4PD4J

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pd4J00
2O5ZL 5FGBA 5GZOD 5FYJU 3N9GL 4YHOL 4U6HB 2W0FA 2EIDA 5DVMA 1IRAY 3ARFB 1WZKA 5DT1L 3CFKB 5ICYB 3OG4B 4KHXH 1Z0NA 3OAYK 3O9WC 5FYKL 1MFAH 3NN8B 3WD5L 3ZE2E 4H26A 3KPSB 1KGCD 2W9LA 1YEEL 3CX5J 5AYUH 4NOFA 3QWQB 2A77L 3T3MF 1MWAL 3QUXD 3QIBB 2PN5A 3KS0J 3BP7B 5GQBA 5IB5A 2VDRH 5A3ID 3HNVL 4NQUA 4H88L 5JUEL 3NIFF 2HJLA 4U1SA 2NY3D 3MLSL 3RZCB 1N4XH 3HMXH 4POZD 1GGCL 2V7NA 3V6OA 1NC4B 4ENED 2XG5A 3ECBA 3F12B 1P6FA 4U1MA 4C4KT 5ACZA 2FDBP 1GZQA 4U6YA 4P5TA 1A6PA 3MNZB 2LVEA 3FRUB 2E5EA 1CLOH 3SJVD 3QUKA 3S5LB 1GGBH 1S78C 1G6RL 4KVNL 1WISA 4JRXD 3L5WB 4PRHE 4UTBL 5D1XC 2YRZA 3LMJL 3IDMA 5B8CC 5I6XB 4OZFG 3EYUH 3P0YH 2EYSA 2EIEA 3QIUA 3T4AB 1OAKH 2W1NA 4X80L 4MAYD 1CDIA 1U8IB 5DWUH 4G7VL 1R3KA 5C08B 2YEZA 1ACYH 4PJCE 2Q3ZA 1EJ6A 4Z0XB 3MV9E 4JFDB 2XI9A 2R69L 4S1DD 1DLFL 3D0LB 4IRJC 5HY9B 5MENA 25C8L 1PW3A 5EOQL 1Q1JL 5C07B 5KN5B 2R0WL 5I30L 2MQ3A 5DJDA 1MCCA 1SEBA 4M62H 4G8IB 1RZ8A 2VWEE 1N8ZB 1QO3B 2R4RL 4MX7B 3TCLA 2GUOA 4RFOH 4ZFOL 3STZA 3IS0X 2E9WA 1TJIH 1PD6A 3EO9H 1LO3L 3WXVH 5FOJA 4OZIB 3V4UL 4PJ8A 4QHMA 2I9TA 1JNHA 1T2XA 3HI6H 1D6VL 1WITA 3IJSB 3EYVB 4MB5A 5E95B 3WE6A 1B88A 5ITBH 2VLJB 4P2OD 3FAXA 3VGDA 5EBWB 4LBEA 1UB5A 1FL3B 3LD8C 1UGNA 5HI4D 3TH3T 5GJTH 5DRXA 2ADFL 1AE6L 1T2QL 4FQHA 1KB5A 2FZ3B 4U1GC 5AZ2L 2DBLL 4QEGA 5HVFB 2QJDA 2ATKB 3MLYH 1C08A 4WTZA 3R1GH 2HFEA 5IB4B 3JTTB 1FZKB 2HJFB 4P59L 5FUOL 3P4LA 2XA3A 1V7ML 4V2BA 1QG3A 3LPGA 3L3KB 1KENH 1Q9LB 4TYUA 3INUL 1HYRC 3LAFA 4HS8L 4NC2B 1E27A 4LASL 4UIMA 3O81A 2A6JB 2I5YL 4N0UA 1OP3H 4HK3J 4YAQA 3PWVA 1PLGH 5HYJE 4NNXB 4U49A 5I74C 5E8EA 1VESA 3M8OH 4Y2DB 3IXAB 5GGRA 4G43A 3CFEA 4AM0B 4HXBL 1VPOH 2BNRB 1CI5A 1KYOK 4YHLL 3QUYA 1YC8A 1R5IB 3VD4A 1Z5LA 1R0AL 4U31A 2V2WA 3JXAA 4BH8A 4LEXH 3OSKA 2MFNA 3ARXA 5INDA 3FTGA 1E6JH 4ZS7L 4V2CB 1DBKL 4XP5H 3QA3B 4F7PB 3MACL 1CXIA 1OT2A 3P9LA 5FDWB 4P3DB 4OF5A 3WFDH 1S9VA 3B9DA 3EDKA 3S4SA 3OPZL 1I3UA 4PJFE 4JO2L 4RAVA 5IBTH 5IROA 3CUPB 1FFPB 1TNMA 4HC1A 2IALA 4MA8H 1GZQB 1Z3GL 3JWNC 1CG9A 5C09D 3N1MC 1JGEA 1URLA 2SEBA 5GSRA 4JVUA 5HGAB 5I8KH 3QIBC 1I1YB 3EDJA 3V79C 2FJFB 2DWEA 5KSUA 2W60B 3FMGL 5IKCB 4L4TD 2FGZA 4L4TB 1RPQA 3HMWH 4X5WA 4YHMH 1CXFA 4XCCH 5GGSY 4LQ1A 3IRPX 5D1XD 1V3MA 5I75B 1Z6JT 1I1AC 1K8DB 3L3GB 1OAUH 3DX8A 3LQMA 5IK3B 3TO2B 3QUZC 3RWJA 2NY6C 2V17H 2BXYA 5JR1L 1T3FA 5I17B 1NGXB 4EI5D 4QXGH 1SJEA 1VEPA 3UTQB 4NQCE 1KGCE 3PHQA 1ZHBA 5EUKA 3QSKB 5IVZB 4NCC1 4LK4A 3MNVA 2E7CA 3JV6B 3GMMB 3DVNB 5D4QA 2BHZA 1HCVA 4HUUA 1IM9B 3BPLB 3GBNH 1QFWM 1EMTH 2YS4A 3RVWC 4G8FB 5DUBB 1FG2B 4AMKL 1MI5B 4X4XA 4TVSa 4Z7OE 1FNAA 4PJ7F 2MNUA 4DW2L 3G5ZA 4LRIA 2ICWJ 4U1LB 1RUAH 3C60B 3ESVF 1E4XH 3LN5B 2QTEA 3T3PF 3PIQB 4XGZB 3U0PA 4DN4H 4YR6A 2ARJQ 5I1IH 3WHE0 5KZCB 1FAIH 3SJVB 1FBIH 3NABL 3JVGA 2OXGA 4YX2L 1N64H 4JG0L 4Y8AA 5E94B 4I2XE 4NZUH 4OFDA 5DD3L 3LHPL 3BE1L 4NO0A 4PJ9C 3NZ8B 4LSTL 5J1TC 2FSEB 1CFTB 3JVGC 1FE8L 1IAMA 3HLAB 2VLME 4DKFH 3GMRA 5ESQA 2KL6A 4UIMB 1E0OB 4JJHA 1ITCA 1G9MH 4WUKL 5EO0B 2AXGA 3IKCA 1JWMA 2VZVA 1Y18A 4NZTL 1ODAA 3HI5H 5KBNC 2X7LB 1WFTA 5F6HI 3FB8B 2V5MA 1DQQA 3BEVB 2F19H 4WHYG 1D5IH 3CVHL 3DOSA 1KIRA 3VXOA 1CL7I 3BDXA 7CGTA 5I1AB 4QF1A 1Q72L 3FCTB 5CEZD 1NLDL 1S9KC 3WLBA 3L9RB 5HHQB 4K3EH 5K59F 3W9EA 1ZXQA 2VDKL 3KPMA 3QO0A 2Z0BA 4KGLA 1H3PH 4WFFE 5E00A 2ILLA 3D2UA 1GHFL 4ALAH 1M7XA 2APXA 1YUHB 2AABH 1NGWB 2MCPL 4ODXB 2H2SC 1HDMB 4N68A 4K7PH 2NR6C 1B0RB 2EO1A 1MCNA 1QHPA 2F53B 4BSWA 5HDQH 3PV6A 5I8OH 2DTSA 2IQAB 4M6MH 1KEGL 1VSCA 1T7WA 4R4FH 4PLJD 3X3FH 4NP4H 4BQ6A 3FT2B 4L4TA 2DL9A 5FB8B 3F58L 4L8SB 3KWWA 4R7DA 5HI3D 1HWHB 1C7SA 1XGTA 4X9IA 3ARQA 3ZE0E 1ZSDA 4NYLA 3O2VL 1NBZA 4PY7B 2NY3B 1IGTA 1YEIL 4F3FB 3BN9C 4R4BB 4MAUL 2K7PA 4XCNB 1I8MB 3WS3B 3HG1B 1SY6H 5C7XL 1BD2E 3A6BL 5M94B 4HFWB 4Z95H 5FYKH 4S1RH 1F4YH 1IC4H 4MA7H 3T0WA 4D2NA 4XMLL 1QD0A 2FX9L 4JFFA 1PJ9A 1RIUL 1MH5A 1OGAA 4P3DA 2BXZA 1S9VB 4H1LB 5C1MB 4ZO8A 4JRXB 1F8TH 4HZLB 1HZHH 4OZ4B 4M7JL 3QIWC 3DTXB 2ADIA 1YN7B 3DBXA 3EHBC 1MAKA 1DN2A 3QUZA 3HA0A 4Y1AE 1YNKH 2YD2A 1QLEL 5DVKA 3MLSH 1VA9A 2ZUVA 1T0MB 3LQZA 3QXVA 2LE9A 4JPKH 2VYRE 3O0RL 3IFPA 4X7SH 2EXYC 4XNXH 5IQ7H 1T04B 4RMTA 2W65B 3RWCA 3U46B 3RWIB 2XQYK 4MXWH 1Q0YH 3SOBL 1CDCA 1S7QA 5TDOA 1WICA 4F9LA 5I9QC 1WT5C 1QVOB 3NFSH 1IGIL 2NY2C 3ARTA 1XIWB 4OFKA 3UAJC 2EDJA 5KANG 1CR9L 4EIGB 5DR5L 3MNWA 1N3NA 2EXWD 5GS1B 3THMH 3NACH 1MFCL 2MQCA 2V5SA 3SQBA 3Q6GL 5BOPA 2X10A 4HLZG 3LN4B 3C9NA 1LE5B 4ZYKA 4HBCL 1P7QB 1RK1A 3P0GB 4MJIB 2AK4E 3VXSE 2R69H 3ULUL 3FRUA 3QHFH 1DLFH 4G80B 1GRWA 2Y1VA 3QPQD 43CAA 3WUZA 1TETL 5C0JB 4TSCH 4B41A 2DLGA 5AUMA 5F88A 4F37F 3JTSA 1CGWA 2HG5A 4PGBB 2CK0L 2YWZA 5IHZA 2VXUL 3QWRD 3FB5B 3RVTC 1RZKC 3PDGA 5CSZB 2NY5H 5DGQA 2WBJD 4GBXC 4BFBD 1L0XA 1R3HB 3GKWL 2NY4B 1NCNA 3GBLA 1KOAA 3S97C 5AG8A 1IQWL 3GMQA 4HH9A 4FNLH 3SGKA 4YPGA 2Z35B 1JHLL 1FQ9C 4KKCC 3HI6L 2OP4L 3DMMC 3TIDB 2G9HB 5IM7A 2AK1L 4OQTL 4CDHA 3B9AA 5SWZA 5EFIA 3TT1L 4ELKB 3KPMB 4OZHF 