4PD4J

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 22
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pd4J00
3FRPA 1HHHA 4LSUH 3LQAH 4MD0B 5BZWA 4R0LA 2R2HA 4U1IB 4UZGA 2FWOB 1X5LA 3L7EA 3C08H 1F6AB 1ONQA 4GFTB 2GSGB 1EEUA 4S10A 5KSUA 4AMKH 4E9LA 1NL0L 3RJQB 5B38G 1X5ZA 1TJGH 1HXYA 4PRDA 5FGRA 4E42B 2NY5L 2HMID 4XBPB 5HD8D 4BELD 4BQCA 5IB2A 2R29L 3RZCA 1WGOA 4S1QL 4AK1A 5CJ5A 5J3HD 5J9PB 5I17B 3EJYD 4M7LT 1UXSA 3BAEH 3RX8A 1LWRA 3IETA 3FQTA 5C0GB 5DMGD 5IB1A 5ID1B 1S9YA 3P9LB 2O5XL 1EVUA 4KKLC 1KCVL 2JKXA 2VR4A 3CSGA 4OAWA 4HCRA 1YEFH 4X98A 4QRRB 4XRCA 2HWZL 2XRAL 1DDHB 3EO9H 4PJ5D 4Y4KC 3MRMA 3E0GA 3HE7D 4G42A 1IKNA 3KPQB 1I1AD 1CFSA 5I66A 4R3SB 4ZS6C 3W11D 3QSKB 3OHXB 5I2IB 1G7IA 5H2BB 1EH9A 4RGMB 4FZ8H 3TIDB 2I26N 5GS1B 3MRBA 3MUGB 1U58A 1RIHL 3IGAA 5J57B 3LDBB 4IRSA 1KTDB 1RMFL 5I1CH 4JRXE 4UTBL 2G5BB 4Y2OA 3DX9B 4DN3L 2L7UA 4WI4A 2VLJD 3C2AL 1ZHKA 3TM6A 1T7WA 3VFNA 4BM7A 1UM4L 2AABL 5AZ2H 4GRLB 1PW3A 2PW2A 5H8DA 3HPJB 4BFIB 3QI9C 3ZTJG 3WD5H 3WUZA 1CI5A 1AI1H 3JTSB 4LCIH 3BKCH 4KK5D 5FFLA 4K2UL 4AJ0A 1JZ3A 1XIWD 1GIGL 5DHVB 3FB5A 4KK9C 1NC4D 4JDVB 3N1QC 2Y72A 3D39A 1ETZB 4K3DL 1CLZL 4UV4H 3RI5F 4KUZH 4R4FL 3IXTB 3BKYL 3D2UA 3MYZA 2AK4A 3OJDB 3VFTA 1CICD 4X9GA 4R3SA 4Z7UE 3VFRA 5FYLE 1ZT7B 2NLJB 1G9NH 1KJVB 4K23H 3UC0H 2X6MA 3ARQA 5F21B 4ZS7L 3QJHA 4WHYH 5HD8C 3CPLA 1Y6MR 3U4BL 1BF2A 1W8OA 4C55A 4PJAB 1FDLL 3HAEH 3UTQA 4WWKA 5L88H 5ETUB 3F7YB 3OAUL 5E2TL 4AEHH 4I4WA 4JQVC 5D7LB 1N8ZA 2F53E 3L3DA 3UJIH 1NMCC 1YN7B 3C6SA 4NO0D 1HHJA 2C3XA 1HHGB 4R8WL 3LKRA 4EUPH 5JPNA 2NY2C 3F8UB 4AG4L 4YNYB 4ODXA 2HT4C 3LKQB 1CGSH 4I18A 2GFBB 3SY0A 3NPSB 3JWOC 2ZNWA 3CXHJ 1FJ1B 5B8CA 4HGKC 5F70A 3DVNA 4FQIL 1U3HB 5C70A 4N9GA 3LKPA 1EVTC 2VZ3A 3NTCL 1JTPA 4RAUA 2OMNA 2CLVB 3HTLX 2WWMC 3MV7E 2Y5TB 3Q1SH 3HZMA 4LSSH 2NX5A 2WLYA 6FABH 4XNXL 5D2LF 4XRCB 3UTTD 3TZVA 3EO1A 5F96H 3C09B 1U92A 5LGHL 3SKNB 2WANA 1PKQA 3RL1B 5E6ZA 2VABB 2ADFL 4FFWC 5DGRA 1I7RB 5KSAA 2GSGA 1GL4B 1G1YA 4PGCA 2CRZA 1EIBA 4N8VB 3KJ4C 4Z6AT 1IM9B 2OTPA 3G5VB 2RFXA 5BV7B 2UV3A 1GOFA 3OQ3B 4S2SB 3MXVL 5MI0B 3BP7A 4K7PH 3SPVB 1XF3B 4IJ3B 2VJXA 1A9EA 1J87A 4WRLA 1IC7L 2QSTA 2J4WH 1MLCA 2BNRB 3L7FA 1RD6A 3Q0HA 4JZJB 1KCSL 2O5ZL 3VFOB 3RVVD 2AXFB 3K2UL 4U3HA 3KPNA 5C09D 3U82B 4XMKH 5MEQA 3UTTA 3GSRA 3H9HA 1P84K 4EXKA 2CRMA 4K3EH 1EBAA 3HB3D 2E7LA 3B9AA 1ZANL 4JFED 4G8EA 1ZVSA 2JJWA 3C2SA 5HHXL 3O0RH 3K4ZA 3KR3H 2D03H 3R8QA 5HYQB 1JPTL 3LZFH 4KROB 3KPMA 5DA4A 3RGVD 2VR5A 4JRWA 5ACZB 1N5YH 3TT1L 4OD3L 4E0RB 4U6TA 4TUOA 5I1KL 1YY8B 4O5LH 4XNUL 1CK0H 4HXAH 1ZV5A 5KN5B 1CXEA 5CBAB 1HILA 1FN4B 4GLRI 4PJ7F 5K9KA 4JVUA 4IDJL 3PWLA 4LCYB 4OZHB 2P5WA 3P4LA 2EEDA 5E9DB 3SJVA 3QG6A 4RA3A 1IEBB 4Z0BL 4WEBH 5GQBA 4LIQL 1FV1B 5IWLC 5K59E 1S9XB 4TUJB 2NY0D 4FQCL 4P2RA 1UXSB 4WWKD 5JW4N 3JWDH 2OK0H 3SE4C 5D1QB 1RK0B 3EIFA 4Z0XB 3L3IB 1NCWL 3SO5A 2R0ZL 2UWEF 4GXUN 3REWB 3ZYJA 1CGUA 2WQRA 1FH5L 1AI1L 4MQSB 4CMHB 4YXHH 1OD7A 2HLAA 2F58L 3GSQA 1N59B 1WTGT 1I3GH 3ISWA 5K9OB 3KNBB 4YZFF 4D9QD 4FTVE 1I1RA 2BY1A 4GKSB 5GHWL 4FTVB 4M6NL 1RZFH 1SYSA 3KPMB 2YA0A 1JZ2A 3OG4B 1EGJL 2DLEA 3P40A 2ZWLT 3BYYA 1Z9MA 3NFPA 5IBLC 1WISA 3N1MC 5DJ8B 4I0PA 1RI8A 2V17L 1AO7E 1JGVL 1EMTH 1S9KC 4JFPA 3ULSB 4OUUA 1MCLA 3FTGB 2P46B 5CWSA 4JO3H 3FO1B 1QSZA 1N8ZB 3L3DB 4ZNCD 1IC7H 3PL6C 4GW4A 3DXAB 3GNML 2CJUL 4NZRL 4IM8A 4U1SA 4PGJA 4OCYH 1MFAL 3TPUB 2MQCA 1BPVA 3MRCA 5E9DE 3OX8A 3RKPA 2D7PA 3FONA 3VWKB 3RWDB 2W0PA 4LLDA 4X4XB 4R4FH 1HYSC 1I9JL 3QUYD 5HHXH 2JJSA 3T3PE 5EU4B 4WGWB 2HRPL 1J0JA 1OP5K 3MX0A 3UC0L 5BW7A 2R4SL 4EN3A 2BJML 3OR7A 3VFOA 3EGSA 1I1YB 3JWDC 1N5YL 3MNVA 3FQUA 1JHLL 3GMOA 5I76A 1I3VA 4PJDF 3H6JA 4XBGB 3ZYOA 5T3XE 3BVNA 3BVNB 2CDEA 1P4IL 3MMEA 2XOTA 4NJ9L 1T7YA 3KLAA 4X80L 4BSWB 1KLGB 3E6HA 5E56A 1B88A 4IDJH 3UTZB 5IF0A 2APXA 1JPFB 2Y25A 3S4SG 3EOAB 3SDDC 4OZIF 4KI5E 3FTGA 4XNZC 1JBJA 4FFYL 5IK3B 1W0VB 3O11B 3O45B 1C8PA 5F3BB 3WFDH 2YEZB 5F1SA 5F9WC 4X9IA 5I1IH 2VXSL 3MJ8B 4UT7L 5HI3D 3P4MB 3GHEH 4UV7H 5DQJB 4CN6A 1IQWL 4PG9B 5C0DA 4L8CB 4LCWD 3MLZL 1ORSB 1P9MA 4MJIB 4RMRA 3UJJL 1BIHA 1TIUA 3ZZ1A 1UM5H 3QHTC 3PXJA 5KVEH 4M9OA 3T0BA 4TOYH 3QH3B 1FJ1A 4AH2B 3R1GH 1CGWA 3SGKC 1DQJA 3TBWA 5B38B 1HH9A 3W9EB 4L4TE 4OLZL 4EN3D 1BBDL 1BQUA 1ADQH 2DLFH 8FABB 1JWSA 3KPNB 4KJQD 3T4YA 4XP5H 2GITB 1KTRL 2AJVL 5HHQA 3U6RB 1ACYL 1U3HC 3MRIB 1A1OA 1YYMH 3SDDB 5I74C 2DQUL 2V9QA 3UX9B 3LEXB 4N0FB 5JQ6H 3PDOA 4YIQA 4TNVF 5AWNL 3MLYL 4PRAA 4U1JB 5L6YL 4JB9H 1MI5E 2SEBB 1ND0B 5ESAA 5MHSD 1J11A 1CFQB 5SWSE 1CVRA 1MRDH 5F9OL 3VRIA 4RNRA 1G0YR 5BO1L 4ZQKA 4TPRL 5ESVA 5D70L 4NCDA 5TF0A 4TUOB 1MCFA 2J88L 2P49B 5E2VL 3VI3F 3FQNB 4YO0B 3R06B 4LSVL 3CFCH 1KFAH 2H32A 1FZJB 5LWYL 1A6WL 3RWGB 5DJ0B 4O58H 3OKEB 4AENB 3DYMA 1VERA 5ILTH 2A6KB 1SJEB 3PP3K 1NGZA 3V6ZB 2VLKD 4G8GD 5DLML 5TFSL 2P42B 1PGRB 4Y4HC 1U8OB 5CFHA 4N0YH 2EDXA 5DD5H 1ZLVK 2IAMA 1QO3B 1WZ1L 4EBQH 5IW1B 3WCYA 1CD1B 1CLCA 3TLRA 1D5MB 2BNRA 3FZUC 3AREC 4ZUSB 4L8SA 1YPZE 4N8CH 1WWCA 2XWTB 4KZEL 2G5BA 1CR9L 