 1EO8L 4HK0B 5IW6B 3B9KA 3JUZA 4Q7DA 4D0CA 3MLXL 3EDJA 3EJZD 4R4BA 4DN3H 2EC9T 2CLRA 3U36A 1GGIH 1QFPA 3QYCA 5I15L 3FQXB 4JLRA 5DK3A 2IAMB 3C2AL 1UADC 2CR6A 3EJYC 2L4OA 1VERA 2X4TA 4UILL 3QO0B 4IOIB 4JR9L 4ODHL 5SWSA 1X7QB 4BZ2H 3KPMB 5HDOA 1GGTA 4DAGH 3OGCA 5D5MB 3OXSB 5DD5L 1GGCH 1UWEL 3PWJB 1FO0L 1XGUA 4HUWB 1F4YH 2DQDH 1XGTA 1JL8A 5E94B 4QHMA 3QHFL 4ZQKA 2COQA 2IFFL 4AM0B 2R8SL 1CDCA 4H1LA 4XNZB 1IKFL 4YEFA 1RZIA 3AY4A 5DHYA 2ZCKL 2XZCL 3EO9H