1RUPL 1BF2A 3MJ6A 4ZFGL 4NO0B 3A6CH 3M45A 3BZFB 3SE4A 8FABB 2DBLH 5BXFA 2J6EH 1AD0A 5JZ7D 4APQB 3IU4H 4LIQH 5HXMA 4TTGA 1F4AA 3O8XA 1S5HA 4N5EC 4X6DB 2CJUH 3MRFA 2V6HA 2R1XA 5FYKU 1K9TA 1V3JA 4QHMB 5CUSL 5C0BD 4U1GB 1UZ6E 3V6OE 4Z7WE 4OF0A 3ARDA 3N9GH 5JPNA 4S1QL 2Y9RT 1EIBA 2W59A 5FYKE 1MFEH 3EOTH 4KROD 4FQQB 3RU8L 3TPUB 1DQQB 4KHTH 3EJYD 5GGQL 3R8BB 2D7TL 3WNNA 4HJ0C 1QFWL 2FATH 2ZG3A 5DRXB 4CADB 3WFHA 4QF1B 2AP2A 4X8JA 4RGND 2DYPA 4DZBA 1KXVC 1EEUA 3QQNA 1T22A 1T66D 5C86A 5E4EC 2YK1L 2W9EL 4KQ4H 1Q94B 1I9JL 4R3SA 3RUGE 2VDLH 2C4FU 4I0PC 1J88A 2HTKD 4C59B 3NGBC 5GJSH 2CLRA 2VDOL 5IBLD 5EOCL 2YPLD 4R96A 4DQOH 3O2DL 1CTOA 1UKTA 4HZLA 4OZ4A 4F37K 4M43L 4R7NB 4ODXA 3MOAL 1KJ2B 3QZWB 3N0PB 2UWEE 3U79A 5IT2H 3ZLQC 1DVFC 1RUKL 1ZVHA 2VLKA 2OK0L 4JO2H 2KZWA 4YBQD 4MA3A 2Z8SA 1A7PL 4X99B 3QEUA 1F4WL 1GVIA 2NXZD 2PO6A 1HH6A 1T20A 4JLRB 1U3HC 1EA9C 4B53A 5DJ2A 3TYGL 3LMJH 5C0BA 3RWIA 2VUYA 4UB0H 4UU9A 2OL3H 2P24A 1FLRH 4KDTA 1XGTB 5EULV 3MRHB 3O8XD 2X4PB 1CXEA 5ICXB 1IEAB 5IFAL 3DV6B 4X9FA 1G7LA 2CDEA 3R4DA 3HPLB 4S1DC 2GTWB 5D96C 4RFEB 4D8PB 1EERB 5FO8B 2X4UA 1GGYA 4BZ1L 2DYPD 3U9PH 2Q1EA 1S7XB 1CICB 2HFFA 2O61B 2FRGP 5EOQH 2DQJL 3QUXC 3AXLB 4RQQB 5D7JB 2QADB 4H1LA 1DUZA 3SPVA 3CDGB 2IC2A 3IB4A 3MLUH 4PB0H 3HZVA 4KK6C 4ZYKB 5JOPD 4Y4KA 3KPRD 4KI5C 1KELL 2WK2A 3BOVA 1NAMH 3F7QA 2H3NB 4LHUG 2BSTB 4V1DE 5F7KC 3SE8L 4KXZI 4IDJL 5DK2B 5K9OA 1W0YT 4X6FA 5T5FL 2DQEL 3FB5A 4M61A 5D6CA 1MCHA 2P8PA 1CFNA 2ITDA 3PWLB 1ZLWK 2FGWH 2XRAL 3GSUB 5D1XA 3K8LA 1S9YA 2AJZA 4L8BA 1IGFH 2ZNWA 3AMKA 5A2LH 1U2CA 3OKEB 1WVZA 5DC0A 3RWJB 1PAMA 1QEWA 4L8DA 3KG5A 5DYOB 3MRJB 3KPPB 4FFWD 3HAEB 4PP2B 5AZ2H 2IANE 1HIMH 4LIQE 3MODL 1TLKA 3FQRA 4LCIL 3RL2B 2NXYB 5EZLA 2L7JA 1DVFA 1CTNA 1G84A 3BZFA 1X4ZA 4NQCB 4XVJL 1L7TH 2BVEA 5E24E 1P7QA 1RK1B 2G5RA 4MQ7A 3CX2A 3P73A 1AXSB 1HHJB 4O2EB 5GIRA 2OSLA 3G6JF 2E7LA 4E0RA 2AKRB 3LKSA 2I5YH 1BMGA 3BH8B 2R0KL 2NY5C 1JPTL 4L4VE 1S8DB 5HYIA 4OFYA 3RNKB 1AY1L 3FN0H 4Q6YA 4Q9QL 4HKBB 4PJIB 5F6HJ 3WIHL 4HXAH 4DKFL 5FV2A 5FCSH 3C60A 3EIFA 1OP3K 1FFOA 5FA4B 3AGVA 4JFXA 3WSQL 1ZGLB 2R2EB 4MVBD 3U0PB 3G6JA 1G9ML 1B90A 2NZIA 4DGIL 1L7IH 3VFNA 3D39E 4WO4A 4Q6IB 2H8PB 3Q3GA 4ZUUB 4U6HA 3C6SA 1DUYA 1RIHH 2CRMA 1Y0LB 4W68A 2VXVH 3SGDI 1T4KB 2CKNA 3BGMA 3VJ6B 1X7QB 4HHAA 5KANI 2G9HA 5IM7B 1D5BA 4NKDB 4JFFD 4BZYA 2R39A 3VRLF 3RZWA 2IBGA 4G8EB 1N5AA 2A1WH 3MZTA 5IMKB 3BP7A 4ZUWA 4GG8A 2Z93B 4I48B 1BBDH 1JGUL 3LDBC 1RJCA 1HXYA 4H1LH 2QHRH 2AV1A 4LCUB 2Q20A 5KS9A 4PJIE 1Y18B 4ZSOE 1H3PL 1P9MC 1OQXA 1A7BA 1S9XA 4YHYC 1IE5A 2IAMC 4ZTPL 1QP1A 1NCAL 4LNRB 4NJAH 4L8CA 4PV9B 2G5BB 4OLWH 4CW1A 4KZDH 4JPVL 5D8JL 4DZ8B 3UTTB 2EYTB 3BFOA 5KSAA 1J10A 1SBSL 3G9VA 1A0QH 3BJLA 2AI0H 2A77H 3MJ7A 4UT7L 3MV7A 3D85B 2P8LB 2PR4H 1A1MA 1T0NA 1RVFH 2Y06L 1MFDH 2O5XL 2UY6A 4R4FL 4HDIA 5D7KE 3V5DB 3NH7L 1LO0H 4XP6L 2VDRL 3MRRA 2HJKB 3HNVH 3F58H 5FOBA 3BX7C 2WIIA 2ICEB 3OBAA 3H7BB 2D03L 4V1DA 4D9RE 3D2UB 3D2UD 3WFZA 2CSPA 1ULVA 5D9SB 2YPLA 5LBSH 5MHSD 4S1RL 3LKRA 4RZCA 4GKNA 1KBGH 1IZJA 1H15B 3MRKA 1Q0XL 3PV6B 5I16A 5JTWA 3LKPB 4PV8A 4S0TD 4XBGA 4XXCA 5LCVL 1DQML 4GMSH 1XEDA 4TVPL 5K33A 3P4OA 5E2WL 5IW6A 2XIDA 1KTLB 3QWOB 2QSTA 1M1SA 5FDYA 5DMKB 4QRPB 4TUKL 1LDPH 1Z9LA 4G5ZL 2B1HH 5CP7B 2VLRA 2P8PB 2Y72A 4ZUVB 2BMKA 1I9RH 2YZ1A 4ONFL 4QRRE 2A73B 1XCTB 1FYHB 1QBMH 3QIBD 1JHTB 3EO0B 1YPZE 3TBTA 1MCPH 1IEAA 1NPUA 4X7SL 3WIIL 2HLAB 1Z0MA 1FPTH 2HLFC 1FAIL 4X4ME 2HN7B 3NABH 1Q1JH 4PD4J 3ULVF 2F58H 2HJLB 4L4JA 5SWZD 4TUJA 5IVXA 5JHDB 3RVXD 1GC1H 5I30H 1IGML 5L0QB 3GGWB 4FQLL 3BPNB 4RQQA 4M7LT 1V3LA 2R4RH 3UTSA 2IQ9L 1MCFA 1GIGL 1T1XB 3I6LE 4NZJA 1Z2KA 4MQ7B 4EXKA 1BF8A 2Y23A 3L95B 4BK5A 4EQ3A 1IM3B 3QUKB 4QTIL 2X4TB 1LO3H 5IV2A 3MRDA 1A6ZB 4QRRD 1YY8A 1BM3H 4P4KC 3OKMB 4R0LC 3SJVE 1IEBB 5I0DA 1M4KA 5DRNA 1N7ML 3SDDB 4X6FB 3MQIA 3I3EA 2R29L 2WBJA 3ULUE 2EYSB 2APTA 3M1BB 3AUVA 1NEZB 3ULUD 1MCBA 2NY7H 2CK0H 2DMCA 5FGCB 2AJXH 2QSVA 3RJDA 1NLDH 2AJ3A 1MJJA 3QXTA 4YUEL 5BJTB 3D18A 1NCCL 1QSFA 3AU1B 5C0AA 4NFDA 1NLBL 2CKBB 5B3NA 4CL7A 3T08A 5LXGL 3ARZA 2E7BA 1JHLH 3OHXB 3VFWB 2BX5A 4M4PA 1HXYB 1NMAH 5EU7E 2JCCE 5BRZA 2VQTA 1MELA 4ZS6C 1VERA 4UBDD 1OB1A 1MCRA 1VPOL 4PJ9D 4YHLH 5D5ME 5H8DA 3MA9L 4MQXD 4I77H 3EGSA 1OHQA 3MV11 3IETA 2PW1B 4EN3C 4XPBL 5C09A 4Q6IC 3S96B 4ZS7H 4P2RD 5CD3B 3N06B 5EBWA 4PJGA 4UZGA 1A4JB 2HKHL 2IAMA 3E6FB 3MUY1 4HFUL 4HDIB 3DXAB 1EEQA 3HFML 1Y0LA 1SY6L 4ELMF 1RZJC 2C1OB 4HUNB 4QXWA 3RY6A 2PNDA 2A74A 1TVDA 5F1IA 4LLVA 1C1EH 4NUJB 1JGDA 2X4SB 2BY1A 2HFEB 3KR3H 3JTTA 2GFBA 3FT4B 3N85L 4WV1B 1T5WB 1T6VN 4OSUL 3LKQA 2E6PA 3VXTB 3PG2A 1I8IB 1MVUA 1WWWX 2E7HA 3O8XB 4QXTA 2APWA 3DI3B 4N9OB 2Y07L 4Q0XH 3C8HA 5JNYB 4U05A 3P30H 1BIIA 3WNMA 1MCEA 1MCSA 1KUMA 3QUMB 4WFED 4XBPB 1J0ZA 4A6YB 2NX5E 5CZXC 3VFSA 4F58L 5DA0B 4XNXL 1X5IA 2AGJH 5C6PB 5IQ7L 1N6QH 1ZT1A 4W6YB 2WUBL 3GSOA 1RSFA 4M93C 1RUKH 4RGOH 2VN7A 4MXWL 4PFEA 3SOBH 3JV5A 1WC7A 2AERT 3HE7C 1T5XA 4OGXH 1WBXA 2NY1B 4Q74A 3B2VH 3RTQA 5F9DC 3FONA 3GJFK 5DRZB 