1UVQB 3TNNA 3QEUB 4HIEB 4XCFL 3TBYB 4ZFGL 3SDXF 3HNTL 4MAYC 4TQEH 3Q2CA 1I1CA 3I6GA 3QIWB 4UB0L 1RVFL 5E7FA 3O2WL 4NYLB 4LNRA 4NZTL 4FXKB 2YD7A 1F4WH 2P4AB 2AKRB 4D9LH 2APVA 1A6UL 5CD3A 5GGSY 4POZD 5MI0C 3ILQC 3QEGH 5HDBF 4AIZB 4OLZH 3SDXE 3FO0H 1ADQL 3MLTB 2H3NB 1XGQA 2DDQL 4R7NB 4FS0A 2GTZA 3GHBH 1MFEL 3CH1B 4DKAA 4JFEA 4HJ0D 4K3JL 4AEIH 4MXVF 3L3GB 1T83C 1CS6A 4LCUB 4LCUA 2Q1EA 3BEWA 5JDSA 1QFUL 2OCFD 5JUEL 4YXKL 3D3VB 3OTTA 3KPPB 3MYJB 4WW1A 3WE6A 5E8DL 1KEML 3B9KA 4BQBA 2YPVL 3T4YB 4JRYA 1I8IB 1K6QL 1ZLSH 3CK0H 2UY7A 3OG6B 4CW1A 3IFPB 3RIFK 3HHRB 1MPAL 2NTSP 4Y4HA 1OAQH 5ALBL 4PJ9D 1T6WA 4KGJA 5E4EC 4Q6YA 3SKOA 1QLRB 1JWMA 1UWGH 3N0PB 3QXDA 5C09B 3FFDA 4XHJD 4XP9H 1I9IH 1OAYL 4G7YH 3MJ8A 4UILL 1GGCH 4LASL 3ARFB 4J4PC 2A0LD 4EI6A 4NQED 3QWOA 1P2CA 1TQBC 4X6EB 3W2DH 1I1FA 5C0CB 1I9JH 2VDOH 4Z7VB 3VXSA 5FK9A 3SDYH 4R7DB 1I8KB 2FX7H 4PP2B 4WUUD 1NFDA 1PQZA 4MA1C 2IADB 1TENA 1INEL 3QEQD 3UDWC 4JDVA 1MQ8A 1P84J 2R69L 1B4JL 4UT6L 2Z9TA 1U2HA 4G6JH 4P9ML 4ZAKC 4NNXA 4Z78B 5FHAL 1IAKA 1FO0H 3JTTA 3MV8E 5D8JH 4ZTPH 1KCRL 2NY4B 4ZFOB 1EEQA 1OAZH 2XI9A 4HZLB 1FHGA 4K3GA 1EAJA 1FZKA 2KKQA 1RJLA 2QADD 5FA3B 3LSOA 4P4RB 4MHHI 2HN7A 3P77B 3REVA 2VISB 1NCAL 1K3IA 3WKNA 1UGNA 4ORGB 4YXHL 5JQ6L 3GK8H 4PV9B 3ES6A 1JGEA 2JJUA 1JCKA 4HS8H 1S9WB 3EYOA 4CAGA 3NIFE 1I7TA 3HE7A 3W82A 3VFUA 2AJZA 2P1YA 4TSAL 2CKNA 4X4YA 5MEPA 5HHPB 2YN5A 3PWNA 2DWEB 3R1GL 1QOKA 4FQLL 4ONFL 4TUKL 4YDIH 1ZMYA 3V4VH 4LPCA 4PGBB 2VNCA 3QA3A 2Q8AH 5GS2D 5FYKL 4JFHE 2H9GA 3QR2A 2C26A 4LSQL 5EOCH 4XVJL 1R3KB 3JV4B 5TFSH 1J5OH 4HWZA 3PABB 5FKPB 5E08L 1KB5H 5DD6A 3QDGB 3S35L 5JZ7C 2R2EB 1P7QD 4OCLC 1WZ1H 5FYJU 2A9MH 1CBVL 5HGDA 1JGUH 4BH8A 2N1KA 4LRNL 5L88L 4XPBL 1T20A 3DNKA 4MQXC 4C56E 5E2TH 3DGCR 2HG5A 1BECA 5GJTH 5SWZA 1T1XA 4IHOA 1AQDA 2IALA 1GZQB 4YHYC 2YA1A 4WV1B 1W0WB 5KANG 1HCVA 3RDTC 1F5WA 3KPTA 1KPRB 5LWYH 3OMZA 3WXVL 2YUWA 2DBLH 3DYOA 4JO4H 4WW2C 5HVGB 3QFJA 4R0LB 3PNWA 4PRHB 2EEBA 3RNKA 4HJGA 1CICA 5DLMH 1S7TA 3JSSA 1XGPB 4ZAKA 5F9JB 1FN4A 4XVUD 4CGTA 4TVPE 3WXWH 2I07A 4DW2L 1NBQA 4HAGA 3RHWF 2W65B 3L3JA 4NQSA 1Y18B 1OAUH 4U1LA 1FRGL 1YQVL 4QHUB 2KUTA 1H3TA 4RFNB 2AEQL 1R3HB 3RVUC 3AM8C 5DJZB 1DVFC 1BAFL 3KPOB 1FL5B 5B22A 4WFED 3IDYC 4R7DA 2DQEH 2ADJB 4LLQB 5EULV 4EDXB 3DX8A 1B2WH 3O8XB 3UO1L 3TWCL 4P2CG 1RFDH 5HHMD 4MA8L 1E4XL 1QBML 4XCFH 3L3OA 1T80A 1ZK9A 5LGHH 2V5TA 4JM4L 2R1YB 3V4UH 1HHKB 1MJUH 1ZA3A 3CVHA 1RVFH 2AJXL 4NJAL 2HFGH 4CRPA 1RIHH 1BBJB 3S37X 5J8OA 2YPVH 5KOMC 3S3SA 1NKRA 3OB0H 3GSNA 3QT2A 5I1AA 1OWWA 1RURH 4OZIA 4DN3H 4W6YB 4FQLH 1JF1B 3SKUD 3RWJA 2XXMB 3ZDZF 1FYTA 1S7WA 2BVQB 4M48L 1F58L 3VXOA 3MCG1 4K7PL 3OKDB 3C08L 3WNOA 4YHKH 2C7UA 2A0LC 2EYSA 4KMTH 5C9JA 3QDME 3DARA 1QVOA 2W9LA 3ECBB 1O0VA 1ZHNB 5C0EB 5GGSB 1YN6A 1AP2B 3T1FB 3QWOB 3D85B 4PY8J 4J3XA 4XP4L 5H35B 1F90L 2ZUQC 3OX8B 4JO1L 1AGDB 3CFBA 4PJCA 4W68A 4C59B 5JO5B 3DIFB 5TDNB 1H8OA 5B8CB 4XPBH 3W2DL 5EFIA 5C92A 2ED9A 2DQIL 1JHTA 3MLVH 5I1JH 4G80B 4M6OL 2FJHB 3UAJC 4GG8B 4NN7C 1TCMA 4G7VL 4JLRB 3FT3A 3IDJA 2D7MA 4MDIA 3ZE1F 3PJSB 3PJSA 5DJ6A 5DJ6B 3QCUH 1DLFH 2R1XB 4UQ3A 1QKZH 4PJ5E 5I6XB 2VXUH 2EXWD 1KCUL 5EIIB 1XR9B 3VXNB 4GMTH 3U0TA 1WV7T 4LFHD 2FZ3A 3MCLL 3CPLB 4BFEA 2W9DL 4HPOL 1U8LA 3NABH 3OGCA 3V5DB 1JNNL 4WU5B 4PJ8B 1DVFD 1JGEB 4IOFC 1N4XL 1NDGB 2HP4A 4Y16D 1P7KB 2DLGA 4U1NB 5EBMA 2HH0H 3TBSA 3KJ4B 3P4OA 3QUZA 5BZDA 4J3VA 3S36L 4UI2A 2OJEA 4KAQL 2P8LA 2ZOKB 1CU4H 3F6LA 1JPGA 4OLVH 4U3CA 4FZ8L 5EU6B 4PJHB 2J6EA 3DUHA 4ZSOE 1RZGA 2B4CH 2NY7L 4FQ1H 2R69H 3MV9B 1U8HB 5CIPH 1MFCL 4G6JL 1MJUL 1KPVB 1RK1B 3G9AB 3TJHD 4X7FC 5FDYA 2V5SA 1MLCB 3V0AC 3S3PA 3KLDA 3FFCD 5DK0B 3S35X 3VGHA 3TVMB 1TTGA 3LN9A 3O3DB 4J6RL 2E6QA 4U6YB 1TVHB 3GI8H 1OWRM 4GG6B 1NC2A 1ZGLP 1Z3GH 5EUKB 4K07A 3RVTD 4R4ND 1VGKB 4J8RA 1WCBA 3FO2A 1G9NL 3GKZA 3ZE0F 1FO0A 4OLUH 3KAAA 1IM3A 4KUCD 4HS3B 1SEBA 1YUHA 2D7OA 2ADFH 4NZRH 2OL3L 3MBED 5A40E 2DQDH 1CLZH 4GG6F 5TQ2H 4EVNB 4O4YH 2C3VB 3F7VB 1LK2A 4P9HL 2FGWH 4LEXH 5KSBF 3C6LC 2AJUL 5IW1A 1DFBL 1V7ML 4OFDA 5E03A 3UZVB 1VADB 1CT8B 4FTVD 25C8L 5JW5B 2YD8A 4Z7WB 2J7LA 3RVUD 2A6KA 5CEYB 5SWSB 3RA7H 1CFNA 1DUZA 3D0LB 2HKFL 2EE9A 3DX7A 1U8KB 3T2QA 2J4WL 1U0QA 5D5MA 3S88L 2XZQL 1HH9B 3SKMB 4PLKC 4RMSA 1W72B 5K9JH 3IKCB 1KB5L 4DW2H 4MA1B 4ODHL 4WY7H 5JA9A 2K3TA 3T8XB 2Z4QB 4O2EA 3TP4A 5IMKB 4JFEB 3QDMD 5E6ID 3RWFA 5GZOD 4P2RE 4LLDB 1ZOXA 1E6OH 4P3DB 3DMMB 4I2XE 1OPGL 5GIRB 2W0KA 4WFGD 1A3LL 5HSFA 5I8CA 2Q7YB 4LIQE 1YMMA 2ICEA 3BW9B 3BRFA 3QIBA 5ISZE 2R39A 1H3XA 1RFDL 4C4KT 4MDJA 1F6FB 3KPRA 5F89A 5KVGL 3W0WD 1JV5A 1OQOA 2FLBT 1S7SB 4XCNA 5J6GA 3EO0B 2D9QB 3AAZB 5M7QA 4QHNA 1UXWB 2HTLC 2HVKB 1LP9E 4E41B 1MFNA 5KSUB 1G7PA 1AIFB 5ERWA 1R5WA 2V5YA 5JXEC 5C07A 3QIUB 4TVPD 1AJ7L 2ZCHH 1CGYA 2OI9B 3BZFA 5C0CE 2VE6A 4FQCH 4GKNB 1KTLA 1DCLA 4RWYL 3BDBA 3VFTB 3NBNA 5C0JB 3QQ9C 4IJ3C 4XXDB 3NH7H 1QG3A 3BISA 3K8LA 3STLA 3ZHKA 2G75A 3IDMB 3MA7A 5DQDL 4EDXA 5D2LE 4JB9L 1TZIB 4F8QA 4TRPL 4HKBA 1C08A 2C9AA 3U1SL 1S7VA 1S7VB 3F7YA 1QFHA 3KPRD 2NY6D 4TPRH 3HG1B 5GGUA 2CDEB 3HE6A 1IAKB 3JTTB 3IDYB 1ZT1A 4FQQB 5TE7L 1T2QH 1S78C 2MHAB 2Z93A 1KFAL 3F5WA 1DL7L 4H0IA 3T3MF 3GMMB 4XWOD 1FG2A 4XMKL 1NCBL 2ORBH 1KPUA 3ULUC 1DLHA 2NXZC 1F8TL 1NFDE 4OD3H 1E6JH 1LO4H 1TJIL 2WP3T 5F7DB 4ZD3L 5C0BD 1AXSA 1ZAGA 2PCPA 3O2VL 3V8OA 3T77B 1WWBX 3HMWL 4OF3A 4ODHH 3HS0B 1QLEH 4PREB 1EHLH 1T1ZB 4OIAA 4RBPH 1ZGLA 3SJVE 1JNNH 1T2JA 1VFAB 1IT9H 1QSFE 3I6KA 1WUNT 4WW2B 4OI8A 3DX6A 4PJDA 1QSFB 2NW3A 4DFIA 5HGHB 2H32H 2PETA 4XNQB 4PJHF 5GJSH 4HDIA 5JIKA 2ZKHH 2BNUA 4NZUH 1DQJB 3KPLB 3TBWB 5B4MC 3SQBA 3H9SB 3O3BB 3HNTH 1SMOA 4XT1C 3HC0B 5I74B 1RJZA 3VJ6B 2NY6B 2OXHA 2ICWB 3F65A 4UNVA 2GQHA 2Z91B 1V3LA 4KH2A 5GSRB 4XXCC 3D18A 1IEHA 3A0OA 1VEOA 4ZO6A 5KSVA 3QIUC 2ZG3A 5E1HB 1PG7X 2A6JB 3BP5A 3ROOB 5LG1A 3BDYL 3FO0L 4K8RD 1RUPL 4JPIA 5L7XL 5DFWH 5FM8A 2WIIA 1PKQB 3X3FH 4KAQH 1CN4A 2BY3A 2H45A 4QRQB 1A14L 3GZKA 2OL3H 4JO3L 1CT8A 2H2PD 2YK1H 3N9GL 2ZUUA 4PJBA 3HCVB 4AEIL 1FZOA 1RZFL 4YGVB 4AQOA 4KKLD 4NC0B 5FM5M 1MFCH 2FEDC 3QDAA 3ULUF 2F54D 4OB5L 1IGJA 4CMMA 4K9EL 4XAKE 5E95B 2AK4B 3OJDA 3P30L 3ZO0A 1T1YB 1IBGH 1NLDL 5CGYD 3SJVB 3FQXB 1QHPA 4YDVA 3C5SA 1GZQA 5KTEL 3QNYA 1W0WA 5TGBB 5TE4L 3LKNB 1QP1A 3PL6B 2LE9A 4TVSa 4P3DA 4F9LC 3BDXA 4MXQC 1Q9OA 3GGWB 3SGEI 1YY8A 5DUMH 3B8YA 1GSMA 3K1KC 2FX8H 4KY1L 3RTQA 1A6AA 4GBXA 4OZGB 4LLAA 4N68A 2GKIA 5IQ9B 3DRQA 2IMMA 4HIEA 5C0FB 1II4E 4OIBA 4X8JA 4OQTA 3B3IB 4FOMA 3O3UN 1KJ3H 4BKLB 5LJYH 4EDWH 3NCCB 2DQTH 4P23C 3WNKA 4CVZB 4CVZA 4QO1A 5HYIA 4WTXA 4JG0H 3VGGA 1QEWB 4QRRE 2F19H 3CMOH 3ROLA 2YXFA 1YQ2A 1AGCB 2Z0BA 2DWEA 3MOBL 2R29H 4HS6B 4HMCA 1XGPA 2O5YL 5F9JA 4UT7H 5K9JL 4M4RA 5DJAA 3HNVH 3GJFK 4KHTL 1AR1C 3V6OC 4XXCA 4W4OA 2NY6C 2QL1A 4O2CB 4WY7L 4PREA 2X4QB 3RP1A 5C0NC 5D2NA 3UTSE 3O4OB 4PGEB 5IWLA 1OPGH 2W60B 3FAXA 4B7LA 3H3PL 3ARXA 4LOUC 4QYOB 1T5XA 3CDYA 2R8SH 4XWOC 4PJ8D 3AVEA 1FIEA 15C8H 4NQEE 3BMVA 5FYJE 1QRKA 4QEGA 4KK8C 4QHMA 3ZDZE 5TE6H 4L29A 2J6EL 4I3RL 4PRAB 4G3YL 3HG1A 4NDMB 1I8LC 1MREH 4HS8L 2UYLA 5DMIL 1WAAA 4C83B 4ZFZA 5CJQL 4NKIL 5ACZA 2VRAA 1TQBB 5ADOL 3QIWC 3GI8L 3H7BB 2P5WD 3QJFB 1MCKA 1CXIA 1NMAL 5TE7H 2AKRA 3MNWB 4DGIH 4JDTH 1HKLH 3RAJH 4M8QB 5JHLH 1RZJC 5DJAB 4M43H 1T0NB 4U6VL 1LO3H 3S4SB 1A6WH 1NJ9A 1NCBH 2ORBL 3GMQA 3MO1A 2N7BA 3QUMA 4TSBH 1A6ZA 2ESVE 4ZO9A 3P0GB 1J5OL 5TDOA 5J6HA 5D70H 2AJUH 3L95A 2IFGA 2F53A 4JREC 1VA9A 1MCDA 2W07A 3FQRA 1FLTX 3QZWB 3WFEL 5L2KA 5A2JH 5EBLB 3VGBA 5CKAA 3LQAC 3K8KA 3SPVA 3BKYH 1EUUA 3QHFH 1KXQE 5KVDL 3S8WA 4YHIA 1KJ3L 3GSOB 4P23D 1NBYB 1OTUC 5IHZA 4Z78A 2VDPL 1LNUA 1W72H 4YJZL 2IH3B 4S1DC 5DR5L 1SYSB 1DANT 3KYOB 3NGBC 4KVCH 1JPGB 1B9ZA 3DMMC 4NYLA 4JRXA 4CNIA 1A0QL 5E99L 4AEHL 3GIVB 4YC2C 3MRPB 3E1F1 1QLEL 1MIEH 1UB6A 4RGMC 3QNZA 2C7UB 3QQ4B 4R8WH 1HNGA 4WEUD 3QXUA 3LCYA 3AXLB 4KRPD 3WIHH 4UTBH 3LDBC 2AJSL 3D0VA 2D4DA 3MLTA 5F9DC 3U36A 4TQEL 5JQHC 5T33L 4K94L 3GBNL 4LLVB 4PRHA 5AD0A 2R8SL 1FNSH 3TPUA 4JPWL 1S5IL 2CLVA 1EA9C 4MGXA 3O9WA 1EEZB 1L6ZA 4YHPA 4BA8A 1CDHA 1YPZF 3SE8L 4PJIA 1QBLL 2VB5A 1G7MA 3EYUH 2VDRH 3QRGL 4UQ2B 4IRJB 4P5TB 5D7KD 3HE6C 3MUY1 2FL5A 3CAFA 3IYLW 1OCWL 4N9GB 4NHUB 2AV1B 3VXRE 1NDMB 4KKBD 4FABL 1AFVH 3QDGA 3DX8B 4POUB 1TETL 4H8WC 2H6PB 4F57L 3MRDB 2BOCA 1ONQB 3EFFB 4UQ3B 4K3JH 1S7UB 3OB0K 2FLRT 2OYPA 3TESA 3C09C 2FYYB 3RAJL 1XGRA 2VLLA 4HIXL 43CAA 4EUPA 1FVCB 3U9PL 1WZKA 3X14A 4YXKH 1CF8H 5ALCH 5ALBH 1KGCD 2ZZUT 3TA3A 1AD9A 1FE8H 4M02A 4R4BA 2NZ9C 1Q38A 3U4EB 1VENA 1FYHB 1FDLH 3WSQL 3VRLE 5J6GB 4X6DB 3EZJB 4KKAC 3CSPA 1U95A 3WUWB 1WK0A 2Y9RT 2LTQC 2YC1B 1I9IL 1HYRC 1N0XH 2A6DA 3UTSA 1GGCL 4LASH 1CIUA 1HHIA 3H0TB 3STZA 4RSVA 3RWGA 5SWSD 4Y1AA 2VKXA 4LEOB 1F4XL 1G9NC 4PRDB 1QUNA 1ZLUK 2VDOL 4YLQT 1UWGL 2FBJL 4LOUD 2E8YA 3Q5TA 5TH2A 1UKTA 3V4PL 5DR5H 2F15A 3QG7H 1OAYH 4G7YL 1T5XB 3TVMA 4QOKE 3T8XA 3W5MA 2A9NL 3IT8D 3MRNA 1YDPB 5FUOL 5EH1A 4G9DA 5GS0H 2Z91A 4L9LA 1ZANH 4OGYH 5ACLA 4WWKC 5EO0A 4KTYA 3LEXA 3RQ3A 1U93B 3LRSA 5EO9A 5J3HC 2K7PA 5JR1H 5FYKE 1INEH 5IKCA 4WCYH 2BRQA 3O6LH 3IFOB 1HDMA 2MWCA 1KLGA 1RULH 2PXYA 2DM4A 4S1SH 4NKDB 4N0UB 2B4CL 2HJKA 3HZKA 3RL2A 2PR4H 4PJGB 3IDNA 1MCOL 3FT4B 5C07B 5BS0B 3OR6B 4DEPC 1I3RB 1NQBA 3GSQB 2BHZA 1F4YL 2W65A 3GK8L 1BOYA 4OCRL 1I9RH 3FQXA 3VMOA 4V2BA 3PWUA 4JHBA 4TSBL 3IFPA 3LKNA 3TA3C 4QGTA 3N85L 3JV5A 1HNFA 3FKUS 4U1JA 4LSQH 1BOGB 2ZUQB 4G3YH 5D1QA 3P2TA 3T3ME 1BD2B 2R23B 3LMJL 1CLOH 2WV3A 3NCEB 4ZS6D 5IJKA 1D7FA 4K9EH 2EDNA 5D6DA 2M26A 4HHAB 4S1DD 1GIGH 3OR7B 4P9HH 2HTKC 3B9KC 3QHFL 3A6BL 3BN9D 5INCA 1P4BH 3PWPB 5SX4I 1BZQK 4PV8B 1DUYB 1CE6B 1A6TA 3L7EB 2LFGA 2IPTL 4JPVL 3WFCH 2D7TH 5GJTL 4XVJH 2XN9A 2JK5A 5ESQB 4DOHB 4JKPL 1LEIA 2AV7B 3GBML 4M43L 5DUML 2OL3A 5ENWB 4OD2A 4OZFA 2BSTA 5BJTB 3QIUA 1KXVC 4NQEB 4MD4A 3VFWB 4FMFA 5MERB 1CD1A 1KELL 3OAUH 1JGLH 5E6IC 5GZOC 4YPGB 2X9XA 4Z77B 5HDOA 5CZKA 5EOQL 3TBVA 4JM2D 5BXFB 4PRBB 2XPGA 2VITB 4F7CA 4X4YB 4Y2DB 4LIQH 1TVBA 2Y36H 3G08B 5BVPL 4XNQA 5HI3C 1JNHA 2Q87A 1V3KA 3LKSA 3V6ZA 5T1KA 2VYRE 5L2KB 1NANH 4ZSOA 1G7LB 4U7SA 4KMQA 3O2DA 