3PGDB 3NFNB 4PRBB 4P4RB 2GT9A 2HJKA 4XH2B 1FLRL 5L8LB 4J7RA 1WZ1L 4C4KO 2Y36L 1CGYA 4RAVB 1IGJA 1G9EA 4GW5B 4RGNB 5KVDH 2GCYA 3MRCA 4TOYL 1KJ2A 3QZWA 3SGKC 4MSWA 1KJ2H 5BZWB 4Y16A 2J7LA 3EYSH 3HRZB 2DQUL 1DBAH 1AKJB 4JFEB 2X9XA 3SKNB 4OM1L 1G6RB 4C55A 2FSEA 1UCBH 5DJ2B 5C0BB 4Z5RB 3TIEB 4YDJB 1SMAA 4YK4C 3D0VB 1BBJB 4I3GA 4Y1AD 2FHCA 3PABB 3GSVB 2RCSL 1FNEA 3LB6C 5E6ZA 4NRZA 3CXDH 3GSXB 4XAKD 1KPVA 3K80A 4NDMA 2VISA 5CBEB 1HH9B 3HTLX 5LGJB 1FFNB 1OF2B 2APBA 2VIRA 1HHHA 5D2NE 3G5YA 2EE3A 4LSTH 3UTPE 4EOWH 4CMHB 5HHQA 3AM8A 4P2OA 5EU4B 3BZ4A 5TDPA 3QIUD 3HR5B 4LARH 1EGJH 4K94H 5GGTL 4NZTH 3MODH 3GMMA 1X5AA 2J6EL 4DKEH 4ZFOB 1Z9SA 1J1OL 1A7QH 1FRGL 4PJHF 1OL0A 2VITB 4X7EC 5E4EB 1XGQA 2OM5A 4IMLA 4S2SA 1A6UH 3FJTA 3KVQA 2F5AL 1A22B 1YPZA 4XVJH 2BVYA 4HWEL 3VE0B 3MUGA 1RZJL 3TM6A 5HHOD 2H32A 1ZGLM 3FQUB 5EORH 4HKJB 4NQTA 1YN6B 1EAPB 2CDFB 2COQA 2FX8H 4R97B 3X11A 2B4CL 4QRUB 3RVTD 1A4JA 1TZIB 2IBZX 1LHZA 4JFOA 4HK0A 2V7HB 1NUDA 1RZ7L 2UZYB 4Y4HB 3QHTC 1INQA 2BNUA 9CGTA 4G7YL 2BNRD 1FGNL 1CFBA 1ORSB 4ZTOL 5C0AB 4PJBE 4XCNA 1I4FA 3UZEA 5EOCH 5BZDA 1CCZA 3X14A 2EDKA 4DFIA 4ZOCA 2YZ8A 3P73B 4KKCD 3VA6A 3NA9L 3RIFF 5HDQL 1U8JA 3KYOA 5I8OL 2RB8A 3BH8A 2R0ZH 1ZLUK 4RA3A 2W92A 3MLTB 4MMZC 5KVEH 1QHOA 4OFVA 4OFYD 4Z78A 5MEPA 3GI9L 1NGZB 1QFUH 1OB1B 3SGJC 1EFXD 2NYYC 4EKXA 3N50A 1DVFD 1Q9WB 1OSZB 4LDOB 1ZLWH 2LTQB 1ZT1B 1G7JB 1CGSL 4ISVB 3B5HA 1C7TA 3Q1SH 4O4YL 5AD0A 4U3CA 4GBXB 3VFTA 2YXMA 2J8UE 2P8MB 4OLWL 1F4YL 4ZQKB 3EBAA 1WBXB 3TZVD 3CMOL 3HI1B 1ZWIA 1KNOB 1NJ9A 1X7QA 2EDOA 3A6OA 5DRZA 1YECL 2X9WA 5J12C 4Z7WA 1DN0A 3UTZB 2BOCB 4BM7A 4EDWH 3CDCA 4BZ1H 4BJLA 1JHKL 1RVFL 2Y06H 1WBYA 1J1XH 1QRKA 2EDRA 5LWYL 5FKAA 2DQIL 3X3GH 4WFFD 4QRPD 5DJXB 5MP6H 3FFDA 3HUJE 5JOFA 3GHEH 4HJJH 1NANI 4KY1L 4XP9H 3QDGD 2DKMA 4XT1C 1FNGB 3NIDE 5DD5H 2HTKC 3FOMB 3K81A 2WV3A 1FCGA 4QXTB 3BUTA 4HLZH 4IM8A 4PRID 3SE8H 1CFVH 1YYMH 3FFCE 3G04A 5INCA 5DLML 2ZUTA 1MRFL 4HIJB 1IAIH 2X4NA 2IPUG 5JW4M 3ZE1F 3KWWB 4GAFB 5LAXA 4PBXA 2BVOA 1N8ZA 3H8NA 4KTEL 1QKZL 5BVPL 3EJZD 3Q2CA 1FIEA 3PE9A 3JBG7 4MNHB 5LCVH 3G5XB 1ZLUH 1I9EA 2GJ6A 1MIEL 2DWDA 3HNTH 5HPOA 5FECB 5FOBB 4NRZB 1G7IB 5EO1B 4UQ2A 3QEGL 4Y19A 1U3ZA 5L2KE 2VISB 5CBEA 1KTKE 1GZPB 4EUPG 3RBGA 1OF2A 4PGCB 1MH5B 2E7MA 4K3DH 3UZVB 4DVBB 5K9JL 3H9HB 1FORH 2J88L 4YWGH 1B0GB 2AXJA 2Z35A 3BZ4B 2PO6D 3QUZD 3GZKA 1AO7D 1FN4B 4EZMA 4FXGA 4N9GB 1P4IH 1KTDA 3L6FA 4O58L 1TPXB 1AKJA 5E7BA 4R8WH 2K1MA 2HH0H 2CDGA 2HVKA 2Y25A 1P1ZB 1XAUA 3P9MB 5KSBE 3P0VH 3FN0L 4JM2C 1KCSH 1W0VA 1AGFA 5I1DA 3L3DA 1N6VA 2JIXA 1ZTXH 5F93C 2A6KA 2R0LL 2NX5D 3EYQD 4X6EA 2CO6B 5F97E 4HG4K 3DHJA 2B2XL 4RDQG 3ESUF 1UM6L 2VLMD 1ZA6B 4AM0A 4PY8J 3FKUS 1P4BH 3TT1H 2J4WL 2Z8VC 5TE7H 3STLA 3SDYL 1ONQB 3ES6B 4OI9A 2OCFD 1TJHL 1T1WB 5C6WH 4UT6H 1N26A 1ZLSH 3KLHC 4LVHB 2E7LC 1UM5L 3VU2A 4NO3B 1MREL 4JM4H 4KUCD 2NY0C 2BVUA 4ZOEA 4MZ2A 4NC1C 2FX7L 3S5LG 1S5IL 5CUSH 1LEKB 4G9FA 3MO1A 3C6LD 2EC8A 1UM4H 5IHZB 5EBMA 1MFEL 5AEAA 1NCAH 4IJ3C 4FFVD 4KUZL 1YPZB 5E8NA 4PS4L 4ISVA 4F7TB 2VLKB 3VG9C 4JFQA 1K5NB 5BQ7A 4C56B 2BVPB 2NMSA 5ILTH 3HCVB 4PJXB 5FUCE 3F7YB 4JM2B 2VJXA 5D2NA 2YK1H 3X11B 4N8VA 4MVBC 1ZWIB 1WF5A 5E9DD 2D03H 1YN6A 5C3LD 1X5FA 4AT6A 1TQBB 1ZEAL 1LNUA 3TJEL 2YUWA 1X9QA 2H2PD 3TBYB 5FYLH 1NKOA 5DMGC 3U1SH 4GAGL 1JZ4A 1QNZH 1NBYB 4RA0C 5BV7L 4Z76B 2I07A 3H0TB 1Q0XH 4ZUTA 1SJVA 1F4WH 2DIBA 4XVSH 5F7NC 4HUKB 3MRBA 2YC1A 4C54A 1XR8A 1N5YH 5KS9F 2CGRL 4Y4KB 1ZK9A 3MNZA 1RIVH 1UYWH 4LSSH 2YKLL 1FZOA 3I6KB 2BSRA 2FBJH 2ICWB 5DF0A 4OQ1A 4NQDA 2NR6D 2UV3A 5L2KA 4LDLB 1JK8B 5K9QI 3ILQC 4M00A 1JYNA 4GW1B 3P30L 4YDLB 2IAMB 2IAMD 2FB4L 3BDYH 3E6FA 3FQTA 4GRMA 3WO4C 3MLZL 4E5XB 4HF5L 3WFHB 3CC5A 2EH7H 4KI5F 4NKIH 4ELME 4I5BA 4OD1H 5T3XE 4K3GA 4LCCB 3ZDXE 3QDGB 3SDAD 2VZ1A 4KHXL 4MDIA 3ZDZF 4BH7B 1IC1A 5CZKA 2GFBB 3FT4A 1YEEH 5D1ZD 4ORGA 4M5YH 1GC1L 3GSWB 1MOEA 4P9ML 3VGFA 3GMPA 1K8IB 1M6OB 1BQHG 1KACB 3QO1A 4AH2B 5F9WC 1VKXB 5IB1A 1FYTB 2EEBA 5JDJA 2G60L 4MHHI 1ZVSA 3CCHA 1JPST 4KMTH 4DOHB 4KJPD 2Y36H 4RWYH 1BJMA 4YLQT 1BVLA 4RGMC 1BM3L 2E6JA 3U0WH 4PTTB 3MFFB 4U2ZA 3QUXA 4E9LA 5JXEC 4DGVH 2VL5B 4HWBL 4YXKH 5JW4N 1VGKA 4NBZB 2A6KB 2QQNL 2FIKA 4M7LH 1JWMB 1NCTA 4JO3H 4JPWH 4JDVB 1V5JA 3CFCL 4WI7A 1F90H 5J89A 3KPTA 5DJZB 1UWXK 4X6DE 3TZVA 1NCCH 5CEZH 1Q8MA 1HSBA 1ONQA 2H8PA 4YBLB 4X7TB 2YEZB 5T33L 1NLBH 3ULUF 2DRUA 4ZFZA 2ZUQB 1L7TL 1E6OL 1KB5L 5HDBF 3AROA 1U8HA 3AFLA 5FK9B 1OD7A 3PP3H 5TH2B 2A83B 3J8F7 3JWDH 3QG7H 5EU3A 2NX5B 5F6IC 4HPYH 3QPQC 2AW2A 1C16B 1T6WA 4WWKA 4G9DA 1LEKA 5E00B 1A9EB 3NCFB 1X5HA 5DK2A 1A14L 1FDLL 3KNBA 5T5NG 4JKKA 1NGWA 1AFVH 4Z7NF 4N0UB 4XPFL 5HPMA 4CMHC 3MROB 1KB9K 1U95A 1FL6A 3C8KA 3V8OA 2XN9A 5ENWB 4MJ5B 1S9WA 3AVEA 1A7QL 1FRGH 2IQAA 3OKEA 2BFVH 2BRQA 4NDMB 4XXCC 2VXVL 1EO8H 5ICZA 5E99H 3GSRA 5F89B 3SQOH 3KPPA 2VAAB 35C8H 3DRTA 2EDHA 3QUYD 4FABH 1BREA 1YMME 4FS0A 4OUUB 5E5MB 4OT1H 4DWHA 2XKNB 3N1GC 4JDTL 2ZCHH 5D7JC 4MLSA 1CFSB 1JF1A 4HWUA 3UC0H 1IGTB 1KCUL 1CICC 1JGUH 4OAWA 1DVFB 