2OR9L 2IPKB 1R5VA 2NY1C 4MA8H 1P9MC 1C16A 1FRGH 1RQ5A 3SGDI 3WMSA 1JZ8A 4C57C 4HIJA 3OKKA 1FNEB 1K4CB 2VXTH 3ZL4H 4OZHF 1OM3L 1UM6L 3WIFB 4L4TA 1H0DA 3UAJD 1D5BA 1X6NA 4NRZA 5ADPH 5GGQH 3Q1SL 4OV6F 3GMMA 4HK0B 3MTRA 1B2WL 4YBHA 4PGZA 2EDQA 4D0BB 4JQXA 4P9HC 5I1EL 1RURL 3G6JE 3ARGC 3FT2B 3GHEL 4UV7L 4M7KH 2NY0B 2VZOA 3U9PH 5F1NB 1CU4L 5LCVH 1IQWH 5J56B 4YO0A 4JHAH 4LU5L 1FZOB 2IANB 3QEHA 5TDPA 5KVMC 3VXSB 1U91A 4QWWD 2NY3D 1A1NB 1EV2E 4TRPH 3VH8A 1T7ZA 4C4KO 3B5GA 1QTYT 4GT7A 1ZLWK 3GBLA 1WSST 2RBLA 3NZHH 4GRWH 4UT9H 4POYA 4F57H 2GEEA 4EKXA 3STLB 3KPOA 1KIPA 4YUEH 3VGAC 4DKDC 1NEZG 4M61A 2V2TA 2R4SH 3HPLB 5J1AA 2VDMH 4G6AC 4K7PX 4WFFE 1BMGA 1GHFH 2J8HA 4MXQD 4OKDA 1RUAH 3GSNL 1GGBH 4PJCE 3AFLA 2WBKA 4X80H 2FGWL 2WINA 2EKJA 4P57B 3VD5A 1S5HB 3SKNA 1YNTA 5F97E 4GRMB 4NNPL 4PTTA 5KSAD 3MLVL 1T1WA 1T1WB 4BKLA 5ID0A 3M8OH 3EDDA 3NCYS 2D03L 4Y19A 1K9TA 3PP4L 4U31A 2QR0B 5C0AD 4QF1A 4RBPK 4Z76B 5HHVH 3V6OE 4PP2A 1JGDB 4LKXB 4KGLA 2IH1A 1FG9C 1EJOL 3EBAA 5T5FH 3BPCA 2FO4B 3FN9A 2IPUK 1HILB 3FHAA 4Y0GA 4Z7WE 3C60B 2VDKH 5A2IH 3Q6FB 3ZSTA 4GKOA 1A4KA 3I02B 2H3NA 2W9DH 4X9HA 3MLZH 3NPZB 3ZYIA 3GJEB 2IG2L 3WYRA 2NY7H 4FQ1L 4TSCL 3QO0B 2UVFA 4AL8L 1HQ4A 3RGHA 2X4NB 1SBBA 1IAIH 2Q76A 2BVOA 1TQCC 3LV3B 3ZE1E 4LHUD 4Y5YB 1V05A 3TZVB 3ULUE 1IJ9A 1EEYB 2I60L 3KPLA 1L7IL 1BJ1H 5KN5A 4WU7A 1MNUH 2YWZA 1RUPH 1BVLA 2O26U 4JGMA 1C5DB 2VLKB 2HVJA 4XI5C 5H37G 2DJ4A 3D87B 3IS1X 1MIMH 2YMXH 3O81A 4EQ2A 1OARH 3V0VB 3B9EA 3OB8A 1TZGL 2L4OA 4YH6A 1HSBA 3BIKB 1GGIL 3T0AA 3VXUE 3FB6B 5HPMA 5FKAB 1IAMA 3IXAB 2EEAA 2N4IA 4QXTB 3W0WE 1F4YH 4YPJA 4OGXH 4F7MB 3P30H 3WO4B 1MJ7L 1XEDA 3Q6FA 4F58L 1WZMA 2BNQE 2NY0C 3D39E 3HAEA 3RWCA 4RFOL 1WAAF 3BP6B 1YN7A 1INQA 3C6SB 1EO5A 3GMPA 4NCC2 5JNYA 1HHJB 1TJGL 3BKJL 3GO1H 1UFUA 4LQFH 4O4YL 1MCIA 4G9FE 3NCYP 2BVOB 3X12B 3X12A 1QFUH 1UJ3A 4PRHD 3PWPD 3CUPA 2EDRA 4JN1H 3VD3A 1ORQB 1EFXD 1LEKB 25C8H 2WMPA 1FVEB 3KYNA 4PJ7E 3TYFB 3BOVA 3GSNH 4KRNA 5CD5D 4J3WA 4ODVH 5T1LB 1N64H 3BEWB 1MJ8L 4WTZG 4L5FL 1E6OL 1HWHB 3IFNL 4FFZL 3FFCE 3QQ4A 3SCMD 3B83A 4NN6C 4QRUB 5IB4B 1A22B 3VGFA 2W0LA 3M45A 1WBZA 5CGMA 1SM3L 4LARL 1ZHBB 4QRPD 1FFNB 1UWEL 2HJLA 4OGAD 2BNRE 4Y89A 4IRZL 5DRXA 3CNKA 1KACB 1HWGB 5FUOH 5IOPA 3ZT7A 3B5HA 3UPAA 2O5YH 1A6PA 5DGQA 2J8UF 5HVFB 4KHTH 4HWBA 4NZTH 1Y18A 2DWDA 4G9FD 3LOWA 1RZ8B 5IHLB 5HHNB 3S6CA 5DJXB 4P5TA 4P46C 3ZDXE 4EZMA 2CKBB 5A3ID 1A6UH 2CQVA 4IS6A 1INQB 3MJ9L 5DFVD 1F3RB 4LSPH 3BO8B 4LHUB 3CIQA 1CQYA 3CVHL 3CXHK 1QFOA 1ZHKB 3MBEC 4JFEE 4FQJL 2NXYC 1T7VA 1U9KA 5GJSL 1Q1JL 4XPTH 3SGJC 1GGYA 3QUYA 3QDMB 3JVGA 1WT5A 4NBXB 4JCLA 2EYRB 3DIFA 5HYSA 2R1YA 3EOBA 5KJRH 1QBBA 5D4QA 2R0LH 3EAKA 2PR4L 1SJHB 3BKCL 4HS3A 2G2RA 4DGVH 4IRJA 1IM9D 2EIBA 4G6MH 2CGRH 4QLRA 2CIKA 1KCRH 4GRWE 2B4CC 2Z31B 4QCIB 2LU4A 1Q0YL 3H42L 4D2NA 4QNPE 3RVXD 5DS8B 2J12B 2B7DT 4I48A 5L7XH 3HC3L 3BXNB 1D6EA 2EIEA 2PO6A 3PV7A 4L3AA 3LQMA 3LMJH 4M7KL 5DQ9A 2XZCL 3LN4A 2J8UA 1A14H 4Q6IA 3H7LA 4CBPA 5IB5B 2MQ0A 2HJFB 4OBRA 4I8DA 3WEXB 4M1CD 1CGTA 1FIGL 2R1WA 1EK3A 4EI6B 1FCCA 4V1DA 4UILH 1MCPH 5EO0B 2F54E 4LSVH 4APQB 2DLTA 2BNQD 5SWZD 2V2WB 1OW0A 1JFQH 4KTDH 1A6ZB 3X17A 1DZBA 2FX7L 3P0YL 1A9BA 2VDPH 5LAXB 3MC0A 2HAZA 2WBJC 8FABA 3LY6A 5CGYC 2RR3A 3UYOD 5L9DH 2BSRA 3L3IA 2GW5A 3I2CH 1U3JA 1FZMB 4LLMB 1EX0A 4CADB 3HPLA 1QSEE 1MFBH 3WN5A 4E41A 4OAWB 1YMHA 2HT3C 1ACZA 3PHQB 3ARGB 4WFEE 4MD5B 3EOTH 4ZUTB 4G80A 2E7BA 4N8CL 3VA2C 2X09A 2EXYC 4L8BB 2NXYD 4H26A 2ED8A 4G9FA 1WT5C 3OKMA 2IC2A 4JO4L 5DO2D 1ZHBA 2GSIB 2FJGB 2OR9H 1AR2A 3QUZB 4UNTA 1X5XA 1JV5B 2C3VA 2E6PA 4HMEA 1T1XB 5C08E 1OAKL 4KUCF 3V7AE 1X4ZA 1GOGA 2EDDA 3DUSB 3WFBH 1H3UA 1H9VA 1WFOA 2VERN 4RZCB 2C1PA 2ZSVB 2BVQA 2YHGA 3FOMB 1OHQA 5C0RL 3N9GH 3BZEA 5I1LB 4MNQB 4OLXH 3SGKA 4PLJD 1PYWB 3ARBB 3I6LD 1FYTE 4O2CA 2CDFB 3AUVA 3L6FA 4R90L 3ARYA 4TUKH 3RVTC 2PW2B 3MXVH 1XF4A 5LGKA 1B0GA 4L3EB 3TBVB 4MS8C 3FFCA 2ARJA 2XPGB 2BSRB 3B5TA 2VXQL 2QADB 4Q6IC 1H5BA 4JM4H 5ITFA 1BWWA 1KLUA 3ALPA 2NX5E 1XCQB 2HFGL 5L2JB 2Z92A 3TO2A 4OIIH 2Y23A 5CJQH 1BFVH 1IBGL 1MJJA 1NLDH 3OBAA 4UDUA 1KB9J 2N7AA 1ZHNA 1WF5A 2HFTA 4R96B 3KR3L 2RQ8A 2GJ6A 4P4KC 3MV9D 4XPGL 4F58H 5IVZA 3UPRA 1JZ4A 1AGEA 2FX8L 2X70A 3PHOA 4KY1H 3TT1H 1JWMB 3CU1A 1TTUA 5DYOB 3O6FB 4L9LC 1ZLUH 4K8RC 2A83B 3ARBD 4ZTOL 4LLVA 4P3WA 1NUNB 5DVMA 5T5NG 1I1YA 3BGFC 3LEVH 1I4FB 4NRZB 3LB6C 1WICA 4NZJA 4JG0L 1NC4B 4WFHD 4L5FH 3FQWB 2EDTA 1S3KL 3B9KD 4PRIA 5GZNC 4TNWK 3TBYA 1OTSD 3JWDL 5E8PA 2OK0L 3I3EA 4FQHB 4PJIE 3UROR 1DQQA 2CLZA 5A2KH 4H5SB 3RWHB 1Q72H 2Z31A 3F7PC 2LAAA 4OFYD 4DCQB 1IEAB 3U6RA 2BCKA 3BE1H 1I3GL 3V4UL 5D5MF 3KPSB 1MREL 1DJSA 1EHNA 3F5WB 2YD6A 4ELME 1AXIB 3MA9L 3ZTJH 1A3RH 3TVMD 3SDCD 3WIHA 3UYPA 1G0DA 5AG9A 3AU1A 4J4PD 5FYLD 12E8L 4ZUWA 4NQEA 5CP3A 2CMRL 4K94H 4OCRH 2KH2B 1SMAA 5JHDB 4I3RH 3MXWL 4HWBH 2GK2A 2JJTC 5DVOA 4PGDB 5E6IB 2ICWI 4JJ5B 4Y4FB 1F6AA 5FYKD 3GJFA 4KJPD 1MF2L 1Z9OA 2G5RA 3HB3C 5J12B 5JDSB 3DHJA 3SCMA 4MWFA 2I9LB 4F37K 4NQCB 4H1LH 3TN0A 1RJLB 3SE3A 3V5KA 1EPFA 3KPPA 