3MRRB 2QHRL 2BP3A 2FR4A 1RZ7H 3N85H 4J3OC 1ADQL 43C9A 1KLUB 3W0WA 5I1JH 4JO4H 4OLVL 1FZJA 3TA3A 3W82A 3SDCB 2Y5TA 4BQBA 3JWDC 3ZE0F 4E0RB 1RUQH 3WL9B 4ZTOH 4IMLB 4LGRB 2GY5A 4L3EB 1H3WM 5FUOH 3MXVH 1INEL 5D8JH 3REWA 5TGBA 5ID1B 4HULB 4Z7UA 1JI1A 1YEKL 5CEXB 1A0QL 1YN7A 2DQTH 1JGEB 4UT7H 2AGJL 3M17B 1N6QL 3GO1H 5CAYB 3QP3A 2EC9T 4JY5L 3HE7D 5T1KB 1JNNL 3OMZA 2ESVB 2W9DL 3B8SA 1BJ1J 3V0VA 1OCWH 4KKBD 1KTLA 1B4JH 4N0CC 4EUPH 1YEHH 3UBXB 5B39B 4G8GE 1INQB 5HYJD 2R9HD 1T4KA 3MV8D 2I25N 4BH7A 3LEVH 4XB7A 4G6FB 2NNAB 4M48L 4JB9H 4JR9L 4OI8A 3IDGA 4KRPD 2JK5A 2QSCH 2WAHA 4RGNC 2FEDC 1VFOA 4F7CA 3QXAB 1KJ2L 3CVIH 4MDJA 3DO3A 2DQUH 1ZT7B 2VLKE 3HMXA 4JJ5B 1AD9A 4Z76A 4KGJA 3WMSA 2AJUH 4O5LH 2ADJB 3AM8C 1EH9A 1LO4L 4CUCA 1UCBL 3QJHB 7FABH 2IANB 1I9RL 4MA8L 1TCMA 3QISA 3QUMH 4HUUB 4XAKE 1MJ7H 5CEZE 4HGWB 5L2KB 1X4YA 1NCUA 4GW1A 5MERA 1BEYH 4OCWL 4JE4B 3CPLA 3VFRB 3UJJH 1JN6B 3CXDL 4PUBH 4H5SA 5GRUH 1AGCB 2YOCA 3BPCA 5H2BB 2CRYA 4JFEE 3LB6D 3CFDB 1FIGL 1IGMH 4RGMB 1UKQA 3O8XC 1U42A 3I2CH 3DNKA 2Z31A 3ZKNC 1OTSD 2IQ9H 3WNLA 5DSCA 3WFCL 1M7IB 3HAEG 4AY0A 1FNGA 4NQDD 3LKRB 4GAJL 5T3ZH 4P9HC 1JTTA 4P46B 3RZCC 1BFSA 4LARL 2GAZB 2DD8L 3FQWA 2F5BH 2OS7A 4R4ND 3OAUH 1BZ7A 4TSBH 4TPRL 4N5UA 3CCHB 4KK9D 2H1PH 1QSED 3O6ML 2ZUWA 5ESQB 2AEQL 2XA8L 1W8OA 1EFXB 5SWQA 5BRZB 2CPCA 3BD4A 4WJ5B 4P3CL 2V2TB 5D7LB 1LWRA 4MS8D 1TQBC 2OYPA 4XP1H 3MMEA 1XGPA 4QKXB 4AMKH 3BYTA 4M6OL 2OMNA 3FB6A 4CJ1A 5IHBA 4BA8A 2ITCA 4RAUA 3FFCB 3QQ9D 1AI1H 2ARJB 3MRQB 4HIIA 4LMQE 1MCQA 4WHTB 4FQIH 1HXMA 2V5TA 5TFSL 5KSVA 3BHBA 1F13A 4AQOA 3MV9B 2J8UA 1NMAL 2V2XA 3MFGB 3ZHLA 1FN4A 43C9B 5GISL 4DUVA 1KTDB 3TA3B 1MIMH 4FP8H 1G7PB 4DN3H 1G1YA 3BE1H 2EKJA 3DSFL 2BVTA 3LKQB 4UT6L 1HHIB 2VMFA 4K8RL 1J12A 5CJBA 4MAYC 4HZAA 2JIXB 3VXMD 5CEXA 4JM4L 4G42B 5F96H 2BC4B 3QQ4B 3RY5A 3J7HA 2DM3A 4CMMB 4PJDB 2WBKA 3FOLB 1JI2A 3MBEC 3QUMA 2OBGA 5T5NF 3UO1L 1JPGB 1J8HB 4M1DL 4Z8FL 3EOAB 3CH8A 1T20B 4L3CB 2IF7A 3PWJB 3CVHH 4UV7H 4P2QA 2MWCA 3I84A 3O9WD 5IOPA 3RUGA 2XTJD 3KPNB 5GGTA 3BSZL 3HG1A 5J1SC 2HWZL 4ZNCD 4M6AA 5AG9A 4URTB 1YA5A 2PYED 2GHWB 4OAWB 3SCMB 3HPLA 4BELD 4AIXA 2Y07H 4N0RA 4HJJL 2P46B 2ZZUT 2W0LA 4RFEA 1C5DA 5FO8A 4Z9KB 4XAWL 1FJ1B 1VEOA 1CXLA 4HIXH 4G9FB 1L9MA 5A3IC 3D25A 1A7OH 3WL9A 1TPXC 3B2UD 2NY3C 1IEHA 4GLRI 1F3JA 4MSWB 5ESVA 4HW6A 3BP4A 3CLEH 4XX1G 4PJBA 3IDYC 3REVB 4WGVB 3LS4L 2F53A 1K4CA 4S1SH 4GRLD 4UDTA 1YY9C 1QKZH 1F3DH 1NAKH 4J4PD 3GIVA 1MIEH 4A2LA 3FO1A 2DQHH 5I19L 1FNHA 5L7XH 3GSNL 4QWWD 1BZ9B 3NN8A 1Q9OB 4JKMA 4AT6B 1G9MC 2EEDA 4G7VH 5IWLC 2YA2A 2DJ4A 1ZLVH 4L8BB 1DBJH 3T0DA 4X6CA 4NN7B 2EIBA 3QIBA 4JQXC 4Z0XA 1WZMA 3BH9B 4LLMB 4PLJC 4C83B 4NT6A 2RHEA 1MAMH 3A6BH 1BVZA 4DVRH 1MCLA 4XMLH 5JOPE 2AK4B 3VXSB 1CD9B 4D9QE 4OFIA 1U6AL 3IFOA 3TESA 3BZDA 4PJAB 2NXYD 1CE6A 4M62L 2NXZB 3L1OH 4LCWB 5HGBA 1JK8A 1MCOL 4HWZA 3C2SA 3DXAD 1QLEH 1ZKAA 4ODSL 2Q86A 1HHJA 4O2EA 3T2NH 4RWYL 3BGFC 3RPKA 2XTJE 4JHZA 3IDIB 5HVHB 2R56L 5C0GA 4YQXL 1KCKA 4MQTB 4JEGB 4HUVB 5EZJB 3MV7E 4CJ0A 4OF8A 1R3HA 1CF8L 1KIQB 4DGVL 5ITBL 5J12B 1P4BL 4S0SD 1S3KH 4J8RA 1Q0YL 1ERNA 4O2FA 1HKLL 1QVOA 4N8VG 1QSEA 4QOKA 4RNRB 1XIWA 3MRGB 4JO3L 3KLHD 4GW5A 5CS7A 4DUXA 4AH2A 1JMZA 2ADFH 3AS3A 5J7CC 3WJLA 5GGTH 1S7WA 1JWSA 5SX4I 3CSYA 4QLRA 3MLWL 3ORJA 1IC5H 3THML 1J1OH 1LK2B 5FA3B 5E6IA 4OFPA 2VDMH 2NY2D 4FTVD 1A02N 4HS8H 4JY4B 1YYLH 3QCUH 3MYJB 5SWSB 3RVUC 4PIRF 3LKNA 4QOKE 2WWKT 3F8UB 3OB0H 3U4EA 1VGKB 4KUZH 5KVFL 2A6JA 4YAQB 4APQD 2VZOA 4Y2OA 2R1XB 1PX3A 3GI8H 4NNPL 1UA6H 3PJSB 1F02I 1MHEA 4G6KL 3TVMD 3VRIA 3VXUB 2AJVH 3BPLC 3MLRH 2H32H 3O6KH 4OCYL 4KTYA 4XPFH 1MCIA 1OAYH 1JV5A 1R3JA 3MCLH 4JG1L 3WIHA 1HH9A 3HPJB 1Z5LB 3JV4B 3SKMA 3QXWA 2IG2H 2VLJA 2X09A 5FXCH 3QI9D 3RUGB 2BFVL 4P57B 1A5FH 4WHTA 4ZQKA 5BRZD 1FL3A 5EU4A 2JJWA 1FC2D 2CUMA 3FB7B 4JRYE 3L7EA 3MGTA 1I1FA 1BQHA 3QDJB 2J8HA 2BHUA 3D25B 1FFRA 5I2IA 4IIQC 4NQSB 2YPLB 2NW2A 3MROA 4GO6B 1N5YL 2EIZB 5BXFB 3B2UC 4LSSL 1A1OA 4HV8A 3Q0HA 3ILQD 2YD5A 1P7QD 3I6GA 3LQAH 4UUJB 4P23B 3S4SG 3B3IA 5DHXB 1YPZF 2C1PA 2ESVD 2V9RA 4RGNE 2VE6A 1CVSC 3IDNB 5GGRB 4HIJA 1S7RA 3Q5TA 3CFEB 4KRNA 3MREA 4JRYA 4YHML 1OT1A 3AREC 4K3HA 4I0CC 2DQTL 5IEHB 5D1QB 2XXCB 5ICXA 2IH1A 4JQVA 3NCYP 2P5WE 1XCTA 1F5WA 3EYOB 2CRIA 3LN9A 5T1DH 3TO4C 2Q76B 3DETC 2FR4B 2PXYA 1AQDB 1EX0A 2X4UB 5CP3H 3KPRE 2N56A 4NT6B 3VWJA 2Z9TA 4KQ4L 2AJSL 1I9JH 3BKML 5C0CD 2OL3B 3E1F1 1AGEA 4ERSH 5DJAA 3ELAT 1LGVA 3H9HA 2Q87A 3E3QE 4RAHA 4YIQA 1A47A 5GRYA 3REWB 5IVXB 4CGTA 2FWOA 5KSBF 1HK6A 3T3ME 3M17A 2VDQL 4XNUH 4DEPB 4KTEH 5C8JA 1FFPA 1FH5H 4GS7C 5C0DB 3O9WA 5IT2L 3REVA 2Y6SD 3K3QA 1FVCB 4I0PD 4X99A 2UWEB 3E3QC 3OQ3B 1IM9A 3T3PE 2IH3B 1JP5A 1A7RH 1IQDA 1P7KA 3DUUA 1QR4A 1A9BB 1U3HB 3P9MA 2W60A 3D9AL 2IEPA 1I7UA 4LLDB 2WWMD 3FQNB 4K7PY 1PEWA 3KPQB 3S37H 4NC0B 1YMMD 2ZJSH 3MJ9A 1YEFL 4EJ1C 1FORL 4GXUN 4LVOC 1NL0L 4FFYL 2PXYD 1QSEB 3O2DA 3BD5A 4YBQC 3ZL4L 2DLFH 1XF4B 3TFKC 1RZGB 4LHJB 4HKZB 4M93B 2MSPA 3TWCL 4GQ9H 1MRCL 4XHJC 3H42H 5I1LA 1DE4A 5GRUL 3QB7C 4LVNC 3TO2A 2FEEL 3ZSSA 4JZNB 3LEXB 3QDAA 1E28A 3AS1A 4LHUD 3JWDL 3PDOA 5GGSA 3LIZL 4J1UB 4JKLA 2O26U 1CLZL 2CKBA 4OF7A 4G6JH 5JW4R 4PB0L 4JY4A 5DZNA 5GGVY 5IMMB 1ZHBB 1P6AB 1QBLH 5H94B 3IKCB 1T1ZB 3MZGB 3QFJA 1JN6A 3GDBA 5C0CA 3SO5A 4Y5YC 1PY9A 1AGCA 1D5IL 1SHMA 3VXQB 3W39A 1WWAX 3I75A 2FJGB 3VXOB 3KDMA 2GSIB 1RZIA 3FCTA 2A2QT 4WHYH 5EU5A 3QRFM 1CIDA 3UC0L 2X4QB 1CIUA 1WUNT 3MRJA 1FNSH 2OTWA 5HY9A 4PJAF 4KJWC 4TSAL 3HS0B 2EXYD 3T0AA 1GHFH 5MEQA 1LK3L 12E8L 4JM2F 3IJYB 4GG8B 2MCPH 4G8IA 1MCWM 2HVJA 4NQCA 2ICES 3MXVL 1QO3A 3GJFB 5JIPA 3D48R 5J11C 1NCDL 2D31A 4LEOB 2VZSA 5E5UB 1V7NL 5GIRB 3VDAA 4XNZB 4NKMB 5C9JA 1UACL 5I1GH 2NY4C 1CBVH 1SYSA 3NCCB 1KEGH 2R0KH 3E0GA 5IJVB 2X4RB 3E8UL 4O9HH 4FZEH 1MHEB 4Y5XC 3P4NA 2MTPA 3IJSA 1UJ3B 5E08H 3W2DL 4JCMA 1S7SA 4PRHA 2I26N 4NN5C 5DZLA 3RNQB 3QR2A 2C3HA 3DURB 3ARED 4J3WA 2P5EB 3ES6A 3LEVL 4W70A 3SDCD 1NBZB 4PY7A 3V5DA 1DQJA 4Y5XA 1NCBL 4K55A 5ACMA 2DDQH 3PUCA 1WV7T 1OW0A 3QNZA 3P40A 2A9NL 4Z8FH 4GAGH 5FEBA 2QHLA 4I3SL 5GHWL 1U3YA 3B9KB 4GOSA 3MJ9L 2XPGA 4R0LB 4XH2A 4AIZA 1ETZB 1VCAA 5I66B 1F8TL 2HWZH 4KK5C 2ZOLA 4H8WL 3QIWB 3VA2C 1R3IH 3IFNH 1T80A 3ZKMD 5KG9B 3PL6D 1BOYA 5C0DA 3VG0H 1HYSC 2P1YA 3DUHA 1XCQA 5DD0L 3I6GB 1MJ7L 3LQZB 1LVEA 4X9GA 3ZKXB 5EPMB 2BVPA 1DEEB 3ARDC 1IGYB 3PWUB 2G5BA 1MF2H 1B6DA 2VR9A 1BEYL 3MSPA 4NJAL 1VFUA 4OCXH 1I7UB 4HIHA 1NUGA 3VWKC 6CGTA 1G7QA 2EDXA 4S1SL 3TZVC 2X9YA 3SDDC 3P4MB 4RBPK 3MJ8A 5KSAC 5E8DL 4MA1B 2AI0L 1HWGB 4NYLB 1IGIH 4EVNB 1A3QA 5BOZG 2X1QA 1CLCA 4DKDC 4U33A 5KOVC 5FUCC 1UVQB 1T7XA 4R4BA 5DXWA 4KDVA 4PRPD 4M8QA 5IB3B 3H7BA 2QL1A 3ROLB 2N7AA 2YMXL 1CT8B 5F9JB 1OTSC 4QYOA 5EG6C 2DLTA 2F9BT 5HYSG 4K71B 5L0QC 3MRBB 3VFVB 1DBJL 2CQVA 5KZCD 4YIQB 1YNTB 2R23B 4HAGA 5DJ8A 2JTDA 4ZOAA 1YMHB 2BNQD 4ZXBA 2ZCKL 2EZ0D 4DK3A 4I13B 4POZC 1YY8B 1FNLA 1G1CA 1BAFH 4PBWD 3JTSB 4X6DF 1G7HB 3UMTA 4S2SB 2X1PA 5HGGS 1NCWH 4LLDA 1KCVL 1A6WL 1FSKB 2LU3A 4ZSOA 3KGRA 3EO0A 2PTVA 3I75B 4QT5B 3T2NL 1IQWH 1HEZB 5HYJA 3UDWC 4NO0D 5EH1A 4OUOA 4HH9B 1U8NA 1IMHC 4YPGB 2VRAA 5DK3A 1GOFA 5ADPL 5D5MF 4LHUA 2E8ZA 1CU4L 4JGUA 1CE6B 2F54D 2B1AH 4DAGL 4MD0B 4WW2F 2M1KA 1A6TA 4OGYL 4TUOB 1KLGA 3MX0A 4MQSB 4YFDB 3H2WA 4K7FB 1X5YA 5DFWH 5DQDL 5F1KC 3AB0C 4XNQA 5CZVH 3PHOA 2E6QA 3SGEI 1L6ZA 3KYOB 3TP4A 1FSKC 2FO4B 3MXWL 4B7IA 1FHGA 1EO8L 2R2CA 3RL1A 5E56A 1U93A 1IEBA 2O5YH 1ZHKA 4F9PA 4M5ZH 4I0PA 1K2DB 3CVHA 3V6FB 3W0WE 4LSDA 3QNYB 1HE7A 2C3XA 1NBQA 4M1DH 4FABL 2BVQA 5IHLB 2D4DA 1QA9A 3BUYA 3OKLA 4OLXL 1EEYB 2JJTA 3ZSTA 1QBBA 1A4KA 3ARVA 3U6RA 3JWOL 4D9LH 2P5EA 3OKDB 5F9AC 4YHYB 1I3VA 4ONGL 3BSZH 2AJXL 4X8JB 5DHYB 5SX5K 4EDXB 4OLVH 3RIFK 2JB5L 3WJJA 4IDLA 2FD6H 4JG1H 4OZGB 5E94A 1RUQL 3QI9A 4BQCA 2DJUA 4HJGA 2IG2L 4I0KA 4XAWH 1ETZA 1INEH 4WWKD 4BSVA 2MHAB 1A5FL 2DJSA 1A7OL 3W5MA 1I8IA 2FEEI 4IOFC 3GRWA 3RDTC 1JUFB 4YHIA 3BWAB 4XCFH 1KC5H 1PGRB 4JFDE 4GG6B 4YEFA 1CDUA 4CVUA 4APQA 1NC4A 5F1OB 5GRZA 5JXAH 4X6DA 2P5WB 2LFGA 3ARGB 4G6AD 3IETB 2B7DT 2ZUYA 3TNMB 3ARDB 1I1AB 2DQHL 1SM3H 5L7XL 1SJHA 3LQAL 1MHPL 4PRHB 5JPMB 5I1HL 4GKZB 2IMNA 3U7YL 3OR6B 3PWPE 3GUTB 1JZ7A 3O11B 2DI9A 3L3JA 3G5XA 4CADA 5I8CB 3WV0A 2ZCLL 3NFNA 4YHOH 4PJ8C 3TBSB 5TQ0L 1XF1A 3HFMH 2AEWA 3QPXL 3DGCR 4F57L 3RPIA 4NUJA 5D70L 4JREC 1MCDA 5IGXH 1ES0A 3T2OA 1LO4H 5T1DL 2MCG1 4U1NA 5IG7A 1W2KT 3VXTA 1X5KA 3EUUA 3F5WB 3D0LA 4WW2C 3L1OL 2YR3A 4IHOB 3I9GH 4H0GA 1H3UA 3VXRB 1W72L 4KK6D 4MJ4A 1BIIB 4Q0XL 4AK1A 2Y7QA 1IC7H 2QADC 4ODSH 2M2DA 3ULVD 2ESVA 2HP4A 1UJ3C 5D2LB 2DQEH 2FJHA 3MR9B 2W0FB 2EDLA 4ZODA 1KEML 1W72A 3NVQA 1PBYA 1W0WB 2GJ6D 1G7MB 2CDGB 5D1QA 2VNCA 1V8HA 4M1GH 2N7BA 5HDOA 3WCYA 1OTTD 3ARYA 3TCLB 3CX5K 2M26A 3L3DB 5J0BA 3SE3A 2RJMA 3WFCH 5ISZE 5J11B 4QHLA 4N0UE 4LCWE 1U8NB 1QSFD 3PGDA 4KKNA 2YUZA 2APVA 4JFFB 4PP2A 2OL3A 3JSSA 4TSBL 4XXDB 1FV1B 3P0YL 4RAUB 1YEFH 2VXSL 3ROLA 1HINH 2ZSWA 3IT8D 4IRSC 3O3UN 5EWIL 2FWOB 5HGDA 4XNYH 4PJGE 2H26B 3BQUC 4XX1E 4Y16B 4ZO6A 3LV3A 3HZVB 2P49B 4U7KA 5DJ8B 5K59E 2BOBA 5JQ6H 1MJ8H 1UXSA 1XGQB 3KXFD 4X7FC 3KPRB 3LIZH 4XI5C 4NNPH 3RL1B 4Q9QH 3NGBB 5J6GA 4I0PB 4J3TA 3GK8H 2C3WA 4YDJA 4WNQB 4KRPB 1OGTA 1QBLL 1AI1L 5CHNB 2BNRE 3I50L 4LQFH 2F54B 4WRLA 1DDHA 3RVWD 4Q6IA 1XF5B 3CXHJ 3OXSA 3GSXA 2EDQA 1J05A 3HCVA 4PJXA 5DHYA 1CDHA 4OTXH 1PYWA 1RMFH 3IAQA 4X6BB 3PGCA 4XPGH 5C0IB 1IGCL 4LOUD 5INDB 2VXTH 2P45B 4U3XA 1DBML 3U2SB 1G9NH 1DEDA 3SBWA 1HQRB 2P7TB 4LVNB 3QA3A 3V5KB 4C58B 4G8EA 1J0IA 5GJTL 3C6LA 4WWKC 3EOYG 2WZPD 5DQJB 4KK8D 4XPTL 1NH6A 1T2QH 3ZT5A 4L3ED 2VZ3A 3UPAA 4DKEL 3MGAA 3UO1H 1RURL 1S9XB 3QAZB 3R1GL 1SMOA 4X0KA 1A6UL 4OZIA 2BSED 1U8KA 1NCDH 1P4LA 1KENL 1RZJH 3HE7B 3FB6B 2FJGA 4AEIH 2W0KA 2BVQB 4R2GD 1I7TB 5I1GL 1KJ3H 5I76B 3KPSE 3OKLB 5HHOA 3QUYC 2QV2A 4UIKL 4NPYB 2P8MA 2RIKA 2DWEB 2IGFH 1LO5B 4HK0B 1TZGH 2B4CH 3BP5A 4MCYB 1I1RA 15C8H 3C6SB 3UP1A 2JB6A 3SY0A 4WO4D 1U58B 3NZHL 4HIEB 4HIXL 4Z18A 2ATKA 3IXTA 3HC4H 3DI2B 1ORSA 2AJSH 3RHWF 4QGTA 4RISL 3NFPA 3C60D 1JGLL 5JOFB 2GYSA 3X14B 3L3KA 2VXQL 4I3SH 1UT9A 4ZXBC 4JFYA 