3TCXA 5F1OB 4DGIL 4JO1H 1OCWH 4ORGA 3VE0B 3D2UB 3WFEH 1B0WA 1JHKH 1KENH 2UY6A 3K2MC 4JFOB 3ZKSD 5DEFA 5IEKA 3RGVB 2QSCL 2BK8A 5IMKA 5AAMA 2GHWB 4WUUE 1M05A 5FO9A 1A7QH 5DK0A 4I9WE 4LQFL 4ERSL 4HIXH 3OXRB 5IROA 2IH3A 2ITCB 3W39A 4G43B 4IIQA 1VCAA 3B9VA 1K5NA 2BJMH 1QFWL 3DVGA 3BXNA 5HVWA 5FO7A 1VGEH 4PLJC 4G6AD 5GRZA 1DN0A 3HNSL 4EUPB 1KCUH 1U8IB 1MFBL 3HUJB 4P2YA 4I5BB 3SOBH 1K85A 3BGAA 2WIIB 4WV1A 3VWJD 4FXKA 1MRCL 3INUL 1D3CA 4OT1L 5IVZB 2VKWA 1WVZA 2Y36L 1QRNE 4G6KL 3RL2B 3TYGH 3QFDA 3RWFB 4HUUA 4PTUA 3DLQR 3R0MA 4FHBD 2RJMA 4NUJA 3SDAC 3BGMB 3NAAL 1K8DA 1BFSA 1MH5B 5EN2A 4PRID 3VW3L 3JWNC 4D94A 1U8KA 2VQTA 3C5SB 4UAOB 5KVEL 4TOYL 1BVKA 2OJZL 4C83A 4FQJH 4IMLA 3HI6H 5T33H 1GH7A 4H1LG 4Y5YA 3OKLA 3VXRA 1L9NA 1YEIL 2MMXA 4ZOCA 1SQ2N 5JR1L 3MRDA 5CLTA 2H26B 2YXMA 4PJEE 3H2WA 4LP4A 4R26L 4JQIL 4WCYL 4M8QA 4NQDE 4KROD 4ZPVA 4ONHB 4NO3A 2VL5B 1VACA 4IEFB 1RULL 4PV8A 1A4JA 1MAJA 1VPOH 3TN0C 1CFQA 3VRIB 2XV6B 4FQXB 3NCMA 2HFFA 2B20A 4P2RB 5BS0D 1W8NA 5TQ2L 1LDSA 1FG2B 1XIWA 2A6JA 2B1HL 3ROOA 5BO1H 4QHNB 5E2UL 5FA4B 1I8MB 1QLRA 5EG6C 2GT9A 5D1ZA 4N5UA 2J88H 2DB8A 2R9HC 3ARBC 2APWA 4JJ5A 3BP6A 1OP5H 3AXLA 5M95B 5D2LA 3LS5L 4PJBB 4PD4J 3GNMH 2GITA 1L7TL 1VFBB 4LHUG 5F7EH 4Q58C 5FGSA 3DXAD 4KDTA 2RCSH 4YFDB 4MJIA 4E41E 1L9MA 3EKCA 4MJ2A 1VGEL 1MEXL 3L3OB 3JVGC 3HNSH 4GBXD 3K4AA 3GSVB 1CIDA 4EOWL 4GAJH 4KKNA 4L4VE 5IB3A 2OQJB 3TNNB 3BD4A 1T2QL 4NQCD 4JFYA 1UA6L 3VFGH 5ITBH 1QEWA 3BJLA 3R0NA 3BKMH 1Q72L 3BT2L 1G84A 1DBML 3BP4A 4O2FB 1KJMA 3O6LL 2ZSWA 5KZCB 4WHDA 5E5MA 4OF8A 4X7TB 2UWEE 1LE5A 2F8OA 4NJ9H 3OKEA 1UXWA 4Y5XC 4AENA 1U8NA 4X6FB 3MROA 5E9DA 1S7WB 4HDIB 4XC3L 1KELH 4MCYB 4GMTL 3U7YH 2BDNL 4PRPE 1JP5A 3HLAB 4HPOH 4ZXBC 3ULVC 3MO1B 4WNQB 5ESVB 3BPLB 1KXTB 1RUMH 5CIPA 4DKFH 1VFMA 2A2QT 4LLUB 3GSWB 3T0EB 2ZKHL 5DS8A 4MX7A 2YZ1A 2IGFL 4JG1H 4YE4H 2IF7A 1MF2H 4X98B 3CZFB 5C07E 2YWYA 2W9EL 1AGBB 1Y6NR 5JOPE 2SEBA 3T0XA 1XCQA 1OM3H 2G2RB 1T0MA 4X4ZA 3C8KB 4LLWB 3NACL 1EAPA 1Q9KB 5BRZB 3U4EA 3D39D 2DQFA 3A6CH 2PYEB 1SYVB 3EYVB 1OL0A 1WJ3A 4YDKH 1XR8B 3CFKB 5HHQB 1WBYB 2ERJB 1X4YA 5F88A 5E2UH 3BDYH 2FEEI 2C1OB 5SV4A 1K6QH 4YBLB 1XGRB 2VLLB 3N85H 4LMQI 1EFQA 5DVLA 1NCDH 4Q7DA 3O6FD 2UUDH 1CYGA 3QUKB 2ENSA 4P4KB 2OSLB 3RIAK 3QNXB 3KLHC 5EO1A 5IMOB 1FGVL 1X5GA 4PS4L 4PJDE 1ZLVH 4X9FA 1XIWB 2E9IA 3F62A 3VFSA 3PV6B 1MCJA 4OB5H 5TDNA 2IPTH 5D1XD 4A6YB 3LQAL 3W5NA 3C8HA 1XZ0B 3MNWA 5DEZA 1X5FA 4G5ZH 5T3XD 1VGKA 2NQCA 2O61B 4ODVL 2X41A 4WTZA 3FRUB 4PY7A 2CO6B 1MJ8H 4QRRA 4EOWH 1EFXA 3GMNB 3ULVH 2QSCH 2CDGA 4BSVA 3ILQD 3FB7A 4MB5A 3WS3A 2GSIA 3IKCA 2J8OA 4MZ3A 2BVTA 4UIMA 1CD8A 2WUCH 1B0GB 4L3EA 1KT2A 1H15A 2EH7L 3WJLC 4OM1H 4FXGA 3O4LE 1PD6A 3BZ4B 3WL9A 4XWGL 4LLMA 4HJ0C 1D5BB 1I75A 3TPKA 3GGWA 1J1OH 3MBEA 5BVPH 2O5XH 1UYWL 1OB1B 2NMSA 4LSSL 1DQLL 3HRZA 5DSCA 3CVHH 4OT1H 3VA6A 2NY5C 2Q20A 5I1EH 1EJOH 5KVGH 2KZWA 5JPNB 2B2XH 2R1WB 3FB6A 1T89A 1CWVA 5KZCD 4YHOH 3NAAH 4QF1B 2PW1A 3HNVL 1U8NB 1QQDA 3ARSA 4L4VA 3RKDD 4HUWB 4MA7L 2DM3A 1C08B 1FORL 4R97C 2Z8RA 1HH6A 5JW4M 1VEPA 2EIZB 4LPXA 1XMWA 1WBXA 3QEGL 3WO4C 2XQBL 5JOPD 2V7NB 3BQUB 4XHJC 4GAGL 5AYUH 2JTDA 2CXGA 1G7IB 4PJDB 4YHLL 3GHBL 4JHAL 4PJXF 4BUHA 3QUML 3FCTB 1I7ZA 4Q97A 4X6CB 3P4NB 1A5FH 5E08H 3KLHD 1FVDA 5JPMA 5IJKC 5T1MB 4OLEA 5HGAA 3TT3L 2FB4L 5FGCE 3CLEH 2YPLA 2BFVL 3RU8H 3KS0J 4PS4H 4F9PA 5J89A 5HYJA 3EO0A 1ZT1B 5JW4Q 2QKIA 1HKLL 3VXNA 3UTZA 3HZYA 4ALAH 5FAAA 1E28B 3VXME 5IGXH 4PBVC 1WIUA 2PYED 3MZTA 3ZYZA 4NQDA 2V2XB 2EDLA 4AEEA 1OAQL 1F4AA 4DGYH 3LS5H 5I1KH 4BH7B 1E6JL 1I3RA 3PL6D 5JLZB 2FJHA 5BZDB 5HHMB 3U48A 2BDNH 4GJTB 3HRPA 1A7NH 1XZ0A 2Y5TA 5D1QD 4B5EA 2XWBB 2BVUA 4MJ6A 4GAJL 4MYWB 3N1FC 1AGBA 5DD1L 1JWUB 4LRIA 4ELMF 2DQHH 4G42B 1CTOA 2CRYA 4HK3J 4NOBA 2JCCE 2CLZB 1DQQB 5L2JA 5T1LA 1QZ1A 2CK0L 5KW9L 5EZLB 4Y4KA 1NCTA 4NHUA 4IRZH 5GZND 1RJZB 5IUSA 1B6UA 3EDKA 5D7LA 2IG2H 2KQMA 3KPSD 5DA0B 1A8JH 3GMRA 4PYHA 3DWTA 5F88B 4F2MA 5AUMA 1ZEAL 2H2SD 3PF2A 1NMBL 3QEHB 3NOIA 4ZFOA 4ETYA 4P46B 4OZGA 4AIZA 4LPTA 5K9KB 3O9WB 4YHML 2JF1A 1U8PB 1MCQA 3L5HA 1IC1A 2GJZA 4ZXBB 4QXTA 2IAMC 3MREB 4Y4FD 1FCGA 1S5IH 5IEKB 4OGXL 5F9AC 4WUUA 2IGFH 2C4FT 3BGFB 1E4KA 2P8MB 4JG1L 4GXVH 1YEGL 4H0HB 1I7RA 4WV1C 3UTSB 3HZKB 2MSPA 1GGIH 4OD1L 1N6QL 4NQCA 3MRRA 4TSAH 3FONB 4PJFB 2HTKD 5D5MB 1WIPA 3L5IA 3A6CL 3CLEL 1F3JB 5GGUB 1AFVL 4PTTB 4YDIL 2AK4D 3FMGL 4L4VD 5DEFB 4YXLL 3T09A 1C1EL 4QRTA 5HHOD 3VFVA 4JFYB 3LV3A 4NM4H 5I1JL 4J23A 4QCIA 5CAYB 4MMZC 3S97C 3GMLA 4IRSB 5F1IA 5MEPB 3K2UH 1AO7A 1XGYH 1CF8L 4M7JH 4M5YH 2X42A 2E7CA 2J3SA 2DMBA 4WENB 1A4KB 1DQDL 3MLRH 1N64L 1NFIB 1P7QB 5E2WH 2GTWB 1M7IB 4Q0XH 4ZTOH 5L2KE 1PBYA 1RZKC 2R0WH 4FZEL 1JL8A 1OP3H 5TGBA 1ZS8A 5DFTA 3VFGL 5DHYA 1SM3H 4LARH 1JI1A 2WM0A 3WHE0 3BT2H 2I9TB 3WFDL 1VEMA 4IOIB 3BIBX 3GSRB 3H9HB 5E5RB 3REWA 3RUGE 3GBNH 5D1ZB 4OKVB 5F6IC 2YPLE 5KG9A 3O4LB 4XPAL 4HXAL 1SEQL 3LH2H 4UINH 2APTA 4K71C 4L29B 3QRFM 3MV9A 3H3KA 4CKVX 5D7IF 4LPVA 1UM5L 3NIGF 1ZT7A 5HJ3B 3RGVC 1FV1A 3BE1L 1YQVH 3GMOB 4LSPL 