5HHNB 2BCKB 4I48A 2XN9E 4RMUA 3QO1B 2IFFL 1VKXA 1NGXA 4UTAH 1PG7H 1AGBA 1BOGA 2GW5A 1F58H 5INCB 2VUOA 3P4OB 5IESL 2HA1A 1CE1H 4GUPB 4FQQA 3T0EC 2QADD 4HS3B 2EICA 1A8JH 1LDPL 3E6HB 2Z91B 5DMKA 5CKAA 2CLZB 2Y5EA 3HZYA 2EYTA 3MRPA 2VKWA 5D7SH 1ND0B 5E5RB 4MJIE 2ZJSL 3AREA 1XIWC 1S7TB 3P11H 3PQYA 2QBWA 3WIIH 3WYRA 1I85A 4FN0A 1MI5A 4X4XB 5D1ZA 2BSSA 2HLAA 5CGYC 3OGOE 4ZO9A 1D6EB 2R4SL 1YECH 3RWDA 2JKXA 2WIIB 4EDWL 1DLHA 1R5VB 2LV4A 1IAKA 1AO7B 3MRGA 4FQLH 5EA0L 4WW2A 1XZ0B 3BYYA 3JZ7A 1TNNA 1FFQA 4J6RH 1UWGH 4ZFZB 1S7WB 1ED3B 4H88H 5F21B 4ODUB 1BGXL 5JUEH 2ICWI 3H9SB 1BFVL 3BVNB 4A6YH 3HZMB 2BY3A 2XACC 1CFVL 3B9EA 3QIWD 4FQ1H 4TTDC 3T4YB 5EU6B 5I1DB 1NMBL 2GJZB 2X4PA 5HPMB 1F6LL 4ACPA 5EO0A 4CVZB 4P49A 2XQBH 4YFLF 1PZUB 4TNWK 3QXDB 1J86A 3GKZA 2ZUUA 5DJ6B 5FAAA 1FNSL 3QFJD 4HSQA 1KCVH 3SDAA 3VI3F 3RDTB 3QH3B 1NANH 2VAAA 4FQ2L 4XXDA 1OSPH 1ACYL 2GJ6E 4LLWB 4K9EC 1V05A 3QNXB 5E1HB 3HUJF 3MLVH 1S7VA 1DBBL 3SO3B 4L1HA 2P48B 4CU8A 1KJMB 1QBAA 5A2IH 2D7QA 3GI8L 1KLUA 1PEZA 3W0WB 3MGTB 4HPOL 1NC4D 3MV9D 4WUUE 4YE4H 4FG6C 1FVDA 4X7DC 4R4NC 4WUUD 4R8WL 5HYQB 4X5XA 4FZEL 4QY8A 4OBSA 1W0VB 5TGBB 5ID1A 1A1OB 1KCRH 3CDYA 3L3OB 5F3HB 1KIQA 3V52L 4YHPB 2RFXA 3C5SB 4FQXB 4JQVC 2WBJB 1TVHB 1XGYL 2PTUA 2HKHH 3X12B 1IILE 2GTZB 5CWSB 3HAEA 1A21A 5FB8A 5IEHA 1J1PH 3D39A 5CINH 5B39A 3PP4H 2IH1B 3BN3B 3D18B 3BWUC 2XKSA 5TE7L 3KR3L 3H3BC 3UYRH 1ZMYA 3D6GA 2P5WD 1T03H 4PJFB 3Q6FA 1BP3B 1T1WA 5CLTA 4WW1A 1FVEB 2QSQA 4N0FA 3F65A 4HFWA 2JB5H 4H8WH 5DD6A 3HC0A 5FHBH 1AXSA 4B5EA 4QGYA 4QXUH 3H0TA 5C0AD 3HRPA 1UWEL 4B7LA 3QXAA 4UAOC 2BJMH 3DX7B 5FF6A 4LPWA 5SWZE 5F1NB 1X5XA 1BX2B 1FFOB 5FA4A 2YHGA 4A6YA 1FZOB 2J5LC 5C8JB 1U8KB 3WNPA 2Z91A 4L9LB 5DMIL 5KSAD 2UUDK 1T0MA 1FVCA 1V3KA 2PCPB 4PGEB 4FQXC 3U4BH 3C87A 3MBED 2WW8A 5CD3A 5CFHA 5D2NB 5J13C 1QPPA 5ILTL 4PTUA 5HHVL 1A9BA 1U3HA 4M8VA 2AXFA 3VXNA 4Y5VA 1A3RL 2YSSA 4PJXE 1R0AH 4LFHD 4V1DD 4AYFA 3L7EB 4X9BA 5F1IB 1DLHB 3QRGL 3MACH 1D5XB 4TOYH 1R3KB 4P5TC 5DFTA 5KVGH 1FH5L 4PJCF 4OV5A 5ANME 3KPSD 5E1AB 4ODUA 4OZIF 1ZVSB 5D70H 1XF3A 3VCLA 4CN4A 1IAII 4JPIA 3DX6B 4ODWA 4BUGA 5DEFB 1A7RL 4Y4FB 3HG1D 1KXTB 1IKFL 1HILA 1F45A 5C07A 4XC1L 5AYQA 3MFFA 3MREB 1HZHL 3MV8B 4HWBA 4PRIB 1HYSD 4MNGB 1HCFX 3GSNB 2X05A 1XMWA 5ETUB 1A6WH 1RY7B 3OAZH 3GSVA 1D9KC 1F3RB 4MD5B 5ANMA 2D0HA 2DI7A 2QQKH 3OKOA 4J3UA 1MRCH 1OY3B 5AAMA 4PJCA 1S7UB 4U7MA 4PJ9A 2I9TB 4LSVL 2EECA 1FO0L 1T7ZA 1XF2B 4XB8A 3C5ZD 3CD4A 4NIKB 2GSIA 1VEMA 5LGHL 1AXTH 5EZIL 4BFGA 1WWBX 4XC3L 2HMIC 1DANT 4DAGH 1LEGB 4YNYB 2Z4QB 3CMGA 4RMSA 5DTFA 2DMBA 3BHBB 1TVBA 5TH2A 5L2JA 6FABL 2NXYC 5DR5H 2NX5A 2NY6B 4QXGL 2XTLA 5FKPA 5EWIH 1MY7A 3TF7C 4MNGE 4LPXA 2OXHA 3PL6A 2A6DB 5EO9A 4Y2DD 2KDGA 1W0WA 3MXWH 3WFBL 4YDIH 4QRPA 1MQ8A 2XWJB 3QHZL 1T04A 1LILA 4I3RH 1AHWA 1D6VH 5DMYA 4P2QD 4M1CD 1EMTL 3FQUA 2FO1A 5D2NC 4D9RD 1SBBA 3OGCA 4D9LL 4DW2H 1J8KA 4WU7B 3GB7A 4GQPH 3P4NB 1FNEB 2CD0A 5HHME 4OKVB 1E4XL 1P84K 5I1LB 2Q7YB 1ORQA 4ONHA 3TVMB 2NY5L 4H20L 4K9EL 3ZTJH 3SDAB 2B0SL 4XVUC 32C2B 3EYFB 3L5XL 4YGVB 3G5YB 3K74B 5IOPB 1F00I 1MUJB 3Q6FB 4Z7VF 3UTSD 2OTUA 4XWGL 5H37G 2CXGA 5DD6B 2Y5TB 4WTXA 4LKXB 4NQEB 5IV2B 3PP3K 1ZE3C 1PLGL 2AK1H 2VZTA 2X40A 2VZUA 1EUUA 5C0FB 1GCFA 4NJ9H 5J6GB 2VC2H 1FE8H 3QFJB 4HXBH 2MKLC 2L4OA 2DM2A 4XPTH 3OXRB 4NQVB 3L3OA 3Q1SL 4O4YH 1XCQB 4OLZH 5F3HA 1WCBA 4GRLB 1A6VL 2FECL 2DDQL 2VLRD 4GW4B 4LIQL 2H45A 1MI5D 3C2AH 5F70A 4E41D 3GJEA 3GMQB 3LSOB 1MJJB 4XCYB 4LLUB 4PTUB 4KRLB 3CDFA 5ICZB 1OP9A 3L7FA 4QRUA 1TZIA 3NCJH 1NMCB 3KPSA 5HHOE 5I15H 1G0DA 3WNKA 3MJ9H 4UU9B 4AEIL 1BWWA 1MFNA 3K46A 2X4OA 1NC2D 1IL1A 3PV7A 1MCKA 5GRVK 1CFSA 1DJSA 3O4LB 2ORBH 5D93C 2ZCHL 5IGXL 4QHKI 3TBWA 1QFPA 4N1EA 3WS6C 1JF5A 1U3JA 5A2JH 1ADQH 2VDKH 5DD5L 3NZHH 3WUWB 4NKQB 1QRNA 5F9JA 4UINL 3UJTH 3DRQB 2J2ZA 5F1SA 4ZDHA 2AV7A 5D7JA 2AABL 1IC7L 2JE8A 1WIPA 4PJ5D 3IFOB 3QG6A 5TF0A 3FL7A 4KKLD 1J8HD 1OTTC 1I7TA 4U1KA 2IFFH 3MLPA 4H1LG 1AKJD 1OSZA 3O4OB 3RKDC 3ARRA 2MMXA 5IVZA 1BD2D 2BY2A 3GO1L 3IS1X 3OJDB 1JFQL 4UTAL 5CD5C 5A2FA 3HNTL 3VFRA 1UXWA 3V6ZB 4TNVK 4G8FA 3RGHA 2X2YA 3B9KD 3DETD 1IVLA 4H26B 5D7SL 4WVRA 3CSBA 5CIPB 5D1XB 3KJ4B 5DO2C 4K3DL 2OL3L 1OARL 1MSPA 2VQ1A 4G6ML 5JMOC 4YWGL 3NCEB 4WY7H 5C7XH 3I3BA 4G3YH 5JOEA 3IGAA 5E70A 4M9OA 2P44B 1CGUA 4IRJB 3FQWB 1WFOA 5KG9A 4DCQA 4HC1L 3DV4A 1AD9B 3BP6A 1ROWA 4I8DA 1RFDH 3CXHK 3ARFD 4YDKH 1XF3B 3VCLB 3FQRB 4KRMB 1LK2A 1GGIH 4O5LL 4TUOA 2DQFB 4UNUA 3MUHL 1NCWL 1UWGL 3QJHA 2VABB 2LU7A 4NGHL 3LCYA 1NC2B 1ND0A 5GGRY 5D2LF 5T3ZD 4UQ3A 1G7QB 1ZTXL 3BZEB 2V2TA 4PRIA 4JPKL 5F7DA 3LS5H 4Y19E 5B4MD 2FH8A 5FO7A 3H6JA 3MOBL 5FHAH 1TMCB 5DQ9A 5I1IL 1BD2A 1H0DB 3FONB 1A7NL 4OCWH 3FO2A 3MC0A 1CVRA 1FBIL 3RWDB 4D8PA 3B5GA 3VWJD 2Q3AA 3BDBA 4XWOD 4I2XB 5GS3A 4XHJD 1OTUD 2B1AL 2D9QB 2XQBL 3LHPH 2XRAH 5C08A 2VDPL 1G9NL 1E4KC 4TVPE 2HLFD 4LCWD 1AQKL 4NO3A 4JHWH 3HAEH 2R2BA 4M6NL 5HJ3A 4FXGB 4OCLC 3V0AC 5C0FA 4BUHA 3V7MA 2H1PL 4ZUWB 4WDIA 5F72S 1GPOL 3MLVL 3PGFL 4JDZB 1CXHA 3TV3L 5EZOH 4KAQL 2CKBH 4CMMA 1AO7E 1QYGH 2EIZA 4HPOH 2E9BA 3U9UA 4Y5YA 3BRFA 4G43B 2LU4A 4U6VH 4BSWB 4P23A 1RJZA 2P42B 1ZHNA 2VE6B 3NOIA 1F6FB 1CK0L 1T7YA 5F8RC 5GRVL 5HYSB 1IFHH 1PY4A 1JYXA 4RFNB 5DJYA 3S35X 3H9ZA 5C2BL 1JNJA 1I8MA 5IFHL 1H3TA 1J1PL 5CINL 4RIRB 5IP4A 3MUJA 3V9FA 1QRNB 3MCG1 1MIML 1N59A 1OVZA 4P2OC 4WEMB 3CSPA 4YO0B 3O2WH 3LRHA 4P46D 4DN3L 5JHDE 1SYVB 1PG7L 3RWFB 3JUYA 3RWEA 1II4E 5HI4C 1DL7L 2Q7NA 3RUGF 3IDXH 1IARB 5D93B 5EDXA 1JPFB 3QQ4A 3BKCH 3DVIA 1NGPH 2OTPA 4PJDA 2CJUL 1T7VA 2AQ2A 3RVVC 2CH8A 3O2VH 1AP2A 1LP9A 2ZKHL 3VFNB 1AGDA 4HF5H 1NMCC 3OKDA 4GRMB 4S1QH 3LSOA 2HRPH 1R5IA 3RU8H 3QDGA 4KHTL 5DRWB 1IC4L 3IF1A 4MA7L 4BH8B 1XIWD 2W65A 3RWCB 2R4SH 4E42B 3FTGB 2A9ML 2J5LB 4HJGB 4GXUM 4Z77A 1EBPA 3KPNA 3U4BL 4M5YL 3AB0B 4P3WA 4DUWA 3ARBA 4NN6C 3F6IA 3GSWA 3LQAC 4FQCH 3BIAX 2Z8WC 5GS0C 5DEGB 3TCXA 4IOIA 1IAIM 5J9PA 4RX4A 5GJSL 4PR5A 1FJ1A 4NN7C 3BP6B 3PL6C 3B4NA 5SX5H 3NIFE 2XTJC 5EOCJ 2AQ3A 5J6HB 4KJPC 2IALB 4KK5D 2PYFB 3RY6C 1DQDH 4HWZB 3JUZA 3UTTA 5J56B 1I1AA 1L9NA 1NMBH 3VFMA 3MJ7B 4U1IB 3O11A 1HI6B 3L3JB 4RRPG 4TVPH 2ZSVB 3F7VA 3CC5B 4PBVC 3BT2H 5C0CB 4UB0L 4ORZC 4OM0L 4PJ7A 3LPWA 1KG0A 2VXSH 1JWUB 2L0DA 4EN3A 2XZQL 4XNYL 2NTFB 4BZ2H 1YY9D 4JRWA 1HOCB 3DYPA 3K1KC 1ZLVK 1DQLH 1J0HA 3F5WA 1MHHA 4JZJA 4LSVH 2OTWB 5I1CH 3SCMC 3SO3C 3B6SA 3I6LD 4NOBA 4OCNC 4ODHL 3EFDL 3WN5C 4MLIA 5EFIB 5LGHH 2P7TA 3V5KA 3ARPA 3SN6N 4L29B 3VFPB 3WXWH 4OZGE 3LKNB 3QULA 2AK4D 3VXSD 2ENYA 4HT1L 4FZ8L 4NRXB 2VABA 4RWHA 1ZHLB 4JVWA 2Q86B 4MA1C 3UYOD 3BKJH 4NFBA 5ENWA 2GK2A 3TGXA 1S5HB 2FIKB 4QHLB 3DYOA 5E99L 4UILH 3VMPA 4HUVA 4KFZC 3FHAA 3HPJA 1OOAA 2OP4H 1N7MH 3Q5YA 4Y5VC 3DRTB 3FZUD 4AENB 3QFDB 5I76A 4OQTA 3RNQA 4TUJB 2NLJA 4NQEE 1BLNB 5L8JB 4N0YL 2DIAA 1SJXA 3A6CL 2OJEB 4XCEA 2DLEA 2QLVB 3W81A 5DJ0A 2DYPB 2HKFH 5T3XD 4H20H 4K9EH 2B8OT 2B5IB 4MNQA 1Q94A 4PJDE 1TCRB 2R2BB 2CLRB 1CQKA 3TNNB 3SDXA 1A6ZA 2VDML 1HDMA 4OLYH 3WN5B 2CMRH 3T0VA 5I1EL 3DX9B 3T0EE 2XNAA 4HKXA 1U95B 4YC2B 3BJ91 4ZOBA 1MFBL 5C0RH 1DDHB 4XBPA 3L3HB 4GKSA 5IF0B 2WP3O 1RJZB 2BNQE 3JV0A 3WSQH 5HHVH 2OR8A 1JV5B 1FYTE 2W9EH 1NDMA 1F97A 4PD4K 1L7IL 5IBUB 3QEHB 4RISH 1EUTA 3ZDXF 2XZCH 1WIOA 1JZ5A 1QSZA 1CGXA 1LQSR 2QSCL 5CIPH 3W9EB 4QCIA 1MCWW 5J3HC 4P4RA 2AAVA 1H3GA 2KKQA 5DDHA 4MDJB 1BQHB 3QDJA 5AZEH 1IAKB 1AO7A 2AJUL 1IGJB 2A1WL 1CE1L 4G8GB 4KI1A 2K9UA 1MLCB 5EBGA 4PP1C 3RTQC 4XC1H 4P2RA 3MJGX 1P4LB 4IOFD 3A67H 5C09B 5EC1B 2OLDA 3EOBA 3BIKB 3P11L 3RFZC 4LSQL 1JZ3A 2IH3A 5F44A 5JA9A 3MGOB 4LLUA 4FOMA 5L6YL 1PKQE 2YPKB 4PRNB 4N8VB 3UJJL 3CPLB 5HDBE 3E2HC 3KPQA 4IRJD 2JF1A 1SBSH 4LDEB 5CSGA 5E2TL 5J4MA 4TNWF 2Z31D 5EN2A 4WI4A 1MWAB 1EXUB 2PR4L 4O2CA 4KH2A 1JFQH 1HN1A 2ITDB 3BAEL 3FO9A 4WWID 1XGRB 3CZFB 3WS3A 4LCYA 4GAYA 5J1AB 5HYJB 4N1HB 4HH8A 4BQ8A 1MAJA 1BFVH 4TVPD 2DD8H 6FABH 4KZEH 5MENB 4WU5A 4NQCD 4JN1H 5C09E 4FFZH 2LAAA 4P2OB 1OGAD 3RL2A 4L5FH 1KBGL 4L29A 3VFPA 3VFSB 2VN4A 43CAB 4HS3A 1PKQB 3LH2L 5AUMB 4I3RL 4MX7A 1BIHA 2FGWL 4H25A 5LGKA 4YDKL 4I18C 5A1AA 1U8LB 4DKAA 4RFNC 5C0EB 3G6AB 1J0YA 2AKRA 3LKSB 4Z7VE 4OZGF 2IWGA 5IBUG 3WFEL 1T5XB 2F74B 4R26H 5HYQA 5MERB 3V7AG 1U93B 3S35H 3U46A 2B1HL 1C5BL 3S36H 1BVKB 4UV4H 4Z7OF 3S37L 2QKIB 5B38G 3IFLL 4FQIL 2ARJA 3MRQA 4LBEB 3QEQB 4P9HH 1HXMB 1RK0B 1MPAH 5IB1B 4YFLI 1H3VA 4LSPH 3DV4B 2ZNXA 2YD4A 5DD1H 5ADOL 5GRXG 1OLZA 2JELL 5MEQB 4J4PC 4F7MB 4MNQB 4MYWB 2VWEC 1LO2H 3DIFB 4S10A 1FZKA 2HJFA 2NPLX 5DI8B 3C09B 4IRSB 2IFGA 2PW2B 1HHIA 2DS4A 4UQ3B 4HGKC 5ESAB 5TE4L 3GMLA 1B3JA 2HAZA 4X4YA 1X4XA 4NFCA 1XGYH 3HG1E 2EKSA 3U36A 4D94A 3L3IA 1RHFA 4GXVL 5IF0A 4PYGA 3VGEA 3VGGA 1MHCB 3KYKL 3EOAA 4WI2A 4KAQH 1VADA 1EHLL 1FL5B 2QEJA 2IPKA 3QH3A 4TULL 3QEHA 1T03L 4U6VL 2VR4A 3O41B 4KI5D 5ID0B 3AMLA 1ADQA 5IR1A 4W81A 4MNQE 4YUEH 5F6IB 4YFEA 4QCIB 3KPOB 4YBHA 5TDPB 2A83A 5I8CA 5I71B 4E41A 1UWEH 4FQHB 1OM3L 1RJYB 1RU9L 2BJML 3IU3A 3NAAL 4XVUD 2VR5A 5ALCL 1IFHL 5I66A 2XICA 3K8KA 2N4IA 3I02A 3UJTL 5LXGH 2GK0B 3NPSC 4Z6AT 5IFJB 1G7PA 1OAXL 5CLWA 2DM7A 3RGVA 1CL7H 1TZHA 4LFHG 3WN5A 4KZDL 5E1AA 1FL6B 4C56D 4PJBB 1KF9B 4NM4L 1CGTA 1TTGA 4B0MM 2VLKD 4BYHA 5EC1A 4CBPA 4K3JH 1RULH 2X41A 3ALPA 4HKXB 3O4LE 2PO6B 4I77L 3FOLA 5FO9B 4PV8B 5ITFB 4EEEA 2O5XH 3BO8B 4MJ6A 3DMMA 3GI9H 3KJ4C 2X4NB 3FRPA 3MRIA 4Y0GA 3QUYB 4HMCA 5FUZH 2IPTL 2D7OA 3SE3C 3QRGH 2BNUB 5ETUA 1EHNA 5JDSB 3IJHA 2O5ZH 3H3PH 3ARGC 1R5WB 5IB2B 2KBGA 4HS6A 1UZ8A 5T1LB 5KVGL 3T0BA 4X6CB 1RAMA 5BZDB 5EO1A 5LQBH 3BH9A 4PJCB 3VFGH 3WD5H 1WEJL 4R3SB 4W4OC 1GZPA 1N59B 3NIGF 4PLOB 1U6AH 4BK4A 1U91A 3CDGA 1BHGA 4R96B 4OJFH 4OSUH 4GMSL 1JHKH 4WHDA 1SJEB 3MV7D 4L3AA 4FQCL 2Z4QA 5F1NA 3RBSA 1P7HL 3EFFB 1GGIL 2CO7B 2BNQA 4ZXBD 4GRWB 4ZFFB 4ONFH 4WI5A 1RUML 3LOWA 1GGCH 5DD0H 2WLYA 3LS5L 2SEBB 5GSRB 1QSEE 5TDNA 1YNLL 5HGHA 4D9QD 1FG2A 2FECI 4HGMA 2MPAH 5MI0B 2AXFB 3VXNB 2HT4D 3IYLW 5DLMH 2J8UF 1Q38A 5B4MC 1DN0B 3BGFB 3UTZA 4Z77B 1BVKA 3O3AB 1U41A 2NNAA 4PJEB 3QCTL 3TT3L 1GGBL 1CXKA 1Q9OA 2H2SD 2ERJB 2PKDA 1A2YA 3DROB 4L8DB 4UTBH 1ZA6A 1Y6KR 2NXZC 5F71A 