4LBEA 2AGJH 5C0CD 2K1MA 4HK0A 1QFWM 4DKFL 1Q1JH 3TVMC 1BAFH 1I7ZB 4Z7NF 2VDQL 1YDPA 1MFDL 3T08A 1DQLH 4CVUA 4OM0H 2H6PA 5E00A 4XP5L 1QACA 4YHLH 3UO1H 3KJ6L 1ROWA 3L5XL 4JFHD 5KJRL 4W6XB 4X7SL 5F7KC 4ONHA 2JCCB 3VMPA 1S9WA 1A5FL 1T4KB 3EYOB 4WI6A 4ZNEA 3HE6B 4Z7OF 1Z9LA 2UWEB 1C7TA 4JY5H 2XZCH 2AJXH 3C6LA 3TT3H 2IANA 1IGTA 4O9HL 2BFVH 2CPCA 4KZDH 4MA7H 3D3VE 4M6NH 4OGAC 2YBRA 7FABL 3WUWA 5D7LD 35C8H 5EU7E 4GLRH 1QA9B 3LAFA 3SDAB 2EXWC 4NUJB 2JIXA 4F7MA 4L4VB 3QDGE 2LTQB 4LSRH 4MXWL 4GAGH 3JV6A 4OQTH 1H3PL 1F58H 2AXJA 2OQJA 3GMQB 2EC9U 5JHLL 4JKKA 3UJTH 5F7WC 1F4XH 4P2QA 1JF6A 4OSUH 4NM4L 2XWBA 4DQOL 2HKFH 3BUYA 4KTDL 1UEYA 2A73B 4NM8L 1HIMH 1INDH 3OHXA 1V7NH 3MRGA 5IQ9A 5I9QC 4PRIB 1S9VB 4H20L 4NO2A 4RISL 5E8PB 5EU5B 4XGZA 3QHZH 1W2KT 2NYYD 3QIBC 3RY4A 3F12B 4WI5A 2RHEA 3I2CL 3HLAA 1NBYA 2R56L 3B6SB 5GSVB 5CKGA 3WDJA 2AQ2A 3OWEA 1FBIH 3L1OL 3CVIH 3VFNB 3MLWH 3OKOA 4IIQB 4NRYA 3QEQB 2IJ0C 2EH7H 2OJEB 3B4NA 3QDGD 1R3JA 5IM7A 3KLAB 1JPSL 2Z31C 3ARPA 3CFJA 4PJCB 5EU6A 2ICCA 3AY4A 2KL6A 5FM5O 3PWLB 4Y2DA 3RVXC 4XWGH 3WFBL 1CDYA 1G7JB 4P57A 2HTLD 5EWIH 3QO1A 3OL2A 5I8KH 2JB5H 2FR4B 5IB2B 2WAHA 1QYGH 4OD2B 4IRSD 3DROB 1AXTH 3LEVL 4WGVB 1F3DJ 5GS1C 3U7AA 2YRZA 4L1DA 4Z76A 1J0YA 1Q9WA 1YEDB 3G5ZB 4PJ8C 4KRMB 4CU6A 1HQRB 2HH0L 2HT2D 2VXSH 4M1CC 4Z95H 2BOCB 2KQNA 4OM0L 3S36H 2Q6WB 5IBTL 1IGMH 4RGNB 1CTNA 2E8ZA 3NCBB 4MJ4A 4RRPA 1MFEH 4JM2F 4MNHA 4G8GE 3FJTA 5C0AA 4HIHA 2MTPA 1QRND 5LXGH 3VXSE 5F3HA 2VISA 2CKBH 2VC2H 4UQ2A 5EUOF 1W0VA 1NBZB 1PZ5B 4LLWA 2X4OB 2X4OA 4ZOAA 5ADPL 4XCCH 4BSJA 5B39B 1CDGA 5GGQL 3RFZC 2PYEA 1F2XK 3QFJB 5FEBA 3NFPB 1KCKA 2E9JA 3VFPB 1D6EB 2C4FU 3FO2B 3C9NA 4ELKA 1XF5A 1Z5LB 3WV0A 2JCCA 2PTUA 5HBBA 4M9PA 3NIDE 1MPAH 2IADA 4XPGH 4OLUL 2P47B 4JE4B 3NA9L 2HJFA 3QEQE 3RU8L 1LO4L 3GSXA 3IDXH 1OLZA 2FECI 1IGYA 1RZIA 3Q3GB 3KDMA 4B50A 1N3NB 1RK0A 1V7NL 1G6RL 1AGCA 2R0WL 5D7JC 4H20H 4RISH 3MRQB 2JIXB 4CN1A 4ZUVA 1EHLL 3QWRD 1GZPB 1H8SA 5EOQH 3NZHL 1LEGA 4UBDD 1EFXB 3CVHB 4NUGH 2L0DA 3FB7B 1MVUB 4HKJA 3TA3B 2AAVA 2CIKB 5I8OL 3D85D 5BW7C 2VXVH 2AK4E 3QIWA 4NQXA 3STBA 4X83A 3V4PH 3MRNB 2GI7A 1FNEA 4EBQL 2K9UA 5EBWB 2EKSA 5AEAA 2VWEC 5MENA 4LGSB 1QYGL 4OFPA 5D6CA 4MAUL 1B90A 4JZOA 4KZEH 3MA9H 2CUMA 1DN0B 3MJGX 3Q5YA 4M00A 5TH2B 5JDJA 3O2DL 3H9SD 12E8H 1CXHA 1QO3A 3HUJE 1HDMB 5FYKU 3FZUD 3G04B 2Y07L 2CMRH 4Y1AD 3H7BA 4IDLA 1GXEA 2D0HA 1A2YB 1B3JA 1PY9A 1U8HA 2A6DB 4D9RD 5B3NA 2FRGP 2BZDA 4LVHB 4N1HB 4ZFOL 2NY2D 3GMNA 1ZVHA 4MNQA 4PG2A 1NEUA 5BV7H 2BMKA 3T77A 5KS9F 1OAXL 4C54A 3D85A 5C9KA 5F89B 1AO7D 5SWZB 4LSRL 4MXWH 3VFRB 5HYJE 4EIZC 1YEJL 3CH1A 4GUPB 5DDHA 1I9RL 3MV7A 2FH6A 1MNUL 2OLDA 4U0QB 4NRXB 5K33A 1RJCA 3LHPH 1YECH 3KG5A 4E0RA 4LCIL 4DZ8A 2PN5A 5I1GH 5FYJD 5A43C 1WQVT 4P3CH 3VH8G 3S35H 1DE4A 3QXDB 4LK4A 3MRKB 4MNGB 4TNWF 4JGJA 2XTJE 2D4FA 1HHHB 4OTXL 4OZHA 2ESVA 3SCMC 5JNYB 3BP4B 2BOBA 1WBYA 5L2KD 3RKDC 4OCNC 2R56H 4NPYB 1ZGLM 5E7BA 1ZLSL 1GAFH 5GPRA 4R9HA 2NY4C 5HGHA 4JPVH 2R2CA 4Z7WA 5C0AE 3WFCL 2XA3A 3RUGA 2ADGB 1DL7H 1P6FA 1V3MA 3QH3A 4I77L 4EN3C 4RMVA 4X6CE 3BKJH 1B4RA 4QRPA 4PRPD 4XVTH 5FYJH 5F7EL 4DVRL 1T04A 1Q9WB 1YEDA 3G5ZA 2VDKL 1ZHLA 5C7XL 4XP9L 4JR9L 3MV7D 4FQ2H 2X4RA 1JGLL 3VW3H 3F7RA 4YNYA 2QJDA 4YEEA 4LDEB 3IFNH 2VLJA 5FO8A 1IAIL 4P2OD 2OTWA 1SJHA 4ETQA 1EEYA 3QPXH 3PDGA 4RMQA 3KYNB 3MUHL 2JELL 1KB5A 4HD9A 4M6AA 4D0DA 3O3BA 4NN7B 1AQKL 4JFOA 3NGBB 1KC5H 3S36X 5LXGL 1T4KA 5EB9A 4BQ9A 1HEZB 1HKFA 4JFXB 4ONOA 4HF5H 4LVEA 5TPWL 1VB9A 3NIFF 1YNLH 4J12A 5C08B 1OOAA 5CINH 4MWFB 4E42A 5BVJB 5F7FA 3ARUA 4X7EC 4Z7WF 2OR7A 1NGYB 2WZPD 3IRPX 4R7NA 1LD9B 3AB0B 3TC9A 1Z6JT 1U3HA 3OJVC 4N0CC 2EO1A 2QTEA 1NLBL 1NC2D 5ID0B 3DJ9A 4Z95L 2I25N 1NJ9B 9CGTA 4KC3B 4HW6A 3OAZH 4XP1H 5JW5A 5MENE 2QV2A 2W9EH 1A47A 4CL7A 1I85A 3UTTB 5SWZE 1TITA 1BLNA 3VH8B 2GYSA 1XH3A 2VLRB 3NACH 1NGXB 3RY5A 1FVEA 1WCQA 4C56D 43CAB 2RCSL 3BHBB 1I8IA 5DRNA 5GRUL 2F54A 3EUUA 2E6JA 2UYLB 2P45B 1AH1A 1YEHL 3ES6B 2X4NA 2Q8AL 4FTVA 1D5ZB 5DI8A 4N90D 3B6SA 5FYKH 5GSVA 1U58B 4ZPTB 2BNQA 1FFNA 3CDFA 1NANI 1AO7B 3I75A 4G8GA 1UWEH 5HGDB 4Y1AE 2CSPA 2X4SB 4DUVA 3RUGF 1CBVH 5FO7B 5SX5H 1LK3L 3IS0X 3QHZL 1FGVH 4EEEA 1F11A 1ODAA 3WDIA 1CGVA 3NFNB 5D2NB 1KPVA 1RK1A 3DETC 1G6RH 5GGSA 5KSBB 1FLRL 4JR9H 4JQVA 1S9XA 2X2YA 4TUJA 1MCPL 3UZEA 3EJZD 5ISZD 4LFHG 4IMLB 4QOKD 3M8OL 3TN0D 5F7YC 1JWSB 1DBMH 1CCZA 3BPOB 1AKJB 1N3NA 5JIIA 1X3DA 1JNJA 2DICA 4U7MA 1FNSL 3M17B 5GGTA 4PJHA 5JHDE 5T5FL 1UZ6E 3IXTA 1TJHL 2VDLH 1PDKA 2DL2A 5I0DA 4M8VA 4Y4KD 5IVXE 5IJVA 3V0VA 5TPWH 5LKNA 1LMKA 4DGVL 1HSBB 3BIKA 2EZ0D 1NDMA 3KPSE 4PJAE 4X6CA 1JWUA 5CHNB 5C07D 3VXMA 1Q0YH 3H42H 3IJHB 3JV0A 3C60A 2J8UE 4OUUB 4RRPG 2R0ZH 4KXZI 5IK3A 1MLBB 2VLKA 1N2RA 1EZVY 3CDCA 1NCDL 2J6EH 1UJTA 3ARTA 3MRHB 4P2QE 4GQPH 1NGWA 3VD7A 4JN2B 5IW6B 1AGDA 1U95B 2VIRA 3BYTA 1UQSA 2IFFL 4RZCA 3VDBA 1NGYA 1TPXC 1GAFL 2OMBA 3G5YA 4Q74A 1MWAH 2HLAB 5EU4A 1N0XL 1UB6B 3ARDA 1A6VH 3E2HB 1CICC 4TTDD 4ZUUA 3LRHA 4Z7VE 2BMKB 1LO3L 4NFBA 4JHWL 3CH8A 3RZCD 4N1CA 1JRHH 2QADC 3TFKD 1V3JA 2XZQH 5EUKA 5I1GL 3W81A 3O4OC 2Y6SC 4M5YL 2EE3A 3G5XB 1OSZB 5ICZA 2RGSA 1LK3H 3CSYA 3GSUB 4JN1L 5J06A 5L9DL 3H9SA 3PHOB 3MV01 5FHBL 4WO4D 1NBZA 4X8XA 3RX5A 1M7DB 1MCCA 3BX7C 4Y8AA 3GMRB 2DQFB 3C5ZA 4R2GD 1W0YT 1CDUA 4Z18A 3MNZB 4GW1B 5MERA 5I8OH 1RHHA 1U8QB 2DQGH 4AM0B 1W72L 5JMOC 3D5OF 3P4MA 5DQJA 3CC5B 5B39G 5F7MC 1OW0C 2DJSA 4KRLB 5JIHA 1F97A 4L3EE 3V2AR 1F00I 3HN3A 3U0WH 4LCCB 3VXPA 2ZG2A 1G9EA 3AY4C 1MH5A 4I9WD 2PW1B 4OZGE 2VDLL 4JKLA 3ARDB 3DOSA 5IB5A 4PRNA 4OV5B 3O45A 4X7DC 1O7SA 5INDA 2P5ED 4BQ8A 2X4UA 4HFUH 2ZCHL 4HIJB 1AD0A 4Q9QL 2XQBH 3KYOA 4MQ7A 3MRLB 2E27L 1YMME 2GUOB 5TJWK 3FB8A 2CIIB 5D71L 3L5XH 5CZXC 3Q6GL 1BOGA 2X89A 4HKXB 4DZ8B 3S96B 5T3ZD 4MDJB 1PZ5A 5DVKA 1T89C 5GS3A 2BVPA 4ZQKB 4CDGC 1V8HA 1YNLL 3K46A 4F8TA 3ZKQD 2X44D 2BNQB 3OZ9H 4HT1L 2DAVA 3D2UD 5K59F 1NAMB 1BFVL 2NZIA 3HFML 4RQQB 2IFFH 2P8LB 1HI6A 2ZOKA 5EBGA 2AJVH 2F5BH 3RIFF 2O61A 2FYYA 4LCCA 3VXPB 3I3BA 4JKWA 1YECL 3SO3B 3EHBD 3EOBB 5D1ZC 1M4KA 4YEFA 3HC3H 5D2NC 2BHYA 4GRMA 1VKXA 5ELIA 3HZVA 5I19L 4NOFA 3ARDD 3U79A 5CZVL 2DM2A 1UCBH 2V9TA 4JEGB 32C2B 32C2A 3EDFA 2BX5A 3WBDA 2QQNL 3G04A 4O02H 3RHWK 1N6QH 4Q9BA 3ROLB 3I85A 1NSNH 2MPAL 3ARFC 3HMWH 4JZJA 4I3GA 5C71A 4M61B 1V7MH 2P8PB 4GRWF 3LQZB 3EOYG 2A1WL 2BRRL 3MV8D 4PUBL 5DJ0A 1EUTA 1K4DA 5FHBH 2V2WA 3VWKD 4NDMA 3KNBA 3LEYH 3WE6B 3GI9L 5GS0C 4DGYL 2Z8SA 4D0CB 4NNYA 1E4WL 3MQIA 3CVIL 1CE6A 4YR6A 3PWUB 3KYMA 3ZMRA 5DD5L 2CK0H 5JW4R 5KW9H 3WLBA 2JK5B 4DCQA 4Y5XB 5C6WH 2EDJA 1JK8B 1D6VL 5IT2L 1UACH 2ZOLB 4FN0A 5E2WL 5I8KL 5ICYA 4OGYL 4Y1AB 1X5KA 3IDNB 4AT6A 1G0XA 1AIFA 5ERWB 4X4MA 1A3LH 1J88A 3D0LA 1AXTL 3BD5A 4LCYA 5IMMA 3D0VB 3U36B 4ZXBA 1W72A 4PGBA 3VD4A 3ZE2E 1XF3A 4YDJB 3NFNA 1ERNA 4XCNB 5B3JF 1I85C 3V52H 5DRWA 2Y06H 4QRQA 1QA9A 3AB0C 4HF5L 4UMGA 5FKAA 3R8BB 4P5KA 4ODWB 2I9TA 4R2GB 3IDGB 3I84A 4HFWA 4HUWA 1G7QA 5EU3B 3QIBB 3FB5B 2WBJD 1DE4B 1R5VB 5ACMA 1F42A 2QQKL 2DRUA 1MCOH 2VDNL 4H1LA 4XCCL 3TFKC 3N1GC 3PGDA 1U2CA 2AJ3B 3HI1B 3OZ9L 1AC0A 5DD0H 5DUBA 2XTLA 3CXDH 3PGCB 2DDQH 2CXKA 3RZCC 1XR9A 4UT9L 4BQ6A 5KTEH 3EOAA 4Y5YC 3E8UL 2F9BT 4RGNE 2ZUVA 3QJFA 1BM3L 2ADIB 3W0WA 3IU3B 5GRVK 2HLFC 4D0DB 1MVFA 4WWKB 3UTQB 2WUBL 4BH7A 1QFWH 2DYPA 5IVXA 1REIA 3NN8A 4NT6A 2F53D 2B1HH 1T66C 5DRXB 4X5XB 1BQHA 2D2OA 3IF1B 3KPSA 4GW5B 2EDWA 4Q0XL 3SOBL 3VFUB 2VUOA 5ESQA 3WLWC 4ENED 1RHFA 2HRLA 4HQQL 3SY0B 3GIVA 4EDWL 4OZ4A 3AS3A 1JGDA 4LKXA 4B7IA 2FR4A 3GBMH 4Z0XA 4YQXL 5HHVL 1U8JA 3WHXA 3VG0L 2QHRH 3U0WL 3D39B 1E4WH 4MS8D 3FAWA 1DQDH 3FFDB 3MLRL 5I71C 1GC1C 4JFDB 1IAOA 4NWTL 4K71B 4RDQF 3IAPA 3P9MB 5DURD 1N26A 4RMTA 1CE1L 1RPQA 4NKMA 4XH2B 3TO4B 3BUTA 2VLJB 5FO8B 1OLLA 1GGUA 4F7EB 2X05A 1YY9C 3U9UB 3QDJE 4C56A 4X0KA 1ZE3C 3QI9D 4S11A 4CJ1A 3B9DA 5D6DC 3MUGA 2Y06L 1QQDB 2I24N 3L3HB 3DX6B 5IHBA 2XTJB 2AJZB 1LGVA 3CCHB 3DBXA 2I9LA 4HS6A 4M4PA 3U7YL 1ZA6B 3FOLA 3FO9A 3ARDC 1JUFB 1ZSDA 1JNLH 7FABH 2DS4A 4MJ5A 2C4XA 5KBNC 2VZTA 1ZVYA 5GGTL 3W11C 2JB6A 1DBJH 3QNYB 4S1RL 1D5XA 1X7QB 3X3FL 1S9YB 3FT3B 3IDJB 5LCVL 3Q5OA 4O9HH 2BHUA 4O51B 4G43A 1TDQA 3VWKC 4KZDL 4Z7QE 4XB7A 1MAML 5EPMB 1MAKA 2DF3A 4ELMA 4UOW1 1TLKA 1ES0A 5HDBE 4U1KA 4N0RA 1FO0B 4XGZB 5IIEA 4HIHB 1CFSB 4P5MA 5IVNA 5I16A 4TNVK 3V4VL 2KZ1B 3HFMH 4EI5D 2DQJH 3GI9H 1CL7I 5B8CC 4CMHC 1VHPA 2R2HB 2IH1B 3PV6A 3LD8C 3CCHA 3VRJA 4FQXD 3GKWL 4G8IA 3KWWB 4HLJA 2VDML 3QYCA 3VXOB 2P5EA 3O4LA 3WJLA 1RUQH 4WI9A 3FO1A 3WO3B 5CEYA 4FNLL 2CDGB 3RVWD 4NWTH 2BOBB 3S37L 5FUZL 5I6XC 5TDOB 1MIEL 2NNAB 4IOFD 5D7KE 2NTFA 1FBIL 2P5WE 3U30C 1NBVH 3BWAA 3ULVL 3MLPA 4H8WH 1NUFA 1RUML 3UYRL 1BGXL 1A6AB 4GBXB 4G6KH 3TYGL 5IFJB 3V52L 4XPTL 1IL1B 1IL1A 3MOBH 2GCYB 2M1KA 2FNBA 1DDHA 3X13A 2ICWA 3WIIL 4KJYB 2CRIA 2PXYD 4KDWA 5C3TA 3EYUL 2Y7QA 5KAQF 1UACL 3VFVB 2P44B 2VDRL 3QRGH 4NQXB 5CINL 4Q9QH 4Z7OE 3FCTA 1QR1B 4BZ2H 3ALWA 4YWGH 1XR8A 3CFKA 1DLHB 3SO3C 5F71A 3BZ4A 3G6AA 5EZIL 1JPFA 1P1ZA 4F9LA 4MZ2A 2NW2A 3DGGB 1L7IH 1E4XH 1QBMH 3UP1A 5L8JB 3O8XC 4XCYA 1BZ9B 1XGUB 2P5WB 4X6DE 1N2RB 5C86A 1T1ZA 5CEZE 4BK4A 1E27B 3X14B 4XAWH 3MRHA 1IRAY 4NZDA 3X11A 4YHYB 1VFUA 3VFSB 1ED3A 3IJYA 4MNGE 3WSQH 4BZYA 1A1MB 5C1MB 1MSPA 3OSKA 4NKOA 2OS7A 4XMLL 4J1UA 4XVSL 5FCSH 1Q8MA 4JDTL 4JVPA 1ZTXH 1T0PB 1J05B 4KMLB 5ICXB 1WBXB 4IMKA 1I1AA 4FFVD 4RFOH 1G7HB 4TTGA 4W70A 3B2UD 1MVUA 4HKJB 2AXGA 5DC4B 3BWUC 1F3DH 5E8OA 5IR1A 2XKNB 3KXFB 4I0PC 3CC5A 3V7MA 1OD9A 2F53B 4ODUB 5EORL 1FZKB 1ITCA 1BZ7A 1WZLA 4LVNB 5C8JB 3DHMA 3WKMH 3SJVD 5DFVC 2FIKB 3LN4B 5ENWA 4M03A 4PRHE 5I9QB 4KHXL 4ZO8A 1SJVA 3J8F7 4M62H 2CR6A 1BJMA 4XAKD 4LRIC 4D8PB 4HUVA 3BN9C 1R6VA 1Q94A 3QZWG 2ZUXA 3E3QE 5ITBL 5T3ZE 4YQXH 4H8WL 5IVOA 4HPYH 5C2BH 2EYTB 5IT2H 4KV5E 3I02A 4Z8FH 2C1PB 4JY6A 4QHKJ 3TO4D 3QAZB 2GTWA 4OI9A 1T1YA 4P2QD 5E99H 1G7LA 4W4NA 4W6WB 3SDCB 2CUHA 4F7PA 3DURA 5J7CC 5CSBA 1YJDL 5BOPA 3O2DH 3RX7A 3A6OA 5GGTH 2AJSH 3MRIA 2ATKA 2P8PA 4R90H 2FX9H 1CLYH 3NZ8B 4I48B 3WN5B 2Q7YA 1NGXA 1F3JA 1VACB 3P4NA 5E8EB 4QRRD 3BJ91 5HYQA 2D0GA 1KIQA 1LO0L 2B8OT 3BAEL 3O3EB 4XAWL 3C8KA 