4HLJA 3DX8B 3EDFA 1ORQB 4OM0H 4WI6A 1YQ2A 4L4VD 1XH3B 1C12A 4K07A 4KQ3H 5HTSA 4DEPC 3MLWH 2YMXH 3PGCB 1G0YR 4QNPF 2C9AA 3VGAB 5EZLB 4M6NH 4MJID 3ROOA 5KVDL 1A6TB 5IVXE 3LRSA 3NZ8A 3WJJC 3BQUB 4KPHH 1DBAL 1CZ8L 2CUIA 4TQEH 5T3XL 5LAXB 3C6LB 4ZD3L 4HGWA 5CJXA 3GJFH 3EFDH 3MNVB 3MRMB 3TO4B 4OF3A 2OX5A 1QFOA 4MD5A 1P4IL 5DK0A 5EBMB 3CGTA 4EBQL 3BGAA 3IDIA 3ZKQD 5IBLC 3SE9H 2HT2C 2F74A 5EOTB 3TVMC 5JXED 4FZ8H 5D6CB 3QIUB 3RA7L 3VI3E 4NQVA 3PWLA 4PPTA 4PJHB 4WFGE 2IPKB 2AJZB 4XGZA 5FYJL 3OJ2C 4DVBA 3OV6A 5D7IA 4D0BB 2UY7A 3WXVL 2NW3A 4XWGH 3WLWC 2CR3A 4YDVA 1IT9H 2Y6SC 3QEQA 1F42A 3BPNC 3R0NA 3O3BB 3DXAA 5IFHH 1BZ7B 3FB7A 4PRDB 3GSQB 1IL1B 4NHUB 1CU4H 4N9GA 2KUTA 3TBVA 5IFJA 5DUPL 3AS2A 3VH8A 3KPLA 1MJUL 3EW3B 4WEBL 3RGVD 3JWOC 4LPTA 1OAQH 1EGJL 4LCUA 4LGSB 3RWGB 3U0TA 1ZLSL 4OLZL 1KIPA 2A38A 2XQYG 3ZYJA 2YA1A 4HV8B 3U82B 4WI3A 3TFKD 4KJQD 1MREH 2K3TA 3MMEB 3VXME 5FO9A 4OLYL 2I9LB 2WINA 3UBXG 1K2DA 3CVHB 4LU5L 4M5ZL 5KSAB 2GJJA 4XMKH 1UM4L 2HRPL 2O93L 4Y4KD 2A0LC 4GKZA 3OJDA 5DJCA 1WLHA 2FX8L 3Q3GB 4M7KH 3LVEA 1T83A 5KSVB 2OJEA 4MAYB 1KTRL 3UEZA 4EDXA 4P57A 5C71A 3K7UA 3TYFA 5EIQA 3VGBA 3BGMB 2F53D 3BKMH 3GIZL 1WGOA 2XZCL 1E6JL 2XFXB 4BSVB 4XP5L 4X98B 1N5AB 4NWUL 1YUHA 2DM4A 4RZCB 4UNTA 2X1WL 1J0JA 1XZ0A 1QTYT 2JIXD 3VXMB 2QR0B 4HUXA 3X13B 5M95B 2H6PB 3O3EB 1PQZB 1E4WL 1WBZB 3QYCA 4P2YA 3HRZA 3SEPA 4IS6B 3VXRD 4RGOL 3H9SA 3CH1A 1KN4H 4GG6E 4NZRH 4WCYH 4C56A 1J8HA 3GJEB 4XVSL 3T1WA 4CAGA 4CW1B 1NDMB 4PTTA 3DHMA 5KTEL 2X42A 4IBLT 4HAFA 1WZLA 3FQNA 5CCKH 3ZYZA 3MRIB 3EYUL 1JHTA 3TIEA 3RZCD 4LSQH 5J13B 3D0VA 4UT9L 4ZAKC 3ULVH 2EYRB 2NYYD 5DWUL 4U0QB 3BDYL 3CMOH 1L0QA 4GQ9L 2YA0A 4HD9A 2ZCLH 3T8XB 3QXDA 4IRZH 4XNZC 3ME0A 4HC1H 5E2TH 3T1FB 3B83A 1FV1A 2AXHA 5TQ0H 4J12A 5D6DC 1M71B 2I07B 3BAEH 4KJYB 4KROC 5C0BE 2YC1B 4G6JL 3GHEL 4KY1H 4XP9L 4U3HA 4ETQA 3ZDZE 4OI7A 3VGHA 4K7PX 1IM3A 2LABA 3CNKA 1CFQB 5FHAL 5HJ3B 3RIAK 1F4HA 4RFOL 1YYML 4FMFA 3BKJL 4AEHL 4LSRL 1TJIL 4E5XA 5DRNB 3FHQA 3V6ZA 1ZA3A 3DXAE 3IFPB 4GFTB 3QEQE 3DUUB 1MWAA 4JQXA 4AL8H 4CVWA 2JJTC 5IW3A 1CYGA 5F7YC 5T1MA 3ZHDA 4M1GL 1FC1A 1RV6X 4Y5YB 4HWBH 5E9DE 3O3AA 4YHPA 3TBTB 5EIVA 2YD6A 5F7HA 1QZ1A 5E6ID 1J05B 3ULVC 4C83A 1D9KD 4HKJA 3FQXA 4YDVB 4N0YH 3IGAB 4MB3A 2CIIA 5JO5A 1RUAL 1WIUA 1AE6H 4IRJA 1UADC 4Y4HA 1JRHL 1LK3H 2GSGB 12E8H 3WNOA 2N1KA 3BW9A 4QRSA 5CEZL 4LCWA 4OZHE 1V7MH 1QR1A 3UTSB 2CKBL 5GRJH 1SQ2N 3LV3B 4LSPL 4U0RC 4WW1B 4K71C 3INUH 4Y4HC 1NC2A 2D31B 2LAGB 4H25B 4LEOA 2BOBB 3BZEA 4ODVL 5DD3H 4Q9RL 3MRDB 3T0XA 1SYSB 2HH0L 3HE6D 3CJJA 3ZTNL 4R97C 4FXKA 3ZO0A 2OR7A 5HD8C 5FF6B 1T66C 3W9DB 1XGUA 3FO2B 1MLBB 2XOTA 1NEZG 4YZFF 1KSRA 3K2UL 3CFIC 5E03A 2ATPB 4L9LA 4Q2ZA 4PJGB 2E27L 4NO5A 4M1CC 4ODBD 5C2BH 3EHBD 5CEYB 3EO1B 3KDMB 3MBEB 5FM8A 1NKRA 3UPRB 3QNZB 4XPHH 4OZHB 4X6BA 3ISWA 5FK9A 4F7MA 1QSFB 5C6TL 3SQOL 3PQYE 5F7UA 4TULH 35C8L 3O2WL 2ZG2A 3EYQC 1BFOA 5JW5B 2ARWA 3OPZH 1C16A 2HTLD 5KAQG 4NCDA 2M8XA 3VFWA 3C5JA 2FLRT 4GMTH 5DUML 3HZKA 5CJOH 1RU9H 1S5IH 4DGYL 4JO4L 3KS0H 4O00A 1QUNA 4P5MB 4ELMA 3RZCA 1U0QA 3VD7A 4FFWC 3ULVE 3MRLA 1PVHA 3MRFB 5L6YH 3OAZK 1OQOA 1HH6B 2F15A 1VADB 4PLKD 4K7PL 1KN2L 4FMKA 2E3VA 1YZZA 4RBPH 3SKMB 4P5KA 1X5JA 4LLYB 3AREB 2CXKA 3G9AB 3S5LA 1WC7B 4M6ML 1KJ3L 2BVOB 5BRZE 4NBXB 5K9KB 1CWVA 4O02H 4JY5H 4EI5C 4EVNA 1J1XL 1JNNH 4RSVA 1LO5A 2EYRA 4XTRD 3DJ9A 1U8QA 4MAYA 1TZGL 4UI2A 1M05B 5MP6L 1B4JL 5FECA 3ILPB 5CJ8A 1U58A 4HIEA 3DVGA 3GNMH 4Z7QF 2OQJB 4LKCA 4JHAH 1ZEAH 1AJ7L 4KZEL 1CICA 2HFFB 5BCAA 2O61A 4IIQB 2EEAA 1ED3A 5J3HD 1IAIL 2GY7B 5GPRA 5DTFB 2UVEA 5E8PB 5IVOA 3KXFA 1PG7X 5BV7H 4UUJA 4ZXBB 3O3EA 3IKKA 2NY1C 5CJQH 4MJ2A 4MXVF 3V8CA 1AP2B 1LP9B 3W11D 5TF1L 2EDDA 1RIVL 3VRLE 3HC3L 1G7HA 5I8EB 3KAAA 1MRDH 1P1ZA 4LSUL 1BBJA 2C4FT 3MRPB 1AHWB 1RUMH 4E42A 4KV5E 2EDYA 2FB4H 3NTCL 3RDTD 5B3JF 5K9JH 1PFCA 5DO2D 1I3RA 1FZMB 4JAMA 1KYOJ 5EC2A 3T0EA 5K93A 3VWJB 4OZIE 3V5HA 5T1LD 5HHMB 3QCTH 3TT3H 1U91B 3CIQA 3S6CA 4YX2H 2JJSA 2YPVL 1CT8A 1NFDA 2F8OA 2R1WA 2GCYB 4KJYA 4Z0BH 3VFVA 5L9DH 1KJMA 2BNQB 1D5ZB 5IVXF 1VFBB 2G60H 5F3BB 3ZT6A 2UWEA 1MFCH 5T3ZL 1JZ6A 3ABZA 1QQDB 3UTOA 2VITA 4BKLB 4Y4HD 2O5YL 4TPRH 3PWPB 1UEMA 4LCCC 4KPHL 4HKBA 4WUUA 5B38A 1VHPA 4YXKL 1CZ8H 4TQEL 3V0WL 1IKNC 4LVOB 1SVCP 1BPVA 4JRYD 1JWUA 2W38A 5ELIA 4EN3B 5H2BA 3OXRA 4YDLC 1CFNB 3JWOH 5DHVA 1CD8A 5E8EB 5DS8A 1MY5A 4D0CA 3VW3L 1PZ5A 2ED8A 2A6IA 4KU1A 1HOCA 4MHHG 5DVNA 2FHBA 1F90L 4GRWE 1JTOA 1E4XI 3MLYL 4K3EL 3DARA 3OB8A 4OZHA 5LGJA 1E28B 3BPOB 1A3LH 2DI8A 2KPNA 2BZDA 1HHHB 2GAZA 1KFAH 5T33H 1BQLL 5SWSD 3HB3C 2NQCA 5CMAB 5FYJE 3V4VH 2DKUA 2B20A 5TFSH 1SEBB 5C0ND 1QR1B 3QG7L 1GGUA 5TE6H 4GKOA 4PS4H 1LE9B 3WUWA 3M8OL 4P2QE 5H37H 2ICCA 5JXAL 4P5MA 4WJ5A 1AC6A 4K3JL 1QLFB 1I9IH 4PJIF 4HWNA 5D72L 4ZFGH 3RX7A 4EIZC 4I1NB 4LAQH 4EQ2A 4F7EB 1AFVL 5ESVB 3HKFA 3VE0A 1XR8B 3W39B 4NP4L 3W9DA 3CU7A 1SM3L 1CG9B 4K8RH 1X44A 2BSRB 1GC1C 1TVHA 3FFCA 3D85A 4PJHE 4P4KB 1YJDH 2XZZA 2YXFA 2Q8AL 4NO5B 4PRNA 1CDYA 4ZO7A 3O3BA 3ZYIA 4ZPTB 4ESKA 4XMKL