3DI3B 1NMBH 4X99A 2YSSB 3UBXG 4XNMA 1CL7L 3S98A 5DTFB 4F33A 3O3AB 4OZHE 2FB4H 3V8CA 1WIOA 1YEJH 1DUYA 3SDAA 3A6BH 2C1OA 1N5AB 3P0VL 2EYRA 3B43A 3DVFA 4OF6A 4YFLF 1G7PB 4LLYA 5DUPL 2GFBA 2P7TB 3WS6C 3L3JB 1ZWIA 4K7FA 4X6BB 2YD5A 4I5BA 3OKNA 4U6HB 4NQDB 1BM3H 5T1DH 5D2LB 4P3CL 3A67H 2UVEA 3V5HA 3QQ3B 3MV8B 1YC7A 1EJ6A 1KOAA 2F5AL 3VD9A 5ANME 1LK2B 1C5CH 2XXCB 1QPXA 3DVIA 4HUKB 2XKSA 4FMKA 2EDFA 4OD1H 5H37H 3VDAA 4UTAL 1FE8L 5DMKB 3WJJA 1AKJA 1J18A 3CX2A 4ACPA 1X7QA 1PG7W 1S8DA 2Q86B 4M1GH 5F6IB 1XAUA 3MRLA 3QQ9D 3IDIA 2VAJA 2ZOLA 5C7XH 3BZEB 2IAND 1YMMB 3BW9A 1G7QB 3FMGH 5D1XA 1ZA3B 4YXLH 4M1DH 4HX1B 1R3IL 1T20B 4OFVA 3ABZA 1JFQL 1S3KH 5FXCH 3MFGB 1KJ2A 4UU9A 3RI5K 3MSPA 4XNMB 5B39A 4U1HA 3GRWA 3KYMB 1KT2B 3RL1A 1M71A 4DVBA 4GAYB 2MHAA 2XNAB 3OKKB 3JTSA 4FQ2L 5FF6A 3EYQD 5GISL 3T2PA 1BP3B 1RU9H 4DK6A 4JAMA 4JAMB 4AT6B 2ADIA 4HBCH 3W0WB 1U93A 4YWGL 5FOBB 1NGZB 4GW4B 1X5AA 3VXTA 4MMXC 3T3PF 1F13A 3BP7B 2JJTA 4YHMH 5J6HB 2LQRA 4V1DD 3UTPE 4KDTC 4OZFH 3VGEA 2ZNXA 2QKIB 1PFCA 2C3WA 2E27H 3EDJA 4NSKA 1HYSD 2IPUG 3MXWH 4WUUB 4A2MA 1SEQH 4KVNH 2ZUYA 1BFOA 1FFPB 5D71H 2K7QA 3RWIB 1YEEL 3EJZC 1XT5A 5J0BA 3Q6GH 1BFTA 1OTUD 3MR9A 2DI9A 4K7PY 2DTSA 2QSVA 2ICEB 4LU5H 4S0SD 3H9SE 5EU3A 2XICA 3D3VA 3Q48A 4XBEH 5H94B 4L8DA 3MRMB 1D5IL 4RGOH 1JNLL 4PRIE 4HGWB 3MUZ1 1QSEA 2XN9E 4HC1L 1N59A 3ILPA 4WJ5B 1CL7H 1AJ7H 1G6RB 3E6FB 3O3DA 4KKCC 3EDEA 1FAKT 1I3UA 1H15B 3BQUD 1BJ8A 4HUNB 3QJHB 2CIIA 2ZG1A 4LPYA 4I0CC 2A6IA 3W9DA 2ITCA 5ABDE 5D2NE 2BVEA 3VXUA 4DZBB 4H5SA 3RWHA 3O6FA 1AXSB 1PEZA 2PCPB 4JZJC 5CZVH 2EDHA 1WBZB 4L3CB 5GRUH 3AGVA 4KJQC 2D7NA 1QVOB 4A6YA 1NSNL 1YEHH 6FABL 2FO1A 4GW5A 2EDKA 1MWAB 4GOSA 3SCMB 4I18B 5C0IB 4MAYB 3HG1E 1MRCH 1YPZB 1XGTA 4PD4K 1IC5H 2GJZB 4WHTA 3MV8A 3RNQA 4HPYL 4QHLA 4DQOH 3LS4L 5DYOA 2ZCLH 3TO2B 4XVUC 4PJHE 5JHDA 2JB6B 1A7RL 3PQYB 4YHIB 3NFSL 5EA0L 4LPWA 4ZD3H 3L3KB 1D5MA 5DURB 4RFEA 3QIUD 5EU6D 5AUMB 4LHJB 5IQ7L 3SDCC 1DSFH 3PQYD 4QHKI 2A74A 4AL8H 5CSGA 2HT2C 5CILH 4WI2A 5IP4A 4BSWA 1NBVL 2OJZH 3LRSB 3RPKA 3TCLB 4BK5A 5JTWA 3G6AB 4NWUH 4F15B 5HYJD 43C9A 1QFWI 5T1MA 3L1OH 1A7PH 2DI7A 5T1KD 4J2XA 2ZPKL 1EBPA 2BC4B 3ECBA 1R24B 5DK2A 3ULUH 5FUCC 1LO0H 4D8PA 4U1NA 1QSFD 1H0DB 1Q9LA 2XQYG 1P2CB 1P6AB 4PGCB 1R5IB 3CX5J 4X5WB 3BPCB 4EJ1C 4BFGA 5C0BE 1M6OB 1TZGH 3LKSB 2IBGA 2VIRB 4XBEL 4CMMB 5IEHA 5HYSB 2D7QA 4P4KA 2QQKH 1YJDH 4P59H 2E7HA 3QUXD 1P4LB 35C8L 4MVBD 4HXBL 3NCJH 4HCRH 1IEBA 2GAZB 1X6LA 1CD9B 1Z0NA 2HYMA 3FT2A 4JFDA 4Y5VA 3L5WA 2VAAA 3UPCA 5DJDB 4JLRA 1IGML 4XNUH 5EDXA 3EGSB 2AK1L 1IAII 3UJTL 5DJCA 2V2TB 4OBSA 4OFIA 2KBGA 5DEGA 3VGDA 5D7SL 2YK1L 1YEGH 2VLRE 4GXVL 1DBBH 1UENA 5FDWA 1MHEA 1KG0A 4OCWH 4MQTB 4NC2B 2MCG1 3UTTE 4G8FA 4G8FB 4HGMA 5F1KC 5I8EA 5I8EB 2P5EE 1HIML 3OKMB 5D72H 4NFCA 4KQ3L 4Z5RB 1MCWM 3KPQA 5FV2A 4M6ML 5E8EA 4I0KA 2YD9A 1A6VL 1A6TB 1MEXH 4WDIB 5CUSH 4ESKA 3O41A 2PTTB 1S7RB 2YPLD 1N6VA 4FFZH 3WL9B 5EBWA 3S5LA 2YRPA 1FNGA 5HHOB 1JRHL 3QXTA 1C5BH 3ZKXC 3DO7B 2V2XA 1KLFA 3QEQA 4PIRF 2EZ0C 4MA3A 2F58H 1S7TB 4ZAKB 3MLWL 3KWWA 2BXZA 4I3SL 4JFPB 3M17A 4JZNB 3ULSA 4MSWB 5GISH 4I4WB 3QDHA 1BD2D 5E1AA 1SJEA 1RUAL 1RU9L 4KJWD 1FL6B 4OCSL 3RRQA 2NX5D 3GIZH 3VI3E 4DK3A 4NNPH 4P46D 1IKFL 4NIKB 3PL6A 1SBSH 1WLHA 1BQLL 3SEPA 5DD3L 1A3QA 2DQTL 3INUH 4B0MM 3U7WL 4RGNC 1MY5A 2EC8A 1NC2B 5IVXF 4QT5A 1AHWB 1A1MA 1MUJA 3T0EA 1XF2B 4GH7B 5E00B 5C2BL 4BH8B 2AP2A 2IMNA 4EI5C 5I73B 1V5JA 1OB1A 1XGUA 1K4CA 2NCMA 4NNXB 2XZZA 2JJSC 4F2MB 1PLGH 3SQOL 2GY5A 4XBGA 2CKBL 2VC2L 3ZHLA 2CGRL 1KLUB 4LHQB 3EYVA 4KKBC 1AE6H 4X7TA 1LE5B 4MAUH 1VADA 3U9UA 2W1NA 1KJ2L 3QXVA 4M7ZC 1WFUA 1TVDA 15C8L 4IIQC 4UOJA 2ICWJ 1MHHB 1CXFA 4PJ8A 4JQIH 1MJJB 4WWID 2FD6L 4ZYKB 4YPGA 4S1RH 1MHPH 2VE6B 1G9MC 2X4PB 1T21B 1JYNA 5KSBE 3MCKB 2W91A 1YEEH 3PHSA 4AIXA 4Q9CA 4N5EC 1DBAL 5CGTA 4N8VA 4APQD 2QHLA 1NAMH 4OCWL 1U8JB 3WHXB 1J8HA 1OAXH 4UIKL 1SVZA 3KXFD 4YHNA 3UTSD 2V9RA 5DD0L 3DV4A 3VJ6A 2X10A 2EE2A 3DURB 2VQ1B 1MJ7H 2DL9A 4DKEL 3TGXA 1IGIL 4U6VH 4HWZB 3WS3B 5BRZD 4P4KD 2ZCLL 1OT1A 5E94B 5E94A 1BQSA 3GO1L 3P0YH 4OSUL 3NFSH 1RY7B 2X7LA 2VSDA 4PJXE 4PRPB 3VU2A 1INDL 4HV8B 3EYSL 1LEIB 4FQHA 2CK2A 1F11B 3S34H 1KB9K 3F12A 1Y0LA 4OM1L 4PUBH 4P5MB 2BY0A 1A7BA 5D7IE 3SBWA 4XX1E 4PJGF 3NIDF 3JZ7A 4QRSB 3QIBD 4NP4L 1KF9B 4NWUL 3ZDXF 2EXYD 3I9GL 3EW3B 4ZPTA 3BUYB 3VCLA 1J0ZA 1UA6H 1NGWB 2JIXD 3LKRB 1UJ3B 5AWNH 1J8KA 1S78D 5HPOA 1MCBA 4NSKB 1D6VH 3G6JF 3ULVF 3LKQA 1TMCB 4YHPB 4KRPB 4MQXD 5E1AB 4FFVC 1JNHB 3QA3B 1MRDL 5F9OH 4PB9L 5DJXA 2H8PA 1D9KD 2CKBA 4GS7C 3WS6A 3TO4C 5IQ7H 5BRZA 5E9DD 2NR6D 1MCRA 2IBZY 2HA1A 3WIHL 1ZHLB 1KSRA 3O8XA 2EH8H 3TV3L 2VDNH 5K9QI 3LKOB 4QXUH 1U36A 5IOPB 4J8RB 2PO6C 2NY5H 4PJFA 5MP6H 3RPIB 3ZKNC 3T4AB 1U3HD 5CEZL 2ZPKH 5LVEA 2JCCF 3QUMH 2XWJB 3IRZA 3PG2A 4XP6L 2BVPB 3MRFB 2QSQA 4DAGH 4PP1D 2X1XR 4YR6B 5LQBH 5DMKA 3W39B 3NN8B 2LU3A 1PZUB 4N9OB 2BVYA 4I18C 2VL4A 3RNKB 2XG4A 4MNQE 2AQ3A 2Q86A 2GT9B 5FIEA 1G9ML 3STZB 2APBA 3TNMA 3TNMB 3P9WB 4H25A 1OGTB 3HZYB 1Z2KA 4ZMAT 4UOW0 5GRYA 1J8HD